BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25744_g1_i1 len=833 path=[9942:0-11 4182:12-36 4625:37-242
10288:243-252 10298:253-267 2500:268-829 10665:830-832]

Length=833
                                                                      Score     E

ref|XP_009780941.1|  PREDICTED: trans-resveratrol di-O-methyltran...    377   8e-127   
ref|XP_009602136.1|  PREDICTED: trans-resveratrol di-O-methyltran...    370   3e-124   
ref|XP_006366298.1|  PREDICTED: trans-resveratrol di-O-methyltran...    354   1e-117   
ref|XP_002278211.1|  PREDICTED: trans-resveratrol di-O-methyltran...    347   5e-115   Vitis vinifera
emb|CAN61955.1|  hypothetical protein VITISV_020020                     345   2e-114   Vitis vinifera
ref|XP_004248183.1|  PREDICTED: trans-resveratrol di-O-methyltran...    344   8e-114   
emb|CAJ65602.1|  putative orcinol O-methyltransferase                   343   8e-114   Rosa banksiae
ref|XP_002278190.1|  PREDICTED: trans-resveratrol di-O-methyltran...    343   2e-113   Vitis vinifera
emb|CAJ65628.1|  putative orcinol O-methyltransferase                   341   5e-113   Rosa odorata var. gigantea
ref|XP_004303127.1|  PREDICTED: trans-resveratrol di-O-methyltran...    342   6e-113   
emb|CAJ65632.1|  putative orcinol O-methyltransferase                   341   9e-113   Rosa odorata var. gigantea
emb|CAJ65663.1|  putative orcinol O-methyltransferase                   341   9e-113   Rosa odorata [tea rose]
emb|CAH05089.1|  putative orcinol O-methyltransferase                   341   9e-113   Rosa odorata var. gigantea
emb|CAJ65630.1|  putative orcinol O-methyltransferase                   340   1e-112   Rosa odorata var. gigantea
emb|CAJ65642.1|  putative orcinol O-methyltransferase                   339   3e-112   Rosa marretii
emb|CAJ65665.1|  putative orcinol O-methyltransferase                   339   4e-112   Rosa odorata [tea rose]
emb|CAJ65609.1|  putative orcinol O-methyltransferase                   339   6e-112   Rosa bracteata [Macartny rose]
emb|CAH05084.1|  orcinol O-methyltransferase 3                          338   6e-112   Rosa hybrid cultivar
ref|XP_011002662.1|  PREDICTED: trans-resveratrol di-O-methyltran...    339   6e-112   
emb|CAJ65598.1|  putative orcinol O-methyltransferase                   338   7e-112   Rosa chinensis [China rose]
emb|CAJ65645.1|  putative orcinol O-methyltransferase                   338   7e-112   Rosa roxburghii [chestnut rose]
emb|CAJ65640.1|  putative orcinol O-methyltransferase                   338   8e-112   Rosa majalis [cinnamon rose]
emb|CAJ65597.1|  putative orcinol O-methyltransferase                   338   8e-112   Rosa chinensis [China rose]
emb|CAJ65601.1|  putative orcinol O-methyltransferase                   338   8e-112   Rosa chinensis [China rose]
emb|CAJ65623.1|  putative orcinol O-methyltransferase                   338   9e-112   Rosa gallica [apothecary rose]
emb|CAJ65607.1|  putative orcinol O-methyltransferase                   338   9e-112   Rosa beggeriana
emb|CAJ65604.1|  putative orcinol O-methyltransferase                   338   9e-112   Rosa beggeriana
emb|CAJ65646.1|  putative orcinol O-methyltransferase                   338   9e-112   Rosa rugosa [Japanese rose]
emb|CAJ65613.1|  putative orcinol O-methyltransferase                   338   1e-111   Rosa chinensis var. spontanea
emb|CAJ65648.1|  putative orcinol O-methyltransferase                   338   1e-111   Rosa woodsii var. ultramontana
emb|CAJ65618.1|  putative orcinol O-methyltransferase                   338   1e-111   Rosa chinensis var. spontanea
gb|AEC13057.1|  orcinol O-methyltransferase-like protein                338   2e-111   
ref|XP_011002666.1|  PREDICTED: trans-resveratrol di-O-methyltran...    338   2e-111   
emb|CAJ65664.1|  putative orcinol O-methyltransferase                   337   2e-111   Rosa odorata [tea rose]
emb|CAJ65614.1|  putative orcinol O-methyltransferase                   337   2e-111   Rosa chinensis var. spontanea
emb|CAH05082.1|  putative orcinol O-methyltransferase                   337   3e-111   Rosa hybrid cultivar
ref|XP_011002663.1|  PREDICTED: trans-resveratrol di-O-methyltran...    337   3e-111   
emb|CAD29556.1|  orcinol O-methyltransferase                            337   3e-111   Rosa hybrid cultivar
emb|CAJ65615.1|  putative orcinol O-methyltransferase                   337   3e-111   Rosa chinensis var. spontanea
emb|CAJ65635.1|  putative orcinol O-methyltransferase                   337   3e-111   Rosa odorata var. gigantea
emb|CAJ65655.1|  putative orcinol O-methyltransferase                   337   3e-111   Rosa lucieae [memorial rose]
emb|CAJ65647.1|  putative orcinol O-methyltransferase                   337   4e-111   Rosa rugosa [Japanese rose]
emb|CAJ65620.1|  putative orcinol O-methyltransferase                   337   4e-111   Rosa chinensis var. spontanea
emb|CAJ65612.1|  putative orcinol O-methyltransferase                   337   5e-111   Rosa canina [dog briar]
emb|CAH05087.1|  orcinol O-methyltransferase 4                          336   5e-111   Rosa hybrid cultivar
emb|CAJ65624.1|  putative orcinol O-methyltransferase                   336   5e-111   Rosa gallica [apothecary rose]
ref|XP_006364110.1|  PREDICTED: trans-resveratrol di-O-methyltran...    333   6e-111   
emb|CAJ65603.1|  putative orcinol O-methyltransferase                   336   7e-111   Rosa banksiae
emb|CAJ65622.1|  putative orcinol O-methyltransferase                   336   7e-111   Rosa gallica [apothecary rose]
emb|CAH05081.1|  putative orcinol O-methyltransferase                   336   8e-111   Rosa hybrid cultivar
emb|CAJ65610.1|  putative orcinol O-methyltransferase                   336   9e-111   Rosa canina [dog briar]
emb|CAJ65629.1|  putative orcinol O-methyltransferase                   336   9e-111   Rosa odorata var. gigantea
emb|CAJ65643.1|  putative orcinol O-methyltransferase                   335   1e-110   Rosa marretii
emb|CAH05083.1|  putative orcinol O-methyltransferase                   335   2e-110   Rosa hybrid cultivar
emb|CAH05085.1|  orcinol O-methyltransferase 3                          335   2e-110   Rosa hybrid cultivar
emb|CAJ65621.1|  putative orcinol O-methyltransferase                   335   2e-110   Rosa gallica [apothecary rose]
emb|CAJ65633.1|  putative orcinol O-methyltransferase                   335   2e-110   Rosa odorata var. gigantea
emb|CAJ65625.1|  putative orcinol O-methyltransferase                   335   2e-110   Rosa gallica [apothecary rose]
emb|CAJ65641.1|  putative orcinol O-methyltransferase                   335   2e-110   Rosa marretii
emb|CAH05079.1|  putative orcinol O-methyltransferase                   335   2e-110   Rosa gallica [apothecary rose]
emb|CAJ65626.1|  putative orcinol O-methyltransferase                   335   2e-110   Rosa gallica [apothecary rose]
emb|CAJ65611.1|  putative orcinol O-methyltransferase                   335   3e-110   Rosa canina [dog briar]
emb|CAJ65634.1|  putative orcinol O-methyltransferase                   334   3e-110   Rosa odorata var. gigantea
emb|CAJ65606.1|  putative orcinol O-methyltransferase                   334   3e-110   Rosa beggeriana
emb|CAJ65599.1|  putative orcinol O-methyltransferase                   334   3e-110   Rosa chinensis [China rose]
emb|CAH05091.1|  putative orcinol O-methyltransferase                   334   3e-110   Rosa odorata var. gigantea
emb|CAJ65608.1|  putative orcinol O-methyltransferase                   334   4e-110   Rosa bracteata [Macartny rose]
emb|CAJ65661.1|  putative orcinol O-methyltransferase                   334   4e-110   Rosa odorata [tea rose]
gb|AAM23004.1|AF502433_1  orcinol O-methyltransferase                   335   4e-110   Rosa hybrid cultivar
emb|CAJ65649.1|  putative orcinol O-methyltransferase                   334   5e-110   Rosa woodsii var. ultramontana
emb|CAJ65600.1|  putative orcinol O-methyltransferase                   333   6e-110   Rosa chinensis [China rose]
emb|CAJ65638.1|  putative orcinol O-methyltransferase                   333   6e-110   Rosa hugonis
emb|CAJ65656.1|  putative orcinol O-methyltransferase                   333   7e-110   Rosa odorata [tea rose]
ref|XP_002326036.2|  hypothetical protein POPTR_0019s12290g             333   1e-109   Populus trichocarpa [western balsam poplar]
emb|CAJ65627.1|  putative orcinol O-methyltransferase                   333   1e-109   Rosa odorata var. gigantea
emb|CAH05090.1|  putative orcinol O-methyltransferase                   333   1e-109   Rosa odorata var. gigantea
emb|CAH05088.1|  putative orcinol O-methyltransferase                   333   1e-109   Rosa odorata var. gigantea
emb|CAH05086.1|  orcinol O-methyltransferase 4                          333   1e-109   Rosa hybrid cultivar
ref|XP_002274019.2|  PREDICTED: trans-resveratrol di-O-methyltran...    333   1e-109   Vitis vinifera
ref|XP_002277927.2|  PREDICTED: trans-resveratrol di-O-methyltran...    333   1e-109   Vitis vinifera
emb|CAD29555.1|  orcinol O-methyltransferase                            332   2e-109   Rosa hybrid cultivar
emb|CAJ65617.1|  putative orcinol O-methyltransferase                   332   2e-109   Rosa chinensis var. spontanea
emb|CAJ65605.1|  putative orcinol O-methyltransferase                   332   2e-109   Rosa beggeriana
emb|CAJ65659.1|  putative orcinol O-methyltransferase                   332   2e-109   Rosa odorata [tea rose]
gb|AAM23005.1|AF502434_1  orcinol O-methyltransferase                   333   2e-109   Rosa hybrid cultivar
emb|CAJ65596.1|  putative orcinol O-methyltransferase                   332   3e-109   Rosa chinensis [China rose]
emb|CAJ65636.1|  putative orcinol O-methyltransferase                   331   4e-109   Rosa odorata var. gigantea
emb|CAJ65631.1|  putative orcinol O-methyltransferase                   331   6e-109   Rosa odorata var. gigantea
emb|CAJ65657.1|  putative orcinol O-methyltransferase                   330   9e-109   Rosa odorata [tea rose]
emb|CAJ65660.1|  putative orcinol O-methyltransferase                   330   1e-108   Rosa odorata [tea rose]
emb|CAJ65639.1|  putative orcinol O-methyltransferase                   330   2e-108   Rosa hugonis
ref|XP_008229109.1|  PREDICTED: trans-resveratrol di-O-methyltran...    329   4e-108   
emb|CAN83014.1|  hypothetical protein VITISV_029725                     329   4e-108   Vitis vinifera
emb|CAJ65666.1|  putative orcinol O-methyltransferase                   329   5e-108   Rosa odorata [tea rose]
emb|CAH05080.1|  putative orcinol O-methyltransferase                   328   5e-108   Rosa gallica [apothecary rose]
ref|XP_002278057.1|  PREDICTED: trans-resveratrol di-O-methyltran...    329   6e-108   Vitis vinifera
emb|CAJ65616.1|  putative orcinol O-methyltransferase                   328   7e-108   Rosa chinensis var. spontanea
emb|CAN69333.1|  hypothetical protein VITISV_003273                     328   8e-108   Vitis vinifera
emb|CDP15888.1|  unnamed protein product                                329   8e-108   
emb|CAJ65662.1|  putative orcinol O-methyltransferase                   328   1e-107   Rosa odorata [tea rose]
ref|XP_002517827.1|  o-methyltransferase, putative                      327   2e-107   Ricinus communis
ref|XP_006376386.1|  hypothetical protein POPTR_0013s12560g             327   2e-107   
ref|XP_006469135.1|  PREDICTED: trans-resveratrol di-O-methyltran...    329   3e-107   
ref|XP_006446728.1|  hypothetical protein CICLE_v10015708mg             327   3e-107   
ref|XP_003527407.1|  PREDICTED: trans-resveratrol di-O-methyltran...    327   3e-107   
ref|XP_006428632.1|  hypothetical protein CICLE_v10012033mg             326   8e-107   
gb|KDO39394.1|  hypothetical protein CISIN_1g021867mg                   324   1e-106   
ref|XP_002278316.1|  PREDICTED: trans-resveratrol di-O-methyltran...    325   2e-106   Vitis vinifera
emb|CDP20220.1|  unnamed protein product                                322   2e-106   
ref|XP_006480453.1|  PREDICTED: trans-resveratrol di-O-methyltran...    325   3e-106   
ref|XP_006376388.1|  6a-hydroxymaackiain methyltransferase family...    323   9e-106   
ref|XP_007043718.1|  Flavonoid o-methyltransferase related              322   2e-105   
ref|XP_002278517.1|  PREDICTED: trans-resveratrol di-O-methyltran...    322   3e-105   Vitis vinifera
ref|XP_006446726.1|  hypothetical protein CICLE_v10015705mg             322   3e-105   
emb|CDP21836.1|  unnamed protein product                                321   7e-105   
ref|XP_009764108.1|  PREDICTED: trans-resveratrol di-O-methyltran...    321   8e-105   
gb|ABZ89567.1|  O-methyltransferase 3                                   322   9e-105   Humulus lupulus [common hop]
gb|KDO40717.1|  hypothetical protein CISIN_1g037127mg                   318   3e-104   
ref|XP_008229108.1|  PREDICTED: trans-resveratrol di-O-methyltran...    319   4e-104   
emb|CAJ65637.1|  putative orcinol O-methyltransferase                   318   6e-104   Rosa odorata var. gigantea
ref|XP_008245137.1|  PREDICTED: trans-resveratrol di-O-methyltran...    318   7e-104   
ref|XP_006469137.1|  PREDICTED: trans-resveratrol di-O-methyltran...    318   7e-104   
emb|CDP19840.1|  unnamed protein product                                318   1e-103   
ref|XP_002525159.1|  o-methyltransferase, putative                      318   1e-103   Ricinus communis
ref|XP_002525160.1|  o-methyltransferase, putative                      318   1e-103   Ricinus communis
ref|XP_003633248.1|  PREDICTED: trans-resveratrol di-O-methyltran...    318   2e-103   
ref|XP_003633249.1|  PREDICTED: trans-resveratrol di-O-methyltran...    317   2e-103   
ref|XP_002278294.1|  PREDICTED: trans-resveratrol di-O-methyltran...    317   4e-103   Vitis vinifera
emb|CDP21787.1|  unnamed protein product                                317   4e-103   
ref|XP_006376381.1|  6a-hydroxymaackiain methyltransferase family...    316   5e-103   
gb|AAB71213.1|  methyltransferase                                       316   8e-103   Prunus armeniaca
emb|CAQ76879.1|  resveratrol O-methyltransferase                        315   2e-102   Vitis vinifera
emb|CDP21661.1|  unnamed protein product                                315   2e-102   
emb|CAN78992.1|  hypothetical protein VITISV_005827                     314   4e-102   Vitis vinifera
gb|AEF97347.1|  O-methyltransferase                                     313   5e-102   
ref|XP_002281368.2|  PREDICTED: trans-resveratrol di-O-methyltran...    313   8e-102   Vitis vinifera
emb|CDP15886.1|  unnamed protein product                                313   9e-102   
ref|XP_003557042.1|  PREDICTED: trans-resveratrol di-O-methyltran...    313   1e-101   
ref|XP_011037442.1|  PREDICTED: trans-resveratrol di-O-methyltran...    312   2e-101   
gb|AFX68805.1|  O-metyltransferase                                      312   2e-101   
ref|XP_006376392.1|  hypothetical protein POPTR_0013s12620g             311   4e-101   
ref|XP_003544912.1|  PREDICTED: trans-resveratrol di-O-methyltran...    310   1e-100   
ref|XP_004235335.1|  PREDICTED: trans-resveratrol di-O-methyltran...    313   1e-100   
ref|XP_007132709.1|  hypothetical protein PHAVU_011G118100g             310   2e-100   
ref|XP_009594948.1|  PREDICTED: trans-resveratrol di-O-methyltran...    310   2e-100   
ref|XP_011037437.1|  PREDICTED: trans-resveratrol di-O-methyltran...    309   3e-100   
ref|XP_011016237.1|  PREDICTED: trans-resveratrol di-O-methyltran...    309   3e-100   
ref|XP_006368013.1|  PREDICTED: trans-resveratrol di-O-methyltran...    309   3e-100   
ref|NP_001267963.1|  O-methyltransferase                                309   4e-100   
ref|XP_010088036.1|  8-hydroxyquercetin 8-O-methyltransferase           309   6e-100   
sp|B6VJS4.2|ROMT_VITVI  RecName: Full=Trans-resveratrol di-O-meth...    308   9e-100   Vitis vinifera
ref|XP_002278398.1|  PREDICTED: trans-resveratrol di-O-methyltran...    308   9e-100   Vitis vinifera
gb|ABQ02270.2|  O-methyltransferase                                     308   1e-99    Vitis vinifera
emb|CAN79968.1|  hypothetical protein VITISV_043678                     307   1e-99    Vitis vinifera
emb|CDP19709.1|  unnamed protein product                                307   1e-99    
ref|NP_001268044.1|  trans-resveratrol di-O-methyltransferase           307   2e-99    
gb|AFK40900.1|  unknown                                                 307   2e-99    
ref|XP_007142077.1|  hypothetical protein PHAVU_008G250700g             306   4e-99    
ref|XP_006346268.1|  PREDICTED: trans-resveratrol di-O-methyltran...    306   6e-99    
ref|XP_003544914.1|  PREDICTED: trans-resveratrol di-O-methyltran...    305   1e-98    
ref|XP_010097399.1|  8-hydroxyquercetin 8-O-methyltransferase           305   2e-98    
ref|XP_006376396.1|  hypothetical protein POPTR_0013s12670g             304   4e-98    
ref|XP_006388573.1|  hypothetical protein POPTR_0151s00210g             303   6e-98    
gb|ABK96707.1|  unknown                                                 303   7e-98    Populus trichocarpa x Populus deltoides
ref|XP_010110665.1|  8-hydroxyquercetin 8-O-methyltransferase           304   8e-98    
emb|CDP17644.1|  unnamed protein product                                302   1e-97    
ref|XP_004490696.1|  PREDICTED: trans-resveratrol di-O-methyltran...    301   3e-97    
ref|XP_006346269.1|  PREDICTED: trans-resveratrol di-O-methyltran...    301   3e-97    
gb|KHN07780.1|  Tabersonine 16-O-methyltransferase                      300   4e-97    
ref|XP_007142076.1|  hypothetical protein PHAVU_008G250600g             301   5e-97    
emb|CDP19713.1|  unnamed protein product                                299   2e-96    
emb|CDP19711.1|  unnamed protein product                                299   2e-96    
gb|KDP24061.1|  hypothetical protein JCGZ_25718                         299   5e-96    
ref|XP_007142043.1|  hypothetical protein PHAVU_008G247600g             298   5e-96    
ref|XP_010110664.1|  8-hydroxyquercetin 8-O-methyltransferase           299   6e-96    
ref|XP_004505627.1|  PREDICTED: trans-resveratrol di-O-methyltran...    298   1e-95    
ref|XP_011100228.1|  PREDICTED: trans-resveratrol di-O-methyltran...    298   1e-95    
ref|XP_004490687.1|  PREDICTED: trans-resveratrol di-O-methyltran...    296   4e-95    
ref|XP_011100233.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...    296   5e-95    
ref|XP_011100227.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...    295   1e-94    
emb|CDP19839.1|  unnamed protein product                                294   1e-94    
ref|XP_003615966.1|  O-methyltransferase                                294   2e-94    
ref|XP_006388414.1|  6a-hydroxymaackiain methyltransferase family...    293   7e-94    
emb|CAA11131.1|  O-methyltransferase                                    293   8e-94    Prunus dulcis [sweet almond]
ref|XP_003615973.1|  O-methyltransferase                                293   9e-94    
emb|CAN70493.1|  hypothetical protein VITISV_002330                     293   1e-93    Vitis vinifera
ref|XP_002522501.1|  o-methyltransferase, putative                      292   1e-93    Ricinus communis
ref|XP_011037440.1|  PREDICTED: trans-resveratrol di-O-methyltran...    292   1e-93    
gb|AES89720.2|  orcinol O-methyltransferase                             292   2e-93    
ref|XP_011091580.1|  PREDICTED: trans-resveratrol di-O-methyltran...    290   7e-93    
gb|KHN08844.1|  8-hydroxyquercetin 8-O-methyltransferase                287   7e-92    
ref|XP_003607523.1|  O-methyltransferase                                288   1e-91    
ref|XP_003615967.1|  O-methyltransferase                                287   1e-91    
ref|XP_002517832.1|  o-methyltransferase, putative                      287   1e-91    Ricinus communis
gb|KDP24060.1|  hypothetical protein JCGZ_25717                         287   2e-91    
emb|CAN69556.1|  hypothetical protein VITISV_027590                     286   2e-91    Vitis vinifera
ref|XP_003633245.1|  PREDICTED: trans-resveratrol di-O-methyltran...    285   8e-91    
ref|XP_011070200.1|  PREDICTED: trans-resveratrol di-O-methyltran...    288   9e-91    
ref|XP_011091583.1|  PREDICTED: trans-resveratrol di-O-methyltran...    285   1e-90    
ref|XP_006469069.1|  PREDICTED: trans-resveratrol di-O-methyltran...    284   2e-90    
gb|AAR09603.1|  O-methyltransferase                                     284   2e-90    Mentha x piperita
ref|XP_011092041.1|  PREDICTED: trans-resveratrol di-O-methyltran...    283   4e-90    
gb|KDP24062.1|  hypothetical protein JCGZ_25719                         283   4e-90    
ref|XP_003527405.1|  PREDICTED: trans-resveratrol di-O-methyltran...    283   5e-90    
ref|XP_011085377.1|  PREDICTED: chavicol O-methyltransferase-like       283   8e-90    
ref|XP_002517833.1|  o-methyltransferase, putative                      283   8e-90    Ricinus communis
ref|XP_002278149.1|  PREDICTED: trans-resveratrol di-O-methyltran...    282   8e-90    Vitis vinifera
gb|AEN94899.1|  desoxyhemigossypol-6-O-methyltransferase                283   9e-90    
ref|XP_006474725.1|  PREDICTED: trans-resveratrol di-O-methyltran...    283   9e-90    
ref|XP_010040912.1|  PREDICTED: trans-resveratrol di-O-methyltran...    281   2e-89    
ref|XP_004490686.1|  PREDICTED: trans-resveratrol di-O-methyltran...    281   3e-89    
gb|KHG15351.1|  8-hydroxyquercetin 8-O-methyltransferase                281   3e-89    
ref|XP_009612081.1|  PREDICTED: trans-resveratrol di-O-methyltran...    281   3e-89    
ref|XP_002517834.1|  o-methyltransferase, putative                      281   5e-89    Ricinus communis
gb|KCW75545.1|  hypothetical protein EUGRSUZ_E04305                     281   5e-89    
ref|XP_010058047.1|  PREDICTED: trans-resveratrol di-O-methyltran...    280   5e-89    
ref|XP_011091578.1|  PREDICTED: trans-resveratrol di-O-methyltran...    280   1e-88    
emb|CAN73269.1|  hypothetical protein VITISV_021917                     279   1e-88    Vitis vinifera
ref|XP_002305103.1|  6a-hydroxymaackiain methyltransferase family...    279   1e-88    Populus trichocarpa [western balsam poplar]
ref|XP_010052409.1|  PREDICTED: trans-resveratrol di-O-methyltran...    279   2e-88    
ref|XP_010093978.1|  Tabersonine 16-O-methyltransferase                 279   2e-88    
ref|XP_010058046.1|  PREDICTED: trans-resveratrol di-O-methyltran...    279   2e-88    
gb|KDO73905.1|  hypothetical protein CISIN_1g017835mg                   278   4e-88    
ref|XP_011091736.1|  PREDICTED: trans-resveratrol di-O-methyltran...    284   4e-88    
ref|XP_011027757.1|  PREDICTED: trans-resveratrol di-O-methyltran...    278   4e-88    
ref|XP_006377432.1|  6a-hydroxymaackiain methyltransferase family...    278   6e-88    
ref|XP_002517835.1|  o-methyltransferase, putative                      277   8e-88    Ricinus communis
ref|XP_010023968.1|  PREDICTED: trans-resveratrol di-O-methyltran...    276   2e-87    
ref|XP_008229106.1|  PREDICTED: trans-resveratrol di-O-methyltran...    277   3e-87    
ref|XP_002262833.1|  PREDICTED: trans-resveratrol di-O-methyltran...    276   3e-87    Vitis vinifera
ref|XP_006446725.1|  hypothetical protein CICLE_v10015630mg             276   3e-87    
gb|EYU30782.1|  hypothetical protein MIMGU_mgv1a021078mg                276   3e-87    
ref|XP_006452811.1|  hypothetical protein CICLE_v10008718mg             276   4e-87    
ref|XP_011001214.1|  PREDICTED: trans-resveratrol di-O-methyltran...    276   4e-87    
gb|ACV65500.1|  deoxyhemigossypol-6-O-methyltransferase                 276   4e-87    Gossypium hirsutum [American cotton]
ref|XP_006387382.1|  hypothetical protein POPTR_1124s00200g             270   9e-87    
ref|XP_002278127.1|  PREDICTED: trans-resveratrol di-O-methyltran...    273   2e-86    Vitis vinifera
gb|KCW89599.1|  hypothetical protein EUGRSUZ_A01884                     273   3e-86    
ref|XP_010070255.1|  PREDICTED: trans-resveratrol di-O-methyltran...    273   4e-86    
ref|XP_010111159.1|  6a-hydroxymaackiain methyltransferase 1            275   4e-86    
gb|KDP21023.1|  hypothetical protein JCGZ_21494                         273   4e-86    
ref|XP_008343875.1|  PREDICTED: trans-resveratrol di-O-methyltran...    274   4e-86    
ref|XP_004169298.1|  PREDICTED: trans-resveratrol di-O-methyltran...    273   4e-86    
dbj|BAI79244.1|  O-methyltransferase                                    273   5e-86    Carapichea ipecacuanha [ipecac]
ref|XP_004151735.1|  PREDICTED: trans-resveratrol di-O-methyltran...    273   5e-86    
ref|XP_011091579.1|  PREDICTED: trans-resveratrol di-O-methyltran...    273   5e-86    
ref|XP_010052318.1|  PREDICTED: trans-resveratrol di-O-methyltran...    273   5e-86    
gb|KGN43480.1|  hypothetical protein Csa_7G039280                       273   6e-86    
ref|XP_009779391.1|  PREDICTED: trans-resveratrol di-O-methyltran...    272   7e-86    
ref|XP_006469063.1|  PREDICTED: trans-resveratrol di-O-methyltran...    273   8e-86    
dbj|BAJ05387.1|  O-methyltransferase                                    272   8e-86    
ref|XP_006469138.1|  PREDICTED: trans-resveratrol di-O-methyltran...    278   9e-86    
sp|Q6VMW0.1|Q8OMT_MENPI  RecName: Full=8-hydroxyquercetin 8-O-met...    272   1e-85    Mentha x piperita
ref|XP_002525163.1|  o-methyltransferase, putative                      270   2e-85    Ricinus communis
dbj|BAJ05384.1|  O-methyltransferase                                    270   3e-85    
gb|AGQ21572.1|  flavone 8-O-methyltransferase                           270   4e-85    
ref|XP_009605623.1|  PREDICTED: myricetin O-methyltransferase-like      271   4e-85    
ref|XP_009345025.1|  PREDICTED: trans-resveratrol di-O-methyltran...    270   4e-85    
gb|EYU30737.1|  hypothetical protein MIMGU_mgv1a009866mg                269   5e-85    
emb|CAN77288.1|  hypothetical protein VITISV_004161                     268   5e-85    Vitis vinifera
emb|CAN73270.1|  hypothetical protein VITISV_021918                     269   5e-85    Vitis vinifera
emb|CDO96819.1|  unnamed protein product                                267   7e-85    
ref|XP_006365443.1|  PREDICTED: trans-resveratrol di-O-methyltran...    270   8e-85    
sp|Q8GSN1.1|MOMT_CATRO  RecName: Full=Myricetin O-methyltransfera...    269   9e-85    Catharanthus roseus [chatas]
ref|XP_010260367.1|  PREDICTED: trans-resveratrol di-O-methyltran...    270   9e-85    
ref|XP_002278208.2|  PREDICTED: trans-resveratrol di-O-methyltran...    270   1e-84    Vitis vinifera
ref|XP_009351009.1|  PREDICTED: trans-resveratrol di-O-methyltran...    270   2e-84    
gb|KHN07781.1|  Tabersonine 16-O-methyltransferase                      268   2e-84    
ref|XP_004229155.1|  PREDICTED: myricetin O-methyltransferase-lik...    268   2e-84    
gb|AIY62760.1|  N-acetylserotonin O-methyltransferase                   268   2e-84    
ref|XP_011085639.1|  PREDICTED: chavicol O-methyltransferase-like       268   3e-84    
ref|XP_004170024.1|  PREDICTED: trans-resveratrol di-O-methyltran...    269   3e-84    
emb|CAN75970.1|  hypothetical protein VITISV_009881                     268   3e-84    Vitis vinifera
ref|XP_008364164.1|  PREDICTED: trans-resveratrol di-O-methyltran...    268   3e-84    
ref|XP_008364163.1|  PREDICTED: trans-resveratrol di-O-methyltran...    268   3e-84    
ref|XP_008455485.1|  PREDICTED: trans-resveratrol di-O-methyltran...    268   5e-84    
ref|XP_006469136.1|  PREDICTED: trans-resveratrol di-O-methyltran...    268   6e-84    
emb|CDO96828.1|  unnamed protein product                                264   1e-83    
ref|XP_006582298.1|  PREDICTED: trans-resveratrol di-O-methyltran...    266   1e-83    
ref|XP_004139733.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...    268   1e-83    
ref|XP_009780812.1|  PREDICTED: myricetin O-methyltransferase-like      266   2e-83    
ref|XP_009778350.1|  PREDICTED: trans-resveratrol di-O-methyltran...    265   3e-83    
dbj|BAJ72588.1|  7'-O-demethylcephaeline/cephaeline O-methyltrans...    265   3e-83    
ref|XP_011077108.1|  PREDICTED: chavicol O-methyltransferase-like       266   3e-83    
ref|XP_007025514.1|  Flavonoid o-methyltransferase related              265   3e-83    
ref|XP_006357086.1|  PREDICTED: tabersonine 16-O-methyltransferas...    265   3e-83    
dbj|BAA86059.1|  O-methyltransferase                                    266   4e-83    
ref|XP_006365444.1|  PREDICTED: trans-resveratrol di-O-methyltran...    265   7e-83    
ref|XP_008392935.1|  PREDICTED: trans-resveratrol di-O-methyltran...    265   8e-83    
ref|XP_004232927.1|  PREDICTED: trans-resveratrol di-O-methyltran...    265   8e-83    
ref|XP_006388574.1|  hypothetical protein POPTR_0151s00220g             263   9e-83    
ref|XP_008354304.1|  PREDICTED: trans-resveratrol di-O-methyltran...    265   1e-82    
ref|XP_008343876.1|  PREDICTED: trans-resveratrol di-O-methyltran...    265   1e-82    
ref|XP_004252468.1|  PREDICTED: trans-resveratrol di-O-methyltran...    264   1e-82    
emb|CDP21583.1|  unnamed protein product                                262   2e-82    
ref|XP_009625456.1|  PREDICTED: trans-resveratrol di-O-methyltran...    263   4e-82    
ref|XP_004139732.1|  PREDICTED: trans-resveratrol di-O-methyltran...    263   5e-82    
ref|XP_002278092.1|  PREDICTED: trans-resveratrol di-O-methyltran...    262   6e-82    
ref|NP_001267964.1|  O-methyltransferase                                261   1e-81    
ref|XP_008362623.1|  PREDICTED: trans-resveratrol di-O-methyltran...    262   2e-81    
sp|Q93WU2.1|EOMT1_OCIBA  RecName: Full=Eugenol O-methyltransferas...    261   3e-81    
emb|CBI22005.3|  unnamed protein product                                259   4e-81    
gb|KDP35397.1|  hypothetical protein JCGZ_10381                         260   5e-81    
ref|XP_004163430.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...    259   6e-81    
gb|KDP21022.1|  hypothetical protein JCGZ_21493                         259   7e-81    
ref|XP_009597678.1|  PREDICTED: trans-resveratrol di-O-methyltran...    261   8e-81    
sp|B0EXJ8.1|HTOMT_CATRO  RecName: Full=Tabersonine 16-O-methyltra...    259   8e-81    
emb|CAN76576.1|  hypothetical protein VITISV_035390                     255   9e-81    
ref|XP_010920172.1|  PREDICTED: trans-resveratrol di-O-methyltran...    259   1e-80    
ref|XP_002522500.1|  o-methyltransferase, putative                      259   1e-80    
ref|XP_009628719.1|  PREDICTED: trans-resveratrol di-O-methyltran...    259   1e-80    
gb|KCW44789.1|  hypothetical protein EUGRSUZ_L01645                     258   2e-80    
ref|XP_003615962.1|  O-methyltransferase                                258   2e-80    
ref|XP_004293905.1|  PREDICTED: trans-resveratrol di-O-methyltran...    258   3e-80    
dbj|BAJ05383.1|  O-methyltransferase                                    257   5e-80    
dbj|BAI79243.1|  O-methyltransferase                                    256   8e-80    
ref|XP_010920173.1|  PREDICTED: trans-resveratrol di-O-methyltran...    257   8e-80    
ref|XP_004303135.1|  PREDICTED: trans-resveratrol di-O-methyltran...    257   8e-80    
gb|KDO75191.1|  hypothetical protein CISIN_1g018205mg                   257   8e-80    
ref|XP_010920170.1|  PREDICTED: trans-resveratrol di-O-methyltran...    257   9e-80    
ref|XP_006371493.1|  hypothetical protein POPTR_0019s12280g             254   9e-80    
ref|XP_010023967.1|  PREDICTED: trans-resveratrol di-O-methyltran...    256   1e-79    
ref|XP_008392936.1|  PREDICTED: trans-resveratrol di-O-methyltran...    256   1e-79    
ref|NP_001241010.1|  uncharacterized protein LOC100812688               256   1e-79    
sp|Q93WU3.1|CVMT1_OCIBA  RecName: Full=Chavicol O-methyltransfera...    256   2e-79    
gb|ADO16249.1|  chavicol O-methyltransferase                            255   4e-79    
ref|XP_009791021.1|  PREDICTED: trans-resveratrol di-O-methyltran...    256   4e-79    
gb|KCW59786.1|  hypothetical protein EUGRSUZ_H02535                     255   4e-79    
ref|XP_006471149.1|  PREDICTED: trans-resveratrol di-O-methyltran...    254   8e-79    
ref|XP_006448856.1|  hypothetical protein CICLE_v10015723mg             254   1e-78    
ref|XP_008359463.1|  PREDICTED: trans-resveratrol di-O-methyltran...    254   1e-78    
ref|XP_010689977.1|  PREDICTED: trans-resveratrol di-O-methyltran...    254   2e-78    
dbj|BAI77794.1|  chavicol O-methyltransferase                           253   2e-78    
ref|XP_010057350.1|  PREDICTED: trans-resveratrol di-O-methyltran...    254   2e-78    
gb|AJD20223.1|  norcoclaurine 6-O-methyltransferase                     253   2e-78    
gb|KCW74501.1|  hypothetical protein EUGRSUZ_E03213                     253   3e-78    
ref|XP_003531866.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    253   3e-78    
ref|XP_010057351.1|  PREDICTED: trans-resveratrol di-O-methyltran...    253   4e-78    
ref|XP_006468348.1|  PREDICTED: trans-resveratrol di-O-methyltran...    252   4e-78    
ref|XP_008356011.1|  PREDICTED: trans-resveratrol di-O-methyltran...    249   9e-78    
gb|AAR02421.1|  putative O-methyltransferase                            251   9e-78    
dbj|BAI79245.1|  O-methyltransferase                                    251   9e-78    
ref|XP_010093977.1|  Tabersonine 16-O-methyltransferase                 251   1e-77    
ref|XP_002522586.1|  o-methyltransferase, putative                      251   1e-77    
ref|XP_011091734.1|  PREDICTED: trans-resveratrol di-O-methyltran...    250   1e-77    
ref|XP_009597680.1|  PREDICTED: trans-resveratrol di-O-methyltran...    251   2e-77    
ref|XP_010920171.1|  PREDICTED: trans-resveratrol di-O-methyltran...    251   2e-77    
ref|XP_010109381.1|  Tabersonine 16-O-methyltransferase                 250   3e-77    
gb|KDP35391.1|  hypothetical protein JCGZ_10375                         250   3e-77    
gb|AAX82431.1|  3,5-dimethoxyphenol O-methyltransferase                 251   3e-77    
gb|KCW74500.1|  hypothetical protein EUGRSUZ_E03212                     250   3e-77    
ref|XP_003615968.1|  O-methyltransferase                                249   5e-77    
ref|XP_010320677.1|  PREDICTED: trans-resveratrol di-O-methyltran...    249   5e-77    
ref|XP_010320673.1|  PREDICTED: trans-resveratrol di-O-methyltran...    249   5e-77    
ref|XP_009791022.1|  PREDICTED: trans-resveratrol di-O-methyltran...    251   6e-77    
dbj|BAJ05388.1|  O-methyltransferase                                    249   7e-77    
ref|XP_011027758.1|  PREDICTED: trans-resveratrol di-O-methyltran...    249   7e-77    
emb|CAN75971.1|  hypothetical protein VITISV_009882                     248   8e-77    
ref|NP_001241162.1|  uncharacterized protein LOC100813225               249   8e-77    
ref|XP_010070153.1|  PREDICTED: trans-resveratrol di-O-methyltran...    249   1e-76    
emb|CDP21582.1|  unnamed protein product                                248   1e-76    
gb|AAR02419.1|  flavonoid 4'-O-methyltransferase                        248   2e-76    
gb|KDP24059.1|  hypothetical protein JCGZ_25716                         244   2e-76    
ref|XP_009344934.1|  PREDICTED: trans-resveratrol di-O-methyltran...    248   2e-76    
ref|XP_004151088.1|  PREDICTED: trans-resveratrol di-O-methyltran...    246   2e-76    
gb|KHN13532.1|  Isoflavone 7-O-methyltransferase                        248   3e-76    
ref|XP_004169299.1|  PREDICTED: trans-resveratrol di-O-methyltran...    246   3e-76    
ref|XP_006377431.1|  6a-hydroxymaackiain methyltransferase family...    248   3e-76    
ref|XP_011001215.1|  PREDICTED: trans-resveratrol di-O-methyltran...    247   4e-76    
ref|XP_003536186.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    247   5e-76    
ref|XP_007025515.1|  Flavonoid o-methyltransferase related, putative    248   5e-76    
ref|XP_004241914.1|  PREDICTED: myricetin O-methyltransferase-like      247   6e-76    
ref|XP_009376908.1|  PREDICTED: trans-resveratrol di-O-methyltran...    247   8e-76    
ref|XP_007132755.1|  hypothetical protein PHAVU_011G1223001g            241   8e-76    
ref|XP_008788394.1|  PREDICTED: trans-resveratrol di-O-methyltran...    247   9e-76    
ref|XP_008788395.1|  PREDICTED: trans-resveratrol di-O-methyltran...    247   9e-76    
ref|XP_010938927.1|  PREDICTED: trans-resveratrol di-O-methyltran...    246   1e-75    
gb|KHN14021.1|  Isoflavone 7-O-methyltransferase                        244   2e-75    
ref|XP_008359464.1|  PREDICTED: trans-resveratrol di-O-methyltran...    246   2e-75    
ref|XP_008778546.1|  PREDICTED: trans-resveratrol di-O-methyltran...    245   2e-75    
ref|XP_010052330.1|  PREDICTED: trans-resveratrol di-O-methyltran...    244   6e-75    
ref|XP_010111158.1|  Tabersonine 16-O-methyltransferase                 244   7e-75    
ref|XP_008362624.1|  PREDICTED: trans-resveratrol di-O-methyltran...    241   8e-75    
ref|XP_006356529.1|  PREDICTED: trans-resveratrol di-O-methyltran...    244   9e-75    
ref|XP_003552589.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    244   9e-75    
ref|XP_003533873.1|  PREDICTED: isoflavone-7-O-methyltransferase ...    243   2e-74    
ref|XP_002305104.2|  6a-hydroxymaackiain methyltransferase family...    243   2e-74    
ref|XP_008778275.1|  PREDICTED: trans-resveratrol di-O-methyltran...    243   2e-74    
ref|XP_006356531.1|  PREDICTED: trans-resveratrol di-O-methyltran...    242   4e-74    
emb|CBI21927.3|  unnamed protein product                                239   4e-74    
ref|XP_003536187.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    241   9e-74    
ref|XP_006364318.1|  PREDICTED: trans-resveratrol di-O-methyltran...    241   1e-73    
ref|XP_010694747.1|  PREDICTED: trans-resveratrol di-O-methyltran...    241   1e-73    
gb|AAR02417.1|  putative O-methyltransferase                            241   1e-73    
ref|XP_010680776.1|  PREDICTED: trans-resveratrol di-O-methyltran...    241   1e-73    
ref|XP_008807987.1|  PREDICTED: trans-resveratrol di-O-methyltran...    240   2e-73    
ref|XP_003556407.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    240   3e-73    
gb|ACU20151.1|  unknown                                                 239   3e-73    
ref|XP_006421002.1|  hypothetical protein CICLE_v10006550mg             239   3e-73    
ref|XP_004232928.1|  PREDICTED: trans-resveratrol di-O-methyltran...    239   3e-73    
ref|XP_003536188.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    239   4e-73    
gb|ADZ76434.1|  myricetin O-methyltransferase 2                         239   6e-73    
ref|XP_004241912.1|  PREDICTED: trans-resveratrol di-O-methyltran...    239   6e-73    
gb|ACU19152.1|  unknown                                                 236   7e-73    
emb|CDP21212.1|  unnamed protein product                                238   9e-73    
ref|XP_011091735.1|  PREDICTED: trans-resveratrol di-O-methyltran...    237   2e-72    
ref|XP_006420642.1|  hypothetical protein CICLE_v10005275mg             238   2e-72    
ref|XP_006489813.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...    237   4e-72    
gb|KEH29280.1|  isoflavone-7-O-methyltransferase                        236   1e-71    
ref|XP_006420638.1|  hypothetical protein CICLE_v10005279mg             236   1e-71    
ref|XP_006420643.1|  hypothetical protein CICLE_v10005276mg             236   1e-71    
ref|XP_010057348.1|  PREDICTED: trans-resveratrol di-O-methyltran...    236   1e-71    
ref|XP_006364328.1|  PREDICTED: trans-resveratrol di-O-methyltran...    235   2e-71    
emb|CBI21932.3|  unnamed protein product                                238   2e-71    
sp|Q84KK4.1|I4OMT_LOTJA  RecName: Full=Isoflavone 4'-O-methyltran...    236   2e-71    
ref|XP_010093975.1|  Isoflavone-7-O-methyltransferase 8                 235   2e-71    
gb|ABD83946.1|  IOMT 7                                                  235   2e-71    
gb|KHN30530.1|  Isoflavone 7-O-methyltransferase                        240   2e-71    
ref|XP_006489814.1|  PREDICTED: trans-resveratrol di-O-methyltran...    234   4e-71    
gb|KCW74012.1|  hypothetical protein EUGRSUZ_E02637                     233   5e-71    
ref|XP_008466961.1|  PREDICTED: trans-resveratrol di-O-methyltran...    231   5e-71    
ref|XP_009593020.1|  PREDICTED: trans-resveratrol di-O-methyltran...    234   5e-71    
emb|CBI21931.3|  unnamed protein product                                231   5e-71    
emb|CBI21925.3|  unnamed protein product                                231   7e-71    
ref|XP_008454865.1|  PREDICTED: trans-resveratrol di-O-methyltran...    235   8e-71    
gb|AAM97498.1|  O-methyltransferase                                     233   8e-71    
gb|KDO39657.1|  hypothetical protein CISIN_1g046346mg                   228   1e-70    
ref|XP_010093976.1|  Myricetin O-methyltransferase                      234   1e-70    
gb|KEH29290.1|  isoflavone-7-O-methyltransferase                        233   1e-70    
ref|XP_010032853.1|  PREDICTED: trans-resveratrol di-O-methyltran...    233   1e-70    
ref|XP_009398848.1|  PREDICTED: trans-resveratrol di-O-methyltran...    233   1e-70    
ref|XP_003555535.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    233   1e-70    
gb|KCW74499.1|  hypothetical protein EUGRSUZ_E03211                     232   3e-70    
ref|XP_006356530.1|  PREDICTED: trans-resveratrol di-O-methyltran...    232   3e-70    
ref|XP_010070166.1|  PREDICTED: trans-resveratrol di-O-methyltran...    233   3e-70    
ref|XP_010095219.1|  Tabersonine 16-O-methyltransferase                 228   7e-70    
ref|XP_008778001.1|  PREDICTED: trans-resveratrol di-O-methyltran...    231   8e-70    
ref|XP_010683510.1|  PREDICTED: trans-resveratrol di-O-methyltran...    230   8e-70    
ref|XP_003556405.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    231   1e-69    
ref|XP_006351391.1|  PREDICTED: trans-resveratrol di-O-methyltran...    231   1e-69    
ref|XP_006364329.1|  PREDICTED: uncharacterized protein LOC102587683    241   2e-69    
ref|XP_007139476.1|  hypothetical protein PHAVU_008G032700g             230   2e-69    
ref|XP_007143925.1|  hypothetical protein PHAVU_007G114000g             230   2e-69    
gb|ABD83942.1|  IOMT 2                                                  230   2e-69    
ref|XP_004489528.1|  PREDICTED: isoflavone-7-O-methyltransferase ...    229   3e-69    
ref|XP_003608210.1|  Isoflavone-7-O-methyltransferase                   229   4e-69    
ref|XP_006449423.1|  hypothetical protein CICLE_v10015724mg             229   4e-69    
emb|CDP19712.1|  unnamed protein product                                225   5e-69    
sp|Q84KK5.1|D7OMT_GLYEC  RecName: Full=Isoflavone 7-O-methyltrans...    229   6e-69    
sp|O22308.1|7OMT6_MEDSA  RecName: Full=Isoflavone-7-O-methyltrans...    228   7e-69    
sp|O24529.1|7OMT8_MEDSA  RecName: Full=Isoflavone-7-O-methyltrans...    228   7e-69    
gb|KHN08846.1|  8-hydroxyquercetin 8-O-methyltransferase                225   8e-69    
gb|KHN30531.1|  Isoflavone 7-O-methyltransferase                        228   8e-69    
gb|KHN05026.1|  Isoflavone 7-O-methyltransferase                        228   8e-69    
ref|XP_009618299.1|  PREDICTED: trans-resveratrol di-O-methyltran...    228   8e-69    
ref|XP_006467714.1|  PREDICTED: isoflavone 4'-O-methyltransferase...    228   1e-68    
sp|O22309.1|7OMT9_MEDSA  RecName: Full=Isoflavone-7-O-methyltrans...    228   1e-68    
ref|XP_006467715.1|  PREDICTED: isoflavone 4'-O-methyltransferase...    228   1e-68    
gb|AES78096.2|  isoflavone-7-O-methyltransferase                        228   1e-68    
ref|XP_007148101.1|  hypothetical protein PHAVU_006G180900g             228   1e-68    
ref|XP_010040590.1|  PREDICTED: trans-resveratrol di-O-methyltran...    227   1e-68    
emb|CBI21921.3|  unnamed protein product                                226   1e-68    
gb|AFK42082.1|  unknown                                                 228   1e-68    
gb|KCW45078.1|  hypothetical protein EUGRSUZ_L01321                     226   2e-68    
ref|XP_010916034.1|  PREDICTED: trans-resveratrol di-O-methyltran...    228   2e-68    
ref|XP_008779514.1|  PREDICTED: trans-resveratrol di-O-methyltran...    228   2e-68    
ref|XP_004505392.1|  PREDICTED: isoflavone-7-O-methyltransferase ...    227   2e-68    
ref|NP_001241397.1|  uncharacterized protein LOC100808660               222   3e-68    
ref|XP_007141104.1|  hypothetical protein PHAVU_008G1678001g            223   3e-68    
ref|XP_007141103.1|  hypothetical protein PHAVU_008G1678001g            223   3e-68    
gb|KEH29286.1|  isoflavone-7-O-methyltransferase                        226   5e-68    
gb|ABD83947.1|  IOMT 8                                                  226   7e-68    
gb|KGN43481.1|  O-methyltransferase                                     224   7e-68    
ref|XP_009396879.1|  PREDICTED: trans-resveratrol di-O-methyltran...    226   7e-68    
gb|AFK47832.1|  unknown                                                 226   7e-68    
gb|AEF14418.1|  isoflavone O-methyltranferase                           226   1e-67    
gb|KGN44538.1|  hypothetical protein Csa_7G328260                       225   1e-67    
ref|XP_003621486.1|  Isoflavone-7-O-methyltransferase                   230   2e-67    
ref|XP_003552574.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    225   2e-67    
ref|XP_008465175.1|  PREDICTED: trans-resveratrol di-O-methyltran...    224   2e-67    
ref|XP_008792251.1|  PREDICTED: trans-resveratrol di-O-methyltran...    224   2e-67    
ref|XP_004158564.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...    225   3e-67    
ref|XP_004151906.1|  PREDICTED: trans-resveratrol di-O-methyltran...    224   3e-67    
ref|XP_003608212.1|  Isoflavone-7-O-methyltransferase                   229   4e-67    
gb|ABD83944.1|  IOMT 4                                                  224   4e-67    
ref|XP_003622357.1|  Isoflavone-7-O-methyltransferase                   224   5e-67    
gb|AIE16688.1|  isoflavone O-methyltransferase                          219   7e-67    
ref|XP_008783119.1|  PREDICTED: trans-resveratrol di-O-methyltran...    223   8e-67    
gb|AIE16682.1|  isoflavone O-methyltransferase                          219   9e-67    
gb|AIE16681.1|  isoflavone O-methyltransferase                          219   1e-66    
gb|AIE16678.1|  isoflavone O-methyltransferase                          219   1e-66    
ref|XP_008455944.1|  PREDICTED: trans-resveratrol di-O-methyltran...    223   1e-66    
ref|XP_006492044.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    223   2e-66    
ref|XP_003608214.1|  Isoflavone-7-O-methyltransferase                   222   2e-66    
gb|KEH29283.1|  isoflavone-7-O-methyltransferase                        222   2e-66    
gb|ABD83945.1|  IOMT 6                                                  222   2e-66    
gb|AES78098.2|  isoflavone-7-O-methyltransferase                        221   3e-66    
gb|ABJ88948.1|  coniferyl alcohol 9-O-methyltransferase                 222   4e-66    
gb|ABJ88946.1|  coniferyl alcohol 9-O-methyltransferase                 221   1e-65    
ref|XP_010070176.1|  PREDICTED: trans-resveratrol di-O-methyltran...    221   1e-65    



