BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25744_g2_i3 len=264 path=[9328:0-20 10021:21-28 1323:29-58
10042:59-68 10052:69-86 9416:87-89 1384:90-104 10661:105-129
6466:130-160 1455:161-202 10149:203-210 3964:211-254 1546:255-263]

Length=264
                                                                      Score     E

ref|XP_006366298.1|  PREDICTED: trans-resveratrol di-O-methyltran...    102   6e-24   
ref|XP_009602136.1|  PREDICTED: trans-resveratrol di-O-methyltran...    100   5e-23   
ref|XP_004248183.1|  PREDICTED: trans-resveratrol di-O-methyltran...  99.8    7e-23   
ref|XP_009780941.1|  PREDICTED: trans-resveratrol di-O-methyltran...  99.0    1e-22   
gb|AEC13057.1|  orcinol O-methyltransferase-like protein              96.3    9e-22   
ref|XP_002278190.1|  PREDICTED: trans-resveratrol di-O-methyltran...  96.3    1e-21   Vitis vinifera
emb|CAN73270.1|  hypothetical protein VITISV_021918                   95.9    1e-21   Vitis vinifera
ref|XP_006480453.1|  PREDICTED: trans-resveratrol di-O-methyltran...  95.9    1e-21   
ref|XP_006428632.1|  hypothetical protein CICLE_v10012033mg           95.9    1e-21   
emb|CDP17644.1|  unnamed protein product                              95.9    2e-21   
ref|XP_006346269.1|  PREDICTED: trans-resveratrol di-O-methyltran...  95.1    3e-21   
emb|CAN61955.1|  hypothetical protein VITISV_020020                   95.1    3e-21   Vitis vinifera
ref|XP_002278211.1|  PREDICTED: trans-resveratrol di-O-methyltran...  94.7    3e-21   Vitis vinifera
gb|KDO41475.1|  hypothetical protein CISIN_1g0225151mg                93.6    3e-21   
gb|EYU30782.1|  hypothetical protein MIMGU_mgv1a021078mg              94.4    6e-21   
ref|XP_006446728.1|  hypothetical protein CICLE_v10015708mg           94.0    6e-21   
ref|XP_002278517.1|  PREDICTED: trans-resveratrol di-O-methyltran...  94.0    6e-21   Vitis vinifera
gb|ABZ89567.1|  O-methyltransferase 3                                 94.4    6e-21   Humulus lupulus [common hop]
emb|CAA11131.1|  O-methyltransferase                                  94.0    6e-21   Prunus dulcis [sweet almond]
ref|XP_004303127.1|  PREDICTED: trans-resveratrol di-O-methyltran...  93.6    9e-21   
ref|XP_006469135.1|  PREDICTED: trans-resveratrol di-O-methyltran...  94.0    9e-21   
gb|AAM23005.1|AF502434_1  orcinol O-methyltransferase                 93.6    1e-20   Rosa hybrid cultivar
ref|XP_002278398.1|  PREDICTED: trans-resveratrol di-O-methyltran...  93.6    1e-20   Vitis vinifera
emb|CBI21932.3|  unnamed protein product                              94.0    1e-20   
emb|CBI21924.3|  unnamed protein product                              91.3    1e-20   
gb|AAM23004.1|AF502433_1  orcinol O-methyltransferase                 92.0    3e-20   Rosa hybrid cultivar
ref|XP_004252468.1|  PREDICTED: trans-resveratrol di-O-methyltran...  91.7    5e-20   
emb|CAN78992.1|  hypothetical protein VITISV_005827                   91.7    5e-20   Vitis vinifera
emb|CDP15888.1|  unnamed protein product                              91.7    5e-20   
ref|XP_002278294.1|  PREDICTED: trans-resveratrol di-O-methyltran...  91.7    5e-20   Vitis vinifera
ref|XP_011091583.1|  PREDICTED: trans-resveratrol di-O-methyltran...  91.3    5e-20   
emb|CBI21926.3|  unnamed protein product                              91.3    5e-20   
ref|XP_010088036.1|  8-hydroxyquercetin 8-O-methyltransferase         91.7    6e-20   
ref|XP_011002663.1|  PREDICTED: trans-resveratrol di-O-methyltran...  91.3    6e-20   
ref|XP_011002662.1|  PREDICTED: trans-resveratrol di-O-methyltran...  91.3    6e-20   
ref|XP_006371494.1|  hypothetical protein POPTR_0019s12300g           88.2    6e-20   
ref|XP_011100227.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...  91.3    7e-20   
emb|CDP21583.1|  unnamed protein product                              90.5    9e-20   
ref|NP_001267963.1|  O-methyltransferase                              90.5    1e-19   
ref|XP_006428633.1|  hypothetical protein CICLE_v10013393mg           90.1    1e-19   
ref|XP_006368013.1|  PREDICTED: trans-resveratrol di-O-methyltran...  90.1    1e-19   
gb|KDO73905.1|  hypothetical protein CISIN_1g017835mg                 90.5    1e-19   
ref|XP_006452811.1|  hypothetical protein CICLE_v10008718mg           90.5    1e-19   
emb|CDP21551.1|  unnamed protein product                              89.7    2e-19   
ref|XP_006474725.1|  PREDICTED: trans-resveratrol di-O-methyltran...  90.1    2e-19   
ref|XP_002326036.2|  hypothetical protein POPTR_0019s12290g           90.1    2e-19   Populus trichocarpa [western balsam poplar]
ref|XP_006388574.1|  hypothetical protein POPTR_0151s00220g           89.7    2e-19   
ref|XP_007043718.1|  Flavonoid o-methyltransferase related            90.1    2e-19   
ref|XP_011091734.1|  PREDICTED: trans-resveratrol di-O-methyltran...  89.4    2e-19   
ref|XP_004987341.1|  PREDICTED: O-methyltransferase ZRP4-like iso...  90.1    2e-19   
ref|XP_004961502.1|  PREDICTED: O-methyltransferase ZRP4-like iso...  90.1    2e-19   
ref|XP_004961504.1|  PREDICTED: O-methyltransferase ZRP4-like         89.7    3e-19   
ref|XP_010110665.1|  8-hydroxyquercetin 8-O-methyltransferase         89.7    3e-19   
emb|CDP20221.1|  unnamed protein product                              84.7    3e-19   
ref|XP_006376381.1|  6a-hydroxymaackiain methyltransferase family...  89.0    4e-19   
ref|XP_006346268.1|  PREDICTED: trans-resveratrol di-O-methyltran...  89.0    4e-19   
emb|CBI21929.3|  unnamed protein product                              88.6    4e-19   
ref|XP_003633248.1|  PREDICTED: trans-resveratrol di-O-methyltran...  89.0    5e-19   
emb|CAN70493.1|  hypothetical protein VITISV_002330                   89.0    5e-19   Vitis vinifera
emb|CAN79968.1|  hypothetical protein VITISV_043678                   88.6    5e-19   Vitis vinifera
emb|CAN69556.1|  hypothetical protein VITISV_027590                   88.2    6e-19   Vitis vinifera
ref|XP_010052409.1|  PREDICTED: trans-resveratrol di-O-methyltran...  88.6    6e-19   
ref|XP_003633249.1|  PREDICTED: trans-resveratrol di-O-methyltran...  88.6    6e-19   
ref|XP_002278316.1|  PREDICTED: trans-resveratrol di-O-methyltran...  88.6    6e-19   Vitis vinifera
ref|XP_011002666.1|  PREDICTED: trans-resveratrol di-O-methyltran...  88.2    7e-19   
ref|XP_006371493.1|  hypothetical protein POPTR_0019s12280g           87.8    7e-19   
ref|XP_003544914.1|  PREDICTED: trans-resveratrol di-O-methyltran...  88.2    7e-19   
ref|XP_008455549.1|  PREDICTED: trans-resveratrol di-O-methyltran...  87.4    8e-19   
gb|KHN08844.1|  8-hydroxyquercetin 8-O-methyltransferase              87.8    9e-19   
emb|CBI21931.3|  unnamed protein product                              87.4    9e-19   
ref|XP_011091580.1|  PREDICTED: trans-resveratrol di-O-methyltran...  88.2    9e-19   
ref|XP_003544912.1|  PREDICTED: trans-resveratrol di-O-methyltran...  87.8    1e-18   
gb|AGQ21572.1|  flavone 8-O-methyltransferase                         87.8    1e-18   
ref|XP_004235335.1|  PREDICTED: trans-resveratrol di-O-methyltran...  89.0    1e-18   
emb|CDP21787.1|  unnamed protein product                              88.2    1e-18   
ref|XP_004151735.1|  PREDICTED: trans-resveratrol di-O-methyltran...  87.8    1e-18   
ref|XP_006376386.1|  hypothetical protein POPTR_0013s12560g           87.8    1e-18   
ref|XP_010097396.1|  8-hydroxyquercetin 8-O-methyltransferase         87.4    1e-18   
ref|XP_004169298.1|  PREDICTED: trans-resveratrol di-O-methyltran...  87.8    1e-18   
ref|XP_002522586.1|  o-methyltransferase, putative                    87.4    1e-18   Ricinus communis
ref|XP_010110664.1|  8-hydroxyquercetin 8-O-methyltransferase         87.8    1e-18   
ref|XP_010040912.1|  PREDICTED: trans-resveratrol di-O-methyltran...  87.4    1e-18   
ref|XP_010058047.1|  PREDICTED: trans-resveratrol di-O-methyltran...  87.4    1e-18   
ref|XP_010058046.1|  PREDICTED: trans-resveratrol di-O-methyltran...  87.4    2e-18   
gb|KCW75545.1|  hypothetical protein EUGRSUZ_E04305                   87.4    2e-18   
gb|KHN08846.1|  8-hydroxyquercetin 8-O-methyltransferase              86.7    2e-18   
ref|XP_006376388.1|  6a-hydroxymaackiain methyltransferase family...  87.4    2e-18   
ref|XP_009594948.1|  PREDICTED: trans-resveratrol di-O-methyltran...  87.0    2e-18   
gb|AEF97347.1|  O-methyltransferase                                   87.0    2e-18   
ref|NP_001268044.1|  trans-resveratrol di-O-methyltransferase         87.0    2e-18   
emb|CDP21231.1|  unnamed protein product                              82.4    3e-18   
gb|KHN07780.1|  Tabersonine 16-O-methyltransferase                    86.7    3e-18   
gb|KCW89599.1|  hypothetical protein EUGRSUZ_A01884                   86.7    3e-18   
ref|XP_010070255.1|  PREDICTED: trans-resveratrol di-O-methyltran...  86.7    3e-18   
gb|ABQ02270.2|  O-methyltransferase                                   86.7    3e-18   Vitis vinifera
ref|XP_010093978.1|  Tabersonine 16-O-methyltransferase               86.7    3e-18   
ref|XP_002281368.2|  PREDICTED: trans-resveratrol di-O-methyltran...  86.7    3e-18   Vitis vinifera
ref|XP_006376396.1|  hypothetical protein POPTR_0013s12670g           86.7    3e-18   
emb|CAQ76879.1|  resveratrol O-methyltransferase                      86.7    3e-18   Vitis vinifera
sp|B6VJS4.2|ROMT_VITVI  RecName: Full=Trans-resveratrol di-O-meth...  86.7    3e-18   Vitis vinifera
ref|XP_003527407.1|  PREDICTED: trans-resveratrol di-O-methyltran...  86.7    3e-18   
emb|CBI22005.3|  unnamed protein product                              86.3    3e-18   
emb|CDP21836.1|  unnamed protein product                              86.7    4e-18   
ref|XP_003557042.1|  PREDICTED: trans-resveratrol di-O-methyltran...  86.3    4e-18   
ref|XP_006388573.1|  hypothetical protein POPTR_0151s00210g           86.3    4e-18   
ref|XP_004303135.1|  PREDICTED: trans-resveratrol di-O-methyltran...  86.3    4e-18   
ref|XP_010040590.1|  PREDICTED: trans-resveratrol di-O-methyltran...  85.9    5e-18   
gb|AFX68805.1|  O-metyltransferase                                    85.9    5e-18   
emb|CDP19708.1|  unnamed protein product                              84.7    6e-18   
gb|KCW45078.1|  hypothetical protein EUGRSUZ_L01321                   85.5    6e-18   
ref|XP_006376392.1|  hypothetical protein POPTR_0013s12620g           85.9    6e-18   
ref|XP_008229108.1|  PREDICTED: trans-resveratrol di-O-methyltran...  85.9    6e-18   
ref|XP_002449557.1|  hypothetical protein SORBIDRAFT_05g019040        85.9    7e-18   Sorghum bicolor [broomcorn]
ref|XP_002305103.1|  6a-hydroxymaackiain methyltransferase family...  85.5    7e-18   Populus trichocarpa [western balsam poplar]
gb|EYU30737.1|  hypothetical protein MIMGU_mgv1a009866mg              85.1    8e-18   
emb|CBI22002.3|  unnamed protein product                              82.4    8e-18   
gb|ABK96707.1|  unknown                                               85.5    8e-18   Populus trichocarpa x Populus deltoides
ref|XP_008455550.1|  PREDICTED: trans-resveratrol di-O-methyltran...  84.7    8e-18   
ref|XP_002437453.1|  hypothetical protein SORBIDRAFT_10g027360        85.5    8e-18   Sorghum bicolor [broomcorn]
gb|ACU19152.1|  unknown                                               84.7    9e-18   Glycine max [soybeans]
ref|XP_002441376.1|  hypothetical protein SORBIDRAFT_09g025540        85.5    9e-18   Sorghum bicolor [broomcorn]
ref|XP_007142077.1|  hypothetical protein PHAVU_008G250700g           85.1    1e-17   
gb|AJD20223.1|  norcoclaurine 6-O-methyltransferase                   85.5    1e-17   
ref|XP_003615967.1|  O-methyltransferase                              84.7    1e-17   
ref|XP_010938927.1|  PREDICTED: trans-resveratrol di-O-methyltran...  84.7    1e-17   
ref|XP_011070200.1|  PREDICTED: trans-resveratrol di-O-methyltran...  85.9    2e-17   
ref|XP_002525159.1|  o-methyltransferase, putative                    84.7    2e-17   Ricinus communis
ref|XP_004158564.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...  84.7    2e-17   
ref|XP_007025514.1|  Flavonoid o-methyltransferase related            84.3    2e-17   
ref|XP_011077108.1|  PREDICTED: chavicol O-methyltransferase-like     84.7    2e-17   
emb|CDP21212.1|  unnamed protein product                              84.3    2e-17   
ref|XP_002525160.1|  o-methyltransferase, putative                    84.3    2e-17   Ricinus communis
ref|XP_011091736.1|  PREDICTED: trans-resveratrol di-O-methyltran...  86.3    2e-17   
ref|XP_011091578.1|  PREDICTED: trans-resveratrol di-O-methyltran...  84.3    2e-17   
ref|XP_002441380.1|  hypothetical protein SORBIDRAFT_09g025570        84.3    2e-17   Sorghum bicolor [broomcorn]
ref|XP_003615966.1|  O-methyltransferase                              84.3    2e-17   
ref|XP_008229106.1|  PREDICTED: trans-resveratrol di-O-methyltran...  84.7    2e-17   
ref|XP_009764108.1|  PREDICTED: trans-resveratrol di-O-methyltran...  84.0    3e-17   
ref|XP_003633245.1|  PREDICTED: trans-resveratrol di-O-methyltran...  84.0    3e-17   
ref|XP_004979388.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...  84.0    3e-17   
ref|XP_010111158.1|  Tabersonine 16-O-methyltransferase               84.0    3e-17   
emb|CDP19709.1|  unnamed protein product                              83.6    3e-17   
ref|XP_010097399.1|  8-hydroxyquercetin 8-O-methyltransferase         84.3    3e-17   
ref|XP_004984099.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...  84.0    3e-17   
ref|XP_008229109.1|  PREDICTED: trans-resveratrol di-O-methyltran...  83.6    3e-17   
emb|CAG27621.1|  putative O-methyltransferase                         80.9    3e-17   Populus deltoides x Populus maximowiczii
emb|CBI21921.3|  unnamed protein product                              83.2    3e-17   
emb|CBI21927.3|  unnamed protein product                              83.2    3e-17   
ref|XP_011100228.1|  PREDICTED: trans-resveratrol di-O-methyltran...  84.0    4e-17   
gb|KCW74501.1|  hypothetical protein EUGRSUZ_E03213                   83.6    4e-17   
ref|XP_008245363.1|  PREDICTED: trans-resveratrol di-O-methyltran...  82.4    4e-17   
ref|XP_011016237.1|  PREDICTED: trans-resveratrol di-O-methyltran...  83.6    5e-17   
ref|XP_006446726.1|  hypothetical protein CICLE_v10015705mg           83.6    5e-17   
emb|CDP21661.1|  unnamed protein product                              83.6    5e-17   
ref|XP_004163430.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...  83.2    5e-17   
ref|XP_008649876.1|  PREDICTED: O-methyltransferase ZRP4-like         83.2    5e-17   
gb|KCW44789.1|  hypothetical protein EUGRSUZ_L01645                   83.2    5e-17   
ref|XP_003615968.1|  O-methyltransferase                              82.8    6e-17   
gb|KGN43480.1|  hypothetical protein Csa_7G039280                     83.6    6e-17   
emb|CAN67020.1|  hypothetical protein VITISV_040589                   82.4    6e-17   Vitis vinifera
ref|XP_002517833.1|  o-methyltransferase, putative                    83.2    6e-17   Ricinus communis
ref|XP_010057350.1|  PREDICTED: trans-resveratrol di-O-methyltran...  83.6    6e-17   
emb|CBI30627.3|  unnamed protein product                              80.1    6e-17   
ref|XP_009376908.1|  PREDICTED: trans-resveratrol di-O-methyltran...  83.2    6e-17   
ref|XP_008343875.1|  PREDICTED: trans-resveratrol di-O-methyltran...  83.2    6e-17   
ref|XP_004151906.1|  PREDICTED: trans-resveratrol di-O-methyltran...  83.2    7e-17   
ref|XP_002454762.1|  hypothetical protein SORBIDRAFT_04g036900        83.6    7e-17   Sorghum bicolor [broomcorn]
gb|AAR09603.1|  O-methyltransferase                                   82.8    7e-17   Mentha x piperita
ref|XP_007142043.1|  hypothetical protein PHAVU_008G247600g           82.8    8e-17   
gb|KDO36159.1|  hypothetical protein CISIN_1g040309mg                 79.3    8e-17   
ref|XP_002278092.1|  PREDICTED: trans-resveratrol di-O-methyltran...  82.8    8e-17   Vitis vinifera
gb|AAB71213.1|  methyltransferase                                     82.8    8e-17   Prunus armeniaca
ref|XP_002517827.1|  o-methyltransferase, putative                    82.4    1e-16   Ricinus communis
emb|CDP19840.1|  unnamed protein product                              82.4    1e-16   
ref|XP_004151089.1|  PREDICTED: trans-resveratrol di-O-methyltran...  81.6    1e-16   
ref|XP_002522501.1|  o-methyltransferase, putative                    82.4    1e-16   Ricinus communis
ref|XP_008455485.1|  PREDICTED: trans-resveratrol di-O-methyltran...  82.8    1e-16   
gb|KDP24061.1|  hypothetical protein JCGZ_25718                       82.4    1e-16   
ref|XP_011100233.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...  82.0    1e-16   
ref|XP_003615973.1|  O-methyltransferase                              82.0    1e-16   
gb|KCW74011.1|  hypothetical protein EUGRSUZ_E02635                   78.6    1e-16   
ref|XP_011037442.1|  PREDICTED: trans-resveratrol di-O-methyltran...  82.0    2e-16   
ref|XP_011037437.1|  PREDICTED: trans-resveratrol di-O-methyltran...  82.0    2e-16   
ref|XP_008364163.1|  PREDICTED: trans-resveratrol di-O-methyltran...  81.6    2e-16   
gb|KHN19130.1|  8-hydroxyquercetin 8-O-methyltransferase              80.9    2e-16   
ref|XP_002538902.1|  o-methyltransferase, putative                    80.5    2e-16   Ricinus communis
ref|XP_002262833.1|  PREDICTED: trans-resveratrol di-O-methyltran...  81.6    2e-16   Vitis vinifera
gb|KDP24057.1|  hypothetical protein JCGZ_25714                       80.9    2e-16   
ref|XP_004293905.1|  PREDICTED: trans-resveratrol di-O-methyltran...  81.6    2e-16   
ref|XP_008455944.1|  PREDICTED: trans-resveratrol di-O-methyltran...  81.6    2e-16   
emb|CBI38115.3|  unnamed protein product                              80.5    3e-16   
ref|XP_006469137.1|  PREDICTED: trans-resveratrol di-O-methyltran...  81.3    3e-16   
gb|AIY62760.1|  N-acetylserotonin O-methyltransferase                 81.3    3e-16   
ref|XP_008649874.1|  PREDICTED: O-methyltransferase ZRP4-like         81.3    3e-16   
ref|XP_011037436.1|  PREDICTED: trans-resveratrol di-O-methyltran...  80.1    3e-16   
ref|XP_011091579.1|  PREDICTED: trans-resveratrol di-O-methyltran...  81.3    3e-16   
gb|ACY41220.1|  O-methyltransferase-like protein                      81.3    3e-16   Saccharum hybrid cultivar CP72-1210
ref|XP_007132750.1|  hypothetical protein PHAVU_011G122000g           80.5    4e-16   
ref|XP_008245137.1|  PREDICTED: trans-resveratrol di-O-methyltran...  80.9    4e-16   
gb|AFK40900.1|  unknown                                               80.9    4e-16   
ref|XP_007132751.1|  hypothetical protein PHAVU_011G1221001g          79.3    5e-16   
ref|XP_006469138.1|  PREDICTED: trans-resveratrol di-O-methyltran...  82.0    5e-16   
ref|XP_006469069.1|  PREDICTED: trans-resveratrol di-O-methyltran...  80.5    5e-16   
ref|XP_004232928.1|  PREDICTED: trans-resveratrol di-O-methyltran...  80.5    6e-16   
ref|XP_009345025.1|  PREDICTED: trans-resveratrol di-O-methyltran...  80.5    6e-16   
ref|XP_006448856.1|  hypothetical protein CICLE_v10015723mg           80.5    6e-16   
ref|XP_008364164.1|  PREDICTED: trans-resveratrol di-O-methyltran...  80.5    6e-16   
ref|XP_008455943.1|  PREDICTED: trans-resveratrol di-O-methyltran...  80.9    7e-16   
ref|NP_001130621.1|  hypothetical protein                             80.9    7e-16   Zea mays [maize]
ref|XP_002517835.1|  o-methyltransferase, putative                    80.1    7e-16   Ricinus communis
ref|XP_011085639.1|  PREDICTED: chavicol O-methyltransferase-like     80.1    7e-16   
ref|XP_011027757.1|  PREDICTED: trans-resveratrol di-O-methyltran...  80.1    7e-16   
ref|XP_002438878.1|  hypothetical protein SORBIDRAFT_10g027650        80.5    8e-16   Sorghum bicolor [broomcorn]
ref|XP_007142076.1|  hypothetical protein PHAVU_008G250600g           80.1    8e-16   
ref|XP_006356529.1|  PREDICTED: trans-resveratrol di-O-methyltran...  80.1    9e-16   
ref|XP_006364318.1|  PREDICTED: trans-resveratrol di-O-methyltran...  80.1    9e-16   
ref|XP_007132709.1|  hypothetical protein PHAVU_011G118100g           79.7    9e-16   
ref|XP_006376393.1|  hypothetical protein POPTR_0013s12640g           76.6    1e-15   
ref|XP_010260367.1|  PREDICTED: trans-resveratrol di-O-methyltran...  79.7    1e-15   
ref|XP_004170025.1|  PREDICTED: trans-resveratrol di-O-methyltran...  77.4    1e-15   
ref|XP_010023967.1|  PREDICTED: trans-resveratrol di-O-methyltran...  79.7    1e-15   
gb|KDP24060.1|  hypothetical protein JCGZ_25717                       79.7    1e-15   
emb|CAJ65648.1|  putative orcinol O-methyltransferase                 79.7    1e-15   Rosa woodsii var. ultramontana
ref|XP_002438877.1|  hypothetical protein SORBIDRAFT_10g027640        80.1    1e-15   Sorghum bicolor [broomcorn]
ref|XP_003615962.1|  O-methyltransferase                              79.3    1e-15   
emb|CAJ65621.1|  putative orcinol O-methyltransferase                 79.3    1e-15   Rosa gallica [apothecary rose]
gb|KDO37374.1|  hypothetical protein CISIN_1g023625mg                 78.6    1e-15   
emb|CAJ65622.1|  putative orcinol O-methyltransferase                 79.3    1e-15   Rosa gallica [apothecary rose]
gb|KDP24062.1|  hypothetical protein JCGZ_25719                       79.3    1e-15   
ref|XP_002437452.1|  hypothetical protein SORBIDRAFT_10g027340        79.7    1e-15   Sorghum bicolor [broomcorn]
ref|XP_008359464.1|  PREDICTED: trans-resveratrol di-O-methyltran...  79.3    1e-15   
ref|XP_004490686.1|  PREDICTED: trans-resveratrol di-O-methyltran...  79.3    2e-15   
emb|CAJ65639.1|  putative orcinol O-methyltransferase                 79.0    2e-15   Rosa hugonis
emb|CAJ65638.1|  putative orcinol O-methyltransferase                 79.0    2e-15   Rosa hugonis
ref|XP_008359463.1|  PREDICTED: trans-resveratrol di-O-methyltran...  79.3    2e-15   
emb|CDP15884.1|  unnamed protein product                              78.2    2e-15   
gb|EMT31218.1|  O-methyltransferase ZRP4                              79.3    2e-15   
ref|XP_010920172.1|  PREDICTED: trans-resveratrol di-O-methyltran...  79.0    2e-15   
ref|XP_004232927.1|  PREDICTED: trans-resveratrol di-O-methyltran...  79.0    2e-15   
ref|XP_003527405.1|  PREDICTED: trans-resveratrol di-O-methyltran...  79.0    2e-15   
emb|CAH05089.1|  putative orcinol O-methyltransferase                 79.0    2e-15   Rosa odorata var. gigantea
ref|XP_009344934.1|  PREDICTED: trans-resveratrol di-O-methyltran...  79.0    2e-15   
gb|KCW74013.1|  hypothetical protein EUGRSUZ_E026382                  75.5    2e-15   
gb|AEQ94124.1|  putative O-methyltransferase                          77.0    2e-15   
ref|NP_001140810.1|  uncharacterized protein LOC100272885             79.0    2e-15   Zea mays [maize]
