BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25744_g2_i2 len=343 path=[5149:0-24 5174:25-49 7023:50-73
9992:74-81 10000:82-93 10012:94-102 10021:103-110 1323:111-140
10042:141-150 1363:151-171 1384:172-186 10661:187-211 10097:212-217
1430:218-242 1455:243-284 10149:285-292 1505:293-333 1546:334-342]

Length=343
                                                                      Score     E

ref|XP_006366298.1|  PREDICTED: trans-resveratrol di-O-methyltran...    114   7e-28   
ref|XP_009602136.1|  PREDICTED: trans-resveratrol di-O-methyltran...    112   5e-27   
ref|XP_004248183.1|  PREDICTED: trans-resveratrol di-O-methyltran...    111   1e-26   
ref|XP_009780941.1|  PREDICTED: trans-resveratrol di-O-methyltran...    111   1e-26   
gb|AEC13057.1|  orcinol O-methyltransferase-like protein                109   6e-26   
ref|XP_002278190.1|  PREDICTED: trans-resveratrol di-O-methyltran...    108   1e-25   Vitis vinifera
emb|CAN61955.1|  hypothetical protein VITISV_020020                     108   2e-25   Vitis vinifera
ref|XP_002278211.1|  PREDICTED: trans-resveratrol di-O-methyltran...    107   2e-25   Vitis vinifera
emb|CBI21924.3|  unnamed protein product                                104   3e-25   
emb|CAN78992.1|  hypothetical protein VITISV_005827                     107   4e-25   Vitis vinifera
ref|XP_002278294.1|  PREDICTED: trans-resveratrol di-O-methyltran...    106   5e-25   Vitis vinifera
ref|XP_004303127.1|  PREDICTED: trans-resveratrol di-O-methyltran...    105   9e-25   
gb|AAM23005.1|AF502434_1  orcinol O-methyltransferase                   105   1e-24   Rosa hybrid cultivar
ref|XP_006346269.1|  PREDICTED: trans-resveratrol di-O-methyltran...    105   1e-24   
emb|CAN73270.1|  hypothetical protein VITISV_021918                     105   2e-24   Vitis vinifera
gb|AAM23004.1|AF502433_1  orcinol O-methyltransferase                   105   2e-24   Rosa hybrid cultivar
ref|XP_006368013.1|  PREDICTED: trans-resveratrol di-O-methyltran...    104   2e-24   
ref|XP_006428632.1|  hypothetical protein CICLE_v10012033mg             104   2e-24   
ref|XP_006480453.1|  PREDICTED: trans-resveratrol di-O-methyltran...    104   2e-24   
gb|KDO41475.1|  hypothetical protein CISIN_1g0225151mg                  102   3e-24   
emb|CBI21926.3|  unnamed protein product                                103   5e-24   
ref|XP_003633248.1|  PREDICTED: trans-resveratrol di-O-methyltran...    103   5e-24   
ref|XP_003633249.1|  PREDICTED: trans-resveratrol di-O-methyltran...    103   5e-24   
ref|XP_006346268.1|  PREDICTED: trans-resveratrol di-O-methyltran...    103   6e-24   
emb|CAN79968.1|  hypothetical protein VITISV_043678                     103   6e-24   Vitis vinifera
ref|XP_002278398.1|  PREDICTED: trans-resveratrol di-O-methyltran...    103   6e-24   Vitis vinifera
ref|XP_002278517.1|  PREDICTED: trans-resveratrol di-O-methyltran...    103   7e-24   Vitis vinifera
ref|XP_006371494.1|  hypothetical protein POPTR_0019s12300g           99.4    7e-24   
emb|CBI22002.3|  unnamed protein product                              98.6    9e-24   
emb|CBI21932.3|  unnamed protein product                                103   1e-23   
ref|XP_002326036.2|  hypothetical protein POPTR_0019s12290g             102   1e-23   Populus trichocarpa [western balsam poplar]
ref|XP_004235335.1|  PREDICTED: trans-resveratrol di-O-methyltran...    103   1e-23   
emb|CDP21787.1|  unnamed protein product                                102   2e-23   
ref|XP_006469135.1|  PREDICTED: trans-resveratrol di-O-methyltran...    102   2e-23   
ref|NP_001268044.1|  trans-resveratrol di-O-methyltransferase           102   2e-23   
gb|AEF97347.1|  O-methyltransferase                                     102   2e-23   
ref|XP_002281368.2|  PREDICTED: trans-resveratrol di-O-methyltran...    102   2e-23   Vitis vinifera
ref|XP_006446728.1|  hypothetical protein CICLE_v10015708mg             102   2e-23   
emb|CAQ76879.1|  resveratrol O-methyltransferase                        101   3e-23   Vitis vinifera
ref|XP_004979388.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...    101   3e-23   
gb|ABQ02270.2|  O-methyltransferase                                     101   3e-23   Vitis vinifera
sp|B6VJS4.2|ROMT_VITVI  RecName: Full=Trans-resveratrol di-O-meth...    101   3e-23   Vitis vinifera
emb|CBI21929.3|  unnamed protein product                                101   3e-23   
emb|CBI21931.3|  unnamed protein product                                100   3e-23   
gb|AFX68805.1|  O-metyltransferase                                      101   4e-23   
emb|CAN69556.1|  hypothetical protein VITISV_027590                     100   4e-23   Vitis vinifera
ref|XP_011091578.1|  PREDICTED: trans-resveratrol di-O-methyltran...    101   5e-23   
ref|NP_001267963.1|  O-methyltransferase                                100   6e-23   
emb|CDP19708.1|  unnamed protein product                              99.0    7e-23   
emb|CAA11131.1|  O-methyltransferase                                    100   7e-23   Prunus dulcis [sweet almond]
ref|XP_010093978.1|  Tabersonine 16-O-methyltransferase                 100   7e-23   
ref|XP_009594948.1|  PREDICTED: trans-resveratrol di-O-methyltran...    100   8e-23   
ref|XP_011002663.1|  PREDICTED: trans-resveratrol di-O-methyltran...    100   9e-23   
ref|XP_011002662.1|  PREDICTED: trans-resveratrol di-O-methyltran...    100   1e-22   
emb|CDP21836.1|  unnamed protein product                                100   1e-22   
ref|XP_007132750.1|  hypothetical protein PHAVU_011G122000g           99.8    1e-22   
emb|CBI22005.3|  unnamed protein product                              99.8    1e-22   
ref|XP_010088036.1|  8-hydroxyquercetin 8-O-methyltransferase           100   1e-22   
emb|CDP17644.1|  unnamed protein product                              99.8    1e-22   
ref|XP_002262833.1|  PREDICTED: trans-resveratrol di-O-methyltran...    100   1e-22   Vitis vinifera
ref|XP_011091580.1|  PREDICTED: trans-resveratrol di-O-methyltran...  99.8    2e-22   
gb|KDO36159.1|  hypothetical protein CISIN_1g040309mg                 95.1    2e-22   
ref|XP_004158564.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...  99.4    2e-22   
ref|XP_011016237.1|  PREDICTED: trans-resveratrol di-O-methyltran...  99.0    3e-22   
gb|KDP35392.1|  hypothetical protein JCGZ_10376                       97.4    3e-22   
ref|XP_006376386.1|  hypothetical protein POPTR_0013s12560g           99.0    3e-22   
gb|KDP35397.1|  hypothetical protein JCGZ_10381                       99.0    3e-22   
emb|CBI38115.3|  unnamed protein product                              97.8    4e-22   
ref|XP_006371493.1|  hypothetical protein POPTR_0019s12280g           98.2    4e-22   
ref|XP_003544912.1|  PREDICTED: trans-resveratrol di-O-methyltran...  98.6    4e-22   
ref|XP_003544914.1|  PREDICTED: trans-resveratrol di-O-methyltran...  98.2    5e-22   
ref|XP_006376388.1|  6a-hydroxymaackiain methyltransferase family...  98.2    5e-22   
ref|XP_002437453.1|  hypothetical protein SORBIDRAFT_10g027360        98.2    5e-22   Sorghum bicolor [broomcorn]
ref|XP_011070200.1|  PREDICTED: trans-resveratrol di-O-methyltran...  99.0    6e-22   
ref|XP_002454762.1|  hypothetical protein SORBIDRAFT_04g036900        98.2    6e-22   Sorghum bicolor [broomcorn]
gb|KDO73905.1|  hypothetical protein CISIN_1g017835mg                 98.2    6e-22   
emb|CAN70493.1|  hypothetical protein VITISV_002330                   97.8    6e-22   Vitis vinifera
gb|ABZ89567.1|  O-methyltransferase 3                                 97.8    7e-22   Humulus lupulus [common hop]
ref|XP_006452811.1|  hypothetical protein CICLE_v10008718mg           97.8    8e-22   
ref|XP_006474725.1|  PREDICTED: trans-resveratrol di-O-methyltran...  97.8    8e-22   
emb|CDP21583.1|  unnamed protein product                              97.4    8e-22   
ref|XP_006376381.1|  6a-hydroxymaackiain methyltransferase family...  97.8    8e-22   
ref|XP_011037437.1|  PREDICTED: trans-resveratrol di-O-methyltran...  97.4    9e-22   
ref|XP_011091734.1|  PREDICTED: trans-resveratrol di-O-methyltran...  97.4    9e-22   
ref|XP_011091583.1|  PREDICTED: trans-resveratrol di-O-methyltran...  97.4    1e-21   
gb|EYU30782.1|  hypothetical protein MIMGU_mgv1a021078mg              97.4    1e-21   
ref|XP_011037442.1|  PREDICTED: trans-resveratrol di-O-methyltran...  97.4    1e-21   
ref|XP_004303135.1|  PREDICTED: trans-resveratrol di-O-methyltran...  97.4    1e-21   
ref|XP_002278316.1|  PREDICTED: trans-resveratrol di-O-methyltran...  97.4    1e-21   Vitis vinifera
ref|XP_008455549.1|  PREDICTED: trans-resveratrol di-O-methyltran...  96.3    1e-21   
ref|XP_004151906.1|  PREDICTED: trans-resveratrol di-O-methyltran...  97.1    1e-21   
gb|AGQ21572.1|  flavone 8-O-methyltransferase                         97.1    1e-21   
ref|XP_003527407.1|  PREDICTED: trans-resveratrol di-O-methyltran...  97.1    1e-21   
ref|XP_011002666.1|  PREDICTED: trans-resveratrol di-O-methyltran...  97.1    1e-21   
ref|XP_006388574.1|  hypothetical protein POPTR_0151s00220g           96.7    1e-21   
ref|XP_003557042.1|  PREDICTED: trans-resveratrol di-O-methyltran...  97.1    2e-21   
ref|XP_002437452.1|  hypothetical protein SORBIDRAFT_10g027340        96.7    2e-21   Sorghum bicolor [broomcorn]
emb|CBI30627.3|  unnamed protein product                              92.8    2e-21   
gb|KHN08844.1|  8-hydroxyquercetin 8-O-methyltransferase              96.7    2e-21   
ref|XP_006376396.1|  hypothetical protein POPTR_0013s12670g           96.7    2e-21   
emb|CDP21661.1|  unnamed protein product                              96.3    2e-21   
emb|CDP15888.1|  unnamed protein product                              96.3    2e-21   
ref|XP_008455550.1|  PREDICTED: trans-resveratrol di-O-methyltran...  95.5    2e-21   
ref|XP_004252468.1|  PREDICTED: trans-resveratrol di-O-methyltran...  96.3    3e-21   
gb|KHN07780.1|  Tabersonine 16-O-methyltransferase                    95.9    3e-21   
ref|XP_002441380.1|  hypothetical protein SORBIDRAFT_09g025570        96.3    3e-21   Sorghum bicolor [broomcorn]
ref|XP_006376392.1|  hypothetical protein POPTR_0013s12620g           95.9    3e-21   
gb|KCW44789.1|  hypothetical protein EUGRSUZ_L01645                   95.9    3e-21   
ref|XP_002305103.1|  6a-hydroxymaackiain methyltransferase family...  95.9    4e-21   Populus trichocarpa [western balsam poplar]
ref|XP_004975403.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...  95.9    4e-21   
ref|XP_007043718.1|  Flavonoid o-methyltransferase related            95.9    4e-21   
ref|XP_009764108.1|  PREDICTED: trans-resveratrol di-O-methyltran...  95.5    4e-21   
ref|XP_003633245.1|  PREDICTED: trans-resveratrol di-O-methyltran...  95.5    5e-21   
ref|XP_010052409.1|  PREDICTED: trans-resveratrol di-O-methyltran...  95.5    5e-21   
gb|KDP35391.1|  hypothetical protein JCGZ_10375                       95.5    5e-21   
gb|KDP24057.1|  hypothetical protein JCGZ_25714                       95.1    5e-21   
gb|ABK96707.1|  unknown                                               95.5    5e-21   Populus trichocarpa x Populus deltoides
ref|XP_004987341.1|  PREDICTED: O-methyltransferase ZRP4-like iso...  95.9    5e-21   
ref|XP_004961502.1|  PREDICTED: O-methyltransferase ZRP4-like iso...  95.9    5e-21   
ref|XP_011100227.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...  95.5    5e-21   
gb|ACU19152.1|  unknown                                               94.7    6e-21   Glycine max [soybeans]
gb|KDP35402.1|  hypothetical protein JCGZ_10386                       95.1    6e-21   
ref|XP_004961504.1|  PREDICTED: O-methyltransferase ZRP4-like         95.1    6e-21   
ref|XP_010023967.1|  PREDICTED: trans-resveratrol di-O-methyltran...  95.1    7e-21   
emb|CDP19840.1|  unnamed protein product                              95.1    7e-21   
ref|XP_008229108.1|  PREDICTED: trans-resveratrol di-O-methyltran...  95.1    7e-21   
gb|KHN08846.1|  8-hydroxyquercetin 8-O-methyltransferase              94.4    8e-21   
ref|XP_010111158.1|  Tabersonine 16-O-methyltransferase               95.1    8e-21   
ref|XP_006469138.1|  PREDICTED: trans-resveratrol di-O-methyltran...  96.7    8e-21   
ref|XP_002449557.1|  hypothetical protein SORBIDRAFT_05g019040        95.1    8e-21   Sorghum bicolor [broomcorn]
ref|XP_006428633.1|  hypothetical protein CICLE_v10013393mg           94.4    9e-21   
ref|XP_006469069.1|  PREDICTED: trans-resveratrol di-O-methyltran...  94.7    9e-21   
gb|KDO37374.1|  hypothetical protein CISIN_1g023625mg                 94.0    1e-20   
ref|XP_002278092.1|  PREDICTED: trans-resveratrol di-O-methyltran...  94.7    1e-20   Vitis vinifera
emb|CBI21927.3|  unnamed protein product                              94.0    1e-20   
ref|XP_006446726.1|  hypothetical protein CICLE_v10015705mg           94.7    1e-20   
ref|XP_011037436.1|  PREDICTED: trans-resveratrol di-O-methyltran...  93.2    1e-20   
ref|XP_010040912.1|  PREDICTED: trans-resveratrol di-O-methyltran...  94.4    1e-20   
ref|XP_002525159.1|  o-methyltransferase, putative                    94.4    1e-20   Ricinus communis
ref|XP_006388573.1|  hypothetical protein POPTR_0151s00210g           94.4    1e-20   
emb|CBI21921.3|  unnamed protein product                              94.0    1e-20   
gb|AAR09603.1|  O-methyltransferase                                   94.0    2e-20   Mentha x piperita
ref|XP_011100228.1|  PREDICTED: trans-resveratrol di-O-methyltran...  94.0    2e-20   
ref|XP_008455944.1|  PREDICTED: trans-resveratrol di-O-methyltran...  94.0    2e-20   
ref|XP_010260367.1|  PREDICTED: trans-resveratrol di-O-methyltran...  94.0    2e-20   
emb|CDP21212.1|  unnamed protein product                              93.6    2e-20   
gb|KCW89599.1|  hypothetical protein EUGRSUZ_A01884                   93.6    2e-20   
ref|XP_008229106.1|  PREDICTED: trans-resveratrol di-O-methyltran...  94.0    2e-20   
ref|XP_010070255.1|  PREDICTED: trans-resveratrol di-O-methyltran...  93.6    2e-20   
ref|XP_004151735.1|  PREDICTED: trans-resveratrol di-O-methyltran...  93.6    2e-20   
ref|XP_004169298.1|  PREDICTED: trans-resveratrol di-O-methyltran...  93.6    2e-20   
emb|CDP21551.1|  unnamed protein product                              92.8    2e-20   
ref|XP_002522586.1|  o-methyltransferase, putative                    93.6    2e-20   Ricinus communis
ref|XP_008455943.1|  PREDICTED: trans-resveratrol di-O-methyltran...  93.6    3e-20   
ref|XP_011001214.1|  PREDICTED: trans-resveratrol di-O-methyltran...  93.6    3e-20   
ref|XP_006377432.1|  6a-hydroxymaackiain methyltransferase family...  93.6    3e-20   
gb|KDP24061.1|  hypothetical protein JCGZ_25718                       93.2    4e-20   
ref|XP_004984099.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...  93.2    4e-20   
ref|XP_002441376.1|  hypothetical protein SORBIDRAFT_09g025540        92.8    4e-20   Sorghum bicolor [broomcorn]
ref|NP_001140810.1|  uncharacterized protein LOC100272885             93.2    4e-20   Zea mays [maize]
ref|XP_002441374.1|  hypothetical protein SORBIDRAFT_09g025530        92.8    4e-20   Sorghum bicolor [broomcorn]
emb|CAG27621.1|  putative O-methyltransferase                         89.4    4e-20   Populus deltoides x Populus maximowiczii
ref|XP_007142077.1|  hypothetical protein PHAVU_008G250700g           92.8    5e-20   
ref|XP_010058047.1|  PREDICTED: trans-resveratrol di-O-methyltran...  92.8    5e-20   
gb|ACF81837.1|  unknown                                               89.0    5e-20   Zea mays [maize]
emb|CAH05083.1|  putative orcinol O-methyltransferase                 92.4    5e-20   Rosa hybrid cultivar
ref|XP_002441372.1|  hypothetical protein SORBIDRAFT_09g025510        92.4    5e-20   Sorghum bicolor [broomcorn]
ref|XP_010058046.1|  PREDICTED: trans-resveratrol di-O-methyltran...  92.4    5e-20   
gb|KCW75545.1|  hypothetical protein EUGRSUZ_E04305                   92.4    5e-20   
gb|EMT23556.1|  O-methyltransferase ZRP4                              92.4    6e-20   
emb|CAJ65639.1|  putative orcinol O-methyltransferase                 92.4    6e-20   Rosa hugonis
ref|XP_006469137.1|  PREDICTED: trans-resveratrol di-O-methyltran...  92.4    6e-20   
ref|XP_010938927.1|  PREDICTED: trans-resveratrol di-O-methyltran...  92.4    6e-20   
emb|CAJ65638.1|  putative orcinol O-methyltransferase                 92.0    7e-20   Rosa hugonis
emb|CAJ65648.1|  putative orcinol O-methyltransferase                 92.0    8e-20   Rosa woodsii var. ultramontana
ref|XP_004293905.1|  PREDICTED: trans-resveratrol di-O-methyltran...  92.0    9e-20   
emb|CAJ65622.1|  putative orcinol O-methyltransferase                 91.7    9e-20   Rosa gallica [apothecary rose]
emb|CAJ65621.1|  putative orcinol O-methyltransferase                 91.7    1e-19   Rosa gallica [apothecary rose]
emb|CBI21913.3|  unnamed protein product                              88.2    1e-19   
gb|EMS47465.1|  O-methyltransferase ZRP4                              91.7    1e-19   
emb|CDP19709.1|  unnamed protein product                              91.7    1e-19   
ref|NP_001148593.1|  O-methyltransferase ZRP4                         91.7    1e-19   Zea mays [maize]
emb|CDP20221.1|  unnamed protein product                              87.0    1e-19   
ref|XP_010110665.1|  8-hydroxyquercetin 8-O-methyltransferase         92.0    1e-19   
ref|XP_008783119.1|  PREDICTED: trans-resveratrol di-O-methyltran...  91.7    1e-19   
ref|XP_008649876.1|  PREDICTED: O-methyltransferase ZRP4-like         91.7    1e-19   
gb|ACY41220.1|  O-methyltransferase-like protein                      91.7    1e-19   Saccharum hybrid cultivar CP72-1210
gb|AIY62760.1|  N-acetylserotonin O-methyltransferase                 91.3    1e-19   
ref|XP_008229109.1|  PREDICTED: trans-resveratrol di-O-methyltran...  91.3    1e-19   
gb|KDP24060.1|  hypothetical protein JCGZ_25717                       91.3    2e-19   
gb|ADZ76434.1|  myricetin O-methyltransferase 2                       91.3    2e-19   
ref|XP_004241912.1|  PREDICTED: trans-resveratrol di-O-methyltran...  91.3    2e-19   
emb|CAJ65665.1|  putative orcinol O-methyltransferase                 90.9    2e-19   Rosa odorata [tea rose]
emb|CAJ65601.1|  putative orcinol O-methyltransferase                 90.9    2e-19   Rosa chinensis [China rose]
emb|CAJ65608.1|  putative orcinol O-methyltransferase                 90.9    2e-19   Rosa bracteata [Macartny rose]
ref|XP_008364163.1|  PREDICTED: trans-resveratrol di-O-methyltran...  90.9    2e-19   
ref|XP_010110664.1|  8-hydroxyquercetin 8-O-methyltransferase         91.3    2e-19   
ref|XP_003527405.1|  PREDICTED: trans-resveratrol di-O-methyltran...  90.9    2e-19   
emb|CAJ65661.1|  putative orcinol O-methyltransferase                 90.9    2e-19   Rosa odorata [tea rose]
ref|XP_011077108.1|  PREDICTED: chavicol O-methyltransferase-like     90.9    2e-19   
gb|KHN19130.1|  8-hydroxyquercetin 8-O-methyltransferase              90.1    2e-19   
gb|EMT32848.1|  O-methyltransferase ZRP4                              87.4    2e-19   
emb|CAJ65647.1|  putative orcinol O-methyltransferase                 90.9    2e-19   Rosa rugosa [Japanese rose]
emb|CAJ65602.1|  putative orcinol O-methyltransferase                 90.9    2e-19   Rosa banksiae
ref|XP_011091736.1|  PREDICTED: trans-resveratrol di-O-methyltran...  92.8    2e-19   
emb|CAJ65626.1|  putative orcinol O-methyltransferase                 90.5    2e-19   Rosa gallica [apothecary rose]
emb|CAJ65641.1|  putative orcinol O-methyltransferase                 90.5    2e-19   Rosa marretii
ref|XP_008364164.1|  PREDICTED: trans-resveratrol di-O-methyltran...  90.9    2e-19   
emb|CDP20595.1|  unnamed protein product                              86.7    3e-19   
emb|CAH05080.1|  putative orcinol O-methyltransferase                 90.5    3e-19   Rosa gallica [apothecary rose]
emb|CDP22155.1|  unnamed protein product                              87.0    3e-19   
ref|XP_009345025.1|  PREDICTED: trans-resveratrol di-O-methyltran...  90.5    3e-19   
emb|CAJ65625.1|  putative orcinol O-methyltransferase                 90.5    3e-19   Rosa gallica [apothecary rose]
emb|CAJ65609.1|  putative orcinol O-methyltransferase                 90.5    3e-19   Rosa bracteata [Macartny rose]
emb|CAJ65630.1|  putative orcinol O-methyltransferase                 90.5    3e-19   Rosa odorata var. gigantea
ref|XP_007142043.1|  hypothetical protein PHAVU_008G247600g           90.5    3e-19   
emb|CAJ65612.1|  putative orcinol O-methyltransferase                 90.5    3e-19   Rosa canina [dog briar]
emb|CAJ65624.1|  putative orcinol O-methyltransferase                 90.5    3e-19   Rosa gallica [apothecary rose]
emb|CAJ65628.1|  putative orcinol O-methyltransferase                 90.5    3e-19   Rosa odorata var. gigantea
emb|CAJ65604.1|  putative orcinol O-methyltransferase                 90.5    3e-19   Rosa beggeriana
emb|CAH05082.1|  putative orcinol O-methyltransferase                 90.5    3e-19   Rosa hybrid cultivar
emb|CAJ65632.1|  putative orcinol O-methyltransferase                 90.5    3e-19   Rosa odorata var. gigantea
gb|AFK40900.1|  unknown                                               90.5    3e-19   
emb|CAJ65640.1|  putative orcinol O-methyltransferase                 90.5    3e-19   Rosa majalis [cinnamon rose]
emb|CAJ65649.1|  putative orcinol O-methyltransferase                 90.5    3e-19   Rosa woodsii var. ultramontana
emb|CAJ65645.1|  putative orcinol O-methyltransferase                 90.5    3e-19   Rosa roxburghii [chestnut rose]
emb|CAJ65598.1|  putative orcinol O-methyltransferase                 90.5    3e-19   Rosa chinensis [China rose]
gb|AFW78710.1|  O-methyltransferase ZRP4                              90.5    3e-19   
ref|XP_008649874.1|  PREDICTED: O-methyltransferase ZRP4-like         90.5    3e-19   
ref|XP_011027757.1|  PREDICTED: trans-resveratrol di-O-methyltran...  90.5    3e-19   
emb|CAJ65613.1|  putative orcinol O-methyltransferase                 90.1    3e-19   Rosa chinensis var. spontanea
emb|CAD29555.1|  orcinol O-methyltransferase                          90.1    3e-19   Rosa hybrid cultivar
ref|XP_002277927.2|  PREDICTED: trans-resveratrol di-O-methyltran...  90.5    3e-19   Vitis vinifera
emb|CAN69333.1|  hypothetical protein VITISV_003273                   90.1    3e-19   Vitis vinifera
emb|CAH05087.1|  orcinol O-methyltransferase 4                        90.1    3e-19   Rosa hybrid cultivar
emb|CAJ65620.1|  putative orcinol O-methyltransferase                 90.1    3e-19   Rosa chinensis var. spontanea
emb|CAJ65603.1|  putative orcinol O-methyltransferase                 90.1    3e-19   Rosa banksiae
ref|XP_002274019.2|  PREDICTED: trans-resveratrol di-O-methyltran...  90.1    3e-19   Vitis vinifera
ref|XP_004163430.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...  90.1    4e-19   
ref|XP_010023968.1|  PREDICTED: trans-resveratrol di-O-methyltran...  90.1    4e-19   