>ref|XP_009780941.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=363

 Score =   377 bits (968),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 180/273 (66%), Positives = 218/273 (80%), Gaps = 14/273 (5%)
 Frame = -2

Query  784  LPSMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIP  605
            +P +G+ + E+L++QTHIWN+IFS+I S SLK A++L IPDIIHKHG+P+TL +LA+A+ 
Sbjct  3    VPIVGEHETEILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLDQLANALS  62

Query  604  INKAKAGHLARLMRTLIHSGFFFHTK------------DAYALAQPSTLLLKDNPFSLRP  461
            INKAK  HL RLMR LIHSGFF  ++            + YALA PS LLLKD P S+ P
Sbjct  63   INKAKTTHLRRLMRILIHSGFFVKSRIQENEGESERIGEGYALAPPSRLLLKDEPLSVTP  122

Query  460  FLLFLVDNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASD  281
            FLL ++D PIL+ +PW+H  EWF+ND P PFDTAHG T WDYAGH+P  NH FN+AMASD
Sbjct  123  FLLAMLD-PILV-KPWHHVSEWFENDHPTPFDTAHGRTFWDYAGHEPRLNHFFNDAMASD  180

Query  280  TRLVMNVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGT  101
             +LVMNVVIKY K VFEGLNS+VDV GGTGTVA++IA AFPDL+CTVFDLPHV+ GLEG 
Sbjct  181  AKLVMNVVIKYSKDVFEGLNSIVDVGGGTGTVAKSIANAFPDLQCTVFDLPHVVEGLEGN  240

Query  100  KNLDYVGGDMFVSIPHANALFLKWILHDWNDED  2
            KNL+YVGGD FVSIP A+AL LKWILHDW+DE+
Sbjct  241  KNLNYVGGDFFVSIPPADALLLKWILHDWSDEE  273



>ref|XP_009602136.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=361

 Score =   370 bits (951),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 177/271 (65%), Positives = 217/271 (80%), Gaps = 12/271 (4%)
 Frame = -2

Query  784  LPSMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIP  605
            +P +G+ + E+L++QTHIWN+IFS+I S SLK A++L IPDIIHKHG+P+TL +LA+A+ 
Sbjct  3    VPIVGEHETEILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLDQLANALS  62

Query  604  INKAKAGHLARLMRTLIHSGFFFHTK----------DAYALAQPSTLLLKDNPFSLRPFL  455
            INKAK  HL RLMR LI SGFF  ++          + Y+LA PS LLLKD P S+ PFL
Sbjct  63   INKAKTTHLRRLMRILIRSGFFVKSRIQENEGESEGEGYSLAPPSRLLLKDEPLSVTPFL  122

Query  454  LFLVDNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTR  275
            L ++D PIL+ +PW+H  EWF+ND P PFDTAHG T WDYAGH+P  NH FN+AMASD +
Sbjct  123  LAMLD-PILV-KPWHHVSEWFENDHPTPFDTAHGRTFWDYAGHEPRLNHFFNDAMASDAK  180

Query  274  LVMNVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKN  95
            LVMNVVIKY K VFEGLNS+VDV GGTGTVA++IA AFPDL+CTVFDLPHV+ GLE +KN
Sbjct  181  LVMNVVIKYSKDVFEGLNSIVDVGGGTGTVAKSIANAFPDLQCTVFDLPHVVEGLEESKN  240

Query  94   LDYVGGDMFVSIPHANALFLKWILHDWNDED  2
            L+YVGGD FVSIP A+AL LKWILHDW+DE+
Sbjct  241  LNYVGGDFFVSIPPADALLLKWILHDWSDEE  271



>ref|XP_006366298.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=365

 Score =   354 bits (908),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 168/275 (61%), Positives = 212/275 (77%), Gaps = 16/275 (6%)
 Frame = -2

Query  784  LPSMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIP  605
            +P +G+ + E+L++QTHIWN+IFS+I S SLK A++L IPDIIHKHG+P+TL ELA+A+ 
Sbjct  3    VPIVGEHESEILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLNELANALS  62

Query  604  INKAKAGHLARLMRTLIHSGFFFH--------------TKDAYALAQPSTLLLKDNPFSL  467
            INK+K  HL RLMR LIHSGFF                  + Y LA P+ LLLKD P ++
Sbjct  63   INKSKITHLRRLMRILIHSGFFLKFAMIPLEEGSSGSGEGEGYVLAPPARLLLKDEPLTV  122

Query  466  RPFLLFLVDNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMA  287
             PFLL ++D PIL+ +PW+H  EWF +D+P PF+ AHG T WDYAGH+   NH FN+AMA
Sbjct  123  TPFLLAMLD-PILV-KPWHHVNEWFSSDEPTPFEVAHGRTFWDYAGHEQRLNHFFNDAMA  180

Query  286  SDTRLVMNVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLE  107
            SD +LVM+VV+KY K VFEGLNS+VDV GGTGTVA+TIA+ FP+L+CTVFDLPHV+ GLE
Sbjct  181  SDAKLVMSVVMKYSKDVFEGLNSIVDVGGGTGTVAKTIAKKFPNLQCTVFDLPHVVEGLE  240

Query  106  GTKNLDYVGGDMFVSIPHANALFLKWILHDWNDED  2
            G+ NL YVGGD FVS+P A+AL LKWILHDW+DE+
Sbjct  241  GSDNLSYVGGDFFVSVPPADALLLKWILHDWSDEE  275



>ref|XP_002278211.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   347 bits (890),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 165/259 (64%), Positives = 201/259 (78%), Gaps = 9/259 (3%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL++Q H+WN+IF++I S SLKCA++LGIPDIIH HG+P+TL EL   +PI+  K   +
Sbjct  11   ELLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPIHPKKVWCV  70

Query  577  ARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
             RLMR L+ SGFF   K       + Y L   S LLL+D+P S+RPFLL ++D PIL T+
Sbjct  71   YRLMRILVQSGFFARQKVEESEQEEGYVLTHASRLLLEDDPLSVRPFLLAMLD-PIL-TK  128

Query  418  PWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKG  239
            PW++   WFQNDDP PFDTAHG T WDY GH+P+ N+ FNEAMASD RLV +V+IK CKG
Sbjct  129  PWHYVSAWFQNDDPTPFDTAHGRTFWDYGGHEPKINNFFNEAMASDARLVTSVLIKDCKG  188

Query  238  VFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSI  59
            VFEGLNSLVDV GGTGTVA+ IA AFP L CTVFDLPHV+ GLEG+KNL+Y+GGDMF  I
Sbjct  189  VFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVFDLPHVVAGLEGSKNLNYLGGDMFKGI  248

Query  58   PHANALFLKWILHDWNDED  2
            P A+A+ LKWILHDWNDE+
Sbjct  249  PPADAILLKWILHDWNDEE  267



>emb|CAN61955.1| hypothetical protein VITISV_020020 [Vitis vinifera]
Length=357

 Score =   345 bits (886),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/259 (63%), Positives = 200/259 (77%), Gaps = 9/259 (3%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL++Q H+WN+IF++I S SLKCA++LGIPDIIH HG+P+TL EL   +PI+  K   +
Sbjct  11   ELLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPIHPKKVWCV  70

Query  577  ARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
             RLMR L+ SGFF   K       + Y L   S LLL+D+P S+RPFLL ++D PIL T+
Sbjct  71   YRLMRILVQSGFFARQKVEESEQEEGYVLTHASRLLLEDDPLSVRPFLLAMLD-PIL-TK  128

Query  418  PWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKG  239
            PW++   WFQNDDP PFDTAHG T WDY GH+P+ N+ FNEAMASD RLV + +IK CKG
Sbjct  129  PWHYVSAWFQNDDPTPFDTAHGXTFWDYGGHEPKJNNFFNEAMASDARLVTSXLIKDCKG  188

Query  238  VFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSI  59
            VFEGLNSLVDV GGTGTVA+ IA AFP L CTVFDLPHV+ GLEG+KNL+Y+GGDMF  I
Sbjct  189  VFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVFDLPHVVAGLEGSKNLNYLGGDMFKGI  248

Query  58   PHANALFLKWILHDWNDED  2
            P A+A+ LKWILHDWNDE+
Sbjct  249  PPADAILLKWILHDWNDEE  267



>ref|XP_004248183.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=362

 Score =   344 bits (882),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 168/272 (62%), Positives = 211/272 (78%), Gaps = 13/272 (5%)
 Frame = -2

Query  784  LPSMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIP  605
            +P +G+ + E+L++QTHIWN+IFS+I S SLK A++L IPDIIHKHG+P+TL ELA+A+ 
Sbjct  3    VPIVGEHETEILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLDELANALS  62

Query  604  INKAKAGHLARLMRTLIHSGFFFHTKDA-----------YALAQPSTLLLKDNPFSLRPF  458
            IN +K  HL RLMR L+HSGFF  +              Y LA P+ LLLKD P ++ PF
Sbjct  63   INHSKITHLRRLMRILVHSGFFLKSVSGSGSESGSGEGGYVLAPPALLLLKDEPLTVTPF  122

Query  457  LLFLVDNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDT  278
            LL ++D PIL+ +PW+H  EWF +D+P  F+ AHG T WDYAGH+P  NH FN+AMASD 
Sbjct  123  LLAMLD-PILV-KPWHHVSEWFTSDEPTAFEVAHGRTFWDYAGHEPRLNHFFNDAMASDA  180

Query  277  RLVMNVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTK  98
            +LVM+VV+KY K VFEGLNS+VDV GGTGTVA+TIA+ FP+L+CTVFDLPHV+ GLEG+ 
Sbjct  181  KLVMSVVMKYSKDVFEGLNSIVDVGGGTGTVAKTIAKTFPNLQCTVFDLPHVVEGLEGSD  240

Query  97   NLDYVGGDMFVSIPHANALFLKWILHDWNDED  2
            NL YVGGD FVSIPHA AL LKWILHDW+DE+
Sbjct  241  NLTYVGGDFFVSIPHAEALLLKWILHDWSDEE  272



>emb|CAJ65602.1| putative orcinol O-methyltransferase [Rosa banksiae]
Length=346

 Score =   343 bits (881),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 165/265 (62%), Positives = 201/265 (76%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMRTL+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRTLVHSGFFAKKKLSTTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDPAPFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPAPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+A+ LKWILHDWNDE+
Sbjct  242  DMFEAVPPADAVLLKWILHDWNDEE  266



>ref|XP_002278190.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   343 bits (879),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/266 (61%), Positives = 200/266 (75%), Gaps = 9/266 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            ++G+   ELL++  H+WN+IF++I S SLKCA+ELGIPDIIH HG+P+TL EL   +P+N
Sbjct  4    AVGETSTELLHAHAHVWNHIFNFINSMSLKCAIELGIPDIIHNHGKPMTLSELVAELPVN  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVD  440
              K   + RLMR L+ SGFF   +       + Y L   S LLLKD+P S RPFLL ++D
Sbjct  64   PEKTKCVYRLMRLLVQSGFFTRKRVQESGQEEGYVLTHASRLLLKDDPLSARPFLLAMLD  123

Query  439  NPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNV  260
             P+LIT PW +   WFQNDDP PFDTAHG T WDYAGH+P+ N+ FNEAMASD RLV +V
Sbjct  124  -PVLIT-PWQYVSAWFQNDDPTPFDTAHGRTFWDYAGHEPKLNNFFNEAMASDARLVTSV  181

Query  259  VIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVG  80
            +IK CKG+F GLNSLVDV GGTGTVAR IA AFP L CTV DLPHV+ GLEG+KNL+Y+ 
Sbjct  182  LIKDCKGIFVGLNSLVDVGGGTGTVARAIANAFPHLNCTVLDLPHVVAGLEGSKNLNYLA  241

Query  79   GDMFVSIPHANALFLKWILHDWNDED  2
            GDMF +IP A+A+ LKWILHDWN ++
Sbjct  242  GDMFEAIPPADAILLKWILHDWNHDE  267



>emb|CAJ65628.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   341 bits (875),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 164/265 (62%), Positives = 199/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q+HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQSHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF +IP AN + LKWILHDWNDE+
Sbjct  242  DMFEAIPPANTVLLKWILHDWNDEE  266



>ref|XP_004303127.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=367

 Score =   342 bits (877),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 163/265 (62%), Positives = 201/265 (76%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHGRP+TL EL  A+PIN
Sbjct  15   SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGRPMTLSELTSALPIN  74

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR LIHSGFF   K      + Y L   S LLLKD+P S+ PFL  ++D 
Sbjct  75   PTKSHSIYRLMRILIHSGFFAKKKLSKSDEEGYVLTDASQLLLKDHPLSITPFLNAMLD-  133

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PW++   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  134  PVL-TKPWHYFSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  192

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            +  C+GVFEGL+SLVDV GGTGTVA+ IA+AFP +KCTV DLPHV+  L+G+KNL Y GG
Sbjct  193  VDECRGVFEGLDSLVDVGGGTGTVAKAIADAFPHIKCTVLDLPHVVADLQGSKNLKYTGG  252

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+A+ LKWILHDWNDE+
Sbjct  253  DMFEAVPPADAVLLKWILHDWNDEE  277



>emb|CAJ65632.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
 emb|CAJ65658.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   341 bits (874),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 164/265 (62%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF +IP AN + LKWILHDWNDE+
Sbjct  242  DMFEAIPPANTVLLKWILHDWNDEE  266



>emb|CAJ65663.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   341 bits (874),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 164/265 (62%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF +IP AN + LKWILHDWNDE+
Sbjct  242  DMFEAIPPANTVLLKWILHDWNDEE  266



>emb|CAH05089.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   341 bits (874),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 164/265 (62%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF +IP AN + LKWILHDWNDE+
Sbjct  242  DMFEAIPPANTVLLKWILHDWNDEE  266



>emb|CAJ65630.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   340 bits (873),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/265 (62%), Positives = 199/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q+HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQSHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G++NL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSRNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF +IP AN + LKWILHDWNDE+
Sbjct  242  DMFEAIPPANTVLLKWILHDWNDEE  266



>emb|CAJ65642.1| putative orcinol O-methyltransferase [Rosa marretii]
Length=346

 Score =   339 bits (870),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 199/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S+SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSTSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAJ65665.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSVSLKSAIQLGIPDIINKHGYPMTLFELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAJ65609.1| putative orcinol O-methyltransferase [Rosa bracteata]
Length=346

 Score =   339 bits (869),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 199/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P S+ PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSTTDEEGYTLTDASQLLLKDHPLSITPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+A+ LKWILHDWNDE+
Sbjct  242  DMFEAVPPADAVLLKWILHDWNDEE  266



>emb|CAH05084.1| orcinol O-methyltransferase 3 [Rosa hybrid cultivar]
Length=346

 Score =   338 bits (868),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL P+L  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H+FN+AMASD RLV +V+
Sbjct  123  PVL-TNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGT+A+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  INDCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF +IP AN + LKWILHDWNDE+
Sbjct  242  DMFEAIPPANTVLLKWILHDWNDEE  266



>ref|XP_011002662.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   339 bits (869),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 165/264 (63%), Positives = 199/264 (75%), Gaps = 9/264 (3%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G  D ELL +Q HIWN+IFS+I S SLKCA++LGIPDII+KH +P+TL EL  A+P++ +
Sbjct  7    GKHDPELLKAQAHIWNHIFSFINSMSLKCAIDLGIPDIINKHSKPVTLPELIAALPVHPS  66

Query  592  KAGHLARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNP  434
            KA  + RLMR LIHSGFF   K       + Y L   S LLLKDNPFS+ PFL  ++D P
Sbjct  67   KARCVPRLMRLLIHSGFFEKQKVSEDDQEEGYVLTNASQLLLKDNPFSVAPFLQAVLD-P  125

Query  433  ILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVI  254
            IL T+PW+    W +NDDP PFDTAHG T WDY GH+P FNH+FN+AMASD RLV  V+I
Sbjct  126  IL-TKPWHFVSTWLKNDDPTPFDTAHGRTFWDYVGHEPVFNHLFNDAMASDARLVTRVLI  184

Query  253  KYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGD  74
              CK VFEGL SLVDV GGTGTVA +IA+AFP L CTVFDLPHV+  L+G++NL YVGGD
Sbjct  185  NECKEVFEGLGSLVDVGGGTGTVANSIAKAFPHLDCTVFDLPHVVADLQGSENLKYVGGD  244

Query  73   MFVSIPHANALFLKWILHDWNDED  2
            MF +IP A+ + LKWILHDWNDE+
Sbjct  245  MFEAIPPADGIVLKWILHDWNDEE  268



>emb|CAJ65598.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   338 bits (868),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVANLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAJ65645.1| putative orcinol O-methyltransferase [Rosa roxburghii]
Length=346

 Score =   338 bits (868),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAJ65640.1| putative orcinol O-methyltransferase [Rosa majalis]
 emb|CAJ65650.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65651.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65652.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65653.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65654.1| putative orcinol O-methyltransferase [Rosa lucieae]
Length=346

 Score =   338 bits (868),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAJ65597.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   338 bits (868),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVANLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAJ65601.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   338 bits (868),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVANLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAJ65623.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   338 bits (867),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAJ65607.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   338 bits (867),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAJ65604.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   338 bits (867),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAJ65646.1| putative orcinol O-methyltransferase [Rosa rugosa]
Length=346

 Score =   338 bits (867),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAJ65613.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
 emb|CAJ65619.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   338 bits (867),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAJ65648.1| putative orcinol O-methyltransferase [Rosa woodsii var. ultramontana]
Length=346

 Score =   338 bits (866),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 199/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   +LL++Q HIWN+IFS+I S+SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNDLLHAQAHIWNHIFSFINSTSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAJ65618.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   338 bits (866),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>gb|AEC13057.1| orcinol O-methyltransferase-like protein [Rosa chinensis]
Length=367

 Score =   338 bits (868),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  15   SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  74

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  75   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  133

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  134  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  192

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  193  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  252

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  253  DMFEAVPPADTVLLKWILHDWNDEE  277



>ref|XP_011002666.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   338 bits (867),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/264 (62%), Positives = 199/264 (75%), Gaps = 9/264 (3%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G  D ELL +Q HIWN+IF++I S SLKCA++LGIPDII+KH +P+TL EL  A+P++  
Sbjct  7    GKHDRELLKAQAHIWNHIFNFINSMSLKCAIDLGIPDIINKHSKPVTLPELIAALPVHPG  66

Query  592  KAGHLARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNP  434
            KA  + RLMR LIHSGFF   K       + Y L   S LLLKDNPFS+ PFL  ++D P
Sbjct  67   KARCVPRLMRLLIHSGFFEKQKVSEDDQEEGYILTNASQLLLKDNPFSVAPFLQAVLD-P  125

Query  433  ILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVI  254
            IL T+PW+    W +NDDP PFDTAHG T WDY GH+P FNH+FN+AMASD RLV  V+I
Sbjct  126  IL-TKPWHFVSTWLKNDDPTPFDTAHGRTFWDYVGHEPVFNHLFNDAMASDARLVTRVLI  184

Query  253  KYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGD  74
              CK VFEGL SLVDV GGTGTVA++IA+AFP L CTVFDLPHV+  L+G++NL YVGGD
Sbjct  185  NECKEVFEGLGSLVDVGGGTGTVAKSIAKAFPHLDCTVFDLPHVVADLQGSENLKYVGGD  244

Query  73   MFVSIPHANALFLKWILHDWNDED  2
            MF +IP A+ + LKWILHDWNDE+
Sbjct  245  MFEAIPPADGIVLKWILHDWNDEE  268



>emb|CAJ65664.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   337 bits (865),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 199/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL+ A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELSSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKIDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDT HGMT WDY  HQP   H+FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAJ65614.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   337 bits (864),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 199/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL P+L  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H+FN+AMASD RLV +V+
Sbjct  123  PVL-TNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGT+A+ IA+AFP ++CTV DLPHV+  L+G+KNL Y+GG
Sbjct  182  INDCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYIGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAH05082.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=346

 Score =   337 bits (864),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPCIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>ref|XP_011002663.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   337 bits (865),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 164/264 (62%), Positives = 198/264 (75%), Gaps = 9/264 (3%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G  D ELL +Q HIWN+IFS+I S SLKCA++LGIPDII+KH +P+TL EL   +P++ +
Sbjct  7    GKHDPELLKAQAHIWNHIFSFINSMSLKCAIDLGIPDIINKHSKPVTLPELIATLPVHPS  66

Query  592  KAGHLARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNP  434
            KA  + RLMR LIHSGFF   K       + Y L   S LLLKDNPFS+ PFL  ++D P
Sbjct  67   KARCVPRLMRLLIHSGFFEKQKVSEDDQEEGYVLTNASQLLLKDNPFSVAPFLQAVLD-P  125

Query  433  ILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVI  254
            IL T+PW+    W +NDDP PFDTAHG T WDY GH+P FNH+FN+AMASD RLV  V+I
Sbjct  126  IL-TKPWHFVSTWLKNDDPTPFDTAHGRTFWDYVGHEPVFNHLFNDAMASDARLVTRVLI  184

Query  253  KYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGD  74
              CK VFEGL SLVDV GGTGTVA +IA+AFP L CTVFDLPHV+  L+G++NL YVGGD
Sbjct  185  NECKEVFEGLGSLVDVGGGTGTVANSIAKAFPHLDCTVFDLPHVVADLQGSENLKYVGGD  244

Query  73   MFVSIPHANALFLKWILHDWNDED  2
            MF +IP A+ + LKWILHDWNDE+
Sbjct  245  MFEAIPPADGIVLKWILHDWNDEE  268



>emb|CAD29556.1| orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=348

 Score =   337 bits (864),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 199/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL+ A+PI+
Sbjct  5    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELSSALPIH  64

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  65   PTKSHSVYRLMRILVHSGFFAKKKLSKIDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  123

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDT HGMT WDY  HQP   H+FN+AMASD RLV +V+
Sbjct  124  PVL-TKPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPNIAHLFNDAMASDARLVTSVI  182

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  183  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQGSKNLKYTGG  242

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  243  DMFEAVPPADTVLLKWILHDWNDEE  267



>emb|CAJ65615.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   337 bits (864),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 199/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL P+L  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H+FN+AMASD RLV +V+
Sbjct  123  PVL-TNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGT+A+ IA+AFP ++CTV DLPHV+  L+G+KNL Y+GG
Sbjct  182  INDCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYIGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAJ65635.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   337 bits (864),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 163/265 (62%), Positives = 197/265 (74%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGI DII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGILDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF +IP AN + LKWILHDWNDE+
Sbjct  242  DMFEAIPPANTVLLKWILHDWNDEE  266



>emb|CAJ65655.1| putative orcinol O-methyltransferase [Rosa lucieae]
Length=346

 Score =   337 bits (863),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   +      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKRLSKTDEEGYTLTDASQLLLKDHPLSLTPFLAAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAJ65647.1| putative orcinol O-methyltransferase [Rosa rugosa]
Length=346

 Score =   337 bits (863),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWN+E+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNNEE  266



>emb|CAJ65620.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   337 bits (863),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 197/265 (74%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL+ Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHVQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAJ65612.1| putative orcinol O-methyltransferase [Rosa canina]
Length=346

 Score =   337 bits (863),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 197/265 (74%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN    WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNCLSTWFQNDDPTPFDTAHGMTFWDYGNHQPRIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFETVPPADTVLLKWILHDWNDEE  266



>emb|CAH05087.1| orcinol O-methyltransferase 4 [Rosa hybrid cultivar]
Length=346

 Score =   336 bits (862),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 197/265 (74%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q H+WN+IFS+I S SLK A++LGI DII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHVWNHIFSFINSMSLKSAIQLGILDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF +IP AN + LKWILHDWNDE+
Sbjct  242  DMFEAIPPANTVLLKWILHDWNDEE  266



>emb|CAJ65624.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   336 bits (862),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 197/265 (74%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+ NL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSTNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>ref|XP_006364110.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=267

 Score =   333 bits (854),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 161/267 (60%), Positives = 203/267 (76%), Gaps = 16/267 (6%)
 Frame = -2

Query  784  LPSMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIP  605
            +P +G+ + E+L++QTHIWN+IFS+I S SLK A++L IPDIIHKHG+P+TL ELA+A+ 
Sbjct  3    VPIVGEHETEILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLDELANALS  62

Query  604  INKAKAGHLARLMRTLIHSGFFFH--------------TKDAYALAQPSTLLLKDNPFSL  467
            INK+K  HL RLMR LIHSGFF                  + Y LA P+ LLLKD P ++
Sbjct  63   INKSKITHLRRLMRILIHSGFFLKFAMIPLEEGSSGSGEGEGYVLAPPARLLLKDEPLTV  122

Query  466  RPFLLFLVDNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMA  287
             PFLL ++D PIL+ +PW+H  EWF +D+P PF+ AHG T WDYAGH+   NH FN+AMA
Sbjct  123  TPFLLAMLD-PILV-KPWHHVNEWFSSDEPTPFEVAHGRTFWDYAGHEQRLNHFFNDAMA  180

Query  286  SDTRLVMNVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLE  107
            SD +LVM+VV+KY K VFEGLNS+VDV GGTGTVA+TIA+ FP+L+CTVFDLPHV+ GLE
Sbjct  181  SDAKLVMSVVMKYSKDVFEGLNSIVDVGGGTGTVAKTIAKKFPNLQCTVFDLPHVVEGLE  240

Query  106  GTKNLDYVGGDMFVSIPHANALFLKWI  26
            G+ NL YVGGD FVS+P A+AL LK I
Sbjct  241  GSDNLSYVGGDFFVSVPPADALLLKVI  267



>emb|CAJ65603.1| putative orcinol O-methyltransferase [Rosa banksiae]
Length=346

 Score =   336 bits (862),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGFPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSTTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTSWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AF  ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFSHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+A+ LKWILHDWNDE+
Sbjct  242  DMFEAVPPADAVLLKWILHDWNDEE  266



>emb|CAJ65622.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   336 bits (861),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 197/265 (74%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  H P   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAH05081.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAJ65644.1| putative orcinol O-methyltransferase [Rosa phoenicia]
Length=346

 Score =   336 bits (861),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 197/265 (74%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  H P   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAJ65610.1| putative orcinol O-methyltransferase [Rosa canina]
Length=346

 Score =   336 bits (861),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+ I+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALLIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H+FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAJ65629.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   336 bits (861),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLFELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL P+L  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H+FN+AMASD RLV +V+
Sbjct  123  PVL-TNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGT+A+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWND++
Sbjct  242  DMFEAVPLADTVLLKWILHDWNDQE  266



>emb|CAJ65643.1| putative orcinol O-methyltransferase [Rosa marretii]
Length=346

 Score =   335 bits (860),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 197/265 (74%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAVLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLP V+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPQVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAH05083.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=346

 Score =   335 bits (859),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 199/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEDSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGPPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  L RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSLDRLMRILVHSGFFAKEKLSETDEEGYTLTDTSQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PW+H   WFQNDD  PF TAHGMT+WDY  HQP F+H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWHHLSTWFQNDDLTPFATAHGMTMWDYGNHQPSFSHFFNDAMASDARLVASVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGT+A+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  INECKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAH05085.1| orcinol O-methyltransferase 3 [Rosa hybrid cultivar]
Length=346

 Score =   335 bits (859),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL P+L  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H+FN+AMASD RLV +V+
Sbjct  123  PVL-TNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGT+A+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  INDCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWND++
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDQE  266



>emb|CAJ65621.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   335 bits (859),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 196/265 (74%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G    ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGKHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  H P   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAJ65633.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   335 bits (859),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 197/265 (74%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL+ Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHVQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P +L PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLTLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDT HGMT WDY  HQP   H+FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAJ65625.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   335 bits (859),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 197/265 (74%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G++NL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSRNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWI HDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWISHDWNDEE  266



>emb|CAJ65641.1| putative orcinol O-methyltransferase [Rosa marretii]
Length=346

 Score =   335 bits (858),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 197/265 (74%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   +LL++Q H WN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNDLLHAQAHTWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAVLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLKSLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAH05079.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   335 bits (858),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 197/265 (74%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  H P   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGT+A+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAJ65626.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   335 bits (858),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 196/265 (74%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHG T WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGTTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G++NL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSRNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A  + LKWILHDWNDE+
Sbjct  242  DMFEAVPPAGTVLLKWILHDWNDEE  266



>emb|CAJ65611.1| putative orcinol O-methyltransferase [Rosa canina]
Length=346

 Score =   335 bits (858),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+ I+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALLIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPSSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H+FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAJ65634.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   334 bits (857),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL+ A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELSSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LL KD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKIDEEGYTLTDASQLLPKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDT HGMT WDY  HQP   H+FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPNIAHLFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAJ65606.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   334 bits (857),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 197/265 (74%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+ I+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALLIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAJ65599.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   334 bits (857),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL P+L  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H+FN+AMASD RLV +V+
Sbjct  123  PVL-TNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGT+A+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  INDCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDW+DE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWSDEE  266



>emb|CAH05091.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   334 bits (857),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+K+G P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGM  WDY  HQP   H+FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMAFWDYGNHQPSIAHLFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGT+A+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPLADTVLLKWILHDWNDEE  266



>emb|CAJ65608.1| putative orcinol O-methyltransferase [Rosa bracteata]
Length=346

 Score =   334 bits (856),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 197/265 (74%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   E L++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNEPLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P S+ PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSTTDEEGYTLTDASQLLLKDHPLSITPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF + P A+A+ LKWILHDWNDE+
Sbjct  242  DMFEAAPPADAVLLKWILHDWNDEE  266



>emb|CAJ65661.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   334 bits (856),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 197/265 (74%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAEKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+    FQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTRFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>gb|AAM23004.1|AF502433_1 orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAD29458.1| orcinol O-methyltransferase [Rosa chinensis]
 emb|CAH05077.1| orcinol O-methyltransferase 1 [Rosa chinensis]
Length=367

 Score =   335 bits (858),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  15   SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  74

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL P+L  ++D 
Sbjct  75   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD-  133

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H+FN+AMASD RLV +V+
Sbjct  134  PVL-TNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVI  192

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGT+A+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  193  INDCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  252

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDW+DE+
Sbjct  253  DMFEAVPPADTVLLKWILHDWSDEE  277



>emb|CAJ65649.1| putative orcinol O-methyltransferase [Rosa woodsii var. ultramontana]
Length=346

 Score =   334 bits (856),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 196/265 (74%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL   +PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSTLPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLAPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PAL-TKPWNYLSIWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPLADTVLLKWILHDWNDEE  266



>emb|CAJ65600.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   333 bits (855),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL P+L  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKGKLCKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H+FN+AMASD RLV +V+
Sbjct  123  PVL-TNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGT+A+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  INDCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDW+DE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWSDEE  266



>emb|CAJ65638.1| putative orcinol O-methyltransferase [Rosa hugonis]
Length=346

 Score =   333 bits (855),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 197/265 (74%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGCPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PW++   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMA D RLV +V+
Sbjct  123  PVL-TKPWHYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSMAHFFNDAMACDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAJ65656.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   333 bits (855),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IF++I S SLK A++LGIPDII+KHG P+TL EL+ A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFNFINSMSLKSAIQLGIPDIINKHGYPMTLSELSSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLK +P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKGHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDT HGMT WDY  HQP   H+FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>ref|XP_002326036.2| hypothetical protein POPTR_0019s12290g [Populus trichocarpa]
 gb|EEF00418.2| hypothetical protein POPTR_0019s12290g [Populus trichocarpa]
Length=357

 Score =   333 bits (855),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/259 (61%), Positives = 197/259 (76%), Gaps = 9/259 (3%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +Q H+WN+IF+++ S SLKCA++LGIPD+IH HG+P+TL EL   +PI+ +KA  +
Sbjct  12   ELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDVIHNHGKPMTLSELVAVLPIHPSKAPGI  71

Query  577  ARLMRTLIHSGFFFHTKDA-------YALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
             RLMR L+HSGFF    ++       Y L   S LL+KDNPFS+ PFLL ++D PIL TQ
Sbjct  72   YRLMRILVHSGFFATQNNSGETEGEGYVLTNASQLLIKDNPFSVTPFLLAMLD-PIL-TQ  129

Query  418  PWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKG  239
            PW++   WFQND P+ F TAH  T W+YAGH+ E NH FNEAMASD RLV +V++  CKG
Sbjct  130  PWHYVSVWFQNDAPSSFYTAHQRTSWEYAGHETELNHFFNEAMASDARLVSSVLVNECKG  189

Query  238  VFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSI  59
            VFEGLNSLVDV GGTGTVA+ IA+ F  L CTVFDLPHV+ GLEG++NL Y+ GDMF +I
Sbjct  190  VFEGLNSLVDVGGGTGTVAKAIAKEFQHLDCTVFDLPHVVAGLEGSENLKYLSGDMFEAI  249

Query  58   PHANALFLKWILHDWNDED  2
            P A+A+ LKWILHDWNDE+
Sbjct  250  PQADAILLKWILHDWNDEE  268



>emb|CAJ65627.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   333 bits (854),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+K+G P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL P+L  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H+FN+AMASD RLV +V+
Sbjct  123  PVL-TNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGT+A+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWND++
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDQE  266



>emb|CAH05090.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   333 bits (853),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 196/265 (74%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGI D+I+KHG  +TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGILDVINKHGYLMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF +IP AN + LKWILHDWNDE+
Sbjct  242  DMFEAIPPANTVLLKWILHDWNDEE  266



>emb|CAH05088.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   333 bits (853),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 197/265 (74%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLFELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL P+L  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H+FN+AMASD RLV +V+
Sbjct  123  PVL-TNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGT+A+ IA+AFP ++CTV DLPHV+  L+G+KNL Y  G
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTRG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWND++
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDQE  266



>emb|CAH05086.1| orcinol O-methyltransferase 4 [Rosa hybrid cultivar]
Length=346

 Score =   333 bits (853),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 197/265 (74%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGI DII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGILDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSTAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWND++
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDQE  266



>ref|XP_002274019.2| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   333 bits (854),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/267 (58%), Positives = 200/267 (75%), Gaps = 9/267 (3%)
 Frame = -2

Query  781  PSMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPI  602
            P+ G+   ELL +Q H+WN+IF+++ S SLKCA++LGIPDIIH HG+P+TL EL   +P+
Sbjct  3    PANGEISSELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPV  62

Query  601  NKAKAGHLARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLV  443
            +  K  ++ RLMR L+ S FF   +       + Y L   S LLLKD+  S+RPFLL ++
Sbjct  63   HPKKTQYVYRLMRVLVQSDFFAAQRAQQSEEEEGYVLTHASRLLLKDDSLSVRPFLLAML  122

Query  442  DNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMN  263
            D P L T+PW++   WFQNDDP PFDTAH  T+WDYAGH+P+ N+ FNEAMASD RLV +
Sbjct  123  D-PTL-TKPWHYVSAWFQNDDPTPFDTAHERTLWDYAGHEPQLNYFFNEAMASDARLVTS  180

Query  262  VVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYV  83
            V++K  KGVFEGLNSLVDV GGTGTVA+ IA AFP L CTV DLPHV+ GL+G+KNL+Y 
Sbjct  181  VLVKEGKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYF  240

Query  82   GGDMFVSIPHANALFLKWILHDWNDED  2
             GDMF +IP A+A+ LKWILHDW+DE+
Sbjct  241  AGDMFEAIPPADAILLKWILHDWSDEE  267



>ref|XP_002277927.2| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   333 bits (854),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/267 (58%), Positives = 200/267 (75%), Gaps = 9/267 (3%)
 Frame = -2

Query  781  PSMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPI  602
            P+  +   ELL +Q H+WN+IF+++ S SLKCA++LGIPDIIH HG+P+TL +L   +P+
Sbjct  3    PANSEMSSELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPQLVAKLPV  62

Query  601  NKAKAGHLARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLV  443
            +  K  ++ RLMR L+ S FF   +       + Y L   S LLLKD+  S+RPFLL ++
Sbjct  63   HPKKTQYVYRLMRVLVQSDFFAAQRAQQSEEEEGYVLTHASRLLLKDDSLSVRPFLLAML  122

Query  442  DNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMN  263
            D P L T+PW++   WFQNDDP PFDTAH  T+WDYAGH+P+ N+ FNEAMASD RLV +
Sbjct  123  D-PTL-TKPWHYVSAWFQNDDPTPFDTAHERTLWDYAGHEPQLNYFFNEAMASDARLVTS  180

Query  262  VVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYV  83
            V++K  KGVFEGLNSLVDV GGTGTVA+ IA AFP LKCTV DLPHV+ GL+G+KNL+Y 
Sbjct  181  VLVKEGKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLKCTVLDLPHVVAGLQGSKNLNYF  240

Query  82   GGDMFVSIPHANALFLKWILHDWNDED  2
             GDMF +IP A+A+ LKWILHDW+DE+
Sbjct  241  AGDMFEAIPPADAILLKWILHDWSDEE  267



>emb|CAD29555.1| orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=348

 Score =   332 bits (852),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+K+G P+TL EL  A+PI+
Sbjct  5    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIH  64

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL P+L  ++D 
Sbjct  65   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD-  123

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H+FN+AMASD RLV +V+
Sbjct  124  PVL-TNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVI  182

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGT+A+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  183  IDDCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  242

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWND++
Sbjct  243  DMFEAVPPADTVLLKWILHDWNDQE  267



>emb|CAJ65617.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   332 bits (852),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL P+L  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H+FN+AMASD RLV +V+
Sbjct  123  PVL-TNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGT+A+ IA+AFP ++CTV DLPHV+  L+G+KNL Y+GG
Sbjct  182  INDCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYIGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHD NDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDRNDEE  266



>emb|CAJ65605.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   332 bits (852),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 196/265 (74%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+ I+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALLIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  C GVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCNGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>emb|CAJ65659.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   332 bits (852),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 197/265 (74%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G    ELL++Q HIWN+IFS+I S SLK A++LGIPDII+K+G P+TL EL  A+PI+
Sbjct  4    SNGQHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL P+L  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H+FN+AMASD RLV +V+
Sbjct  123  PVL-TNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGT+A+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWND++
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDQE  266



>gb|AAM23005.1|AF502434_1 orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAD29459.1| orcinol O-methyltransferase [Rosa chinensis]
 emb|CAH05078.1| orcinol O-methyltransferase 2 [Rosa chinensis]
 dbj|BAQ20440.1| 3,5-dimethoxytoluene [Rosa hybrid cultivar]
Length=366

 Score =   333 bits (853),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 198/265 (75%), Gaps = 9/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  15   SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHG-PMTLSELTSALPIH  73

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  74   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  132

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T PWN+   WFQN+DP PFDTAHGMT WDY  HQP   H+FN+AMASD RLV +V+
Sbjct  133  PVLTT-PWNYLSTWFQNEDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVI  191

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  192  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  251

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  252  DMFEAVPPADTVLLKWILHDWNDEE  276



>emb|CAJ65596.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=345

 Score =   332 bits (851),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 197/265 (74%), Gaps = 9/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHG-PMTLSELTSALPIH  62

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL P+L  ++D 
Sbjct  63   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD-  121

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H+FN+AMASD RLV +V+
Sbjct  122  PVL-TNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVI  180

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SL DV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  181  INDCKGVFEGLESLADVGGGTGTVAKAIADAFPYIECTVLDLPHVVANLQGSKNLKYTGG  240

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  241  DMFEAVPPADTVLLKWILHDWNDEE  265



>emb|CAJ65636.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   331 bits (849),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 197/265 (74%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+K+G P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL P+L  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H+FN+AMASD RLV +V+
Sbjct  123  PVL-TNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SL DV GGTGT+A+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLADVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWND++
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDQE  266



>emb|CAJ65631.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   331 bits (849),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+K+G P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL P+L  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H+FN+AMASD RLV +V+
Sbjct  123  PVL-TNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGT+A+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDW+D++
Sbjct  242  DMFEAVPPADTVLLKWILHDWSDQE  266



>emb|CAJ65657.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=345

 Score =   330 bits (847),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 197/265 (74%), Gaps = 9/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I   SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINPMSLKSAIQLGIPDIINKHG-PMTLSELTSALPIH  62

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  63   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  121

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T PWN+   WFQN+DP PFDTAHGMT WDY  HQP   H+FN+AMASD RLV +V+
Sbjct  122  PVLTT-PWNYLSTWFQNEDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVI  180

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  181  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  240

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  241  DMFEAVPPADTVLLKWILHDWNDEE  265



>emb|CAJ65660.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=345

 Score =   330 bits (847),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 197/265 (74%), Gaps = 9/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHG-PMTLSELTSALPIH  62

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  63   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD-  121

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T PWN+   WFQN+DP PFDTAHGMT WDY  HQP   H+FN+AMASD RLV +V+
Sbjct  122  PVLTT-PWNYLSTWFQNEDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVI  180

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+A P ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  181  IDDCKGVFEGLESLVDVGGGTGTVAKAIADALPHIECTVLDLPHVVADLQGSKNLKYTGG  240

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  241  DMFEAVPPADTVLLKWILHDWNDEE  265



>emb|CAJ65639.1| putative orcinol O-methyltransferase [Rosa hugonis]
Length=346

 Score =   330 bits (845),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 196/265 (74%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS++ S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFMNSMSLKSAIQLGIPDIINKHGCPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S  LLKD+P SL PFL  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQPLLKDHPLSLTPFLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PW++   WFQNDDP PFDTAHGMT WDY  HQP   H FN+AMA D RLV +V+
Sbjct  123  PVL-TKPWHYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSMAHFFNDAMACDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>ref|XP_008229109.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=354

 Score =   329 bits (844),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 155/257 (60%), Positives = 193/257 (75%), Gaps = 7/257 (3%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +Q HIWN+IFS+I S SLKCAV+LGIPD+I KHG+P+TL EL  A+PI+  KA  +
Sbjct  10   ELLQAQAHIWNHIFSFINSMSLKCAVQLGIPDVIQKHGQPMTLSELVSALPISPTKAHFI  69

Query  577  ARLMRTLIHSGFFFHT-----KDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQPW  413
             RLMR L+HS FF        +  Y L   STLLL+DNP S RPFLL ++ NPIL T PW
Sbjct  70   PRLMRILVHSSFFARESLSGGEQGYVLTDASTLLLEDNPMSARPFLLAVL-NPIL-TDPW  127

Query  412  NHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGVF  233
             +   WFQND+P PF   HGMT WDY    P   H FN+AMASD RL+ ++VI  CKGVF
Sbjct  128  QYLTTWFQNDNPTPFHMVHGMTFWDYGNQDPTIAHFFNDAMASDARLISSLVIDECKGVF  187

Query  232  EGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSIPH  53
            +G++SLVDV GGTGTVA++IA+AFP +KCTV DLPHV+  L+G+KNL+YV GDMF ++P 
Sbjct  188  QGVDSLVDVGGGTGTVAKSIADAFPHMKCTVLDLPHVVADLKGSKNLEYVAGDMFDAVPA  247

Query  52   ANALFLKWILHDWNDED  2
            A+A+FLKWILHDW+DE+
Sbjct  248  ADAIFLKWILHDWSDEE  264



>emb|CAN83014.1| hypothetical protein VITISV_029725 [Vitis vinifera]
Length=357

 Score =   329 bits (844),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 154/267 (58%), Positives = 198/267 (74%), Gaps = 9/267 (3%)
 Frame = -2

Query  781  PSMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPI  602
            P+ G+   ELL +Q H+WN+IF+++ S SLKCA++LGIPDIIH HG+P+TL EL   +P+
Sbjct  3    PAXGEISSELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPV  62

Query  601  NKAKAGHLARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLV  443
            +  K  ++ RLMR L+ S FF   +       + Y L   S LLLKD+  S+RPFLL ++
Sbjct  63   HPKKTQYVYRLMRVLVQSDFFAAQRAQQSEEEEGYVLTHASXLLLKDDSLSVRPFLLAML  122

Query  442  DNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMN  263
            D P L T+PW++   WFQNDDP PF+TAH  T+WDYAGH+P+ N+  NEAMASD RLV +
Sbjct  123  D-PTL-TKPWHYVSAWFQNDDPTPFNTAHERTLWDYAGHEPQLNYFINEAMASDARLVTS  180

Query  262  VVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYV  83
            V++K  KGVFEGLNSLVDV GGTGTVA+ IA AFP L CTV DLPHV+ GL+G+KNL+Y 
Sbjct  181  VLVKEGKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYF  240

Query  82   GGDMFVSIPHANALFLKWILHDWNDED  2
             GDMF  IP A+A+ LKWILHDW+DE+
Sbjct  241  AGDMFEXIPPADAILLKWILHDWSDEE  267



>emb|CAJ65666.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   329 bits (843),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 156/265 (59%), Positives = 197/265 (74%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+K+G P+TL EL  A+PI+
Sbjct  4    SHGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HS FF   K      + Y L   S LLLKD+P SL P+L  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSSFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T PWN+   WFQNDDP PFDTAHGMT WDY  +QP   H+FN+AMASD RLV +V+
Sbjct  123  PVL-TNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNYQPSIAHLFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGT+A+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWND++
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDQE  266



>emb|CAH05080.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   328 bits (842),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 195/265 (74%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HI N+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIRNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  + D 
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMPD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T+PWN+   WFQNDDP PFDTAHGMT WDY  H P   H FN+AMASD RLV +V+
Sbjct  123  PVL-TKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGT+A+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  INDCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  242  DMFEAVPPADTVLLKWILHDWNDEE  266



>ref|XP_002278057.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   329 bits (843),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 154/267 (58%), Positives = 198/267 (74%), Gaps = 9/267 (3%)
 Frame = -2

Query  781  PSMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPI  602
            P+ G+   ELL +Q H+WN+IF+++ S SLKCA++LGIPDIIH HG+P+TL EL   +P+
Sbjct  3    PAKGEISSELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPV  62

Query  601  NKAKAGHLARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLV  443
            +  K  ++ RLMR L+ S FF   +       + Y L   S LLLKD+  S+RPFLL ++
Sbjct  63   HPKKTQYVYRLMRVLVQSDFFAAQRAQQSEEEEGYVLTHASQLLLKDDSLSVRPFLLAML  122

Query  442  DNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMN  263
            D P L T+PW++   WFQNDDP PF+TAH  T+WDYAGH+P+ N+  NEAMASD RLV +
Sbjct  123  D-PTL-TKPWHYVSAWFQNDDPTPFNTAHERTLWDYAGHEPQLNYFINEAMASDARLVTS  180

Query  262  VVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYV  83
            V++K  KGVFEGLNSLVDV GGTGTVA+ IA AFP L CTV DLPHV+ GL+G+KNL+Y 
Sbjct  181  VLVKEGKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYF  240

Query  82   GGDMFVSIPHANALFLKWILHDWNDED  2
             GDMF  IP A+A+ LKWILHDW+DE+
Sbjct  241  AGDMFEPIPPADAILLKWILHDWSDEE  267



>emb|CAJ65616.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=345

 Score =   328 bits (841),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 197/265 (74%), Gaps = 9/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+KHG P+TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKYAIQLGIPDIINKHG-PMTLSELTSALPIH  62

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL  ++D 
Sbjct  63   PTKSPSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLMPFLTAMLD-  121

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T PWN+   WFQNDDP PFDTAHGMT WDY  HQP   H+FN+AMASD RLV +V+
Sbjct  122  PVLTT-PWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVI  180

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SL+DV GG GTVA+ IA+AFP ++CTV DLP+V+  L+G+KNL Y GG
Sbjct  181  INDCKGVFEGLESLIDVGGGIGTVAKAIADAFPHIECTVLDLPYVVADLQGSKNLKYTGG  240

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  241  DMFEAVPPADTVLLKWILHDWNDEE  265



>emb|CAN69333.1| hypothetical protein VITISV_003273 [Vitis vinifera]
Length=350

 Score =   328 bits (842),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 153/259 (59%), Positives = 196/259 (76%), Gaps = 9/259 (3%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +Q H+WN+IF+++ S SLKCA++LGIPDIIH HG+P+TL +L   +P++  K  ++
Sbjct  4    ELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPQLVAKLPVHPKKTQYV  63

Query  577  ARLMRTLIHSGFFF-------HTKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
             RLMR L+ S FF          ++ Y L   S LLLKD+  S+RPFLL ++D P L T+
Sbjct  64   YRLMRVLVQSDFFAAPRAQQSEEEEGYVLTHASRLLLKDDSLSVRPFLLAMLD-PTL-TK  121

Query  418  PWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKG  239
            PW++   WFQNDDP PFDTAH  T+WDYAGH+P+ N+ FNEAMASD RLV +V++K  KG
Sbjct  122  PWHYVSAWFQNDDPTPFDTAHERTLWDYAGHEPQLNYXFNEAMASDARLVTSVLVKEGKG  181

Query  238  VFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSI  59
            VFEGLNSLVDV GGTGTVA+ IA AFP L CTV DLPHV+ GL+G+KNL+Y  GDMF +I
Sbjct  182  VFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDMFEAI  241

Query  58   PHANALFLKWILHDWNDED  2
            P A+A+ LKWILHDW+DE+
Sbjct  242  PPADAILLKWILHDWSDEE  260



>emb|CDP15888.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   329 bits (843),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 159/268 (59%), Positives = 197/268 (74%), Gaps = 9/268 (3%)
 Frame = -2

Query  784  LPSMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIP  605
            L   GD   EL  +Q HIWN+IF++I S SLKCA++LGIPDIIHKHG+P+ L +L DA+P
Sbjct  3    LARNGDHTGELFQAQAHIWNHIFNFINSMSLKCAIQLGIPDIIHKHGQPMALAQLIDALP  62

Query  604  INKAKAGHLARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFL  446
            IN AKA  + RLMR LIHSGFF   K       + YAL   S LLL ++PFS+ PFLL +
Sbjct  63   INNAKAPFVYRLMRILIHSGFFIKAKIPDNEGQEGYALTSASKLLLANDPFSVTPFLLAM  122

Query  445  VDNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVM  266
            +D PIL T PW+H  +WFQN +  PF T HG ++W+ AG QP+ N  FNE MASD RLV 
Sbjct  123  LD-PIL-TDPWHHFSQWFQNSEETPFHTCHGTSLWELAGRQPQLNQFFNEGMASDARLVS  180

Query  265  NVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDY  86
             +VI+ CK VF GLNSL+DV GGTGTVA+ IA+AFP L+C+V DLPHV+ G E +KNL Y
Sbjct  181  TMVIENCKDVFMGLNSLIDVGGGTGTVAKAIADAFPHLQCSVLDLPHVVDGWESSKNLAY  240

Query  85   VGGDMFVSIPHANALFLKWILHDWNDED  2
            VGGDMF +IP A+A+ LKWILHDW+DE+
Sbjct  241  VGGDMFEAIPPADAVLLKWILHDWSDEE  268



>emb|CAJ65662.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   328 bits (840),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 197/265 (74%), Gaps = 8/265 (3%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGIPDII+K+G P+TL EL  A+PI+
Sbjct  4    SHGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HS FF   K      + Y L   S LLLKD+P SL P+L  ++D 
Sbjct  64   PTKSHSVYRLMRILVHSSFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD-  122

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            P+L T PWN+   WFQNDDP PFDTAHGMT WDY  +QP   H+FN+AMASD RLV +V+
Sbjct  123  PVL-TNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNYQPSIAHLFNDAMASDARLVTSVI  181

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGT+A+ IA+AFP ++CTV DLPHV+  L+G+KNL Y GG
Sbjct  182  IDDCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGG  241

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + L+WILHDWND++
Sbjct  242  DMFEAVPPADTVLLRWILHDWNDQE  266



>ref|XP_002517827.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44345.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   327 bits (839),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/260 (60%), Positives = 196/260 (75%), Gaps = 9/260 (3%)
 Frame = -2

Query  760  IELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGH  581
            +ELL +Q HIWN+IF++I S SLK A++LGIPD IH HGRPI+L +L  A+P+  AKA  
Sbjct  9    VELLQAQAHIWNHIFNFINSMSLKSAIQLGIPDAIHSHGRPISLSQLIAALPVLPAKARC  68

Query  580  LARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILIT  422
            + RLMR L+HSGFF + K       + + L   S LLLKDNP S+ PFLL ++D PIL T
Sbjct  69   IPRLMRILVHSGFFANAKIKGNDEEEGFVLTSASKLLLKDNPLSVTPFLLAMLD-PIL-T  126

Query  421  QPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCK  242
            +PW++   WFQNDD  PFDT HGM  W+YAG++P+FN+ FNEAMASD RLVM V+I   K
Sbjct  127  EPWHYVSTWFQNDDATPFDTVHGMPFWEYAGNEPKFNNFFNEAMASDARLVMRVLIDEYK  186

Query  241  GVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVS  62
            GVFEGLNSLVDV GGTGT+A  IA+AFP L C VFDLPHV+ GL+ + NL YVGG+MF  
Sbjct  187  GVFEGLNSLVDVGGGTGTMAAAIAKAFPQLDCIVFDLPHVVAGLQSSANLKYVGGNMFEG  246

Query  61   IPHANALFLKWILHDWNDED  2
            +P A+A+ LKWI+HDW+DE+
Sbjct  247  VPPADAILLKWIIHDWSDEE  266



>ref|XP_006376386.1| hypothetical protein POPTR_0013s12560g [Populus trichocarpa]
 ref|XP_006376390.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54183.1| hypothetical protein POPTR_0013s12560g [Populus trichocarpa]
 gb|ERP54187.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score =   327 bits (839),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/259 (59%), Positives = 197/259 (76%), Gaps = 9/259 (3%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +QTH+WN+IF +I S +LKCAV+LGIPD+I KHG+P+TL EL  A+PI+ +KA ++
Sbjct  11   ELLQAQTHVWNHIFYFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSKAQYV  70

Query  577  ARLMRTLIHSGFF-------FHTKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
             RLMR L+HSGFF        H +DAY+L Q + LLLKDNP+S+RP LL  +D P+L T+
Sbjct  71   HRLMRILVHSGFFSQQNLNDIHNQDAYSLTQSTRLLLKDNPWSMRPLLLVFLD-PVL-TK  128

Query  418  PWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKG  239
            PW+    WFQNDD   F  AH  T W+YAG  P  N++FN+AMA D+ LV  VV+  CKG
Sbjct  129  PWDCLSTWFQNDDRNAFSVAHENTFWEYAGQDPRINNLFNDAMARDSILVSKVVVCKCKG  188

Query  238  VFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSI  59
            +F+G+NSLVDV GG GT+A+ IAEAFP + CTVFDLPHV+  L+G+KNL YVGGDMF ++
Sbjct  189  IFDGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGSKNLKYVGGDMFEAV  248

Query  58   PHANALFLKWILHDWNDED  2
            P A+A+ LKWILHDW+DED
Sbjct  249  PPADAILLKWILHDWSDED  267



>ref|XP_006469135.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=402

 Score =   329 bits (843),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 162/269 (60%), Positives = 196/269 (73%), Gaps = 14/269 (5%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G+ D ELL +Q H+WN+IF++I S SLKCAVELGIPDII+KHG+P+TL EL  A+ IN +
Sbjct  46   GEHDTELLEAQAHVWNHIFNFINSMSLKCAVELGIPDIINKHGKPMTLNELVSALTINPS  105

Query  592  KAGHLARLMRTLIHSGFFFHT-----------KDAYALAQPSTLLLKDNPFSLRPFLLFL  446
            K   + RLMR LIHSGFF              +  Y L   S LLLKDNP S+ PFL  +
Sbjct  106  KTRCVYRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLTNASKLLLKDNPLSVTPFLQAM  165

Query  445  VDNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVM  266
            +D PIL++ PW     WFQNDDP PFDTAHG ++W+YAG +P+ N+ FNEAMASD RL  
Sbjct  166  LD-PILLS-PWLKLSTWFQNDDPTPFDTAHGKSLWEYAGDEPKINNFFNEAMASDARLAT  223

Query  265  NVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGT-KNLD  89
             VVI  CK VFEGLNSLVDV GGTGTVA+ IA+AFP+L+CT FDLPHV+ GLE    NL 
Sbjct  224  RVVIHKCKDVFEGLNSLVDVGGGTGTVAKAIAKAFPNLECTDFDLPHVVNGLESDLANLK  283

Query  88   YVGGDMFVSIPHANALFLKWILHDWNDED  2
            Y+GGDMF +IP A+A+  KWILHDWNDE+
Sbjct  284  YIGGDMFEAIPPADAVLFKWILHDWNDEE  312



>ref|XP_006446728.1| hypothetical protein CICLE_v10015708mg [Citrus clementina]
 gb|ESR59968.1| hypothetical protein CICLE_v10015708mg [Citrus clementina]
Length=362

 Score =   327 bits (839),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 161/269 (60%), Positives = 196/269 (73%), Gaps = 14/269 (5%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G+ D ELL +Q H+WN+IF++I S SLKCAVELGIPD+I+KHG+P+TL EL  A+ IN +
Sbjct  6    GEHDTELLEAQAHVWNHIFNFINSMSLKCAVELGIPDLINKHGKPMTLNELVSALTINPS  65

Query  592  KAGHLARLMRTLIHSGFFFHT-----------KDAYALAQPSTLLLKDNPFSLRPFLLFL  446
            K   + RLMR LIHSGFF              +  Y L   S LLLKDNP S+ PFL  +
Sbjct  66   KTRCVYRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLTNASKLLLKDNPLSVTPFLQAM  125

Query  445  VDNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVM  266
            +D PIL++ PW     WFQNDDP PFDTAHG + W+YAG +P+ N+ FNEAMASD RL  
Sbjct  126  LD-PILLS-PWLKLSTWFQNDDPTPFDTAHGKSFWEYAGDEPKINNFFNEAMASDARLAT  183

Query  265  NVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGT-KNLD  89
            +VVI  CK VFEGLNSLVDV GGTGTVA+ IA+AFP+L+CT FDLPHV+ GLE    NL 
Sbjct  184  SVVIHKCKDVFEGLNSLVDVGGGTGTVAKAIAKAFPNLECTDFDLPHVVNGLESDLANLK  243

Query  88   YVGGDMFVSIPHANALFLKWILHDWNDED  2
            YVGGD+F +IP A+A+  KWILHDWNDE+
Sbjct  244  YVGGDVFEAIPPADAVLFKWILHDWNDEE  272



>ref|XP_003527407.1| PREDICTED: trans-resveratrol di-O-methyltransferase isoform 1 
[Glycine max]
Length=352

 Score =   327 bits (837),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 159/258 (62%), Positives = 194/258 (75%), Gaps = 9/258 (3%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            +LL +QTH+WN+IFS+I S SLKCA+EL IPDIIHK+G+P+ L +L  ++ I+ +KA  +
Sbjct  11   KLLGAQTHVWNHIFSFINSMSLKCAIELDIPDIIHKYGQPMPLSKLTTSLSIHPSKANCI  70

Query  577  ARLMRTLIHSGFFFHTKD-------AYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
             RLMR L HSGFF   K         Y L   STLLLKDNP S+ PFL  ++D P L TQ
Sbjct  71   YRLMRILTHSGFFSQHKVNENELEMGYVLTDASTLLLKDNPLSMVPFLHAMLD-PTL-TQ  128

Query  418  PWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKG  239
            PW     WF+NDDP+PF TAHGM IWDYA  +P  N +FN+AMASDT+LV NVVI+ CKG
Sbjct  129  PWLQLPTWFKNDDPSPFQTAHGMKIWDYADREPRLNDLFNDAMASDTQLVANVVIERCKG  188

Query  238  VFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSI  59
            VF GL SLVDV GGTGT+A  IA++FP L+CTVFDLPHV+  L+G++NL YVGGDMF SI
Sbjct  189  VFNGLESLVDVGGGTGTMAMAIAKSFPQLECTVFDLPHVVATLQGSENLKYVGGDMFESI  248

Query  58   PHANALFLKWILHDWNDE  5
            P A+A+ LKWILHDWNDE
Sbjct  249  PSADAILLKWILHDWNDE  266



>ref|XP_006428632.1| hypothetical protein CICLE_v10012033mg [Citrus clementina]
 gb|ESR41872.1| hypothetical protein CICLE_v10012033mg [Citrus clementina]
Length=362

 Score =   326 bits (836),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 159/269 (59%), Positives = 195/269 (72%), Gaps = 14/269 (5%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            GD D ELL +QTH+WN+IF++I S +LKCA++LGIPDII KHG+P+TL EL  A+ IN +
Sbjct  6    GDHDTELLEAQTHVWNHIFNFINSMTLKCAIQLGIPDIISKHGKPMTLNELVSALTINPS  65

Query  592  KAGHLARLMRTLIHSGFFFHTK-----------DAYALAQPSTLLLKDNPFSLRPFLLFL  446
            K+  + RLMR LIH+GFF   K             Y L   S LLLKDNP S+ PFL  +
Sbjct  66   KSRCVYRLMRILIHTGFFAQQKLISSRNNNDEEQGYVLTNASKLLLKDNPLSVTPFLQAM  125

Query  445  VDNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVM  266
            +D PIL++ PW   R WFQNDDP PFDTAHG T+W+YAG +P+ N+ FNEAMASD  L  
Sbjct  126  LD-PILLS-PWQQLRTWFQNDDPTPFDTAHGKTLWEYAGDEPKLNNFFNEAMASDAWLAT  183

Query  265  NVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGT-KNLD  89
            +V+I  CK VFEGLNSLVDV GG GT A+ IA+AFP L+CT FDLPHV+ GL+    NL 
Sbjct  184  SVMIHKCKDVFEGLNSLVDVGGGIGTAAKAIAKAFPKLECTCFDLPHVVNGLDSDLANLK  243

Query  88   YVGGDMFVSIPHANALFLKWILHDWNDED  2
            YVGGDMF +I  A+A+ LKWILHDWNDE+
Sbjct  244  YVGGDMFEAISPADAVLLKWILHDWNDEE  272



>gb|KDO39394.1| hypothetical protein CISIN_1g021867mg [Citrus sinensis]
Length=306

 Score =   324 bits (830),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 162/269 (60%), Positives = 193/269 (72%), Gaps = 14/269 (5%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G+ D ELL +Q H+WN+IF++I S SLKCAVELGIPDII+KHG+P+TL EL  A+ IN +
Sbjct  6    GEHDTELLEAQAHVWNHIFNFINSMSLKCAVELGIPDIINKHGKPMTLNELVSALTINPS  65

Query  592  KAGHLARLMRTLIHSGFFFHT-----------KDAYALAQPSTLLLKDNPFSLRPFLLFL  446
            K   + RLMR LIHSGFF              +  Y L   S LLLKDNP S+ PFL  +
Sbjct  66   KTRCVYRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLKNASKLLLKDNPLSVTPFLQAM  125

Query  445  VDNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVM  266
            +D PIL++ PW     WFQNDDP PFDT HG + W YAG +P+ N+ FNEAMASD RL  
Sbjct  126  LD-PILLS-PWLKLSTWFQNDDPTPFDTLHGKSFWVYAGDEPKINNFFNEAMASDARLAT  183

Query  265  NVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGT-KNLD  89
             VVI  CK VFEGLNSLVDV GG GTVA+ IA+AFP+L+CT FDLPHV+ GLE    NL 
Sbjct  184  RVVIHKCKDVFEGLNSLVDVGGGIGTVAKAIAKAFPNLECTDFDLPHVVNGLESDLANLK  243

Query  88   YVGGDMFVSIPHANALFLKWILHDWNDED  2
            YVGGDMF +IP A+A+ LKWILHDWNDE+
Sbjct  244  YVGGDMFEAIPPADAVLLKWILHDWNDEE  272



>ref|XP_002278316.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=359

 Score =   325 bits (833),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/264 (59%), Positives = 194/264 (73%), Gaps = 9/264 (3%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G +  ELL +QTH+WN+IF++I S SLKCA++LGIPDIIH H +P+TL EL   +P+   
Sbjct  6    GGRSSELLQAQTHVWNHIFNFINSMSLKCAIQLGIPDIIHNHCQPMTLHELVAKLPVRPN  65

Query  592  KAGHLARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNP  434
            K   + RLMR L+HSGFF   +       + YALA  S LLLKD+P S  PFLL ++D  
Sbjct  66   KTLCVHRLMRILVHSGFFTMQRVQESADEEGYALANASRLLLKDHPLSATPFLLAMLDPD  125

Query  433  ILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVI  254
            +  T+PW++   WFQNDDP PF TAHG TIWDY  H+P FN+ FNEAMASD RLV +V+I
Sbjct  126  L--TEPWHYVSAWFQNDDPTPFFTAHGRTIWDYGCHEPRFNNFFNEAMASDARLVTSVLI  183

Query  253  KYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGD  74
            K CKG FEGLNS VDV GGTGTVA+TI +AFP L  TV DLPHV+  L+G+KNL Y+ GD
Sbjct  184  KECKGAFEGLNSFVDVGGGTGTVAKTIVDAFPHLHSTVLDLPHVVADLQGSKNLTYLAGD  243

Query  73   MFVSIPHANALFLKWILHDWNDED  2
            MF +IP A+A+ LKWILHDW+DE+
Sbjct  244  MFEAIPPADAILLKWILHDWSDEE  267



>emb|CDP20220.1| unnamed protein product [Coffea canephora]
Length=270

 Score =   322 bits (824),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/267 (59%), Positives = 196/267 (73%), Gaps = 11/267 (4%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            ++GD   EL  +Q HIW++IF++I S SLKCA++LGIPD+IHKHG+P+TL +L DA+PI 
Sbjct  6    NIGDHTGELFQAQAHIWSHIFNFINSMSLKCAIQLGIPDVIHKHGQPMTLDQLIDALPIK  65

Query  598  KAKAGHLARLMRTLIHSGFFFHTK---------DAYALAQPSTLLLKDNPFSLRPFLLFL  446
             AKA  + RLM+ LIHSGFF   K           Y L   S LLLK NPFS+ PFLL +
Sbjct  66   NAKATFIYRLMQNLIHSGFFIEAKIPGNENDNQKGYLLTPASELLLKSNPFSVTPFLLAM  125

Query  445  VDNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVM  266
            +D P L T PW+H  +WFQN D  PF T HG +++D+A H+P  N  FN+AMASD RLV 
Sbjct  126  LD-PTL-TDPWHHLSQWFQNSDETPFYTCHGRSLYDFASHEPRINQFFNKAMASDARLVS  183

Query  265  NVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDY  86
            +VV K CK VFEGLNSLVDV GGTGT+A+ IA+AFP LKCTV DLPHV+ GLE +KNL Y
Sbjct  184  SVVTKDCKHVFEGLNSLVDVGGGTGTLAKAIADAFPSLKCTVLDLPHVVDGLESSKNLAY  243

Query  85   VGGDMFVSIPHANALFLKWILHDWNDE  5
            VGG+MF +IP ANA+ +KWIL DW+D+
Sbjct  244  VGGNMFEAIPPANAVLMKWILIDWSDD  270



>ref|XP_006480453.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=362

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 159/269 (59%), Positives = 195/269 (72%), Gaps = 14/269 (5%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            GD D ELL +QTH+WN+IF++I S +LKCA++LGIPDII KHG+P+TL EL  A+ IN +
Sbjct  6    GDHDTELLEAQTHVWNHIFNFINSMTLKCAIQLGIPDIISKHGKPMTLNELVSALTINPS  65

Query  592  KAGHLARLMRTLIHSGFFFHTKD-----------AYALAQPSTLLLKDNPFSLRPFLLFL  446
            K+  + RLMR LIH+GFF   K             Y L   S LLLKDNP S+ PFL  +
Sbjct  66   KSRCVYRLMRILIHTGFFAQQKLISSRNNNDEELGYVLTNASKLLLKDNPLSVTPFLQAM  125

Query  445  VDNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVM  266
            +D PIL++ PW   R WFQNDDP PFDTAHG T+W+YAG +P+ N+ FNEAMASD  L  
Sbjct  126  LD-PILLS-PWQQLRTWFQNDDPTPFDTAHGKTLWEYAGDEPKLNNFFNEAMASDAWLAT  183

Query  265  NVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGT-KNLD  89
            +V+I  CK VFEGLNSLVDV GG GT A+ IA+AFP L+CT FDLPHV+ GL+    NL 
Sbjct  184  SVMIHKCKDVFEGLNSLVDVGGGIGTAAKAIAKAFPKLECTCFDLPHVVNGLDSDLANLK  243

Query  88   YVGGDMFVSIPHANALFLKWILHDWNDED  2
            YVGGDMF +I  A+A+ LKWILHDWNDE+
Sbjct  244  YVGGDMFEAISPADAVLLKWILHDWNDEE  272



>ref|XP_006376388.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54185.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=365

 Score =   323 bits (829),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 148/259 (57%), Positives = 196/259 (76%), Gaps = 9/259 (3%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +QTH+WN+IF++I S +LKCAV+LGIPD+I KHG+P+TL EL  A+PI+ +KA ++
Sbjct  17   ELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSKAQYV  76

Query  577  ARLMRTLIHSGFF-------FHTKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
             RLMR L+HSGFF        H ++AY+L Q + LLLKDNP+++RP LLF +D+  ++T+
Sbjct  77   HRLMRILVHSGFFSQQNLNGVHNQEAYSLTQSTRLLLKDNPWNMRPLLLFELDS--VLTK  134

Query  418  PWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKG  239
            PW+    WF+ND+   F  AH  T W+YAG  P   ++FNEAMASD+ L   +V+  CKG
Sbjct  135  PWDCLSTWFRNDEATAFSVAHENTFWEYAGQDPRIKNLFNEAMASDSILASKLVVSKCKG  194