ref|XP_002441379.1|  hypothetical protein SORBIDRAFT_09g025550        77.8    3e-15   Sorghum bicolor [broomcorn]
emb|CAJ65637.1|  putative orcinol O-methyltransferase                 78.6    3e-15   Rosa odorata var. gigantea
emb|CAJ65608.1|  putative orcinol O-methyltransferase                 78.6    3e-15   Rosa bracteata [Macartny rose]
emb|CAJ65602.1|  putative orcinol O-methyltransferase                 78.6    3e-15   Rosa banksiae
ref|XP_004490687.1|  PREDICTED: trans-resveratrol di-O-methyltran...  78.6    3e-15   
ref|XP_002517834.1|  o-methyltransferase, putative                    78.6    3e-15   Ricinus communis
ref|XP_008778546.1|  PREDICTED: trans-resveratrol di-O-methyltran...  78.6    3e-15   
emb|CAD29555.1|  orcinol O-methyltransferase                          78.6    3e-15   Rosa hybrid cultivar
emb|CAJ65601.1|  putative orcinol O-methyltransferase                 78.2    3e-15   Rosa chinensis [China rose]
emb|CAJ65611.1|  putative orcinol O-methyltransferase                 78.2    3e-15   Rosa canina [dog briar]
emb|CAJ65609.1|  putative orcinol O-methyltransferase                 78.2    3e-15   Rosa bracteata [Macartny rose]
emb|CAJ65623.1|  putative orcinol O-methyltransferase                 78.2    3e-15   Rosa gallica [apothecary rose]
gb|EMS47465.1|  O-methyltransferase ZRP4                              78.6    3e-15   
emb|CAJ65630.1|  putative orcinol O-methyltransferase                 78.2    3e-15   Rosa odorata var. gigantea
emb|CAJ65647.1|  putative orcinol O-methyltransferase                 78.2    3e-15   Rosa rugosa [Japanese rose]
emb|CAH05082.1|  putative orcinol O-methyltransferase                 78.2    3e-15   Rosa hybrid cultivar
emb|CAJ65632.1|  putative orcinol O-methyltransferase                 78.2    4e-15   Rosa odorata var. gigantea
emb|CAJ65626.1|  putative orcinol O-methyltransferase                 78.2    4e-15   Rosa gallica [apothecary rose]
emb|CAJ65663.1|  putative orcinol O-methyltransferase                 78.2    4e-15   Rosa odorata [tea rose]
emb|CAH05087.1|  orcinol O-methyltransferase 4                        78.2    4e-15   Rosa hybrid cultivar
emb|CAJ65665.1|  putative orcinol O-methyltransferase                 78.2    4e-15   Rosa odorata [tea rose]
emb|CAJ65628.1|  putative orcinol O-methyltransferase                 78.2    4e-15   Rosa odorata var. gigantea
emb|CAJ65641.1|  putative orcinol O-methyltransferase                 78.2    4e-15   Rosa marretii
emb|CAJ65624.1|  putative orcinol O-methyltransferase                 78.2    4e-15   Rosa gallica [apothecary rose]
emb|CAJ65661.1|  putative orcinol O-methyltransferase                 78.2    4e-15   Rosa odorata [tea rose]
emb|CAJ65603.1|  putative orcinol O-methyltransferase                 78.2    4e-15   Rosa banksiae
emb|CAJ65604.1|  putative orcinol O-methyltransferase                 78.2    4e-15   Rosa beggeriana
ref|XP_002441374.1|  hypothetical protein SORBIDRAFT_09g025530        78.2    4e-15   Sorghum bicolor [broomcorn]
ref|XP_006468348.1|  PREDICTED: trans-resveratrol di-O-methyltran...  78.2    4e-15   
emb|CAJ65645.1|  putative orcinol O-methyltransferase                 78.2    4e-15   Rosa roxburghii [chestnut rose]
emb|CAJ65635.1|  putative orcinol O-methyltransferase                 78.2    4e-15   Rosa odorata var. gigantea
gb|KDP21023.1|  hypothetical protein JCGZ_21494                       78.2    4e-15   
emb|CAJ65625.1|  putative orcinol O-methyltransferase                 78.2    4e-15   Rosa gallica [apothecary rose]
emb|CAH05090.1|  putative orcinol O-methyltransferase                 77.8    4e-15   Rosa odorata var. gigantea
emb|CAJ65605.1|  putative orcinol O-methyltransferase                 77.8    4e-15   
emb|CAJ65642.1|  putative orcinol O-methyltransferase                 77.8    4e-15   
emb|CAJ65607.1|  putative orcinol O-methyltransferase                 77.8    4e-15   
emb|CAJ65640.1|  putative orcinol O-methyltransferase                 77.8    4e-15   
emb|CAJ65598.1|  putative orcinol O-methyltransferase                 77.8    4e-15   
gb|KGN44538.1|  hypothetical protein Csa_7G328260                     77.8    4e-15   
emb|CAJ65612.1|  putative orcinol O-methyltransferase                 77.8    4e-15   
emb|CAJ65610.1|  putative orcinol O-methyltransferase                 77.8    5e-15   
emb|CAJ65613.1|  putative orcinol O-methyltransferase                 77.8    5e-15   
emb|CAJ65606.1|  putative orcinol O-methyltransferase                 77.8    5e-15   
emb|CAH05080.1|  putative orcinol O-methyltransferase                 77.8    5e-15   
emb|CAJ65620.1|  putative orcinol O-methyltransferase                 77.8    5e-15   
emb|CAH05091.1|  putative orcinol O-methyltransferase                 77.8    5e-15   
ref|XP_004139732.1|  PREDICTED: trans-resveratrol di-O-methyltran...  78.2    5e-15   
emb|CAH05081.1|  putative orcinol O-methyltransferase                 77.4    6e-15   
emb|CAJ65646.1|  putative orcinol O-methyltransferase                 77.4    6e-15   
gb|KDO75191.1|  hypothetical protein CISIN_1g018205mg                 77.8    6e-15   
ref|XP_011001214.1|  PREDICTED: trans-resveratrol di-O-methyltran...  77.8    6e-15   
emb|CAJ65643.1|  putative orcinol O-methyltransferase                 77.4    6e-15   
emb|CAJ65649.1|  putative orcinol O-methyltransferase                 77.4    7e-15   
ref|XP_006377432.1|  6a-hydroxymaackiain methyltransferase family...  77.8    7e-15   
ref|XP_002447425.1|  hypothetical protein SORBIDRAFT_06g000820        77.8    7e-15   
ref|XP_010920173.1|  PREDICTED: trans-resveratrol di-O-methyltran...  77.8    7e-15   
emb|CDP19839.1|  unnamed protein product                              77.0    7e-15   
gb|EMT32848.1|  O-methyltransferase ZRP4                              74.7    7e-15   
emb|CAJ65655.1|  putative orcinol O-methyltransferase                 77.4    7e-15   
gb|EMS45262.1|  O-methyltransferase ZRP4                              77.4    7e-15   
emb|CAJ65662.1|  putative orcinol O-methyltransferase                 77.4    8e-15   
ref|XP_010052318.1|  PREDICTED: trans-resveratrol di-O-methyltran...  77.4    8e-15   
gb|ABJ88947.1|  coniferyl alcohol 9-O-methyltransferase               77.4    9e-15   
ref|XP_010023968.1|  PREDICTED: trans-resveratrol di-O-methyltran...  77.0    1e-14   
emb|CAH05079.1|  putative orcinol O-methyltransferase                 77.0    1e-14   
gb|AEN94899.1|  desoxyhemigossypol-6-O-methyltransferase              77.0    1e-14   
ref|XP_004975403.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...  77.0    1e-14   
pdb|4E70|A  Chain A, Crystal Structure Analysis Of Coniferyl Alco...  77.4    1e-14   
ref|XP_010052398.1|  PREDICTED: trans-resveratrol di-O-methyltran...  77.0    1e-14   
emb|CDP21582.1|  unnamed protein product                              76.6    1e-14   
ref|XP_006388414.1|  6a-hydroxymaackiain methyltransferase family...  76.6    1e-14   
emb|CDP15886.1|  unnamed protein product                              76.6    1e-14   
emb|CAJ65615.1|  putative orcinol O-methyltransferase                 76.6    1e-14   
ref|XP_006489813.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...  76.6    1e-14   
ref|XP_010097402.1|  8-hydroxyquercetin 8-O-methyltransferase         73.6    1e-14   
gb|EAZ42961.1|  hypothetical protein OsJ_27551                        76.6    1e-14   
ref|XP_002454761.1|  hypothetical protein SORBIDRAFT_04g036890        77.0    2e-14   
ref|XP_004490696.1|  PREDICTED: trans-resveratrol di-O-methyltran...  76.6    2e-14   
gb|AFX68806.1|  O-metyltransferase                                    76.6    2e-14   
ref|XP_006364328.1|  PREDICTED: trans-resveratrol di-O-methyltran...  76.3    2e-14   
emb|CDP19713.1|  unnamed protein product                              76.3    2e-14   
emb|CAH05083.1|  putative orcinol O-methyltransferase                 76.3    2e-14   
sp|Q6VMW0.1|Q8OMT_MENPI  RecName: Full=8-hydroxyquercetin 8-O-met...  76.3    2e-14   
emb|CAH05085.1|  orcinol O-methyltransferase 3                        76.3    2e-14   
ref|XP_006356531.1|  PREDICTED: trans-resveratrol di-O-methyltran...  76.3    2e-14   
gb|ACF81837.1|  unknown                                               73.2    2e-14   
gb|ACV65500.1|  deoxyhemigossypol-6-O-methyltransferase               76.3    2e-14   
ref|XP_002537255.1|  o-methyltransferase, putative                    72.4    2e-14   
ref|XP_002441372.1|  hypothetical protein SORBIDRAFT_09g025510        76.3    2e-14   
ref|XP_008455942.1|  PREDICTED: trans-resveratrol di-O-methyltran...  75.9    3e-14   
gb|KCW74012.1|  hypothetical protein EUGRSUZ_E02637                   75.5    3e-14   
emb|CAJ65659.1|  putative orcinol O-methyltransferase                 75.9    3e-14   
ref|XP_002517828.1|  o-methyltransferase, putative                    72.8    3e-14   
emb|CAJ65631.1|  putative orcinol O-methyltransferase                 75.9    3e-14   
emb|CAJ65636.1|  putative orcinol O-methyltransferase                 75.9    3e-14   
emb|CAJ65627.1|  putative orcinol O-methyltransferase                 75.9    3e-14   
emb|CAD29556.1|  orcinol O-methyltransferase                          75.9    3e-14   
emb|CAH05086.1|  orcinol O-methyltransferase 4                        75.9    3e-14   
emb|CAH05088.1|  putative orcinol O-methyltransferase                 75.5    3e-14   
emb|CAJ65629.1|  putative orcinol O-methyltransferase                 75.5    3e-14   
ref|XP_010070166.1|  PREDICTED: trans-resveratrol di-O-methyltran...  75.9    3e-14   
gb|AAR02421.1|  putative O-methyltransferase                          75.5    3e-14   
ref|XP_011092041.1|  PREDICTED: trans-resveratrol di-O-methyltran...  75.5    3e-14   
emb|CAJ65660.1|  putative orcinol O-methyltransferase                 75.5    4e-14   
emb|CAJ65657.1|  putative orcinol O-methyltransferase                 75.5    4e-14   
ref|XP_011037440.1|  PREDICTED: trans-resveratrol di-O-methyltran...  75.5    4e-14   
emb|CAN83014.1|  hypothetical protein VITISV_029725                   75.5    4e-14   
emb|CAJ65616.1|  putative orcinol O-methyltransferase                 75.5    4e-14   
gb|KCW74500.1|  hypothetical protein EUGRSUZ_E03212                   75.5    4e-14   
gb|KEH30982.1|  isoflavone-7-O-methyltransferase                      75.5    4e-14   
emb|CAJ65599.1|  putative orcinol O-methyltransferase                 75.1    4e-14   
ref|XP_002517832.1|  o-methyltransferase, putative                    75.5    5e-14   
ref|XP_009351010.1|  PREDICTED: trans-resveratrol di-O-methyltran...  73.2    5e-14   
emb|CAJ65597.1|  putative orcinol O-methyltransferase                 75.1    5e-14   
ref|XP_006366911.1|  PREDICTED: trans-resveratrol di-O-methyltran...  73.6    5e-14   
gb|EAZ20360.1|  hypothetical protein OsJ_35968                        74.3    5e-14   
gb|EMS51298.1|  putative O-methyltransferase 2                        76.3    5e-14   
ref|XP_010057351.1|  PREDICTED: trans-resveratrol di-O-methyltran...  75.5    5e-14   
emb|CBI21915.3|  unnamed protein product                              72.4    5e-14   
dbj|BAA86059.1|  O-methyltransferase                                  75.5    5e-14   
emb|CAJ65614.1|  putative orcinol O-methyltransferase                 75.1    5e-14   
gb|KCW74499.1|  hypothetical protein EUGRSUZ_E03211                   75.1    5e-14   
emb|CAJ65617.1|  putative orcinol O-methyltransferase                 75.1    5e-14   
ref|XP_008362623.1|  PREDICTED: trans-resveratrol di-O-methyltran...  75.5    5e-14   
ref|NP_001148593.1|  O-methyltransferase ZRP4                         75.1    6e-14   
ref|NP_001066711.2|  Os12g0445200                                     74.7    6e-14   
ref|XP_010057348.1|  PREDICTED: trans-resveratrol di-O-methyltran...  75.1    6e-14   
gb|KHG15351.1|  8-hydroxyquercetin 8-O-methyltransferase              75.1    6e-14   
ref|XP_006421002.1|  hypothetical protein CICLE_v10006550mg           75.1    6e-14   
ref|XP_008788394.1|  PREDICTED: trans-resveratrol di-O-methyltran...  75.1    6e-14   
ref|XP_002450325.1|  hypothetical protein SORBIDRAFT_05g003780        75.1    6e-14   
ref|XP_009351009.1|  PREDICTED: trans-resveratrol di-O-methyltran...  75.1    6e-14   
emb|CDP00481.1|  unnamed protein product                              75.5    7e-14   
gb|ACF84530.1|  unknown                                               74.3    7e-14   
gb|EEE69517.1|  hypothetical protein OsJ_28977                        74.3    8e-14   
ref|XP_010320677.1|  PREDICTED: trans-resveratrol di-O-methyltran...  74.3    8e-14   
emb|CBI21913.3|  unnamed protein product                              71.6    8e-14   
emb|CBI21919.3|  unnamed protein product                              72.4    8e-14   
ref|XP_010320673.1|  PREDICTED: trans-resveratrol di-O-methyltran...  74.3    8e-14   
ref|XP_006364316.1|  PREDICTED: trans-resveratrol di-O-methyltran...  71.2    9e-14   
ref|XP_010916032.1|  PREDICTED: trans-resveratrol di-O-methyltran...  74.3    9e-14   
ref|XP_006365444.1|  PREDICTED: trans-resveratrol di-O-methyltran...  74.3    9e-14   
ref|XP_006364329.1|  PREDICTED: uncharacterized protein LOC102587683  76.3    9e-14   
ref|XP_004229155.1|  PREDICTED: myricetin O-methyltransferase-lik...  74.3    9e-14   
gb|EMT02778.1|  hypothetical protein F775_52566                       74.3    1e-13   
gb|AFW78710.1|  O-methyltransferase ZRP4                              74.3    1e-13   
ref|NP_001062931.1|  Os09g0344500                                     74.3    1e-13   
gb|ABA98340.1|  O-methyltransferase ZRP4, putative, expressed         74.3    1e-13   
gb|EAY82987.1|  hypothetical protein OsI_38209                        74.3    1e-13   
emb|CBI21920.3|  unnamed protein product                              71.2    1e-13   
emb|CAJ65596.1|  putative orcinol O-methyltransferase                 73.9    1e-13   
ref|NP_001066710.1|  Os12g0444800                                     74.3    1e-13   
gb|KDP35397.1|  hypothetical protein JCGZ_10381                       74.3    1e-13   
gb|ABJ88948.1|  coniferyl alcohol 9-O-methyltransferase               74.3    1e-13   
ref|XP_003622357.1|  Isoflavone-7-O-methyltransferase                 74.3    1e-13   
emb|CAN69333.1|  hypothetical protein VITISV_003273                   73.9    1e-13   
gb|KCW74498.1|  hypothetical protein EUGRSUZ_E03210                   71.2    1e-13   
ref|XP_007025515.1|  Flavonoid o-methyltransferase related, putative  74.3    1e-13   
ref|XP_002274019.2|  PREDICTED: trans-resveratrol di-O-methyltran...  74.3    1e-13   
ref|XP_002277927.2|  PREDICTED: trans-resveratrol di-O-methyltran...  73.9    1e-13   
emb|CAH05084.1|  orcinol O-methyltransferase 3                        73.9    1e-13   
ref|XP_008392935.1|  PREDICTED: trans-resveratrol di-O-methyltran...  74.3    1e-13   
ref|XP_008392936.1|  PREDICTED: trans-resveratrol di-O-methyltran...  73.9    1e-13   
gb|ABA98018.1|  O-methyltransferase ZRP4, putative                    71.2    1e-13   
ref|XP_008360804.1|  PREDICTED: trans-resveratrol di-O-methyltran...  72.8    2e-13   
gb|AAM97498.1|  O-methyltransferase                                   73.9    2e-13   
ref|XP_002278057.1|  PREDICTED: trans-resveratrol di-O-methyltran...  73.9    2e-13   
gb|ADZ76434.1|  myricetin O-methyltransferase 2                       73.9    2e-13   
ref|XP_004241912.1|  PREDICTED: trans-resveratrol di-O-methyltran...  73.9    2e-13   
ref|XP_006489775.1|  PREDICTED: isoflavone 4'-O-methyltransferase...  72.8    2e-13   
dbj|BAJ85395.1|  predicted protein                                    73.9    2e-13   
ref|XP_004961505.1|  PREDICTED: O-methyltransferase ZRP4-like         73.9    2e-13   
ref|XP_008343876.1|  PREDICTED: trans-resveratrol di-O-methyltran...  73.9    2e-13   
ref|XP_008354304.1|  PREDICTED: trans-resveratrol di-O-methyltran...  73.9    2e-13   
emb|CAJ65656.1|  putative orcinol O-methyltransferase                 73.6    2e-13   
emb|CDP11862.1|  unnamed protein product                              71.2    2e-13   
ref|XP_009597680.1|  PREDICTED: trans-resveratrol di-O-methyltran...  73.6    2e-13   
emb|CAJ65634.1|  putative orcinol O-methyltransferase                 73.6    2e-13   
gb|EAZ07211.1|  hypothetical protein OsI_29456                        73.6    2e-13   
dbj|BAJ96732.1|  predicted protein                                    73.6    2e-13   
ref|XP_002444017.1|  hypothetical protein SORBIDRAFT_07g005970        73.6    2e-13   
ref|XP_008677433.1|  PREDICTED: O-methyltransferase ZRP4 isoform X1   73.6    2e-13   
ref|XP_008679470.1|  PREDICTED: O-methyltransferase ZRP4-like         73.6    2e-13   
emb|CAJ65664.1|  putative orcinol O-methyltransferase                 73.2    2e-13   
gb|EAZ20367.1|  hypothetical protein OsJ_35978                        73.2    2e-13   
ref|XP_009612081.1|  PREDICTED: trans-resveratrol di-O-methyltran...  73.2    2e-13   
ref|NP_001066698.2|  Os12g0441300                                     70.9    2e-13   
ref|NP_001168311.1|  uncharacterized protein LOC100382077             73.2    2e-13   
emb|CAJ65633.1|  putative orcinol O-methyltransferase                 73.2    3e-13   
ref|XP_006420638.1|  hypothetical protein CICLE_v10005279mg           73.2    3e-13   
emb|CAJ65600.1|  putative orcinol O-methyltransferase                 73.2    3e-13   
ref|XP_010032853.1|  PREDICTED: trans-resveratrol di-O-methyltran...  73.2    3e-13   
ref|XP_009605623.1|  PREDICTED: myricetin O-methyltransferase-like    73.2    3e-13   
emb|CBI21922.3|  unnamed protein product                              72.0    3e-13   
gb|EAY82991.1|  hypothetical protein OsI_38213                        73.2    3e-13   
gb|EAY82990.1|  hypothetical protein OsI_38212                        73.2    3e-13   
gb|EEE64356.1|  hypothetical protein OsJ_19196                        72.8    3e-13   
ref|NP_001149121.1|  O-methyltransferase ZRP4                         73.2    3e-13   
ref|XP_006489814.1|  PREDICTED: trans-resveratrol di-O-methyltran...  73.2    3e-13   
ref|XP_006420642.1|  hypothetical protein CICLE_v10005275mg           73.2    3e-13   
gb|AFW60893.1|  O-methyltransferase ZRP4                              73.2    3e-13   
ref|XP_006420643.1|  hypothetical protein CICLE_v10005276mg           73.2    3e-13   
emb|CAJ65666.1|  putative orcinol O-methyltransferase                 72.8    3e-13   
gb|EAZ15132.1|  hypothetical protein OsJ_30546                        72.4    3e-13   
ref|XP_006421003.1|  hypothetical protein CICLE_v10006646mg           72.4    3e-13   
ref|XP_004505627.1|  PREDICTED: trans-resveratrol di-O-methyltran...  73.2    3e-13   
ref|XP_003556407.1|  PREDICTED: isoflavone 7-O-methyltransferase-...  72.8    3e-13   
gb|ACU20151.1|  unknown                                               72.8    3e-13   
ref|NP_001175192.1|  Os07g0463600                                     72.8    3e-13   
ref|XP_004973018.1|  PREDICTED: O-methyltransferase ZRP4-like         72.8    4e-13   
ref|XP_004951544.1|  PREDICTED: trans-resveratrol di-O-methyltran...  72.8    4e-13   
ref|XP_008660003.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...  72.8    4e-13   
ref|XP_004241914.1|  PREDICTED: myricetin O-methyltransferase-like    72.8    4e-13   
ref|XP_004979195.1|  PREDICTED: O-methyltransferase ZRP4-like         72.8    4e-13   
ref|NP_001056040.1|  Os05g0515600                                     72.8    4e-13   
ref|XP_010243530.1|  PREDICTED: trans-resveratrol di-O-methyltran...  73.9    4e-13   
ref|XP_006431705.1|  hypothetical protein CICLE_v10003093mg           71.2    4e-13   
dbj|BAF36052.1|  O-methyltransferase                                  72.8    4e-13   
gb|EMT24461.1|  O-methyltransferase ZRP4                              72.4    5e-13   
ref|XP_010052330.1|  PREDICTED: trans-resveratrol di-O-methyltran...  72.8    5e-13   
gb|EAZ41655.1|  hypothetical protein OsJ_26190                        72.4    5e-13   
gb|EMT21689.1|  O-methyltransferase ZRP4                              71.6    5e-13   
ref|XP_003536186.1|  PREDICTED: isoflavone 7-O-methyltransferase-...  72.4    5e-13   
ref|XP_003569832.1|  PREDICTED: LOW QUALITY PROTEIN: O-methyltran...  72.8    5e-13   
gb|ABJ88946.1|  coniferyl alcohol 9-O-methyltransferase               72.8    5e-13   
gb|ACF82933.1|  unknown                                               72.4    5e-13   
ref|NP_001105689.1|  O-methyltransferase ZRP4                         72.4    5e-13   
gb|KDO50646.1|  hypothetical protein CISIN_1g043533mg                 71.6    6e-13   
ref|XP_002450037.1|  hypothetical protein SORBIDRAFT_05g027340        72.4    6e-13   
gb|EMT23556.1|  O-methyltransferase ZRP4                              72.4    6e-13   
gb|KHN46106.1|  Tabersonine 16-O-methyltransferase                    70.5    6e-13   
ref|NP_001158962.1|  O-methyltransferase ZRP4                         72.4    7e-13   
gb|AAL31646.1|AC079179_1  Putative o-methyltransferase ZRP4           72.4    7e-13   
gb|EAY77535.1|  hypothetical protein OsI_32574                        72.4    7e-13   
dbj|BAC99560.1|  putative flavonoid 7-O-methyltransferase             72.4    7e-13   
ref|XP_006356530.1|  PREDICTED: trans-resveratrol di-O-methyltran...  72.0    7e-13   
ref|XP_003564176.2|  PREDICTED: O-methyltransferase ZRP4-like         72.4    7e-13   
emb|CAN73269.1|  hypothetical protein VITISV_021917                   72.0    7e-13   
ref|XP_002278149.1|  PREDICTED: trans-resveratrol di-O-methyltran...  72.0    7e-13   
emb|CAJ65618.1|  putative orcinol O-methyltransferase                 72.0    7e-13   
gb|AES89720.2|  orcinol O-methyltransferase                           72.0    8e-13   
ref|XP_009597678.1|  PREDICTED: trans-resveratrol di-O-methyltran...  72.4    8e-13   
ref|XP_010070153.1|  PREDICTED: trans-resveratrol di-O-methyltran...  72.0    8e-13   
ref|XP_008660004.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...  72.0    8e-13   
ref|XP_009791021.1|  PREDICTED: trans-resveratrol di-O-methyltran...  72.4    8e-13   
gb|EMT10547.1|  O-methyltransferase ZRP4                              72.0    9e-13   
ref|XP_003607523.1|  O-methyltransferase                              72.0    9e-13   
ref|XP_010920171.1|  PREDICTED: trans-resveratrol di-O-methyltran...  72.0    9e-13   
ref|XP_008783119.1|  PREDICTED: trans-resveratrol di-O-methyltran...  72.0    9e-13   
gb|EEC82964.1|  hypothetical protein OsI_27968                        69.7    9e-13   
gb|KDO77724.1|  hypothetical protein CISIN_1g030291mg                 70.1    1e-12   
gb|EMT30442.1|  O-methyltransferase ZRP4                              71.6    1e-12   
gb|KDO37870.1|  hypothetical protein CISIN_1g023384mg                 70.5    1e-12   
ref|XP_006467714.1|  PREDICTED: isoflavone 4'-O-methyltransferase...  71.6    1e-12   