emb|CAJ65635.1|  putative orcinol O-methyltransferase                 90.1    4e-19   Rosa odorata var. gigantea
emb|CAJ65610.1|  putative orcinol O-methyltransferase                 90.1    4e-19   Rosa canina [dog briar]
emb|CAJ65605.1|  putative orcinol O-methyltransferase                 90.1    4e-19   Rosa beggeriana
emb|CAJ65606.1|  putative orcinol O-methyltransferase                 90.1    4e-19   Rosa beggeriana
ref|XP_010040590.1|  PREDICTED: trans-resveratrol di-O-methyltran...  90.1    4e-19   
ref|XP_010243530.1|  PREDICTED: trans-resveratrol di-O-methyltran...  92.0    4e-19   
emb|CAH05081.1|  putative orcinol O-methyltransferase                 90.1    4e-19   Rosa hybrid cultivar
ref|XP_002441379.1|  hypothetical protein SORBIDRAFT_09g025550        89.4    4e-19   Sorghum bicolor [broomcorn]
emb|CAJ65623.1|  putative orcinol O-methyltransferase                 90.1    4e-19   Rosa gallica [apothecary rose]
emb|CAJ65611.1|  putative orcinol O-methyltransferase                 90.1    4e-19   Rosa canina [dog briar]
emb|CDP21582.1|  unnamed protein product                              90.1    4e-19   
ref|XP_006376393.1|  hypothetical protein POPTR_0013s12640g           86.3    4e-19   
emb|CAH05090.1|  putative orcinol O-methyltransferase                 89.7    4e-19   Rosa odorata var. gigantea
emb|CBI21915.3|  unnamed protein product                              87.0    5e-19   
gb|KCW45078.1|  hypothetical protein EUGRSUZ_L01321                   89.7    5e-19   
ref|XP_008245137.1|  PREDICTED: trans-resveratrol di-O-methyltran...  90.1    5e-19   
emb|CAH05091.1|  putative orcinol O-methyltransferase                 89.7    5e-19   Rosa odorata var. gigantea
emb|CAN83014.1|  hypothetical protein VITISV_029725                   89.7    5e-19   Vitis vinifera
emb|CAJ65646.1|  putative orcinol O-methyltransferase                 89.7    5e-19   Rosa rugosa [Japanese rose]
ref|XP_010052330.1|  PREDICTED: trans-resveratrol di-O-methyltran...  89.7    5e-19   
ref|XP_002517832.1|  o-methyltransferase, putative                    89.7    5e-19   Ricinus communis
emb|CBI21920.3|  unnamed protein product                              86.3    5e-19   
ref|XP_008778546.1|  PREDICTED: trans-resveratrol di-O-methyltran...  89.7    5e-19   
ref|XP_011100233.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...  89.7    6e-19   
ref|XP_006366911.1|  PREDICTED: trans-resveratrol di-O-methyltran...  87.8    6e-19   
gb|AAB71213.1|  methyltransferase                                     89.7    6e-19   Prunus armeniaca
emb|CAH05089.1|  putative orcinol O-methyltransferase                 89.4    6e-19   Rosa odorata var. gigantea
emb|CAJ65662.1|  putative orcinol O-methyltransferase                 89.4    7e-19   Rosa odorata [tea rose]
ref|XP_006448856.1|  hypothetical protein CICLE_v10015723mg           89.4    7e-19   
emb|CAH05079.1|  putative orcinol O-methyltransferase                 89.4    7e-19   Rosa gallica [apothecary rose]
emb|CAJ65607.1|  putative orcinol O-methyltransferase                 89.4    7e-19   Rosa beggeriana
gb|AJD20223.1|  norcoclaurine 6-O-methyltransferase                   89.7    7e-19   
emb|CBI21919.3|  unnamed protein product                              87.0    7e-19   
ref|XP_009344934.1|  PREDICTED: trans-resveratrol di-O-methyltran...  89.4    8e-19   
gb|KCW89583.1|  hypothetical protein EUGRSUZ_A01867                   88.2    8e-19   
emb|CAJ65615.1|  putative orcinol O-methyltransferase                 89.4    8e-19   Rosa chinensis var. spontanea
ref|XP_002517833.1|  o-methyltransferase, putative                    89.4    8e-19   Ricinus communis
gb|KGN43480.1|  hypothetical protein Csa_7G039280                     89.4    9e-19   
ref|XP_002438878.1|  hypothetical protein SORBIDRAFT_10g027650        89.4    1e-18   Sorghum bicolor [broomcorn]
emb|CAJ65642.1|  putative orcinol O-methyltransferase                 89.0    1e-18   
ref|XP_002517835.1|  o-methyltransferase, putative                    89.0    1e-18   
gb|EYU30737.1|  hypothetical protein MIMGU_mgv1a009866mg              89.0    1e-18   
ref|XP_006356529.1|  PREDICTED: trans-resveratrol di-O-methyltran...  89.0    1e-18   
ref|XP_006356530.1|  PREDICTED: trans-resveratrol di-O-methyltran...  89.0    1e-18   
emb|CAJ65663.1|  putative orcinol O-methyltransferase                 89.0    1e-18   
ref|XP_010032853.1|  PREDICTED: trans-resveratrol di-O-methyltran...  89.0    1e-18   
gb|ACF84530.1|  unknown                                               88.6    1e-18   
ref|XP_002447425.1|  hypothetical protein SORBIDRAFT_06g000820        89.0    1e-18   
ref|XP_004241914.1|  PREDICTED: myricetin O-methyltransferase-like    88.6    1e-18   
emb|CAJ65655.1|  putative orcinol O-methyltransferase                 88.6    1e-18   
gb|AFX68806.1|  O-metyltransferase                                    88.6    1e-18   
gb|KCW74013.1|  hypothetical protein EUGRSUZ_E026382                  84.7    2e-18   
ref|XP_007132751.1|  hypothetical protein PHAVU_011G1221001g          87.0    2e-18   
ref|XP_004490686.1|  PREDICTED: trans-resveratrol di-O-methyltran...  88.6    2e-18   
ref|XP_002278057.1|  PREDICTED: trans-resveratrol di-O-methyltran...  88.2    2e-18   
ref|XP_003615966.1|  O-methyltransferase                              88.2    2e-18   
dbj|BAJ89955.1|  predicted protein                                    88.2    2e-18   
emb|CAJ65643.1|  putative orcinol O-methyltransferase                 88.2    2e-18   
ref|XP_010070153.1|  PREDICTED: trans-resveratrol di-O-methyltran...  88.2    2e-18   
gb|KDP21023.1|  hypothetical protein JCGZ_21494                       88.2    2e-18   
gb|EMT10452.1|  O-methyltransferase ZRP4                              88.2    2e-18   
ref|XP_002522501.1|  o-methyltransferase, putative                    88.2    2e-18   
ref|XP_006356531.1|  PREDICTED: trans-resveratrol di-O-methyltran...  88.2    2e-18   
ref|XP_010916032.1|  PREDICTED: trans-resveratrol di-O-methyltran...  88.2    2e-18   
emb|CAH05085.1|  orcinol O-methyltransferase 3                        87.8    2e-18   
ref|XP_004232927.1|  PREDICTED: trans-resveratrol di-O-methyltran...  88.2    2e-18   
emb|CAJ65631.1|  putative orcinol O-methyltransferase                 87.8    2e-18   
emb|CAJ65636.1|  putative orcinol O-methyltransferase                 87.8    3e-18   
emb|CAJ65659.1|  putative orcinol O-methyltransferase                 87.8    3e-18   
emb|CAH05088.1|  putative orcinol O-methyltransferase                 87.8    3e-18   
emb|CAJ65627.1|  putative orcinol O-methyltransferase                 87.8    3e-18   
dbj|BAJ93308.1|  predicted protein                                    84.0    3e-18   
ref|XP_007132709.1|  hypothetical protein PHAVU_011G118100g           87.8    3e-18   
gb|EAZ42961.1|  hypothetical protein OsJ_27551                        87.8    3e-18   
ref|XP_004151089.1|  PREDICTED: trans-resveratrol di-O-methyltran...  87.0    3e-18   
emb|CAN67020.1|  hypothetical protein VITISV_040589                   87.4    3e-18   
emb|CAJ65657.1|  putative orcinol O-methyltransferase                 87.8    3e-18   
emb|CAH05086.1|  orcinol O-methyltransferase 4                        87.8    3e-18   
ref|XP_004962112.1|  PREDICTED: TRIBOA-glucoside O-methyltransfer...  88.2    3e-18   
emb|CAJ65617.1|  putative orcinol O-methyltransferase                 87.8    3e-18   
gb|KCW89582.1|  hypothetical protein EUGRSUZ_A01865                   86.7    3e-18   
emb|CDP00481.1|  unnamed protein product                              89.0    3e-18   
emb|CAJ65614.1|  putative orcinol O-methyltransferase                 87.4    3e-18   
emb|CAD29556.1|  orcinol O-methyltransferase                          87.4    3e-18   
ref|XP_004232928.1|  PREDICTED: trans-resveratrol di-O-methyltran...  87.8    3e-18   
ref|XP_004505627.1|  PREDICTED: trans-resveratrol di-O-methyltran...  88.2    3e-18   
emb|CAJ65660.1|  putative orcinol O-methyltransferase                 87.4    3e-18   
ref|XP_003615967.1|  O-methyltransferase                              87.8    3e-18   
emb|CAJ65629.1|  putative orcinol O-methyltransferase                 87.4    3e-18   
emb|CAJ65597.1|  putative orcinol O-methyltransferase                 87.4    3e-18   
ref|XP_007142076.1|  hypothetical protein PHAVU_008G250600g           87.4    3e-18   
emb|CAJ65637.1|  putative orcinol O-methyltransferase                 87.4    3e-18   
ref|XP_002278149.1|  PREDICTED: trans-resveratrol di-O-methyltran...  87.4    3e-18   
emb|CDP21231.1|  unnamed protein product                              83.2    4e-18   
emb|CAJ65599.1|  putative orcinol O-methyltransferase                 87.4    4e-18   
gb|ACF82933.1|  unknown                                               87.4    4e-18   
ref|NP_001105689.1|  O-methyltransferase ZRP4                         87.4    4e-18   
gb|AES89720.2|  orcinol O-methyltransferase                           87.4    4e-18   
emb|CAN73269.1|  hypothetical protein VITISV_021917                   87.4    4e-18   
emb|CAJ65616.1|  putative orcinol O-methyltransferase                 87.4    4e-18   
emb|CDP15884.1|  unnamed protein product                              86.7    4e-18   
ref|XP_006468348.1|  PREDICTED: trans-resveratrol di-O-methyltran...  87.4    4e-18   
ref|XP_003615968.1|  O-methyltransferase                              87.0    5e-18   
ref|XP_010231162.1|  PREDICTED: O-methyltransferase ZRP4-like iso...  87.4    5e-18   
ref|XP_011091579.1|  PREDICTED: trans-resveratrol di-O-methyltran...  87.0    5e-18   
gb|EMS54380.1|  putative O-methyltransferase 2                        87.4    5e-18   
gb|KDO75191.1|  hypothetical protein CISIN_1g018205mg                 87.0    5e-18   
ref|XP_008455942.1|  PREDICTED: trans-resveratrol di-O-methyltran...  87.0    5e-18   
ref|XP_003607523.1|  O-methyltransferase                              87.0    5e-18   
ref|XP_002438877.1|  hypothetical protein SORBIDRAFT_10g027640        87.4    5e-18   
ref|XP_008656437.1|  PREDICTED: O-methyltransferase ZRP4-like         87.0    6e-18   
ref|XP_010231163.1|  PREDICTED: O-methyltransferase ZRP4-like iso...  87.0    6e-18   
ref|XP_002525160.1|  o-methyltransferase, putative                    86.7    6e-18   
ref|XP_010916033.1|  PREDICTED: trans-resveratrol di-O-methyltran...  86.7    8e-18   
ref|XP_003574581.2|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...  86.7    8e-18   
ref|XP_004979195.1|  PREDICTED: O-methyltransferase ZRP4-like         86.3    8e-18   
dbj|BAK00087.1|  predicted protein                                    86.7    9e-18   
ref|XP_002517834.1|  o-methyltransferase, putative                    86.7    9e-18   
gb|EMS48795.1|  O-methyltransferase ZRP4                              86.3    9e-18   
ref|XP_002538902.1|  o-methyltransferase, putative                    85.5    9e-18   
emb|CAJ65596.1|  putative orcinol O-methyltransferase                 86.3    9e-18   
emb|CDP19839.1|  unnamed protein product                              86.3    1e-17   
gb|EMS45262.1|  O-methyltransferase ZRP4                              86.3    1e-17   
gb|EAY82990.1|  hypothetical protein OsI_38212                        86.3    1e-17   
ref|XP_009351009.1|  PREDICTED: trans-resveratrol di-O-methyltran...  86.7    1e-17   
gb|KCW74501.1|  hypothetical protein EUGRSUZ_E03213                   86.3    1e-17   
gb|EAY82987.1|  hypothetical protein OsI_38209                        86.3    1e-17   
ref|XP_010057350.1|  PREDICTED: trans-resveratrol di-O-methyltran...  86.7    1e-17   
ref|XP_004490696.1|  PREDICTED: trans-resveratrol di-O-methyltran...  86.3    1e-17   
gb|EMS62894.1|  putative O-methyltransferase 2                        86.3    1e-17   
emb|CBI21922.3|  unnamed protein product                              85.5    1e-17   
gb|EMS45259.1|  O-methyltransferase ZRP4                              85.9    1e-17   
ref|XP_002454761.1|  hypothetical protein SORBIDRAFT_04g036890        86.7    1e-17   
emb|CAJ65600.1|  putative orcinol O-methyltransferase                 85.9    1e-17   
ref|XP_002450325.1|  hypothetical protein SORBIDRAFT_05g003780        85.9    1e-17   
emb|CAH05084.1|  orcinol O-methyltransferase 3                        85.9    1e-17   
ref|XP_006351391.1|  PREDICTED: trans-resveratrol di-O-methyltran...  85.9    1e-17   
ref|XP_002517827.1|  o-methyltransferase, putative                    85.5    2e-17   
emb|CAJ65656.1|  putative orcinol O-methyltransferase                 85.5    2e-17   
gb|EMT07736.1|  O-methyltransferase ZRP4                              85.9    2e-17   
ref|XP_003569832.1|  PREDICTED: LOW QUALITY PROTEIN: O-methyltran...  85.9    2e-17   
emb|CAJ65634.1|  putative orcinol O-methyltransferase                 85.5    2e-17   
emb|CAJ65633.1|  putative orcinol O-methyltransferase                 85.5    2e-17   
emb|CAJ65664.1|  putative orcinol O-methyltransferase                 85.1    2e-17   
ref|XP_010097396.1|  8-hydroxyquercetin 8-O-methyltransferase         85.1    2e-17   
ref|XP_010231167.1|  PREDICTED: O-methyltransferase ZRP4-like iso...  84.0    2e-17   
gb|EAZ20367.1|  hypothetical protein OsJ_35978                        85.1    2e-17   
gb|KCW74499.1|  hypothetical protein EUGRSUZ_E03211                   85.1    2e-17   
emb|CBI30626.3|  unnamed protein product                              82.8    2e-17   
dbj|BAJ87046.1|  predicted protein                                    85.5    3e-17   
emb|CAJ65666.1|  putative orcinol O-methyltransferase                 85.1    3e-17   
gb|EAY82991.1|  hypothetical protein OsI_38213                        85.1    3e-17   
ref|XP_006388414.1|  6a-hydroxymaackiain methyltransferase family...  85.1    3e-17   
ref|XP_010057348.1|  PREDICTED: trans-resveratrol di-O-methyltran...  85.1    3e-17   
gb|EMT07737.1|  O-methyltransferase ZRP4                              85.1    3e-17   
gb|EAZ07211.1|  hypothetical protein OsI_29456                        84.7    3e-17   
gb|KDP24062.1|  hypothetical protein JCGZ_25719                       85.1    3e-17   
emb|CDP15886.1|  unnamed protein product                              84.7    3e-17   
ref|NP_001056040.1|  Os05g0515600                                     85.1    3e-17   
emb|CDP19711.1|  unnamed protein product                              84.7    3e-17   
ref|NP_001175192.1|  Os07g0463600                                     84.7    3e-17   
ref|XP_003564176.2|  PREDICTED: O-methyltransferase ZRP4-like         85.1    4e-17   
ref|XP_003615973.1|  O-methyltransferase                              84.7    4e-17   
ref|XP_010231166.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...  83.6    4e-17   
ref|XP_011085639.1|  PREDICTED: chavicol O-methyltransferase-like     84.7    4e-17   
ref|XP_008788394.1|  PREDICTED: trans-resveratrol di-O-methyltran...  84.7    4e-17   
ref|XP_003568107.1|  PREDICTED: O-methyltransferase ZRP4-like         84.7    4e-17   
gb|EMT04621.1|  O-methyltransferase ZRP4                              84.0    5e-17   
gb|EMS51298.1|  putative O-methyltransferase 2                        85.9    5e-17   
emb|CAJ65618.1|  putative orcinol O-methyltransferase                 84.3    5e-17   
gb|EMT21689.1|  O-methyltransferase ZRP4                              84.0    5e-17   
ref|XP_010231165.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...  83.6    5e-17   
gb|EMT31218.1|  O-methyltransferase ZRP4                              84.3    5e-17   
ref|XP_010097399.1|  8-hydroxyquercetin 8-O-methyltransferase         84.7    5e-17   
gb|EMT17312.1|  O-methyltransferase ZRP4                              84.3    6e-17   
ref|XP_006364328.1|  PREDICTED: trans-resveratrol di-O-methyltran...  84.3    6e-17   
gb|EEE64356.1|  hypothetical protein OsJ_19196                        84.0    6e-17   
gb|KEH30982.1|  isoflavone-7-O-methyltransferase                      84.0    6e-17   
emb|CAN75970.1|  hypothetical protein VITISV_009881                   84.0    6e-17   
ref|XP_003536187.1|  PREDICTED: isoflavone 7-O-methyltransferase-...  84.0    6e-17   
ref|XP_004249745.2|  PREDICTED: trans-resveratrol di-O-methyltran...  83.6    7e-17   
ref|XP_010920172.1|  PREDICTED: trans-resveratrol di-O-methyltran...  84.0    7e-17   
ref|NP_001066710.1|  Os12g0444800                                     84.0    7e-17   
gb|EMT02778.1|  hypothetical protein F775_52566                       84.0    7e-17   
ref|XP_011037440.1|  PREDICTED: trans-resveratrol di-O-methyltran...  84.0    7e-17   
ref|XP_002278127.1|  PREDICTED: trans-resveratrol di-O-methyltran...  84.0    7e-17   
ref|XP_004973018.1|  PREDICTED: O-methyltransferase ZRP4-like         84.0    7e-17   
dbj|BAJ96732.1|  predicted protein                                    84.0    8e-17   
emb|CDP19713.1|  unnamed protein product                              83.6    8e-17   
ref|XP_002444017.1|  hypothetical protein SORBIDRAFT_07g005970        84.0    8e-17   
ref|XP_006431705.1|  hypothetical protein CICLE_v10003093mg           82.8    9e-17   
gb|AEQ94124.1|  putative O-methyltransferase                          82.0    9e-17   
ref|NP_001147709.1|  LOC100281319                                     83.6    1e-16   
gb|EMT21986.1|  O-methyltransferase ZRP4                              83.6    1e-16   
ref|XP_004170025.1|  PREDICTED: trans-resveratrol di-O-methyltran...  81.3    1e-16   
ref|NP_001130621.1|  hypothetical protein                             84.3    1e-16   
ref|XP_008660004.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...  83.6    1e-16   
gb|EMT13411.1|  O-methyltransferase ZRP4                              83.6    1e-16   
ref|XP_002537255.1|  o-methyltransferase, putative                    79.7    1e-16   
gb|EMT24461.1|  O-methyltransferase ZRP4                              83.2    1e-16   
ref|XP_008660003.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...  83.6    1e-16   
ref|XP_006365443.1|  PREDICTED: trans-resveratrol di-O-methyltran...  83.2    1e-16   
ref|XP_008783118.1|  PREDICTED: trans-resveratrol di-O-methyltran...  82.8    1e-16   
gb|KEH30981.1|  isoflavone-7-O-methyltransferase                      82.8    1e-16   
gb|EMT23443.1|  O-methyltransferase ZRP4                              83.2    1e-16   
gb|ABA98340.1|  O-methyltransferase ZRP4, putative, expressed         83.2    1e-16   
gb|EMT10454.1|  O-methyltransferase ZRP4                              83.2    1e-16   
ref|NP_001062931.1|  Os09g0344500                                     83.2    1e-16   
ref|XP_003568106.1|  PREDICTED: O-methyltransferase ZRP4-like         83.2    2e-16   
ref|XP_002456368.1|  hypothetical protein SORBIDRAFT_03g034845        83.2    2e-16   
gb|EAZ20360.1|  hypothetical protein OsJ_35968                        82.4    2e-16   
ref|NP_001066698.2|  Os12g0441300                                     80.1    2e-16   
ref|XP_002517828.1|  o-methyltransferase, putative                    79.3    2e-16   
ref|XP_009612081.1|  PREDICTED: trans-resveratrol di-O-methyltran...  82.8    2e-16   
ref|XP_010920173.1|  PREDICTED: trans-resveratrol di-O-methyltran...  82.8    2e-16   
ref|XP_003536186.1|  PREDICTED: isoflavone 7-O-methyltransferase-...  82.8    2e-16   
gb|EMS61187.1|  putative O-methyltransferase 2                        82.8    2e-16   
ref|XP_006364316.1|  PREDICTED: trans-resveratrol di-O-methyltran...  79.3    2e-16   
emb|CAP72304.1|  O-methyltransferase                                  82.8    2e-16   
gb|EMT18419.1|  O-methyltransferase ZRP4                              83.6    2e-16   
ref|XP_007141105.1|  hypothetical protein PHAVU_008G1678000g          79.0    2e-16   
gb|EMS57517.1|  5-pentadecatrienyl resorcinol O-methyltransferase     82.0    3e-16   
emb|CDM80939.1|  unnamed protein product                              82.4    3e-16   
gb|KGN44538.1|  hypothetical protein Csa_7G328260                     82.0    3e-16   
ref|XP_006657707.1|  PREDICTED: probable O-methyltransferase 2-like   82.4    3e-16   
ref|XP_006654645.1|  PREDICTED: O-methyltransferase ZRP4-like         82.4    3e-16   
gb|KHN46106.1|  Tabersonine 16-O-methyltransferase                    80.9    3e-16   
gb|EMT08560.1|  O-methyltransferase ZRP4                              83.2    3e-16   
ref|NP_001158962.1|  O-methyltransferase ZRP4                         82.4    3e-16   
ref|XP_004139732.1|  PREDICTED: trans-resveratrol di-O-methyltran...  82.4    3e-16   
emb|CDM84119.1|  unnamed protein product                              82.0    3e-16   
sp|Q6VMW0.1|Q8OMT_MENPI  RecName: Full=8-hydroxyquercetin 8-O-met...  82.0    4e-16   
ref|XP_006658538.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...  82.4    4e-16   
gb|EMT13345.1|  O-methyltransferase ZRP4                              82.0    4e-16   
ref|XP_006364318.1|  PREDICTED: trans-resveratrol di-O-methyltran...  82.0    4e-16   
gb|EEE69517.1|  hypothetical protein OsJ_28977                        81.6    4e-16   
gb|KCW74498.1|  hypothetical protein EUGRSUZ_E03210                   78.6    4e-16   
dbj|BAJ99088.1|  predicted protein                                    82.0    5e-16   
ref|XP_003580668.1|  PREDICTED: probable O-methyltransferase 2        82.0    5e-16   
gb|AAR02421.1|  putative O-methyltransferase                          81.6    5e-16   
ref|XP_003560974.1|  PREDICTED: TRIBOA-glucoside O-methyltransfer...  81.6    6e-16   
ref|XP_004979084.1|  PREDICTED: probable O-methyltransferase 2-like   81.6    6e-16   
gb|AFU52936.1|  anthranilate N-methyltransferase                      81.6    6e-16   
ref|XP_003577609.1|  PREDICTED: probable O-methyltransferase 2        81.6    6e-16   
ref|XP_010070166.1|  PREDICTED: trans-resveratrol di-O-methyltran...  81.6    7e-16   
ref|XP_009620258.1|  PREDICTED: trans-resveratrol di-O-methyltran...  78.2    7e-16   
ref|XP_008779862.1|  PREDICTED: trans-resveratrol di-O-methyltran...  79.7    8e-16   
ref|XP_004983195.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...  81.3    8e-16   
gb|EMT27354.1|  O-methyltransferase ZRP4                              81.3    8e-16   
ref|XP_003556407.1|  PREDICTED: isoflavone 7-O-methyltransferase-...  81.3    8e-16   
dbj|BAC99560.1|  putative flavonoid 7-O-methyltransferase             81.3    8e-16   
ref|XP_009351010.1|  PREDICTED: trans-resveratrol di-O-methyltran...  79.0    9e-16   
ref|NP_001056039.1|  Os05g0515500                                     81.3    9e-16   
ref|XP_007025515.1|  Flavonoid o-methyltransferase related, putative  81.3    9e-16   
ref|XP_006365444.1|  PREDICTED: trans-resveratrol di-O-methyltran...  80.9    9e-16   
ref|XP_010920171.1|  PREDICTED: trans-resveratrol di-O-methyltran...  80.9    1e-15   
ref|XP_006656835.1|  PREDICTED: O-methyltransferase ZRP4-like         80.5    1e-15   
ref|NP_001149533.1|  LOC100283159                                     80.9    1e-15   
ref|XP_004970090.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...  80.9    1e-15   
ref|XP_008677433.1|  PREDICTED: O-methyltransferase ZRP4 isoform X1   80.9    1e-15   