Query  238  VFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSI  59
            +FEGL+SLVDV GG GT+A+ IAEAFP + CTVFDLPHV+  L+G KNL YVGGDMF ++
Sbjct  195  IFEGLSSLVDVGGGFGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGCKNLKYVGGDMFQAV  254

Query  58   PHANALFLKWILHDWNDED  2
            P A A+ LKWILHDW+DED
Sbjct  255  PPAEAILLKWILHDWSDED  273



>ref|XP_007043718.1| Flavonoid o-methyltransferase related [Theobroma cacao]
 gb|EOX99549.1| Flavonoid o-methyltransferase related [Theobroma cacao]
Length=364

 Score =   322 bits (826),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/262 (58%), Positives = 190/262 (73%), Gaps = 9/262 (3%)
 Frame = -2

Query  766  QDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKA  587
             D ELL +Q H+WN +F++I S SLKCA++LGIPD+I  HG+P+T+ EL  A+PIN  KA
Sbjct  13   NDHELLQAQAHVWNYLFNFINSMSLKCAIDLGIPDVIQNHGKPMTVTELVAALPINATKA  72

Query  586  GHLARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPIL  428
              + RLMR L+HSGFF   K       + Y L   S LLL  +P S+ PFL  ++D PIL
Sbjct  73   SSIYRLMRILVHSGFFAQQKLGNNDQEEGYVLTHASRLLLNGDPLSVTPFLKAMLD-PIL  131

Query  427  ITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKY  248
             T+PW+    WFQNDDP PFDTAHG T WDY GH P  +H FNE MASD RLV +++I  
Sbjct  132  -TKPWHFLGAWFQNDDPTPFDTAHGRTFWDYGGHDPMLSHFFNEGMASDARLVSSILIHK  190

Query  247  CKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMF  68
            C+GVF+GLNS+VDV GG GTVA+ I++AFP L+CTVFDLP V+ GL+   NL YVGGDMF
Sbjct  191  CEGVFQGLNSMVDVGGGIGTVAKAISDAFPHLECTVFDLPRVVAGLQDRGNLKYVGGDMF  250

Query  67   VSIPHANALFLKWILHDWNDED  2
             ++P A+A+ LKWILHDWNDE+
Sbjct  251  EAVPAADAVLLKWILHDWNDEE  272



>ref|XP_002278517.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=359

 Score =   322 bits (826),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/264 (58%), Positives = 193/264 (73%), Gaps = 9/264 (3%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G +  ELL +QTH+WN+IF++I S SLKCA++LGIPDIIH H +P+TL EL   +P+   
Sbjct  6    GGRSSELLQAQTHVWNHIFNFINSMSLKCAIQLGIPDIIHNHCQPMTLHELVAKLPVRPN  65

Query  592  KAGHLARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNP  434
            K   + RLMR L+HSGFF   +       + Y LA  S LLLKD+P S+ PFLL ++D  
Sbjct  66   KTLCVHRLMRILVHSGFFTMQRVQESADEEGYVLANASRLLLKDHPLSVTPFLLAMLDPD  125

Query  433  ILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVI  254
            +  T+PW++   WFQNDDP PF TAHG TIWDY  H+P FN+ FNEAMASD RLV +V++
Sbjct  126  L--TEPWHYVSAWFQNDDPTPFFTAHGRTIWDYGCHEPRFNNFFNEAMASDARLVTSVLV  183

Query  253  KYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGD  74
            K CKG FEGLNS VDV GGTGTVA+TI EAFP L  TV DLPHV+  L+G K+L Y+ GD
Sbjct  184  KECKGAFEGLNSFVDVGGGTGTVAKTIVEAFPHLHSTVLDLPHVVADLQGGKSLTYLAGD  243

Query  73   MFVSIPHANALFLKWILHDWNDED  2
            MF +IP A+A+ LKWILHDW+DE+
Sbjct  244  MFEAIPPADAILLKWILHDWSDEE  267



>ref|XP_006446726.1| hypothetical protein CICLE_v10015705mg [Citrus clementina]
 gb|ESR59966.1| hypothetical protein CICLE_v10015705mg [Citrus clementina]
Length=362

 Score =   322 bits (826),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 160/269 (59%), Positives = 195/269 (72%), Gaps = 14/269 (5%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G+ D ELL +Q H+WN+IF++I S SLKCAVEL IPDII+KHG+P+TL +L  A+ IN +
Sbjct  6    GEHDTELLEAQAHVWNHIFNFINSMSLKCAVELSIPDIINKHGKPMTLNKLVSALTINPS  65

Query  592  KAGHLARLMRTLIHSGFFFHT-----------KDAYALAQPSTLLLKDNPFSLRPFLLFL  446
            K   + RLMR LIHSGFF              +  Y L   S LLLKD+P S+ PFL  +
Sbjct  66   KTRCVYRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLTNASKLLLKDSPLSVTPFLQAM  125

Query  445  VDNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVM  266
            +D PIL++ PW     WFQ+DDPAPFDTAHG + W+YAG +P+ N+ FNEAMASD RL  
Sbjct  126  LD-PILLS-PWLKLSTWFQSDDPAPFDTAHGKSFWEYAGDEPKINNFFNEAMASDARLAT  183

Query  265  NVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGT-KNLD  89
             VVI  CK VF+GLNSLVDV GGTGTVA+ IA AFP+L+CT FDLPHV+ GLE    NL 
Sbjct  184  RVVIHKCKDVFQGLNSLVDVGGGTGTVAKAIAIAFPNLECTDFDLPHVVNGLESDLANLK  243

Query  88   YVGGDMFVSIPHANALFLKWILHDWNDED  2
            YVGGDMF +IP A+A+ LKWILHDWNDE+
Sbjct  244  YVGGDMFEAIPPADAVVLKWILHDWNDEE  272



>emb|CDP21836.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   321 bits (823),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 158/268 (59%), Positives = 195/268 (73%), Gaps = 11/268 (4%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            ++GD   EL  +Q HIWN+IF++I S S+KCA++LGIPD+IHKHG+PITL +L DA+PI 
Sbjct  6    NIGDHTGELFQAQAHIWNHIFNFINSMSVKCAIQLGIPDVIHKHGQPITLDQLIDALPIK  65

Query  598  KAKAGHLARLMRTLIHSGFFFHTK---------DAYALAQPSTLLLKDNPFSLRPFLLFL  446
             AKA  + RLM+ LIHSGFF   K           Y L   S LLLK NPFS+ PFLL +
Sbjct  66   NAKAPFVYRLMQILIHSGFFIEAKIPGNENDNQKGYLLTSASELLLKSNPFSMTPFLLAM  125

Query  445  VDNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVM  266
            +D P L T PW+H  +WFQN D  PF T HG +I+ +A H+P  N  FNEAMASDTRLV 
Sbjct  126  LD-PTL-TDPWHHLSQWFQNSDETPFYTCHGRSIYAFASHEPWLNQFFNEAMASDTRLVS  183

Query  265  NVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDY  86
            +VV K CK VFE LNSLVDV GGTGT A+ IA+AFP LKCTV DLPHV+ GLE +KNL Y
Sbjct  184  SVVTKDCKHVFESLNSLVDVGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLESSKNLGY  243

Query  85   VGGDMFVSIPHANALFLKWILHDWNDED  2
            VGG+MF +IP A+A+ +KWIL DW+D++
Sbjct  244  VGGNMFEAIPPADAVLMKWILIDWSDDE  271



>ref|XP_009764108.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=360

 Score =   321 bits (822),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 157/272 (58%), Positives = 201/272 (74%), Gaps = 10/272 (4%)
 Frame = -2

Query  793  MAQLPSMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELAD  614
            MA   ++GD+  E+L +Q HI N++F+Y+ S SLKCA++L IPDIIH HG+P+TL  L +
Sbjct  1    MALSNNIGDETREILAAQAHIANHVFNYLNSMSLKCAIQLEIPDIIHNHGKPMTLSNLVN  60

Query  613  AIPINKAKAGH-LARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPF  458
            A+PINKAK    + RLMR LIHSGFF  TK       + Y L   S LLLK+ P SL PF
Sbjct  61   ALPINKAKGQDCIYRLMRILIHSGFFIQTKINETEEEEGYLLTPNSRLLLKNEPLSLVPF  120

Query  457  LLFLVDNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDT  278
            +L  +D PIL+  P+    +W QNDD  PF TAHG  +++YAG +P  N++FNEAMASD 
Sbjct  121  VLAQLD-PILM-DPFQSLSKWLQNDDSTPFATAHGKPLFEYAGEEPRLNYLFNEAMASDA  178

Query  277  RLVMNVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTK  98
            RL+++VVIK   G+F+GL SLVDV GG GTVA+ I+ AFP++KCTVFDLPHV+ GLEG+K
Sbjct  179  RLMISVVIKTGSGIFDGLKSLVDVGGGIGTVAKAISNAFPEVKCTVFDLPHVVEGLEGSK  238

Query  97   NLDYVGGDMFVSIPHANALFLKWILHDWNDED  2
            NL YVGGDMF S+P A+A+ LKWILHDW+DED
Sbjct  239  NLSYVGGDMFKSVPSADAILLKWILHDWSDED  270



>gb|ABZ89567.1| O-methyltransferase 3 [Humulus lupulus]
Length=377

 Score =   322 bits (824),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 151/267 (57%), Positives = 193/267 (72%), Gaps = 13/267 (5%)
 Frame = -2

Query  769  DQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAK  590
            +   E+L +Q HIWN IF++I S SLKCA++LGIPDII+ HG+P+T+ +L  A+PIN+ K
Sbjct  21   ENSTEILGAQAHIWNQIFNFINSMSLKCAIQLGIPDIINNHGKPMTISQLTLALPINRKK  80

Query  589  AGHLARLMRTLIHSGFFFHTK-----------DAYALAQPSTLLLKDNPFSLRPFLLFLV  443
            +  + RLMR LIHSGFF   K           + Y +   S LLLKDNP S+ PFLL ++
Sbjct  81   SPCVYRLMRILIHSGFFALQKAEVGEEGGGEEEGYVITDASKLLLKDNPMSVTPFLLAML  140

Query  442  DNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMN  263
            D P++ T+PW+    WFQN DP PFDTA+GM  WDY  H+P+    FN+AMASD RLV +
Sbjct  141  D-PVM-TKPWDFLSNWFQNGDPTPFDTANGMAFWDYGSHEPKLARFFNDAMASDARLVTS  198

Query  262  VVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYV  83
            VVI+ CKGVFEG+ SLVDV GGTGTVA +IA AFP ++CTVFDLPHV+  L+G  NL++V
Sbjct  199  VVIEKCKGVFEGVESLVDVGGGTGTVASSIAAAFPHIQCTVFDLPHVVADLQGGNNLNFV  258

Query  82   GGDMFVSIPHANALFLKWILHDWNDED  2
            GGDMFV +P    + LKWILHDWNDE+
Sbjct  259  GGDMFVDVPATEVVLLKWILHDWNDEE  285



>gb|KDO40717.1| hypothetical protein CISIN_1g037127mg, partial [Citrus sinensis]
Length=307

 Score =   318 bits (814),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 158/269 (59%), Positives = 191/269 (71%), Gaps = 14/269 (5%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            GD D ELL +Q H+WN+IF++I S SLKCAVEL IPDII+KHG+P TL +L  A+ IN +
Sbjct  6    GDHDTELLEAQAHVWNHIFNFINSMSLKCAVELSIPDIINKHGKPTTLNDLVSALTINPS  65

Query  592  KAGHLARLMRTLIHSGFFFHT-----------KDAYALAQPSTLLLKDNPFSLRPFLLFL  446
            K   + RLMR LIHSGFF              +  Y L   S LLLKD+P S+ P L  +
Sbjct  66   KTRCVYRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLTNASKLLLKDSPLSVTPLLQAV  125

Query  445  VDNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVM  266
            +D PIL++ PW     WFQ+DDPAPFD  HG + W+YAG +P+ N+ FNEAMASD RL  
Sbjct  126  LD-PILLS-PWLKLSTWFQSDDPAPFDMVHGKSFWEYAGDEPKINNFFNEAMASDARLAT  183

Query  265  NVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGT-KNLD  89
             VVI  CK VFEGLNSLVDV G TGTVA+ IA+AFP+L+CT FDLPHV+ GLE    NL 
Sbjct  184  RVVIHKCKNVFEGLNSLVDVGGATGTVAKAIAKAFPNLECTDFDLPHVVNGLESDLANLK  243

Query  88   YVGGDMFVSIPHANALFLKWILHDWNDED  2
            YVGGDMF +IP A+A+ LKWILHDWNDE+
Sbjct  244  YVGGDMFEAIPPADAVVLKWILHDWNDEE  272



>ref|XP_008229108.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=355

 Score =   319 bits (817),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 149/258 (58%), Positives = 190/258 (74%), Gaps = 8/258 (3%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +Q HIWN+IFS++ S SLKCAV+L I D+I KHG+P+ L EL  A+PI+  KA  +
Sbjct  10   ELLKAQAHIWNHIFSFVNSMSLKCAVQLDIADVIQKHGQPMILSELVSALPISPTKAHFI  69

Query  577  ARLMRTLIHSGFFFHT------KDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQP  416
             RLMR L+HSGFF         +  Y L   S LLLKDNP S RPFLL ++ NP+L T P
Sbjct  70   PRLMRILVHSGFFARESLSGGGEQGYVLTDASALLLKDNPMSARPFLLAML-NPML-TDP  127

Query  415  WNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGV  236
            W +   WFQND+P PF   HGMT WDY    P   H FN+AMASD +L+ +++I  CKGV
Sbjct  128  WQYLTTWFQNDNPTPFHVVHGMTFWDYGNQDPTLAHFFNDAMASDAQLISSLMIDDCKGV  187

Query  235  FEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSIP  56
            F+G++SLVDV GGTGTVA++IA+AFP +KCTV DLPHV+  L+G+KNL+YV GDMF ++P
Sbjct  188  FQGVDSLVDVGGGTGTVAKSIADAFPHMKCTVLDLPHVVADLKGSKNLEYVAGDMFEAVP  247

Query  55   HANALFLKWILHDWNDED  2
             A+A+FLKWILHDW+DE+
Sbjct  248  EADAIFLKWILHDWSDEE  265



>emb|CAJ65637.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=341

 Score =   318 bits (815),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 153/265 (58%), Positives = 188/265 (71%), Gaps = 13/265 (5%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            S G+   ELL++Q HIWN+IFS+I S SLK A++LGI D+I+KHG  +TL EL  A+PI+
Sbjct  4    SNGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGILDVINKHGYLMTLSELTSALPIH  63

Query  598  KAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              K+  + RLMR L+HSGFF   K      + Y L   S LLLKD+P SL PFL      
Sbjct  64   PTKSHSVYRLMRILVHSGFFAKKKLSKIDEEGYTLTNASQLLLKDDPLSLTPFL------  117

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
               + +PWN+   WFQN+DP PFDTAHGMT WDY  HQP   H FN AMASD RLV +V+
Sbjct  118  -TAMNKPWNYLSTWFQNNDPTPFDTAHGMTFWDYGNHQPSIAHFFNNAMASDARLVTSVI  176

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CKGVFEGL SLVDV GGTGTVA+ IA+AFP ++CTV DLPHV+  L+G+KNL Y  G
Sbjct  177  IDDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTRG  236

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF ++P A+ + LKWILHDWNDE+
Sbjct  237  DMFEAVPPADTVLLKWILHDWNDEE  261



>ref|XP_008245137.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=354

 Score =   318 bits (816),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 152/257 (59%), Positives = 188/257 (73%), Gaps = 7/257 (3%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +Q  IWN+ FS+I S SLKCAV+L IPD+I KHG+P+TL EL  A+PI+  KA  +
Sbjct  10   ELLKAQAQIWNHTFSFINSMSLKCAVQLDIPDVIQKHGQPMTLSELVSALPISPTKAHFI  69

Query  577  ARLMRTLIHSGFFFHT-----KDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQPW  413
             RL+R L+HSGFF        +  Y L   S LLLKDNP S RPFLL ++ NPIL T PW
Sbjct  70   PRLIRILVHSGFFASESLNGGEQGYVLTDASALLLKDNPMSARPFLLAML-NPIL-TDPW  127

Query  412  NHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGVF  233
             +   WFQND+P PF  AHGMT WDY        H FNEAMASD RL+ +++I  CKGVF
Sbjct  128  QYLTTWFQNDNPTPFHVAHGMTFWDYGNQDTTLAHFFNEAMASDARLISSLMIDDCKGVF  187

Query  232  EGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSIPH  53
            +G++SLVDV GGTGTVA++IA AFP +KCTV DLPHV+  L+G+ NL+YV GDMF +IP 
Sbjct  188  QGVDSLVDVGGGTGTVAKSIAAAFPHMKCTVLDLPHVVADLKGSNNLEYVAGDMFEAIPG  247

Query  52   ANALFLKWILHDWNDED  2
            A+A+FLKWILHDW+DE+
Sbjct  248  ADAIFLKWILHDWSDEE  264



>ref|XP_006469137.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=362

 Score =   318 bits (816),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 158/269 (59%), Positives = 191/269 (71%), Gaps = 14/269 (5%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            GD D ELL +Q H+WN+IF++I S SLKCAVEL IPDII+KHG+P TL +L  A+ IN +
Sbjct  6    GDHDTELLEAQAHVWNHIFNFINSMSLKCAVELSIPDIINKHGKPTTLNDLVSALTINPS  65

Query  592  KAGHLARLMRTLIHSGFFFHT-----------KDAYALAQPSTLLLKDNPFSLRPFLLFL  446
            K   + RLMR LIHSGFF              +  Y L   S LLLKD+P S+ P L  +
Sbjct  66   KTRCVYRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLTNASKLLLKDSPLSVTPLLQAV  125

Query  445  VDNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVM  266
            +D PIL++ PW     WFQ+DDPAPFD  HG + W+YAG +P+ N+ FNEAMASD RL  
Sbjct  126  LD-PILLS-PWLKLSTWFQSDDPAPFDMVHGKSFWEYAGDEPKINNFFNEAMASDARLAT  183

Query  265  NVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGT-KNLD  89
             VVI  CK VFEGLNSLVDV G TGTVA+ IA+AFP+L+CT FDLPHV+ GLE    NL 
Sbjct  184  RVVIHKCKNVFEGLNSLVDVGGATGTVAKAIAKAFPNLECTDFDLPHVVNGLESDLANLK  243

Query  88   YVGGDMFVSIPHANALFLKWILHDWNDED  2
            YVGGDMF +IP A+A+ LKWILHDWNDE+
Sbjct  244  YVGGDMFEAIPPADAVVLKWILHDWNDEE  272



>emb|CDP19840.1| unnamed protein product [Coffea canephora]
Length=363

 Score =   318 bits (815),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/268 (58%), Positives = 195/268 (73%), Gaps = 11/268 (4%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            ++GD   EL  +Q HIWN+IF++I S S+KCA++LGIPD+IHKHG+P+TL +L DA+PI 
Sbjct  6    NIGDHTGELFQAQAHIWNHIFNFINSMSVKCAIQLGIPDVIHKHGQPMTLDQLIDALPIK  65

Query  598  KAKAGHLARLMRTLIHSGFFFHTK---------DAYALAQPSTLLLKDNPFSLRPFLLFL  446
             AKA  + RLM+ LIHSGFF   K           Y L   S LLLK NPFS+ PFLL +
Sbjct  66   NAKAPFVYRLMQILIHSGFFIEAKIPGNENDNQKGYLLTSASELLLKSNPFSVTPFLLAM  125

Query  445  VDNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVM  266
            +D P L T PW+H  +WFQN D  PF T HG +I+ +A H+P  N  FNEAMASD R+V 
Sbjct  126  LD-PAL-TDPWHHLSQWFQNSDETPFYTCHGRSIYAFASHEPWLNQFFNEAMASDARMVS  183

Query  265  NVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDY  86
            +VV K CK VFEGLNSLVD+ GGTGT A+ IA+AFP LKCTV DLPHV+ GLE +KNL Y
Sbjct  184  SVVTKDCKHVFEGLNSLVDIGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLESSKNLAY  243

Query  85   VGGDMFVSIPHANALFLKWILHDWNDED  2
            VGG+MF +IP A+A+ +KWIL DW+D++
Sbjct  244  VGGNMFEAIPPADAVLMKWILIDWSDDE  271



>ref|XP_002525159.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF37286.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/259 (59%), Positives = 192/259 (74%), Gaps = 9/259 (3%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +Q +IWN+IF++I S SLK A++LGIPD IH HG+PI+L  L  A+PI+ AKA  +
Sbjct  10   ELLQAQAYIWNHIFNFINSMSLKTAIQLGIPDAIHSHGKPISLSLLIAALPIHPAKARCI  69

Query  577  ARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
             RLMR LIHSGFF   K       + Y L + S LLLKDNPFS+ PFLL ++D   ++T+
Sbjct  70   PRLMRILIHSGFFAKAKLKENDEAEGYVLTKASKLLLKDNPFSVTPFLLAMLDR--ILTE  127

Query  418  PWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKG  239
            PW++   WFQNDD   F TAHGM  W+YAG++P+ N+ FNEAMASD RLVM V+I   KG
Sbjct  128  PWHYLSTWFQNDDATAFTTAHGMGFWEYAGNEPKLNNFFNEAMASDARLVMRVLIDEYKG  187

Query  238  VFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSI  59
            VFEGL SLVDV GGTGT+A+ IA+AFP L C VFDLPHV+ GL G++NL YV GDMF  +
Sbjct  188  VFEGLKSLVDVGGGTGTMAKAIAKAFPRLDCIVFDLPHVVAGLAGSENLKYVAGDMFEGV  247

Query  58   PHANALFLKWILHDWNDED  2
            P A+A+ LKWI+H W+DE+
Sbjct  248  PPADAILLKWIMHVWSDEE  266



>ref|XP_002525160.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF37287.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/258 (61%), Positives = 188/258 (73%), Gaps = 9/258 (3%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +Q HIWN+IFS+I S SLK AV+LGIPD IH HGRPI+L +L  A+PI+ AKA  +
Sbjct  10   ELLQAQAHIWNHIFSFINSMSLKSAVQLGIPDAIHSHGRPISLSQLIAALPIHPAKARGI  69

Query  577  ARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
             RLMR LIHSGFF   K       + Y L   S LLLKDNP S+ PFLL ++D PILI +
Sbjct  70   PRLMRILIHSGFFAKAKIEEKDEEEGYVLTNASKLLLKDNPLSIAPFLLAMLD-PILI-K  127

Query  418  PWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKG  239
            PW++   WFQNDD   FDTAHGM  W+Y    P  N+ FNEAMASD RLVM V+I   KG
Sbjct  128  PWHYLSTWFQNDDATAFDTAHGMGFWEYTASDPNLNNFFNEAMASDARLVMKVLIDEHKG  187

Query  238  VFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSI  59
            +FEGL SLVDV GGTGT+A  IA+AFP L+CTVFDLPHV+ GL+GT+NL YV GDMF +I
Sbjct  188  LFEGLKSLVDVGGGTGTMAAAIAKAFPQLECTVFDLPHVVVGLQGTENLKYVAGDMFEAI  247

Query  58   PHANALFLKWILHDWNDE  5
            P A+A+ LKWI+H W  E
Sbjct  248  PPADAVLLKWIMHGWTHE  265



>ref|XP_003633248.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   318 bits (814),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/264 (57%), Positives = 195/264 (74%), Gaps = 9/264 (3%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G+   ELL++Q H+WN+I ++IKS SLKCA++LGIPDIIH HG+P+TL EL   +P++  
Sbjct  6    GEISAELLHAQAHVWNHILNFIKSVSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPK  65

Query  592  KAGHLARLMRTLIHSGFFF-------HTKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNP  434
            ++  + RLMR L+HSGF           ++ Y L   S LLL D+  S+RP LL ++D P
Sbjct  66   RSQCVYRLMRILVHSGFLAAQSVQQGEEEEGYVLTDASRLLLMDDSLSIRPLLLAMLD-P  124

Query  433  ILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVI  254
            IL T+PW++   WFQNDDP PF TAH    WDYAGH+P+ N+ FNEAMASD RLV +V++
Sbjct  125  IL-TKPWHYLSAWFQNDDPTPFHTAHERPFWDYAGHEPQLNNFFNEAMASDARLVTSVLL  183

Query  253  KYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGD  74
            K  KGVFEGLNSLVDV GGTG VA+ IA AFP L CTV DLPHV+ GL+G+KNL+Y  GD
Sbjct  184  KEGKGVFEGLNSLVDVGGGTGQVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGD  243

Query  73   MFVSIPHANALFLKWILHDWNDED  2
            +F +IP A+A+ LKWILHDW+DE+
Sbjct  244  IFEAIPPADAILLKWILHDWSDEE  267



>ref|XP_003633249.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   317 bits (813),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/264 (57%), Positives = 195/264 (74%), Gaps = 9/264 (3%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G+   ELL++Q H+WN+I ++IKS SLKCA++LGIPDIIH HG+P+TL EL   +P++  
Sbjct  6    GEISAELLHAQAHVWNHILNFIKSVSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPK  65

Query  592  KAGHLARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNP  434
            ++  + RLMR L+HSGF    +       + Y L   S LLL D+  S+RP LL ++D P
Sbjct  66   RSQCVYRLMRILVHSGFLAAQRVQQGEEEEGYVLTDASRLLLMDDSLSIRPLLLAMLD-P  124

Query  433  ILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVI  254
            IL T+PW++   WFQNDDP PF TAH    WDYAGH+P+ N+ FNEAMASD RLV +V++
Sbjct  125  IL-TKPWHYLSAWFQNDDPTPFHTAHERPFWDYAGHEPQLNNFFNEAMASDARLVTSVLL  183

Query  253  KYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGD  74
            K  KGVFEGLNSLVDV GGTG VA+ IA AFP L CTV DLPHV+ GL+G+KNL+Y  GD
Sbjct  184  KEGKGVFEGLNSLVDVGGGTGQVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGD  243

Query  73   MFVSIPHANALFLKWILHDWNDED  2
            +F +IP A+A+ LKWILHDW+DE+
Sbjct  244  IFEAIPPADAILLKWILHDWSDEE  267



>ref|XP_002278294.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   317 bits (811),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 149/264 (56%), Positives = 196/264 (74%), Gaps = 9/264 (3%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G+   ELL++Q H+WN+IF++I S SLKCA++LGIPDIIH HG+P+T  EL   +P++  
Sbjct  6    GEISAELLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHGKPMTFPELVAKLPVHPK  65

Query  592  KAGHLARLMRTLIHSGFFF-------HTKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNP  434
            ++  + RLMR L+HSGF           ++ Y L   S LLL D+  S+RPFLL ++D P
Sbjct  66   RSQCVYRLMRILVHSGFLAAQRVQQGEQEEGYVLTDASRLLLMDDSLSIRPFLLAMLD-P  124

Query  433  ILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVI  254
            +L T+PW++   WFQNDDP PF TAH    WDYAGH+P+ N+ FNEAMASD+RLV++V++
Sbjct  125  VL-TKPWHYLSAWFQNDDPTPFHTAHEQPFWDYAGHEPQLNNFFNEAMASDSRLVISVLL  183

Query  253  KYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGD  74
            K  KG+FEGLNSLVDV GGTG VA+ IA AFP L CTV DLPHV+ GL+ +KNL+Y  GD
Sbjct  184  KEGKGLFEGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQESKNLNYFAGD  243

Query  73   MFVSIPHANALFLKWILHDWNDED  2
            MF +IP A+A+ LKWILHDW+DE+
Sbjct  244  MFEAIPPADAILLKWILHDWSDEE  267



>emb|CDP21787.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   317 bits (812),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 156/268 (58%), Positives = 193/268 (72%), Gaps = 11/268 (4%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            ++GD   EL  +Q HIWN+IF++I S S+KCA +LGIPD+IHKHG+P+TL +L DA+PI 
Sbjct  6    NLGDHTGELFQAQAHIWNHIFNFINSMSVKCATQLGIPDVIHKHGQPMTLDQLIDALPIK  65

Query  598  KAKAGHLARLMRTLIHSGFFFHTK---------DAYALAQPSTLLLKDNPFSLRPFLLFL  446
             AKA  + RLM+ LIHSGFF   K           Y L   S LLLK NPFS+ PFLL +
Sbjct  66   NAKAPFVYRLMQILIHSGFFIEAKIPGNENDNQKGYLLTSASELLLKSNPFSMTPFLLAM  125

Query  445  VDNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVM  266
            +D P L T PW +  +WFQN D  PF T HG +I+ +A H+P  N  FNEAMASDTRLV 
Sbjct  126  LD-PTL-TDPWQNLSQWFQNSDETPFYTCHGRSIYAFASHEPWLNQFFNEAMASDTRLVS  183

Query  265  NVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDY  86
            +VV K CK VFE LNSLVDV GGTGT A+ IA+AFP LKCTV DLPHV+ GLE +KNL Y
Sbjct  184  SVVTKDCKHVFESLNSLVDVGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLESSKNLAY  243

Query  85   VGGDMFVSIPHANALFLKWILHDWNDED  2
            VGG+MF +IP A+A+ +KWIL DW+D++
Sbjct  244  VGGNMFEAIPPADAVLMKWILIDWSDDE  271



>ref|XP_006376381.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54178.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score =   316 bits (810),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 150/259 (58%), Positives = 196/259 (76%), Gaps = 9/259 (3%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            E+L +Q+H+WN+IF++I S +LKCAV+LGIPD+I KHG+P+TL EL  A+PI+ +KA ++
Sbjct  11   EMLQAQSHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSKAQYV  70

Query  577  ARLMRTLIHSGFF-------FHTKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
             RLMR L+HSGFF        H ++AY+L Q + LLLKDNP+S+RP LL L+D P+L T+
Sbjct  71   HRLMRILVHSGFFSQQNLNGIHNQEAYSLTQSTRLLLKDNPWSVRPLLLLLLD-PVL-TK  128

Query  418  PWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKG  239
            PW+    WFQNDD   F  AH  T W+YAG     N++FNEAMASD+ L   +V+  CKG
Sbjct  129  PWDCLSTWFQNDDRNAFSVAHEKTFWEYAGQDARLNNLFNEAMASDSILASKLVVSKCKG  188

Query  238  VFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSI  59
            +F+G+NSLVDV GG GT+ + IAEAFP + CTVFDLPHV+  L+G KNL YVGGDMF ++
Sbjct  189  IFDGVNSLVDVGGGLGTMTKGIAEAFPHMDCTVFDLPHVVSDLQGGKNLKYVGGDMFEAV  248

Query  58   PHANALFLKWILHDWNDED  2
            P A+AL LKWILHDW+DED
Sbjct  249  PPADALLLKWILHDWSDED  267



>gb|AAB71213.1| methyltransferase [Prunus armeniaca]
Length=354

 Score =   316 bits (809),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 150/258 (58%), Positives = 191/258 (74%), Gaps = 8/258 (3%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +Q HIWN+IFS+I S SLKCAV+L IPD+I KHG+P+TL EL  A+PI+  KA  +
Sbjct  9    ELLQAQAHIWNHIFSFINSLSLKCAVQLDIPDVIQKHGQPMTLSELVSALPISPTKAHFI  68

Query  577  ARLMRTLIHSGFFFHT------KDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQP  416
             RLMR L+HSGFF         +  Y L   S LLLKDNP S RPFLL ++ +PIL T P
Sbjct  69   PRLMRILVHSGFFAKESLSGCGEQGYILTDASALLLKDNPMSARPFLLAML-SPIL-TDP  126

Query  415  WNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGV  236
            + +   WFQND+P PF   +GMT WDY    P   H FN+AMASD +L+ ++VI  CK V
Sbjct  127  YQYLTTWFQNDNPTPFHVVNGMTCWDYVNQDPTLAHFFNDAMASDAQLISSLVIDDCKEV  186

Query  235  FEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSIP  56
            F+G++SLVDV GGTGTVA++IA+AFP +KCTV DLPHV+  L+G+KNL+YV GDMF ++P
Sbjct  187  FQGVDSLVDVGGGTGTVAKSIADAFPHMKCTVLDLPHVVADLKGSKNLEYVAGDMFEAVP  246

Query  55   HANALFLKWILHDWNDED  2
             A+A+FLKWILHDW+DE+
Sbjct  247  AADAIFLKWILHDWSDEE  264



>emb|CAQ76879.1| resveratrol O-methyltransferase [Vitis vinifera]
Length=357

 Score =   315 bits (806),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/259 (57%), Positives = 194/259 (75%), Gaps = 9/259 (3%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL++Q H+WN+IF++IKS SLKCA++LGIPDIIH HG+P+TL EL   +P++  ++  +
Sbjct  11   ELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  577  ARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
             RLMR L+HSGF    +       + Y L   S LLL D+  S+RP +L ++D PIL T+
Sbjct  71   YRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLD-PIL-TK  128

Query  418  PWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKG  239
            PW++   WFQNDDP PF TAH  + WDYAGH+P+ N+ FNEAMASD RL+ +V++K  +G
Sbjct  129  PWHYLSAWFQNDDPTPFHTAHERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLKEGQG  188

Query  238  VFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSI  59
            VF GLNSLVDV GGTG VA+ IA AFP L CTV DLPHV+ GL+G+KNL+Y  GDMF +I
Sbjct  189  VFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDMFEAI  248

Query  58   PHANALFLKWILHDWNDED  2
            P A+A+ LKWILHDW+DE+
Sbjct  249  PPADAILLKWILHDWSDEE  267



>emb|CDP21661.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   315 bits (806),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/268 (57%), Positives = 193/268 (72%), Gaps = 11/268 (4%)
 Frame = -2

Query  778  SMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN  599
            ++GD   EL  +Q HIWN+IF++I S SLKCA++L IPD+IHKHGRP+TL +L DA+PI 
Sbjct  6    NIGDHTDELFQAQAHIWNHIFNFINSMSLKCAIQLDIPDVIHKHGRPMTLDQLIDALPIK  65

Query  598  KAKAGHLARLMRTLIHSGFFFHTK---------DAYALAQPSTLLLKDNPFSLRPFLLFL  446
              KA  + RLM+ LIHSGFF   K           Y L   S LLLK NPFS+ PFLL +
Sbjct  66   NEKAPFVYRLMQILIHSGFFIEAKIPGNENDNQKGYLLTSASELLLKSNPFSVTPFLLAM  125

Query  445  VDNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVM  266
            +D P L T PW+H  +WFQN   +PF T HG +++D+A H+ + N  FNEAMASD R+V 
Sbjct  126  LD-PAL-TDPWHHLSQWFQNSYESPFYTCHGRSLYDFASHESQLNQFFNEAMASDARMVS  183

Query  265  NVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDY  86
            +VV K CK VFE LNSLVDV GGTGT A+ IA+AFP LKCTV DLPHV+ GLE TKNL Y
Sbjct  184  SVVTKDCKHVFESLNSLVDVGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLESTKNLGY  243

Query  85   VGGDMFVSIPHANALFLKWILHDWNDED  2
            VGG+MF +IP A+A+ +KWIL DW+D++
Sbjct  244  VGGNMFEAIPPADAVLMKWILIDWSDDE  271



>emb|CAN78992.1| hypothetical protein VITISV_005827 [Vitis vinifera]
Length=357

 Score =   314 bits (805),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 148/264 (56%), Positives = 195/264 (74%), Gaps = 9/264 (3%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G+   ELL++Q H+WN+IF++I S SLKCA++LGIPDIIH HG+P+T  EL   +P++  
Sbjct  6    GEISAELLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHGKPMTFPELVAKLPVHPK  65

Query  592  KAGHLARLMRTLIHSGFFF-------HTKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNP  434
            ++  + RLMR L+HSGF           ++ Y L   S LLL D+  S+RPFLL ++D P
Sbjct  66   RSQCVYRLMRILVHSGFLAAQRVQQGEQEEGYVLTDASRLLLMDDSLSIRPFLLAMLD-P  124

Query  433  ILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVI  254
            +L T+PW++   WFQNDDP PF TAH    WDYAGH+P+ N+ FNEAMASD+RLV++V++
Sbjct  125  VL-TKPWHYLSAWFQNDDPTPFHTAHEQPFWDYAGHEPQLNNFFNEAMASDSRLVISVLL  183

Query  253  KYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGD  74
            K  KG+FEGLNSLVDV GGTG VA+ IA AFP L CTV D PHV+ GL+ +KNL+Y  GD
Sbjct  184  KEGKGLFEGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDPPHVVAGLQESKNLNYFAGD  243

Query  73   MFVSIPHANALFLKWILHDWNDED  2
            MF +IP A+A+ LKWILHDW+DE+
Sbjct  244  MFEAIPPADAILLKWILHDWSDEE  267



>gb|AEF97347.1| O-methyltransferase [Vitis pseudoreticulata]
Length=357

 Score =   313 bits (803),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 148/259 (57%), Positives = 193/259 (75%), Gaps = 9/259 (3%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL++Q H+WN+IF++IKS SLKCA +LGIPDIIH HG+P+TL EL   +P++  ++  +
Sbjct  11   ELLHAQAHVWNHIFNFIKSMSLKCATQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  577  ARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
             RLMR L+HSGF    +       + Y L   S LLL D+  S+RP +L ++D PIL T+
Sbjct  71   YRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLD-PIL-TK  128

Query  418  PWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKG  239
            PW++   WFQNDDP PF TAH  + WDYAGH+P+ N+ FNEAMASD RL+ +V++K  +G
Sbjct  129  PWHYLSAWFQNDDPTPFHTAHERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLKEGQG  188

Query  238  VFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSI  59
            VF GLNSLVDV GGTG VA+ IA AFP L CTV DLPHV+ GL+G+KNL+Y  GDMF +I
Sbjct  189  VFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDMFEAI  248

Query  58   PHANALFLKWILHDWNDED  2
            P A+A+ LKWILHDW+DE+
Sbjct  249  PPADAILLKWILHDWSDEE  267



>ref|XP_002281368.2| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   313 bits (802),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 149/264 (56%), Positives = 194/264 (73%), Gaps = 9/264 (3%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G+   ELL++Q H+WN+IF++IKS SLKCA +LGIPDIIH HG+P+TL EL   +P++  
Sbjct  6    GEISAELLHAQAHVWNHIFNFIKSMSLKCATQLGIPDIIHNHGKPMTLPELVAKLPVHPK  65

Query  592  KAGHLARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNP  434
            ++  + RLMR L+HSGF    +       + Y L   S LLL D+  S+RP +L ++D P
Sbjct  66   RSQCVYRLMRILVHSGFLAAQRVQQGEEEEGYVLTDASRLLLMDDSLSIRPLVLAMLD-P  124

Query  433  ILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVI  254
            IL T+PW++   WFQNDDP PF TA+    WDYAGH+P+ N+ FNEAMASD RL+ +V++
Sbjct  125  IL-TKPWHYLSAWFQNDDPTPFHTAYERPFWDYAGHEPQLNNSFNEAMASDARLLTSVLL  183

Query  253  KYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGD  74
            K  KGVF GLNSLVDV GGTG VA+ IA AFP L CTV DLPHV+ GL+G+KNL+Y  GD
Sbjct  184  KEGKGVFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGD  243

Query  73   MFVSIPHANALFLKWILHDWNDED  2
            MF +IP A+A+ LKWILHDW+DE+
Sbjct  244  MFEAIPPADAILLKWILHDWSDEE  267



>emb|CDP15886.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   313 bits (801),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 144/252 (57%), Positives = 187/252 (74%), Gaps = 2/252 (1%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +Q H+ N + ++ KS+SLKCA+ELGIPD I++HG+PITL EL  A+PIN +KA H+
Sbjct  9    ELLAAQNHVGNQMLNFRKSASLKCAIELGIPDAINQHGKPITLSELVSALPINPSKANHI  68

Query  577  ARLMRTLIHSGFFFHTKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQPWNHARE  398
             RLMR L ++GFF      YAL     LLLK+ PF+LR F+ ++ D P+L+ +PWN   E
Sbjct  69   YRLMRFLSNAGFFVLQDQGYALTAAGRLLLKEEPFNLRAFIFYMSD-PVLV-KPWNSLTE  126

Query  397  WFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGVFEGLNS  218
            WF+NDDP+PF TAHG   W YA  +P F ++FNEAMA+D+ L++ V++  CK VF+GL S
Sbjct  127  WFRNDDPSPFHTAHGKNFWAYAAEEPNFANLFNEAMANDSTLIVQVMMTQCKFVFDGLTS  186