>ref|XP_006366298.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=365

 Score =   102 bits (254),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 56/77 (73%), Positives = 67/77 (87%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KEKGGKVIIIDM++D  + +DE SIETQI FDMLMM+ +TGRER+E+ WAK+FFEAGF D
Sbjct  290  KEKGGKVIIIDMMVDNKIGDDE-SIETQIFFDMLMMVLVTGRERSERGWAKIFFEAGFSD  348

Query  83   YKIIPILGVRSLIEAYP  33
            YK+ PILG+RSLIE YP
Sbjct  349  YKVTPILGLRSLIEVYP  365



>ref|XP_009602136.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=361

 Score =   100 bits (248),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 55/77 (71%), Positives = 66/77 (86%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            +EKGGKVIIIDM++D  + +DE SIETQI FDMLMM+ +TGRER+EK WAKLF +AGF D
Sbjct  286  REKGGKVIIIDMMVDNKIGDDE-SIETQIFFDMLMMVLVTGRERSEKGWAKLFLDAGFSD  344

Query  83   YKIIPILGVRSLIEAYP  33
            YK+ PILG+RSLIE YP
Sbjct  345  YKVTPILGLRSLIEVYP  361



>ref|XP_004248183.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=362

 Score = 99.8 bits (247),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 55/77 (71%), Positives = 66/77 (86%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KEKGGKVIIIDM++D  + +DE SIETQI FDMLMM+ +TGRER+E+ WAK+F EAGF D
Sbjct  287  KEKGGKVIIIDMMVDNKIGDDE-SIETQIFFDMLMMVLVTGRERSERGWAKIFSEAGFSD  345

Query  83   YKIIPILGVRSLIEAYP  33
            YK+ PILG+RSLIE YP
Sbjct  346  YKVTPILGLRSLIEVYP  362



>ref|XP_009780941.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=363

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 55/77 (71%), Positives = 66/77 (86%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            +EKGGKVIIIDM++D  + +DE SIETQI FDMLMM+ +TGRER+EK WAKLF +AGF D
Sbjct  288  REKGGKVIIIDMMVDNKIGDDE-SIETQIFFDMLMMVLVTGRERSEKGWAKLFSDAGFSD  346

Query  83   YKIIPILGVRSLIEAYP  33
            YK+ PILG+RSLIE YP
Sbjct  347  YKVTPILGLRSLIEVYP  363



>gb|AEC13057.1| orcinol O-methyltransferase-like protein [Rosa chinensis]
Length=367

 Score = 96.3 bits (238),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + DE+SIETQ+ FDMLMM  +TG+ER EK+WAKLF +AGF DYKI PILG+RSLIE YP
Sbjct  309  KGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPILGLRSLIEVYP  367



>ref|XP_002278190.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 53/77 (69%), Positives = 63/77 (82%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KEKGGKVIIIDM+++    +DE SIETQ+ +DMLMMI LTG+ER  KDW KLFF+AGF  
Sbjct  282  KEKGGKVIIIDMMMENQKADDE-SIETQLFWDMLMMIVLTGQERNIKDWEKLFFDAGFSG  340

Query  83   YKIIPILGVRSLIEAYP  33
            YKI P+LG+RSLIE YP
Sbjct  341  YKITPMLGLRSLIEVYP  357



>emb|CAN73270.1| hypothetical protein VITISV_021918 [Vitis vinifera]
Length=328

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 53/77 (69%), Positives = 63/77 (82%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KEKGGKVIIIDM+++    +DE SIETQ+ +DMLMMI LTG+ER  KDW KLFF+AGF  
Sbjct  253  KEKGGKVIIIDMMMENQKADDE-SIETQLFWDMLMMIVLTGQERNIKDWEKLFFDAGFSG  311

Query  83   YKIIPILGVRSLIEAYP  33
            YKI P+LG+RSLIE YP
Sbjct  312  YKITPMLGLRSLIEVYP  328



>ref|XP_006480453.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=362

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 43/59 (73%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + D+KSIETQ+ FDMLMM+ LTG ER EK+W KLF  AGF DYKIIPILG+RSLIE YP
Sbjct  304  KGDDKSIETQLFFDMLMMVLLTGTERDEKEWTKLFTYAGFSDYKIIPILGLRSLIEVYP  362



>ref|XP_006428632.1| hypothetical protein CICLE_v10012033mg [Citrus clementina]
 gb|ESR41872.1| hypothetical protein CICLE_v10012033mg [Citrus clementina]
Length=362

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 43/59 (73%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + D+KSIETQ+ FDMLMM+ LTG ER EK+W KLF  AGF DYKIIPILG+RSLIE YP
Sbjct  304  KGDDKSIETQLFFDMLMMVLLTGTERDEKEWTKLFTYAGFSDYKIIPILGLRSLIEVYP  362



>emb|CDP17644.1| unnamed protein product [Coffea canephora]
Length=347

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 51/80 (64%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDE----KSIETQILFDMLMMIQLTGRERTEKDWAKLFFEA  96
            KEKGGKVIIIDM++ +    D+    ++IETQ+ FDMLMM+ + GRER EKDWAKLFFEA
Sbjct  266  KEKGGKVIIIDMLLKSRQNGDDDDNAEAIETQLFFDMLMMVLVKGRERNEKDWAKLFFEA  325

Query  95   GFRDYKIIPILGVRSLIEAY  36
            GF  YKI P+LG+RS+IE Y
Sbjct  326  GFNGYKITPVLGLRSIIEVY  345



>ref|XP_006346269.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=364

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 48/77 (62%), Positives = 67/77 (87%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KE GGKVI+I++V+D   ++D+KS ETQ+L D+LMMI L+G+ER++++WAKLFF+AG+ D
Sbjct  289  KENGGKVILIEIVMDQN-KDDDKSYETQLLIDILMMILLSGKERSQQEWAKLFFDAGYSD  347

Query  83   YKIIPILGVRSLIEAYP  33
            YKIIPILG+R +IE YP
Sbjct  348  YKIIPILGLRCVIEVYP  364



>emb|CAN61955.1| hypothetical protein VITISV_020020 [Vitis vinifera]
Length=357

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 51/77 (66%), Positives = 64/77 (83%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KEKGGKVIIIDM+++   + D++S+ETQ+ FDMLMMI +TG+ER EK+W KLF +AGF  
Sbjct  282  KEKGGKVIIIDMMMENQ-KGDDESMETQLFFDMLMMILVTGQERNEKEWEKLFLDAGFSG  340

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG+RSLIE YP
Sbjct  341  YKITPILGLRSLIEVYP  357



>ref|XP_002278211.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 51/77 (66%), Positives = 64/77 (83%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KEKGGKVIIIDM+++   + D++S+ETQ+ FDMLMMI +TG+ER EK+W KLF +AGF  
Sbjct  282  KEKGGKVIIIDMMMENQ-KGDDESMETQLFFDMLMMILVTGQERNEKEWEKLFLDAGFSG  340

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG+RSLIE YP
Sbjct  341  YKITPILGLRSLIEVYP  357



>gb|KDO41475.1| hypothetical protein CISIN_1g0225151mg, partial [Citrus sinensis]
Length=227

 Score = 93.6 bits (231),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + D+KSIETQ+ FDMLMM+ LTG ER EK+W KLF  AGF DYKIIPILG+RSLIE YP
Sbjct  169  KGDDKSIETQLFFDMLMMVLLTGTERDEKEWTKLFTYAGFSDYKIIPILGLRSLIEVYP  227



>gb|EYU30782.1| hypothetical protein MIMGU_mgv1a021078mg [Erythranthe guttata]
Length=359

 Score = 94.4 bits (233),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 38/59 (64%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + ++K+ ETQ+LFDMLMMI++TG+ERTEK+WA LFF AGF +YKI P+LG+RS+IE +P
Sbjct  301  KENQKATETQLLFDMLMMIEVTGKERTEKEWANLFFSAGFSNYKITPVLGLRSIIEVFP  359



>ref|XP_006446728.1| hypothetical protein CICLE_v10015708mg [Citrus clementina]
 gb|ESR59968.1| hypothetical protein CICLE_v10015708mg [Citrus clementina]
Length=362

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 41/59 (69%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + D +SIETQ+ FDMLMM+ +TG ER EK+WAKLF +AGF DYKI PILG+RSLIE YP
Sbjct  304  KGDSESIETQLFFDMLMMVLVTGTERDEKEWAKLFADAGFSDYKITPILGLRSLIEVYP  362



>ref|XP_002278517.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=359

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 50/78 (64%), Positives = 61/78 (78%), Gaps = 1/78 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKS-IETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFR  87
            KEKGGKV+IIDM I     +D++S +ETQ+ FDMLMM+ L GRER EK+W KLF ++GF 
Sbjct  282  KEKGGKVMIIDMAIQNKKGDDDESNVETQLFFDMLMMVLLPGREREEKEWKKLFLDSGFS  341

Query  86   DYKIIPILGVRSLIEAYP  33
             YKI PILG+RSLIE YP
Sbjct  342  GYKITPILGLRSLIEVYP  359



>gb|ABZ89567.1| O-methyltransferase 3 [Humulus lupulus]
Length=377

 Score = 94.4 bits (233),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 50/76 (66%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -2

Query  260  EKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDY  81
            +KGGKVIIIDM ++     D++S ETQ+ FDMLMM  +TGRER EK+WAKLF +AGF +Y
Sbjct  302  KKGGKVIIIDMKVENEKDEDDESYETQLFFDMLMMALVTGRERNEKEWAKLFKDAGFSNY  361

Query  80   KIIPILGVRSLIEAYP  33
            KI PILG+RSLIE YP
Sbjct  362  KITPILGLRSLIEVYP  377



>emb|CAA11131.1| O-methyltransferase [Prunus dulcis]
Length=356

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 51/77 (66%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KEK GKVII+DMV+    + D++SIETQ+ FDMLMM+  TG+ERTEK+WAKLF +AGF D
Sbjct  282  KEKKGKVIIVDMVMKQ--KGDDQSIETQLFFDMLMMVLFTGKERTEKEWAKLFSDAGFSD  339

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PI G+R LIE YP
Sbjct  340  YKITPICGLRYLIEVYP  356



>ref|XP_004303127.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=367

 Score = 93.6 bits (231),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 40/59 (68%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + DE+S+ETQ+ FDMLMM  +TG+ER EK+W+KLF +AGF DYKI PILG+RSLIE YP
Sbjct  309  KGDEESMETQLFFDMLMMALVTGKERNEKEWSKLFTDAGFSDYKITPILGLRSLIEVYP  367



>ref|XP_006469135.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=402

 Score = 94.0 bits (232),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 41/59 (69%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + D +SIETQ+ FDMLMM+ +TG ER EK+WAKLF +AGF DYKI PILG+RSLIE YP
Sbjct  344  KGDSESIETQLFFDMLMMVLVTGTERDEKEWAKLFADAGFSDYKITPILGLRSLIEVYP  402



>gb|AAM23005.1|AF502434_1 orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAD29459.1| orcinol O-methyltransferase [Rosa chinensis]
 emb|CAH05078.1| orcinol O-methyltransferase 2 [Rosa chinensis]
 dbj|BAQ20440.1| 3,5-dimethoxytoluene [Rosa hybrid cultivar]
Length=366

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 41/59 (69%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + DE+SIETQ+ FDMLMM  + G+ER EK+WAKLF +AGF DYKI PILG+RSLIE YP
Sbjct  308  KGDEESIETQLFFDMLMMALVRGQERNEKEWAKLFTDAGFSDYKITPILGLRSLIEVYP  366