>ref|XP_006366298.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=365

 Score =   114 bits (286),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KE GGK+IIIDM++ N   D++SIETQI FDML M+ +TGR+R+E+ WAK+FFEAGFSDY
Sbjct  290  KEKGGKVIIIDMMVDNKIGDDESIETQIFFDMLMMVLVTGRERSERGWAKIFFEAGFSDY  349

Query  162  KIILILGVRSLIEAYP  115
            K+  ILG+RSLIE YP
Sbjct  350  KVTPILGLRSLIEVYP  365



>ref|XP_009602136.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=361

 Score =   112 bits (280),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 50/76 (66%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            +E GGK+IIIDM++ N   D++SIETQI FDML M+ +TGR+R+EK WAKLF +AGFSDY
Sbjct  286  REKGGKVIIIDMMVDNKIGDDESIETQIFFDMLMMVLVTGRERSEKGWAKLFLDAGFSDY  345

Query  162  KIILILGVRSLIEAYP  115
            K+  ILG+RSLIE YP
Sbjct  346  KVTPILGLRSLIEVYP  361



>ref|XP_004248183.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=362

 Score =   111 bits (278),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 50/76 (66%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KE GGK+IIIDM++ N   D++SIETQI FDML M+ +TGR+R+E+ WAK+F EAGFSDY
Sbjct  287  KEKGGKVIIIDMMVDNKIGDDESIETQIFFDMLMMVLVTGRERSERGWAKIFSEAGFSDY  346

Query  162  KIILILGVRSLIEAYP  115
            K+  ILG+RSLIE YP
Sbjct  347  KVTPILGLRSLIEVYP  362



>ref|XP_009780941.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=363

 Score =   111 bits (277),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 50/76 (66%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            +E GGK+IIIDM++ N   D++SIETQI FDML M+ +TGR+R+EK WAKLF +AGFSDY
Sbjct  288  REKGGKVIIIDMMVDNKIGDDESIETQIFFDMLMMVLVTGRERSEKGWAKLFSDAGFSDY  347

Query  162  KIILILGVRSLIEAYP  115
            K+  ILG+RSLIE YP
Sbjct  348  KVTPILGLRSLIEVYP  363



>gb|AEC13057.1| orcinol O-methyltransferase-like protein [Rosa chinensis]
Length=367

 Score =   109 bits (272),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  292  KDKNGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  351

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  352  KITPILGLRSLIEVYP  367



>ref|XP_002278190.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   108 bits (269),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KE GGK+IIIDM++ N + D++SIETQ+ +DML MI LTG++R  KDW KLFF+AGFS Y
Sbjct  282  KEKGGKVIIIDMMMENQKADDESIETQLFWDMLMMIVLTGQERNIKDWEKLFFDAGFSGY  341

Query  162  KIILILGVRSLIEAYP  115
            KI  +LG+RSLIE YP
Sbjct  342  KITPMLGLRSLIEVYP  357



>emb|CAN61955.1| hypothetical protein VITISV_020020 [Vitis vinifera]
Length=357

 Score =   108 bits (269),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/76 (63%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KE GGK+IIIDM++ N + D++S+ETQ+ FDML MI +TG++R EK+W KLF +AGFS Y
Sbjct  282  KEKGGKVIIIDMMMENQKGDDESMETQLFFDMLMMILVTGQERNEKEWEKLFLDAGFSGY  341

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  342  KITPILGLRSLIEVYP  357



>ref|XP_002278211.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   107 bits (268),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/76 (63%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KE GGK+IIIDM++ N + D++S+ETQ+ FDML MI +TG++R EK+W KLF +AGFS Y
Sbjct  282  KEKGGKVIIIDMMMENQKGDDESMETQLFFDMLMMILVTGQERNEKEWEKLFLDAGFSGY  341

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  342  KITPILGLRSLIEVYP  357



>emb|CBI21924.3| unnamed protein product [Vitis vinifera]
Length=187

 Score =   104 bits (259),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KE GGK+IIIDM++ N + D++S+ETQ+ FDML MI +TG++R EK+W KLF +AGFS Y
Sbjct  112  KEKGGKVIIIDMMMENQKGDDESMETQLFFDMLMMILVTGQERNEKEWEKLFLDAGFSGY  171

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  172  KITPILGLRSLIEVYP  187



>emb|CAN78992.1| hypothetical protein VITISV_005827 [Vitis vinifera]
Length=357

 Score =   107 bits (266),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 48/76 (63%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KENGGK+IIIDM++   + D KS+ETQ+ FDM+ MI +TGR+R E +W KLF +AGFS Y
Sbjct  282  KENGGKVIIIDMIMMKNQGDYKSVETQLYFDMVMMILVTGRERDENEWEKLFLDAGFSHY  341

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  342  KITPILGLRSLIEVYP  357



>ref|XP_002278294.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   106 bits (265),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 48/76 (63%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KENGGK+IIIDM++   + D KS+ETQ+ FDM+ MI +TGR+R E +W KLF +AGFS Y
Sbjct  282  KENGGKVIIIDMIMMKNQGDYKSVETQLYFDMVMMILVTGRERDENEWEKLFLDAGFSHY  341

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  342  KITPILGLRSLIEVYP  357



>ref|XP_004303127.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=367

 Score =   105 bits (263),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 47/76 (62%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+S+ETQ+ FDML M  +TG++R EK+W+KLF +AGFSDY
Sbjct  292  KDKKGKVIIIDMMMENQKGDEESMETQLFFDMLMMALVTGKERNEKEWSKLFTDAGFSDY  351

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  352  KITPILGLRSLIEVYP  367



>gb|AAM23005.1|AF502434_1 orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAD29459.1| orcinol O-methyltransferase [Rosa chinensis]
 emb|CAH05078.1| orcinol O-methyltransferase 2 [Rosa chinensis]
 dbj|BAQ20440.1| 3,5-dimethoxytoluene [Rosa hybrid cultivar]
Length=366

 Score =   105 bits (263),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 48/76 (63%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  + G++R EK+WAKLF +AGFSDY
Sbjct  291  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVRGQERNEKEWAKLFTDAGFSDY  350

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  351  KITPILGLRSLIEVYP  366



>ref|XP_006346269.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=364

 Score =   105 bits (263),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 45/76 (59%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KENGGK+I+I++V+   ++D+KS ETQ+L D+L MI L+G++R++++WAKLFF+AG+SDY
Sbjct  289  KENGGKVILIEIVMDQNKDDDKSYETQLLIDILMMILLSGKERSQQEWAKLFFDAGYSDY  348

Query  162  KIILILGVRSLIEAYP  115
            KII ILG+R +IE YP
Sbjct  349  KIIPILGLRCVIEVYP  364



>emb|CAN73270.1| hypothetical protein VITISV_021918 [Vitis vinifera]
Length=328

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KE GGK+IIIDM++ N + D++SIETQ+ +DML MI LTG++R  KDW KLFF+AGFS Y
Sbjct  253  KEKGGKVIIIDMMMENQKADDESIETQLFWDMLMMIVLTGQERNIKDWEKLFFDAGFSGY  312

Query  162  KIILILGVRSLIEAYP  115
            KI  +LG+RSLIE YP
Sbjct  313  KITPMLGLRSLIEVYP  328



>gb|AAM23004.1|AF502433_1 orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAD29458.1| orcinol O-methyltransferase [Rosa chinensis]
 emb|CAH05077.1| orcinol O-methyltransferase 1 [Rosa chinensis]
Length=367

 Score =   105 bits (261),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 48/76 (63%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KE  GK+IIIDM++ N + DE+SIETQ+ FDML M  + G++R EK+WAKLF +AGFSDY
Sbjct  292  KEKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDY  351

Query  162  KIILILGVRSLIEAYP  115
            KI  I G+RSLIE YP
Sbjct  352  KITPISGLRSLIEVYP  367



>ref|XP_006368013.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=353

 Score =   104 bits (260),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 46/76 (61%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KENGGK+I+ID VI N + D+KS ETQ+  D+L M+ ++G++R E++WAKLF +AGFSDY
Sbjct  278  KENGGKVIVIDTVIDNQKGDDKSFETQLFLDVLMMVHVSGKERNEQEWAKLFSDAGFSDY  337

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RS+IE YP
Sbjct  338  KISPILGLRSVIEVYP  353



>ref|XP_006428632.1| hypothetical protein CICLE_v10012033mg [Citrus clementina]
 gb|ESR41872.1| hypothetical protein CICLE_v10012033mg [Citrus clementina]
Length=362

 Score =   104 bits (260),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 49/72 (68%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIIL  151
            GK+IIIDM+  N + D+KSIETQ+ FDML M+ LTG +R EK+W KLF  AGFSDYKII 
Sbjct  291  GKVIIIDMIRENKKGDDKSIETQLFFDMLMMVLLTGTERDEKEWTKLFTYAGFSDYKIIP  350

Query  150  ILGVRSLIEAYP  115
            ILG+RSLIE YP
Sbjct  351  ILGLRSLIEVYP  362



>ref|XP_006480453.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=362

 Score =   104 bits (260),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 49/72 (68%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIIL  151
            GK+IIIDM+  N + D+KSIETQ+ FDML M+ LTG +R EK+W KLF  AGFSDYKII 
Sbjct  291  GKVIIIDMIRENKKGDDKSIETQLFFDMLMMVLLTGTERDEKEWTKLFTYAGFSDYKIIP  350

Query  150  ILGVRSLIEAYP  115
            ILG+RSLIE YP
Sbjct  351  ILGLRSLIEVYP  362



>gb|KDO41475.1| hypothetical protein CISIN_1g0225151mg, partial [Citrus sinensis]
Length=227

 Score =   102 bits (255),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIIL  151
            GK+IIIDM+  N + D+KSIETQ+ FDML M+ LTG +R EK+W KLF  AGFSDYKII 
Sbjct  156  GKVIIIDMIRENKKGDDKSIETQLFFDMLMMVLLTGTERDEKEWTKLFTYAGFSDYKIIP  215

Query  150  ILGVRSLIEAYP  115
            ILG+RSLIE YP
Sbjct  216  ILGLRSLIEVYP  227



>emb|CBI21926.3| unnamed protein product [Vitis vinifera]
Length=297

 Score =   103 bits (257),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KENGGK+IIIDM++   + D KS+ETQ+ FDM+ MI +TGR+R E +W KLF +AGFS Y
Sbjct  222  KENGGKVIIIDMIMMKNQGDYKSVETQLYFDMVMMILVTGRERDENEWEKLFLDAGFSHY  281

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  282  KITPILGLRSLIEVYP  297



>ref|XP_003633248.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   103 bits (258),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 48/76 (63%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KENGGK+IIIDM++   + D KSIETQ+ FDM  MI   GR+R E +W KLF +AGFS Y
Sbjct  282  KENGGKVIIIDMIMMKNQGDYKSIETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHY  341

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  342  KITPILGLRSLIEVYP  357



>ref|XP_003633249.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   103 bits (258),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 48/76 (63%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KENGGK+IIIDM++   + D KSIETQ+ FDM  MI   GR+R E +W KLF +AGFS Y
Sbjct  282  KENGGKVIIIDMIMMKNQGDYKSIETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHY  341

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  342  KITPILGLRSLIEVYP  357



>ref|XP_006346268.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=353

 Score =   103 bits (257),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 45/76 (59%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KENGGK+I+ID VI N + D+KS E+Q+  D+L M+ ++G++R E++WAKLF +AGFSDY
Sbjct  278  KENGGKVIVIDTVIDNQKGDDKSFESQLFLDVLMMVHVSGKERNEQEWAKLFSDAGFSDY  337

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RS+IE YP
Sbjct  338  KISPILGLRSVIEVYP  353



>emb|CAN79968.1| hypothetical protein VITISV_043678 [Vitis vinifera]
Length=357

 Score =   103 bits (257),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 47/76 (62%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KENGGK+IIIDM++   + D+KSIETQ+ FDM  MI   GR+R E +W K+F +AGFS Y
Sbjct  282  KENGGKVIIIDMIMMKNQGDDKSIETQLFFDMTMMIFSAGRERDENEWEKIFLDAGFSHY  341

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  342  KITPILGLRSLIEVYP  357



>ref|XP_002278398.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
 emb|CBI21930.3| unnamed protein product [Vitis vinifera]
Length=358

 Score =   103 bits (257),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 60/78 (77%), Gaps = 2/78 (3%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVR--NDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFS  169
            KE GGK++IIDM I N +  +DE ++ETQ+ FDML M+ L GR+R EK+W KLF ++GFS
Sbjct  281  KEKGGKVMIIDMAIQNKKGDDDESNVETQLFFDMLMMVLLPGREREEKEWKKLFLDSGFS  340

Query  168  DYKIILILGVRSLIEAYP  115
             YKI  ILG+RSLIE YP
Sbjct  341  GYKITPILGLRSLIEVYP  358



>ref|XP_002278517.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=359

 Score =   103 bits (257),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 60/78 (77%), Gaps = 2/78 (3%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVR--NDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFS  169
            KE GGK++IIDM I N +  +DE ++ETQ+ FDML M+ L GR+R EK+W KLF ++GFS
Sbjct  282  KEKGGKVMIIDMAIQNKKGDDDESNVETQLFFDMLMMVLLPGREREEKEWKKLFLDSGFS  341