Query  217  LVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSIPHANALF  38
            L DV GGTG VAR IA+ FP+LKC V DLPHVI G EGT+NLD+V GDM   +P A+A+ 
Sbjct  187  LADVGGGTGAVARAIAQNFPNLKCVVCDLPHVIAGQEGTENLDFVAGDMLEKVPAADAIL  246

Query  37   LKWILHDWNDED  2
            LKWILHDW+DED
Sbjct  247  LKWILHDWSDED  258



>ref|XP_003557042.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Glycine 
max]
Length=358

 Score =   313 bits (802),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/260 (57%), Positives = 193/260 (74%), Gaps = 10/260 (4%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            +LL +QTHIWN+IFS+I S SLKC V+LGIPDIIH +G+P+ L  L  ++PI+ +K   +
Sbjct  11   KLLRAQTHIWNHIFSFINSMSLKCVVDLGIPDIIHNYGQPMPLSNLIASLPIHPSKTCFV  70

Query  577  ARLMRTLIHSGFFFHTKD--------AYALAQPSTLLLKDNPFSLRPFLLFLVDNPILIT  422
             RLMR +IHSGFF   K          Y L   S LLLK++P S+ PFL  ++D P+L T
Sbjct  71   HRLMRIMIHSGFFSQQKHDLENELEAKYVLTDASVLLLKNHPMSVTPFLHAMLD-PVL-T  128

Query  421  QPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCK  242
             PWN    WF+N DP PF+TAHGM +WDYAG  P+ N++FN+AMASD R V ++VI+ CK
Sbjct  129  NPWNQFSTWFKNGDPTPFETAHGMMLWDYAGADPKLNNLFNDAMASDARFVTSLVIEKCK  188

Query  241  GVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVS  62
            GVF GL SLVDV GGTGT+A+ IA++FP ++C VFDLPHV+ GL+G++NL YV GDMF +
Sbjct  189  GVFMGLESLVDVGGGTGTMAKAIAKSFPRVECIVFDLPHVVSGLKGSENLKYVSGDMFEA  248

Query  61   IPHANALFLKWILHDWNDED  2
            IP A+A+ LKWILHDWNDE+
Sbjct  249  IPPADAILLKWILHDWNDEE  268



>ref|XP_011037442.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=355

 Score =   312 bits (800),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/255 (57%), Positives = 194/255 (76%), Gaps = 5/255 (2%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +QTH+WN++F++I S +LKCAVELGIPD+I KHG+P+TL EL  A+PI+ +KA ++
Sbjct  11   ELLQAQTHVWNHLFNFINSMTLKCAVELGIPDVIQKHGKPMTLSELVTALPIHPSKAQYV  70

Query  577  ARLMRTLIHSGFFFHT---KDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQPWNH  407
             RLMR L+HSGFF      ++AY+L Q + LLLKDNP+S+R  LLF++D P+L T+P + 
Sbjct  71   HRLMRILVHSGFFSQQNLKQEAYSLTQSTRLLLKDNPWSMRTLLLFVLD-PVL-TKPHDC  128

Query  406  AREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGVFEG  227
               WF+ND+ + F  AH  T W+YAG  P  N++FN+AMASD+ L   VV+  CKG+FEG
Sbjct  129  LSTWFRNDEASAFSVAHENTFWEYAGQDPRINNLFNDAMASDSILASKVVVSKCKGIFEG  188

Query  226  LNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSIPHAN  47
            +NSLVDV GG GT+A+ I EAFP + CTVFDLPHV+  L+G+KNL YVGGDMF ++P A+
Sbjct  189  VNSLVDVGGGLGTMAKGIVEAFPHMDCTVFDLPHVVSDLQGSKNLKYVGGDMFQAVPPAD  248

Query  46   ALFLKWILHDWNDED  2
            A+ LK ILH W DED
Sbjct  249  AILLKLILHCWRDED  263



>gb|AFX68805.1| O-metyltransferase [Vitis riparia]
Length=357

 Score =   312 bits (800),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/259 (58%), Positives = 192/259 (74%), Gaps = 9/259 (3%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL++Q H+WN+IF++IKS SLKCA +LGIPDIIH HG+P+TL EL   +P++  ++  +
Sbjct  11   ELLHAQAHVWNHIFNFIKSMSLKCATQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  577  ARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
             RLMR L+HSGF    +       + Y L   S LLL D+  S+RP +L ++D PIL T+
Sbjct  71   YRLMRILVHSGFLAAQRVQQGEEEEGYVLTDASRLLLMDDSLSIRPLVLAMLD-PIL-TK  128

Query  418  PWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKG  239
            PW++   WFQNDDP PF TA+    WDYAGH+P+ N+ FNEAMASD RL+ +V+IK  KG
Sbjct  129  PWHYLSAWFQNDDPTPFHTAYERPFWDYAGHEPQLNNSFNEAMASDARLLTSVLIKEGKG  188

Query  238  VFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSI  59
            VF GLNSLVDV GGTG VA+ IA AFP L CTV DLPHV+ GL+G+KNL+Y  GDMF +I
Sbjct  189  VFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDMFEAI  248

Query  58   PHANALFLKWILHDWNDED  2
            P A+A+ LKWILHDW+DE+
Sbjct  249  PPADAILLKWILHDWSDEE  267



>ref|XP_006376392.1| hypothetical protein POPTR_0013s12620g [Populus trichocarpa]
 gb|ERP54189.1| hypothetical protein POPTR_0013s12620g [Populus trichocarpa]
Length=355

 Score =   311 bits (797),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 145/255 (57%), Positives = 191/255 (75%), Gaps = 5/255 (2%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +QTH+WN+IF +I S +LKCAV+LGIPD+I KHG+P+TL EL  A+PI+ +KA ++
Sbjct  11   ELLQAQTHVWNHIFCFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSKAQYV  70

Query  577  ARLMRTLIHSGFFFH---TKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQPWNH  407
             RLMR L+HSGFF      ++AY+L Q + LLLKDNP S+R  LLF++D P+L T+P + 
Sbjct  71   HRLMRILVHSGFFSQQNLNQEAYSLTQSTRLLLKDNPLSMRTLLLFVLD-PVL-TKPHDC  128

Query  406  AREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGVFEG  227
               WF+ND+   F  AH    W+YAG     N++FN+AMASD+ LV  VV+  CKG+FEG
Sbjct  129  LSTWFRNDEATAFSIAHESIFWEYAGQDSRINNLFNDAMASDSILVSKVVVSKCKGIFEG  188

Query  226  LNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSIPHAN  47
            +NSLVDV GG GT+A+ IAEAFP + CTVFDLP V+  L+G+KNL YVGGDMF ++P A+
Sbjct  189  VNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPRVVSDLQGSKNLKYVGGDMFEAVPPAD  248

Query  46   ALFLKWILHDWNDED  2
             + LKWILH W+DED
Sbjct  249  VILLKWILHAWSDED  263



>ref|XP_003544912.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
1 [Glycine max]
Length=358

 Score =   310 bits (795),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/260 (57%), Positives = 191/260 (73%), Gaps = 10/260 (4%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            +LL +QTHIWN+IFS+I S SLKC V+LGIPDIIH +G+P+ L  L  ++PI+ +K   +
Sbjct  11   KLLRAQTHIWNHIFSFINSMSLKCVVDLGIPDIIHNYGQPMPLSNLIASLPIHPSKTCFV  70

Query  577  ARLMRTLIHSGFFF--------HTKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILIT  422
             RLMR +IHSGFF           +  Y L   S LLLK++P S+ PFL  ++D P+L T
Sbjct  71   HRLMRIMIHSGFFSLQNHDLENELEAKYVLTDASVLLLKNHPMSVTPFLHAMLD-PVL-T  128

Query  421  QPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCK  242
             PWN    WF+N DP PF+TAHG   WDYAG  P+ NH+FN+AMASD R V ++VI+ CK
Sbjct  129  NPWNQFSTWFKNGDPTPFETAHGKMFWDYAGADPKLNHLFNDAMASDARFVTSLVIEKCK  188

Query  241  GVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVS  62
            GVF GL SLVDV GGTGT+A+ IA++FP ++C VFDLPHV+ GL+G++NL YV GDMF +
Sbjct  189  GVFMGLESLVDVGGGTGTMAKAIAKSFPRVECIVFDLPHVVSGLKGSENLKYVAGDMFEA  248

Query  61   IPHANALFLKWILHDWNDED  2
            IP A+A+ LKWILHDWNDE+
Sbjct  249  IPPADAILLKWILHDWNDEE  268



>ref|XP_004235335.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=445

 Score =   313 bits (802),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 153/269 (57%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -2

Query  802  KFKMAQLPSMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLE  623
            K KMA   ++GD+  E+L +Q HI N++F+YI S SLKCA++LGIPDIIH HGR +T  +
Sbjct  90   KEKMALPNNIGDETNEVLAAQAHIANHVFNYINSMSLKCAIQLGIPDIIHNHGRAMTQSD  149

Query  622  LADAIPINKAKAGH--LARLMRTLIHSGFFFHTKDAYALAQPSTLLLKDNPFSLRPFLLF  449
            L +A+PINK+K GH  + RLMR LIH+GFF   ++ Y L   S LLLK+ P SL PF+  
Sbjct  150  LVNALPINKSK-GHDCIYRLMRILIHAGFFTQGEEGYLLTPTSRLLLKNEPLSLAPFVQA  208

Query  448  LVDNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLV  269
             +D P+L+  PW+   EWF N+D  PF TAHG  +++YAG +   N++FNEAM  D RL+
Sbjct  209  QLD-PVLM-DPWHSLGEWFANEDSTPFATAHGKPLFEYAGDEQRLNNLFNEAMGCDARLI  266

Query  268  MNVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLD  89
            M+V+IK  KGVFEGL SLVDV GG GTVA+ I+ AFP+LKC+VFDLPHV+ GLEG KNL 
Sbjct  267  MSVLIKNGKGVFEGLKSLVDVGGGIGTVAKAISNAFPELKCSVFDLPHVVEGLEGGKNLT  326

Query  88   YVGGDMFVSIPHANALFLKWILHDWNDED  2
            Y+ GDMF  +P A+A+ LKWILHDW+D+D
Sbjct  327  YIAGDMFKFVPSADAILLKWILHDWSDKD  355



>ref|XP_007132709.1| hypothetical protein PHAVU_011G118100g [Phaseolus vulgaris]
 gb|ESW04703.1| hypothetical protein PHAVU_011G118100g [Phaseolus vulgaris]
Length=352

 Score =   310 bits (793),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/258 (57%), Positives = 188/258 (73%), Gaps = 9/258 (3%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            +LL +QTH+WN+IFS++ S SLKCA++L IPDIIHK+G  +   +L  ++ +N +KA  +
Sbjct  11   KLLRAQTHVWNHIFSFVNSMSLKCAIDLEIPDIIHKYGETMPFSQLTASLSLNPSKANCI  70

Query  577  ARLMRTLIHSGFFFHTKD-------AYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
             RLMR L HSGFF   +         Y L   STLLLKDNP S+ PF   ++D PIL T+
Sbjct  71   YRLMRILTHSGFFSQLQVNENDLEMGYVLTDASTLLLKDNPLSMLPFFHAMLD-PIL-TK  128

Query  418  PWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKG  239
            PW+    WF+NDDP PF TAH M IWDYAG  P+ N +FN+AMASD +LV NVVI+ C G
Sbjct  129  PWHQLPTWFRNDDPTPFHTAHEMKIWDYAGRDPKLNQLFNDAMASDAQLVSNVVIERCSG  188

Query  238  VFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSI  59
            VF+GL SLVDV GGTG +A+ IA++FP + CTVFDLPHV+  L+G +NL YVGGDMF S+
Sbjct  189  VFKGLESLVDVGGGTGIMAKAIAKSFPHIDCTVFDLPHVVANLKGCENLKYVGGDMFESV  248

Query  58   PHANALFLKWILHDWNDE  5
            P A+A+ LKWILHDWNDE
Sbjct  249  PPADAVLLKWILHDWNDE  266



>ref|XP_009594948.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=359

 Score =   310 bits (793),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/271 (56%), Positives = 196/271 (72%), Gaps = 9/271 (3%)
 Frame = -2

Query  793  MAQLPSMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELAD  614
            MA   ++ D+  E+L +Q HI N++F+YI   SLKCA++L IPDIIH HG+P+TL  L +
Sbjct  1    MALSNNIRDKTREILAAQAHIANHVFNYINFVSLKCAIQLEIPDIIHNHGKPMTLSNLVN  60

Query  613  AIPINKAKAGH-LARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFL  455
            A+PINKAK    + RLMR LIHSGFF  TK      + Y L   S LLLK+ P SL PF+
Sbjct  61   ALPINKAKGQDCIYRLMRILIHSGFFIQTKINENEEEGYLLTPNSHLLLKNEPLSLAPFV  120

Query  454  LFLVDNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTR  275
            L  +D PIL+  P+    +W QN D  PF TAHG  +++YAG +P  N++FNEAMASD R
Sbjct  121  LAQLD-PILM-DPFQSLSKWLQNSDSTPFATAHGKPLFEYAGDEPRLNYLFNEAMASDAR  178

Query  274  LVMNVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKN  95
            L+++VVIK  +G+FEGL SL DV GG GTVA+ I+ AFP++KCTVFDLPHV+ GLEG+  
Sbjct  179  LMISVVIKNGRGIFEGLKSLADVGGGIGTVAKAISNAFPEIKCTVFDLPHVVEGLEGSNK  238

Query  94   LDYVGGDMFVSIPHANALFLKWILHDWNDED  2
            L YVGGDMF S+P A+A+ LKWILHDW+DED
Sbjct  239  LSYVGGDMFKSVPSADAILLKWILHDWSDED  269



>ref|XP_011037437.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score =   309 bits (792),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/258 (57%), Positives = 196/258 (76%), Gaps = 9/258 (3%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +QTH+WN+IF++I S +LKCAV+LGIPD+I KHG+P+TL EL  A+PI+ +KA ++
Sbjct  11   ELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSKAQYV  70

Query  577  ARLMRTLIHSGFF-------FHTKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
             RLMR L+HSGFF        H ++AY+L Q + LLLKDNP+S+RP LL ++    ++T+
Sbjct  71   HRLMRILVHSGFFSQQNLNGIHNQEAYSLTQSTRLLLKDNPWSVRPLLLLVL--DPVLTK  128

Query  418  PWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKG  239
            PW+    WF+NDD   F  AH  T+W+YAG    FN++FNEAMASD+ L   +V+  CKG
Sbjct  129  PWDCLSTWFRNDDCNAFIVAHEKTLWEYAGQDARFNNLFNEAMASDSILASKLVVSKCKG  188

Query  238  VFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSI  59
            +F+G+NSLVDV GG GT+A+ IAEAFP + CTVFDLPHV+  L+G KNL YVGGDMF ++
Sbjct  189  IFDGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGGKNLKYVGGDMFEAV  248

Query  58   PHANALFLKWILHDWNDE  5
            P A+AL LKW+LHDW+DE
Sbjct  249  PPADALLLKWVLHDWSDE  266



>ref|XP_011016237.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score =   309 bits (792),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/258 (57%), Positives = 196/258 (76%), Gaps = 9/258 (3%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +QTH+WN+IF++I S +LKCAV+LGIPD+I KHG+P+TL EL  A+PI+ +KA ++
Sbjct  11   ELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSKAQYV  70

Query  577  ARLMRTLIHSGFF-------FHTKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
             RLMR L+HSGFF        H ++AY+L Q + LLLKDNP+S+RP LL ++    ++T+
Sbjct  71   HRLMRILVHSGFFSQQNLNGIHNQEAYSLTQSTRLLLKDNPWSVRPLLLLVL--DPVLTK  128

Query  418  PWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKG  239
            PW+    WF+NDD   F  AH  T+W+YAG    FN++FNEAMASD+ L   +V+  CKG
Sbjct  129  PWDCLSTWFRNDDCNAFIVAHEKTLWEYAGQDARFNNLFNEAMASDSILASKLVVSKCKG  188

Query  238  VFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSI  59
            +F+G+NSLVDV GG GT+A+ IAEAFP + CTVFDLPHV+  L+G KNL YVGGDMF ++
Sbjct  189  IFDGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGGKNLKYVGGDMFEAV  248

Query  58   PHANALFLKWILHDWNDE  5
            P A+AL LKW+LHDW+DE
Sbjct  249  PPADALLLKWVLHDWSDE  266



>ref|XP_006368013.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=353

 Score =   309 bits (791),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/266 (57%), Positives = 193/266 (73%), Gaps = 5/266 (2%)
 Frame = -2

Query  793  MAQLPSMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELAD  614
            MA    +GD+  E+L +Q HI N++ +Y+ S SLKCA++LGIPDIIH HGR +T  +L +
Sbjct  1    MALHNKIGDETNEVLAAQAHILNHVLNYVNSMSLKCAIQLGIPDIIHSHGRAMTRSDLVN  60

Query  613  AIPINKAKAGH--LARLMRTLIHSGFFFHTKDAYALAQPSTLLLKDNPFSLRPFLLFLVD  440
            A+PINK+K GH  + RLMR LIH+GFF   ++ Y L   S LLLK+ P +L PF+   +D
Sbjct  61   ALPINKSK-GHECIYRLMRILIHTGFFIEGEEGYLLTPTSRLLLKNEPLNLAPFVQAHLD  119

Query  439  NPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNV  260
             PIL+  PW+   EWF N D  PF TAHG  ++DYAG  P  N +FNEAM SD RL+M+V
Sbjct  120  -PILM-DPWHSLGEWFANGDSTPFATAHGKPLFDYAGDDPRLNRIFNEAMESDARLIMSV  177

Query  259  VIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVG  80
            +IK  K VFEGL SLVDV GG GTVA+ I+ AFP+LKC+VFDLPHV+ GLEG  NL Y+ 
Sbjct  178  LIKNGKRVFEGLTSLVDVGGGIGTVAKAISNAFPELKCSVFDLPHVVEGLEGGNNLSYIT  237

Query  79   GDMFVSIPHANALFLKWILHDWNDED  2
            GDMF S+P A+A+ LKWILHDW+DED
Sbjct  238  GDMFKSVPSADAILLKWILHDWSDED  263



>ref|NP_001267963.1| O-methyltransferase [Vitis vinifera]
 gb|AEP17010.1| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   309 bits (791),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 146/259 (56%), Positives = 192/259 (74%), Gaps = 9/259 (3%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL++Q H+WN+IF++IKS SLKCA++LGIPDIIH HG+P+TL EL   +P++  ++  +
Sbjct  11   ELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  577  ARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
             RLMR L+HSGF    +       + Y L   S LLL D+  S+RP +L ++D PIL T+
Sbjct  71   YRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLD-PIL-TK  128

Query  418  PWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKG  239
            PW++   WFQNDDP PF TA+  + WDYAGH+P+ N+ FNEAMASD RL+ +V++K  +G
Sbjct  129  PWHYLSAWFQNDDPTPFHTAYERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLKEGQG  188

Query  238  VFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSI  59
            VF GLNSLVDV GGTG VA+ IA AFP L CTV DL HV+ GL+G+KNL+Y  GDMF +I
Sbjct  189  VFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLSHVVAGLQGSKNLNYFAGDMFEAI  248

Query  58   PHANALFLKWILHDWNDED  2
            P A A+ LKWILHDW+DE+
Sbjct  249  PPAVAILLKWILHDWSDEE  267



>ref|XP_010088036.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXB31255.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=373

 Score =   309 bits (791),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 145/261 (56%), Positives = 190/261 (73%), Gaps = 11/261 (4%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +Q HIWNNIF++I S SLKCAV+LGIPD IHKHG+P+TL +L  A+P+++ KA ++
Sbjct  24   ELLGAQAHIWNNIFNFINSMSLKCAVQLGIPDTIHKHGKPMTLSKLIGALPVHQNKAPYV  83

Query  577  ARLMRTLIHSGFF---------FHTKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILI  425
             RLMR L+HSGFF            ++ Y L   S LL+ DNP S+ PFLL ++D P+L 
Sbjct  84   YRLMRILVHSGFFSLQTIGESDHQEEEGYVLTDASKLLVGDNPLSVAPFLLAMLD-PVL-  141

Query  424  TQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYC  245
            T+PW+    WFQNDDP  FDT +G+  W Y G +P+  + FN+AMASD RLV++VVI+ C
Sbjct  142  TKPWDFLSTWFQNDDPTAFDTVNGLPFWKYGGQEPKMANFFNDAMASDARLVISVVIENC  201

Query  244  KGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFV  65
            K VF+ L S VDV GGTGTVA+ IA  FP ++CTVFDLPHV+  L+G  NL +VGGDMF 
Sbjct  202  KWVFDELESFVDVGGGTGTVAKAIAATFPKMECTVFDLPHVVGDLQGKDNLKFVGGDMFQ  261

Query  64   SIPHANALFLKWILHDWNDED  2
             +P A+A+ LKWILHDW+D++
Sbjct  262  QVPPADAILLKWILHDWSDDE  282



>sp|B6VJS4.2|ROMT_VITVI RecName: Full=Trans-resveratrol di-O-methyltransferase; AltName: 
Full=Resveratrol O-methyltransferase; Short=ROMT; Short=VvROMT 
[Vitis vinifera]
Length=357

 Score =   308 bits (789),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 145/259 (56%), Positives = 193/259 (75%), Gaps = 9/259 (3%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL++Q H+WN+IF++IKS SLKCA++LGIPDIIH HG+P+TL EL   +P++  ++  +
Sbjct  11   ELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  577  ARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
             RLMR L+HSGF    +       + Y L   S LLL D+  S+RP +L ++D PIL T+
Sbjct  71   YRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLD-PIL-TK  128

Query  418  PWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKG  239
            PW++   WFQNDDP PF TA+  + WDYAGH+P+ N+ FNEAMASD RL+ +V++K  +G
Sbjct  129  PWHYLSAWFQNDDPTPFHTAYERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLKEGQG  188

Query  238  VFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSI  59
            VF GLNSLVDV GGTG VA+ IA AFP L CTV DL HV+ GL+G+KNL+Y  GDMF +I
Sbjct  189  VFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLSHVVAGLQGSKNLNYFAGDMFEAI  248

Query  58   PHANALFLKWILHDWNDED  2
            P A+A+ LKWILHDW++E+
Sbjct  249  PPADAILLKWILHDWSNEE  267



>ref|XP_002278398.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
 emb|CBI21930.3| unnamed protein product [Vitis vinifera]
Length=358

 Score =   308 bits (789),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 152/264 (58%), Positives = 191/264 (72%), Gaps = 10/264 (4%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G++  ELL +Q H+WN+IF++I S SLKCA++LGIPDIIH H +P+TL EL   +P+   
Sbjct  6    GERSSELLQAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHCKPMTLHELVAKLPVRPN  65

Query  592  KAGHLARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNP  434
            K   + RLMR L+HSGFF   +       + Y LA  S LLLKD+P S+ PFLL L    
Sbjct  66   KTLCVHRLMRILVHSGFFTKQRVQESADEEGYVLANASRLLLKDHPLSITPFLLLLD---  122

Query  433  ILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVI  254
              +T+PW++A  WFQNDDP PF TAHG T+WDY  H+P FN+ FNE MASD RLV +V++
Sbjct  123  PDLTEPWDYASAWFQNDDPTPFFTAHGRTLWDYGCHEPRFNNFFNEGMASDARLVTSVLV  182

Query  253  KYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGD  74
            K CKG FEGLNS VDV GGTGTVA+TI EAFP L  TV DLPHV+  L G+KNL Y+ GD
Sbjct  183  KECKGAFEGLNSFVDVGGGTGTVAKTIVEAFPHLHGTVLDLPHVVADLRGSKNLTYLAGD  242

Query  73   MFVSIPHANALFLKWILHDWNDED  2
            +F +IP A+A+ LKWILHDW+DE+
Sbjct  243  LFEAIPPADAILLKWILHDWSDEE  266



>gb|ABQ02270.2| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   308 bits (788),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/259 (56%), Positives = 193/259 (75%), Gaps = 9/259 (3%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL++Q H+WN+IF++IKS SLKCA++LGIPDIIH HG+P+TL EL   +P++  ++  +
Sbjct  11   ELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  577  ARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
             RLMR L+HSGF    +       + Y L   S LLL D+  S+RP +L ++D PIL T+
Sbjct  71   YRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLD-PIL-TK  128

Query  418  PWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKG  239
            PW++   WFQNDDP PF TA+  + WDYAGH+P+ N+ FNEAMASD RL+ +V++K  +G
Sbjct  129  PWHYLSAWFQNDDPTPFHTAYERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLKEGQG  188

Query  238  VFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSI  59
            VF GLNSLVDV GGTG VA+ IA AFP L CTV DL HV+ GL+G+KNL+Y  GDMF +I
Sbjct  189  VFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLSHVVAGLQGSKNLNYFAGDMFGAI  248

Query  58   PHANALFLKWILHDWNDED  2
            P A+A+ LKWILHDW++E+
Sbjct  249  PPADAILLKWILHDWSNEE  267



>emb|CAN79968.1| hypothetical protein VITISV_043678 [Vitis vinifera]
Length=357

 Score =   307 bits (787),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/264 (56%), Positives = 191/264 (72%), Gaps = 9/264 (3%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G+   ELL++Q H+WN+IF++IKS SLKCA +LGIPDIIH HG+P+TL EL   +P++  
Sbjct  6    GEISAELLHAQAHVWNHIFNFIKSMSLKCATQLGIPDIIHNHGKPMTLPELVAKLPVHPK  65

Query  592  KAGHLARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNP  434
            ++  + RLMR L+HSGF    +       + Y L   S LLL D+  S+RP +L ++D P
Sbjct  66   RSQCVYRLMRILVHSGFLAAQRVQQGEEEEGYVLTDASRLLLMDDSLSIRPLVLAMLD-P  124

Query  433  ILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVI  254
            IL T+PW++   WFQNDDP PF TA+    WDYAGH+P+ N+ FNEAMASD RL+  V++
Sbjct  125  IL-TKPWHYLSAWFQNDDPTPFHTAYEXXFWDYAGHEPQLNNSFNEAMASDARLLTXVLL  183

Query  253  KYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGD  74
            K   GVF GLNSLVDV GGTG VA+ IA AFP L CTV DL HV+ GL+G+KNL+Y  GD
Sbjct  184  KEGXGVFAGLNSLVDVGGGTGKVAKAIAXAFPHLNCTVLDLSHVVAGLQGSKNLNYFAGD  243

Query  73   MFVSIPHANALFLKWILHDWNDED  2
            MF +IP A+A+ LKWILHDW+DE+
Sbjct  244  MFEAIPPADAILLKWILHDWSDEE  267



>emb|CDP19709.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   307 bits (786),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 143/252 (57%), Positives = 186/252 (74%), Gaps = 2/252 (1%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +Q H+ N + ++ KS+SLKCA+ELGIPD I++HG+PITL EL  A+PIN +KA H+
Sbjct  9    ELLAAQNHVGNQMPNFRKSASLKCAIELGIPDAINQHGKPITLSELVSALPINPSKANHI  68

Query  577  ARLMRTLIHSGFFFHTKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQPWNHARE  398
             RLMR L ++GFF      YAL     LLLK+ PF+LR F+ +  D P+L+ +PWN   E
Sbjct  69   YRLMRFLSNAGFFVLQDQGYALTAAGRLLLKEEPFNLRAFIFYTSD-PVLV-KPWNSLTE  126

Query  397  WFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGVFEGLNS  218
            WF+NDDP+PF TAHG   W YA  +P F ++FNEAMA+D+ L + V++  CK VF+GL S
Sbjct  127  WFRNDDPSPFHTAHGKNFWAYAAEEPNFANLFNEAMANDSTLTVQVMMTQCKFVFDGLTS  186

Query  217  LVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSIPHANALF  38
            LVDV GGTG VAR IA+ FP+L+C V DLPHVI G EGT+NLD+V GDM   +P A+A+ 
Sbjct  187  LVDVGGGTGAVARAIAQNFPNLECVVCDLPHVIAGQEGTENLDFVAGDMLEKVPAADAIL  246

Query  37   LKWILHDWNDED  2
            LKWILHDW+D+D
Sbjct  247  LKWILHDWSDDD  258



>ref|NP_001268044.1| trans-resveratrol di-O-methyltransferase [Vitis vinifera]
 gb|AEP17011.1| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   307 bits (787),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/259 (56%), Positives = 191/259 (74%), Gaps = 9/259 (3%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL++Q H+WN+IF++IKS SLKCA++LGIPD IH HG+P+TL EL   +P++  ++  +
Sbjct  11   ELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDTIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  577  ARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
             RLMR L+HSGF    +       + Y L   S LLL D+  S+RP +L ++D PIL T+
Sbjct  71   YRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLD-PIL-TK  128

Query  418  PWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKG  239
            PW++   WFQNDDP PF T +  + WDYAGH+P+ N+ FNEAMASD RL+ +V++K  +G
Sbjct  129  PWHYLSAWFQNDDPTPFHTTYERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLKEGQG  188

Query  238  VFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSI  59
            VF GLNSLVDV GGTG VA+ IA AFP L CTV DLPHV+ GL+G+KNL+Y  GDMF +I
Sbjct  189  VFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDMFEAI  248

Query  58   PHANALFLKWILHDWNDED  2
            P A+A+ LKW LHDW+DE+
Sbjct  249  PPADAILLKWTLHDWSDEE  267



>gb|AFK40900.1| unknown [Lotus japonicus]
Length=357

 Score =   307 bits (786),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/264 (55%), Positives = 193/264 (73%), Gaps = 9/264 (3%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G+   +LL +Q+HIWN+I SYI S SLKC V+LGIPDIIH +G+P+ L +L  ++PI+ +
Sbjct  6    GENAAKLLRAQSHIWNHILSYINSMSLKCVVDLGIPDIIHNYGKPMPLSKLIASLPIHSS  65

Query  592  KAGHLARLMRTLIHSGFFFH-------TKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNP  434
            KAG++ RLMR +IHSGFF          +  Y L   S LLLK +PFS+ PFLL   ++P
Sbjct  66   KAGNIPRLMRVMIHSGFFSQHNITENELEVEYTLTDDSILLLKGHPFSILPFLL-CSNDP  124

Query  433  ILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVI  254
            IL  +PW+H   WF+NDD  PF+TAHGM  WDYA   P+ N++ NE+MA D +L+  V I
Sbjct  125  IL-KKPWHHLSTWFKNDDLTPFETAHGMLPWDYANRDPKVNNLLNESMACDAQLIAGVFI  183

Query  253  KYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGD  74
            + CK +  GL SLVDV GGTGT+AR IA++FP LKCTVFDLPHV+  L+G++NL+Y+GGD
Sbjct  184  EKCKDMLNGLESLVDVGGGTGTMARAIAKSFPRLKCTVFDLPHVVADLQGSENLEYIGGD  243

Query  73   MFVSIPHANALFLKWILHDWNDED  2
            MF  IP A+A+ LKWILHDW+DE+
Sbjct  244  MFKEIPPADAILLKWILHDWSDEE  267



>ref|XP_007142077.1| hypothetical protein PHAVU_008G250700g [Phaseolus vulgaris]
 gb|ESW14071.1| hypothetical protein PHAVU_008G250700g [Phaseolus vulgaris]
Length=357

 Score =   306 bits (784),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 147/263 (56%), Positives = 191/263 (73%), Gaps = 9/263 (3%)
 Frame = -2

Query  769  DQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAK  590
            DQ  +LL +QTH+WN+I S+I S SLKC V+LGIPDIIH HG+P++L  L  ++PI+ +K
Sbjct  7    DQSAKLLKAQTHVWNHILSFINSMSLKCIVDLGIPDIIHNHGQPMSLSNLISSLPIHSSK  66

Query  589  AGHLARLMRTLIHSGFFF---HTKD----AYALAQPSTLLLKDNPFSLRPFLLFLVDNPI  431
               + RLMR ++HSGFF    HT++     YAL   S LLLK N  S+ PFL  ++D P+
Sbjct  67   THFIHRLMRIMVHSGFFSQHNHTENELEVKYALTDSSLLLLKSNAMSVTPFLQAMLD-PV  125

Query  430  LITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIK  251
            L T PWN    WF+N +P  F+ A G   W+YAG  P  N +FN+AMASD +LV +VVI+
Sbjct  126  LTT-PWNQFANWFKNGNPTTFEMAQGKPFWEYAGSDPRINSLFNDAMASDAQLVTSVVIE  184

Query  250  YCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDM  71
             CK VF GL SLVDV GGTGT+ + IA++FP L+CTVFDLPHV+ GL+G++NL YVGGDM
Sbjct  185  KCKRVFMGLESLVDVGGGTGTMGKAIAKSFPQLECTVFDLPHVVSGLQGSENLKYVGGDM  244

Query  70   FVSIPHANALFLKWILHDWNDED  2
            F +IP A+A+ LKWILHDW+DED
Sbjct  245  FEAIPPADAILLKWILHDWSDED  267



>ref|XP_006346268.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=353

 Score =   306 bits (783),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 149/259 (58%), Positives = 188/259 (73%), Gaps = 5/259 (2%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            GD+  E+L +Q HI N++ +Y+ S SLKCA++LGIPDIIH HGR +T  +L +A+PINK+
Sbjct  8    GDETNEVLAAQAHILNHVLNYVNSMSLKCAIQLGIPDIIHSHGRAMTRSDLVNALPINKS  67

Query  592  KAGH--LARLMRTLIHSGFFFHTKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
            K GH  + RLMR LIH+ FF   +D Y L   S LLLK+ P SL PF+   +D PIL+  
Sbjct  68   K-GHECIYRLMRILIHASFFIEGEDGYLLTPTSRLLLKNEPLSLAPFVQAQLD-PILM-D  124

Query  418  PWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKG  239
            PW+   EWF N D  PF TAHG  ++DYAG  P  N +FNEAM SD RL+M+ +IK  K 
Sbjct  125  PWHSLGEWFANGDSTPFATAHGKPLFDYAGDDPRLNRIFNEAMESDARLIMSALIKNGKR  184

Query  238  VFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSI  59
            VFEGL SLVDV GG GTVA+ I+ AFP+LKC+VFDLPHV+ GLEG  NL Y+ GDMF S+
Sbjct  185  VFEGLTSLVDVGGGIGTVAKAISNAFPELKCSVFDLPHVVEGLEGGNNLSYITGDMFKSV  244

Query  58   PHANALFLKWILHDWNDED  2
            P A+A+ LKWILHDW+D+D
Sbjct  245  PSADAILLKWILHDWSDKD  263



>ref|XP_003544914.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X1 [Glycine max]
Length=358

 Score =   305 bits (781),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 148/260 (57%), Positives = 193/260 (74%), Gaps = 10/260 (4%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            +LL +QTHIWN+IFS+I S SLKC V+LGIPDIIH +G+P+ L  L  ++PI+ +K   +
Sbjct  11   KLLRAQTHIWNHIFSFINSMSLKCVVDLGIPDIIHNYGQPMPLSNLIASLPIHPSKTCFV  70

Query  577  ARLMRTLIHSGFFFHTK-------DA-YALAQPSTLLLKDNPFSLRPFLLFLVDNPILIT  422
             RLMR +IHSGFF           DA Y L   S LLLK++P S+ PFL  ++D PIL T
Sbjct  71   HRLMRIMIHSGFFSQQNHDMENQLDAKYVLTDASVLLLKNHPMSVTPFLHAMLD-PIL-T  128

Query  421  QPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCK  242
             PWN    WF+N D  PF+TAHGM +WDYAG  P+ N++FN+AMASD R V ++VI+ CK
Sbjct  129  NPWNQFSTWFKNGDTTPFETAHGMMLWDYAGADPKHNNLFNDAMASDARFVTSLVIEKCK  188

Query  241  GVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVS  62
            G+F GL SLVDV GGTGT+A+ IA++FP ++C VFDLPHV+ GL+G++NL YV GDMF +
Sbjct  189  GMFMGLESLVDVGGGTGTMAKAIAKSFPRVECIVFDLPHVVSGLKGSENLKYVAGDMFEA  248

Query  61   IPHANALFLKWILHDWNDED  2
            IP A+A+ LKWILHDWND++
Sbjct  249  IPPADAILLKWILHDWNDKE  268



>ref|XP_010097399.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXB67905.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=384

 Score =   305 bits (782),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/265 (57%), Positives = 188/265 (71%), Gaps = 15/265 (6%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGH-  581
            EL+ +Q HIWN IF++I S SLKCAV+LGIPD IH HG+P+TL +L  A+PI++ K    
Sbjct  18   ELVKAQAHIWNYIFNFINSMSLKCAVQLGIPDAIHSHGKPMTLSQLISALPIHQNKKSDS  77

Query  580  --LARLMRTLIHSGFFFHTK----------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              + RLMR L++SGFF   +          + Y L   S LLL+DNP S+ P LL ++D 
Sbjct  78   RLIYRLMRILVNSGFFVLQEVVVGETDLLEEGYVLTTASKLLLRDNPLSVTPLLLSMLD-  136

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            PI+ T+PW+    W Q+DDP PF   HGM IWDY  + P   ++FNEAMASD RLV +V+
Sbjct  137  PIM-TKPWHSLSTWLQSDDPTPFAATHGMGIWDYNEYDPRLGNLFNEAMASDARLVTSVL  195

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I  CK V EGL SLVD+AGGTGTVA+ IA AFP L CTVFDLPHVI  L+G+KNL +VGG
Sbjct  196  IDKCKSVLEGLESLVDLAGGTGTVAKAIAYAFPHLACTVFDLPHVIADLQGSKNLKFVGG  255

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF  IP A+A+F+KWILHDW+DED
Sbjct  256  DMFDEIPPADAIFMKWILHDWSDED  280



>ref|XP_006376396.1| hypothetical protein POPTR_0013s12670g [Populus trichocarpa]
 gb|ERP54193.1| hypothetical protein POPTR_0013s12670g [Populus trichocarpa]
Length=359

 Score =   304 bits (778),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 141/259 (54%), Positives = 187/259 (72%), Gaps = 9/259 (3%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +QTH+WN+IF +I S +LKCAV+LGIPD+I KHG+P+TL EL  A+PI+ +KA ++
Sbjct  11   ELLQAQTHVWNHIFYFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSKAQYV  70

Query  577  ARLMRTLIHSGFFFH-------TKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
             RLMR L+HSGFF          ++AY+L Q + LLLKDNP+S+R  LLF++D P+L T+
Sbjct  71   HRLMRILVHSGFFSQRNLNGVDNQEAYSLTQSTRLLLKDNPWSVRAHLLFVLD-PVL-TK  128

Query  418  PWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKG  239
            PW+    WFQNDD   F  AH    W+Y G  P  N++ NE MA D+ L   +V+  CKG
Sbjct  129  PWDCLSTWFQNDDRTAFSVAHEKAPWEYVGQDPRINNLCNEVMARDSILACKLVVNKCKG  188

Query  238  VFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSI  59
            +FEG++SLVDV GG GT+A+ I EAFP + CTV DLPHV+  L+G KNL YV GDMF ++
Sbjct  189  IFEGVSSLVDVGGGIGTMAKGITEAFPHMDCTVLDLPHVVSDLQGCKNLKYVAGDMFQAV  248

Query  58   PHANALFLKWILHDWNDED  2
            P A A+ LKW+LH+W+DED
Sbjct  249  PPAEAILLKWMLHNWSDED  267



>ref|XP_006388573.1| hypothetical protein POPTR_0151s00210g [Populus trichocarpa]
 gb|ERP47487.1| hypothetical protein POPTR_0151s00210g [Populus trichocarpa]
Length=359

 Score =   303 bits (777),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 145/259 (56%), Positives = 193/259 (75%), Gaps = 9/259 (3%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +QTH+WN+IF++I S +LKCAV+LGIPD+I KHG+P+TL EL  A+PI+ +KA ++
Sbjct  11   ELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSKAQYV  70

Query  577  ARLMRTLIHSGFF-------FHTKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
             RLMR L+HSGFF        H + AY+L Q + LLLKDNP+S+RP LL ++    ++T+
Sbjct  71   HRLMRILVHSGFFSQQNLNGIHNQVAYSLTQSTRLLLKDNPWSVRPLLLLVL--DPVLTK  128

Query  418  PWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKG  239
            PW+    WF+NDD   F  AH  T+W+YAG     N++FN+AMASD+ L   +V+  CKG
Sbjct  129  PWDCLSTWFRNDDRNAFSVAHEKTLWEYAGQDARLNNLFNDAMASDSILASKLVVSKCKG  188