>ref|XP_002278398.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
 emb|CBI21930.3| unnamed protein product [Vitis vinifera]
Length=358

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 50/78 (64%), Positives = 61/78 (78%), Gaps = 1/78 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKS-IETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFR  87
            KEKGGKV+IIDM I     +D++S +ETQ+ FDMLMM+ L GRER EK+W KLF ++GF 
Sbjct  281  KEKGGKVMIIDMAIQNKKGDDDESNVETQLFFDMLMMVLLPGREREEKEWKKLFLDSGFS  340

Query  86   DYKIIPILGVRSLIEAYP  33
             YKI PILG+RSLIE YP
Sbjct  341  GYKITPILGLRSLIEVYP  358



>emb|CBI21932.3| unnamed protein product [Vitis vinifera]
Length=436

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 50/78 (64%), Positives = 61/78 (78%), Gaps = 1/78 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKS-IETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFR  87
            KEKGGKV+IIDM I     +D++S +ETQ+ FDMLMM+ L GRER EK+W KLF ++GF 
Sbjct  359  KEKGGKVMIIDMAIQNKKGDDDESNVETQLFFDMLMMVLLPGREREEKEWKKLFLDSGFS  418

Query  86   DYKIIPILGVRSLIEAYP  33
             YKI PILG+RSLIE YP
Sbjct  419  GYKITPILGLRSLIEVYP  436



>emb|CBI21924.3| unnamed protein product [Vitis vinifera]
Length=187

 Score = 91.3 bits (225),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 64/77 (83%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KEKGGKVIIIDM+++   + D++S+ETQ+ FDMLMMI +TG+ER EK+W KLF +AGF  
Sbjct  112  KEKGGKVIIIDMMMENQ-KGDDESMETQLFFDMLMMILVTGQERNEKEWEKLFLDAGFSG  170

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG+RSLIE YP
Sbjct  171  YKITPILGLRSLIEVYP  187



>gb|AAM23004.1|AF502433_1 orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAD29458.1| orcinol O-methyltransferase [Rosa chinensis]
 emb|CAH05077.1| orcinol O-methyltransferase 1 [Rosa chinensis]
Length=367

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 51/77 (66%), Positives = 62/77 (81%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KEK GKVIIIDM+++   + DE+SIETQ+ FDMLMM  + G+ER EK+WAKLF +AGF D
Sbjct  292  KEKKGKVIIIDMMMENQ-KGDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSD  350

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PI G+RSLIE YP
Sbjct  351  YKITPISGLRSLIEVYP  367



>ref|XP_004252468.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=362

 Score = 91.7 bits (226),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 61/79 (77%), Gaps = 2/79 (3%)
 Frame = -2

Query  263  KEKGGKvii--idmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGF  90
            KEKGGKVII  + ++   + + D KS ETQ+ FDMLMM+ ++G+ER ++DWAKLF  AGF
Sbjct  284  KEKGGKVIIIDMVLMDRKIEKGDGKSYETQLFFDMLMMVHVSGKERNQQDWAKLFCSAGF  343

Query  89   RDYKIIPILGVRSLIEAYP  33
             DY IIP+LG+RS+IE +P
Sbjct  344  SDYNIIPMLGLRSIIEVFP  362



>emb|CAN78992.1| hypothetical protein VITISV_005827 [Vitis vinifera]
Length=357

 Score = 91.7 bits (226),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 50/77 (65%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KE GGKVIIIDM++    + D KS+ETQ+ FDM+MMI +TGRER E +W KLF +AGF  
Sbjct  282  KENGGKVIIIDMIMMKN-QGDYKSVETQLYFDMVMMILVTGRERDENEWEKLFLDAGFSH  340

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG+RSLIE YP
Sbjct  341  YKITPILGLRSLIEVYP  357



>emb|CDP15888.1| unnamed protein product [Coffea canephora]
Length=362

 Score = 91.7 bits (226),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 48/77 (62%), Positives = 60/77 (78%), Gaps = 2/77 (3%)
 Frame = -2

Query  260  EKGGKviiidmvidtvMRNDE--KSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFR  87
            EKGGKVIIIDM++ +    D+  ++IETQ+ FDMLMM+ + GRER EKDW KLF EAGF 
Sbjct  284  EKGGKVIIIDMLLKSQQNGDDDAEAIETQLFFDMLMMVHVKGRERNEKDWEKLFLEAGFN  343

Query  86   DYKIIPILGVRSLIEAY  36
             YKI P+LG+RS+IE Y
Sbjct  344  GYKITPVLGLRSIIEVY  360



>ref|XP_002278294.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score = 91.7 bits (226),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 50/77 (65%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KE GGKVIIIDM++    + D KS+ETQ+ FDM+MMI +TGRER E +W KLF +AGF  
Sbjct  282  KENGGKVIIIDMIMMKN-QGDYKSVETQLYFDMVMMILVTGRERDENEWEKLFLDAGFSH  340

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG+RSLIE YP
Sbjct  341  YKITPILGLRSLIEVYP  357



>ref|XP_011091583.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score = 91.3 bits (225),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            R++ +S+ETQ+LFDMLMM  + G+ER EK+WAKLF++AGF+DY+I P+LG+RS+IE YP
Sbjct  301  RSNTESVETQLLFDMLMMTLVGGKERKEKEWAKLFYDAGFQDYRIYPVLGLRSIIEVYP  359



>emb|CBI21926.3| unnamed protein product [Vitis vinifera]
Length=297

 Score = 91.3 bits (225),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 50/77 (65%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KE GGKVIIIDM++    + D KS+ETQ+ FDM+MMI +TGRER E +W KLF +AGF  
Sbjct  222  KENGGKVIIIDMIMMKN-QGDYKSVETQLYFDMVMMILVTGRERDENEWEKLFLDAGFSH  280

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG+RSLIE YP
Sbjct  281  YKITPILGLRSLIEVYP  297



>ref|XP_010088036.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXB31255.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=373

 Score = 91.7 bits (226),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 40/57 (70%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            D+KS ETQ+ FDM+MM+  TG+ER EK+WAKLF ++GF DYKIIPILG+RSLIE YP
Sbjct  317  DDKSYETQLFFDMMMMVLATGQERNEKEWAKLFQDSGFSDYKIIPILGLRSLIEVYP  373



>ref|XP_011002663.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score = 91.3 bits (225),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 42/77 (55%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            K++ G  ++I  ++    + +++SIETQI FDMLMMI  TG+ER EK+WAKLF +AGF +
Sbjct  281  KDREGGKVMIIEMMMENQKGEDESIETQIFFDMLMMILFTGQERNEKEWAKLFSDAGFSN  340

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG+RS+IE +P
Sbjct  341  YKITPILGLRSIIEVFP  357



>ref|XP_011002662.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score = 91.3 bits (225),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 42/77 (55%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            K++ G  ++I  ++    + +++SIETQI FDMLMMI  TG+ER EK+WAKLF +AGF +
Sbjct  281  KDREGGKVMIIEMMMENQKGEDESIETQIFFDMLMMILFTGQERNEKEWAKLFSDAGFSN  340

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG+RS+IE +P
Sbjct  341  YKITPILGLRSIIEVFP  357



>ref|XP_006371494.1| hypothetical protein POPTR_0019s12300g [Populus trichocarpa]
 gb|ERP49291.1| hypothetical protein POPTR_0019s12300g [Populus trichocarpa]
Length=121

 Score = 88.2 bits (217),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + +++SIETQI FDMLMMI +TG+ER EK+WAKLF +AGF +YKI PILG+RS+IE +P
Sbjct  63   KGEDESIETQIFFDMLMMILVTGQERNEKEWAKLFSDAGFSNYKITPILGLRSIIEVFP  121



>ref|XP_011100227.1| PREDICTED: 8-hydroxyquercetin 8-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score = 91.3 bits (225),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 39/59 (66%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + + K+IETQ+ FDMLMM   +GRERTEKDWA+LFF AGF  YKI P+LG+RSLIE +P
Sbjct  301  QKEHKAIETQLFFDMLMMNVASGRERTEKDWAELFFAAGFTSYKITPVLGLRSLIELFP  359



>emb|CDP21583.1| unnamed protein product [Coffea canephora]
Length=307

 Score = 90.5 bits (223),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 63/78 (81%), Gaps = 2/78 (3%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMR--NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGF  90
            KEKGGKVIIID+++ +  +  +D ++IETQ+LFDMLMM+ L GRER EKDWAKLFF AGF
Sbjct  228  KEKGGKVIIIDILLKSQQKGDDDHEAIETQLLFDMLMMVLLKGRERNEKDWAKLFFGAGF  287

Query  89   RDYKIIPILGVRSLIEAY  36
             DYKI   LG+RS+IE Y
Sbjct  288  NDYKITAALGLRSIIEVY  305



>ref|NP_001267963.1| O-methyltransferase [Vitis vinifera]
 gb|AEP17010.1| O-methyltransferase [Vitis vinifera]
Length=357

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 51/77 (66%), Positives = 58/77 (75%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KEKGGKVIIIDM++    + D KSIETQ+ FDM MMI   GRER E +W KLF +AGF  
Sbjct  282  KEKGGKVIIIDMIMMKN-QGDYKSIETQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSH  340

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG+RSLIE YP
Sbjct  341  YKITPILGLRSLIEVYP  357



>ref|XP_006428633.1| hypothetical protein CICLE_v10013393mg [Citrus clementina]
 gb|ESR41873.1| hypothetical protein CICLE_v10013393mg [Citrus clementina]
Length=280

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + D KSIETQ+ F+M MM+ LTG ER EK+WAK+F ++GF DYKIIPILG+RSLIE YP
Sbjct  222  KKDYKSIETQLFFEMFMMVLLTGTERDEKEWAKIFADSGFSDYKIIPILGLRSLIEIYP  280



>ref|XP_006368013.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=353

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 48/77 (62%), Positives = 62/77 (81%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KE GGKVI+ID VID   + D+KS ETQ+  D+LMM+ ++G+ER E++WAKLF +AGF D
Sbjct  278  KENGGKVIVIDTVIDNQ-KGDDKSFETQLFLDVLMMVHVSGKERNEQEWAKLFSDAGFSD  336

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG+RS+IE YP
Sbjct  337  YKISPILGLRSVIEVYP  353



>gb|KDO73905.1| hypothetical protein CISIN_1g017835mg [Citrus sinensis]
Length=365

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + D K+ ETQ+  DMLMM+ + G ER EK+WAKLFFEAGF DYKI  +LGVRSLIE YP
Sbjct  307  KADYKTTETQLFMDMLMMVLVKGEERNEKEWAKLFFEAGFSDYKITDVLGVRSLIEVYP  365



>ref|XP_006452811.1| hypothetical protein CICLE_v10008718mg [Citrus clementina]
 gb|ESR66051.1| hypothetical protein CICLE_v10008718mg [Citrus clementina]
Length=365

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + D K+ ETQ+  DMLMM+ + G ER EK+WAKLFFEAGF DYKI  +LGVRSLIE YP
Sbjct  307  KADYKTTETQLFMDMLMMVLVKGEERNEKEWAKLFFEAGFSDYKITDVLGVRSLIEVYP  365



>emb|CDP21551.1| unnamed protein product [Coffea canephora]
Length=269

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 48/78 (62%), Positives = 60/78 (77%), Gaps = 2/78 (3%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDE--KSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGF  90
            KEKGGKVIIIDM++ +    D+  ++IETQ+ FD+LMM+   GRER EKDW KLF EAGF
Sbjct  190  KEKGGKVIIIDMLLKSQQNGDDDAEAIETQLFFDILMMVHAKGRERNEKDWEKLFLEAGF  249

Query  89   RDYKIIPILGVRSLIEAY  36
              YKI P+LG+RS+IE Y
Sbjct  250  NGYKITPVLGLRSIIEVY  267



>ref|XP_006474725.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=365

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + D K+ ETQ+  DMLMM+ + G ER EK+WAKLFFEAGF DYKI  +LGVRSLIE YP
Sbjct  307  KADYKTTETQLFMDMLMMVLVKGEERNEKEWAKLFFEAGFSDYKITDVLGVRSLIEVYP  365



>ref|XP_002326036.2| hypothetical protein POPTR_0019s12290g [Populus trichocarpa]
 gb|EEF00418.2| hypothetical protein POPTR_0019s12290g [Populus trichocarpa]
Length=357

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -2

Query  200  EKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            E S ETQ+ FDMLMMI +TG+ER EK+WAKLF +AGF +YKI P+LG+RSLIE YP
Sbjct  302  EGSTETQLFFDMLMMILVTGKERNEKEWAKLFTDAGFSNYKINPVLGLRSLIEVYP  357



>ref|XP_006388574.1| hypothetical protein POPTR_0151s00220g [Populus trichocarpa]
 gb|ERP47488.1| hypothetical protein POPTR_0151s00220g [Populus trichocarpa]
Length=326

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 38/57 (67%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            DE SIETQ+LFD+ MM+ ++G ER EK+WAKLFF+AGF +YKI P+LG R+LIE YP
Sbjct  270  DEGSIETQLLFDLQMMVAVSGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALIELYP  326



>ref|XP_007043718.1| Flavonoid o-methyltransferase related [Theobroma cacao]
 gb|EOX99549.1| Flavonoid o-methyltransferase related [Theobroma cacao]
Length=364

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 37/57 (65%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            ++ SIETQ+ FDMLMM+ +TG+ER E++WA LF  AGF DYKI PI+G+RSLIE YP
Sbjct  308  NDASIETQLFFDMLMMVLVTGKERNEEEWATLFLAAGFSDYKITPIMGLRSLIEVYP  364



>ref|XP_011091734.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=337

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 37/58 (64%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -2

Query  206  NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            +D KS+ETQ+ FDMLMM  + G+ER +K+WAKLFF+AGF +YKI P+LG+RS+IE YP
Sbjct  280  SDHKSVETQLFFDMLMMTVVGGKERNQKEWAKLFFDAGFTNYKISPLLGIRSIIEVYP  337



>ref|XP_004987341.1| PREDICTED: O-methyltransferase ZRP4-like isoform X1 [Setaria 
italica]
Length=387

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/77 (57%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KE+GGKVII+D+++     +D+K +ETQ+LFD+ +M  + G ER E++W  + FEAGF D
Sbjct  312  KERGGKVIILDIMVGAGSSSDQKHVETQVLFDLFIMF-INGAERDEQEWKNIIFEAGFSD  370

Query  83   YKIIPILGVRSLIEAYP  33
            YKIIP+LGVRS+IEAYP
Sbjct  371  YKIIPVLGVRSIIEAYP  387



>ref|XP_004961502.1| PREDICTED: O-methyltransferase ZRP4-like isoform X1 [Setaria 
italica]
Length=387

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/77 (57%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KE+GGKVII+D+++     +D+K +ETQ+LFD+ +M  + G ER E++W  + FEAGF D
Sbjct  312  KERGGKVIILDIMVGAGSSSDQKHVETQVLFDLFIMF-INGAERDEQEWKNIIFEAGFSD  370

Query  83   YKIIPILGVRSLIEAYP  33
            YKIIP+LGVRS+IEAYP
Sbjct  371  YKIIPVLGVRSIIEAYP  387



>ref|XP_004961504.1| PREDICTED: O-methyltransferase ZRP4-like [Setaria italica]
Length=366

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 44/77 (57%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KE+GGKVII+D+++     +D+K +ETQ+LFD+ +M  + G ER E++W  + FEAGF D
Sbjct  291  KERGGKVIILDIMVGAGSSSDQKHVETQVLFDLFIMF-VNGAERDEQEWKNIIFEAGFSD  349

Query  83   YKIIPILGVRSLIEAYP  33
            YKIIP+LGVRS+IEAYP
Sbjct  350  YKIIPVLGVRSIIEAYP  366



>ref|XP_010110665.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXC27580.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=384

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  197  KSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            +S ETQ+ FDMLMM+ L+GRER E +WAKLFF+AGF  YKI PILGVRSLIE +P
Sbjct  330  QSYETQLFFDMLMMVLLSGRERKETEWAKLFFDAGFSTYKITPILGVRSLIEVFP  384



>emb|CDP20221.1| unnamed protein product [Coffea canephora]
Length=69

 Score = 84.7 bits (208),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -2

Query  206  NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAY  36
            +D ++IETQ+ FDML+M+ L GR+R EKDWAKLF EAGF DYKI  +LG+RS+IE Y
Sbjct  11   DDHEAIETQLFFDMLVMVLLKGRQRNEKDWAKLFTEAGFSDYKITAVLGLRSIIEVY  67



>ref|XP_006376381.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54178.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score = 89.0 bits (219),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 38/57 (67%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            DE SIETQ+LFD+ MM+ ++G ER EK+WAKLFF+AGF +YKI P+LG R+LIE YP
Sbjct  303  DEGSIETQLLFDLEMMVAVSGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALIELYP  359



>ref|XP_006346268.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=353

 Score = 89.0 bits (219),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 47/77 (61%), Positives = 62/77 (81%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KE GGKVI+ID VID   + D+KS E+Q+  D+LMM+ ++G+ER E++WAKLF +AGF D
Sbjct  278  KENGGKVIVIDTVIDNQ-KGDDKSFESQLFLDVLMMVHVSGKERNEQEWAKLFSDAGFSD  336

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG+RS+IE YP
Sbjct  337  YKISPILGLRSVIEVYP  353



>emb|CBI21929.3| unnamed protein product [Vitis vinifera]
Length=294

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 50/77 (65%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KE GGKVIIIDM++    + D KSIETQ+ FDM MMI   GRER E +W KLF +AGF  
Sbjct  219  KENGGKVIIIDMIMMKN-QGDYKSIETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSH  277

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG+RSLIE YP
Sbjct  278  YKITPILGLRSLIEVYP  294



>ref|XP_003633248.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 50/77 (65%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KE GGKVIIIDM++    + D KSIETQ+ FDM MMI   GRER E +W KLF +AGF  
Sbjct  282  KENGGKVIIIDMIMMKN-QGDYKSIETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSH  340

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG+RSLIE YP
Sbjct  341  YKITPILGLRSLIEVYP  357



>emb|CAN70493.1| hypothetical protein VITISV_002330 [Vitis vinifera]
Length=363

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 48/78 (62%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKS-IETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFR  87
            KEKGGKV+IIDM I     +D++S +ETQ+  DMLMM+   GRER EK+W KLF ++GF 
Sbjct  286  KEKGGKVMIIDMAIXNKKGDDDESXVETQLFXDMLMMVLXPGREREEKEWKKLFLDSGFS  345

Query  86   DYKIIPILGVRSLIEAYP  33
             YKI PILG+RSLIE YP
Sbjct  346  GYKITPILGLRSLIEVYP  363



>emb|CAN79968.1| hypothetical protein VITISV_043678 [Vitis vinifera]
Length=357

 Score = 88.6 bits (218),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 49/77 (64%), Positives = 58/77 (75%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KE GGKVIIIDM++    + D+KSIETQ+ FDM MMI   GRER E +W K+F +AGF  
Sbjct  282  KENGGKVIIIDMIMMKN-QGDDKSIETQLFFDMTMMIFSAGRERDENEWEKIFLDAGFSH  340

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG+RSLIE YP
Sbjct  341  YKITPILGLRSLIEVYP  357



>emb|CAN69556.1| hypothetical protein VITISV_027590 [Vitis vinifera]
Length=323

 Score = 88.2 bits (217),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 50/77 (65%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KE GGKVIIIDM++    + D KSIETQ+ FDM MMI   GRER E +W KLF +AGF  
Sbjct  248  KENGGKVIIIDMIMMKN-QGDYKSIETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSH  306

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG+RSLIE YP
Sbjct  307  YKITPILGLRSLIEVYP  323



>ref|XP_010052409.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW89598.1| hypothetical protein EUGRSUZ_A01881 [Eucalyptus grandis]
Length=358

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            ++D++++ETQ+ +DMLMM   +GRER E +WAKLF  AGF DYKI P+LG+RSLIE YP
Sbjct  300  KSDKETVETQLFYDMLMMTLASGRERNEAEWAKLFVAAGFGDYKITPVLGLRSLIEVYP  358



>ref|XP_003633249.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 50/77 (65%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KE GGKVIIIDM++    + D KSIETQ+ FDM MMI   GRER E +W KLF +AGF  
Sbjct  282  KENGGKVIIIDMIMMKN-QGDYKSIETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSH  340

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG+RSLIE YP
Sbjct  341  YKITPILGLRSLIEVYP  357



>ref|XP_002278316.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=359

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 48/78 (62%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRN-DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFR  87
            KEKGGKV+IIDM I     + DE  +ETQ+  DMLMM+   GRER EK+W KLF ++GF 
Sbjct  282  KEKGGKVMIIDMAILNKKGDEDESKVETQLFMDMLMMVLYPGREREEKEWKKLFLDSGFS  341

Query  86   DYKIIPILGVRSLIEAYP  33
             YKI PILG+RSLIE YP
Sbjct  342  GYKITPILGLRSLIEVYP  359



>ref|XP_011002666.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score = 88.2 bits (217),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 41/77 (53%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            K++ G  ++I  ++    + ++ SIETQI FDMLMMI +TG+ER EK+WAKLF +A F +
Sbjct  281  KDREGGKVMIIEMMMENQKGEDDSIETQIFFDMLMMILVTGQERNEKEWAKLFSDASFSN  340