Query  168  DYKIILILGVRSLIEAYP  115
             YKI  ILG+RSLIE YP
Sbjct  342  GYKITPILGLRSLIEVYP  359



>ref|XP_006371494.1| hypothetical protein POPTR_0019s12300g [Populus trichocarpa]
 gb|ERP49291.1| hypothetical protein POPTR_0019s12300g [Populus trichocarpa]
Length=121

 Score = 99.4 bits (246),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -2

Query  333  GGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKII  154
            GGK++IIDM++ N + +++SIETQI FDML MI +TG++R EK+WAKLF +AGFS+YKI 
Sbjct  49   GGKVMIIDMMMENQKGEDESIETQIFFDMLMMILVTGQERNEKEWAKLFSDAGFSNYKIT  108

Query  153  LILGVRSLIEAYP  115
             ILG+RS+IE +P
Sbjct  109  PILGLRSIIEVFP  121



>emb|CBI22002.3| unnamed protein product [Vitis vinifera]
Length=114

 Score = 98.6 bits (244),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KENGGK+IIIDM++   + D KS ETQ+ FDM  MI   GR+R E +W KLF +AGFS Y
Sbjct  39   KENGGKVIIIDMIMMKNQGDYKSTETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHY  98

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  99   KITPILGLRSLIEVYP  114



>emb|CBI21932.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   103 bits (257),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 60/78 (77%), Gaps = 2/78 (3%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVR--NDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFS  169
            KE GGK++IIDM I N +  +DE ++ETQ+ FDML M+ L GR+R EK+W KLF ++GFS
Sbjct  359  KEKGGKVMIIDMAIQNKKGDDDESNVETQLFFDMLMMVLLPGREREEKEWKKLFLDSGFS  418

Query  168  DYKIILILGVRSLIEAYP  115
             YKI  ILG+RSLIE YP
Sbjct  419  GYKITPILGLRSLIEVYP  436



>ref|XP_002326036.2| hypothetical protein POPTR_0019s12290g [Populus trichocarpa]
 gb|EEF00418.2| hypothetical protein POPTR_0019s12290g [Populus trichocarpa]
Length=357

 Score =   102 bits (255),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -2

Query  333  GGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKII  154
            GGK+IIIDMV+ N +  E S ETQ+ FDML MI +TG++R EK+WAKLF +AGFS+YKI 
Sbjct  285  GGKLIIIDMVVENNKEVEGSTETQLFFDMLMMILVTGKERNEKEWAKLFTDAGFSNYKIN  344

Query  153  LILGVRSLIEAYP  115
             +LG+RSLIE YP
Sbjct  345  PVLGLRSLIEVYP  357



>ref|XP_004235335.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=445

 Score =   103 bits (256),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/76 (61%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KENGGK+I+ID+VI N + D KS ETQ+  D+L M+ ++G++R E++WAKLF  AGFSDY
Sbjct  370  KENGGKVIVIDIVIDNQKRDNKSFETQLFSDVLMMVHVSGKERNEQEWAKLFSNAGFSDY  429

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RS+IE YP
Sbjct  430  KISPILGLRSVIEVYP  445



>emb|CDP21787.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   102 bits (254),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 60/78 (77%), Gaps = 3/78 (4%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVR---NDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGF  172
            KE GGK+II+DM   +++   +D ++IETQ+ FDM  M+ L GRQR EKDWAKLF EAGF
Sbjct  286  KEKGGKVIIVDMFCKSLQKGDDDHETIETQLFFDMEVMVLLKGRQRNEKDWAKLFTEAGF  345

Query  171  SDYKIILILGVRSLIEAY  118
            SDYKI  +LG+RS+IE Y
Sbjct  346  SDYKITAVLGLRSIIEVY  363



>ref|XP_006469135.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=402

 Score =   102 bits (254),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/72 (65%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIIL  151
            GK+IIIDM+  N + D +SIETQ+ FDML M+ +TG +R EK+WAKLF +AGFSDYKI  
Sbjct  331  GKVIIIDMMRENKKGDSESIETQLFFDMLMMVLVTGTERDEKEWAKLFADAGFSDYKITP  390

Query  150  ILGVRSLIEAYP  115
            ILG+RSLIE YP
Sbjct  391  ILGLRSLIEVYP  402



>ref|NP_001268044.1| trans-resveratrol di-O-methyltransferase [Vitis vinifera]
 gb|AEP17011.1| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   102 bits (254),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 48/76 (63%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KENGGK+IIIDM++   + D KSIETQ+ FDM  MI   GR+R E +W KLF  AGFS Y
Sbjct  282  KENGGKVIIIDMIMMKNQGDYKSIETQLFFDMTMMIFAPGRERDENEWEKLFLGAGFSHY  341

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  342  KITPILGLRSLIEVYP  357



>gb|AEF97347.1| O-methyltransferase [Vitis pseudoreticulata]
Length=357

 Score =   102 bits (254),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/76 (62%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KENGGK+IIIDM++   + D KS ETQ+ FDM  MI   GR+R E +W KLF +AGFS Y
Sbjct  282  KENGGKVIIIDMIMMKNQGDYKSTETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHY  341

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  342  KITPILGLRSLIEVYP  357



>ref|XP_002281368.2| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   102 bits (254),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/76 (62%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KENGGK+IIIDM++   + D KS ETQ+ FDM  MI   GR+R E +W KLF +AGFS Y
Sbjct  282  KENGGKVIIIDMIMMKNQGDYKSTETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHY  341

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  342  KITPILGLRSLIEVYP  357



>ref|XP_006446728.1| hypothetical protein CICLE_v10015708mg [Citrus clementina]
 gb|ESR59968.1| hypothetical protein CICLE_v10015708mg [Citrus clementina]
Length=362

 Score =   102 bits (253),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/72 (65%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIIL  151
            GK+IIIDM+  N + D +SIETQ+ FDML M+ +TG +R EK+WAKLF +AGFSDYKI  
Sbjct  291  GKVIIIDMMRENKKGDSESIETQLFFDMLMMVLVTGTERDEKEWAKLFADAGFSDYKITP  350

Query  150  ILGVRSLIEAYP  115
            ILG+RSLIE YP
Sbjct  351  ILGLRSLIEVYP  362



>emb|CAQ76879.1| resveratrol O-methyltransferase [Vitis vinifera]
Length=357

 Score =   101 bits (252),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 47/76 (62%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KENGGK+IIIDM++   + D KS ETQ+ FDM  MI   GR+R E +W KLF +AGFS Y
Sbjct  282  KENGGKVIIIDMIMMKNQGDYKSTETQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHY  341

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  342  KITPILGLRSLIEVYP  357



>ref|XP_004979388.1| PREDICTED: 5-pentadecatrienyl resorcinol O-methyltransferase-like 
[Setaria italica]
Length=366

 Score =   101 bits (252),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 47/76 (62%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            ++ GGK+IIIDMV+G   ++EK  ETQ+LFD+L MIAL G +R E++W K+FFEAGF DY
Sbjct  292  RDAGGKVIIIDMVLGWGPSEEKHTETQLLFDLL-MIALNGVERDEQEWKKIFFEAGFKDY  350

Query  162  KIILILGVRSLIEAYP  115
            KII +LG+RS+IE YP
Sbjct  351  KIITLLGIRSIIELYP  366



>gb|ABQ02270.2| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   101 bits (252),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 47/76 (62%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KENGGK+IIIDM++   + D KS ETQ+ FDM  MI   GR+R E +W KLF +AGFS Y
Sbjct  282  KENGGKVIIIDMIMMKNQGDYKSTETQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHY  341

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  342  KITPILGLRSLIEVYP  357



>sp|B6VJS4.2|ROMT_VITVI RecName: Full=Trans-resveratrol di-O-methyltransferase; AltName: 
Full=Resveratrol O-methyltransferase; Short=ROMT; Short=VvROMT 
[Vitis vinifera]
Length=357

 Score =   101 bits (252),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 47/76 (62%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KENGGK+IIIDM++   + D KS ETQ+ FDM  MI   GR+R E +W KLF +AGFS Y
Sbjct  282  KENGGKVIIIDMIMMKNQGDYKSTETQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHY  341

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  342  KITPILGLRSLIEVYP  357



>emb|CBI21929.3| unnamed protein product [Vitis vinifera]
Length=294

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KENGGK+IIIDM++   + D KSIETQ+ FDM  MI   GR+R E +W KLF +AGFS Y
Sbjct  219  KENGGKVIIIDMIMMKNQGDYKSIETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHY  278

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  279  KITPILGLRSLIEVYP  294



>emb|CBI21931.3| unnamed protein product [Vitis vinifera]
Length=278

 Score =   100 bits (250),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KENGGK+IIIDM++   + D KSIETQ+ FDM  MI   GR+R E +W KLF +AGFS Y
Sbjct  203  KENGGKVIIIDMIMMKNQGDYKSIETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHY  262

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  263  KITPILGLRSLIEVYP  278



>gb|AFX68805.1| O-metyltransferase [Vitis riparia]
Length=357

 Score =   101 bits (251),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 47/76 (62%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KENGGK+IIIDM++   + D KSIETQ+ FDM   I   GR+R E +W KLF +AGFS Y
Sbjct  282  KENGGKVIIIDMIMMKNQGDYKSIETQLFFDMTMTIFAPGRERDENEWEKLFLDAGFSHY  341

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  342  KITPILGLRSLIEVYP  357



>emb|CAN69556.1| hypothetical protein VITISV_027590 [Vitis vinifera]
Length=323

 Score =   100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KENGGK+IIIDM++   + D KSIETQ+ FDM  MI   GR+R E +W KLF +AGFS Y
Sbjct  248  KENGGKVIIIDMIMMKNQGDYKSIETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHY  307

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  308  KITPILGLRSLIEVYP  323



>ref|XP_011091578.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=360

 Score =   101 bits (251),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 45/75 (60%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = -2

Query  339  ENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYK  160
            E  GK+IIIDMVI + + D KS+ET++ FDML M  + GR+R EK+WAKLF +AGFSDY+
Sbjct  286  EKKGKVIIIDMVIDDQKCDHKSVETKLFFDMLMMTIVGGRERNEKEWAKLFSDAGFSDYR  345

Query  159  IILILGVRSLIEAYP  115
            I  +LG+RS+IE YP
Sbjct  346  ISSLLGLRSIIEVYP  360



>ref|NP_001267963.1| O-methyltransferase [Vitis vinifera]
 gb|AEP17010.1| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   100 bits (250),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 47/76 (62%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KE GGK+IIIDM++   + D KSIETQ+ FDM  MI   GR+R E +W KLF +AGFS Y
Sbjct  282  KEKGGKVIIIDMIMMKNQGDYKSIETQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHY  341

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  342  KITPILGLRSLIEVYP  357



>emb|CDP19708.1| unnamed protein product [Coffea canephora]
Length=212

 Score = 99.0 bits (245),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 62/78 (79%), Gaps = 3/78 (4%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVR---NDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGF  172
            KENGGK+IIIDMV+ + +   +D ++IETQ+  DML M+ L G+QR E++WAKLF EAGF
Sbjct  134  KENGGKVIIIDMVLSDQQKGADDHEAIETQLFSDMLMMVLLRGKQRNEREWAKLFSEAGF  193

Query  171  SDYKIILILGVRSLIEAY  118
            +DYKI  +LG+RSL+E Y
Sbjct  194  NDYKITPVLGLRSLVEVY  211



>emb|CAA11131.1| O-methyltransferase [Prunus dulcis]
Length=356

 Score =   100 bits (249),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 46/76 (61%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KE  GK+II+DMV+   + D++SIETQ+ FDML M+  TG++R EK+WAKLF +AGFSDY
Sbjct  282  KEKKGKVIIVDMVMKQ-KGDDQSIETQLFFDMLMMVLFTGKERTEKEWAKLFSDAGFSDY  340

Query  162  KIILILGVRSLIEAYP  115
            KI  I G+R LIE YP
Sbjct  341  KITPICGLRYLIEVYP  356



>ref|XP_010093978.1| Tabersonine 16-O-methyltransferase [Morus notabilis]
 gb|EXB54965.1| Tabersonine 16-O-methyltransferase [Morus notabilis]
Length=364

 Score =   100 bits (249),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 47/76 (62%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KE G K+IIIDMVI N + D+KS ETQ+ FDML M+ LTGR+R +K+W  LF  AGFS Y
Sbjct  289  KEKGEKVIIIDMVIENPKMDKKSAETQLYFDMLMMVNLTGRERNQKEWESLFVAAGFSHY  348

Query  162  KIILILGVRSLIEAYP  115
            KI  I+G+RSL+E YP
Sbjct  349  KITPIVGLRSLMEVYP  364



>ref|XP_009594948.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=359

 Score =   100 bits (249),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KENGGK+IIID+V+ + + D KS ETQ+  D L M+ ++G++R  ++W KLF +AGFSDY
Sbjct  284  KENGGKVIIIDIVVDSQKGDNKSFETQLFSDTLMMVHVSGKERNREEWVKLFCDAGFSDY  343

Query  162  KIILILGVRSLIEAYP  115
            KII ILG+RSLIE YP
Sbjct  344  KIIPILGLRSLIEVYP  359



>ref|XP_011002663.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   100 bits (249),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -2

Query  333  GGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKII  154
            GGK++II+M++ N + +++SIETQI FDML MI  TG++R EK+WAKLF +AGFS+YKI 
Sbjct  285  GGKVMIIEMMMENQKGEDESIETQIFFDMLMMILFTGQERNEKEWAKLFSDAGFSNYKIT  344

Query  153  LILGVRSLIEAYP  115
             ILG+RS+IE +P
Sbjct  345  PILGLRSIIEVFP  357



>ref|XP_011002662.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   100 bits (248),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -2

Query  333  GGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKII  154
            GGK++II+M++ N + +++SIETQI FDML MI  TG++R EK+WAKLF +AGFS+YKI 
Sbjct  285  GGKVMIIEMMMENQKGEDESIETQIFFDMLMMILFTGQERNEKEWAKLFSDAGFSNYKIT  344

Query  153  LILGVRSLIEAYP  115
             ILG+RS+IE +P
Sbjct  345  PILGLRSIIEVFP  357



>emb|CDP21836.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   100 bits (249),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/78 (59%), Positives = 60/78 (77%), Gaps = 3/78 (4%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVR---NDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGF  172
            KE GGK+II+DM   +++   +D ++IETQ+ FDM+ M+ L  RQR EKDWAKLF EAGF
Sbjct  286  KEKGGKVIIVDMFCKSLQKGDDDHEAIETQLFFDMVVMVLLKRRQRNEKDWAKLFTEAGF  345

Query  171  SDYKIILILGVRSLIEAY  118
            SDYKI  +LG+RS+IE Y
Sbjct  346  SDYKITAVLGLRSIIEVY  363



>ref|XP_007132750.1| hypothetical protein PHAVU_011G122000g [Phaseolus vulgaris]
 gb|ESW04744.1| hypothetical protein PHAVU_011G122000g [Phaseolus vulgaris]
Length=297

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = -2

Query  339  ENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYK  160
            ++ GK+IIID VIGNV+ D +S +T++ +DM  M+ +TG+QR EKDWAKLFF AGF+ YK
Sbjct  223  KDKGKVIIIDTVIGNVKGDSESEQTKLYYDMEMMVLVTGKQRNEKDWAKLFFSAGFNHYK  282

Query  159  IILILGVRSLIEAYP  115
            I  +LG +SLIE YP
Sbjct  283  ITQVLGFKSLIEVYP  297



>emb|CBI22005.3| unnamed protein product [Vitis vinifera]
Length=309

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KENGGK+IIIDM++   + D KS ETQ+ FDM  MI   GR+R E +W KLF +AGFS Y
Sbjct  234  KENGGKVIIIDMIMMKNQGDYKSTETQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHY  293

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  294  KITPILGLRSLIEVYP  309



>ref|XP_010088036.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXB31255.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=373

 Score =   100 bits (248),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/72 (64%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIIL  151
            GK+IIID++I N   D+KS ETQ+ FDM+ M+  TG++R EK+WAKLF ++GFSDYKII 
Sbjct  302  GKVIIIDIMIENKDEDDKSYETQLFFDMMMMVLATGQERNEKEWAKLFQDSGFSDYKIIP  361

Query  150  ILGVRSLIEAYP  115
            ILG+RSLIE YP
Sbjct  362  ILGLRSLIEVYP  373



>emb|CDP17644.1| unnamed protein product [Coffea canephora]
Length=347

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/80 (58%), Positives = 62/80 (78%), Gaps = 5/80 (6%)
 Frame = -2

Query  342  KENGGKIIIIDMVI-----GNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEA  178
            KE GGK+IIIDM++     G+  ++ ++IETQ+ FDML M+ + GR+R EKDWAKLFFEA
Sbjct  266  KEKGGKVIIIDMLLKSRQNGDDDDNAEAIETQLFFDMLMMVLVKGRERNEKDWAKLFFEA  325

Query  177  GFSDYKIILILGVRSLIEAY  118
            GF+ YKI  +LG+RS+IE Y
Sbjct  326  GFNGYKITPVLGLRSIIEVY  345



>ref|XP_002262833.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=358

 Score =   100 bits (248),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+ GGK++IIDMV+ N + D++++ETQ+ +DML M  LTG+QR E +W KLF  AGF+ Y
Sbjct  283  KDKGGKLMIIDMVMENNKGDDQAVETQLFWDMLMMTVLTGKQRNENEWKKLFVTAGFTHY  342

Query  162  KIILILGVRSLIEAYP  115
            KI  +LG RSLIE YP
Sbjct  343  KISAVLGFRSLIEVYP  358



>ref|XP_011091580.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=358

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -2

Query  339  ENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYK  160
            E GGK++II+MV+ +  +D KS+ETQ+LFDML M  + G++R +K+WAKLF +AGF++YK
Sbjct  284  EKGGKVVIIEMVVDDQNSDHKSVETQLLFDMLMMTVVGGKERNQKEWAKLFSDAGFTNYK  343

Query  159  IILILGVRSLIEAYP  115
            I  +LG+RS+IE YP
Sbjct  344  ISPLLGIRSIIEVYP  358



>gb|KDO36159.1| hypothetical protein CISIN_1g040309mg, partial [Citrus sinensis]
Length=100

 Score = 95.1 bits (235),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+ GGK+IIIDM I N   D++S+ETQ+ FD+L +    G++R+  DW KLF  AGFS Y
Sbjct  25   KDEGGKVIIIDMAIENQSQDKESMETQLCFDILMVSLFRGKERSVDDWKKLFLAAGFSHY  84

Query  162  KIILILGVRSLIEAYP  115
            KI  ILGVRSLIEAYP
Sbjct  85   KITPILGVRSLIEAYP  100



>ref|XP_004158564.1| PREDICTED: LOW QUALITY PROTEIN: trans-resveratrol di-O-methyltransferase-like 
[Cucumis sativus]
Length=363

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 44/76 (58%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            ++ GGK+IIIDMV+   + D++S ETQ+LFD+L M+ L G++R E +W  LF EAGFS Y
Sbjct  287  RDEGGKLIIIDMVMXKKKEDKESTETQLLFDLLMMVNLNGKERNENEWKNLFMEAGFSGY  346

Query  162  KIILILGVRSLIEAYP  115
            KII  LG+RSLIE YP
Sbjct  347  KIISKLGLRSLIEVYP  362



>ref|XP_011016237.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 45/76 (59%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            ++  GK+IIIDMV  N+  DE SIETQ+LFD+  M+A +G +R EK+WAKLFF+AGF +Y
Sbjct  284  QQKAGKVIIIDMVRENLSGDEGSIETQLLFDLEIMVAASGMERNEKEWAKLFFDAGFLNY  343

Query  162  KIILILGVRSLIEAYP  115
            KI  +LG R+LIE YP
Sbjct  344  KIHSVLGTRALIELYP  359



>gb|KDP35392.1| hypothetical protein JCGZ_10376 [Jatropha curcas]
Length=224

 Score = 97.4 bits (241),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            +EN  K+IIIDMV+GN  +D+  IE +  FD+L M  L GRQR E++WAKLFF+AGF+ Y
Sbjct  149  QENNNKVIIIDMVMGNKNSDDDCIEAEQFFDILEMGCLNGRQRNEEEWAKLFFDAGFTKY  208

Query  162  KIILILGVRSLIEAYP  115
            KI  +LG R LIE YP
Sbjct  209  KINYVLGPRPLIEVYP  224



>ref|XP_006376386.1| hypothetical protein POPTR_0013s12560g [Populus trichocarpa]
 ref|XP_006376390.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54183.1| hypothetical protein POPTR_0013s12560g [Populus trichocarpa]
 gb|ERP54187.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 44/76 (58%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            ++  GK+IIIDMV  N+  DE SIETQ+LFD+  M+  +G +R EK+WAKLFF+AGF +Y
Sbjct  284  QQKAGKVIIIDMVRENLNGDEGSIETQLLFDLQLMVGFSGMERNEKEWAKLFFDAGFLNY  343

Query  162  KIILILGVRSLIEAYP  115
            KI  +LG R+LIE YP
Sbjct  344  KIHPVLGTRALIELYP  359



>gb|KDP35397.1| hypothetical protein JCGZ_10381 [Jatropha curcas]
Length=355

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 44/76 (58%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            +EN  K+IIIDMV+GN  +D+  IE ++ FDM  M  LTG+QR E++WAKLFF+AGF  Y
Sbjct  280  QENNNKVIIIDMVMGNKNSDDDCIEAELFFDMAEMAYLTGKQRNEEEWAKLFFDAGFIKY  339

Query  162  KIILILGVRSLIEAYP  115
            KI  +LG R+LIE YP
Sbjct  340  KINYVLGPRALIEVYP  355



>emb|CBI38115.3| unnamed protein product [Vitis vinifera]
Length=270

 Score = 97.8 bits (242),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+ GGK++IIDMV+ N + D++++ETQ+ +DML M  LTG+QR E +W KLF  AGF+ Y
Sbjct  195  KDKGGKLMIIDMVMENNKGDDQAVETQLFWDMLMMTVLTGKQRNENEWKKLFVTAGFTHY  254