Query  238  VFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSI  59
            +F+G+NSLVDV GG GT+A+ IAEAFP + CTVFDLPHV+  L+G KNL Y GGDMF ++
Sbjct  189  IFDGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGGKNLKYAGGDMFEAV  248

Query  58   PHANALFLKWILHDWNDED  2
            P  +AL LKWILHDW+DED
Sbjct  249  PPVDALLLKWILHDWSDED  267



>gb|ABK96707.1| unknown [Populus trichocarpa x Populus deltoides]
Length=359

 Score =   303 bits (776),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 141/259 (54%), Positives = 187/259 (72%), Gaps = 9/259 (3%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +QTH+WN+IF +I S +LKCAV+LGIPD+I KHG+P+TL EL  A+PI+ +KA ++
Sbjct  11   ELLQAQTHVWNHIFYFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSKAQYV  70

Query  577  ARLMRTLIHSGFFFH-------TKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
             RLMR L+HSGFF          ++AY+L Q + LLLKDNP+S+R  LLF++D P+L T+
Sbjct  71   HRLMRILVHSGFFSQRNLNGVDNQEAYSLTQSTRLLLKDNPWSVRAHLLFVLD-PVL-TK  128

Query  418  PWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKG  239
            PW+    WFQNDD   F  AH    W+Y G  P  N++ NE MA D+ L   +V+  CKG
Sbjct  129  PWDCLSTWFQNDDRTAFSVAHEKAPWEYVGQDPRINNLCNEVMARDSILACKLVVNKCKG  188

Query  238  VFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSI  59
            +FEG++SLVDV GG GT+A+ I EAFP + CTV DLPHV+  L+G KNL +V GDMF ++
Sbjct  189  IFEGVSSLVDVGGGLGTMAKGITEAFPHMDCTVLDLPHVVSDLQGCKNLKFVAGDMFQAV  248

Query  58   PHANALFLKWILHDWNDED  2
            P A A+ LKWILH+W+DED
Sbjct  249  PPAEAILLKWILHNWSDED  267



>ref|XP_010110665.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXC27580.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=384

 Score =   304 bits (778),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 148/265 (56%), Positives = 190/265 (72%), Gaps = 15/265 (6%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAK---A  587
            EL+ SQ HIWN IF++I S SLKCA++LGIPD I+ HG+P+ L +L  ++PI++ K   +
Sbjct  18   ELVKSQAHIWNQIFNFINSMSLKCAIQLGIPDAIYSHGKPMILSQLISSLPIHQNKRPDS  77

Query  586  GHLARLMRTLIHSGFFFHTK----------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
              + RLMR L++SGFF   +          + Y L   S LLL+DNP S+ PFLL ++D 
Sbjct  78   RLIYRLMRILVNSGFFALEEVVVGETNLLEEGYVLTNASKLLLRDNPLSVTPFLLSMLD-  136

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            PI+ T+PW+    W Q+DDP PF T HG   WDY  + P   ++FNEAMASD RLV +VV
Sbjct  137  PIM-TKPWHSISTWLQSDDPTPFATTHGKEFWDYNEYDPRLGNLFNEAMASDARLVTSVV  195

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            I+ CK +FEGL SLVD+AGGTGTVA+ IA AFP L CTVFDLPHVI  L+G+KNL +VGG
Sbjct  196  IEKCKSMFEGLESLVDLAGGTGTVAKAIAYAFPHLACTVFDLPHVIADLQGSKNLKFVGG  255

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF  IP A+A+F+KWILHDW+DED
Sbjct  256  DMFDEIPPADAIFVKWILHDWSDED  280



>emb|CDP17644.1| unnamed protein product [Coffea canephora]
Length=347

 Score =   302 bits (774),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/259 (57%), Positives = 186/259 (72%), Gaps = 16/259 (6%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            GD   EL  +Q HIWN++F++I S SLKCA++LGIPDIIHKHG+P+ L +L DA+PIN A
Sbjct  7    GDHTGELFQAQAHIWNHLFNFINSMSLKCAIQLGIPDIIHKHGQPMALAQLIDALPINNA  66

Query  592  KAGHLARLMRTLIHSGFFFHTKDAYALAQPSTLLLKDNPF--SLRPFLLFLVDNPILITQ  419
            KA  + RLMR LIHSGFF   K            + DN     + PFLL ++D PIL T 
Sbjct  67   KAHFVYRLMRILIHSGFFIKAK------------MPDNEGHEGVTPFLLAMLD-PIL-TD  112

Query  418  PWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKG  239
            PW+H  +WFQ+++  PF + HG ++W+ AG QP  N  FNE MASD RLV  +VIK CK 
Sbjct  113  PWHHFSQWFQDNEETPFHSCHGTSMWELAGRQPRLNQFFNEGMASDARLVCTMVIKNCKD  172

Query  238  VFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSI  59
            VF GLNSL+DV GGTGTVA+ IA+AFP LKC+V DLPHV+ G E +KNL YVGGDMF +I
Sbjct  173  VFMGLNSLIDVGGGTGTVAKAIADAFPHLKCSVLDLPHVVDGSESSKNLAYVGGDMFEAI  232

Query  58   PHANALFLKWILHDWNDED  2
            P ++A+ LKWILHDW+DE+
Sbjct  233  PPSDAVLLKWILHDWSDEE  251



>ref|XP_004490696.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=359

 Score =   301 bits (772),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/258 (56%), Positives = 188/258 (73%), Gaps = 9/258 (3%)
 Frame = -2

Query  754  LLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHLA  575
            LL +Q+HIWN+IF++I S SLKC V+LGIPDIIH +G+P++L +L   +PI+ +K   + 
Sbjct  13   LLKAQSHIWNHIFNFINSMSLKCVVDLGIPDIIHNYGKPMSLSKLIPLLPIHPSKTFFIY  72

Query  574  RLMRTLIHSGFFFH-------TKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQP  416
            RLMR + HSGFF          +  Y L   S LLLKDNP ++R F+  LV +P+L T+P
Sbjct  73   RLMRIMTHSGFFSQHNISENELETEYVLTDTSLLLLKDNPMNMRSFV-HLVFDPVL-TKP  130

Query  415  WNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGV  236
            W+    W  NDDP  F+T HGM  WDYA  + + N++FN+AMASD RLV +VVI+ CK V
Sbjct  131  WHQLSSWLTNDDPTAFETTHGMLFWDYAERESKINNLFNDAMASDARLVSSVVIEKCKEV  190

Query  235  FEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSIP  56
            F GL SLVDV GGTGT+A+ +A++FP L+CTVFDLPHV+ GL+GT NL YVGGDMF  IP
Sbjct  191  FNGLESLVDVGGGTGTMAKALAKSFPQLECTVFDLPHVVVGLQGTDNLKYVGGDMFKEIP  250

Query  55   HANALFLKWILHDWNDED  2
             A+A+ LKWILHDWND++
Sbjct  251  PADAILLKWILHDWNDDE  268



>ref|XP_006346269.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=364

 Score =   301 bits (772),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/269 (57%), Positives = 194/269 (72%), Gaps = 13/269 (5%)
 Frame = -2

Query  775  MGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPIN-  599
            +GD+  ++L +Q HIWN+IF+YI S SLKCA++L IPDIIH HGRP+ L +LA+A+PIN 
Sbjct  8    IGDETRQVLAAQAHIWNHIFNYINSMSLKCAIQLEIPDIIHSHGRPMNLSDLAEALPINN  67

Query  598  ---KAKAGHLA-RLMRTLIHSGFFFH-TKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNP  434
               KAK      RLMR L+H+GFF    ++ Y L   S LLLKD P S+ PFL F +D  
Sbjct  68   NHDKAKTHDCVYRLMRILVHAGFFIQEAEEGYLLTPTSRLLLKDEPMSMIPFLNFQLDPN  127

Query  433  ILITQPWNHAREWFQN----DDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVM  266
            ++   PW+   +WF N     +  P+ TAHGM  + YA ++P  NH+FNEAMASDTRLVM
Sbjct  128  LM--DPWHSLSKWFNNVSDDSNTTPYATAHGMPFFKYAENEPRLNHLFNEAMASDTRLVM  185

Query  265  NVVIKYCKG-VFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLD  89
             V+I+  KG +FEGL SLVDV GGTGT+A+ IA+ FP + CTVF+LPHVI GL+G+KNL 
Sbjct  186  TVLIQNGKGLIFEGLKSLVDVGGGTGTIAKAIADTFPQINCTVFELPHVIEGLKGSKNLS  245

Query  88   YVGGDMFVSIPHANALFLKWILHDWNDED  2
            +VGGDMF SIP ANA+ LKWILHDW+D D
Sbjct  246  FVGGDMFNSIPSANAILLKWILHDWSDGD  274



>gb|KHN07780.1| Tabersonine 16-O-methyltransferase [Glycine soja]
Length=323

 Score =   300 bits (768),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 147/238 (62%), Positives = 177/238 (74%), Gaps = 9/238 (4%)
 Frame = -2

Query  697  SLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHLARLMRTLIHSGFFFHTKD--  524
            SLKCA+EL IPDIIHK+G+P+ L +L  ++ I+ +KA  + RLMR L HSGFF   K   
Sbjct  2    SLKCAIELDIPDIIHKYGQPMPLSKLTTSLSIHPSKANCIYRLMRILTHSGFFSQHKVNE  61

Query  523  -----AYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQPWNHAREWFQNDDPAPFDTA  359
                  Y L   STLLLKDNP S+ PFL  ++D P L TQPW     WF+NDDP+PF TA
Sbjct  62   NELEMGYVLTDASTLLLKDNPLSMVPFLHAMLD-PTL-TQPWLQLPTWFKNDDPSPFQTA  119

Query  358  HGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGVFEGLNSLVDVAGGTGTVAR  179
            HGM IWDYA  +P  N +FN+AMASDT+LV NVVI+ CKGVF GL SLVDV GGTGT+A 
Sbjct  120  HGMKIWDYADREPRLNDLFNDAMASDTQLVANVVIERCKGVFNGLESLVDVGGGTGTMAM  179

Query  178  TIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSIPHANALFLKWILHDWNDE  5
             IA++FP L+CTVFDLPHV+  L+G++NL YVGGDMF SIP A+A+ LKWILHDWNDE
Sbjct  180  AIAKSFPQLECTVFDLPHVVATLQGSENLKYVGGDMFESIPSADAILLKWILHDWNDE  237



>ref|XP_007142076.1| hypothetical protein PHAVU_008G250600g [Phaseolus vulgaris]
 gb|ESW14070.1| hypothetical protein PHAVU_008G250600g [Phaseolus vulgaris]
Length=357

 Score =   301 bits (770),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 142/263 (54%), Positives = 186/263 (71%), Gaps = 9/263 (3%)
 Frame = -2

Query  769  DQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAK  590
            DQ  +LL +QTH+WN+I S+I S SLKC V+LGIPDIIH HG+P++L  L  ++PI+ +K
Sbjct  7    DQSAKLLRAQTHVWNHILSFINSMSLKCIVDLGIPDIIHNHGQPMSLSNLISSLPIHSSK  66

Query  589  AGHLARLMRTLIHSGFFFH-------TKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPI  431
               + RLMR ++ SGFF          +  YAL   S LLLK +  S+ P+L   +D   
Sbjct  67   THFIHRLMRIMVQSGFFSQHNPTENELEVKYALTDSSLLLLKSHAMSMTPYLQAKLDPAF  126

Query  430  LITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIK  251
              T PWN    WF+ND P  F+ AHG   W+YAG  P FN +FN+AMASD +LV +VVI+
Sbjct  127  --TNPWNQFSNWFKNDSPTTFEMAHGKPFWEYAGSDPRFNILFNDAMASDAQLVTSVVIE  184

Query  250  YCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDM  71
             CKGVF GL SLVDV GGTGT+ + I+++FP L+CTVFDLPHV+ GL+G++NL YVGGDM
Sbjct  185  KCKGVFMGLESLVDVGGGTGTMGKAISKSFPQLECTVFDLPHVVSGLQGSENLKYVGGDM  244

Query  70   FVSIPHANALFLKWILHDWNDED  2
            F +IP A+A+ LKWILHDW+DE+
Sbjct  245  FEAIPPADAILLKWILHDWSDEE  267



>emb|CDP19713.1| unnamed protein product [Coffea canephora]
Length=350

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/254 (56%), Positives = 184/254 (72%), Gaps = 4/254 (2%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +Q H+ N + ++ KS+SLKCA+ELGIP+ I++HG+PITL EL  A+P+N +KA H+
Sbjct  9    ELLAAQNHVRNQMLNFRKSASLKCAIELGIPEAINQHGKPITLSELVSALPVNPSKASHI  68

Query  577  ARLMRTLIHSGFFFHTKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQPWNHARE  398
             RLMR L  +GFF      YAL     LLLKD+PF+LR  + F+ D P+L+ +PWN   E
Sbjct  69   YRLMRFLSKAGFFVLQDQCYALTAAGRLLLKDDPFNLRALIFFMSD-PVLV-KPWNSLTE  126

Query  397  WFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGVFEGLNS  218
            WF+NDDPAPFDTAHG   W YA  +P F + FNEAMA+D+  ++ V++  CK VF+GL S
Sbjct  127  WFRNDDPAPFDTAHGKNFWAYAAEEPNFANRFNEAMANDSTFIVQVMMTRCKFVFDGLTS  186

Query  217  LVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSIPHANALF  38
            LVDV GGTGTVAR IA+ FP+L+C V DLPHVI   EGT+NLD+V GDM   +P A+A+ 
Sbjct  187  LVDVGGGTGTVARAIAQNFPNLECVVCDLPHVIACQEGTENLDFVAGDMLEKVPTADAIL  246

Query  37   LKW--ILHDWNDED  2
            LK    +HDW+DED
Sbjct  247  LKKPDSIHDWSDED  260



>emb|CDP19711.1| unnamed protein product [Coffea canephora]
Length=349

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 137/252 (54%), Positives = 178/252 (71%), Gaps = 2/252 (1%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            EL+ +QTH+WN +F + KS+ LKCAVELGIPD+I  HG+PITL +L   +PI+ +K+ H+
Sbjct  9    ELIEAQTHVWNAMFHFKKSACLKCAVELGIPDVIRNHGKPITLSDLISVLPIHPSKSAHI  68

Query  577  ARLMRTLIHSGFFFHTKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQPWNHARE  398
             RLMR L +SGFF      YAL     LLLKD PF++R  +    D  +L  +PWN   +
Sbjct  69   FRLMRFLANSGFFVENPQGYALTSAGRLLLKDEPFNVRAHIFLSCDPAML--KPWNFLTK  126

Query  397  WFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGVFEGLNS  218
            WFQNDDP+PFDTA+G   W Y   +  F  MFNEAMASD +L + V++  CK VFEGL +
Sbjct  127  WFQNDDPSPFDTAYGNNFWHYNAQEVRFGKMFNEAMASDNQLSVEVLMTKCKFVFEGLTT  186

Query  217  LVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSIPHANALF  38
            L DV GGTG V R IA+ FP++KCTV+DLPHV+   EG +NL+++ GDMF S+P ANA+ 
Sbjct  187  LADVGGGTGKVDRAIAQNFPNIKCTVYDLPHVVANQEGAENLEFLAGDMFQSVPRANAIL  246

Query  37   LKWILHDWNDED  2
            LK ILHDW+DED
Sbjct  247  LKRILHDWSDED  258



>gb|KDP24061.1| hypothetical protein JCGZ_25718 [Jatropha curcas]
Length=367

 Score =   299 bits (765),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 145/265 (55%), Positives = 188/265 (71%), Gaps = 16/265 (6%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            +LL +Q HIWN+IF++I S SLKCA++LGIPD I+KHG+P+TL +L  A+ I+ AK   +
Sbjct  15   QLLQAQAHIWNHIFNFINSMSLKCAIQLGIPDAINKHGKPMTLSDLIIALSIHPAKTHAI  74

Query  577  ARLMRTLIHSGFFFHTK--------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILIT  422
             RL+R L+HSGF    K        + Y L   S LL+K++PFSL+ FLL ++D P+L T
Sbjct  75   PRLVRILVHSGFLDKEKTEENSQETEGYVLTNASKLLVKEHPFSLKTFLLAMLD-PVL-T  132

Query  421  QPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCK  242
             PW+H   WF NDDP PF T HG  IW YAGH PE N  FNEAMA D ++V +++IK C+
Sbjct  133  GPWDHLTTWFLNDDPTPFQTCHGRGIWKYAGHNPELNSSFNEAMACDAKMVASILIKECE  192

Query  241  GVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVS  62
            GVF+GL SLVDV GGTGTVA+ +A++FP L C VFDLPHV+ GL+   NL +VGGDMF  
Sbjct  193  GVFDGLKSLVDVGGGTGTVAKALADSFPQLDCCVFDLPHVVAGLQDGDNLKFVGGDMFEE  252

Query  61   IPHANALFLK------WILHDWNDE  5
            IP A+A+ LK      WI+HDW+DE
Sbjct  253  IPPADAILLKACYYIYWIMHDWHDE  277



>ref|XP_007142043.1| hypothetical protein PHAVU_008G247600g [Phaseolus vulgaris]
 gb|ESW14037.1| hypothetical protein PHAVU_008G247600g [Phaseolus vulgaris]
Length=357

 Score =   298 bits (764),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 142/263 (54%), Positives = 190/263 (72%), Gaps = 9/263 (3%)
 Frame = -2

Query  769  DQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAK  590
            DQ  +LL +QTH+WN+IFS+I S SLKC V+LGIPDIIH HG+P++L  L  ++PI+ +K
Sbjct  7    DQSAKLLRAQTHVWNHIFSFINSMSLKCIVDLGIPDIIHNHGQPMSLSNLISSLPIHSSK  66

Query  589  AGHLARLMRTLIHSGFFFH---TKD----AYALAQPSTLLLKDNPFSLRPFLLFLVDNPI  431
               + RLMR ++HSGFF     T++     YAL   S LLLK N  S+ PFL  ++D P+
Sbjct  67   THFIHRLMRIMVHSGFFSQHNPTENELELKYALTDSSLLLLKSNAMSVTPFLQAMLD-PV  125

Query  430  LITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIK  251
            + T PWN    WF+N +P  F+  +G   W+YA   P FN +FN+AMASD +LV ++V +
Sbjct  126  M-TNPWNQFSNWFKNGNPTTFEMENGKPFWEYASCDPRFNILFNDAMASDAQLVTSLVTE  184

Query  250  YCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDM  71
             CKGVF GL SLVDV GGTG + + IA++FP L+CTVFDLPHV+ GL+G++NL YVGGDM
Sbjct  185  KCKGVFMGLESLVDVGGGTGIMGKAIAKSFPQLECTVFDLPHVVSGLQGSENLKYVGGDM  244

Query  70   FVSIPHANALFLKWILHDWNDED  2
            F +IP A+A+ LKWILHDW+DE+
Sbjct  245  FEAIPPADAILLKWILHDWSDEE  267



>ref|XP_010110664.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXC27579.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=377

 Score =   299 bits (765),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 149/264 (56%), Positives = 186/264 (70%), Gaps = 14/264 (5%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPI--NKAKAG  584
            E L +Q HIWN IF++I S SLKCA++LGIPD IH HG+P+TL +L  A+PI  NK    
Sbjct  17   EQLKAQAHIWNQIFNFINSMSLKCAIQLGIPDAIHSHGKPMTLSQLISALPIHQNKKLDS  76

Query  583  HLA-RLMRTLIHSGFFF---------HTKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNP  434
            HL  RLMR L++S FF            +D Y L   S LL++DNPFSL P LL ++D P
Sbjct  77   HLIYRLMRILVNSSFFSLQEVVGETDQLEDGYVLTNSSKLLVRDNPFSLTPILLTVLD-P  135

Query  433  ILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVI  254
            I+ T+PW+    W Q+DDP PF T HGM  WDY    P F ++FNEAMASD RLV++V+ 
Sbjct  136  IM-TKPWHSISTWLQSDDPTPFATTHGMEFWDYTVRDPRFGNVFNEAMASDARLVVSVLF  194

Query  253  KYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGD  74
                 VFEGL SLVD+AGGTGTV + IA+AFP ++CTVFDLPHVI  L+G+ NL +VGGD
Sbjct  195  DKRISVFEGLESLVDLAGGTGTVGKAIADAFPHVECTVFDLPHVIADLQGSTNLKFVGGD  254

Query  73   MFVSIPHANALFLKWILHDWNDED  2
            MF  IP A+A+F+KWILHDW+DED
Sbjct  255  MFDEIPPADAIFMKWILHDWSDED  278



>ref|XP_004505627.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=389

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/280 (50%), Positives = 200/280 (71%), Gaps = 8/280 (3%)
 Frame = -2

Query  823  LSLTSELKFKMAQ-LPSMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKH  647
             +++S  +F  A+ +    +   +LL +QT ++N IFS+I S SLKCA+EL IPDIIH +
Sbjct  22   FTISSSTRFLQAKPMAQSEEHATKLLQAQTQVFNQIFSFINSMSLKCAIELSIPDIIHNY  81

Query  646  GRPITLLELADAIPINKAKAGHLARLMRTLIHSGFFFHTKDA----YALAQPSTLLLKDN  479
            G+PI L +L  ++PI+ +K+G + RLMR L HS FF  TK+     Y L   S LLLKD+
Sbjct  82   GQPIPLSQLISSLPIHPSKSGDIDRLMRVLTHSNFFIVTKNELEVMYELTDASRLLLKDH  141

Query  478  PFSLRPFLLFLVDNPILITQPWNHAREWFQNDDPAPFDTAH-GMTIWDYAGHQPEFNHMF  302
            PFS+   +L ++  PI+ ++PW+    W++N+DP+PF T + G+  WDYAGH PEFNH+F
Sbjct  142  PFSMTS-MLHVILGPIM-SKPWHQLSNWYKNEDPSPFYTENNGIEFWDYAGHDPEFNHLF  199

Query  301  NEAMASDTRLVMNVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHV  122
            NEAMA +TR+   VV+  CKGVF+GL SLVDV GG GT+++ IA++FP+++C VFDLPHV
Sbjct  200  NEAMACETRMASTVVMGKCKGVFQGLESLVDVGGGIGTMSKAIAKSFPNIECIVFDLPHV  259

Query  121  IRGLEGTKNLDYVGGDMFVSIPHANALFLKWILHDWNDED  2
            + GL+G++N  YV GDMF SIP   ++ LK +LHDWNDE+
Sbjct  260  VDGLQGSENFKYVAGDMFESIPPTQSILLKGVLHDWNDEE  299



>ref|XP_011100228.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=367

 Score =   298 bits (762),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/277 (54%), Positives = 191/277 (69%), Gaps = 19/277 (7%)
 Frame = -2

Query  784  LPSMGDQDI-ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAI  608
            L S G Q   ELL++Q+H+WN++F++I S SLKC ++LGIPDII KHG+P+TL EL  ++
Sbjct  3    LSSNGIQSTQELLDAQSHVWNHLFNFINSMSLKCVIQLGIPDIILKHGKPMTLSELTHSL  62

Query  607  PINKAKAGHLARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLF  449
             +N+AK+  L RLMR +IHS FF + K       + Y L   S LLL+D P S+RPF L 
Sbjct  63   HLNEAKSPSLERLMRIMIHSKFFINVKISHVEETEGYWLTPASHLLLRDEPLSVRPFALS  122

Query  448  LVDNPILITQPWNHAREWFQND---------DPAPFDTAHGMTIWDYAGHQPEFNHMFNE  296
            ++D PIL T PW+H  EWF+ D         D  PF T HG T+W+YAG  P  N +FNE
Sbjct  123  MLD-PIL-TDPWHHVSEWFKTDVSEWFKTDGDLTPFLTTHGRTLWEYAGQDPRLNGLFNE  180

Query  295  AMASDTRLVMNVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIR  116
             MASD++LV  V+ K C+ VFEGL S+VDV GGTGTVA+ +A+AF  L C V DLPHV+ 
Sbjct  181  GMASDSKLVATVITKDCRNVFEGLKSMVDVGGGTGTVAKAVADAFTGLNCVVLDLPHVVA  240

Query  115  GLEGTKNLDYVGGDMFVSIPHANALFLKWILHDWNDE  5
            G EGT NL +V GDMF  IP A+A+F+KWILHDW DE
Sbjct  241  GCEGTANLVFVAGDMFEYIPPADAVFMKWILHDWPDE  277



>ref|XP_004490687.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=354

 Score =   296 bits (757),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 142/260 (55%), Positives = 190/260 (73%), Gaps = 13/260 (5%)
 Frame = -2

Query  754  LLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHLA  575
            LL +Q+HIWN++ ++I S SLKC V+LGIPDIIH + +P+ L  L  ++PI+ +K   + 
Sbjct  9    LLKAQSHIWNHMCNFINSMSLKCVVDLGIPDIIHNYEKPMPLSVLISSLPIHPSKIPCIY  68

Query  574  RLMRTLIHSGFFFHTKD---------AYALAQPSTLLLKDNPFSLRPFLLFLVDNPILIT  422
            RLMR + H GFF  +KD          Y L   S LLLKD+P S+ PFL  ++D PI + 
Sbjct  69   RLMRIMTHLGFF--SKDNVTENELEIEYMLTDESILLLKDHPMSVTPFLQVVLD-PI-VA  124

Query  421  QPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCK  242
             PW++   W +NDDP  F+T HGM IWDYA  +P+FN++FN+AMASD RLV +VVI+ CK
Sbjct  125  NPWHNLSTWLKNDDPTTFETTHGMLIWDYAAREPKFNNLFNDAMASDARLVTSVVIEKCK  184

Query  241  GVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVS  62
            GVF GL SLVDV GGTGT+A+ +A+ FP ++C VFDLPHV+ GL+G+ NL+YVGGDMF +
Sbjct  185  GVFNGLESLVDVGGGTGTMAKALAKTFPMMECNVFDLPHVVDGLQGSDNLNYVGGDMFKN  244

Query  61   IPHANALFLKWILHDWNDED  2
            IP A+A+ LKWILHDWND++
Sbjct  245  IPPADAILLKWILHDWNDDE  264



>ref|XP_011100233.1| PREDICTED: 8-hydroxyquercetin 8-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score =   296 bits (757),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 147/269 (55%), Positives = 190/269 (71%), Gaps = 11/269 (4%)
 Frame = -2

Query  784  LPSMGDQDI-ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAI  608
            L S G Q   ELL++Q+H+WN++F+++ S SLKC ++LGIPDII KHG+P+TL EL  ++
Sbjct  3    LSSNGIQSTQELLDAQSHVWNHLFNFVNSMSLKCVIQLGIPDIILKHGKPMTLSELTHSL  62

Query  607  PINKAKAGHLARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLF  449
             +N AK+  L RLMR +IHS FF + K       + Y L   S LLL+D P S+RPF L 
Sbjct  63   HLNDAKSPSLERLMRIMIHSKFFINVKISQVEESEGYWLTPASHLLLRDEPLSVRPFALG  122

Query  448  LVDNPILITQPWNHAREWFQND-DPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRL  272
            ++D PIL T PW+H  EWF+ D D  PF T HG T+W++AG  P  N +FNE MASD+ L
Sbjct  123  MLD-PIL-TDPWHHLSEWFKTDGDLTPFLTTHGRTLWEHAGQDPRLNELFNEGMASDSEL  180

Query  271  VMNVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNL  92
            V  V+ K C+ VFEGL S+VDV GGTGTVA+ IA+AF  L C V DLPHV+ G EGT++L
Sbjct  181  VATVITKDCRNVFEGLKSMVDVGGGTGTVAKAIADAFTGLNCVVLDLPHVVAGCEGTESL  240

Query  91   DYVGGDMFVSIPHANALFLKWILHDWNDE  5
             +V GDMF  IP A+A+F+KWILHDW DE
Sbjct  241  TFVAGDMFDYIPPADAVFMKWILHDWPDE  269



>ref|XP_011100227.1| PREDICTED: 8-hydroxyquercetin 8-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score =   295 bits (755),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/259 (56%), Positives = 184/259 (71%), Gaps = 10/259 (4%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL++Q+H+WN++F++I S SLKC ++LGIPDII KHG+P+TL EL  ++ +N AK+  L
Sbjct  13   ELLDAQSHVWNHLFNFINSMSLKCVIQLGIPDIILKHGKPMTLSELTHSLHLNDAKSPSL  72

Query  577  ARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
             RLMR +IHS FF + K       D Y L   S LLL+D P S+RPF L L+D PILI  
Sbjct  73   ERLMRIMIHSKFFINVKISQVEETDGYWLTPASHLLLRDEPSSMRPFALVLLD-PILI-D  130

Query  418  PWNHAREWFQND-DPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCK  242
            PW+H  +WF++D D  PF T HG T W+YA   P  N  FNEAMA DT LV +V+   C+
Sbjct  131  PWHHVSKWFKSDHDLTPFLTTHGRTFWEYAAQDPRLNCFFNEAMACDTVLVASVITGDCR  190

Query  241  GVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVS  62
             VFEGL S+VDV GGTGTVA+ +A+AF  L C V DLPHV+ G EGT+NL +V GDMF  
Sbjct  191  NVFEGLKSMVDVGGGTGTVAKAVADAFTGLNCVVLDLPHVVAGCEGTENLVFVAGDMFEY  250

Query  61   IPHANALFLKWILHDWNDE  5
            IP A+A+F+KWILHDW DE
Sbjct  251  IPSADAVFMKWILHDWPDE  269



>emb|CDP19839.1| unnamed protein product [Coffea canephora]
Length=334

 Score =   294 bits (752),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/241 (60%), Positives = 176/241 (73%), Gaps = 11/241 (5%)
 Frame = -2

Query  697  SLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHLARLMRTLIHSGFFFHTK---  527
            S+KCA++LGIPD+IHKHG+P+TL +L DA+PI  AKA  + RLM+ LIHSGFF   K   
Sbjct  2    SVKCAIQLGIPDVIHKHGQPMTLDQLIDALPIKNAKAPFVYRLMQILIHSGFFIEAKIPG  61

Query  526  ------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQPWNHAREWFQNDDPAPFD  365
                    Y L   S LLLK NPFS+ PFLL ++D P L T PW+H  +WFQN D  PF 
Sbjct  62   NENDNQKGYLLTSASELLLKSNPFSMTPFLLAILD-PTL-TDPWHHLSQWFQNSDETPFY  119

Query  364  TAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGVFEGLNSLVDVAGGTGTV  185
            T HG +I+ +A H+P  N  FNEAMASDTRLV  VV K CK VFEGLNSLVDV GGTGT 
Sbjct  120  TCHGRSIYAFASHEPWLNQFFNEAMASDTRLVSRVVTKDCKHVFEGLNSLVDVGGGTGTF  179

Query  184  ARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSIPHANALFLKWILHDWNDE  5
            A+ IA+AFP LKCTV DLPHV+ GLE +KNL YVGG+MF +IP A+A+ +KWIL DW+D+
Sbjct  180  AKAIADAFPRLKCTVLDLPHVVDGLESSKNLAYVGGNMFEAIPPADAVLMKWILIDWSDD  239

Query  4    D  2
            +
Sbjct  240  E  240



>ref|XP_003615966.1| O-methyltransferase [Medicago truncatula]
 gb|AES98924.1| orcinol O-methyltransferase [Medicago truncatula]
Length=360

 Score =   294 bits (753),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/258 (53%), Positives = 188/258 (73%), Gaps = 9/258 (3%)
 Frame = -2

Query  754  LLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHLA  575
            LL +Q+HIWN+IF++I S SLKC V+LGIPDIIH +G+PI+L +L   +PI+ +K   + 
Sbjct  14   LLKAQSHIWNHIFNFINSMSLKCVVDLGIPDIIHNYGKPISLSKLISLLPIHPSKTCFIH  73

Query  574  RLMRTLIHSGFFFH-------TKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQP  416
            RLMR + HS FF          +  Y L   S LLLKDNP S+ PF+  ++D P+L T P
Sbjct  74   RLMRIMTHSSFFSQYNVTENELEIEYMLTDASILLLKDNPMSVTPFVHAMLD-PVL-TNP  131

Query  415  WNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGV  236
            W+    W +NDDP  F+T H M +W+Y     +F+++FNE+MASDTRLV N++I+ C+GV
Sbjct  132  WHQFSTWLKNDDPTTFETTHRMLLWEYVACDSKFSNLFNESMASDTRLVTNLLIEKCRGV  191

Query  235  FEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSIP  56
            F GL SLVDV GGTGT+A+ +A++FP ++ +VFDLPHV+ GL+G++NL+YVGGDMF  IP
Sbjct  192  FNGLESLVDVGGGTGTMAKALAKSFPQMEFSVFDLPHVVDGLQGSENLNYVGGDMFKEIP  251

Query  55   HANALFLKWILHDWNDED  2
              +A+ LKWILHDWNDE+
Sbjct  252  PTDAILLKWILHDWNDEE  269



>ref|XP_006388414.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP47328.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=354

 Score =   293 bits (749),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/255 (55%), Positives = 189/255 (74%), Gaps = 5/255 (2%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +QTH+WN+IF +I S +LKCAV+LGIPD+I KHG+P+TL EL  A+PI+ +KA ++
Sbjct  11   ELLQAQTHVWNHIFCFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSKAQYV  70

Query  577  ARLMRTLIHSGFFFH---TKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQPWNH  407
             RLMR L+HSGFF      ++AY+L Q + LLLKDNP S+R   L L+    ++T+P + 
Sbjct  71   HRLMRILVHSGFFSQQNLNQEAYSLTQSTRLLLKDNPLSMR--PLLLMLLDPVLTKPHDC  128

Query  406  AREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGVFEG  227
               WFQND+   F  AH  T+W+YAG  P  +++FNEAMASD+ L   +V+  CKG+F+G
Sbjct  129  LSTWFQNDEATAFSVAHERTLWEYAGQDPRLSNLFNEAMASDSILASKLVLSQCKGIFDG  188

Query  226  LNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSIPHAN  47
            ++SLVDV GG+GT+A+ IAEAFP + CTVFDLP V+  L+G KNL YVGGDMF ++P A+
Sbjct  189  VDSLVDVGGGSGTMAKGIAEAFPHMDCTVFDLPRVVSDLQGRKNLKYVGGDMFEAVPPAD  248

Query  46   ALFLKWILHDWNDED  2
             + LKW LHDW+DED
Sbjct  249  VILLKWTLHDWSDED  263



>emb|CAA11131.1| O-methyltransferase [Prunus dulcis]
Length=356

 Score =   293 bits (749),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/258 (54%), Positives = 180/258 (70%), Gaps = 9/258 (3%)
 Frame = -2

Query  754  LLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHLA  575
            LL +Q HIWN IFS+I   SLKCAV+LGIPDII KHG P++L +L  A+PI+  K+  + 
Sbjct  12   LLQAQAHIWNCIFSFINPMSLKCAVQLGIPDIIKKHGNPMSLSDLISALPIHPKKSNCVY  71

Query  574  RLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQP  416
            RLMR L+HSGFF   K       + Y L   S LLLKD+P S RPFLL  +D    +T+P
Sbjct  72   RLMRILVHSGFFCRQKLSELDEEEGYVLTDASRLLLKDDPLSARPFLLGALDP--FMTKP  129

Query  415  WNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGV  236
            W++   WFQNDDP    TAHG T WD+   +P  +H+FN+AMASD RL+  VV    KGV
Sbjct  130  WHYFSTWFQNDDPTACVTAHGTTFWDFGCLEPSLSHIFNDAMASDARLISKVVSNEYKGV  189

Query  235  FEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSIP  56
            FEGL SLVDV GG GT+ + IA+ FP ++C VFDLPHV+  L+G++NL + GGDMF +IP
Sbjct  190  FEGLESLVDVGGGIGTMPKAIADVFPHVECIVFDLPHVVADLKGSENLKFFGGDMFEAIP  249

Query  55   HANALFLKWILHDWNDED  2
              +A+ +KWILHDW+DE+
Sbjct  250  PTDAILMKWILHDWSDEE  267



>ref|XP_003615973.1| O-methyltransferase [Medicago truncatula]
 gb|AES98931.1| orcinol O-methyltransferase [Medicago truncatula]
Length=363

 Score =   293 bits (749),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 134/258 (52%), Positives = 186/258 (72%), Gaps = 9/258 (3%)
 Frame = -2

Query  754  LLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHLA  575
            LL +Q+H+WN+IF++I S SLKC V+LGIPDIIH HG+P+ + +L  ++PI+ +K   + 
Sbjct  14   LLKAQSHVWNHIFNFINSMSLKCVVDLGIPDIIHNHGKPMPISKLISSLPIHPSKKPCIH  73

Query  574  RLMRTLIHSGFFFHTKDA-------YALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQP  416
            RLMR + HSGFF     A       Y L   S LLLKDNP S+ PF+  ++D P+++  P
Sbjct  74   RLMRIMTHSGFFSQQNIAANEPEIEYMLTDASRLLLKDNPMSVTPFVYAMLD-PVMM-NP  131

Query  415  WNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGV  236
            W+    W +NDD   F+T HGM +W+YA    +FN++FNE+MA+D +LV N++++ CKGV
Sbjct  132  WHQFSMWLKNDDTTSFETTHGMLLWEYAACDSKFNNLFNESMANDAQLVSNLLVEKCKGV  191

Query  235  FEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSIP  56
            F    SLVDV GGTGT+A+T A++FP ++C VFDLPHV+ GL+G++NL YVGGDMF  IP
Sbjct  192  FNEFESLVDVGGGTGTMAKTFAKSFPQMECIVFDLPHVVDGLQGSENLSYVGGDMFKEIP  251

Query  55   HANALFLKWILHDWNDED  2
              +A+ LKWILHDWNDE+
Sbjct  252  PTDAILLKWILHDWNDEE  269



>emb|CAN70493.1| hypothetical protein VITISV_002330 [Vitis vinifera]
Length=363

 Score =   293 bits (749),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 148/269 (55%), Positives = 182/269 (68%), Gaps = 15/269 (6%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G +  ELL +QTH+WN+IF++I S SLKCA++LGIPDIIH H +P+TL EL   +P+   
Sbjct  6    GGRSSELLQAQTHVWNHIFNFINSMSLKCAIQLGIPDIIHNHCQPMTLHELVAKLPVRPN  65

Query  592  KAGHLARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNP  434
            K   + RLMR L+HSGFF   +       + Y LA  S LLLKD+P S  PFLL ++D  
Sbjct  66   KTLCVHRLMRILVHSGFFTMQRVQESADEEGYXLANASRLLLKDHPLSATPFLLAMLDPD  125

Query  433  ILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVI  254
            +  T+PW++   WFQNDDP PF TAHG TIWDY  H+P FN+ FNEAMASD RLV +V+I
Sbjct  126  L--TEPWHYVSAWFQNDDPTPFFTAHGRTIWDYGCHEPRFNNFFNEAMASDARLVTSVLI  183

Query  253  KYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLD-----  89
            K CKG FEGLNS VDV GGTGTVA+TI  AFP L  TV DLPHV+  L+G K LD     
Sbjct  184  KECKGAFEGLNSFVDVGGGTGTVAKTIVXAFPHLHSTVLDLPHVVADLQGXKXLDLPRRG  243

Query  88   YVGGDMFVSIPHANALFLKWILHDWNDED  2
            YV G+      H      +WILHDW+DE+
Sbjct  244  YVRGNSSCGC-HFTEGITQWILHDWSDEE  271



>ref|XP_002522501.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF39801.1| o-methyltransferase, putative [Ricinus communis]
Length=359

 Score =   292 bits (748),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 148/261 (57%), Positives = 186/261 (71%), Gaps = 12/261 (5%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +Q H++N+IF+YI S  LKCAV+LGIPDIIHKHG+PITL EL  A+ I+  K   +
Sbjct  11   ELLQAQLHVYNHIFNYINSMCLKCAVQLGIPDIIHKHGKPITLPELVSALHIHPTKINFM  70

Query  577  ARLMRTLIHSGFFFHTKDA---------YALAQPSTLLLKDNPFSLRPFLLFLVDNPILI  425
             RLMR L+HSGFF  TK A         Y L   S LL+KDNP  L+PF+  L+  P  +
Sbjct  71   YRLMRMLVHSGFFSITKAANGQEEGQEVYVLTPSSKLLVKDNPNCLKPFVDSLL-KPDFV  129