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG+RS+IE +P
Sbjct  341  YKITPILGLRSIIEVFP  357



>ref|XP_006371493.1| hypothetical protein POPTR_0019s12280g [Populus trichocarpa]
 gb|ERP49290.1| hypothetical protein POPTR_0019s12280g [Populus trichocarpa]
Length=283

 Score = 87.8 bits (216),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 41/77 (53%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            K++ G  ++I  ++    + +++SIETQI FDMLMMI +TG+ER EK+WAKLF +AGF +
Sbjct  207  KDREGGKVMIIDMMMENQKGEDESIETQIFFDMLMMILVTGQERNEKEWAKLFSDAGFSN  266

Query  83   YKIIPILGVRSLIEAYP  33
            +KI PILG+RS+IE +P
Sbjct  267  FKITPILGLRSIIEVFP  283



>ref|XP_003544914.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X1 [Glycine max]
Length=358

 Score = 88.2 bits (217),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 48/77 (62%), Positives = 63/77 (82%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            K K GKVIIIDMV++   R+DE S+ETQ+ FDMLMM+ +TG+ER++K+WAKL   AG+ +
Sbjct  283  KGKEGKVIIIDMVVENEKRDDE-SVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNN  341

Query  83   YKIIPILGVRSLIEAYP  33
            YKI P+LG+RSLIE YP
Sbjct  342  YKITPVLGLRSLIEIYP  358



>ref|XP_008455549.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like, partial 
[Cucumis melo]
Length=266

 Score = 87.4 bits (215),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            +ND+ SIE+Q+ FDMLMM+++ G+ER EK+WAKL  EAGF  YKI PILG+RSLIE YP
Sbjct  208  KNDQDSIESQLFFDMLMMVEVGGKEREEKEWAKLVKEAGFSAYKIFPILGLRSLIEIYP  266



>gb|KHN08844.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=329

 Score = 87.8 bits (216),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 48/77 (62%), Positives = 63/77 (82%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            K K GKVIIIDMV++   R+DE S+ETQ+ FDMLMM+ +TG+ER++K+WAKL   AG+ +
Sbjct  254  KGKEGKVIIIDMVVENEKRDDE-SVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNN  312

Query  83   YKIIPILGVRSLIEAYP  33
            YKI P+LG+RSLIE YP
Sbjct  313  YKITPVLGLRSLIEIYP  329



>emb|CBI21931.3| unnamed protein product [Vitis vinifera]
Length=278

 Score = 87.4 bits (215),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 50/77 (65%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KE GGKVIIIDM++    + D KSIETQ+ FDM MMI   GRER E +W KLF +AGF  
Sbjct  203  KENGGKVIIIDMIMMKN-QGDYKSIETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSH  261

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG+RSLIE YP
Sbjct  262  YKITPILGLRSLIEVYP  278



>ref|XP_011091580.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=358

 Score = 88.2 bits (217),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 48/76 (63%), Positives = 63/76 (83%), Gaps = 1/76 (1%)
 Frame = -2

Query  260  EKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDY  81
            EKGGKV+II+MV+D    +D KS+ETQ+LFDMLMM  + G+ER +K+WAKLF +AGF +Y
Sbjct  284  EKGGKVVIIEMVVDDQ-NSDHKSVETQLLFDMLMMTVVGGKERNQKEWAKLFSDAGFTNY  342

Query  80   KIIPILGVRSLIEAYP  33
            KI P+LG+RS+IE YP
Sbjct  343  KISPLLGIRSIIEVYP  358



>ref|XP_003544912.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
1 [Glycine max]
Length=358

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 48/77 (62%), Positives = 63/77 (82%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            K K GKVIIIDMV++   R+DE S+ETQ+ FDMLMM+ +TG+ER++K+WAKL   AG+ +
Sbjct  283  KGKEGKVIIIDMVVENEKRDDE-SVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNN  341

Query  83   YKIIPILGVRSLIEAYP  33
            YKI P+LG+RSLIE YP
Sbjct  342  YKITPVLGLRSLIEIYP  358



>gb|AGQ21572.1| flavone 8-O-methyltransferase [Ocimum basilicum]
Length=359

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = -2

Query  257  KGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYK  78
            KGGKVII+DM++    + DE ++ETQ+ FDM+MM  LTG+ERTE++WAK+FF AGF+ YK
Sbjct  286  KGGKVIIVDMILGYEKQQDE-AVETQLFFDMMMMTTLTGKERTEQEWAKIFFAAGFKTYK  344

Query  77   IIPILGVRSLIEAYP  33
            I P+LG+RSLIE +P
Sbjct  345  IYPLLGLRSLIEVFP  359



>ref|XP_004235335.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=445

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 49/77 (64%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KE GGKVI+ID+VID   R D KS ETQ+  D+LMM+ ++G+ER E++WAKLF  AGF D
Sbjct  370  KENGGKVIVIDIVIDNQKR-DNKSFETQLFSDVLMMVHVSGKERNEQEWAKLFSNAGFSD  428

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG+RS+IE YP
Sbjct  429  YKISPILGLRSVIEVYP  445



>emb|CDP21787.1| unnamed protein product [Coffea canephora]
Length=365

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 61/78 (78%), Gaps = 2/78 (3%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMR--NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGF  90
            KEKGGKVII+DM   ++ +  +D ++IETQ+ FDM +M+ L GR+R EKDWAKLF EAGF
Sbjct  286  KEKGGKVIIVDMFCKSLQKGDDDHETIETQLFFDMEVMVLLKGRQRNEKDWAKLFTEAGF  345

Query  89   RDYKIIPILGVRSLIEAY  36
             DYKI  +LG+RS+IE Y
Sbjct  346  SDYKITAVLGLRSIIEVY  363



>ref|XP_004151735.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
sativus]
Length=357

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/59 (69%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            +ND  SIETQ+L+DMLMMI   G+ER EK+WAKL  EAGFR YKI PIL +RSLIE YP
Sbjct  299  KNDADSIETQLLYDMLMMIVPGGKEREEKEWAKLIKEAGFRAYKIFPILDLRSLIEIYP  357



>ref|XP_006376386.1| hypothetical protein POPTR_0013s12560g [Populus trichocarpa]
 ref|XP_006376390.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54183.1| hypothetical protein POPTR_0013s12560g [Populus trichocarpa]
 gb|ERP54187.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/57 (65%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            DE SIETQ+LFD+ +M+  +G ER EK+WAKLFF+AGF +YKI P+LG R+LIE YP
Sbjct  303  DEGSIETQLLFDLQLMVGFSGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALIELYP  359



>ref|XP_010097396.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXB67902.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=305

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/58 (64%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -2

Query  206  NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            +D +S ETQ+ FDMLMM+ + GRER E +WAKLF +AGF  YKI PILGV+SLIE +P
Sbjct  248  HDHQSYETQLFFDMLMMVLVRGRERKETEWAKLFLDAGFSTYKITPILGVKSLIEVFP  305



>ref|XP_004169298.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
sativus]
 gb|KGN43482.1| hypothetical protein Csa_7G039790 [Cucumis sativus]
Length=357

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/59 (69%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            +ND  SIETQ+L+DMLMMI   G+ER EK+WAKL  EAGFR YKI PIL +RSLIE YP
Sbjct  299  KNDADSIETQLLYDMLMMIVPGGKEREEKEWAKLIKEAGFRAYKIFPILDLRSLIEIYP  357



>ref|XP_002522586.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF39886.1| o-methyltransferase, putative [Ricinus communis]
Length=355

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 48/77 (62%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            K KGGKVI+ID+V+D     DE + ET++LFD+LMM+ + G ERTEK+W +LF EAGF  
Sbjct  280  KGKGGKVIVIDIVVDEKKEQDELT-ETKLLFDILMMVVVNGTERTEKEWKRLFLEAGFSH  338

Query  83   YKIIPILGVRSLIEAYP  33
            YKI P+LGVRSLIE YP
Sbjct  339  YKITPLLGVRSLIEVYP  355



>ref|XP_010110664.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXC27579.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=377

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/58 (67%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -2

Query  206  NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            +D +  ETQILFDMLMM+   GRER E +WAKLF +AGF  YKI PILGVRSLIE +P
Sbjct  320  HDHQLYETQILFDMLMMVSFPGRERKETEWAKLFSDAGFSTYKITPILGVRSLIEVFP  377



>ref|XP_010040912.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW44790.1| hypothetical protein EUGRSUZ_L01646 [Eucalyptus grandis]
Length=357

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            ++D++ +ETQ+ +DMLMM   +GRER E +WAKLF  AGF DYKI P+LG+RSLIE YP
Sbjct  298  KSDKEMVETQLFYDMLMMTLTSGRERNEAEWAKLFVAAGFGDYKITPVLGLRSLIEVYP  356



>ref|XP_010058047.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
Length=359

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            ++D++ +ETQ+ +DMLMM   +GRER E +WAKLF  AGF DYKI P+LG+RSLIE YP
Sbjct  300  KSDKEMVETQLFYDMLMMTLTSGRERNEAEWAKLFVAAGFGDYKITPVLGLRSLIEVYP  358



>ref|XP_010058046.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
Length=359

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            ++D++ +ETQ+ +DMLMM   +GRER E +WAKLF  AGF DYKI P+LG+RSLIE YP
Sbjct  300  KSDKEMVETQLFYDMLMMTLASGRERNEAEWAKLFVAAGFGDYKITPVLGLRSLIEVYP  358



>gb|KCW75545.1| hypothetical protein EUGRSUZ_E04305 [Eucalyptus grandis]
Length=359

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            ++D++ +ETQ+ +DMLMM   +GRER E +WAKLF  AGF DYKI P+LG+RSLIE YP
Sbjct  300  KSDKEMVETQLFYDMLMMTLASGRERNEAEWAKLFVAAGFGDYKITPVLGLRSLIEVYP  358



>gb|KHN08846.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=263

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + D++S+ETQ+ FDMLMM+ +TG+ER++K+WAKL   AG+ +YKI P+LG+RSLIE YP
Sbjct  205  KRDDESVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNYKITPVLGLRSLIEIYP  263



>ref|XP_006376388.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54185.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=365

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAY  36
            DE SIETQ+ FD+LMM+ ++G ER EK+WAKLFF+AGF +YKI P+LG R+LIE Y
Sbjct  309  DEGSIETQLFFDLLMMVAVSGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALIELY  364



>ref|XP_009594948.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=359

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 48/77 (62%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KE GGKVIIID+V+D+  + D KS ETQ+  D LMM+ ++G+ER  ++W KLF +AGF D
Sbjct  284  KENGGKVIIIDIVVDSQ-KGDNKSFETQLFSDTLMMVHVSGKERNREEWVKLFCDAGFSD  342

Query  83   YKIIPILGVRSLIEAYP  33
            YKIIPILG+RSLIE YP
Sbjct  343  YKIIPILGLRSLIEVYP  359



>gb|AEF97347.1| O-methyltransferase [Vitis pseudoreticulata]
Length=357

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 49/77 (64%), Positives = 56/77 (73%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KE GGKVIIIDM++    + D KS ETQ+ FDM MMI   GRER E +W KLF +AGF  
Sbjct  282  KENGGKVIIIDMIMMKN-QGDYKSTETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSH  340

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG+RSLIE YP
Sbjct  341  YKITPILGLRSLIEVYP  357



>ref|NP_001268044.1| trans-resveratrol di-O-methyltransferase [Vitis vinifera]
 gb|AEP17011.1| O-methyltransferase [Vitis vinifera]
Length=357

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 50/77 (65%), Positives = 56/77 (73%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KE GGKVIIIDM++    + D KSIETQ+ FDM MMI   GRER E +W KLF  AGF  
Sbjct  282  KENGGKVIIIDMIMMKN-QGDYKSIETQLFFDMTMMIFAPGRERDENEWEKLFLGAGFSH  340

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG+RSLIE YP
Sbjct  341  YKITPILGLRSLIEVYP  357



>emb|CDP21231.1| unnamed protein product [Coffea canephora]
Length=69

 Score = 82.4 bits (202),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -2

Query  206  NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAY  36
            +D ++IETQ+LF MLMM+   GR+R EKDWAKLF E GF DYKI  +LG+RS+IE Y
Sbjct  11   DDHEAIETQLLFHMLMMVLFKGRQRNEKDWAKLFTETGFSDYKITAVLGLRSIIEVY  67



>gb|KHN07780.1| Tabersonine 16-O-methyltransferase [Glycine soja]
Length=323

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + D++SIETQ+  DM++M+   G+ERTEK+WAKL F  GF DYKI P+LG+RSLIE YP
Sbjct  265  KGDDESIETQLFIDMVVMVLYPGKERTEKEWAKLIFSTGFSDYKITPVLGLRSLIEIYP  323



>gb|KCW89599.1| hypothetical protein EUGRSUZ_A01884 [Eucalyptus grandis]
Length=357

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            ++D++ +ETQ+ +DMLMM  ++GRER E +WAKLF  AGF DYKI P LG+RSLIE YP
Sbjct  298  KSDKEMVETQLFYDMLMMTLVSGRERNEAEWAKLFVTAGFGDYKITPALGLRSLIEVYP  356



>ref|XP_010070255.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
Length=359

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            ++D++ +ETQ+ +DMLMM  ++GRER E +WAKLF  AGF DYKI P LG+RSLIE YP
Sbjct  300  KSDKEMVETQLFYDMLMMTLVSGRERNEAEWAKLFVTAGFGDYKITPALGLRSLIEVYP  358



>gb|ABQ02270.2| O-methyltransferase [Vitis vinifera]
Length=357

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 49/77 (64%), Positives = 56/77 (73%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KE GGKVIIIDM++    + D KS ETQ+ FDM MMI   GRER E +W KLF +AGF  
Sbjct  282  KENGGKVIIIDMIMMKN-QGDYKSTETQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSH  340

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG+RSLIE YP
Sbjct  341  YKITPILGLRSLIEVYP  357



>ref|XP_010093978.1| Tabersonine 16-O-methyltransferase [Morus notabilis]
 gb|EXB54965.1| Tabersonine 16-O-methyltransferase [Morus notabilis]
Length=364

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 37/57 (65%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            D+KS ETQ+ FDMLMM+ LTGRER +K+W  LF  AGF  YKI PI+G+RSL+E YP
Sbjct  308  DKKSAETQLYFDMLMMVNLTGRERNQKEWESLFVAAGFSHYKITPIVGLRSLMEVYP  364



>ref|XP_002281368.2| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 49/77 (64%), Positives = 56/77 (73%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KE GGKVIIIDM++    + D KS ETQ+ FDM MMI   GRER E +W KLF +AGF  
Sbjct  282  KENGGKVIIIDMIMMKN-QGDYKSTETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSH  340

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG+RSLIE YP
Sbjct  341  YKITPILGLRSLIEVYP  357



>ref|XP_006376396.1| hypothetical protein POPTR_0013s12670g [Populus trichocarpa]
 gb|ERP54193.1| hypothetical protein POPTR_0013s12670g [Populus trichocarpa]
Length=359

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 37/57 (65%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            DE SIETQ+ FD+ MM+ + G ER EK+WAKLFF+AGF +YKI P+LG R+LIE YP
Sbjct  303  DEGSIETQLFFDLQMMVVVGGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALIELYP  359



>emb|CAQ76879.1| resveratrol O-methyltransferase [Vitis vinifera]
Length=357

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 49/77 (64%), Positives = 56/77 (73%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KE GGKVIIIDM++    + D KS ETQ+ FDM MMI   GRER E +W KLF +AGF  
Sbjct  282  KENGGKVIIIDMIMMKN-QGDYKSTETQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSH  340

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG+RSLIE YP
Sbjct  341  YKITPILGLRSLIEVYP  357



>sp|B6VJS4.2|ROMT_VITVI RecName: Full=Trans-resveratrol di-O-methyltransferase; AltName: 
Full=Resveratrol O-methyltransferase; Short=ROMT; Short=VvROMT 
[Vitis vinifera]
Length=357

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 49/77 (64%), Positives = 56/77 (73%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KE GGKVIIIDM++    + D KS ETQ+ FDM MMI   GRER E +W KLF +AGF  
Sbjct  282  KENGGKVIIIDMIMMKN-QGDYKSTETQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSH  340

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG+RSLIE YP
Sbjct  341  YKITPILGLRSLIEVYP  357



>ref|XP_003527407.1| PREDICTED: trans-resveratrol di-O-methyltransferase isoform 1 
[Glycine max]
Length=352

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + D++SIETQ+  DM++M+   G+ERTEK+WAKL F  GF DYKI P+LG+RSLIE YP
Sbjct  294  KGDDESIETQLFIDMVVMVLYPGKERTEKEWAKLIFSTGFSDYKITPVLGLRSLIEIYP  352



>emb|CBI22005.3| unnamed protein product [Vitis vinifera]
Length=309

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 49/77 (64%), Positives = 56/77 (73%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KE GGKVIIIDM++    + D KS ETQ+ FDM MMI   GRER E +W KLF +AGF  
Sbjct  234  KENGGKVIIIDMIMMKN-QGDYKSTETQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSH  292

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG+RSLIE YP
Sbjct  293  YKITPILGLRSLIEVYP  309



>emb|CDP21836.1| unnamed protein product [Coffea canephora]
Length=365

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 46/78 (59%), Positives = 61/78 (78%), Gaps = 2/78 (3%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMR--NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGF  90
            KEKGGKVII+DM   ++ +  +D ++IETQ+ FDM++M+ L  R+R EKDWAKLF EAGF
Sbjct  286  KEKGGKVIIVDMFCKSLQKGDDDHEAIETQLFFDMVVMVLLKRRQRNEKDWAKLFTEAGF  345

Query  89   RDYKIIPILGVRSLIEAY  36
             DYKI  +LG+RS+IE Y
Sbjct  346  SDYKITAVLGLRSIIEVY  363



>ref|XP_003557042.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Glycine 
max]
Length=358

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 47/77 (61%), Positives = 62/77 (81%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            K K GKVIIIDMV++   R+DE S+ETQ+ FDMLMM+ +TG+ER++K+WAKL   AG+ +
Sbjct  283  KGKEGKVIIIDMVVENEKRDDE-SVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNN  341

Query  83   YKIIPILGVRSLIEAYP  33
            YKI P+ G+RSLIE YP
Sbjct  342  YKITPVFGLRSLIEIYP  358



>ref|XP_006388573.1| hypothetical protein POPTR_0151s00210g [Populus trichocarpa]
 gb|ERP47487.1| hypothetical protein POPTR_0151s00210g [Populus trichocarpa]
Length=359

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = -2

Query  209  RN-DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            RN DE SI TQ+LFD+ MM+ L+G ER EK+WAKLFF+AGF +YKI P+LG R+L E YP
Sbjct  300  RNGDEGSIGTQLLFDLEMMVALSGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALFELYP  359



>ref|XP_004303135.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=365

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 38/57 (67%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + KS ETQ+ +DMLMM+ LTGRERTEKDW KLF  AGF  YKI   LG+RS IE YP
Sbjct  309  NNKSTETQLFWDMLMMVCLTGRERTEKDWEKLFLAAGFSHYKITHTLGIRSFIEVYP  365



>ref|XP_010040590.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like, partial 
[Eucalyptus grandis]
Length=326

 Score = 85.9 bits (211),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            ++D++ +ETQ+ +DMLMM    GRER + +WAKLF  AGF DYKI P+LG+RSLIE YP
Sbjct  267  KSDKEMVETQLFYDMLMMTLAVGRERNQAEWAKLFIAAGFGDYKITPVLGLRSLIEVYP  325



>gb|AFX68805.1| O-metyltransferase [Vitis riparia]
Length=357

 Score = 85.9 bits (211),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 49/77 (64%), Positives = 56/77 (73%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KE GGKVIIIDM++    + D KSIETQ+ FDM M I   GRER E +W KLF +AGF  
Sbjct  282  KENGGKVIIIDMIMMKN-QGDYKSIETQLFFDMTMTIFAPGRERDENEWEKLFLDAGFSH  340

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG+RSLIE YP
Sbjct  341  YKITPILGLRSLIEVYP  357



>emb|CDP19708.1| unnamed protein product [Coffea canephora]
Length=212

 Score = 84.7 bits (208),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 61/78 (78%), Gaps = 2/78 (3%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMR--NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGF  90
            KE GGKVIIIDMV+    +  +D ++IETQ+  DMLMM+ L G++R E++WAKLF EAGF
Sbjct  134  KENGGKVIIIDMVLSDQQKGADDHEAIETQLFSDMLMMVLLRGKQRNEREWAKLFSEAGF  193

Query  89   RDYKIIPILGVRSLIEAY  36
             DYKI P+LG+RSL+E Y
Sbjct  194  NDYKITPVLGLRSLVEVY  211



>gb|KCW45078.1| hypothetical protein EUGRSUZ_L01321 [Eucalyptus grandis]
Length=331

 Score = 85.5 bits (210),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            ++D++ +ETQ+ +DMLMM    GRER + +WAKLF  AGF DYKI P+LG+RSLIE YP
Sbjct  272  KSDKEMVETQLFYDMLMMTLAVGRERNQAEWAKLFIAAGFGDYKITPVLGLRSLIEVYP  330



>ref|XP_006376392.1| hypothetical protein POPTR_0013s12620g [Populus trichocarpa]
 gb|ERP54189.1| hypothetical protein POPTR_0013s12620g [Populus trichocarpa]
Length=355