Query  162  KIILILGVRSLIEAYP  115
            KI  +LG RSLIE YP
Sbjct  255  KISAVLGFRSLIEVYP  270



>ref|XP_006371493.1| hypothetical protein POPTR_0019s12280g [Populus trichocarpa]
 gb|ERP49290.1| hypothetical protein POPTR_0019s12280g [Populus trichocarpa]
Length=283

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -2

Query  333  GGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKII  154
            GGK++IIDM++ N + +++SIETQI FDML MI +TG++R EK+WAKLF +AGFS++KI 
Sbjct  211  GGKVMIIDMMMENQKGEDESIETQIFFDMLMMILVTGQERNEKEWAKLFSDAGFSNFKIT  270

Query  153  LILGVRSLIEAYP  115
             ILG+RS+IE +P
Sbjct  271  PILGLRSIIEVFP  283



>ref|XP_003544912.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
1 [Glycine max]
Length=358

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K   GK+IIIDMV+ N + D++S+ETQ+ FDML M+ +TG++R++K+WAKL   AG+++Y
Sbjct  283  KGKEGKVIIIDMVVENEKRDDESVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNY  342

Query  162  KIILILGVRSLIEAYP  115
            KI  +LG+RSLIE YP
Sbjct  343  KITPVLGLRSLIEIYP  358



>ref|XP_003544914.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X1 [Glycine max]
Length=358

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K   GK+IIIDMV+ N + D++S+ETQ+ FDML M+ +TG++R++K+WAKL   AG+++Y
Sbjct  283  KGKEGKVIIIDMVVENEKRDDESVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNY  342

Query  162  KIILILGVRSLIEAYP  115
            KI  +LG+RSLIE YP
Sbjct  343  KITPVLGLRSLIEIYP  358



>ref|XP_006376388.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54185.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=365

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 44/75 (59%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            ++  GK+IIIDMV  N+  DE SIETQ+ FD+L M+A++G +R EK+WAKLFF+AGF +Y
Sbjct  290  QQKAGKVIIIDMVRENLNGDEGSIETQLFFDLLMMVAVSGMERNEKEWAKLFFDAGFLNY  349

Query  162  KIILILGVRSLIEAY  118
            KI  +LG R+LIE Y
Sbjct  350  KIHPVLGTRALIELY  364



>ref|XP_002437453.1| hypothetical protein SORBIDRAFT_10g027360 [Sorghum bicolor]
 gb|EER88820.1| hypothetical protein SORBIDRAFT_10g027360 [Sorghum bicolor]
Length=372

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 45/76 (59%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            ++ GGKIIIIDMV+G+  +D K IETQ+LFD++ M+ + G +R E +W  +FFEAGF DY
Sbjct  298  RDAGGKIIIIDMVVGSEPSDLKHIETQVLFDLM-MMNVNGVERDENEWKNIFFEAGFKDY  356

Query  162  KIILILGVRSLIEAYP  115
            KII +LGVRS+IE YP
Sbjct  357  KIIPLLGVRSIIELYP  372



>ref|XP_011070200.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=458

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = -2

Query  339  ENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYK  160
            E  GK++II+MV+ +  +D KS+ETQ+ FD L M    GR+R++K+WAKLFF+AGFS+YK
Sbjct  384  EKRGKVVIIEMVVDDQNSDHKSVETQLFFDTLVMTIADGRERSQKEWAKLFFDAGFSNYK  443

Query  159  IILILGVRSLIEAYP  115
            I  +LG+RS+IE YP
Sbjct  444  ISPLLGLRSIIEVYP  458



>ref|XP_002454762.1| hypothetical protein SORBIDRAFT_04g036900 [Sorghum bicolor]
 gb|EES07738.1| hypothetical protein SORBIDRAFT_04g036900 [Sorghum bicolor]
Length=391

 Score = 98.2 bits (243),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            ++ GGK+IIIDMV+G+  +D + +ETQ+LFD+L M  + G +R E++W K+F EAGF DY
Sbjct  317  RDVGGKVIIIDMVVGSESSDNRHVETQVLFDLLVM-TIDGAERDEQEWKKIFLEAGFEDY  375

Query  162  KIILILGVRSLIEAYP  115
            KII +LGVRS+IE YP
Sbjct  376  KIIPVLGVRSIIELYP  391



>gb|KDO73905.1| hypothetical protein CISIN_1g017835mg [Citrus sinensis]
Length=365

 Score = 98.2 bits (243),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  333  GGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKII  154
             GK+IIID+ + + + D K+ ETQ+  DML M+ + G +R EK+WAKLFFEAGFSDYKI 
Sbjct  293  AGKVIIIDIKMESEKADYKTTETQLFMDMLMMVLVKGEERNEKEWAKLFFEAGFSDYKIT  352

Query  153  LILGVRSLIEAYP  115
             +LGVRSLIE YP
Sbjct  353  DVLGVRSLIEVYP  365



>emb|CAN70493.1| hypothetical protein VITISV_002330 [Vitis vinifera]
Length=363

 Score = 97.8 bits (242),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 45/78 (58%), Positives = 57/78 (73%), Gaps = 2/78 (3%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVR--NDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFS  169
            KE GGK++IIDM I N +  +DE  +ETQ+  DML M+   GR+R EK+W KLF ++GFS
Sbjct  286  KEKGGKVMIIDMAIXNKKGDDDESXVETQLFXDMLMMVLXPGREREEKEWKKLFLDSGFS  345

Query  168  DYKIILILGVRSLIEAYP  115
             YKI  ILG+RSLIE YP
Sbjct  346  GYKITPILGLRSLIEVYP  363



>gb|ABZ89567.1| O-methyltransferase 3 [Humulus lupulus]
Length=377

 Score = 97.8 bits (242),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 47/76 (62%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = -2

Query  339  ENGGKIIIIDMVIGNVRN-DEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            + GGK+IIIDM + N ++ D++S ETQ+ FDML M  +TGR+R EK+WAKLF +AGFS+Y
Sbjct  302  KKGGKVIIIDMKVENEKDEDDESYETQLFFDMLMMALVTGRERNEKEWAKLFKDAGFSNY  361

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  362  KITPILGLRSLIEVYP  377



>ref|XP_006452811.1| hypothetical protein CICLE_v10008718mg [Citrus clementina]
 gb|ESR66051.1| hypothetical protein CICLE_v10008718mg [Citrus clementina]
Length=365

 Score = 97.8 bits (242),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  333  GGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKII  154
             GK+IIID+ + + + D K+ ETQ+  DML M+ + G +R EK+WAKLFFEAGFSDYKI 
Sbjct  293  AGKVIIIDIKMESEKADYKTTETQLFMDMLMMVLVKGEERNEKEWAKLFFEAGFSDYKIT  352

Query  153  LILGVRSLIEAYP  115
             +LGVRSLIE YP
Sbjct  353  DVLGVRSLIEVYP  365



>ref|XP_006474725.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=365

 Score = 97.8 bits (242),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  333  GGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKII  154
             GK+IIID+ + + + D K+ ETQ+  DML M+ + G +R EK+WAKLFFEAGFSDYKI 
Sbjct  293  AGKVIIIDIKMESEKADYKTTETQLFMDMLMMVLVKGEERNEKEWAKLFFEAGFSDYKIT  352

Query  153  LILGVRSLIEAYP  115
             +LGVRSLIE YP
Sbjct  353  DVLGVRSLIEVYP  365



>emb|CDP21583.1| unnamed protein product [Coffea canephora]
Length=307

 Score = 97.4 bits (241),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 62/78 (79%), Gaps = 3/78 (4%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVR---NDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGF  172
            KE GGK+IIID+++ + +   +D ++IETQ+LFDML M+ L GR+R EKDWAKLFF AGF
Sbjct  228  KEKGGKVIIIDILLKSQQKGDDDHEAIETQLLFDMLMMVLLKGRERNEKDWAKLFFGAGF  287

Query  171  SDYKIILILGVRSLIEAY  118
            +DYKI   LG+RS+IE Y
Sbjct  288  NDYKITAALGLRSIIEVY  305



>ref|XP_006376381.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54178.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score = 97.8 bits (242),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 45/72 (63%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIIL  151
            GK+IIIDMV  N   DE SIETQ+LFD+  M+A++G +R EK+WAKLFF+AGF +YKI  
Sbjct  288  GKVIIIDMVRENQNRDEGSIETQLLFDLEMMVAVSGMERNEKEWAKLFFDAGFLNYKIHP  347

Query  150  ILGVRSLIEAYP  115
            +LG R+LIE YP
Sbjct  348  VLGTRALIELYP  359



>ref|XP_011037437.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score = 97.4 bits (241),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 44/76 (58%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            ++  GK+IIIDMV  N+  DE SIETQ+LFD+  M+A +G +R E++WAKLFF+AGF +Y
Sbjct  284  QQKAGKVIIIDMVRENLSGDEGSIETQLLFDLEIMVAASGMERNEEEWAKLFFDAGFLNY  343

Query  162  KIILILGVRSLIEAYP  115
            KI  +LG R+LIE YP
Sbjct  344  KIHSVLGTRALIELYP  359



>ref|XP_011091734.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=337

 Score = 97.4 bits (241),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -2

Query  339  ENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYK  160
            E  GK++II+MV+ +  +D KS+ETQ+ FDML M  + G++R +K+WAKLFF+AGF++YK
Sbjct  263  EKRGKVVIIEMVVDDQNSDHKSVETQLFFDMLMMTVVGGKERNQKEWAKLFFDAGFTNYK  322

Query  159  IILILGVRSLIEAYP  115
            I  +LG+RS+IE YP
Sbjct  323  ISPLLGIRSIIEVYP  337



>ref|XP_011091583.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 40/72 (56%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIIL  151
            GK+I+I+MV+ + R++ +S+ETQ+LFDML M  + G++R EK+WAKLF++AGF DY+I  
Sbjct  288  GKVILIEMVVDDERSNTESVETQLLFDMLMMTLVGGKERKEKEWAKLFYDAGFQDYRIYP  347

Query  150  ILGVRSLIEAYP  115
            +LG+RS+IE YP
Sbjct  348  VLGLRSIIEVYP  359



>gb|EYU30782.1| hypothetical protein MIMGU_mgv1a021078mg [Erythranthe guttata]
Length=359

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 40/72 (56%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIIL  151
            GK+II+++V+ + + ++K+ ETQ+LFDML MI +TG++R EK+WA LFF AGFS+YKI  
Sbjct  288  GKVIIVEIVVDDQKENQKATETQLLFDMLMMIEVTGKERTEKEWANLFFSAGFSNYKITP  347

Query  150  ILGVRSLIEAYP  115
            +LG+RS+IE +P
Sbjct  348  VLGLRSIIEVFP  359



>ref|XP_011037442.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=355

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 44/76 (58%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            ++  GK+IIIDMV  N+  DE SIETQ+ FD+  M+A +G +R EK+WAKLFF+AGF +Y
Sbjct  280  QQKAGKVIIIDMVRENLNGDEGSIETQLFFDLQLMVAASGIERNEKEWAKLFFDAGFLNY  339

Query  162  KIILILGVRSLIEAYP  115
            KI  +LG R+LIE YP
Sbjct  340  KIHSVLGTRALIELYP  355



>ref|XP_004303135.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=365

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 57/79 (72%), Gaps = 3/79 (4%)
 Frame = -2

Query  342  KENGGKIIIIDMVI---GNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGF  172
            K +GGK+III+MV+    + + + KS ETQ+ +DML M+ LTGR+R EKDW KLF  AGF
Sbjct  287  KSDGGKVIIIEMVVTVDDDKKMNNKSTETQLFWDMLMMVCLTGRERTEKDWEKLFLAAGF  346

Query  171  SDYKIILILGVRSLIEAYP  115
            S YKI   LG+RS IE YP
Sbjct  347  SHYKITHTLGIRSFIEVYP  365



>ref|XP_002278316.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=359

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/78 (58%), Positives = 56/78 (72%), Gaps = 2/78 (3%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVR--NDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFS  169
            KE GGK++IIDM I N +   DE  +ETQ+  DML M+   GR+R EK+W KLF ++GFS
Sbjct  282  KEKGGKVMIIDMAILNKKGDEDESKVETQLFMDMLMMVLYPGREREEKEWKKLFLDSGFS  341

Query  168  DYKIILILGVRSLIEAYP  115
             YKI  ILG+RSLIE YP
Sbjct  342  GYKITPILGLRSLIEVYP  359



>ref|XP_008455549.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like, partial 
[Cucumis melo]
Length=266

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIIL  151
            GK+++ID+V+ N +ND+ SIE+Q+ FDML M+ + G++R EK+WAKL  EAGFS YKI  
Sbjct  195  GKVMVIDLVLFNTKNDQDSIESQLFFDMLMMVEVGGKEREEKEWAKLVKEAGFSAYKIFP  254

Query  150  ILGVRSLIEAYP  115
            ILG+RSLIE YP
Sbjct  255  ILGLRSLIEIYP  266



>ref|XP_004151906.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
sativus]
 gb|KGN63210.1| hypothetical protein Csa_2G415520 [Cucumis sativus]
Length=363

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 44/76 (58%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            ++ GGK+IIIDMV+   + D +S ETQ+LFD+L M+ L G++R E +W  LF EAGFS Y
Sbjct  287  RDEGGKLIIIDMVMERKKEDIESTETQLLFDLLMMVNLNGKERNENEWKNLFMEAGFSGY  346

Query  162  KIILILGVRSLIEAYP  115
            KII  LG+RSLIE YP
Sbjct  347  KIISKLGLRSLIEVYP  362



>gb|AGQ21572.1| flavone 8-O-methyltransferase [Ocimum basilicum]
Length=359

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 39/73 (53%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  333  GGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKII  154
            GGK+II+DM++G  +  ++++ETQ+ FDM+ M  LTG++R E++WAK+FF AGF  YKI 
Sbjct  287  GGKVIIVDMILGYEKQQDEAVETQLFFDMMMMTTLTGKERTEQEWAKIFFAAGFKTYKIY  346

Query  153  LILGVRSLIEAYP  115
             +LG+RSLIE +P
Sbjct  347  PLLGLRSLIEVFP  359



>ref|XP_003527407.1| PREDICTED: trans-resveratrol di-O-methyltransferase isoform 1 
[Glycine max]
Length=352

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -2

Query  327  KIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIILI  148
            K+IIIDMV+ N + D++SIETQ+  DM+ M+   G++R EK+WAKL F  GFSDYKI  +
Sbjct  282  KVIIIDMVVENEKGDDESIETQLFIDMVVMVLYPGKERTEKEWAKLIFSTGFSDYKITPV  341

Query  147  LGVRSLIEAYP  115
            LG+RSLIE YP
Sbjct  342  LGLRSLIEIYP  352



>ref|XP_011002666.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -2

Query  333  GGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKII  154
            GGK++II+M++ N + ++ SIETQI FDML MI +TG++R EK+WAKLF +A FS+YKI 
Sbjct  285  GGKVMIIEMMMENQKGEDDSIETQIFFDMLMMILVTGQERNEKEWAKLFSDASFSNYKIT  344

Query  153  LILGVRSLIEAYP  115
             ILG+RS+IE +P
Sbjct  345  PILGLRSIIEVFP  357



>ref|XP_006388574.1| hypothetical protein POPTR_0151s00220g [Populus trichocarpa]
 gb|ERP47488.1| hypothetical protein POPTR_0151s00220g [Populus trichocarpa]
Length=326

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIIL  151
            GK+IIIDMV  N   DE SIETQ+LFD+  M+A++G +R EK+WAKLFF+AGF +YKI  
Sbjct  255  GKVIIIDMVRENQNGDEGSIETQLLFDLQMMVAVSGMERNEKEWAKLFFDAGFLNYKIHP  314

Query  150  ILGVRSLIEAYP  115
            +LG R+LIE YP
Sbjct  315  VLGTRALIELYP  326



>ref|XP_003557042.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Glycine 
max]
Length=358

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K   GK+IIIDMV+ N + D++S+ETQ+ FDML M+ +TG++R++K+WAKL   AG+++Y
Sbjct  283  KGKEGKVIIIDMVVENEKRDDESVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNY  342

Query  162  KIILILGVRSLIEAYP  115
            KI  + G+RSLIE YP
Sbjct  343  KITPVFGLRSLIEIYP  358



>ref|XP_002437452.1| hypothetical protein SORBIDRAFT_10g027340 [Sorghum bicolor]
 gb|EER88819.1| hypothetical protein SORBIDRAFT_10g027340 [Sorghum bicolor]
Length=374

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/76 (59%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            ++ GGKIIIIDMV+G+  +D K +ETQ+L D++ M+ L G +R E++W K+FFEAGF DY
Sbjct  300  RDAGGKIIIIDMVVGSEPSDIKHLETQVLHDII-MMNLNGIERDEQEWKKIFFEAGFKDY  358

Query  162  KIILILGVRSLIEAYP  115
            KII +LGVRS+IE YP
Sbjct  359  KIIQLLGVRSIIELYP  374



>emb|CBI30627.3| unnamed protein product [Vitis vinifera]
Length=114

 Score = 92.8 bits (229),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KE GGK+I+ID+VI   + +    E ++LFD+L M  +TGR+R EK+W KLF EAGFS Y
Sbjct  39   KEKGGKVIVIDIVINEKKEEHDITEAKLLFDLLMMTVVTGRERNEKEWEKLFLEAGFSHY  98

Query  162  KIILILGVRSLIEAYP  115
            KI  I G+RSLIE +P
Sbjct  99   KINPIFGLRSLIEVFP  114



>gb|KHN08844.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=329

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIIL  151
            GK+IIIDMV+ N + D++S+ETQ+ FDML M+ +TG++R++K+WAKL   AG+++YKI  
Sbjct  258  GKVIIIDMVVENEKRDDESVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNYKITP  317

Query  150  ILGVRSLIEAYP  115
            +LG+RSLIE YP
Sbjct  318  VLGLRSLIEIYP  329



>ref|XP_006376396.1| hypothetical protein POPTR_0013s12670g [Populus trichocarpa]
 gb|ERP54193.1| hypothetical protein POPTR_0013s12670g [Populus trichocarpa]
Length=359

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            ++  GK+IIIDMV  N+  DE SIETQ+ FD+  M+ + G +R EK+WAKLFF+AGF +Y
Sbjct  284  QQKAGKVIIIDMVRENLNGDEGSIETQLFFDLQMMVVVGGMERNEKEWAKLFFDAGFLNY  343

Query  162  KIILILGVRSLIEAYP  115
            KI  +LG R+LIE YP
Sbjct  344  KIHPVLGTRALIELYP  359



>emb|CDP21661.1| unnamed protein product [Coffea canephora]
Length=364

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 3/78 (4%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVR---NDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGF  172
            KE GGK+II+D    +++   +D ++IETQ+ +DM AM+ + GRQR EKDWAKLF EAGF
Sbjct  286  KEKGGKVIIVDTFCKSLQKGDDDHEAIETQLFYDMGAMVLVKGRQRNEKDWAKLFSEAGF  345

Query  171  SDYKIILILGVRSLIEAY  118
             DYKI  +LG+RS+IE Y
Sbjct  346  CDYKITAVLGLRSIIEVY  363



>emb|CDP15888.1| unnamed protein product [Coffea canephora]
Length=362

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/77 (57%), Positives = 59/77 (77%), Gaps = 3/77 (4%)
 Frame = -2

Query  339  ENGGKIIIIDMVIGNVRN---DEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFS  169
            E GGK+IIIDM++ + +N   D ++IETQ+ FDML M+ + GR+R EKDW KLF EAGF+
Sbjct  284  EKGGKVIIIDMLLKSQQNGDDDAEAIETQLFFDMLMMVHVKGRERNEKDWEKLFLEAGFN  343

Query  168  DYKIILILGVRSLIEAY  118
             YKI  +LG+RS+IE Y
Sbjct  344  GYKITPVLGLRSIIEVY  360



>ref|XP_008455550.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
melo]
Length=267

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  336  NGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKI  157
            N GK+++ID+V+ N +ND+ SIETQ+  DML M+   G++R EK+WAKL  EAGFS YKI
Sbjct  194  NKGKVMVIDLVLFNKKNDQDSIETQLFHDMLMMVVTGGKEREEKEWAKLIKEAGFSAYKI  253

Query  156  ILILGVRSLIEAYP  115
              ILG+RSLIE YP
Sbjct  254  FPILGLRSLIEIYP  267



>ref|XP_004252468.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=362

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 61/79 (77%), Gaps = 3/79 (4%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGN---VRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGF  172
            KE GGK+IIIDMV+ +    + D KS ETQ+ FDML M+ ++G++R ++DWAKLF  AGF
Sbjct  284  KEKGGKVIIIDMVLMDRKIEKGDGKSYETQLFFDMLMMVHVSGKERNQQDWAKLFCSAGF  343

Query  171  SDYKIILILGVRSLIEAYP  115
            SDY II +LG+RS+IE +P
Sbjct  344  SDYNIIPMLGLRSIIEVFP  362



>gb|KHN07780.1| Tabersonine 16-O-methyltransferase [Glycine soja]
Length=323

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIIL  151
             K+IIIDMV+ N + D++SIETQ+  DM+ M+   G++R EK+WAKL F  GFSDYKI  
Sbjct  252  SKVIIIDMVVENEKGDDESIETQLFIDMVVMVLYPGKERTEKEWAKLIFSTGFSDYKITP  311

Query  150  ILGVRSLIEAYP  115
            +LG+RSLIE YP
Sbjct  312  VLGLRSLIEIYP  323



>ref|XP_002441380.1| hypothetical protein SORBIDRAFT_09g025570 [Sorghum bicolor]
 gb|EES19810.1| hypothetical protein SORBIDRAFT_09g025570 [Sorghum bicolor]
Length=359

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = -2

Query  333  GGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKII  154
            GGK++I+DMV+G   +DEK +ETQILFD+  M+ + G +R E +W K+ FEAGFS YKII
Sbjct  288  GGKVVILDMVVGAGSSDEKHVETQILFDLF-MMFINGAERDELEWKKIIFEAGFSSYKII  346