Query  424  TQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYC  245
            T P +   +WF+ ++   F  AHGM  W+Y    PEFN +FNEAMASD+R+ MN+VI+ C
Sbjct  130  T-PGHVLGDWFRGNELTVFQRAHGMAFWEYNERNPEFNQLFNEAMASDSRM-MNLVIRDC  187

Query  244  KGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFV  65
            K +FEG+NSLVDV GG G++AR I+EAFPD+KCTV +LP VI  LEGTKNL+YVGGDMF 
Sbjct  188  KPIFEGVNSLVDVGGGNGSLARIISEAFPDMKCTVLELPQVIGNLEGTKNLNYVGGDMFQ  247

Query  64   SIPHANALFLKWILHDWNDED  2
             IP A+A+ LK ILH WNDE+
Sbjct  248  HIPSADAIILKLILHGWNDEE  268



>ref|XP_011037440.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
 ref|XP_011037441.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=355

 Score =   292 bits (747),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/256 (56%), Positives = 193/256 (75%), Gaps = 6/256 (2%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +QTH+WN+IF++I S +LKCAV+LGIPD+I KHG+P+TL EL  A+PI+ +KA ++
Sbjct  11   ELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSKAQYV  70

Query  577  ARLMRTLIHSGFFFH---TKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQPWNH  407
             RLMR L+H+GFF      ++AY+L Q + LLLKDNP S+RP LL L+    ++T+P + 
Sbjct  71   HRLMRILVHAGFFSQQNLNQEAYSLTQSTRLLLKDNPLSMRPLLLMLL--DPVLTKPHDC  128

Query  406  AREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGVFEG  227
               WFQND+   F  AH  T+W+YAG  P  +++FNEAMASD+ L   +V+  C+G+FEG
Sbjct  129  LSTWFQNDEATAFSVAHERTLWEYAGQDPRLSNLFNEAMASDSILASKLVVSKCQGIFEG  188

Query  226  LNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLE-GTKNLDYVGGDMFVSIPHA  50
            +NSLVDV GG+GT+A+ IAEAFP + CTVFDLP V+  L+ G+KNL YVGGDMF ++P A
Sbjct  189  VNSLVDVGGGSGTMAKGIAEAFPHMDCTVFDLPRVVSDLQAGSKNLKYVGGDMFEAVPPA  248

Query  49   NALFLKWILHDWNDED  2
            + + LKW LHDWNDED
Sbjct  249  DVILLKWTLHDWNDED  264



>gb|AES89720.2| orcinol O-methyltransferase [Medicago truncatula]
Length=355

 Score =   292 bits (747),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/261 (54%), Positives = 191/261 (73%), Gaps = 7/261 (3%)
 Frame = -2

Query  769  DQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAK  590
            D   +LL +QT ++N+IFS+I S SLKCA+EL IPD+IH +G+PI L +L   +PI+ +K
Sbjct  7    DHVAKLLQAQTQVFNHIFSFINSMSLKCAIELCIPDVIHNYGQPIPLSKLISLLPIHPSK  66

Query  589  AGHLARLMRTLIHSGFFFHTKD----AYALAQPSTLLLKDNPFSLRPFLLFLVDNPILIT  422
             G + RLMR L HSGFF  +K+     Y L   S LLLKD+PFS+   LL ++  PIL +
Sbjct  67   TGDIHRLMRVLTHSGFFNVSKNDLEVMYELNDASRLLLKDHPFSMTS-LLHVILGPIL-S  124

Query  421  QPWNHAREWFQNDDPAPFDTAH-GMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYC  245
            +PW     W++NDDP+PF T + G+  WDYAGH P  N++FNEAMA +TRL  +VV+  C
Sbjct  125  KPWYQLSNWYKNDDPSPFHTENNGVAFWDYAGHDPNHNNLFNEAMACETRLASSVVMGKC  184

Query  244  KGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFV  65
            KGVFEGL SLVDV GG GT+ + IA++FP+++C VFDLPHV+ GL+G++NL YVGGDMF 
Sbjct  185  KGVFEGLESLVDVGGGIGTITKVIAKSFPNIECIVFDLPHVVDGLQGSENLKYVGGDMFE  244

Query  64   SIPHANALFLKWILHDWNDED  2
            +IP  +++ LK +LHDWNDE+
Sbjct  245  AIPPTHSILLKGVLHDWNDEE  265



>ref|XP_011091580.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=358

 Score =   290 bits (743),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 137/260 (53%), Positives = 185/260 (71%), Gaps = 10/260 (4%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIP-INKAKAGH  581
            ELL ++  IWN +FSYI S SLKC  ELGIP II+KHGRP+TL EL +A+P +++AKA H
Sbjct  11   ELLEAEARIWNQVFSYINSMSLKCVTELGIPGIINKHGRPMTLTELMEALPGVDRAKADH  70

Query  580  LARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
            + RLMRT++HSGFF   K        Y L   S LL++D+P S++ FLL  +D+  ++ +
Sbjct  71   VRRLMRTVVHSGFFVLEKVDSSDEQGYWLTPASRLLMEDHPMSMKAFLLSQLDS--VLCE  128

Query  418  PWNHAREWFQN-DDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCK  242
            PW H   WF+N +D   F T HGM++W+     P F H+F++ M +DT +V +V+ + C+
Sbjct  129  PWQHLSGWFRNIEDRTAFHTTHGMSLWEQKEQNPRFGHLFDQGMGNDTPMVADVIARDCR  188

Query  241  GVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVS  62
             VFEGL SLVDV GGTGT+A+ IAEAFP++ CTV DL  ++ GLEGT+NL YV GDMF  
Sbjct  189  QVFEGLGSLVDVGGGTGTLAKAIAEAFPEIHCTVLDLAPIVAGLEGTRNLKYVEGDMFEY  248

Query  61   IPHANALFLKWILHDWNDED  2
            IP A+A+ LKWILHDW+DE+
Sbjct  249  IPPADAVLLKWILHDWSDEE  268



>gb|KHN08844.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=329

 Score =   287 bits (734),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 136/240 (57%), Positives = 176/240 (73%), Gaps = 10/240 (4%)
 Frame = -2

Query  697  SLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHLARLMRTLIHSGFFFHT----  530
            SLKC V+LGIPDIIH +G+P+ L  L  ++PI+ +K   + RLMR +IHSGFF       
Sbjct  2    SLKCVVDLGIPDIIHNYGQPMPLSNLIASLPIHPSKTCFVHRLMRIMIHSGFFSQQNHDL  61

Query  529  ----KDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQPWNHAREWFQNDDPAPFDT  362
                +  Y L   S LLLK++P S+ PFL  ++D P+L T PWN    WF+N DP PF+T
Sbjct  62   ENELEAKYVLTDASVLLLKNHPMSVTPFLHAMLD-PVL-TNPWNQFSTWFKNGDPTPFET  119

Query  361  AHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGVFEGLNSLVDVAGGTGTVA  182
            AHGM +WDYAG  P+ NH+FN+AMASD R V ++VI+ CKGVF GL SLVDV GGTGT+A
Sbjct  120  AHGMMLWDYAGADPKLNHLFNDAMASDARFVTSLVIEKCKGVFMGLESLVDVGGGTGTMA  179

Query  181  RTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSIPHANALFLKWILHDWNDED  2
            + IA++FP ++C VFDLPHV+ GL+G++NL YV GDMF +IP A+A+ LKWILHDWNDE+
Sbjct  180  KAIAKSFPRVECIVFDLPHVVSGLKGSENLKYVAGDMFEAIPPADAILLKWILHDWNDEE  239



>ref|XP_003607523.1| O-methyltransferase [Medicago truncatula]
Length=370

 Score =   288 bits (736),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/262 (54%), Positives = 191/262 (73%), Gaps = 8/262 (3%)
 Frame = -2

Query  769  DQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAK  590
            D   +LL +QT ++N+IFS+I S SLKCA+EL IPD+IH +G+PI L +L   +PI+ +K
Sbjct  21   DHVAKLLQAQTQVFNHIFSFINSMSLKCAIELCIPDVIHNYGQPIPLSKLISLLPIHPSK  80

Query  589  AGHLARLMRTLIHSGFFFHTKD----AYALAQPSTLLLKDNPFSLRPFLLFLVDNPILIT  422
             G + RLMR L HSGFF  +K+     Y L   S LLLKD+PFS+   LL ++  PIL +
Sbjct  81   TGDIHRLMRVLTHSGFFNVSKNDLEVMYELNDASRLLLKDHPFSMTS-LLHVILGPIL-S  138

Query  421  QPWNHAREWFQNDDPAPFDTAH-GMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYC  245
            +PW     W++NDDP+PF T + G+  WDYAGH P  N++FNEAMA +TRL  +VV+  C
Sbjct  139  KPWYQLSNWYKNDDPSPFHTENNGVAFWDYAGHDPNHNNLFNEAMACETRLASSVVMGKC  198

Query  244  KGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFV  65
            KGVFEGL SLVDV GG GT+ + IA++FP+++C VFDLPHV+ GL+G++NL YVGGDMF 
Sbjct  199  KGVFEGLESLVDVGGGIGTITKVIAKSFPNIECIVFDLPHVVDGLQGSENLKYVGGDMFE  258

Query  64   SIPHANALFLK-WILHDWNDED  2
            +IP  +++ LK  +LHDWNDE+
Sbjct  259  AIPPTHSILLKVGVLHDWNDEE  280



>ref|XP_003615967.1| O-methyltransferase [Medicago truncatula]
 gb|AES98925.1| orcinol O-methyltransferase [Medicago truncatula]
Length=359

 Score =   287 bits (735),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/269 (51%), Positives = 189/269 (70%), Gaps = 14/269 (5%)
 Frame = -2

Query  775  MGDQDIE-----LLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADA  611
            M  Q+IE     LL +Q+H+WN++F++I S SLKC V+LGIPDIIH +G+PI L +L  +
Sbjct  1    MESQNIEQVASNLLKAQSHVWNHMFNFINSMSLKCVVDLGIPDIIHNYGKPIPLSKLISS  60

Query  610  IPINKAKAGHLARLMRTLIHSGFFFHT-------KDAYALAQPSTLLLKDNPFSLRPFLL  452
            + I+ +K   + RLMR + HSGFF          +  Y L   S LLLKDNP S+ P++ 
Sbjct  61   LSIHPSKNHGIHRLMRIMTHSGFFSQKNVIGNELEIEYMLTDASKLLLKDNPMSVAPYVH  120

Query  451  FLVDNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRL  272
             +V NP+++  PW     W +NDD   F+T HGM+ W+YA    E N++FNE+MA+DTRL
Sbjct  121  AMV-NPVMMN-PWYQFSTWLKNDDTNTFETTHGMSTWEYAARDSEINNLFNESMANDTRL  178

Query  271  VMNVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNL  92
            V +++++ CKGVF  + SLVDV GGTGT+A+T+ ++FP ++C VFDLPHV+ GL+G++ L
Sbjct  179  VSDLLVEKCKGVFNEVESLVDVGGGTGTMAKTLVKSFPQMECIVFDLPHVVDGLQGSEKL  238

Query  91   DYVGGDMFVSIPHANALFLKWILHDWNDE  5
             YVGGDMF  IP A+A+ LKWILHDWNDE
Sbjct  239  RYVGGDMFKEIPPADAILLKWILHDWNDE  267



>ref|XP_002517832.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44350.1| o-methyltransferase, putative [Ricinus communis]
Length=362

 Score =   287 bits (735),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/259 (53%), Positives = 184/259 (71%), Gaps = 9/259 (3%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            EL+ +QTHIWN+ F +IKS SLKCAV+LGIPDII+ HG+P+TL EL   + ++  K  HL
Sbjct  11   ELIKAQTHIWNHTFHFIKSMSLKCAVQLGIPDIINSHGQPMTLSELVLTLQVHPTKTDHL  70

Query  577  ARLMRTLIHSGFFF-------HTKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
             RLMR L+HSGFF        H+++ Y L   S LLLKD  F  RPF+   +D P+  T+
Sbjct  71   YRLMRVLVHSGFFNLQNASDNHSQEGYILTPASRLLLKDCSFDTRPFISLALD-PV-ATE  128

Query  418  PWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKG  239
            P+N+   + +NDDP  F TA G T++ YAG++   NH+FNE MASD+ ++   VI  CK 
Sbjct  129  PYNYLIPFLRNDDPTAFVTAFGETLFGYAGNEARINHLFNECMASDSSVIGRAVIIKCKK  188

Query  238  VFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSI  59
            VFEG+NSLVDV GGTG +A+ I + FP+LKCTV DLPHV+  L+G+ NL ++GGDMF ++
Sbjct  189  VFEGVNSLVDVGGGTGNMAKAIGQTFPNLKCTVLDLPHVVDKLQGSNNLSFLGGDMFQAV  248

Query  58   PHANALFLKWILHDWNDED  2
            P A+A+ LKWILHDW DE+
Sbjct  249  PPADAILLKWILHDWPDEE  267



>gb|KDP24060.1| hypothetical protein JCGZ_25717 [Jatropha curcas]
Length=358

 Score =   287 bits (734),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/254 (56%), Positives = 184/254 (72%), Gaps = 4/254 (2%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKH-GRPITLLELADAIPINKAKAGH  581
            ELL +Q+HIW +   +IKS SLKCAVELG+P     H G+P+ L +L  A+ +N AK  H
Sbjct  11   ELLKAQSHIWTHSLQFIKSMSLKCAVELGVPVAFSTHHGQPMPLSDLVSALQVNPAKTHH  70

Query  580  LARLMRTLIHSGFFFHTKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQPWNHAR  401
            L RLMR L+HSGFF   +D Y L   S LLLKD P + RPF+  ++D PIL T+P+N   
Sbjct  71   LHRLMRILVHSGFFSLKEDGYLLTASSRLLLKDTPLNSRPFISLVLD-PIL-TEPYNCMS  128

Query  400  EWFQND-DPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGVFEGL  224
            +W ++D D  PF TA G ++W++AGH+   N++FNEAMASD+ L+   VI  CK VFEGL
Sbjct  129  KWLKDDHDQTPFVTAFGESLWEHAGHEIRVNNLFNEAMASDSFLISEAVIVKCKEVFEGL  188

Query  223  NSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSIPHANA  44
            +SLVDVAGGTG +A+ IA  FP+LKCTV DLPHV+ GL+G KNL+++ GDMF ++P A+A
Sbjct  189  DSLVDVAGGTGNMAKAIANTFPNLKCTVLDLPHVVAGLQGIKNLNFLAGDMFEAVPPADA  248

Query  43   LFLKWILHDWNDED  2
            + LKWILHDW DED
Sbjct  249  VLLKWILHDWTDED  262



>emb|CAN69556.1| hypothetical protein VITISV_027590 [Vitis vinifera]
Length=323

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/257 (54%), Positives = 178/257 (69%), Gaps = 29/257 (11%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G+   ELL++Q H+WN+I ++IKS SLKCA++LGIPDIIH HG+P+TL E  +       
Sbjct  6    GEISAELLHAQAHVWNHILNFIKSVSLKCAIQLGIPDIIHNHGKPMTLPEAGE-------  58

Query  592  KAGHLARLMRTLIHSGFFFHTKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQPW  413
                                 ++ Y L   S LLL D+  S+RP LL ++D PIL T+PW
Sbjct  59   --------------------EEEGYVLTDASRLLLMDDSLSIRPLLLAMLD-PIL-TKPW  96

Query  412  NHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGVF  233
            ++   WFQNDDP PF TAH    WDYAGH+P+ N+ FNEAMASD RLV +V++K  KGVF
Sbjct  97   HYLSAWFQNDDPTPFHTAHERPFWDYAGHEPQLNNFFNEAMASDARLVTSVLLKEGKGVF  156

Query  232  EGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSIPH  53
            EGLNSLVDV GGTG VA+ IA AFP L CTV DLPHV+ GL+G+KNL+Y  GD+F +IP 
Sbjct  157  EGLNSLVDVGGGTGQVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDIFEAIPP  216

Query  52   ANALFLKWILHDWNDED  2
            A+A+ LKWILHDW+DE+
Sbjct  217  ADAILLKWILHDWSDEE  233



>ref|XP_003633245.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   285 bits (729),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 137/264 (52%), Positives = 182/264 (69%), Gaps = 10/264 (4%)
 Frame = -2

Query  769  DQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAK  590
            ++  ELL +Q H W +  +++ S  LKCA++LGIPD+IH HG+P+ L +L  A+ +   K
Sbjct  8    ERATELLQAQVHTWKHTTNFVNSMVLKCAIQLGIPDVIHSHGQPMALSQLITALSLEPTK  67

Query  589  AGHLARLMRTLIHSGFFFHTK--------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNP  434
            A  L RLMR L+HSGFF   K        + Y+L   S  LLKD P S  PFLL  +D P
Sbjct  68   APCLYRLMRVLVHSGFFAQQKLLHNSEEEEGYSLTFASQFLLKDEPVSGVPFLLLQLD-P  126

Query  433  ILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVI  254
            IL T PW+   +WFQN+DP PF TAH  + WDYA H+P+ N +FNE M SD+RL+ N+++
Sbjct  127  IL-TAPWHFLGDWFQNEDPTPFHTAHRKSFWDYAVHEPKLNDIFNETMVSDSRLIANMIV  185

Query  253  KYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGD  74
            +  K VFEGL SLVDV GGTGT+ + IA+AFP LKC VFD PHV+  LE  +NL+ VGG+
Sbjct  186  RQYKEVFEGLASLVDVGGGTGTMVKAIAKAFPQLKCIVFDQPHVVANLEVGENLEIVGGN  245

Query  73   MFVSIPHANALFLKWILHDWNDED  2
            +F +IP A+A+ LKWILHDW+DE+
Sbjct  246  IFEAIPPADAILLKWILHDWSDEE  269



>ref|XP_011070200.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=458

 Score =   288 bits (737),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 139/277 (50%), Positives = 189/277 (68%), Gaps = 11/277 (4%)
 Frame = -2

Query  805  LKFKMAQLPSMGDQ-DIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITL  629
            L F++  + ++  +   ELL +  HIWN +FSYI S SLKC  ELGIP+IIHKHGRP+TL
Sbjct  94   LTFELRDMGTIKQEPSSELLEAGAHIWNQVFSYINSMSLKCVTELGIPEIIHKHGRPMTL  153

Query  628  LELADAIP-INKAKAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFS  470
             +L +A+P +++AKA H+ RLMRT++HSGFF   K        Y L   S LL++D+P S
Sbjct  154  TQLMEALPGVDRAKADHVRRLMRTVVHSGFFVLEKVDSSDEQGYWLTPASRLLMEDHPMS  213

Query  469  LRPFLLFLVDNPILITQPWNHAREWFQN-DDPAPFDTAHGMTIWDYAGHQPEFNHMFNEA  293
            ++ F+L  + +  ++ +PW H   WF+N +D   F T HGM++W+     P F H+F+  
Sbjct  214  MKAFVLSQLGS--VLCEPWQHLSGWFRNTEDRTSFHTTHGMSLWELKEQNPSFGHLFDRG  271

Query  292  MASDTRLVMNVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRG  113
            M +D  +V +V+ + C+ VFEGL SLVDV GGTGTVA+ IAE FP + CTV DL  VI G
Sbjct  272  MENDATIVADVITRDCRQVFEGLGSLVDVGGGTGTVAKAIAEVFPQIHCTVLDLAPVIAG  331

Query  112  LEGTKNLDYVGGDMFVSIPHANALFLKWILHDWNDED  2
            LEGT+NL YV GDMF  IP A+A+ LKW+LHDWNDE+
Sbjct  332  LEGTRNLKYVEGDMFEYIPPADAVLLKWLLHDWNDEE  368



>ref|XP_011091583.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score =   285 bits (728),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/263 (53%), Positives = 193/263 (73%), Gaps = 11/263 (4%)
 Frame = -2

Query  766  QDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIP-INKAK  590
            Q +ELL ++ HIWN++F+YI S+SLKCA ELGIPD+IHKHG P+TLLEL DA+P ++KAK
Sbjct  8    QSLELLEAEAHIWNHVFNYINSTSLKCATELGIPDVIHKHGGPMTLLELVDALPGVDKAK  67

Query  589  AGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPIL  428
            A  + RLMR L+HSGFF   K      +AY+L   S LL+ D P S++P+++  +D PIL
Sbjct  68   ADCMYRLMRILVHSGFFVLEKINSSNEEAYSLTPASRLLVGDLPMSMKPYVISQID-PIL  126

Query  427  ITQPWNHAREWFQN-DDPAPFDTAH-GMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVI  254
            + +P +H   WFQN ++  PF T + GM+ W+       F+H+F++ +ASDT +V +V+ 
Sbjct  127  V-EPMHHLSRWFQNANNHTPFQTINNGMSFWEQKERNLRFSHLFDQGVASDTPMVAHVIT  185

Query  253  KYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGD  74
            + C+ VFEGL+SLVDV GGTGT+A+ IAEAFP + CTV DL  V+ G++GTKNL Y+ G+
Sbjct  186  RDCRQVFEGLDSLVDVGGGTGTLAKAIAEAFPQIHCTVLDLAPVVAGMDGTKNLKYIEGN  245

Query  73   MFVSIPHANALFLKWILHDWNDE  5
            MF  IP ++A+ LKWILHDW+DE
Sbjct  246  MFEYIPPSDAVLLKWILHDWSDE  268



>ref|XP_006469069.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=353

 Score =   284 bits (726),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/254 (54%), Positives = 174/254 (69%), Gaps = 4/254 (2%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +Q  +WN  F+Y+ S SLKCAVELGI DIIH HG+P TL ++A A+ I   K   +
Sbjct  12   ELLKAQAQVWNCTFNYVNSMSLKCAVELGIADIIHSHGQPTTLSQIASALNIKPNKVECI  71

Query  577  ARLMRTLIHSGFFFHTKD-AYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQPWNHAR  401
              +MR L+HSGFF   KD  Y L   S LLLKD P    PF+  + D   L T  ++   
Sbjct  72   QSVMRILVHSGFFAQQKDDEYFLTPASRLLLKDTPLKAAPFVDLVADP--LYTTAFHCLG  129

Query  400  EWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGVFEGLN  221
             W QNDDP  F+TAHG  +WD    +P+F  +F + M +D+ L+  +VIK CK VFEGL 
Sbjct  130  TWLQNDDPTLFETAHGKKVWDRVADEPKFKSLFYDLMITDSELIAGIVIKDCKEVFEGLK  189

Query  220  SLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTK-NLDYVGGDMFVSIPHANA  44
            SLVDVAGGTG +AR IA AFPD+KCTVFDLPHV+  L+GT  NLD++GG+MF +IP ANA
Sbjct  190  SLVDVAGGTGIMARAIATAFPDIKCTVFDLPHVVDNLQGTNDNLDFLGGNMFEAIPQANA  249

Query  43   LFLKWILHDWNDED  2
            + LKWILH+WNDE+
Sbjct  250  VLLKWILHNWNDEE  263



>gb|AAR09603.1| O-methyltransferase [Mentha x piperita]
Length=361

 Score =   284 bits (726),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/269 (51%), Positives = 193/269 (72%), Gaps = 10/269 (4%)
 Frame = -2

Query  784  LPSMGDQDIE-LLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAI  608
            LP++ +  +E LL+++ H+WN+IFSYI S SLK A++LGIPDIIHKHG PITL +LADA+
Sbjct  3    LPNLEESTVEELLDAEAHVWNHIFSYINSMSLKSALQLGIPDIIHKHGNPITLSQLADAL  62

Query  607  PINKAKAGHLARLMRTLIHSGFF-------FHTKDAYALAQPSTLLLKDNPFSLRPFLLF  449
             INKAK   L RLMR L HS FF          ++AY+L + S LLL+D P SL P++  
Sbjct  63   NINKAKTDGLFRLMRLLEHSKFFDKVKVEGEGEEEAYSLTRASRLLLRDEPSSLAPYIRA  122

Query  448  LVDNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLV  269
            ++D   +   P++H  EW  ++ P+PF+  HG ++W+YAG +  +N +FN+AMA+D +LV
Sbjct  123  MLDPNFM--DPFHHLSEWLGSECPSPFEFKHGRSLWEYAGIEERWNQLFNQAMANDAKLV  180

Query  268  MNVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLD  89
             ++++K C+ +F+GL SLVDV GG GTVA+ +A+AFP LK  V DLPHV+  L  ++NL 
Sbjct  181  TSILVKECRHIFQGLESLVDVGGGAGTVAKVVADAFPGLKAVVLDLPHVVADLATSENLR  240

Query  88   YVGGDMFVSIPHANALFLKWILHDWNDED  2
            YV GDMF  IP A+A+ LKWILH+W+DE+
Sbjct  241  YVSGDMFEDIPRADAVLLKWILHNWSDEE  269



>ref|XP_011092041.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=355

 Score =   283 bits (724),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/264 (52%), Positives = 189/264 (72%), Gaps = 11/264 (4%)
 Frame = -2

Query  766  QDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIP-INKAK  590
            Q++E+L ++ HIWN +F+YI S+SLKCA ELGIPD+IHKHG P+TL EL DA+P ++KAK
Sbjct  8    QNLEVLEAEAHIWNQVFNYINSTSLKCATELGIPDVIHKHGGPMTLTELLDALPAVDKAK  67

Query  589  AGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPIL  428
            A  + RLMRTL+HSGFF   K      + Y+L     LL+ D P S++PF++  +D PIL
Sbjct  68   ANCMYRLMRTLVHSGFFVLEKLNSSNEEGYSLTPAPRLLVGDRPMSMKPFVISQID-PIL  126

Query  427  ITQPWNHAREWFQND-DPAPFDTAH-GMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVI  254
             T+  +H   WFQ   D   F TA+ G + W+     P F+H+F++ M SDT +V +V+ 
Sbjct  127  -TESMHHLGRWFQTTHDRTTFHTANNGTSFWEQKERNPRFSHLFDQGMESDTPMVASVIT  185

Query  253  KYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGD  74
            + C+ VFEGL+S+VDV GGTGT+A+ IAEAFP + CTV DLPH++ GLEG +NL Y+ G+
Sbjct  186  RDCRQVFEGLDSVVDVGGGTGTLAKAIAEAFPQIHCTVLDLPHIVAGLEGRRNLKYIEGN  245

Query  73   MFVSIPHANALFLKWILHDWNDED  2
            MF  IP ++A+ LKW+LHDW+DE+
Sbjct  246  MFDYIPPSDAVVLKWLLHDWSDEE  269



>gb|KDP24062.1| hypothetical protein JCGZ_25719 [Jatropha curcas]
Length=358

 Score =   283 bits (724),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 140/264 (53%), Positives = 184/264 (70%), Gaps = 9/264 (3%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G+   ELL +  HIWN+ F+++KS SLKCA+ELGIPDIIH HG+P+TL +L  A+ I ++
Sbjct  6    GESTNELLRAHAHIWNHTFNFVKSMSLKCAIELGIPDIIHSHGQPMTLSDLVSALKIPQS  65

Query  592  KAGHLARLMRTLIHSGFFFHTK----DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILI  425
            K+ H+ RLM+ L+ SGFF   K    + Y L Q S LL+K++P + RP++L ++D PIL 
Sbjct  66   KSHHIHRLMQVLVQSGFFSLQKVSDENGYLLTQSSLLLVKEHPVTARPYVLAVLD-PIL-  123

Query  424  TQPWNHAREWFQNDD---PAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVI  254
            T+PW+    WFQN D     PF  AH    WD A ++  FN  FNEAMASD+ +V  VVI
Sbjct  124  TKPWHFLSSWFQNTDDKETTPFSVAHEQKFWDLASNEDRFNKFFNEAMASDSSIVKQVVI  183

Query  253  KYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGD  74
              CK VF+GL SLVDV G TG + + IAE FP+LKCTV DLPHV+ GL+GTKNL+Y+GG+
Sbjct  184  SNCKEVFKGLKSLVDVGGNTGAMTKAIAETFPNLKCTVLDLPHVVAGLKGTKNLNYIGGN  243

Query  73   MFVSIPHANALFLKWILHDWNDED  2
            MF  IP A+A+ LK I H  +DED
Sbjct  244  MFEFIPPADAILLKMICHILDDED  267



>ref|XP_003527405.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
1 [Glycine max]
 gb|KHN07776.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=359

 Score =   283 bits (724),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 136/266 (51%), Positives = 188/266 (71%), Gaps = 12/266 (5%)
 Frame = -2

Query  769  DQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAK  590
            D   +LL +QTHI++  F +I S SLKCA++L IPD+IHK+G+P+ L +L  ++PI+ +K
Sbjct  7    DHYAKLLRAQTHIFDQTFGFINSMSLKCAIDLCIPDVIHKYGQPMPLSQLIASLPIHPSK  66

Query  589  AGHLARLMRTLIHSGFFFHTKDA----------YALAQPSTLLLKDNPFSLRPFLLFLVD  440
            A  + RLM+ L HSGFF    +A          Y L   S LLLKD+ FS+      ++D
Sbjct  67   ACFIFRLMQILTHSGFFSQHNNATENYEQEEVSYVLTDASKLLLKDHHFSMISLPQVILD  126

Query  439  NPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNV  260
             PIL+  PW     WF N+DP PF T +GM  WDYA  +P+ NH+FN+AM +D+RL+ +V
Sbjct  127  -PILVN-PWFQFSTWFTNEDPTPFHTQNGMAFWDYASSEPKLNHLFNDAMTNDSRLISSV  184

Query  259  VIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVG  80
            +I+ CKGVF GL SLVDV GGTGT+A+ IA++FP LKC VFDLPHV+ GL+GT+N++YV 
Sbjct  185  LIEKCKGVFSGLESLVDVGGGTGTMAKAIAKSFPQLKCIVFDLPHVVDGLQGTENVEYVH  244

Query  79   GDMFVSIPHANALFLKWILHDWNDED  2
            GDMF +IP A+++ LK I+H+WNDE+
Sbjct  245  GDMFEAIPSADSIMLKTIMHNWNDEE  270



>ref|XP_011085377.1| PREDICTED: chavicol O-methyltransferase-like [Sesamum indicum]
Length=368

 Score =   283 bits (723),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 133/260 (51%), Positives = 185/260 (71%), Gaps = 10/260 (4%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            +LL+ Q H+WN++FS+I S SLKCA+ELGIPDIIH H +P++L +L DA+PI K K+  +
Sbjct  23   QLLDGQAHVWNHLFSFINSMSLKCAIELGIPDIIHNHAKPMSLSQLVDALPIPKVKSHFV  82

Query  577  ARLMRTLIHSGFFFHT-------KDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
             RLMR LIHS FF          K+ Y L   S LLL++ P S+ P +  ++D  +  T+
Sbjct  83   YRLMRLLIHSEFFVKVDVSDEEEKEHYWLTPASLLLLRNAPLSVAPLVQLILDPNM--TE  140

Query  418  PWNHAREWFQNDD-PAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCK  242
            P +H  EW  +    +P++  HG  ++++ G QP  N+++N+A +SD+RL+ +V+++ CK
Sbjct  141  PLDHLSEWLASQRHTSPYELVHGKVLFEHLGLQPGLNNLYNDATSSDSRLLTHVLVRDCK  200

Query  241  GVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVS  62
             +FEG+ SLVDV GGTGT A+ IA+AFPD+KC V DLPHV+ GLEGT N  YV GDMF +
Sbjct  201  QIFEGIKSLVDVGGGTGTTAKAIADAFPDMKCIVLDLPHVVGGLEGTNNFTYVAGDMFEN  260

Query  61   IPHANALFLKWILHDWNDED  2
            IP A+A+FLKWILHDWNDED
Sbjct  261  IPSADAVFLKWILHDWNDED  280



>ref|XP_002517833.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44351.1| o-methyltransferase, putative [Ricinus communis]
Length=372

 Score =   283 bits (724),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 140/275 (51%), Positives = 190/275 (69%), Gaps = 10/275 (4%)
 Frame = -2

Query  802  KFKMAQLPSMGDQDI-ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLL  626
            K K  Q+  + +++I EL+ +QTHIWN  F +IKS SLKCAV+LGIPDII+ HG+P+TL 
Sbjct  10   KIKNNQMELVNEENIDELIKAQTHIWNETFHFIKSMSLKCAVQLGIPDIINSHGQPMTLS  69

Query  625  ELADAIPINKAKAGHLARLMRTLIHSGFFF-------HTKDAYALAQPSTLLLKDNPFSL  467
            EL  A+ +   K  HL RLMR L+ SGFF        ++++ Y L   S LLL+++ F  
Sbjct  70   ELVLALQVRPTKTHHLYRLMRVLVRSGFFNLQNASDNYSQEGYILTPASRLLLQNSSFDT  129

Query  466  RPFLLFLVDNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMA  287
            RPF+  ++D PI IT+P+N    + +NDD  PF TA   T+W  AG++   NH+ N+ MA
Sbjct  130  RPFISLVLD-PI-ITEPYNSLTSFLRNDDLTPFVTAFKDTLWGCAGNEARINHLVNDCMA  187

Query  286  SDTRLVMNVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLE  107
            SD+ ++   VI  CK VFEGLNSLVDV GGTG +A+ IA+ FP+LKCTV DLPHV+  L+
Sbjct  188  SDSSVIGRAVIIKCKEVFEGLNSLVDVGGGTGNMAKAIAQTFPNLKCTVLDLPHVVDKLQ  247

Query  106  GTKNLDYVGGDMFVSIPHANALFLKWILHDWNDED  2
            G  NL ++GGDMF ++P A+A+ LKWILHDW DE+
Sbjct  248  GINNLSFLGGDMFQAVPPADAILLKWILHDWPDEE  282



>ref|XP_002278149.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   282 bits (722),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 141/264 (53%), Positives = 184/264 (70%), Gaps = 9/264 (3%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G +   LL +Q H+WN+  +++ S +LKCAV LGIPD I+ HG+PITL EL  A+ IN  
Sbjct  6    GKRASLLLQAQAHVWNHTMNFVNSMALKCAVRLGIPDAINNHGQPITLSELVTALSINPI  65

Query  592  KAGHLARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNP  434
            KA  L RLMR L+HSGFF   +         Y+L   S  LLKD P S  P LL  VD P
Sbjct  66   KAPCLHRLMRVLVHSGFFAQQQADHNEQEQLYSLTYASRFLLKDEPTSGAPLLLVQVD-P  124

Query  433  ILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVI  254
             L T P +   +WF+N DP PF TA+G   WDYA H+P+FN+ FNEAMASD++L+ +VV+
Sbjct  125  HL-TNPCHFLSDWFRNSDPTPFVTAYGKPFWDYAAHEPKFNNFFNEAMASDSQLIASVVV  183

Query  253  KYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGD  74
              CK VF GL+SL+DV GGTGT+A+ IA+AFP LKCTVFD PHV+  L+G +NL++VGGD
Sbjct  184  GECKEVFRGLSSLIDVGGGTGTMAKVIAKAFPHLKCTVFDQPHVVANLQGGENLEFVGGD  243

Query  73   MFVSIPHANALFLKWILHDWNDED  2
            +F +IP A+A+ LK ILH+W+D +
Sbjct  244  IFEAIPPADAILLKSILHNWSDGE  267



>gb|AEN94899.1| desoxyhemigossypol-6-O-methyltransferase [Gossypium barbadense]
Length=365

 Score =   283 bits (723),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 136/264 (52%), Positives = 183/264 (69%), Gaps = 10/264 (4%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPI-NK  596
            G+  IE L SQ HIW + F+++   SLKCA++LGI DIIH HG+P+T+ +L  A+ I N 
Sbjct  8    GEDAIEALQSQAHIWRHAFNFVSFMSLKCALDLGILDIIHDHGKPMTITQLVAALQILNP  67

Query  595  AKAGHLARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
             KA  + RLMR L+HS FF   K       + Y L   S +LLK+NPF + P L   +D 
Sbjct  68   TKACDIYRLMRILVHSDFFARQKLDNDAQEEGYVLTNSSRILLKNNPFCITPTLKATMD-  126

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            PI IT+PW+    WFQNDD  PF TA+G T+WDY  H P+   + N+ +ASD++LV +V+
Sbjct  127  PI-ITKPWSFLGTWFQNDDHTPFATAYGKTLWDYFTHDPQLKDLINDGLASDSQLVTSVL  185

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            +  CKG FEGL+SLVDV GGTGT A+ IA+ FP ++CTVFDLP+++ GL+G+KNL YVGG
Sbjct  186  VDKCKGAFEGLDSLVDVGGGTGTTAKAIADTFPLMECTVFDLPNIVAGLQGSKNLKYVGG  245

Query  76   DMFVSIPHANALFLKWILHDWNDE  5
            +MF + P  +A+ LK +LHDWNDE
Sbjct  246  NMFEAFPTGDAILLKKVLHDWNDE  269



>ref|XP_006474725.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=365

 Score =   283 bits (723),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 143/263 (54%), Positives = 179/263 (68%), Gaps = 13/263 (5%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL SQ H+WNNIFS++ S SLKCA++LGIPDIIH H +P+TL +L  A+ I+  K   +
Sbjct  15   ELLQSQAHVWNNIFSFVNSMSLKCAIQLGIPDIIHNHAKPMTLNQLLTALQIHPTKTQCV  74

Query  577  ARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
             RLMR L+HSGFF   K       + Y L   S LLLKD+P SL PFLL ++D PIL T+
Sbjct  75   YRLMRILVHSGFFALQKTSENEQEEGYILTSASKLLLKDHPLSLAPFLLAMLD-PIL-TK  132

Query  418  PWNHAREWFQNDDPAP----FDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIK  251
            PW+    W QNDD       F   HGM  WDYA  +   NH FNE MASDTRL  + +I 
Sbjct  133  PWHQVSTWIQNDDDDDAATTFALPHGMNFWDYAVRETRLNHFFNEGMASDTRLTSSALIH  192

Query  250  YCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDM  71
             CK VFEGLN+LVDV GGTGT+A  IA+ FP ++CTVFD PHV+  L+   NL YVGG+M
Sbjct  193  KCKDVFEGLNTLVDVGGGTGTLASAIAKKFPHIECTVFDQPHVVADLKSNGNLKYVGGNM  252

Query  70   FVSIPHANALFLKWILHDWNDED  2
            F +IP A+A+ +K +LH+WNDE+
Sbjct  253  FEAIPPADAVLIKCVLHNWNDEE  275



>ref|XP_010040912.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW44790.1| hypothetical protein EUGRSUZ_L01646 [Eucalyptus grandis]
Length=357

 Score =   281 bits (720),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/264 (53%), Positives = 183/264 (69%), Gaps = 9/264 (3%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G+   + L +Q HIWN+IF++I S  LKCA++LGIPD IH HG+P+TL  L  A+ I+ +
Sbjct  4    GEMGSQQLLAQAHIWNHIFNFINSMCLKCAIQLGIPDTIHHHGQPMTLDALVSALQIHPS  63

Query  592  KAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPI  431
            +A  + RLMR L+HSGFF   K       AY L   S LLL DNP ++ PF L ++D PI
Sbjct  64   RAHCVDRLMRILVHSGFFEQKKLAPDGQGAYVLNHVSKLLLTDNPSNVAPFALSMLD-PI  122

Query  430  LITQPWNHAREWFQND-DPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVI  254
            LI  PW+    WF N  DP PF+   GM+ W YAG +P FN +FN+ MASD RLV ++V+
Sbjct  123  LIN-PWHGLSAWFHNHVDPTPFEMVQGMSFWRYAGQEPGFNRLFNDGMASDARLVASMVV  181

Query  253  KYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGD  74
               KGVFEG+ SLVDV GGTGT A+ IA +FP ++CT+FDLPHV+  LE ++N+  V GD
Sbjct  182  NEHKGVFEGITSLVDVGGGTGTTAKAIANSFPHMECTIFDLPHVVANLEVSENVRCVPGD  241

Query  73   MFVSIPHANALFLKWILHDWNDED  2
            MF +IP A+A+ LKWILHDW+DED
Sbjct  242  MFEAIPPADAIILKWILHDWSDED  265



>ref|XP_004490686.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=358

 Score =   281 bits (719),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/258 (54%), Positives = 184/258 (71%), Gaps = 9/258 (3%)
 Frame = -2

Query  754  LLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHLA  575
            LL +Q+HIWN+IF++I S SLKC V+LGIPDIIH +G+PI+L +L   +PI+ +K   + 
Sbjct  13   LLKAQSHIWNHIFNFINSMSLKCVVDLGIPDIIHNYGKPISLSKLIPLLPIHPSKTIFIY  72