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 37/57 (65%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            D  SIETQ+ FD+ MM+  TG ER EK+WAKLFF+AGF +YKI P+LG R+LIE YP
Sbjct  299  DGGSIETQLFFDLQMMVAATGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALIELYP  355



>ref|XP_008229108.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=355

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 37/57 (65%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            D++S ETQ+ FDMLMM+ + G+ER EK+WAKLF +AGF  YKI P LG+RSLIE YP
Sbjct  299  DKESGETQLFFDMLMMVLVKGKERNEKEWAKLFSDAGFSHYKITPCLGLRSLIEVYP  355



>ref|XP_002449557.1| hypothetical protein SORBIDRAFT_05g019040 [Sorghum bicolor]
 gb|EES08545.1| hypothetical protein SORBIDRAFT_05g019040 [Sorghum bicolor]
Length=379

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 47/77 (61%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            ++ GGKVIIIDMV+ +   +D K  ETQ+LFD+LMM  L G ER E++W K+F EAGF+D
Sbjct  304  RDAGGKVIIIDMVLGSGPADDVKHKETQVLFDLLMM-ALNGVERDEQEWKKIFLEAGFKD  362

Query  83   YKIIPILGVRSLIEAYP  33
            YKIIP+LGVRS++E YP
Sbjct  363  YKIIPVLGVRSIVELYP  379



>ref|XP_002305103.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|EEE85614.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score = 85.5 bits (210),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 49/78 (63%), Positives = 61/78 (78%), Gaps = 3/78 (4%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSI-ETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFR  87
            KEKGGKVII+D+VID   + DEK + ET++LFDMLMM+   G+ER+ K+W KLF EAGF 
Sbjct  284  KEKGGKVIIVDVVIDE--KKDEKELTETKLLFDMLMMVVAAGKERSVKEWEKLFLEAGFS  341

Query  86   DYKIIPILGVRSLIEAYP  33
             YKI P+ G+RSLIE YP
Sbjct  342  HYKITPLFGLRSLIEVYP  359



>gb|EYU30737.1| hypothetical protein MIMGU_mgv1a009866mg [Erythranthe guttata]
Length=329

 Score = 85.1 bits (209),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  254  GGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKI  75
            GGK+IIIDMV++    +D K++E Q+ FDM MM  L G+ER+EK+W KLFF+AGF +YKI
Sbjct  256  GGKLIIIDMVMNIYEGDDNKAMEDQLFFDMAMMAYLNGKERSEKEWVKLFFDAGFTNYKI  315

Query  74   IPILGVRSLIEAYP  33
             P  GVRSLIE YP
Sbjct  316  TPAFGVRSLIEVYP  329



>emb|CBI22002.3| unnamed protein product [Vitis vinifera]
Length=114

 Score = 82.4 bits (202),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 56/77 (73%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KE GGKVIIIDM++    + D KS ETQ+ FDM MMI   GRER E +W KLF +AGF  
Sbjct  39   KENGGKVIIIDMIMMKN-QGDYKSTETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSH  97

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG+RSLIE YP
Sbjct  98   YKITPILGLRSLIEVYP  114



>gb|ABK96707.1| unknown [Populus trichocarpa x Populus deltoides]
Length=359

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 37/57 (65%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            DE SIETQ+ FD+ MM+   G ER EK+WAKLFF+AGF +YKI P+LG R+LIE YP
Sbjct  303  DEGSIETQLFFDLQMMVVAGGMERNEKEWAKLFFDAGFLNYKIYPVLGPRALIELYP  359



>ref|XP_008455550.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
melo]
Length=267

 Score = 84.7 bits (208),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            +ND+ SIETQ+  DMLMM+   G+ER EK+WAKL  EAGF  YKI PILG+RSLIE YP
Sbjct  209  KNDQDSIETQLFHDMLMMVVTGGKEREEKEWAKLIKEAGFSAYKIFPILGLRSLIEIYP  267



>ref|XP_002437453.1| hypothetical protein SORBIDRAFT_10g027360 [Sorghum bicolor]
 gb|EER88820.1| hypothetical protein SORBIDRAFT_10g027360 [Sorghum bicolor]
Length=372

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = -2

Query  206  NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            +D K IETQ+LFD LMM+ + G ER E +W  +FFEAGF+DYKIIP+LGVRS+IE YP
Sbjct  316  SDLKHIETQVLFD-LMMMNVNGVERDENEWKNIFFEAGFKDYKIIPLLGVRSIIELYP  372



>gb|ACU19152.1| unknown [Glycine max]
Length=282

 Score = 84.7 bits (208),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 47/77 (61%), Positives = 62/77 (81%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            K K GKVIIIDMV++   R+DE S+ETQ+ FDMLMM+ +TG+ER++K+WAKL   AG+ +
Sbjct  207  KGKEGKVIIIDMVVENEKRDDE-SVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNN  265

Query  83   YKIIPILGVRSLIEAYP  33
            YKI P+ G+RSLIE YP
Sbjct  266  YKITPVFGLRSLIEIYP  282



>ref|XP_002441376.1| hypothetical protein SORBIDRAFT_09g025540 [Sorghum bicolor]
 gb|EES19806.1| hypothetical protein SORBIDRAFT_09g025540 [Sorghum bicolor]
Length=362

 Score = 85.5 bits (210),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  206  NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            +D+K++ETQ+LFD+ +M  + G ER EK+W K+ FEAGFR YKI+P+LGVRS+IE YP
Sbjct  306  SDQKNVETQVLFDLFIM-TINGAERDEKEWKKIIFEAGFRSYKIMPVLGVRSIIEVYP  362



>ref|XP_007142077.1| hypothetical protein PHAVU_008G250700g [Phaseolus vulgaris]
 gb|ESW14071.1| hypothetical protein PHAVU_008G250700g [Phaseolus vulgaris]
Length=357

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            D++S ETQ+ FDMLMM+  TG+ER +K+W KLF  AGF +YKI P++G+RSLIE YP
Sbjct  301  DDESFETQLFFDMLMMVFFTGKERNKKEWVKLFSSAGFNNYKITPVVGLRSLIEIYP  357



>gb|AJD20223.1| norcoclaurine 6-O-methyltransferase [Podophyllum peltatum]
Length=373

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 48/77 (62%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KE GGKVIIIDMV+D   +N  +S ETQ+ FDMLMM+ +TG+ERTE +W KLF +AGF  
Sbjct  297  KEAGGKVIIIDMVVDDKNKNHYESTETQLFFDMLMMVLITGKERTETEWKKLFSDAGFTG  356

Query  83   YKIIPILGVRSLIEAYP  33
            Y I PILG+RS IE  P
Sbjct  357  YTITPILGLRSFIEVLP  373



>ref|XP_003615967.1| O-methyltransferase [Medicago truncatula]
 gb|AES98925.1| orcinol O-methyltransferase [Medicago truncatula]
Length=359

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/58 (64%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -2

Query  206  NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            ++ +S+ETQ+ FDMLMM  LTG+ER EK+W KL   AGF DYKI PILG+RS+IE YP
Sbjct  302  DNNESVETQLFFDMLMMALLTGKERNEKEWMKLISLAGFNDYKITPILGLRSMIEIYP  359



>ref|XP_010938927.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Elaeis 
guineensis]
Length=362

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/77 (53%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KE GGK+II+D V+        K+ ETQ+ FDMLMM+   G +R EK+W+K+FF+AGF +
Sbjct  286  KENGGKLIIVDAVVKAGDDGSNKTTETQLFFDMLMMVNSGGMQREEKEWSKIFFDAGFSN  345

Query  83   YKIIPILGVRSLIEAYP  33
            YKI P++G+RS+IE YP
Sbjct  346  YKINPVMGLRSIIEVYP  362



>ref|XP_011070200.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=458

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/58 (62%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -2

Query  206  NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            +D KS+ETQ+ FD L+M    GRER++K+WAKLFF+AGF +YKI P+LG+RS+IE YP
Sbjct  401  SDHKSVETQLFFDTLVMTIADGRERSQKEWAKLFFDAGFSNYKISPLLGLRSIIEVYP  458



>ref|XP_002525159.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF37286.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -2

Query  206  NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
             D +SIE+Q+ FDMLMM   TG++R +K+W KLF +AGF DYKI PILG+RS+IE YP
Sbjct  299  TDHQSIESQLFFDMLMMTLQTGKQRNKKEWGKLFLDAGFSDYKITPILGLRSVIEVYP  356



>ref|XP_004158564.1| PREDICTED: LOW QUALITY PROTEIN: trans-resveratrol di-O-methyltransferase-like 
[Cucumis sativus]
Length=363

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + D++S ETQ+LFD+LMM+ L G+ER E +W  LF EAGF  YKII  LG+RSLIE YP
Sbjct  304  KEDKESTETQLLFDLLMMVNLNGKERNENEWKNLFMEAGFSGYKIISKLGLRSLIEVYP  362



>ref|XP_007025514.1| Flavonoid o-methyltransferase related [Theobroma cacao]
 gb|EOY28136.1| Flavonoid o-methyltransferase related [Theobroma cacao]
Length=352

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            +++ +  E ++ FDMLMM+ +TGRERTE+DW KLF  AGF DYKI P+ G+RSLIE YP
Sbjct  294  KDEHELTEAKLFFDMLMMVVVTGRERTEQDWQKLFMAAGFTDYKISPLFGLRSLIEVYP  352



>ref|XP_011077108.1| PREDICTED: chavicol O-methyltransferase-like [Sesamum indicum]
Length=361

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/57 (65%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            D K +ET   FD+ +M  LTGRERTEK+WAKLFF+AGF +YKI P  G+RSLIE YP
Sbjct  305  DNKEMETCFFFDIALMPYLTGRERTEKEWAKLFFDAGFTNYKITPAFGLRSLIEVYP  361



>emb|CDP21212.1| unnamed protein product [Coffea canephora]
Length=324

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 2/78 (3%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMR--NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGF  90
            KEK GKVII++M   +  +  +D ++IETQ+ FDM +M+ + GR+R EKDWAKLF EAGF
Sbjct  245  KEKRGKVIIVEMFCKSQQKGDDDHEAIETQLFFDMAVMVLVKGRQRNEKDWAKLFTEAGF  304

Query  89   RDYKIIPILGVRSLIEAY  36
             DYKI  +LG+RS+IE Y
Sbjct  305  SDYKITAVLGLRSIIEVY  322



>ref|XP_002525160.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF37287.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  260  EKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDY  81
            +KGGK+II+D+V+++    D + +ETQ  FD+L+M   TG+E+  KDW KLF +AGF DY
Sbjct  281  KKGGKLIIVDLVLESQHVTDHQDVETQFFFDILLMTLQTGKEKNNKDWGKLFMDAGFSDY  340

Query  80   KIIPILGVRSLIEAYP  33
            KI PILG+RS+IE YP
Sbjct  341  KINPILGLRSVIEVYP  356



>ref|XP_011091736.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=560

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/57 (67%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            D KS+ETQ+  DMLMM  L GRER E +WAKLF +AGF +YKI PILG+RS+IE YP
Sbjct  504  DHKSVETQLFIDMLMMTILRGRERKEIEWAKLFSDAGFTNYKISPILGLRSIIEVYP  560



>ref|XP_011091578.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=360

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/57 (63%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            D KS+ET++ FDMLMM  + GRER EK+WAKLF +AGF DY+I  +LG+RS+IE YP
Sbjct  304  DHKSVETKLFFDMLMMTIVGGRERNEKEWAKLFSDAGFSDYRISSLLGLRSIIEVYP  360



>ref|XP_002441380.1| hypothetical protein SORBIDRAFT_09g025570 [Sorghum bicolor]
 gb|EES19810.1| hypothetical protein SORBIDRAFT_09g025570 [Sorghum bicolor]
Length=359

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/58 (64%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = -2

Query  206  NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            +DEK +ETQILFD+ MM  + G ER E +W K+ FEAGF  YKIIP+LGVRS+IE YP
Sbjct  303  SDEKHVETQILFDLFMMF-INGAERDELEWKKIIFEAGFSSYKIIPVLGVRSIIEVYP  359



>ref|XP_003615966.1| O-methyltransferase [Medicago truncatula]
 gb|AES98924.1| orcinol O-methyltransferase [Medicago truncatula]
Length=360

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 46/77 (60%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            K K GKVI+IDMV+++   +  +S+ETQ+ FDMLMM+ L G+ER +K+W KL   AGF D
Sbjct  284  KGKQGKVIVIDMVLESEKESINESVETQLFFDMLMMVVLAGKERNKKEWIKLISSAGFSD  343

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG+RSLIE YP
Sbjct  344  YKITPILGLRSLIEIYP  360



>ref|XP_008229106.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=391

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/57 (63%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            D+KSIETQ+++D+LMM+ L G+ER+E +W KLF  AGF  YKI  ILG+RSLIE YP
Sbjct  335  DKKSIETQLMWDILMMVDLNGKERSEAEWEKLFLTAGFSHYKITHILGLRSLIEVYP  391



>ref|XP_009764108.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=360

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + D KS ETQ+  D+LMM+ ++G+ER  ++WAKLF +AGF DYKI PILG+RS+IE YP
Sbjct  302  KGDNKSFETQLFSDILMMVHVSGKERNREEWAKLFCDAGFSDYKINPILGLRSVIEVYP  360



>ref|XP_003633245.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + D K++ETQ+  DMLMM+ + G+ER EK+W KLF  AGF  YKI P LG+RSLIE YP
Sbjct  299  KGDNKAVETQLFIDMLMMVVVAGKERNEKEWEKLFLAAGFTHYKITPALGLRSLIEVYP  357



>ref|XP_004979388.1| PREDICTED: 5-pentadecatrienyl resorcinol O-methyltransferase-like 
[Setaria italica]
Length=366

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 37/58 (64%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  206  NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            ++EK  ETQ+LFD+LM I L G ER E++W K+FFEAGF+DYKII +LG+RS+IE YP
Sbjct  310  SEEKHTETQLLFDLLM-IALNGVERDEQEWKKIFFEAGFKDYKIITLLGIRSIIELYP  366



>ref|XP_010111158.1| Tabersonine 16-O-methyltransferase [Morus notabilis]
 gb|EXC30549.1| Tabersonine 16-O-methyltransferase [Morus notabilis]
Length=369

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            ++D +  E ++ FD+LMMI +TGRER+EKDW KLF EAGF  YKI P+ G+RSLIE +P
Sbjct  272  KDDPELTEGKLYFDLLMMILVTGRERSEKDWEKLFLEAGFSHYKITPLFGLRSLIEVFP  330



>emb|CDP19709.1| unnamed protein product [Coffea canephora]
Length=348

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 45/77 (58%), Positives = 63/77 (82%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            ++KGGKVIIIDM++++ M++DE S+ETQ + DM M+     +ERTEK+WAK+F +AGF D
Sbjct  273  RDKGGKVIIIDMILESHMKDDE-SVETQFVVDMQMLTCYGAKERTEKEWAKVFQDAGFSD  331

Query  83   YKIIPILGVRSLIEAYP  33
            YK++P+LGVR LIE YP
Sbjct  332  YKVLPVLGVRCLIEVYP  348



>ref|XP_010097399.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXB67905.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=384

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -2

Query  197  KSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            +S ETQ+ FDMLMM+   GRER E +WAKLF +AGF  YKI PILGVRSLIE +P
Sbjct  330  QSYETQLFFDMLMMVLYPGRERKETEWAKLFSDAGFNTYKITPILGVRSLIEVFP  384



>ref|XP_004984099.1| PREDICTED: 5-pentadecatrienyl resorcinol O-methyltransferase-like 
[Setaria italica]
Length=379

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 45/77 (58%), Positives = 62/77 (81%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            ++ GGK+IIIDMV+ +   +D K  ETQ+L+D+L+M  + G ER E++W K+FFEAGF+D
Sbjct  304  RDAGGKIIIIDMVVGSGPSDDIKHAETQVLYDLLIM-NINGVERDEQEWKKIFFEAGFKD  362

Query  83   YKIIPILGVRSLIEAYP  33
            YKIIP+LGVRS+IE YP
Sbjct  363  YKIIPVLGVRSVIELYP  379



>ref|XP_008229109.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=354

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 37/57 (65%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            D++S ETQ+ FDM MM+  TG+ER EK+WAKLF +AGF  YKI P LG+RSLIE YP
Sbjct  298  DKESGETQLFFDMEMMVLATGKERNEKEWAKLFSDAGFSHYKITPSLGLRSLIEVYP  354



>emb|CAG27621.1| putative O-methyltransferase [Populus deltoides x Populus maximowiczii]
Length=119

 Score = 80.9 bits (198),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
              DE SIETQ++FD+ MM+ ++G ER EK+WAKLFF++GF +YKI P+ G R++IE YP
Sbjct  61   NGDEGSIETQLIFDLAMMVVVSGVERNEKEWAKLFFDSGFLNYKIHPVPGTRAVIELYP  119



>emb|CBI21921.3| unnamed protein product [Vitis vinifera]
Length=306

 Score = 83.2 bits (204),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + D K++ETQ+  DMLMM+ + G+ER EK+W KLF  AGF  YKI P LG+RSLIE YP
Sbjct  248  KGDNKAVETQLFIDMLMMVVVAGKERNEKEWEKLFLAAGFTHYKITPALGLRSLIEVYP  306



>emb|CBI21927.3| unnamed protein product [Vitis vinifera]
Length=277

 Score = 83.2 bits (204),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRN-DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFR  87
            KEKGGKV+IIDM I     + DE  +ETQ+  DMLMM+   GRER EK+W KLF ++GF 
Sbjct  200  KEKGGKVMIIDMAILNKKGDEDESKVETQLFMDMLMMVLYPGREREEKEWKKLFLDSGFS  259

Query  86   DYKIIPILGVRSLIEAYP  33
             YKI PILG+RSLIE YP
Sbjct  260  GYKITPILGLRSLIEVYP  277



>ref|XP_011100228.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=367

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + + K+IETQ+ FDML+M   +GR+RTEKDWA+LF  AGF  YKI P+LG+RSLIE +P
Sbjct  309  QKEHKAIETQLFFDMLIMNLASGRQRTEKDWAELFSAAGFTSYKITPVLGLRSLIELFP  367



>gb|KCW74501.1| hypothetical protein EUGRSUZ_E03213 [Eucalyptus grandis]
Length=360

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            D ++  T++ FDMLMM   TGRERTEK+W KLF EAGFR +KI P+ G+RSLIE +P
Sbjct  304  DAQANATKLFFDMLMMTVATGRERTEKEWGKLFLEAGFRQHKITPLFGLRSLIEVFP  360



>ref|XP_008245363.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=235

 Score = 82.4 bits (202),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = -2

Query  203  DEKSI-ETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            DE  I E ++ FD+LMM+ +TGRER+EKDW KLF EAGF +YK+ PI G+RSLIE YP
Sbjct  178  DEHEITEAKLFFDLLMMVVVTGRERSEKDWKKLFLEAGFSNYKLTPIFGLRSLIEVYP  235



>ref|XP_011016237.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/57 (63%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            DE SIETQ+LFD+ +M+  +G ER EK+WAKLFF+AGF +YKI  +LG R+LIE YP
Sbjct  303  DEGSIETQLLFDLEIMVAASGMERNEKEWAKLFFDAGFLNYKIHSVLGTRALIELYP  359



>ref|XP_006446726.1| hypothetical protein CICLE_v10015705mg [Citrus clementina]
 gb|ESR59966.1| hypothetical protein CICLE_v10015705mg [Citrus clementina]
Length=362

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 49/75 (65%), Positives = 56/75 (75%), Gaps = 1/75 (1%)
 Frame = -2

Query  257  KGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYK  78
            K GKVIIIDM+ +    NDE S ETQ+ FDMLMM+  TG ER EK+WAKLF +AGF DYK
Sbjct  289  KKGKVIIIDMMRENKKGNDE-STETQLFFDMLMMVLATGTERDEKEWAKLFADAGFSDYK  347

Query  77   IIPILGVRSLIEAYP  33
            I  ILG+RSLIE  P
Sbjct  348  ITSILGLRSLIEVCP  362



>emb|CDP21661.1| unnamed protein product [Coffea canephora]
Length=364

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 2/78 (3%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMR--NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGF  90
            KEKGGKVII+D    ++ +  +D ++IETQ+ +DM  M+ + GR+R EKDWAKLF EAGF
Sbjct  286  KEKGGKVIIVDTFCKSLQKGDDDHEAIETQLFYDMGAMVLVKGRQRNEKDWAKLFSEAGF  345

Query  89   RDYKIIPILGVRSLIEAY  36
             DYKI  +LG+RS+IE Y
Sbjct  346  CDYKITAVLGLRSIIEVY  363



>ref|XP_004163430.1| PREDICTED: LOW QUALITY PROTEIN: trans-resveratrol di-O-methyltransferase-like 
[Cucumis sativus]
Length=354

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -2

Query  200  EKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + S+ETQ+LFDMLMM  + G+ER EK+WAKL  EAGF  YKI PI+GVRSL+E YP
Sbjct  299  KDSMETQLLFDMLMMTLVGGKEREEKEWAKLIKEAGFGSYKIFPIMGVRSLVEIYP  354



>ref|XP_008649876.1| PREDICTED: O-methyltransferase ZRP4-like [Zea mays]
 gb|AFW78713.1| hypothetical protein ZEAMMB73_831416 [Zea mays]
Length=358