Query  153  LILGVRSLIEAYP  115
             +LGVRS+IE YP
Sbjct  347  PVLGVRSIIEVYP  359



>ref|XP_006376392.1| hypothetical protein POPTR_0013s12620g [Populus trichocarpa]
 gb|ERP54189.1| hypothetical protein POPTR_0013s12620g [Populus trichocarpa]
Length=355

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 44/76 (58%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            ++  GK+IIIDMV  N+  D  SIETQ+ FD+  M+A TG +R EK+WAKLFF+AGF +Y
Sbjct  280  QQKAGKVIIIDMVRENLNGDGGSIETQLFFDLQMMVAATGMERNEKEWAKLFFDAGFLNY  339

Query  162  KIILILGVRSLIEAYP  115
            KI  +LG R+LIE YP
Sbjct  340  KIHPVLGTRALIELYP  355



>gb|KCW44789.1| hypothetical protein EUGRSUZ_L01645 [Eucalyptus grandis]
Length=349

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 40/70 (57%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -2

Query  324  IIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIILIL  145
            +III+MV+ N ++D++ +ETQ+ +DML M   +GR+R E +WAKLF  AGF DYKI L+L
Sbjct  279  VIIIEMVMDNTKSDKEMVETQLFYDMLMMTVASGRERNEAEWAKLFVAAGFGDYKITLVL  338

Query  144  GVRSLIEAYP  115
            G+RSLIE YP
Sbjct  339  GLRSLIEVYP  348



>ref|XP_002305103.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|EEE85614.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KE GGK+II+D+VI   +++++  ET++LFDML M+   G++R+ K+W KLF EAGFS Y
Sbjct  284  KEKGGKVIIVDVVIDEKKDEKELTETKLLFDMLMMVVAAGKERSVKEWEKLFLEAGFSHY  343

Query  162  KIILILGVRSLIEAYP  115
            KI  + G+RSLIE YP
Sbjct  344  KITPLFGLRSLIEVYP  359



>ref|XP_004975403.1| PREDICTED: 5-pentadecatrienyl resorcinol O-methyltransferase-like 
[Setaria italica]
Length=366

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            ++ GGK+IIIDMV+G+  +D + +ETQ+L+D+L M  + G +R E++W K+F EAGF+DY
Sbjct  292  RDKGGKVIIIDMVVGSESSDTRHLETQVLYDLLIM-GINGVERDEQEWKKIFLEAGFNDY  350

Query  162  KIILILGVRSLIEAYP  115
            KI+ ILGVRS+IE YP
Sbjct  351  KIMSILGVRSIIELYP  366



>ref|XP_007043718.1| Flavonoid o-methyltransferase related [Theobroma cacao]
 gb|EOX99549.1| Flavonoid o-methyltransferase related [Theobroma cacao]
Length=364

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 45/75 (60%), Positives = 58/75 (77%), Gaps = 2/75 (3%)
 Frame = -2

Query  333  GGKIIIIDMVI--GNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYK  160
            GGK IIIDMV+   N + ++ SIETQ+ FDML M+ +TG++R E++WA LF  AGFSDYK
Sbjct  290  GGKAIIIDMVLTEKNHKVNDASIETQLFFDMLMMVLVTGKERNEEEWATLFLAAGFSDYK  349

Query  159  IILILGVRSLIEAYP  115
            I  I+G+RSLIE YP
Sbjct  350  ITPIMGLRSLIEVYP  364



>ref|XP_009764108.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=360

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KEN GK+IIID+V+ + + D KS ETQ+  D+L M+ ++G++R  ++WAKLF +AGFSDY
Sbjct  285  KENRGKVIIIDIVVDSQKGDNKSFETQLFSDILMMVHVSGKERNREEWAKLFCDAGFSDY  344

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RS+IE YP
Sbjct  345  KINPILGLRSVIEVYP  360



>ref|XP_003633245.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -2

Query  333  GGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKII  154
            GGK+IIIDMV+ + + D K++ETQ+  DML M+ + G++R EK+W KLF  AGF+ YKI 
Sbjct  285  GGKVIIIDMVVESNKGDNKAVETQLFIDMLMMVVVAGKERNEKEWEKLFLAAGFTHYKIT  344

Query  153  LILGVRSLIEAYP  115
              LG+RSLIE YP
Sbjct  345  PALGLRSLIEVYP  357



>ref|XP_010052409.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW89598.1| hypothetical protein EUGRSUZ_A01881 [Eucalyptus grandis]
Length=358

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 40/70 (57%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -2

Query  324  IIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIILIL  145
            +IIIDMV+ N ++D++++ETQ+ +DML M   +GR+R E +WAKLF  AGF DYKI  +L
Sbjct  289  VIIIDMVMDNTKSDKETVETQLFYDMLMMTLASGRERNEAEWAKLFVAAGFGDYKITPVL  348

Query  144  GVRSLIEAYP  115
            G+RSLIE YP
Sbjct  349  GLRSLIEVYP  358



>gb|KDP35391.1| hypothetical protein JCGZ_10375 [Jatropha curcas]
Length=356

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            +EN  K+IIIDMV+GN  +++  IE ++LFDM  M  LTG+QR E++W+KLF +AGF+ Y
Sbjct  281  RENNNKVIIIDMVMGNQNSNDDWIEAELLFDMAEMACLTGKQRNEEEWSKLFMDAGFTKY  340

Query  162  KIILILGVRSLIEAYP  115
            KI  +LG R+LIE YP
Sbjct  341  KINYLLGPRALIEVYP  356



>gb|KDP24057.1| hypothetical protein JCGZ_25714 [Jatropha curcas]
Length=307

 Score = 95.1 bits (235),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = -2

Query  333  GGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKII  154
            GGK+II+DMV+G  + +  SIETQ+ FDM+ M+   G++R +++WAKLF +AGFSDYKI 
Sbjct  235  GGKLIIVDMVMGTQKQNNDSIETQLFFDMMMMVLFNGKERNKEEWAKLFSDAGFSDYKIT  294

Query  153  LILGVRSLIEAYP  115
              LG+RS+IE YP
Sbjct  295  HKLGLRSVIEVYP  307



>gb|ABK96707.1| unknown [Populus trichocarpa x Populus deltoides]
Length=359

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            ++  GK+IIIDMV  N+  DE SIETQ+ FD+  M+   G +R EK+WAKLFF+AGF +Y
Sbjct  284  QQKAGKVIIIDMVRENLNGDEGSIETQLFFDLQMMVVAGGMERNEKEWAKLFFDAGFLNY  343

Query  162  KIILILGVRSLIEAYP  115
            KI  +LG R+LIE YP
Sbjct  344  KIYPVLGPRALIELYP  359



>ref|XP_004987341.1| PREDICTED: O-methyltransferase ZRP4-like isoform X1 [Setaria 
italica]
Length=387

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 43/77 (56%), Positives = 60/77 (78%), Gaps = 2/77 (3%)
 Frame = -2

Query  342  KENGGKIIIIDMVIG-NVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSD  166
            KE GGK+II+D+++G    +D+K +ETQ+LFD+  M  + G +R E++W  + FEAGFSD
Sbjct  312  KERGGKVIILDIMVGAGSSSDQKHVETQVLFDLFIMF-INGAERDEQEWKNIIFEAGFSD  370

Query  165  YKIILILGVRSLIEAYP  115
            YKII +LGVRS+IEAYP
Sbjct  371  YKIIPVLGVRSIIEAYP  387



>ref|XP_004961502.1| PREDICTED: O-methyltransferase ZRP4-like isoform X1 [Setaria 
italica]
Length=387

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 43/77 (56%), Positives = 60/77 (78%), Gaps = 2/77 (3%)
 Frame = -2

Query  342  KENGGKIIIIDMVIG-NVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSD  166
            KE GGK+II+D+++G    +D+K +ETQ+LFD+  M  + G +R E++W  + FEAGFSD
Sbjct  312  KERGGKVIILDIMVGAGSSSDQKHVETQVLFDLFIMF-INGAERDEQEWKNIIFEAGFSD  370

Query  165  YKIILILGVRSLIEAYP  115
            YKII +LGVRS+IEAYP
Sbjct  371  YKIIPVLGVRSIIEAYP  387



>ref|XP_011100227.1| PREDICTED: 8-hydroxyquercetin 8-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+II+D+V+ + + + K+IETQ+ FDML M   +GR+R EKDWA+LFF AGF+ Y
Sbjct  285  KDKKGKVIIVDIVV-DFQKEHKAIETQLFFDMLMMNVASGRERTEKDWAELFFAAGFTSY  343

Query  162  KIILILGVRSLIEAYP  115
            KI  +LG+RSLIE +P
Sbjct  344  KITPVLGLRSLIELFP  359



>gb|ACU19152.1| unknown [Glycine max]
Length=282

 Score = 94.7 bits (234),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIIL  151
            GK+IIIDMV+ N + D++S+ETQ+ FDML M+ +TG++R++K+WAKL   AG+++YKI  
Sbjct  211  GKVIIIDMVVENEKRDDESVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNYKITP  270

Query  150  ILGVRSLIEAYP  115
            + G+RSLIE YP
Sbjct  271  VFGLRSLIEIYP  282



>gb|KDP35402.1| hypothetical protein JCGZ_10386 [Jatropha curcas]
Length=305

 Score = 95.1 bits (235),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            +EN  K+IIIDMV+GN  +D    E ++LFDM  M  LTG+QR E++WAKLF +AGF+ Y
Sbjct  230  RENNNKVIIIDMVMGNKTSDGDLAEAELLFDMTVMACLTGKQRNEEEWAKLFIDAGFTKY  289

Query  162  KIILILGVRSLIEAYP  115
            KI  +LG R+LIE YP
Sbjct  290  KINYVLGPRALIEVYP  305



>ref|XP_004961504.1| PREDICTED: O-methyltransferase ZRP4-like [Setaria italica]
Length=366

 Score = 95.1 bits (235),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 43/77 (56%), Positives = 60/77 (78%), Gaps = 2/77 (3%)
 Frame = -2

Query  342  KENGGKIIIIDMVIG-NVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSD  166
            KE GGK+II+D+++G    +D+K +ETQ+LFD+  M  + G +R E++W  + FEAGFSD
Sbjct  291  KERGGKVIILDIMVGAGSSSDQKHVETQVLFDLFIMF-VNGAERDEQEWKNIIFEAGFSD  349

Query  165  YKIILILGVRSLIEAYP  115
            YKII +LGVRS+IEAYP
Sbjct  350  YKIIPVLGVRSIIEAYP  366



>ref|XP_010023967.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW60370.1| hypothetical protein EUGRSUZ_H03085 [Eucalyptus grandis]
Length=362

 Score = 95.1 bits (235),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 42/72 (58%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIIL  151
            GKII+IDMV+G+   D +S ETQ+ FDML M+    ++R EK+WAKLF +AGFS Y+I+ 
Sbjct  291  GKIIMIDMVVGSQTEDHESTETQLFFDMLMMVTFNAKERDEKEWAKLFADAGFSGYEIVS  350

Query  150  ILGVRSLIEAYP  115
             LG+RSLIE YP
Sbjct  351  HLGLRSLIEIYP  362



>emb|CDP19840.1| unnamed protein product [Coffea canephora]
Length=363

 Score = 95.1 bits (235),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 3/78 (4%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVR---NDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGF  172
            KE GGK+II+D    + +   +D ++IETQ+ +DM AM+ + GRQR E DWAKLF EAGF
Sbjct  286  KEKGGKVIIVDTFCKSQQKGDDDHEAIETQLFYDMGAMVLVKGRQRNETDWAKLFSEAGF  345

Query  171  SDYKIILILGVRSLIEAY  118
            SDYKI  +LG+RS+IE Y
Sbjct  346  SDYKITAVLGLRSIIEVY  363



>ref|XP_008229108.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=355

 Score = 95.1 bits (235),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 42/72 (58%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIIL  151
            GK+II+DM + N   D++S ETQ+ FDML M+ + G++R EK+WAKLF +AGFS YKI  
Sbjct  284  GKVIIVDMTVENKNTDKESGETQLFFDMLMMVLVKGKERNEKEWAKLFSDAGFSHYKITP  343

Query  150  ILGVRSLIEAYP  115
             LG+RSLIE YP
Sbjct  344  CLGLRSLIEVYP  355



>gb|KHN08846.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=263

 Score = 94.4 bits (233),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIIL  151
            GK+IIIDMV+ + + D++S+ETQ+ FDML M+ +TG++R++K+WAKL   AG+++YKI  
Sbjct  192  GKVIIIDMVVEDEKRDDESVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNYKITP  251

Query  150  ILGVRSLIEAYP  115
            +LG+RSLIE YP
Sbjct  252  VLGLRSLIEIYP  263



>ref|XP_010111158.1| Tabersonine 16-O-methyltransferase [Morus notabilis]
 gb|EXC30549.1| Tabersonine 16-O-methyltransferase [Morus notabilis]
Length=369

 Score = 95.1 bits (235),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  336  NGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKI  157
            NGGK+II D+VI   ++D +  E ++ FD+L MI +TGR+R+EKDW KLF EAGFS YKI
Sbjct  257  NGGKVIITDIVINKDKDDPELTEGKLYFDLLMMILVTGRERSEKDWEKLFLEAGFSHYKI  316

Query  156  ILILGVRSLIEAYP  115
              + G+RSLIE +P
Sbjct  317  TPLFGLRSLIEVFP  330



>ref|XP_006469138.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=551

 Score = 96.7 bits (239),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 45/76 (59%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+ GGK+IIIDM I N   D++S+ETQ+ FD+L +    G++R+  DW KLF  AGFS Y
Sbjct  476  KDEGGKVIIIDMAIENQSQDKESMETQLCFDILMVSLFRGKERSVDDWKKLFLAAGFSHY  535

Query  162  KIILILGVRSLIEAYP  115
            KI  ILGVRSLIEAYP
Sbjct  536  KITPILGVRSLIEAYP  551



>ref|XP_002449557.1| hypothetical protein SORBIDRAFT_05g019040 [Sorghum bicolor]
 gb|EES08545.1| hypothetical protein SORBIDRAFT_05g019040 [Sorghum bicolor]
Length=379

 Score = 95.1 bits (235),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 45/77 (58%), Positives = 61/77 (79%), Gaps = 2/77 (3%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGN-VRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSD  166
            ++ GGK+IIIDMV+G+   +D K  ETQ+LFD+L M+AL G +R E++W K+F EAGF D
Sbjct  304  RDAGGKVIIIDMVLGSGPADDVKHKETQVLFDLL-MMALNGVERDEQEWKKIFLEAGFKD  362

Query  165  YKIILILGVRSLIEAYP  115
            YKII +LGVRS++E YP
Sbjct  363  YKIIPVLGVRSIVELYP  379



>ref|XP_006428633.1| hypothetical protein CICLE_v10013393mg [Citrus clementina]
 gb|ESR41873.1| hypothetical protein CICLE_v10013393mg [Citrus clementina]
Length=280

 Score = 94.4 bits (233),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = -2

Query  327  KIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIILI  148
            K+II DM+  N + D KSIETQ+ F+M  M+ LTG +R EK+WAK+F ++GFSDYKII I
Sbjct  210  KVIIKDMIKENRKKDYKSIETQLFFEMFMMVLLTGTERDEKEWAKIFADSGFSDYKIIPI  269

Query  147  LGVRSLIEAYP  115
            LG+RSLIE YP
Sbjct  270  LGLRSLIEIYP  280



>ref|XP_006469069.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=353

 Score = 94.7 bits (234),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 44/76 (58%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+ GGK+IIIDM I N   D++S+ETQ+ FD+L +    G++R+  DW KLF  AGFS Y
Sbjct  278  KDEGGKVIIIDMAIENQSQDKESMETQLCFDILMVSLFRGKERSVDDWKKLFLAAGFSHY  337

Query  162  KIILILGVRSLIEAYP  115
            KI  +LGVRSLIEAYP
Sbjct  338  KITPMLGVRSLIEAYP  353



>gb|KDO37374.1| hypothetical protein CISIN_1g023625mg [Citrus sinensis]
Length=279

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+ GGK+IIIDM I N   D++S+ETQ+ FD+L +    G++R+  DW KLF  AGFS Y
Sbjct  204  KDEGGKVIIIDMAIENQSQDKESMETQLCFDILMVSLFRGKERSVDDWKKLFLAAGFSHY  263

Query  162  KIILILGVRSLIEAYP  115
            KI  +LGVRSLIEAYP
Sbjct  264  KITPMLGVRSLIEAYP  279



>ref|XP_002278092.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=361

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KE GGK+I+ID+VI   + +    E ++LFD+L M  +TGR+R EK+W KLF EAGFS Y
Sbjct  286  KEKGGKVIVIDIVINEKKEEHDITEAKLLFDLLMMTVVTGRERNEKEWEKLFLEAGFSHY  345

Query  162  KIILILGVRSLIEAYP  115
            KI  I G+RSLIE +P
Sbjct  346  KINPIFGLRSLIEVFP  361



>emb|CBI21927.3| unnamed protein product [Vitis vinifera]
Length=277

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 56/78 (72%), Gaps = 2/78 (3%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVR--NDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFS  169
            KE GGK++IIDM I N +   DE  +ETQ+  DML M+   GR+R EK+W KLF ++GFS
Sbjct  200  KEKGGKVMIIDMAILNKKGDEDESKVETQLFMDMLMMVLYPGREREEKEWKKLFLDSGFS  259

Query  168  DYKIILILGVRSLIEAYP  115
             YKI  ILG+RSLIE YP
Sbjct  260  GYKITPILGLRSLIEVYP  277



>ref|XP_006446726.1| hypothetical protein CICLE_v10015705mg [Citrus clementina]
 gb|ESR59966.1| hypothetical protein CICLE_v10015705mg [Citrus clementina]
Length=362

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/72 (61%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIIL  151
            GK+IIIDM+  N + +++S ETQ+ FDML M+  TG +R EK+WAKLF +AGFSDYKI  
Sbjct  291  GKVIIIDMMRENKKGNDESTETQLFFDMLMMVLATGTERDEKEWAKLFADAGFSDYKITS  350

Query  150  ILGVRSLIEAYP  115
            ILG+RSLIE  P
Sbjct  351  ILGLRSLIEVCP  362



>ref|XP_011037436.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=227

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
             +  GK+IIIDMV  N   DE+SIETQ++FD+  M+A++G +R EK+WAKLFF++GF +Y
Sbjct  152  HQKAGKVIIIDMVRENQNGDERSIETQLVFDLAMMVAVSGMERNEKEWAKLFFDSGFLNY  211

Query  162  KIILILGVRSLIEAYP  115
            KI  + G R++IE YP
Sbjct  212  KIHTVPGTRAVIELYP  227



>ref|XP_010040912.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW44790.1| hypothetical protein EUGRSUZ_L01646 [Eucalyptus grandis]
Length=357

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/70 (57%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -2

Query  324  IIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIILIL  145
            +IIIDMV+ N ++D++ +ETQ+ +DML M   +GR+R E +WAKLF  AGF DYKI  +L
Sbjct  287  VIIIDMVMDNTKSDKEMVETQLFYDMLMMTLTSGRERNEAEWAKLFVAAGFGDYKITPVL  346

Query  144  GVRSLIEAYP  115
            G+RSLIE YP
Sbjct  347  GLRSLIEVYP  356



>ref|XP_002525159.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF37286.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = -2

Query  330  GKIIIIDMVIGNVR-NDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKII  154
            GK+IIIDMV+ N +  D +SIE+Q+ FDML M   TG+QR +K+W KLF +AGFSDYKI 
Sbjct  284  GKLIIIDMVLENRQVTDHQSIESQLFFDMLMMTLQTGKQRNKKEWGKLFLDAGFSDYKIT  343

Query  153  LILGVRSLIEAYP  115
             ILG+RS+IE YP
Sbjct  344  PILGLRSVIEVYP  356



>ref|XP_006388573.1| hypothetical protein POPTR_0151s00210g [Populus trichocarpa]
 gb|ERP47487.1| hypothetical protein POPTR_0151s00210g [Populus trichocarpa]
Length=359

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/72 (61%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIIL  151
            GK+IIIDMV  N   DE SI TQ+LFD+  M+AL+G +R EK+WAKLFF+AGF +YKI  
Sbjct  288  GKVIIIDMVRDNRNGDEGSIGTQLLFDLEMMVALSGMERNEKEWAKLFFDAGFLNYKIHP  347

Query  150  ILGVRSLIEAYP  115
            +LG R+L E YP
Sbjct  348  VLGTRALFELYP  359



>emb|CBI21921.3| unnamed protein product [Vitis vinifera]
Length=306

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -2

Query  333  GGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKII  154
            GGK+IIIDMV+ + + D K++ETQ+  DML M+ + G++R EK+W KLF  AGF+ YKI 
Sbjct  234  GGKVIIIDMVVESNKGDNKAVETQLFIDMLMMVVVAGKERNEKEWEKLFLAAGFTHYKIT  293

Query  153  LILGVRSLIEAYP  115
              LG+RSLIE YP
Sbjct  294  PALGLRSLIEVYP  306



>gb|AAR09603.1| O-methyltransferase [Mentha x piperita]
Length=361

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  336  NGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKI  157
            NGGK+I+IDM++ + +   K  ETQ+LFD+L M ALTG++R EK+WA LFF AGF  YKI
Sbjct  288  NGGKVIVIDMILKDEKQHHKGTETQLLFDVLMMTALTGKERTEKEWANLFFAAGFKTYKI  347

Query  156  ILILGVRSLIEAYP  115
              +L +RS+IE +P
Sbjct  348  HPVLRLRSVIEIFP  361



>ref|XP_011100228.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=367

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 58/76 (76%), Gaps = 1/76 (1%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+II+DMV+ + + + K+IETQ+ FDML M   +GRQR EKDWA+LF  AGF+ Y
Sbjct  293  KDKEGKVIIVDMVV-DFQKEHKAIETQLFFDMLIMNLASGRQRTEKDWAELFSAAGFTSY  351

Query  162  KIILILGVRSLIEAYP  115
            KI  +LG+RSLIE +P
Sbjct  352  KITPVLGLRSLIELFP  367



>ref|XP_008455944.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X2 [Cucumis melo]
Length=362

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            +E GGK+IIID+V+ + + +++S ETQ+LFD+L M+ L G++R E +W  LF EAGFS Y
Sbjct  286  REKGGKLIIIDIVMEDKKEEKESTETQLLFDVLMMVNLGGKERNENEWKNLFMEAGFSGY  345

Query  162  KIILILGVRSLIEAYP  115
            KII  LG+RS+IE YP
Sbjct  346  KIISKLGLRSVIEVYP  361



>ref|XP_010260367.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nelumbo 
nucifera]
Length=366

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = -2

Query  339  ENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYK  160
            + GG++IIIDMVIG+ + + +  ETQ+LFDML M  +TGR+R++++  KL  EAGF+ YK
Sbjct  292  DKGGRVIIIDMVIGDNKMENELTETQLLFDMLMMGLVTGRERSKQELEKLLLEAGFTHYK  351

Query  159  IILILGVRSLIEAYP  115
            II ILG+RSLIE YP
Sbjct  352  IIPILGLRSLIEVYP  366



>emb|CDP21212.1| unnamed protein product [Coffea canephora]
Length=324

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 3/78 (4%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVR---NDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGF  172
            KE  GK+II++M   + +   +D ++IETQ+ FDM  M+ + GRQR EKDWAKLF EAGF
Sbjct  245  KEKRGKVIIVEMFCKSQQKGDDDHEAIETQLFFDMAVMVLVKGRQRNEKDWAKLFTEAGF  304

Query  171  SDYKIILILGVRSLIEAY  118
            SDYKI  +LG+RS+IE Y
Sbjct  305  SDYKITAVLGLRSIIEVY  322



>gb|KCW89599.1| hypothetical protein EUGRSUZ_A01884 [Eucalyptus grandis]
Length=357

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 40/70 (57%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -2

Query  324  IIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIILIL  145
            +IIIDMV+ N ++D++ +ETQ+ +DML M  ++GR+R E +WAKLF  AGF DYKI   L
Sbjct  287  VIIIDMVMDNTKSDKEMVETQLFYDMLMMTLVSGRERNEAEWAKLFVTAGFGDYKITPAL  346

Query  144  GVRSLIEAYP  115
            G+RSLIE YP
Sbjct  347  GLRSLIEVYP  356



>ref|XP_008229106.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=391

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 59/78 (76%), Gaps = 2/78 (3%)
 Frame = -2

Query  342  KENGGKIIIIDM--VIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFS  169
            K  GGK+II+D+   + N + D+KSIETQ+++D+L M+ L G++R+E +W KLF  AGFS
Sbjct  314  KNGGGKVIILDINVSVDNKKMDKKSIETQLMWDILMMVDLNGKERSEAEWEKLFLTAGFS  373

Query  168  DYKIILILGVRSLIEAYP  115
             YKI  ILG+RSLIE YP
Sbjct  374  HYKITHILGLRSLIEVYP  391



>ref|XP_010070255.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
Length=359

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 40/70 (57%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -2

Query  324  IIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIILIL  145
            +IIIDMV+ N ++D++ +ETQ+ +DML M  ++GR+R E +WAKLF  AGF DYKI   L
Sbjct  289  VIIIDMVMDNTKSDKEMVETQLFYDMLMMTLVSGRERNEAEWAKLFVTAGFGDYKITPAL  348

Query  144  GVRSLIEAYP  115
            G+RSLIE YP
Sbjct  349  GLRSLIEVYP  358



>ref|XP_004151735.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
sativus]
Length=357

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/72 (60%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIIL  151
            GK+++ID+V+ N +ND  SIETQ+L+DML MI   G++R EK+WAKL  EAGF  YKI  
Sbjct  286  GKVMVIDLVLFNTKNDADSIETQLLYDMLMMIVPGGKEREEKEWAKLIKEAGFRAYKIFP  345

Query  150  ILGVRSLIEAYP  115
            IL +RSLIE YP
Sbjct  346  ILDLRSLIEIYP  357



>ref|XP_004169298.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
sativus]
 gb|KGN43482.1| hypothetical protein Csa_7G039790 [Cucumis sativus]
Length=357

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/72 (60%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIIL  151
            GK+++ID+V+ N +ND  SIETQ+L+DML MI   G++R EK+WAKL  EAGF  YKI  
Sbjct  286  GKVMVIDLVLFNTKNDADSIETQLLYDMLMMIVPGGKEREEKEWAKLIKEAGFRAYKIFP  345

Query  150  ILGVRSLIEAYP  115
            IL +RSLIE YP
Sbjct  346  ILDLRSLIEIYP  357



>emb|CDP21551.1| unnamed protein product [Coffea canephora]
Length=269

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 3/78 (4%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRN---DEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGF  172
            KE GGK+IIIDM++ + +N   D ++IETQ+ FD+L M+   GR+R EKDW KLF EAGF
Sbjct  190  KEKGGKVIIIDMLLKSQQNGDDDAEAIETQLFFDILMMVHAKGRERNEKDWEKLFLEAGF  249

Query  171  SDYKIILILGVRSLIEAY  118
            + YKI  +LG+RS+IE Y
Sbjct  250  NGYKITPVLGLRSIIEVY  267



>ref|XP_002522586.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF39886.1| o-methyltransferase, putative [Ricinus communis]
Length=355

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 40/76 (53%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K  GGK+I+ID+V+   +  ++  ET++LFD+L M+ + G +R EK+W +LF EAGFS Y
Sbjct  280  KGKGGKVIVIDIVVDEKKEQDELTETKLLFDILMMVVVNGTERTEKEWKRLFLEAGFSHY  339

Query  162  KIILILGVRSLIEAYP  115
            KI  +LGVRSLIE YP
Sbjct  340  KITPLLGVRSLIEVYP  355



>ref|XP_008455943.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X1 [Cucumis melo]
Length=397

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            +E GGK+IIID+V+ + + +++S ETQ+LFD+L M+ L G++R E +W  LF EAGFS Y
Sbjct  321  REKGGKLIIIDIVMEDKKEEKESTETQLLFDVLMMVNLGGKERNENEWKNLFMEAGFSGY  380

Query  162  KIILILGVRSLIEAYP  115
            KII  LG+RS+IE YP
Sbjct  381  KIISKLGLRSVIEVYP  396



>ref|XP_011001214.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=373

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 39/76 (51%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KE GGK+II+D+VI   +++ +  ET++LFDML M+   G++R+ ++W +LF EAGFS Y
Sbjct  298  KEKGGKVIIVDVVINKKKDEHELTETKLLFDMLMMVVAAGKERSVEEWERLFLEAGFSHY  357

Query  162  KIILILGVRSLIEAYP  115
            KI  + G+RSLIE YP
Sbjct  358  KITSLFGLRSLIEVYP  373



>ref|XP_006377432.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP55229.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=372

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 39/76 (51%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KE GGK+II+D+VI   +++ +  ET++LFDML M+   G++R+ ++W +LF EAGFS Y
Sbjct  297  KEKGGKVIIVDVVINEKKDEHELTETKLLFDMLMMVVAAGKERSVEEWERLFLEAGFSHY  356

Query  162  KIILILGVRSLIEAYP  115
            KI  + G+RSLIE YP
Sbjct  357  KITSLFGLRSLIEVYP  372



>gb|KDP24061.1| hypothetical protein JCGZ_25718 [Jatropha curcas]
Length=367

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 38/73 (52%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = -2

Query  333  GGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKII  154
            GGK+IIIDMV+   + D+ + ET++  DML ++   G++R +K+WAKLFF+AGFSD+KI 
Sbjct  295  GGKLIIIDMVMETQKEDKDATETELFLDMLMIVLYNGKERNKKEWAKLFFDAGFSDFKIT  354

Query  153  LILGVRSLIEAYP  115
             +LG+RS++E YP
Sbjct  355  PVLGLRSVVEVYP  367



>ref|XP_004984099.1| PREDICTED: 5-pentadecatrienyl resorcinol O-methyltransferase-like 
[Setaria italica]
Length=379

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 45/77 (58%), Positives = 61/77 (79%), Gaps = 2/77 (3%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDE-KSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSD  166
            ++ GGKIIIIDMV+G+  +D+ K  ETQ+L+D+L M  + G +R E++W K+FFEAGF D
Sbjct  304  RDAGGKIIIIDMVVGSGPSDDIKHAETQVLYDLLIM-NINGVERDEQEWKKIFFEAGFKD  362

Query  165  YKIILILGVRSLIEAYP  115
            YKII +LGVRS+IE YP
Sbjct  363  YKIIPVLGVRSVIELYP  379



>ref|XP_002441376.1| hypothetical protein SORBIDRAFT_09g025540 [Sorghum bicolor]
 gb|EES19806.1| hypothetical protein SORBIDRAFT_09g025540 [Sorghum bicolor]
Length=362

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 40/73 (55%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = -2

Query  333  GGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKII  154
            GGK+II+D+V+G   +D+K++ETQ+LFD+  M  + G +R EK+W K+ FEAGF  YKI+
Sbjct  291  GGKVIIMDIVVGAGSSDQKNVETQVLFDLFIM-TINGAERDEKEWKKIIFEAGFRSYKIM  349

Query  153  LILGVRSLIEAYP  115
             +LGVRS+IE YP
Sbjct  350  PVLGVRSIIEVYP  362



>ref|NP_001140810.1| uncharacterized protein LOC100272885 [Zea mays]
 gb|ACF84681.1| unknown [Zea mays]
 gb|AFW78711.1| hypothetical protein ZEAMMB73_088089 [Zea mays]
Length=368

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = -2

Query  333  GGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKII  154
            GGK+II+D+V+G   +D K +ETQ+LFD+  M A+ G +R E++W K+ FEAGFS Y II
Sbjct  297  GGKVIIMDIVVGAGSSDRKHVETQVLFDLFIM-AINGAERDEEEWKKIIFEAGFSSYNII  355

Query  153  LILGVRSLIEAYP  115
             +LGVRS+IE YP
Sbjct  356  PVLGVRSIIEVYP  368



>ref|XP_002441374.1| hypothetical protein SORBIDRAFT_09g025530 [Sorghum bicolor]
 gb|EES19804.1| hypothetical protein SORBIDRAFT_09g025530 [Sorghum bicolor]
Length=361

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 58/76 (76%), Gaps = 1/76 (1%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            ++ GGK+II+DMV+G   ++ K  ETQ+LFD+  M  + G +R E++W K+ FEAGFSDY
Sbjct  287  RDAGGKVIILDMVMGGQSSNIKHKETQVLFDLFIMF-VNGVERDEQEWKKIIFEAGFSDY  345

Query  162  KIILILGVRSLIEAYP  115
            KII +LGVRS+IE YP
Sbjct  346  KIIPVLGVRSIIEVYP  361



>emb|CAG27621.1| putative O-methyltransferase [Populus deltoides x Populus maximowiczii]
Length=119

 Score = 89.4 bits (220),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            ++  GK+IIIDMV  N   DE SIETQ++FD+  M+ ++G +R EK+WAKLFF++GF +Y
Sbjct  44   QQKAGKVIIIDMVRENQNGDEGSIETQLIFDLAMMVVVSGVERNEKEWAKLFFDSGFLNY  103

Query  162  KIILILGVRSLIEAYP  115
            KI  + G R++IE YP
Sbjct  104  KIHPVPGTRAVIELYP  119



>ref|XP_007142077.1| hypothetical protein PHAVU_008G250700g [Phaseolus vulgaris]
 gb|ESW14071.1| hypothetical protein PHAVU_008G250700g [Phaseolus vulgaris]
Length=357

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K   GK+IIIDMV+     D++S ETQ+ FDML M+  TG++R +K+W KLF  AGF++Y
Sbjct  282  KGKEGKVIIIDMVVDKEMKDDESFETQLFFDMLMMVFFTGKERNKKEWVKLFSSAGFNNY  341

Query  162  KIILILGVRSLIEAYP  115
            KI  ++G+RSLIE YP
Sbjct  342  KITPVVGLRSLIEIYP  357



>ref|XP_010058047.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
Length=359

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 39/70 (56%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -2

Query  324  IIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIILIL  145
            +III+MV+ N ++D++ +ETQ+ +DML M   +GR+R E +WAKLF  AGF DYKI  +L
Sbjct  289  VIIIEMVMDNTKSDKEMVETQLFYDMLMMTLTSGRERNEAEWAKLFVAAGFGDYKITPVL  348

Query  144  GVRSLIEAYP  115
            G+RSLIE YP
Sbjct  349  GLRSLIEVYP  358



>gb|ACF81837.1| unknown [Zea mays]
Length=113

 Score = 89.0 bits (219),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 56/76 (74%), Gaps = 1/76 (1%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            ++ GGK+II+DMV+G   ++ K  ETQ+LFD+  M  + G +R E +W K+  EAGFSDY
Sbjct  39   RDAGGKVIIVDMVVGGQSSNNKHKETQVLFDLFIM-TINGAERDEHEWKKIISEAGFSDY  97

Query  162  KIILILGVRSLIEAYP  115
            KII +LGVRS+IE YP
Sbjct  98   KIIPVLGVRSIIEVYP  113



>emb|CAH05083.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=346

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++GN + DE+SIE Q+ FDML M+ L G++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMIMGNQKGDEESIEMQLFFDMLMMVLLKGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>ref|XP_002441372.1| hypothetical protein SORBIDRAFT_09g025510 [Sorghum bicolor]
 gb|EES19802.1| hypothetical protein SORBIDRAFT_09g025510 [Sorghum bicolor]
Length=355

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 57/76 (75%), Gaps = 1/76 (1%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KE GGK+IIID+VIG   ++ K  ETQ LFD+  M+ + G +R E++W K+FFEAGFSDY
Sbjct  281  KEEGGKVIIIDIVIGEESSNLKHKETQALFDLYIML-VNGIERDEQEWKKIFFEAGFSDY  339

Query  162  KIILILGVRSLIEAYP  115
            KI+ +LG RS+I  YP
Sbjct  340  KILPVLGARSIISVYP  355



>ref|XP_010058046.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
Length=359

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 39/70 (56%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -2

Query  324  IIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIILIL  145
            +III+MV+ N ++D++ +ETQ+ +DML M   +GR+R E +WAKLF  AGF DYKI  +L
Sbjct  289  VIIIEMVMDNTKSDKEMVETQLFYDMLMMTLASGRERNEAEWAKLFVAAGFGDYKITPVL  348

Query  144  GVRSLIEAYP  115
            G+RSLIE YP
Sbjct  349  GLRSLIEVYP  358



>gb|KCW75545.1| hypothetical protein EUGRSUZ_E04305 [Eucalyptus grandis]
Length=359

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 39/70 (56%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -2

Query  324  IIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIILIL  145
            +III+MV+ N ++D++ +ETQ+ +DML M   +GR+R E +WAKLF  AGF DYKI  +L
Sbjct  289  VIIIEMVMDNTKSDKEMVETQLFYDMLMMTLASGRERNEAEWAKLFVAAGFGDYKITPVL  348

Query  144  GVRSLIEAYP  115
            G+RSLIE YP
Sbjct  349  GLRSLIEVYP  358



>gb|EMT23556.1| O-methyltransferase ZRP4 [Aegilops tauschii]
Length=359

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 57/76 (75%), Gaps = 1/76 (1%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            ++ GGK+II+DMV+G+  N+  + ETQ+LFD+  M    G +R E +W K+F EAGFSDY
Sbjct  285  RDAGGKVIIVDMVVGSGPNENVTRETQVLFDLFIM-CFEGIEREEHEWKKIFMEAGFSDY  343

Query  162  KIILILGVRSLIEAYP  115
            KII ++GVRS+IE YP
Sbjct  344  KIIAVMGVRSVIELYP  359



>emb|CAJ65639.1| putative orcinol O-methyltransferase [Rosa hugonis]
Length=346

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  LTG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMIMENQKVDEESIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>ref|XP_006469137.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=362

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 43/72 (60%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIIL  151
            GK+IIIDM+  N + D++S ETQ+ F ML M+  TG +R EK+WAKL  + GFSDYKI  
Sbjct  291  GKVIIIDMMRENKKGDDESTETQLFFYMLMMVLATGTERDEKEWAKLLADVGFSDYKITS  350

Query  150  ILGVRSLIEAYP  115
            ILG+RSLIE YP
Sbjct  351  ILGLRSLIEVYP  362



>ref|XP_010938927.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Elaeis 
guineensis]
Length=362

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 42/77 (55%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = -2

Query  342  KENGGKIIIIDMVI-GNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSD  166
            KENGGK+II+D V+        K+ ETQ+ FDML M+   G QR EK+W+K+FF+AGFS+
Sbjct  286  KENGGKLIIVDAVVKAGDDGSNKTTETQLFFDMLMMVNSGGMQREEKEWSKIFFDAGFSN  345

Query  165  YKIILILGVRSLIEAYP  115
            YKI  ++G+RS+IE YP
Sbjct  346  YKINPVMGLRSIIEVYP  362



>emb|CAJ65638.1| putative orcinol O-methyltransferase [Rosa hugonis]
Length=346

 Score = 92.0 bits (227),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  LTG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMIMENQKVDEESIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>emb|CAJ65648.1| putative orcinol O-methyltransferase [Rosa woodsii var. ultramontana]
Length=346

 Score = 92.0 bits (227),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  +TGR+R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGRERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>ref|XP_004293905.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=355

 Score = 92.0 bits (227),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 56/76 (74%), Gaps = 1/76 (1%)
 Frame = -2

Query  339  ENG-GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            +NG GK+IIID+VI    ++ +S E ++ FDML M+ +TGR+R EK+W KL  EAGFS Y
Sbjct  280  DNGKGKVIIIDIVINEEGDEHESTEAKLFFDMLMMVVVTGRERREKEWEKLILEAGFSKY  339

Query  162  KIILILGVRSLIEAYP  115
            +I  I G+RSLIE YP
Sbjct  340  QITPIFGLRSLIEVYP  355



>emb|CAJ65622.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score = 91.7 bits (226),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  LTG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>emb|CAJ65621.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  LTG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>emb|CBI21913.3| unnamed protein product [Vitis vinifera]
 emb|CBI21917.3| unnamed protein product [Vitis vinifera]
Length=114

 Score = 88.2 bits (217),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KE GGK+IIIDM++ N + D KS ETQ+ FDML M+ +TG++R EK+W KLF EAGFS Y
Sbjct  39   KERGGKVIIIDMMVKNQKGDCKSRETQLFFDMLMMVLVTGKEREEKEWEKLFLEAGFSHY  98

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  99   KITPILGLRSLIEVYP  114



>gb|EMS47465.1| O-methyltransferase ZRP4 [Triticum urartu]
Length=362

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 56/76 (74%), Gaps = 1/76 (1%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+ GGK+II+DMV+G    D K  ETQ++FD+  M  + G +R E++W K+ FEAGF+DY
Sbjct  288  KDAGGKVIIVDMVVGAGPQDPKHKETQVMFDLFIMF-INGVERDEQEWKKIIFEAGFNDY  346

Query  162  KIILILGVRSLIEAYP  115
            KI  ILGVRS+IE YP
Sbjct  347  KITPILGVRSIIEVYP  362



>emb|CDP19709.1| unnamed protein product [Coffea canephora]
Length=348

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            ++ GGK+IIIDM++ +   D++S+ETQ + DM  +     ++R EK+WAK+F +AGFSDY
Sbjct  273  RDKGGKVIIIDMILESHMKDDESVETQFVVDMQMLTCYGAKERTEKEWAKVFQDAGFSDY  332

Query  162  KIILILGVRSLIEAYP  115
            K++ +LGVR LIE YP
Sbjct  333  KVLPVLGVRCLIEVYP  348



>ref|NP_001148593.1| O-methyltransferase ZRP4 [Zea mays]
 gb|ACG32160.1| O-methyltransferase ZRP4 [Zea mays]
Length=359

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 56/76 (74%), Gaps = 1/76 (1%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            ++ GGK+II+DMV+G   ++ K  ETQ+LFD+  M  + G +R E +W K+  EAGFSDY
Sbjct  285  RDAGGKVIIVDMVVGGQSSNNKHKETQVLFDLFIM-TINGAERDEHEWKKIISEAGFSDY  343

Query  162  KIILILGVRSLIEAYP  115
            KII +LGVRS+IE YP
Sbjct  344  KIIPVLGVRSIIEVYP  359



>emb|CDP20221.1| unnamed protein product [Coffea canephora]
Length=69

 Score = 87.0 bits (214),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -2

Query  288  NDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIILILGVRSLIEAY  118
            +D ++IETQ+ FDML M+ L GRQR EKDWAKLF EAGFSDYKI  +LG+RS+IE Y
Sbjct  11   DDHEAIETQLFFDMLVMVLLKGRQRNEKDWAKLFTEAGFSDYKITAVLGLRSIIEVY  67



>ref|XP_010110665.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXC27580.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=384

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 45/85 (53%), Positives = 59/85 (69%), Gaps = 13/85 (15%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRNDE-------------KSIETQILFDMLAMIALTGRQRAEKDWAKL  190
            GK+I++DMVI   +N++             +S ETQ+ FDML M+ L+GR+R E +WAKL
Sbjct  300  GKVILVDMVIVEEQNNKDIGHDHHAHDHDHQSYETQLFFDMLMMVLLSGRERKETEWAKL  359

Query  189  FFEAGFSDYKIILILGVRSLIEAYP  115
            FF+AGFS YKI  ILGVRSLIE +P
Sbjct  360  FFDAGFSTYKITPILGVRSLIEVFP  384