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/58 (62%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = -2

Query  206  NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            +DEK +ETQI+FD+ MM  + G ER E +W K+ FEAGF  YKIIP+LGVRS+IE YP
Sbjct  302  SDEKHVETQIVFDLFMMF-INGTERDETEWKKIIFEAGFSRYKIIPVLGVRSIIEVYP  358



>gb|KCW44789.1| hypothetical protein EUGRSUZ_L01645 [Eucalyptus grandis]
Length=349

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            ++D++ +ETQ+ +DMLMM   +GRER E +WAKLF  AGF DYKI  +LG+RSLIE YP
Sbjct  290  KSDKEMVETQLFYDMLMMTVASGRERNEAEWAKLFVAAGFGDYKITLVLGLRSLIEVYP  348



>ref|XP_003615968.1| O-methyltransferase [Medicago truncatula]
 gb|AES98926.1| flavonoid O-methyltransferase-like protein [Medicago truncatula]
Length=326

 Score = 82.8 bits (203),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 34/59 (58%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + + +S +TQ+ FDMLMM+  TG+ERT+K+W KL   AGF DYKI P+LG+RS+IE YP
Sbjct  268  KGNSESAKTQLFFDMLMMVLATGKERTKKEWVKLISSAGFNDYKITPVLGLRSVIEIYP  326



>gb|KGN43480.1| hypothetical protein Csa_7G039280 [Cucumis sativus]
Length=380

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -2

Query  200  EKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + S+ETQ+LFDMLMM  + G+ER EK+WAKL  EAGF  YKI PI+GVRSL+E YP
Sbjct  325  KDSMETQLLFDMLMMTLVGGKEREEKEWAKLIKEAGFGSYKIFPIMGVRSLVEIYP  380



>emb|CAN67020.1| hypothetical protein VITISV_040589 [Vitis vinifera]
Length=280

 Score = 82.4 bits (202),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + D K +ETQ+  DMLMM+ + G+ER EK+W KLF  AGF  YKI P LG+RSLIE YP
Sbjct  222  KGDNKEVETQLFMDMLMMVVVAGKERNEKEWEKLFLAAGFTHYKITPALGLRSLIEVYP  280



>ref|XP_002517833.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44351.1| o-methyltransferase, putative [Ricinus communis]
Length=372

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            D+   E Q+LFDM MM+ + G+ER EK+W KLFF+AGF +YKI P+LG R+LIE YP
Sbjct  316  DDSLTEAQLLFDMKMMVAVMGKERNEKEWTKLFFDAGFTNYKIYPVLGPRALIEVYP  372



>ref|XP_010057350.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
Length=408

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            D ++  T++ FDMLMM   TGRERTEK+W KLF EAGFR +KI P+ G+RSLIE +P
Sbjct  352  DAQANATKLFFDMLMMTVATGRERTEKEWGKLFLEAGFRQHKITPLFGLRSLIEVFP  408



>emb|CBI30627.3| unnamed protein product [Vitis vinifera]
Length=114

 Score = 80.1 bits (196),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 60/78 (77%), Gaps = 3/78 (4%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSI-ETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFR  87
            KEKGGKVI+ID+VI+   + +E  I E ++LFD+LMM  +TGRER EK+W KLF EAGF 
Sbjct  39   KEKGGKVIVIDIVINE--KKEEHDITEAKLLFDLLMMTVVTGRERNEKEWEKLFLEAGFS  96

Query  86   DYKIIPILGVRSLIEAYP  33
             YKI PI G+RSLIE +P
Sbjct  97   HYKINPIFGLRSLIEVFP  114



>ref|XP_009376908.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Pyrus 
x bretschneideri]
Length=382

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            D+KSIETQ++FDMLMM  +TG+ER+E +W K+F  AGF  Y I  +LG+RSLIE YP
Sbjct  326  DKKSIETQLMFDMLMMSTITGKERSESEWEKIFLAAGFSHYNITHMLGLRSLIEVYP  382



>ref|XP_008343875.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Malus 
domestica]
Length=382

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            D+KSIETQ++FDMLMM  +TG+ER+E +W K+F  AGF  Y I  +LG+RSLIE YP
Sbjct  326  DKKSIETQLMFDMLMMSTITGKERSESEWEKIFLAAGFSHYNITHMLGLRSLIEVYP  382



>ref|XP_004151906.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
sativus]
 gb|KGN63210.1| hypothetical protein Csa_2G415520 [Cucumis sativus]
Length=363

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + D +S ETQ+LFD+LMM+ L G+ER E +W  LF EAGF  YKII  LG+RSLIE YP
Sbjct  304  KEDIESTETQLLFDLLMMVNLNGKERNENEWKNLFMEAGFSGYKIISKLGLRSLIEVYP  362



>ref|XP_002454762.1| hypothetical protein SORBIDRAFT_04g036900 [Sorghum bicolor]
 gb|EES07738.1| hypothetical protein SORBIDRAFT_04g036900 [Sorghum bicolor]
Length=391

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = -2

Query  206  NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            +D + +ETQ+LFD+L+M  + G ER E++W K+F EAGF DYKIIP+LGVRS+IE YP
Sbjct  335  SDNRHVETQVLFDLLVM-TIDGAERDEQEWKKIFLEAGFEDYKIIPVLGVRSIIELYP  391



>gb|AAR09603.1| O-methyltransferase [Mentha x piperita]
Length=361

 Score = 82.8 bits (203),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            +   K  ETQ+LFD+LMM  LTG+ERTEK+WA LFF AGF+ YKI P+L +RS+IE +P
Sbjct  303  KQHHKGTETQLLFDVLMMTALTGKERTEKEWANLFFAAGFKTYKIHPVLRLRSVIEIFP  361



>ref|XP_007142043.1| hypothetical protein PHAVU_008G247600g [Phaseolus vulgaris]
 gb|ESW14037.1| hypothetical protein PHAVU_008G247600g [Phaseolus vulgaris]
Length=357

 Score = 82.8 bits (203),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            D++S ETQ+ FD+LMM+ LTG+ER +K+W KLF  AGF +YKI P +G RSLIE YP
Sbjct  301  DDESFETQLFFDILMMVLLTGKERNKKEWVKLFSSAGFNNYKITPFVGSRSLIEIYP  357



>gb|KDO36159.1| hypothetical protein CISIN_1g040309mg, partial [Citrus sinensis]
Length=100

 Score = 79.3 bits (194),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            D++S+ETQ+ FD+LM+    G+ER+  DW KLF  AGF  YKI PILGVRSLIEAYP
Sbjct  44   DKESMETQLCFDILMVSLFRGKERSVDDWKKLFLAAGFSHYKITPILGVRSLIEAYP  100



>ref|XP_002278092.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=361

 Score = 82.8 bits (203),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 48/78 (62%), Positives = 60/78 (77%), Gaps = 3/78 (4%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSI-ETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFR  87
            KEKGGKVI+ID+VI+   + +E  I E ++LFD+LMM  +TGRER EK+W KLF EAGF 
Sbjct  286  KEKGGKVIVIDIVINE--KKEEHDITEAKLLFDLLMMTVVTGRERNEKEWEKLFLEAGFS  343

Query  86   DYKIIPILGVRSLIEAYP  33
             YKI PI G+RSLIE +P
Sbjct  344  HYKINPIFGLRSLIEVFP  361



>gb|AAB71213.1| methyltransferase [Prunus armeniaca]
Length=354

 Score = 82.8 bits (203),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            D++S ETQ+ FDM MM+  TG+ER EK+WAKLF +AGF  YKI P+ G +SLIE YP
Sbjct  298  DKESGETQLFFDMHMMVMSTGKERNEKEWAKLFSDAGFSQYKITPLFGFKSLIEVYP  354



>ref|XP_002517827.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44345.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -2

Query  260  EKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDY  81
            +KGGK+IIIDMV +     D++ +ETQ+ +DMLMM   TG+ER  K+W KLF +AGF +Y
Sbjct  281  KKGGKLIIIDMVSENQQVIDDQYVETQLFYDMLMMALQTGKERNNKEWGKLFLDAGFSNY  340

Query  80   KIIPILGVRSLIEAY  36
            KI PILG+RS+IE Y
Sbjct  341  KITPILGLRSVIEVY  355



>emb|CDP19840.1| unnamed protein product [Coffea canephora]
Length=363

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 57/78 (73%), Gaps = 2/78 (3%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMR--NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGF  90
            KEKGGKVII+D    +  +  +D ++IETQ+ +DM  M+ + GR+R E DWAKLF EAGF
Sbjct  286  KEKGGKVIIVDTFCKSQQKGDDDHEAIETQLFYDMGAMVLVKGRQRNETDWAKLFSEAGF  345

Query  89   RDYKIIPILGVRSLIEAY  36
             DYKI  +LG+RS+IE Y
Sbjct  346  SDYKITAVLGLRSIIEVY  363



>ref|XP_004151089.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like, partial 
[Cucumis sativus]
Length=263

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -2

Query  200  EKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + S+ETQ+LFDMLMM  + G+ER EK+WAKL  EAGF  YKI PI+GVRSL+E YP
Sbjct  208  KDSMETQLLFDMLMMTLVGGKEREEKEWAKLIKEAGFGSYKIFPIMGVRSLVEIYP  263



>ref|XP_002522501.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF39801.1| o-methyltransferase, putative [Ricinus communis]
Length=359

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 47/62 (76%), Gaps = 4/62 (6%)
 Frame = -2

Query  206  NDEKS----IETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEA  39
            ND+K      ET++LFDMLMM   TG+ERTEK+W +LF +AGF  +KI PILG+RSLIE 
Sbjct  298  NDKKDEYEFTETKLLFDMLMMFVATGKERTEKEWGELFLKAGFSHFKITPILGLRSLIEV  357

Query  38   YP  33
            YP
Sbjct  358  YP  359



>ref|XP_008455485.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
melo]
Length=384

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -2

Query  206  NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            N + S+ETQ+LFDMLMM    G+ER E+ WA+L  EAGFR YKI PI+GVRSLIE YP
Sbjct  327  NKKDSMETQLLFDMLMMTLAGGKEREEEKWAELIKEAGFRSYKIFPIMGVRSLIEIYP  384



>gb|KDP24061.1| hypothetical protein JCGZ_25718 [Jatropha curcas]
Length=367

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 31/59 (53%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + D+ + ET++  DMLM++   G+ER +K+WAKLFF+AGF D+KI P+LG+RS++E YP
Sbjct  309  KEDKDATETELFLDMLMIVLYNGKERNKKEWAKLFFDAGFSDFKITPVLGLRSVVEVYP  367



>ref|XP_011100233.1| PREDICTED: 8-hydroxyquercetin 8-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 48/77 (62%), Positives = 59/77 (77%), Gaps = 2/77 (3%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            K+KGGKVII+DMV+D   + + K+IETQ+ FDMLM+   +G ERTEKDWAKLF  AGF  
Sbjct  285  KDKGGKVIIVDMVVDF--KKEHKAIETQLFFDMLMINLTSGIERTEKDWAKLFSAAGFTS  342

Query  83   YKIIPILGVRSLIEAYP  33
            YKI P  G+RSLIE +P
Sbjct  343  YKITPAFGLRSLIELFP  359



>ref|XP_003615973.1| O-methyltransferase [Medicago truncatula]
 gb|AES98931.1| orcinol O-methyltransferase [Medicago truncatula]
Length=363

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -2

Query  206  NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAY  36
            ++ +S+ET++ FDMLMM+ LTG+ERT+K+W KL   AGF DYKI PILG+R++IE Y
Sbjct  303  DNNESVETKLFFDMLMMVTLTGKERTKKEWVKLISSAGFCDYKITPILGLRAVIEIY  359



>gb|KCW74011.1| hypothetical protein EUGRSUZ_E02635 [Eucalyptus grandis]
Length=100

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            D +   T++ FDMLM+  +TGRERTEK+W KLF EAGFR +KI P+ G+RSLIE +P
Sbjct  44   DAQENATKLFFDMLMITVVTGRERTEKEWGKLFLEAGFRKHKITPLFGLRSLIEVFP  100



>ref|XP_011037442.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=355

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            DE SIETQ+ FD+ +M+  +G ER EK+WAKLFF+AGF +YKI  +LG R+LIE YP
Sbjct  299  DEGSIETQLFFDLQLMVAASGIERNEKEWAKLFFDAGFLNYKIHSVLGTRALIELYP  355



>ref|XP_011037437.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            DE SIETQ+LFD+ +M+  +G ER E++WAKLFF+AGF +YKI  +LG R+LIE YP
Sbjct  303  DEGSIETQLLFDLEIMVAASGMERNEEEWAKLFFDAGFLNYKIHSVLGTRALIELYP  359



>ref|XP_008364163.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Malus 
domestica]
Length=358

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/57 (63%), Positives = 45/57 (79%), Gaps = 1/57 (2%)
 Frame = -2

Query  203  DEKSI-ETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAY  36
            DE  I E ++LFD+LMM+ +TGRER+EKDW KLF EAGF  YK+ PI G+RSLIE +
Sbjct  301  DEHEITEAKLLFDLLMMVVITGRERSEKDWKKLFLEAGFSSYKVTPIFGLRSLIEVF  357



>gb|KHN19130.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=246

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + D++S+ETQ+ FDM MM+ +TG+ER++K+W KL   AG+ +YKI P+LG+RSLIE YP
Sbjct  188  KRDDESVETQLFFDMQMMVLVTGKERSKKEWTKLISSAGYNNYKITPVLGLRSLIEIYP  246



>ref|XP_002538902.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF23481.1| o-methyltransferase, putative [Ricinus communis]
Length=228

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -2

Query  260  EKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDY  81
            +KGGK+IIIDMV +     D++ +ETQ+ FDMLMM   TG+ER  K+W KLF +AGF +Y
Sbjct  153  KKGGKLIIIDMVSENQQVIDDQYVETQLFFDMLMMALQTGKERNNKEWGKLFLDAGFSNY  212

Query  80   KIIPILGVRSLIEAY  36
            KI PILG+RS+IE Y
Sbjct  213  KITPILGLRSVIEVY  227



>ref|XP_002262833.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=358

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 43/77 (56%), Positives = 59/77 (77%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            K+KGGK++IIDMV++   + D++++ETQ+ +DMLMM  LTG++R E +W KLF  AGF  
Sbjct  283  KDKGGKLMIIDMVMENN-KGDDQAVETQLFWDMLMMTVLTGKQRNENEWKKLFVTAGFTH  341

Query  83   YKIIPILGVRSLIEAYP  33
            YKI  +LG RSLIE YP
Sbjct  342  YKISAVLGFRSLIEVYP  358



>gb|KDP24057.1| hypothetical protein JCGZ_25714 [Jatropha curcas]
Length=307

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 44/75 (59%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = -2

Query  257  KGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYK  78
            KGGK+II+DMV+ T  +N++ SIETQ+ FDM+MM+   G+ER +++WAKLF +AGF DYK
Sbjct  234  KGGKLIIVDMVMGTQKQNND-SIETQLFFDMMMMVLFNGKERNKEEWAKLFSDAGFSDYK  292

Query  77   IIPILGVRSLIEAYP  33
            I   LG+RS+IE YP
Sbjct  293  ITHKLGLRSVIEVYP  307



>ref|XP_004293905.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=355

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -2

Query  206  NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            ++ +S E ++ FDMLMM+ +TGRER EK+W KL  EAGF  Y+I PI G+RSLIE YP
Sbjct  298  DEHESTEAKLFFDMLMMVVVTGRERREKEWEKLILEAGFSKYQITPIFGLRSLIEVYP  355



>ref|XP_008455944.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X2 [Cucumis melo]
Length=362

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 44/77 (57%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            +EKGGK+IIID+V++   + +++S ETQ+LFD+LMM+ L G+ER E +W  LF EAGF  
Sbjct  286  REKGGKLIIIDIVMEDK-KEEKESTETQLLFDVLMMVNLGGKERNENEWKNLFMEAGFSG  344

Query  83   YKIIPILGVRSLIEAYP  33
            YKII  LG+RS+IE YP
Sbjct  345  YKIISKLGLRSVIEVYP  361



>emb|CBI38115.3| unnamed protein product [Vitis vinifera]
Length=270

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 43/77 (56%), Positives = 59/77 (77%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            K+KGGK++IIDMV++   + D++++ETQ+ +DMLMM  LTG++R E +W KLF  AGF  
Sbjct  195  KDKGGKLMIIDMVMENN-KGDDQAVETQLFWDMLMMTVLTGKQRNENEWKKLFVTAGFTH  253

Query  83   YKIIPILGVRSLIEAYP  33
            YKI  +LG RSLIE YP
Sbjct  254  YKISAVLGFRSLIEVYP  270



>ref|XP_006469137.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=362

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + D++S ETQ+ F MLMM+  TG ER EK+WAKL  + GF DYKI  ILG+RSLIE YP
Sbjct  304  KGDDESTETQLFFYMLMMVLATGTERDEKEWAKLLADVGFSDYKITSILGLRSLIEVYP  362



>gb|AIY62760.1| N-acetylserotonin O-methyltransferase [Malus zumi]
Length=358

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 36/57 (63%), Positives = 45/57 (79%), Gaps = 1/57 (2%)
 Frame = -2

Query  203  DEKSI-ETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAY  36
            DE  I E ++LFD+LMM+ +TGRER+EKDW KLF EAGF  YK+ PI G+RSLIE +
Sbjct  301  DEHEITEAKLLFDLLMMVVVTGRERSEKDWKKLFLEAGFSGYKVTPIFGLRSLIEVF  357



>ref|XP_008649874.1| PREDICTED: O-methyltransferase ZRP4-like [Zea mays]
 gb|AFW78712.1| hypothetical protein ZEAMMB73_957932 [Zea mays]
Length=356

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = -2

Query  206  NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            +DEK +E QI+FD+ MM  + G ER E +W K+ FEAGF  YKIIP+LGVRS+IE YP
Sbjct  300  SDEKHVEMQIVFDLFMMF-INGTERDETEWKKIIFEAGFSRYKIIPVLGVRSIIEVYP  356



>ref|XP_011037436.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=227

 Score = 80.1 bits (196),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
              DE+SIETQ++FD+ MM+ ++G ER EK+WAKLFF++GF +YKI  + G R++IE YP
Sbjct  169  NGDERSIETQLVFDLAMMVAVSGMERNEKEWAKLFFDSGFLNYKIHTVPGTRAVIELYP  227



>ref|XP_011091579.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=358

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            R++ +S+ETQ+ FDM+MM  L G+ER EK+WA LF  AGF+ Y+I PILG+RS+IE YP
Sbjct  300  RSNTESVETQLQFDMIMMTLLGGKERKEKEWANLFSGAGFQGYRIYPILGLRSIIEIYP  358



>gb|ACY41220.1| O-methyltransferase-like protein [Saccharum hybrid cultivar CP72-1210]
Length=361

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 46/77 (60%), Positives = 58/77 (75%), Gaps = 1/77 (1%)
 Frame = -2

Query  260  EKGGKviiidmvidtvMRNDEKSIETQILFDMLMM-IQLTGRERTEKDWAKLFFEAGFRD  84
            + GGKVII+DMV+ T   +DEK +ETQ+LFD+L+M I   G ER E +W K+ FEAGF  
Sbjct  285  QGGGKVIILDMVVGTGSSSDEKHVETQMLFDLLVMSIYTKGAERDELEWKKIIFEAGFSH  344

Query  83   YKIIPILGVRSLIEAYP  33
            YKIIP+LG RS+IE YP
Sbjct  345  YKIIPVLGARSIIEVYP  361



>ref|XP_007132750.1| hypothetical protein PHAVU_011G122000g [Phaseolus vulgaris]
 gb|ESW04744.1| hypothetical protein PHAVU_011G122000g [Phaseolus vulgaris]
Length=297

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 33/59 (56%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + D +S +T++ +DM MM+ +TG++R EKDWAKLFF AGF  YKI  +LG +SLIE YP
Sbjct  239  KGDSESEQTKLYYDMEMMVLVTGKQRNEKDWAKLFFSAGFNHYKITQVLGFKSLIEVYP  297



>ref|XP_008245137.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=354

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            D++S ETQ+ FDM MM+  TG+ER EK+WA LF +AGF  YKI P LG+RSLIE YP
Sbjct  298  DKESGETQLFFDMEMMVLATGKERNEKEWAMLFSDAGFSHYKITPGLGLRSLIEVYP  354



>gb|AFK40900.1| unknown [Lotus japonicus]
Length=357

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/59 (58%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + D+KS+ETQ+LFDM MM+  TG+ER+ K+W  L   AGF DYKI P+LG+RS++E YP
Sbjct  299  KGDDKSVETQLLFDMGMMVLTTGKERSMKEWGILISSAGFSDYKISPVLGLRSVVEIYP  357



>ref|XP_007132751.1| hypothetical protein PHAVU_011G1221001g, partial [Phaseolus vulgaris]
 gb|ESW04745.1| hypothetical protein PHAVU_011G1221001g, partial [Phaseolus vulgaris]
Length=214

 Score = 79.3 bits (194),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            D +S ET++L DM++M+   G+ERTEK+WAK+ F AGF DYKI P++G+RSLIE YP
Sbjct  158  DFESTETKLLVDMVVMVLYPGKERTEKEWAKIIFSAGFSDYKITPVVGLRSLIEIYP  214