>ref|XP_008783119.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008783121.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X2 [Phoenix dactylifera]
 ref|XP_008783122.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X3 [Phoenix dactylifera]
Length=366

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K++GGK+IIIDMV+G   +   S+E Q+LFDM  MI  TG++R+E +W++LF  AGFSDY
Sbjct  291  KKDGGKVIIIDMVVGVTTDVSISVEPQLLFDMEMMILCTGKERSETEWSRLFHAAGFSDY  350

Query  162  KIILILGVRSLIEAY  118
            KI   +G+RS+IE Y
Sbjct  351  KITASMGLRSVIELY  365



>ref|XP_008649876.1| PREDICTED: O-methyltransferase ZRP4-like [Zea mays]
 gb|AFW78713.1| hypothetical protein ZEAMMB73_831416 [Zea mays]
Length=358

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 41/72 (57%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIIL  151
            GK++I+DMV+G   +DEK +ETQI+FD+  M+ + G +R E +W K+ FEAGFS YKII 
Sbjct  288  GKVVILDMVVGAGSSDEKHVETQIVFDLF-MMFINGTERDETEWKKIIFEAGFSRYKIIP  346

Query  150  ILGVRSLIEAYP  115
            +LGVRS+IE YP
Sbjct  347  VLGVRSIIEVYP  358



>gb|ACY41220.1| O-methyltransferase-like protein [Saccharum hybrid cultivar CP72-1210]
Length=361

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 44/77 (57%), Positives = 57/77 (74%), Gaps = 2/77 (3%)
 Frame = -2

Query  339  ENGGKIIIIDMVIGN-VRNDEKSIETQILFDMLAM-IALTGRQRAEKDWAKLFFEAGFSD  166
            + GGK+II+DMV+G    +DEK +ETQ+LFD+L M I   G +R E +W K+ FEAGFS 
Sbjct  285  QGGGKVIILDMVVGTGSSSDEKHVETQMLFDLLVMSIYTKGAERDELEWKKIIFEAGFSH  344

Query  165  YKIILILGVRSLIEAYP  115
            YKII +LG RS+IE YP
Sbjct  345  YKIIPVLGARSIIEVYP  361



>gb|AIY62760.1| N-acetylserotonin O-methyltransferase [Malus zumi]
Length=358

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = -2

Query  336  NG-GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYK  160
            NG GK+IIID+VI   +++ +  E ++LFD+L M+ +TGR+R+EKDW KLF EAGFS YK
Sbjct  284  NGQGKVIIIDIVINEEKDEHEITEAKLLFDLLMMVVVTGRERSEKDWKKLFLEAGFSGYK  343

Query  159  IILILGVRSLIEAY  118
            +  I G+RSLIE +
Sbjct  344  VTPIFGLRSLIEVF  357



>ref|XP_008229109.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=354

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 41/72 (57%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIIL  151
            GK+II+DM + +   D++S ETQ+ FDM  M+  TG++R EK+WAKLF +AGFS YKI  
Sbjct  283  GKVIIVDMTVEDKNTDKESGETQLFFDMEMMVLATGKERNEKEWAKLFSDAGFSHYKITP  342

Query  150  ILGVRSLIEAYP  115
             LG+RSLIE YP
Sbjct  343  SLGLRSLIEVYP  354



>gb|KDP24060.1| hypothetical protein JCGZ_25717 [Jatropha curcas]
Length=358

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 40/70 (57%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = -2

Query  324  IIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIILIL  145
            +IIIDMV+GN   D    E Q+LFDM  M+ L G++R EK+WAKLFF+AGF+ YKI  +L
Sbjct  289  VIIIDMVMGNQTWDNDWTEAQVLFDMEMMVCLVGKERTEKEWAKLFFDAGFTKYKIDYVL  348

Query  144  GVRSLIEAYP  115
            G R++IE YP
Sbjct  349  GPRAVIEVYP  358



>gb|ADZ76434.1| myricetin O-methyltransferase 2 [Solanum habrochaites]
Length=355

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 40/76 (53%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            +ENGGK+IIIDM++ +  N+++ +++Q L D++  I    ++R EK+W KLF EAGFS Y
Sbjct  280  RENGGKVIIIDMIMEDNYNNKQLVQSQHLMDLIMRITYASKERTEKEWEKLFLEAGFSGY  339

Query  162  KIILILGVRSLIEAYP  115
            KII  LG+RSLIE YP
Sbjct  340  KIITSLGLRSLIEIYP  355



>ref|XP_004241912.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=356

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 40/76 (53%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            +ENGGK+IIIDM++ +  N+++ +++Q L D++  I    ++R EK+W KLF EAGFS Y
Sbjct  281  RENGGKVIIIDMIMEDNYNNKQLVQSQHLMDLIMRITYASKERTEKEWEKLFLEAGFSGY  340

Query  162  KIILILGVRSLIEAYP  115
            KII  LG+RSLIE YP
Sbjct  341  KIITSLGLRSLIEIYP  356



>emb|CAJ65665.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKSGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>emb|CAJ65601.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKNGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>emb|CAJ65608.1| putative orcinol O-methyltransferase [Rosa bracteata]
Length=346

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>ref|XP_008364163.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Malus 
domestica]
Length=358

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 40/74 (54%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = -2

Query  336  NG-GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYK  160
            NG GK+IIID+V+   +++ +  E ++LFD+L M+ +TGR+R+EKDW KLF EAGFS YK
Sbjct  284  NGQGKVIIIDIVMNEEKDEHEITEAKLLFDLLMMVVITGRERSEKDWKKLFLEAGFSSYK  343

Query  159  IILILGVRSLIEAY  118
            +  I G+RSLIE +
Sbjct  344  VTPIFGLRSLIEVF  357



>ref|XP_010110664.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXC27579.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=377

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 45/80 (56%), Positives = 56/80 (70%), Gaps = 8/80 (10%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRN--------DEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAG  175
            GK+I++DMVI   +N        D +  ETQILFDML M++  GR+R E +WAKLF +AG
Sbjct  298  GKVILVDMVIVEKQNNKDIGHDHDHQLYETQILFDMLMMVSFPGRERKETEWAKLFSDAG  357

Query  174  FSDYKIILILGVRSLIEAYP  115
            FS YKI  ILGVRSLIE +P
Sbjct  358  FSTYKITPILGVRSLIEVFP  377



>ref|XP_003527405.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
1 [Glycine max]
 gb|KHN07776.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=359

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -2

Query  339  ENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYK  160
            ++ GK+IIID+VIGN + D +  +T++ +D+  M+ +TG++R EKDWAKLF  AGF+ YK
Sbjct  285  KDKGKVIIIDVVIGNEKGDSELDQTKLFYDIEMMVLVTGKERNEKDWAKLFLSAGFNSYK  344

Query  159  IILILGVRSLIEAYP  115
            I  +LG +SLIE YP
Sbjct  345  ITPVLGFKSLIEVYP  359



>emb|CAJ65661.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKNGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>ref|XP_011077108.1| PREDICTED: chavicol O-methyltransferase-like [Sesamum indicum]
Length=361

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = -2

Query  339  ENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYK  160
            + GGK++I+DMV+     D K +ET   FD+  M  LTGR+R EK+WAKLFF+AGF++YK
Sbjct  287  KTGGKVMIVDMVLDVNGRDNKEMETCFFFDIALMPYLTGRERTEKEWAKLFFDAGFTNYK  346

Query  159  IILILGVRSLIEAYP  115
            I    G+RSLIE YP
Sbjct  347  ITPAFGLRSLIEVYP  361



>gb|KHN19130.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=246

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIIL  151
            GK+IIIDMV+ + + D++S+ETQ+ FDM  M+ +TG++R++K+W KL   AG+++YKI  
Sbjct  175  GKVIIIDMVVEDEKRDDESVETQLFFDMQMMVLVTGKERSKKEWTKLISSAGYNNYKITP  234

Query  150  ILGVRSLIEAYP  115
            +LG+RSLIE YP
Sbjct  235  VLGLRSLIEIYP  246



>gb|EMT32848.1| O-methyltransferase ZRP4 [Aegilops tauschii]
Length=121

 Score = 87.4 bits (215),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 56/76 (74%), Gaps = 1/76 (1%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+ GGK+II+D+V+G    D K  ETQ++FD+  M  + G +R E++W K+ FEAGF+DY
Sbjct  47   KDAGGKVIIVDIVVGAGPQDPKHKETQVMFDLFIMF-INGVERDEQEWKKIIFEAGFNDY  105

Query  162  KIILILGVRSLIEAYP  115
            KI  ILGVRS+IE YP
Sbjct  106  KITPILGVRSIIEVYP  121



>emb|CAJ65647.1| putative orcinol O-methyltransferase [Rosa rugosa]
Length=346

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMTLVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>emb|CAJ65602.1| putative orcinol O-methyltransferase [Rosa banksiae]
Length=346

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>ref|XP_011091736.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=560

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/72 (57%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIIL  151
            GK++II+MV+ +   D KS+ETQ+  DML M  L GR+R E +WAKLF +AGF++YKI  
Sbjct  489  GKVVIIEMVLDDQNADHKSVETQLFIDMLMMTILRGRERKEIEWAKLFSDAGFTNYKISP  548

Query  150  ILGVRSLIEAYP  115
            ILG+RS+IE YP
Sbjct  549  ILGLRSIIEVYP  560



>emb|CAJ65626.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>emb|CAJ65641.1| putative orcinol O-methyltransferase [Rosa marretii]
Length=346

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>ref|XP_008364164.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Malus 
domestica]
Length=358

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = -2

Query  336  NG-GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYK  160
            NG GK+IIID+VI   +++ +  E ++LFD+L M+  TGR+R+EKDW KLF EAGFS YK
Sbjct  284  NGQGKVIIIDIVINEEKDEHEITEAKLLFDLLMMVVXTGRERSEKDWKKLFLEAGFSGYK  343

Query  159  IILILGVRSLIEAY  118
            +  I G+RSLIE +
Sbjct  344  VTPIFGLRSLIEVF  357



>emb|CDP20595.1| unnamed protein product [Coffea canephora]
Length=99

 Score = 86.7 bits (213),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 56/70 (80%), Gaps = 3/70 (4%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVR---NDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGF  172
            KENG K+IIIDMV+ + +   +D ++IE+Q+ FDML M+ +TG+QR E++WAKLF EAGF
Sbjct  27   KENGRKVIIIDMVLNDQQKGADDHEAIESQLFFDMLMMVLVTGKQRNEREWAKLFSEAGF  86

Query  171  SDYKIILILG  142
            +DYK  L+LG
Sbjct  87   NDYKTTLVLG  96



>emb|CAH05080.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  LTG++R +K+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALLTGKERNKKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>emb|CDP22155.1| unnamed protein product, partial [Coffea canephora]
Length=108

 Score = 87.0 bits (214),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 56/70 (80%), Gaps = 3/70 (4%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVR---NDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGF  172
            KENG K+IIIDMV+ + +   +D ++IE+Q+ FDML M+ +TG+QR E++WAKLF EAGF
Sbjct  36   KENGRKVIIIDMVLNDQQKGADDHEAIESQLFFDMLLMVLVTGKQRNEREWAKLFSEAGF  95

Query  171  SDYKIILILG  142
            +DYK  L+LG
Sbjct  96   NDYKTTLVLG  105



>ref|XP_009345025.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Pyrus 
x bretschneideri]
Length=358

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 40/74 (54%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = -2

Query  336  NG-GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYK  160
            NG GK+IIID+VI   +++ +  E ++LFD+L M+ +TGR+R+EKDW KLF EAGFS YK
Sbjct  284  NGQGKVIIIDIVINEEKDEHEITEAKLLFDLLMMVVVTGRERSEKDWKKLFLEAGFSSYK  343

Query  159  IILILGVRSLIEAY  118
            +  I G+RSL+E +
Sbjct  344  VTPIFGLRSLLEVF  357



>emb|CAJ65625.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>emb|CAJ65609.1| putative orcinol O-methyltransferase [Rosa bracteata]
Length=346

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>emb|CAJ65630.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>ref|XP_007142043.1| hypothetical protein PHAVU_008G247600g [Phaseolus vulgaris]
 gb|ESW14037.1| hypothetical protein PHAVU_008G247600g [Phaseolus vulgaris]
Length=357

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K   GK+IIIDMV+     D++S ETQ+ FD+L M+ LTG++R +K+W KLF  AGF++Y
Sbjct  282  KGKEGKVIIIDMVVDKEMKDDESFETQLFFDILMMVLLTGKERNKKEWVKLFSSAGFNNY  341

Query  162  KIILILGVRSLIEAYP  115
            KI   +G RSLIE YP
Sbjct  342  KITPFVGSRSLIEIYP  357



>emb|CAJ65612.1| putative orcinol O-methyltransferase [Rosa canina]
Length=346

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>emb|CAJ65624.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>emb|CAJ65628.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>emb|CAJ65604.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>emb|CAH05082.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=346

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM + N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMTMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>emb|CAJ65632.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
 emb|CAJ65658.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>gb|AFK40900.1| unknown [Lotus japonicus]
Length=357

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K   GK+IIIDMVI   + D+KS+ETQ+LFDM  M+  TG++R+ K+W  L   AGFSDY
Sbjct  282  KGKEGKVIIIDMVIEEDKGDDKSVETQLLFDMGMMVLTTGKERSMKEWGILISSAGFSDY  341

Query  162  KIILILGVRSLIEAYP  115
            KI  +LG+RS++E YP
Sbjct  342  KISPVLGLRSVVEIYP  357



>emb|CAJ65640.1| putative orcinol O-methyltransferase [Rosa majalis]
 emb|CAJ65650.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65651.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65652.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65653.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65654.1| putative orcinol O-methyltransferase [Rosa lucieae]
Length=346

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>emb|CAJ65649.1| putative orcinol O-methyltransferase [Rosa woodsii var. ultramontana]
Length=346

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIET++ FDML M  LTG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMIMENQKGDEESIETELFFDMLMMAILTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>emb|CAJ65645.1| putative orcinol O-methyltransferase [Rosa roxburghii]
Length=346

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>emb|CAJ65598.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>gb|AFW78710.1| O-methyltransferase ZRP4 [Zea mays]
Length=359

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 56/76 (74%), Gaps = 1/76 (1%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            ++ GGK+II+DMV+G   ++ K  ETQ+LFD+  M  + G +R E +W K+  EAGFSDY
Sbjct  285  RDAGGKVIIVDMVVGGQSSNIKHKETQVLFDLFIM-TINGAERDEHEWKKIISEAGFSDY  343

Query  162  KIILILGVRSLIEAYP  115
            KII +LGVRS+IE YP
Sbjct  344  KIIPVLGVRSIIEVYP  359



>ref|XP_008649874.1| PREDICTED: O-methyltransferase ZRP4-like [Zea mays]
 gb|AFW78712.1| hypothetical protein ZEAMMB73_957932 [Zea mays]
Length=356

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 40/72 (56%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIIL  151
            GK++I+DMV+G   +DEK +E QI+FD+  M+ + G +R E +W K+ FEAGFS YKII 
Sbjct  286  GKVVILDMVVGAGSSDEKHVEMQIVFDLF-MMFINGTERDETEWKKIIFEAGFSRYKIIP  344

Query  150  ILGVRSLIEAYP  115
            +LGVRS+IE YP
Sbjct  345  VLGVRSIIEVYP  356



>ref|XP_011027757.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 39/76 (51%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K  GGK+II+D+VI   +++++  ET++LFDML M+   G++R+ K+W KLF EAGFS Y
Sbjct  284  KGKGGKVIIVDVVIDEKKDEKELTETKLLFDMLMMVVAAGKERSVKEWEKLFLEAGFSHY  343

Query  162  KIILILGVRSLIEAYP  115
             I  + G+RSLIE YP
Sbjct  344  MITPLFGLRSLIEVYP  359



>emb|CAJ65613.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
 emb|CAJ65619.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>emb|CAD29555.1| orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=348

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/67 (61%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  + G++R EK+WAKLF +AGFSDY
Sbjct  282  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDY  341

Query  162  KIILILG  142
            KI  ILG
Sbjct  342  KITPILG  348



>ref|XP_002277927.2| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KE GGK+IIIDM++ N + D KS ETQ+ FDML M+ +TG++R EK+W KLF EAGFS Y
Sbjct  282  KERGGKVIIIDMMVKNQKGDCKSRETQLFFDMLMMVLVTGKEREEKEWEKLFLEAGFSHY  341

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  342  KITPILGLRSLIEVYP  357



>emb|CAN69333.1| hypothetical protein VITISV_003273 [Vitis vinifera]
Length=350

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KE GGK+IIIDM++ N + D KS ETQ+ FDML M+ +TG++R EK+W KLF EAGFS Y
Sbjct  275  KERGGKVIIIDMMVKNQKGDCKSRETQLFFDMLMMVLVTGKEREEKEWEKLFLEAGFSHY  334

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  335  KITPILGLRSLIEVYP  350



>emb|CAH05087.1| orcinol O-methyltransferase 4 [Rosa hybrid cultivar]
Length=346

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>emb|CAJ65620.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>emb|CAJ65603.1| putative orcinol O-methyltransferase [Rosa banksiae]
Length=346

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>ref|XP_002274019.2| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KE GGK+IIIDM++ N + D KS ETQ+ FDML M+ +TG++R EK+W KLF EAGFS Y
Sbjct  282  KERGGKVIIIDMMVKNQKGDCKSRETQLFFDMLMMVLVTGKEREEKEWEKLFLEAGFSHY  341

Query  162  KIILILGVRSLIEAYP  115
            KI  ILG+RSLIE YP
Sbjct  342  KITPILGLRSLIEVYP  357



>ref|XP_004163430.1| PREDICTED: LOW QUALITY PROTEIN: trans-resveratrol di-O-methyltransferase-like 
[Cucumis sativus]
Length=354

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 57/75 (76%), Gaps = 3/75 (4%)
 Frame = -2

Query  336  NGGKIIIIDMVI-GNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYK  160
            N GK+++ID+V+ GN + D  S+ETQ+LFDML M  + G++R EK+WAKL  EAGF  YK
Sbjct  282  NKGKVMVIDIVLFGNYKKD--SMETQLLFDMLMMTLVGGKEREEKEWAKLIKEAGFGSYK  339

Query  159  IILILGVRSLIEAYP  115
            I  I+GVRSL+E YP
Sbjct  340  IFPIMGVRSLVEIYP  354



>ref|XP_010023968.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW60372.1| hypothetical protein EUGRSUZ_H03087 [Eucalyptus grandis]
Length=361

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 42/72 (58%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = -2

Query  330  GKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIIL  151
            GK+I+I++V+GN   D +S ETQ+ FDM  M+ L G++R EK+W KLF +AGFS YKII 
Sbjct  291  GKVILIEIVVGNQTEDHRSTETQLFFDMW-MMNLNGKERNEKEWEKLFVDAGFSGYKIIS  349

Query  150  ILGVRSLIEAYP  115
             LG+RSLIE YP
Sbjct  350  HLGLRSLIEIYP  361



>emb|CAJ65635.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>emb|CAJ65610.1| putative orcinol O-methyltransferase [Rosa canina]
Length=346

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>emb|CAJ65605.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>emb|CAJ65606.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>ref|XP_010040590.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like, partial 
[Eucalyptus grandis]
Length=326

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = -2

Query  324  IIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYKIILIL  145
            +IIIDMV+ N ++D++ +ETQ+ +DML M    GR+R + +WAKLF  AGF DYKI  +L
Sbjct  256  VIIIDMVMENTKSDKEMVETQLFYDMLMMTLAVGRERNQAEWAKLFIAAGFGDYKITPVL  315

Query  144  GVRSLIEAYP  115
            G+RSLIE YP
Sbjct  316  GLRSLIEVYP  325



>ref|XP_010243530.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nelumbo 
nucifera]
Length=580

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 2/76 (3%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            KE+GGK+IIID+V+GN   D+KS E Q+ FD+  M+ L  ++R E +W  LF EAGFSDY
Sbjct  507  KEDGGKVIIIDIVLGN--EDDKSFELQLFFDITMMVLLGAKERTEGEWKTLFKEAGFSDY  564

Query  162  KIILILGVRSLIEAYP  115
            KI   LG RS+IE YP
Sbjct  565  KIKRALGFRSIIELYP  580



>emb|CAH05081.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAJ65644.1| putative orcinol O-methyltransferase [Rosa phoenicia]
Length=346

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K+  GK+IIIDM++ N + DE+SIETQ+ FDML M  LTG++R +K+WAKLF +AGFSDY
Sbjct  281  KDKKGKVIIIDMMMENQKGDEESIETQLFFDMLMMALLTGKERNKKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>ref|XP_002441379.1| hypothetical protein SORBIDRAFT_09g025550 [Sorghum bicolor]
 gb|EES19809.1| hypothetical protein SORBIDRAFT_09g025550 [Sorghum bicolor]
Length=236

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = -2

Query  339  ENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDYK  160
              GGK++I+DMV+G   +DEK +E QILFD+  M  + G +R E +W K+ FEAGFS YK
Sbjct  163  SQGGKVVILDMVVGAGSSDEKYVEMQILFDLFMMF-INGAERDELEWKKIIFEAGFSSYK  221

Query  159  IILILGVRSLIEAYP  115
            II +LGVRS+IE YP
Sbjct  222  IIPVLGVRSIIEIYP  236



>emb|CAJ65623.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K   GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KAKNGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



>emb|CAJ65611.1| putative orcinol O-methyltransferase [Rosa canina]
Length=346

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  342  KENGGKIIIIDMVIGNVRNDEKSIETQILFDMLAMIALTGRQRAEKDWAKLFFEAGFSDY  163
            K   GK+IIIDM++ N + DE+SIETQ+ FDML M  +TG++R EK+WAKLF +AGFSDY
Sbjct  281  KAKNGKVIIIDMMMENQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDY  340

Query  162  KIILIL  145
            KI  IL
Sbjct  341  KITPIL  346



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 511879084288