>ref|XP_006469138.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=551

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 47/77 (61%), Positives = 59/77 (77%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            K++GGKVIIIDM I+   + D++S+ETQ+ FD+LM+    G+ER+  DW KLF  AGF  
Sbjct  476  KDEGGKVIIIDMAIENQSQ-DKESMETQLCFDILMVSLFRGKERSVDDWKKLFLAAGFSH  534

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILGVRSLIEAYP
Sbjct  535  YKITPILGVRSLIEAYP  551



>ref|XP_006469069.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=353

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 46/77 (60%), Positives = 59/77 (77%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            K++GGKVIIIDM I+   + D++S+ETQ+ FD+LM+    G+ER+  DW KLF  AGF  
Sbjct  278  KDEGGKVIIIDMAIENQSQ-DKESMETQLCFDILMVSLFRGKERSVDDWKKLFLAAGFSH  336

Query  83   YKIIPILGVRSLIEAYP  33
            YKI P+LGVRSLIEAYP
Sbjct  337  YKITPMLGVRSLIEAYP  353



>ref|XP_004232928.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=357

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 48/61 (79%), Gaps = 2/61 (3%)
 Frame = -2

Query  209  RNDEKS--IETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAY  36
            R+ E++   E +++FD+LMM+ +TGR+RTEK+W KLF EAGF  YKI P+ G+RSLIE +
Sbjct  297  RDKEEANMTEVKLIFDVLMMVLVTGRQRTEKEWEKLFLEAGFMSYKITPLFGLRSLIEVF  356

Query  35   P  33
            P
Sbjct  357  P  357



>ref|XP_009345025.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Pyrus 
x bretschneideri]
Length=358

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 45/57 (79%), Gaps = 1/57 (2%)
 Frame = -2

Query  203  DEKSI-ETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAY  36
            DE  I E ++LFD+LMM+ +TGRER+EKDW KLF EAGF  YK+ PI G+RSL+E +
Sbjct  301  DEHEITEAKLLFDLLMMVVVTGRERSEKDWKKLFLEAGFSSYKVTPIFGLRSLLEVF  357



>ref|XP_006448856.1| hypothetical protein CICLE_v10015723mg [Citrus clementina]
 gb|ESR62096.1| hypothetical protein CICLE_v10015723mg [Citrus clementina]
Length=359

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + D +  E ++L+DMLMM+ + G ERTEK+W KLFF+AGF  +KI P+ G++SLIE YP
Sbjct  301  KEDAQLTEAKLLYDMLMMVAVRGSERTEKEWEKLFFDAGFSHFKITPVYGIKSLIEVYP  359



>ref|XP_008364164.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Malus 
domestica]
Length=358

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 1/57 (2%)
 Frame = -2

Query  203  DEKSI-ETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAY  36
            DE  I E ++LFD+LMM+  TGRER+EKDW KLF EAGF  YK+ PI G+RSLIE +
Sbjct  301  DEHEITEAKLLFDLLMMVVXTGRERSEKDWKKLFLEAGFSGYKVTPIFGLRSLIEVF  357



>ref|XP_008455943.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X1 [Cucumis melo]
Length=397

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 44/77 (57%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            +EKGGK+IIID+V++   + +++S ETQ+LFD+LMM+ L G+ER E +W  LF EAGF  
Sbjct  321  REKGGKLIIIDIVMEDK-KEEKESTETQLLFDVLMMVNLGGKERNENEWKNLFMEAGFSG  379

Query  83   YKIIPILGVRSLIEAYP  33
            YKII  LG+RS+IE YP
Sbjct  380  YKIISKLGLRSVIEVYP  396



>ref|NP_001130621.1| hypothetical protein [Zea mays]
 gb|ACF78916.1| unknown [Zea mays]
 gb|AFW64033.1| hypothetical protein ZEAMMB73_445874 [Zea mays]
Length=417

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  206  NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            +D + +ETQILFD+LMM  + G ER E++W K+F EAGF+DY+I+P+LGVRS+IE YP
Sbjct  360  SDLRHVETQILFDLLMMC-VNGVERDEQEWKKIFSEAGFQDYRIMPLLGVRSIIELYP  416



>ref|XP_002517835.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44353.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score = 80.1 bits (196),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            D+   E Q+LFDM MM+   G+ER E++W KLFF+AGF +YKI P+LG R+LIE YP
Sbjct  300  DDSLTELQLLFDMEMMVAAMGKERNEEEWKKLFFDAGFSNYKIYPVLGPRALIEVYP  356



>ref|XP_011085639.1| PREDICTED: chavicol O-methyltransferase-like [Sesamum indicum]
Length=361

 Score = 80.1 bits (196),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            D+K++ET + FD+ MM  + G+ERTEK+WAKLFF++GF  YKI    G+RSLIE YP
Sbjct  305  DDKAVETHLFFDIAMMSYINGKERTEKEWAKLFFDSGFTSYKITNAFGLRSLIEVYP  361



>ref|XP_011027757.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score = 80.1 bits (196),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = -2

Query  209  RNDEKSI-ETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + DEK + ET++LFDMLMM+   G+ER+ K+W KLF EAGF  Y I P+ G+RSLIE YP
Sbjct  300  KKDEKELTETKLLFDMLMMVVAAGKERSVKEWEKLFLEAGFSHYMITPLFGLRSLIEVYP  359



>ref|XP_002438878.1| hypothetical protein SORBIDRAFT_10g027650 [Sorghum bicolor]
 gb|EER90245.1| hypothetical protein SORBIDRAFT_10g027650 [Sorghum bicolor]
Length=382

 Score = 80.5 bits (197),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = -2

Query  206  NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            +D K IETQIL D LMM+ + G ER E++W K+ FEAGF+DYKIIP+LGVRS+IE YP
Sbjct  326  SDIKHIETQILKD-LMMMNINGVERDEQEWKKISFEAGFKDYKIIPLLGVRSIIELYP  382



>ref|XP_007142076.1| hypothetical protein PHAVU_008G250600g [Phaseolus vulgaris]
 gb|ESW14070.1| hypothetical protein PHAVU_008G250600g [Phaseolus vulgaris]
Length=357

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            D++S ETQ+ FD++MM+   G+ER +K+W KL   AGF +YKI P++G+RSLIE YP
Sbjct  301  DDESFETQLFFDLMMMVLFNGKERNKKEWVKLISSAGFNNYKITPVMGIRSLIEIYP  357



>ref|XP_006356529.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=357

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 44/77 (57%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            KEKGGKVIIID+V++    N+E+ +++Q L D+LM I    +ER++K+W KLF EAGF  
Sbjct  281  KEKGGKVIIIDIVMEDNCSNNEQLVQSQHLMDVLMRISYASKERSKKEWEKLFLEAGFSG  340

Query  83   YKIIPILGVRSLIEAYP  33
            YKII  LG+RSLIE YP
Sbjct  341  YKIITSLGLRSLIEVYP  357



>ref|XP_006364318.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=357

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 47/61 (77%), Gaps = 2/61 (3%)
 Frame = -2

Query  209  RNDEKS--IETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAY  36
            R++E +   E +++FD+LMM+ +TGRERTEK+W  LF EAGF  YKI P+ G+RSLIE +
Sbjct  297  RDEEAANMTEVKLIFDVLMMVLVTGRERTEKEWENLFLEAGFMSYKITPLFGLRSLIEVF  356

Query  35   P  33
            P
Sbjct  357  P  357



>ref|XP_007132709.1| hypothetical protein PHAVU_011G118100g [Phaseolus vulgaris]
 gb|ESW04703.1| hypothetical protein PHAVU_011G118100g [Phaseolus vulgaris]
Length=352

 Score = 79.7 bits (195),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            D +S ET++L DM++M+   G+ERTEK+WAK+ F AGF DYKI P++G+RS IE YP
Sbjct  296  DFESTETKLLVDMVVMVLYPGKERTEKEWAKIIFSAGFSDYKITPVVGLRSFIEIYP  352



>ref|XP_006376393.1| hypothetical protein POPTR_0013s12640g [Populus trichocarpa]
 gb|ERP54190.1| hypothetical protein POPTR_0013s12640g [Populus trichocarpa]
Length=108

 Score = 76.6 bits (187),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            DE SIETQ+LFD  MM+  +G ER EK+WAKLFF++G  +YKI P+ G R++IE YP
Sbjct  52   DEGSIETQLLFDREMMVAFSGLERNEKEWAKLFFDSGCLNYKIHPVPGTRAVIELYP  108



>ref|XP_010260367.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nelumbo 
nucifera]
Length=366

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -2

Query  188  ETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            ETQ+LFDMLMM  +TGRER++++  KL  EAGF  YKIIPILG+RSLIE YP
Sbjct  315  ETQLLFDMLMMGLVTGRERSKQELEKLLLEAGFTHYKIIPILGLRSLIEVYP  366



>ref|XP_004170025.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
sativus]
Length=153

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + D  S +TQ+L+DMLMM  + G+ER EK+WA+LF +AGF  YKI PILG+RSLI+ YP
Sbjct  95   KADYISTQTQLLWDMLMMASVGGKERDEKEWAQLFHKAGFGSYKIFPILGLRSLIKLYP  153



>ref|XP_010023967.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW60370.1| hypothetical protein EUGRSUZ_H03085 [Eucalyptus grandis]
Length=362

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            D +S ETQ+ FDMLMM+    +ER EK+WAKLF +AGF  Y+I+  LG+RSLIE YP
Sbjct  306  DHESTETQLFFDMLMMVTFNAKERDEKEWAKLFADAGFSGYEIVSHLGLRSLIEIYP  362



>gb|KDP24060.1| hypothetical protein JCGZ_25717 [Jatropha curcas]
Length=358

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            D    E Q+LFDM MM+ L G+ERTEK+WAKLFF+AGF  YKI  +LG R++IE YP
Sbjct  302  DNDWTEAQVLFDMEMMVCLVGKERTEKEWAKLFFDAGFTKYKIDYVLGPRAVIEVYP  358



>emb|CAJ65648.1| putative orcinol O-methyltransferase [Rosa woodsii var. ultramontana]
Length=346

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPIL  63
            + DE+SIETQ+ FDMLMM  +TGRER EK+WAKLF +AGF DYKI PIL
Sbjct  298  KGDEESIETQLFFDMLMMALVTGRERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_002438877.1| hypothetical protein SORBIDRAFT_10g027640 [Sorghum bicolor]
 gb|EER90244.1| hypothetical protein SORBIDRAFT_10g027640 [Sorghum bicolor]
Length=383

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 37/58 (64%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = -2

Query  206  NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            +D K IETQIL D LMM+ + G ER E++W K+ F+AGF+DYKIIP+LGVRS+IE YP
Sbjct  327  SDIKHIETQILKD-LMMMNINGLERDEQEWKKISFKAGFKDYKIIPLLGVRSIIELYP  383



>ref|XP_003615962.1| O-methyltransferase [Medicago truncatula]
 gb|AES98920.1| orcinol O-methyltransferase [Medicago truncatula]
Length=341

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/77 (56%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            K K GKV+I D V D+   N  +S+ETQ+ FDM MM+   G+ER EK+W KL   AGF D
Sbjct  265  KGKEGKVVIFDKVFDSEKGNINESVETQLFFDMFMMVVFAGKERNEKEWIKLISSAGFSD  324

Query  83   YKIIPILGVRSLIEAYP  33
            YKI PILG  S+IE YP
Sbjct  325  YKITPILGSTSMIEIYP  341



>emb|CAJ65621.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPIL  63
            + DE+SIETQ+ FDMLMM  LTG+ER EK+WAKLF +AGF DYKI PIL
Sbjct  298  KGDEESIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>gb|KDO37374.1| hypothetical protein CISIN_1g023625mg [Citrus sinensis]
Length=279

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 46/77 (60%), Positives = 59/77 (77%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            K++GGKVIIIDM I+   + D++S+ETQ+ FD+LM+    G+ER+  DW KLF  AGF  
Sbjct  204  KDEGGKVIIIDMAIENQSQ-DKESMETQLCFDILMVSLFRGKERSVDDWKKLFLAAGFSH  262

Query  83   YKIIPILGVRSLIEAYP  33
            YKI P+LGVRSLIEAYP
Sbjct  263  YKITPMLGVRSLIEAYP  279



>emb|CAJ65622.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPIL  63
            + DE+SIETQ+ FDMLMM  LTG+ER EK+WAKLF +AGF DYKI PIL
Sbjct  298  KGDEESIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>gb|KDP24062.1| hypothetical protein JCGZ_25719 [Jatropha curcas]
Length=358

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -2

Query  200  EKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            +K+ ET  L+D+ M++ ++G+ER EKDWAKLFF+AGF +YKI P+LG+RS+IE +P
Sbjct  303  DKATETIQLYDLEMLVLVSGQERNEKDWAKLFFDAGFSNYKINPVLGLRSIIEVFP  358



>ref|XP_002437452.1| hypothetical protein SORBIDRAFT_10g027340 [Sorghum bicolor]
 gb|EER88819.1| hypothetical protein SORBIDRAFT_10g027340 [Sorghum bicolor]
Length=374

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/58 (62%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = -2

Query  206  NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            +D K +ETQ+L D++MM  L G ER E++W K+FFEAGF+DYKII +LGVRS+IE YP
Sbjct  318  SDIKHLETQVLHDIIMM-NLNGIERDEQEWKKIFFEAGFKDYKIIQLLGVRSIIELYP  374



>ref|XP_008359464.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X2 [Malus domestica]
Length=370

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            D+KSIETQ++FDMLMM  +TG+ER+E +W K+F  AGF  Y I    G RSLIE YP
Sbjct  314  DKKSIETQLMFDMLMMSTVTGKERSESEWKKIFLAAGFTHYNITHTFGFRSLIELYP  370



>ref|XP_004490686.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=358

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            +   +S++TQ+ FDMLMM+ +TG+ERT+K+W  L   +GF +YKI PILG+RS+IE YP
Sbjct  300  KGKNESLQTQLFFDMLMMVLVTGKERTKKEWVNLISSSGFSNYKITPILGLRSVIEIYP  358



>emb|CAJ65639.1| putative orcinol O-methyltransferase [Rosa hugonis]
Length=346

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPIL  63
            DE+SIETQ+ FDMLMM  LTG+ER EK+WAKLF +AGF DYKI PIL
Sbjct  300  DEESIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65638.1| putative orcinol O-methyltransferase [Rosa hugonis]
Length=346

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPIL  63
            DE+SIETQ+ FDMLMM  LTG+ER EK+WAKLF +AGF DYKI PIL
Sbjct  300  DEESIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_008359463.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X1 [Malus domestica]
Length=384

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -2

Query  203  DEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            D+KSIETQ++FDMLMM  +TG+ER+E +W K+F  AGF  Y I    G RSLIE YP
Sbjct  328  DKKSIETQLMFDMLMMSTVTGKERSESEWKKIFLAAGFTHYNITHTFGFRSLIELYP  384



>emb|CDP15884.1| unnamed protein product [Coffea canephora]
Length=282

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 44/77 (57%), Positives = 62/77 (81%), Gaps = 1/77 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            +EKGGKVIIIDM++++ M++DE S+ETQ+  +M M++    +ER+EK+WAKLF +AGF D
Sbjct  207  REKGGKVIIIDMILESQMKDDE-SVETQVGVNMQMLMGYGAKERSEKEWAKLFQDAGFSD  265

Query  83   YKIIPILGVRSLIEAYP  33
            YK +P+LGV  LIE YP
Sbjct  266  YKALPLLGVCCLIEVYP  282



>gb|EMT31218.1| O-methyltransferase ZRP4 [Aegilops tauschii]
Length=362

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = -2

Query  197  KSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            K  ETQ+LFD+ MM++  G ER E++W+K+FFEAGF DYKI+P+LG RSLI+ +P
Sbjct  309  KETETQVLFDLYMMME-NGAERDEQEWSKIFFEAGFSDYKIMPVLGARSLIQVFP  362



>ref|XP_010920172.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Elaeis 
guineensis]
Length=362

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  188  ETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAY  36
            ETQ+LFD+ MM+Q TG+ER E +W K+F +AGF DYKIIP LG+RS+IE Y
Sbjct  311  ETQLLFDLEMMVQTTGKERNECEWKKIFMDAGFTDYKIIPALGLRSIIEVY  361



>ref|XP_004232927.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=360

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 49/61 (80%), Gaps = 2/61 (3%)
 Frame = -2

Query  209  RNDEKS--IETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAY  36
            R++E++   E +++FD+LMM+  TGR+RTEK+W KLF EAGF  YKI P+LG+RSLI+ +
Sbjct  300  RDEEEANMTEVKLIFDVLMMVVTTGRQRTEKEWEKLFTEAGFMSYKITPLLGLRSLIQVF  359

Query  35   P  33
            P
Sbjct  360  P  360



>ref|XP_003527405.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
1 [Glycine max]
 gb|KHN07776.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=359

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + D +  +T++ +D+ MM+ +TG+ER EKDWAKLF  AGF  YKI P+LG +SLIE YP
Sbjct  301  KGDSELDQTKLFYDIEMMVLVTGKERNEKDWAKLFLSAGFNSYKITPVLGFKSLIEVYP  359



>emb|CAH05089.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            K+K GKVII+DM+++   R DE+SIETQ+ FDMLMM  +TG+ER EK+WAKLF +AGF D
Sbjct  281  KDKKGKVIILDMMMENQKR-DEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSD  339

Query  83   YKIIPIL  63
            YKI PIL
Sbjct  340  YKITPIL  346



>ref|XP_009344934.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Pyrus 
x bretschneideri]
Length=354

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 44/57 (77%), Gaps = 1/57 (2%)
 Frame = -2

Query  203  DEKSI-ETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAY  36
            DE  I E ++LFD+LMM+ +TGRER+EKDW KLF EAGF  YK+ PI G+R LIE +
Sbjct  297  DEHEITEAKLLFDLLMMVVVTGRERSEKDWKKLFLEAGFSSYKVTPIFGLRFLIEVF  353



>gb|KCW74013.1| hypothetical protein EUGRSUZ_E026382, partial [Eucalyptus grandis]
Length=102

 Score = 75.5 bits (184),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -2

Query  206  NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            +D ++  T++ FDMLMM  +TGRERTEK+W  LF +AGF  +KI P+ G+RSLIE +P
Sbjct  45   DDAEATSTKLFFDMLMMTVVTGRERTEKEWEHLFSKAGFSQHKITPMFGLRSLIEVFP  102



>gb|AEQ94124.1| putative O-methyltransferase [Elaeis guineensis]
Length=186

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  188  ETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAY  36
            ETQ+LFD+ MM+Q TG+ER E +W K+F +AGF DYKIIP LG+RS+IE Y
Sbjct  135  ETQLLFDLEMMVQTTGKERNECEWKKIFMDAGFTDYKIIPALGLRSIIEVY  185



>ref|NP_001140810.1| uncharacterized protein LOC100272885 [Zea mays]
 gb|ACF84681.1| unknown [Zea mays]
 gb|AFW78711.1| hypothetical protein ZEAMMB73_088089 [Zea mays]
Length=368

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = -2

Query  206  NDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            +D K +ETQ+LFD+ +M  + G ER E++W K+ FEAGF  Y IIP+LGVRS+IE YP
Sbjct  312  SDRKHVETQVLFDLFIM-AINGAERDEEEWKKIIFEAGFSSYNIIPVLGVRSIIEVYP  368



>ref|XP_002441379.1| hypothetical protein SORBIDRAFT_09g025550 [Sorghum bicolor]
 gb|EES19809.1| hypothetical protein SORBIDRAFT_09g025550 [Sorghum bicolor]
Length=236

 Score = 77.8 bits (190),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
             +DEK +E QILFD+ MM  + G ER E +W K+ FEAGF  YKIIP+LGVRS+IE YP
Sbjct  179  SSDEKYVEMQILFDLFMMF-INGAERDELEWKKIIFEAGFSSYKIIPVLGVRSIIEIYP  236



>emb|CAJ65637.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=341

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = -2

Query  263  KEKGGKviiidmvidtvMRNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRD  84
            K+K GKVII+DM+++   R DE+SIETQ+ FDMLMM  +TG+ER EK+WAKLF +AGF D
Sbjct  276  KDKKGKVIILDMMMENQKR-DEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSD  334

Query  83   YKIIPIL  63
            YKI PIL
Sbjct  335  YKITPIL  341



>emb|CAJ65608.1| putative orcinol O-methyltransferase [Rosa bracteata]
Length=346

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPIL  63
            + DE+SIETQ+ FDMLMM  +TG+ER EK+WAKLF +AGF DYKI PIL
Sbjct  298  KGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65602.1| putative orcinol O-methyltransferase [Rosa banksiae]
Length=346

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPIL  63
            + DE+SIETQ+ FDMLMM  +TG+ER EK+WAKLF +AGF DYKI PIL
Sbjct  298  KGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_004490687.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=354

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 31/59 (53%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = -2

Query  209  RNDEKSIETQILFDMLMMIQLTGRERTEKDWAKLFFEAGFRDYKIIPILGVRSLIEAYP  33
            + + +++ TQ+ FDMLMM+  TG+ERT+K+W  L   +GF DYKI P+LG+RS+IE YP
Sbjct  296  KGNNETLGTQLFFDMLMMVLATGKERTKKEWVNLISSSGFSDYKITPVLGLRSVIEIYP  354



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 521539397520