Query  574  RLMRTLIHSGFFFHT-------KDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQP  416
            RLMR + HSGFF          +  Y L   S LLL DNP S+ PF+  ++D P+L T P
Sbjct  73   RLMRIMTHSGFFSQQNITENELETEYMLTDTSLLLLSDNPMSVAPFVHAMLD-PVL-TNP  130

Query  415  WNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGV  236
            W+    W  N DP  F+T HGM  WD A  +P+FN++FN+AMASD RLV +VVI+ CK V
Sbjct  131  WHQLSTWLTNGDPTAFETKHGMLFWDCAEREPKFNNLFNDAMASDARLVSSVVIEKCKEV  190

Query  235  FEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSIP  56
            F GL S+VDV GG GT+A+ +A++FP L+CTV DLPHV+ GL+ T+NL YVGGDMF  IP
Sbjct  191  FNGLESIVDVGGGIGTMAKALAKSFPQLECTVLDLPHVVAGLQETENLKYVGGDMFKEIP  250

Query  55   HANALFLKWILHDWNDED  2
             A+A+ LKWILHDWND++
Sbjct  251  SADAILLKWILHDWNDDE  268



>gb|KHG15351.1| 8-hydroxyquercetin 8-O-methyltransferase [Gossypium arboreum]
Length=366

 Score =   281 bits (719),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/264 (51%), Positives = 182/264 (69%), Gaps = 10/264 (4%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIP-INK  596
            G+  IE L +Q HIW + F+++   SLKCA++LGI DIIH HG+P+T+ EL  A+  +N 
Sbjct  8    GEDAIEALQAQAHIWRHAFNFVSFMSLKCALDLGILDIIHNHGKPMTITELVVALRMLNP  67

Query  595  AKAGHLARLMRTLIHSGFFFHT-------KDAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
             KA  + R+MR L+HSG F          ++ Y L   S +LLK+NPF + P L   +D 
Sbjct  68   TKACDIYRIMRVLVHSGIFARQNLFNDAQEEGYVLTNSSRMLLKNNPFCITPTLKATMD-  126

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            PI IT+PW+    WFQND+  PF TA+G T+WDY  H P+   + N+ +ASD++LV NV+
Sbjct  127  PI-ITKPWSFLGTWFQNDEHTPFATAYGKTLWDYFTHDPQLKDLINDGLASDSQLVTNVL  185

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            +  CK  FEGLNSLVDV GGTGT A+ IA+ FP ++CTVFDLPH++ GL+G+KNL YVGG
Sbjct  186  VDKCKEAFEGLNSLVDVGGGTGTTAKAIADTFPHMECTVFDLPHIVAGLQGSKNLKYVGG  245

Query  76   DMFVSIPHANALFLKWILHDWNDE  5
            +MF + P  +A+ LK +LHDWNDE
Sbjct  246  NMFEAFPTGDAILLKKVLHDWNDE  269



>ref|XP_009612081.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=350

 Score =   281 bits (718),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 131/253 (52%), Positives = 180/253 (71%), Gaps = 3/253 (1%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL + T IWN+I++++ SS+ KCAV+LGIPD+++KHG+ + L +L+ A+P+N +K   L
Sbjct  10   ELLQAHTQIWNHIYNFVSSSAAKCAVQLGIPDVLYKHGKSMCLSDLSAALPLNPSKISFL  69

Query  577  ARLMRTLIHSGFFFHTKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQPWNHARE  398
              L+R+L+HSGF    +D Y+L   S L LKD+P S+R + L + D    + +PW     
Sbjct  70   PILIRSLVHSGFLNEHEDYYSLTPASRLFLKDDPLSMRSYFLIMHDP--CVQKPWFELSS  127

Query  397  WFQNDDPAPFDTAH-GMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGVFEGLN  221
            WFQND P  F  AH G + WDY   +P  N++FN++MA+D+ L+ NV+I  CK VFEGL 
Sbjct  128  WFQNDFPTAFHAAHNGKSFWDYFADEPRVNNIFNDSMANDSSLIANVLITECKHVFEGLT  187

Query  220  SLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSIPHANAL  41
            SLVDV GGTGT+A  IA+AFP + CTV DLPHVI  L+G+ NL++VGG MF  IP+ANA+
Sbjct  188  SLVDVGGGTGTLAIAIAKAFPAINCTVLDLPHVIGDLKGSGNLEFVGGSMFEKIPNANAI  247

Query  40   FLKWILHDWNDED  2
             LKWILH+W DED
Sbjct  248  LLKWILHNWGDED  260



>ref|XP_002517834.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44352.1| o-methyltransferase, putative [Ricinus communis]
Length=362

 Score =   281 bits (718),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 150/267 (56%), Positives = 183/267 (69%), Gaps = 12/267 (4%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIP-INK  596
            GD   ELL +  H+W++ FS+IKS SLKCAVELGIPDIIH HG+P+TL EL   +P +  
Sbjct  6    GDCGNELLQAHAHVWSHAFSFIKSMSLKCAVELGIPDIIHNHGQPMTLSELVAGLPHVLP  65

Query  595  AKAGHLARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
            +K+ H+ RLMR L HSGFF   K       D Y L +P  LLLKD+P S RP+L F V +
Sbjct  66   SKSHHVCRLMRVLTHSGFFTLQKASDNRDEDGYLLTKPCLLLLKDSPISARPYL-FAVLD  124

Query  436  PILITQPWNHAREWFQNDDP--APFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMN  263
            PIL T+PW+    WFQNDD   +PF  AHG T WD A H+  FN +FNEAMASD+ +V  
Sbjct  125  PIL-TKPWDCLSSWFQNDDSKCSPFSIAHGKTFWDLASHEARFNSIFNEAMASDSSVVRE  183

Query  262  VVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYV  83
            VVI  CK VF GLNSLVDV G TG +A+ I E FP+LKCTV DLPHV+ G++   NL ++
Sbjct  184  VVISKCKDVFMGLNSLVDVGGSTGIMAKAIVETFPELKCTVLDLPHVVAGMQDDHNLSFL  243

Query  82   GGDMFVSIPHANALFLKWILHDWNDED  2
            GGDMF SIP A+A+ LK I H   DED
Sbjct  244  GGDMFESIPPADAIMLKMIFHVLGDED  270



>gb|KCW75545.1| hypothetical protein EUGRSUZ_E04305 [Eucalyptus grandis]
Length=359

 Score =   281 bits (718),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 139/264 (53%), Positives = 184/264 (70%), Gaps = 9/264 (3%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G+   + L +Q HIWN+IF++I S  LKCA++LGIPD IH HG+P+TL  L  A+ I+ +
Sbjct  6    GEMGSQQLLAQAHIWNHIFNFISSMCLKCAIQLGIPDTIHHHGQPMTLDALVSALQIHPS  65

Query  592  KAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPI  431
            +A  + RLMR L+HSGFF   K       AY L + S LLL DNP ++ PF L ++D PI
Sbjct  66   RAHCVDRLMRILVHSGFFEQKKLAPDGQGAYVLNRVSKLLLTDNPSNVAPFALSVLD-PI  124

Query  430  LITQPWNHAREWFQND-DPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVI  254
            LI  PW+    WF N  DP PF+   GM+ W YAG +P  N +FN+ MASD RLV ++V+
Sbjct  125  LIN-PWHGLSAWFHNHADPTPFEMVQGMSFWRYAGQEPGLNRLFNDGMASDARLVASMVV  183

Query  253  KYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGD  74
               KGVFEG+ SLVDV GGTGT+A+ IA +FP ++CT+FDLPHV+  LE ++N+  V GD
Sbjct  184  NEHKGVFEGITSLVDVGGGTGTMAKAIANSFPHMECTIFDLPHVVANLEVSENVRCVPGD  243

Query  73   MFVSIPHANALFLKWILHDWNDED  2
            MF +IP A+A+ LKWILHDW+DED
Sbjct  244  MFEAIPPADAIILKWILHDWSDED  267



>ref|XP_010058047.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
Length=359

 Score =   280 bits (717),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 139/264 (53%), Positives = 184/264 (70%), Gaps = 9/264 (3%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G+   + L +Q HIWN+IF++I S  LKCA++LGIPD IH HG+P+TL  L  A+ I+ +
Sbjct  6    GEMGSQQLLAQAHIWNHIFNFISSMCLKCAIQLGIPDTIHHHGQPMTLDALVSALQIHPS  65

Query  592  KAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPI  431
            +A  + RLMR L+HSGFF   K       AY L + S LLL DNP ++ PF L ++D PI
Sbjct  66   RAHCVDRLMRILVHSGFFEQKKLAPDGQGAYVLNRVSKLLLTDNPSNVAPFALSVLD-PI  124

Query  430  LITQPWNHAREWFQND-DPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVI  254
            LI  PW+    WF N  DP PF+   GM+ W YAG +P  N +FN+ MASD RLV ++V+
Sbjct  125  LIN-PWHGLSAWFHNHADPTPFEMVQGMSFWRYAGQEPGLNRLFNDGMASDARLVASMVV  183

Query  253  KYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGD  74
               KGVFEG+ SLVDV GGTGT+A+ IA +FP ++CT+FDLPHV+  LE ++N+  V GD
Sbjct  184  NEHKGVFEGITSLVDVGGGTGTMAKAIANSFPHMECTIFDLPHVVANLEVSENVRCVPGD  243

Query  73   MFVSIPHANALFLKWILHDWNDED  2
            MF +IP A+A+ LKWILHDW+DED
Sbjct  244  MFEAIPPADAIILKWILHDWSDED  267



>ref|XP_011091578.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=360

 Score =   280 bits (715),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/265 (52%), Positives = 182/265 (69%), Gaps = 12/265 (5%)
 Frame = -2

Query  769  DQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIP-INKA  593
            +Q  E L +Q HIWN++ SY  S SLKCA ELGIPD IH+HG P++L EL DA+P ++K 
Sbjct  7    EQSSEKLEAQAHIWNHVLSYTNSMSLKCATELGIPDAIHQHGGPMSLTELVDALPGVDKT  66

Query  592  KAGHLARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNP  434
            KA  + RLMR L+HSGFF   K       + Y+L   S LL+ D+PFS++P ++  + NP
Sbjct  67   KADCVYRLMRILVHSGFFVLEKIDSSNYEEGYSLTSTSRLLVGDHPFSMKPLVICGL-NP  125

Query  433  ILITQPWNHAREWFQN-DDPAPFDTAH-GMTIWDYAGHQPEFNHMFNEAMASDTRLVMNV  260
            IL T+PW     W QN +D  PF  A+ GM+ W+Y    P F+H+ ++ MASDT LV  V
Sbjct  126  IL-TEPWRQLGRWLQNTEDHTPFHIANNGMSFWEYKERNPRFSHLLDQVMASDTPLVAGV  184

Query  259  VIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVG  80
            + + C+ VFEGL+SLVDV GGTGT+A+ IAE FP + CTV DL  V+ GLEGT+NL YV 
Sbjct  185  ITRDCRQVFEGLDSLVDVGGGTGTLAKVIAEGFPQIHCTVLDLAPVVAGLEGTRNLKYVE  244

Query  79   GDMFVSIPHANALFLKWILHDWNDE  5
            GDMF  IP ++A+  KWILHDW+DE
Sbjct  245  GDMFEFIPPSDAVLCKWILHDWSDE  269



>emb|CAN73269.1| hypothetical protein VITISV_021917 [Vitis vinifera]
Length=357

 Score =   279 bits (714),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/262 (53%), Positives = 182/262 (69%), Gaps = 9/262 (3%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G +   LL +Q H+WN+  +++ S +LKCAV LGIPD I+ HG+PITL EL  A+ IN  
Sbjct  6    GKRASLLLQAQAHVWNHTMNFVNSMALKCAVRLGIPDAINNHGQPITLSELVTALSINPI  65

Query  592  KAGHLARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNP  434
            KA  L RLMR L+ SGFF   +         Y+L   S  LLKD P S  P LL  VD P
Sbjct  66   KAPCLHRLMRVLVXSGFFAQQQADHNEQEQLYSLTYASRFLLKDEPTSGAPLLLVQVD-P  124

Query  433  ILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVI  254
             L T P +   +WF+N DP PF TA+G   WDYA H+P+FN+ FNEAMASD++L+ +VV+
Sbjct  125  HL-TNPCHFLSDWFRNSDPTPFVTAYGKPFWDYAAHEPKFNNFFNEAMASDSQLIASVVV  183

Query  253  KYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGD  74
              CK VF GL+SL+DV GGTGT+A+ IA+AFP LKCTVFD PHV+  L+G +NL++VGGD
Sbjct  184  GECKEVFRGLSSLIDVGGGTGTMAKVIAKAFPHLKCTVFDQPHVVANLQGGENLEFVGGD  243

Query  73   MFVSIPHANALFLKWILHDWND  8
            +F +IP A+A+ LK ILH+W+D
Sbjct  244  IFEAIPPADAILLKSILHNWSD  265



>ref|XP_002305103.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|EEE85614.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score =   279 bits (714),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/271 (52%), Positives = 181/271 (67%), Gaps = 15/271 (6%)
 Frame = -2

Query  781  PSMGDQD-IELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIP  605
            P + DQ   EL  + TH+ + +F+YI S SL CA +LGIPDIIH HGRPITL  L  A+ 
Sbjct  3    PIIQDQKATELFQAHTHLHSQMFNYINSMSLMCAAQLGIPDIIHNHGRPITLPHLVSALH  62

Query  604  INKAKAGHLARLMRTLIHSGFFFHTK----------DAYALAQPSTLLLKDNPFSLRPFL  455
            I   K   + RLMR L+HSGFF  TK          +AY L  PS LL+KDN   L PF+
Sbjct  63   IAPNKTSIIYRLMRMLVHSGFFATTKAANGQGEGEEEAYVLTPPSQLLVKDNTNCLSPFM  122

Query  454  LFLVDNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTR  275
              +  NP  +T PW    +WF+ ++P  F+ A+GM  W+Y    PE N +FNEAMA D++
Sbjct  123  SLI--NPAFVT-PWLSLGDWFRGNEPTAFEHAYGMAFWEYHNQNPELNRLFNEAMACDSQ  179

Query  274  LVMNVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKN  95
            + MN+VI+ CK +FEGLNS+VDV GGTG+++R I+EAFP + CTV +LP VI  LEGTKN
Sbjct  180  M-MNLVIRDCKPIFEGLNSMVDVGGGTGSLSRIISEAFPHMNCTVLELPQVITNLEGTKN  238

Query  94   LDYVGGDMFVSIPHANALFLKWILHDWNDED  2
            L+YVGGDMF  IP A+A+ LK I H W+DED
Sbjct  239  LNYVGGDMFQHIPSADAVLLKLIFHGWSDED  269



>ref|XP_010052409.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW89598.1| hypothetical protein EUGRSUZ_A01881 [Eucalyptus grandis]
Length=358

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/264 (53%), Positives = 181/264 (69%), Gaps = 9/264 (3%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G+   + L +Q HIWN+IF++I S  LKCA++LGIPD IH HG+P+ L  L  A+ I+ +
Sbjct  6    GEMGSQQLLAQAHIWNHIFNFINSMCLKCAIQLGIPDTIHHHGQPMNLDALVSALQIHPS  65

Query  592  KAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPI  431
            +A  + RLMR L+HSGFF   K       AY L + S LLL DNP ++ PF L ++D P 
Sbjct  66   RAHCVDRLMRILVHSGFFEQKKLAPDGRGAYVLNRVSKLLLTDNPCNVAPFALSMLD-PT  124

Query  430  LITQPWNHAREWFQND-DPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVI  254
            LI  PW+    WF N  DP PF+   GM+ W YAG +P  N +FN+ MASD RLV ++V+
Sbjct  125  LI-NPWHGLSAWFHNRVDPTPFEMVQGMSFWRYAGQEPGLNRLFNDGMASDARLVASMVV  183

Query  253  KYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGD  74
               KGVFEG+ SLVDV GGTGT A+ IA AFP ++CT+FDLPHV+  LE ++N+  V GD
Sbjct  184  NEHKGVFEGITSLVDVGGGTGTTAKAIANAFPHMECTIFDLPHVVANLEVSENVRCVPGD  243

Query  73   MFVSIPHANALFLKWILHDWNDED  2
            MF SIP A+A+ LKWILHDW+DED
Sbjct  244  MFESIPPADAIILKWILHDWSDED  267



>ref|XP_010093978.1| Tabersonine 16-O-methyltransferase [Morus notabilis]
 gb|EXB54965.1| Tabersonine 16-O-methyltransferase [Morus notabilis]
Length=364

 Score =   279 bits (714),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/266 (51%), Positives = 180/266 (68%), Gaps = 16/266 (6%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +   IWN   ++IK  SLKCAVELGIPDII+ HG+PITL +L  ++PI+ +KA  +
Sbjct  11   ELLQAHGLIWNCSLNFIKPMSLKCAVELGIPDIINNHGQPITLSKLISSLPIHSSKAHCI  70

Query  577  ARLMRTLIHSGFFFHTK--------------DAYALAQPSTLLLKDNPFSLRPFLLFLVD  440
             RLMR L+HSGFF   K              +AY+L   S LLLKD P+   PF L  ++
Sbjct  71   YRLMRILVHSGFFATQKVDNKIDEGEEEEEEEAYSLTIASRLLLKDGPWRATPFFLVQLE  130

Query  439  NPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNV  260
             P L+T PW+    W QN DP PF+  HG T WD  G +P   ++F EAMA+D++L++ V
Sbjct  131  -PHLMT-PWHFVSTWLQNSDPTPFEMVHGKTFWDGVGDEPRLKYLFTEAMATDSQLMVKV  188

Query  259  VIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVG  80
            +++ CK VFEGL SLVDV GGTG VA+ IA+ FP++ CTV DLP+V+   +G KNL+++ 
Sbjct  189  IVEECKQVFEGLTSLVDVGGGTGIVAKAIAKTFPNIMCTVLDLPYVVANSQGAKNLNFIA  248

Query  79   GDMFVSIPHANALFLKWILHDWNDED  2
            GDMF  IP ANA+ LKWILHDW+DE+
Sbjct  249  GDMFKEIPPANAILLKWILHDWSDEE  274



>ref|XP_010058046.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
Length=359

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/264 (52%), Positives = 184/264 (70%), Gaps = 9/264 (3%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G+   + L +Q HIWN+IF++I S  LKC ++LGIPD IH HG+P+TL  L  A+ I+ +
Sbjct  6    GEMGSQQLLAQAHIWNHIFNFINSMCLKCTIQLGIPDTIHHHGQPMTLDALVSALQIHPS  65

Query  592  KAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPI  431
            +A  + RLMR L+HSGFF   K       AY L + S LLL DNP ++ PF L ++D PI
Sbjct  66   RAHCVDRLMRILVHSGFFEQKKLAPDGQGAYVLNRVSKLLLTDNPSNVAPFALSVLD-PI  124

Query  430  LITQPWNHAREWFQND-DPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVI  254
            LI  PW+    WF N  DP PF+   GM+ W YAG +P F+ +FN+ MASD RLV ++V+
Sbjct  125  LIN-PWHGLSAWFHNHADPTPFEMVQGMSFWRYAGQEPGFDRLFNDGMASDARLVASMVV  183

Query  253  KYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGD  74
               KGVFEG+ SLVDV GGTGT+A+ IA +FP ++CT+FDLPHV+  LE ++N+  V GD
Sbjct  184  NEHKGVFEGITSLVDVGGGTGTMAKAIANSFPHMECTIFDLPHVVANLEVSENVRCVPGD  243

Query  73   MFVSIPHANALFLKWILHDWNDED  2
            MF +IP A+A+ LKWILHDW+DED
Sbjct  244  MFEAIPPADAIILKWILHDWSDED  267



>gb|KDO73905.1| hypothetical protein CISIN_1g017835mg [Citrus sinensis]
Length=365

 Score =   278 bits (712),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 141/263 (54%), Positives = 177/263 (67%), Gaps = 13/263 (5%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL SQ H+WNNIFS++ S SLKCA++LGIPDIIH H +P+TL +L   + I+  K   +
Sbjct  15   ELLQSQAHVWNNIFSFVNSMSLKCAIQLGIPDIIHNHAKPMTLNQLLTTLQIHPTKTQCV  74

Query  577  ARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
              LMR L+HSGFF   K       + Y L   S LLLKD+P SL PFLL ++D PIL T+
Sbjct  75   YHLMRILVHSGFFALQKTSENEQEEGYILTSASKLLLKDHPLSLAPFLLAMLD-PIL-TK  132

Query  418  PWNHAREWFQNDDPAP----FDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIK  251
            PW+    W QNDD       F   HGM  WDYA  +   NH FNE MASDTRL  + +I 
Sbjct  133  PWHQVSTWIQNDDDDDAATTFALPHGMNFWDYAVRETRLNHFFNEGMASDTRLTSSALIH  192

Query  250  YCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDM  71
             CK VFEGLN+LVDV GGTGT+A  IA+ FP ++CTVFD PHV+  L+   NL YVGG+M
Sbjct  193  KCKDVFEGLNTLVDVGGGTGTLASAIAKKFPHIECTVFDQPHVVADLKSNGNLKYVGGNM  252

Query  70   FVSIPHANALFLKWILHDWNDED  2
            F +IP A+A+ +K +LH+WNDE+
Sbjct  253  FEAIPPADAVLIKCVLHNWNDEE  275



>ref|XP_011091736.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=560

 Score =   284 bits (727),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 142/265 (54%), Positives = 187/265 (71%), Gaps = 11/265 (4%)
 Frame = -2

Query  769  DQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIP-INKA  593
            ++  ELL +Q HIWN +FSYI S SLKCA ELGIPDIIHKHGRP+TL EL DA+P  +K 
Sbjct  208  ERSSELLEAQAHIWNQVFSYINSMSLKCATELGIPDIIHKHGRPMTLTELVDALPGADKP  267

Query  592  KAGHLARLMRTLIHSGFFF------HTKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPI  431
            KA  + RLMR L+HSGFF         K+AY+L   S LL+ D+  S++ ++L  +D PI
Sbjct  268  KADCVYRLMRILVHSGFFVLEKIDSCNKEAYSLTPASRLLIGDHTMSMKAYVLSQLD-PI  326

Query  430  LITQPWNHAREWFQNDD-PAPFDTAH-GMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            L T+PW H   WFQN +    F TA+ G +IW+     P F+H+F++ MA DT +V + +
Sbjct  327  L-TEPWQHLSRWFQNTEYHTAFHTANNGTSIWEQKERNPRFSHLFDQGMACDTPMVADAI  385

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
             + C+ VFEGL+S+VDV GGTGT+A+ IAEAFP + C V +L  VI GL+GT+NL+YV G
Sbjct  386  TRDCRQVFEGLDSIVDVGGGTGTLAKAIAEAFPQIHCLVLELAPVIAGLQGTRNLEYVEG  445

Query  76   DMFVSIPHANALFLKWILHDWNDED  2
            DMF  IP A+A+ LKWILHDW+DE+
Sbjct  446  DMFEYIPPADAVVLKWILHDWSDEE  470



>ref|XP_011027757.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score =   278 bits (711),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 137/262 (52%), Positives = 177/262 (68%), Gaps = 14/262 (5%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            EL  + TH+ + +F+YI S SL CA +LGIPDIIH HGRPITL  L  A+ I   K   +
Sbjct  12   ELFQAHTHLHSQMFNYINSMSLMCAAQLGIPDIIHDHGRPITLPHLVSALHIAPNKTSII  71

Query  577  ARLMRTLIHSGFFFHTK----------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPIL  428
             RLMR L+HSGFF  T+          +AY L  PS LL+KDN   L PF+  +  NP  
Sbjct  72   YRLMRMLVHSGFFATTRAANGQGEGEEEAYVLTPPSQLLVKDNTNCLSPFMSLI--NPAF  129

Query  427  ITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKY  248
            +T PW    +WF+ ++P  F+ A+GM  W+Y    PE N +FNEAMA D+++ MN+VI+ 
Sbjct  130  VT-PWLSLGDWFRGNEPTAFEQAYGMAFWEYHNQNPELNRLFNEAMACDSQM-MNLVIRD  187

Query  247  CKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMF  68
            CK +FEGLNS+VDV GGTG+++R I+EAFP + CTV +LP VI  LEGTKNL+YVGGDMF
Sbjct  188  CKPIFEGLNSMVDVGGGTGSLSRIISEAFPHMNCTVLELPQVITNLEGTKNLNYVGGDMF  247

Query  67   VSIPHANALFLKWILHDWNDED  2
              IP A+A+ LK I H W+DED
Sbjct  248  QHIPSADAVLLKLIFHGWSDED  269



>ref|XP_006377432.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP55229.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=372

 Score =   278 bits (711),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 136/269 (51%), Positives = 178/269 (66%), Gaps = 13/269 (5%)
 Frame = -2

Query  781  PSMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPI  602
            P    +  EL  +QTH++  +F+Y+ S SL CA +LGIPDIIH HGRPITL EL  A+ I
Sbjct  18   PIQEQKATELFQAQTHLYGQMFNYLNSMSLVCAAQLGIPDIIHNHGRPITLPELVSALHI  77

Query  601  NKAKAGHLARLMRTLIHSGFFFHTK---------DAYALAQPSTLLLKDNPFSLRPFLLF  449
               K+  + RLMR L+HSGFF  TK         +AY L  PS LL+KDN   L PF+  
Sbjct  78   PPNKSSCIYRLMRMLVHSGFFATTKAVIGQGGGEEAYVLTPPSQLLVKDNTNCLSPFMSL  137

Query  448  LVDNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLV  269
            +  NP  +T PW+   +WF+  +P  F  A+GM  W+Y    PE N +FN AMA D+++ 
Sbjct  138  I--NPAFVT-PWHSLGDWFRGSEPTAFQQAYGMAFWEYNNQNPELNGLFNAAMACDSQM-  193

Query  268  MNVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLD  89
            MN+VI+ CK +FEGL+S+VDV GGTG++AR I+E FP + CTV ++P VI  LEGT+NL 
Sbjct  194  MNLVIRDCKPIFEGLDSMVDVGGGTGSLARIISETFPHMNCTVLEIPQVIANLEGTENLK  253

Query  88   YVGGDMFVSIPHANALFLKWILHDWNDED  2
            YVGGDMF  IP A+A+ LK I H W+DED
Sbjct  254  YVGGDMFQHIPSADAVLLKLIFHGWSDED  282



>ref|XP_002517835.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44353.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   277 bits (709),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 136/258 (53%), Positives = 178/258 (69%), Gaps = 8/258 (3%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            EL+ +QTHI N  F +IKS SLKCAV+LGIPD I+ HG+P+TL EL  A+ ++  K  HL
Sbjct  11   ELIKAQTHIRNETFHFIKSMSLKCAVQLGIPDTINSHGQPMTLSELVRALQVHPTKTHHL  70

Query  577  ARLMRTLIHSGFFF------HTKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQP  416
              LMR L+HSGFF       +    Y L   S LLLKD+ F  RPF+  ++D PI+ T+P
Sbjct  71   YCLMRVLVHSGFFNLQNASDNYSQKYVLTPASRLLLKDSSFDTRPFISLVLD-PIM-TEP  128

Query  415  WNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGV  236
            +N    + +NDD  PF TA G+T+W Y G++   NH+ N+ MASD+ ++   VI  CK V
Sbjct  129  YNSLTPFLRNDDLTPFVTAFGVTLWGYTGNEARANHLVNDCMASDSSVIGRAVIIKCKEV  188

Query  235  FEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSIP  56
            FEGLNSLVDV GGTG +A+ IA+ FP+LKCTV DLPHV+  L+G  NL ++GGDMF  +P
Sbjct  189  FEGLNSLVDVGGGTGNMAKAIAQTFPNLKCTVLDLPHVVDKLQGINNLSFLGGDMFQPVP  248

Query  55   HANALFLKWILHDWNDED  2
             A+A+ LKWILHDW DE+
Sbjct  249  PADAILLKWILHDWPDEE  266



>ref|XP_010023968.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW60372.1| hypothetical protein EUGRSUZ_H03087 [Eucalyptus grandis]
Length=361

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/268 (51%), Positives = 179/268 (67%), Gaps = 14/268 (5%)
 Frame = -2

Query  772  GDQDI---ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPI  602
            GD D    ELL +Q HIWN+IFS+I S  LKCA++LGIPD+IH HGRP+TL EL  A+ +
Sbjct  6    GDGDAAASELLRAQAHIWNHIFSFINSMCLKCAIQLGIPDLIHGHGRPMTLPELISALHV  65

Query  601  NKAKAGHLARLMRTLIHSGFF-------FHTKDAYALAQPSTLLLKDNPFSLRPFLLFLV  443
               +A  + RLMR L+HSGFF          +  YAL   S LL+K +P +L PF LF +
Sbjct  66   QPTRAHCIRRLMRVLVHSGFFEVRDLDGVDRQTGYALTGASRLLVKHDPLTLAPFALFAL  125

Query  442  DNPILITQPWNHAREWF--QNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLV  269
            +   +   PW +   W   + D P+  D AHG+  W+Y    PE    F+EAMASD+RL+
Sbjct  126  EPYSM--DPWQYLSAWLGDREDVPSTLDMAHGVPAWEYVRRNPEVASSFHEAMASDSRLI  183

Query  268  MNVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLD  89
              +V   C GVFEG++S+VDV GG+GT+A+ IA+AFP L CTVFDLP V+ GL G++ L 
Sbjct  184  AKLVGDTCGGVFEGMSSVVDVGGGSGTMAKAIADAFPHLTCTVFDLPAVVDGLVGSERLK  243

Query  88   YVGGDMFVSIPHANALFLKWILHDWNDE  5
            +VGGDMFV IP A+A+ LKWILHDW+DE
Sbjct  244  FVGGDMFVEIPQADAILLKWILHDWSDE  271



>ref|XP_008229106.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=391

 Score =   277 bits (709),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 141/290 (49%), Positives = 185/290 (64%), Gaps = 40/290 (14%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +Q H+WN+IF +I S SLKCAV+LGIPD+IH HG+PI+L  L   + ++ +KA  +
Sbjct  12   ELLQAQAHVWNHIFQFINSMSLKCAVQLGIPDVIHSHGQPISLSNLISGLNVHPSKAHFI  71

Query  577  ARLMRTLIHSGFFFHTKD-------------------------------AYALAQPSTLL  491
            ARLMR L+HS FF   +                                 Y L   S LL
Sbjct  72   ARLMRILVHSNFFAQDQQVQLPLLPNDNNNNENIVHQDLDDEEEEKTVVVYRLTPASRLL  131

Query  490  LKDNPFSLRPFLLFLVDNPILITQPWNHAREWFQ------NDDPA-PFDTAHGMTIWDYA  332
            LK++P S   FLL ++D P+ +T P++    W Q       D PA PF+ AHG   W  A
Sbjct  132  LKESPLSTTQFLLMILD-PV-VTDPFHLMGTWCQMNNHGNQDHPASPFEMAHGRPFWGLA  189

Query  331  GHQPEFNHMFNEAMASDTRLVMNVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDL  152
              QP+F  +FNEAM +D++L+   V++ C+GVFEGLNSLVDV GGTGT+A+ IA+AFP++
Sbjct  190  AQQPKFGSLFNEAMEADSQLLARAVVEECEGVFEGLNSLVDVGGGTGTMAKAIAKAFPNI  249

Query  151  KCTVFDLPHVIRGLEGTKNLDYVGGDMFVSIPHANALFLKWILHDWNDED  2
             CTVFD PHV+  L+GT NLD+VGGDMF  IP ANA+FLKWILHDW+DE+
Sbjct  250  NCTVFDQPHVVANLQGTHNLDFVGGDMFEKIPPANAIFLKWILHDWSDEE  299



>ref|XP_002262833.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=358

 Score =   276 bits (705),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/260 (51%), Positives = 178/260 (68%), Gaps = 10/260 (4%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +Q  + N++F+++ S +LKCA++L IPD+IH HG+P+ L +L  A+ +  +KA  L
Sbjct  11   ELLQAQAQVVNHVFNFMNSMALKCAIDLAIPDVIHSHGQPMLLSQLVTALSVQPSKAPCL  70

Query  577  ARLMRTLIHSGFFFHTK--------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILIT  422
             RLMR L+HSGFF   +        + Y+L   S  LLKD P +  P  L  + NP+L T
Sbjct  71   HRLMRLLVHSGFFSQQQVIHNNEQEEGYSLTSASRFLLKDEPLTGLPLSLLHL-NPVL-T  128

Query  421  QPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCK  242
             PW+    WF+N DP PF TAHG   WDY   +P+FN +FNEAMASD+R++ +V+I  CK
Sbjct  129  APWHFLSGWFRNGDPTPFYTAHGKPYWDYTAQEPDFNDLFNEAMASDSRIIASVLITKCK  188

Query  241  GVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVS  62
              F+GL SLVDV  GTGT+ + IA+AFP LKC VFD PHV+  L+G  NL+ VGGDMF +
Sbjct  189  EQFKGLFSLVDVGAGTGTMTKAIAKAFPHLKCIVFDQPHVVADLQGGGNLEVVGGDMFET  248

Query  61   IPHANALFLKWILHDWNDED  2
            IP ANA+ LKWILH+W+DE+
Sbjct  249  IPSANAVILKWILHNWSDEE  268



>ref|XP_006446725.1| hypothetical protein CICLE_v10015630mg [Citrus clementina]
 gb|ESR59965.1| hypothetical protein CICLE_v10015630mg [Citrus clementina]
Length=377

 Score =   276 bits (707),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 139/268 (52%), Positives = 187/268 (70%), Gaps = 18/268 (7%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +Q  +WN  FSYI S SLKCAVELGIPD+IHKHG+P+TL ++A A+ I K KA  +
Sbjct  20   ELLKAQAQVWNCAFSYINSMSLKCAVELGIPDVIHKHGQPMTLSQIASALDIQKNKAHCI  79

Query  577  ARLMRTLIHSGFFFHT----KDA----YALAQPSTLLLKDNPFSLRPFLLFLVDNPILIT  422
             RLMR L+HSGFF       KD     Y+L   S LLLKD P    PF +FL+ +PI IT
Sbjct  80   QRLMRILVHSGFFAQQNKIDKDESEVYYSLTPASRLLLKDEPLRAAPF-MFLITHPI-IT  137

Query  421  QPWNHAREWFQNDDPAP---FDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIK  251
             P+N    WF+NDDP+    F++ HG  IW     + +F ++F +AM +D++ + +V+IK
Sbjct  138  TPFNFLSSWFKNDDPSTPTVFESTHGKDIWGCLAQEAKFKNVFYDAMMTDSQFISSVLIK  197

Query  250  YCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVI----RGLEGT-KNLDY  86
             CK VF+GL  LVD+ GGTGT+A+ IAEAFP++KC VFDLPHV+    +  +GT KNL++
Sbjct  198  DCKVVFKGLKCLVDLGGGTGTMAKAIAEAFPEMKCIVFDLPHVVDNNLQQQQGTNKNLEF  257

Query  85   VGGDMFVSIPHANALFLKWILHDWNDED  2
            +GGDMF +IP A+A+ LKW+LH+W DE+
Sbjct  258  LGGDMFEAIPPADAVLLKWVLHNWGDEE  285



>gb|EYU30782.1| hypothetical protein MIMGU_mgv1a021078mg [Erythranthe guttata]
Length=359

 Score =   276 bits (705),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/266 (54%), Positives = 190/266 (71%), Gaps = 8/266 (3%)
 Frame = -2

Query  781  PSMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPI  602
            PS      EL ++Q H+WN IF+Y+ S SLKCA++LGIPDIIHKHG+P++L +L DA+ I
Sbjct  4    PSNNPSSQELFDAQAHVWNFIFNYLNSMSLKCAIQLGIPDIIHKHGKPMSLDQLVDALSI  63

Query  601  NKAKAGHLARLMRTLIHSGFFFHTKDA----YALAQPSTLLLKDNPFSLRPFLLFLVDNP  434
            +K+K+  + RLMR L HS FF   ++     Y+L   S LLLKD P S+ PF L ++D P
Sbjct  64   DKSKSRCVYRLMRILTHSKFFVEEEEEEEARYSLTLASRLLLKDEPLSIAPFALAMMD-P  122

Query  433  ILITQPWNHAREWFQNDD--PAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNV  260
            ILI +P +H  EWFQ++D    PF T +GM  ++YA ++  +N +FNE MASD R V ++
Sbjct  123  ILI-EPCHHVSEWFQSNDEISCPFVTKYGMGFFEYARNKERWNKVFNEGMASDARFVNSL  181

Query  259  VIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVG  80
            +I+  K VFEGL+S+VDV GGTG  A+ I  AFP LKCTV +LPHVI GLEGT NL++VG
Sbjct  182  LIREYKQVFEGLDSIVDVGGGTGAAAKAIVSAFPGLKCTVLELPHVIAGLEGTDNLNFVG  241

Query  79   GDMFVSIPHANALFLKWILHDWNDED  2
            GDMF  IPHA+A+F KWI HDW DE+
Sbjct  242  GDMFNFIPHAHAVFFKWIFHDWTDEE  267



>ref|XP_006452811.1| hypothetical protein CICLE_v10008718mg [Citrus clementina]
 gb|ESR66051.1| hypothetical protein CICLE_v10008718mg [Citrus clementina]
Length=365

 Score =   276 bits (705),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 140/263 (53%), Positives = 176/263 (67%), Gaps = 13/263 (5%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL SQ H+WNNIFS++ S SLKCA++LGIPDIIH H +P+TL +L   + I+  K   +
Sbjct  15   ELLQSQAHVWNNIFSFVNSMSLKCAIQLGIPDIIHNHAKPMTLNQLLTTLQIHPTKTQCV  74

Query  577  ARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
              LMR L+HSGFF   K       + Y L   S LLLKD+P SL PFLL ++D PIL T+
Sbjct  75   YHLMRILVHSGFFALQKTSENEQEEGYILTSASKLLLKDHPLSLAPFLLAMLD-PIL-TK  132

Query  418  PWNHAREWFQNDDPAP----FDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIK  251
            PW+    W QNDD       F   HGM  WDYA  +   NH FNE MASDTRL  + +I 
Sbjct  133  PWHQVSTWIQNDDDDDAATTFALPHGMNFWDYAVRETRLNHFFNEGMASDTRLTSSALIN  192

Query  250  YCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDM  71
             CK VFEGLN+LVDV GGTGT+A  IA+ FP ++CTVFD PHV+  L+    L YVGG+M
Sbjct  193  KCKDVFEGLNTLVDVGGGTGTLASAIAKKFPHIECTVFDQPHVVADLKSNGYLKYVGGNM  252

Query  70   FVSIPHANALFLKWILHDWNDED  2
            F +IP A+A+ +K +LH+WNDE+
Sbjct  253  FEAIPPADAVLIKCVLHNWNDEE  275



>ref|XP_011001214.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=373

 Score =   276 bits (706),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 135/270 (50%), Positives = 177/270 (66%), Gaps = 14/270 (5%)
 Frame = -2

Query  781  PSMGDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPI  602
            P    ++ EL  +QTH++  +F+Y+ S SL CA +LGIPDIIH HG PITL EL  A+ I
Sbjct  18   PIQEQKETELFQAQTHLYGQMFNYLNSMSLVCAAQLGIPDIIHNHGSPITLPELVSALHI  77

Query  601  NKAKAGHLARLMRTLIHSGFFFHTK----------DAYALAQPSTLLLKDNPFSLRPFLL  452
               K   + RLMR L+HSGFF  T+          +AY L  PS LL+KDN   L PF+ 
Sbjct  78   PPNKTSCIYRLMRMLVHSGFFATTRAANGQGEGEEEAYVLTPPSQLLVKDNTNCLSPFMS  137

Query  451  FLVDNPILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRL  272
             +  NP  +T PW+   +WF+  +P  F  A+GM  W+Y    PE N +FN AMA D+++
Sbjct  138  LI--NPAFVT-PWHSLGDWFRGSEPTAFQQAYGMAFWEYNNQNPELNCLFNAAMACDSQM  194

Query  271  VMNVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNL  92
             MN+VI+ CK +FEGL+S+VDV GGTG++AR I+E FP +KCTV + P VI  LEGT+NL
Sbjct  195  -MNLVIRDCKPIFEGLDSMVDVGGGTGSLARIISETFPHMKCTVLETPQVIANLEGTENL  253

Query  91   DYVGGDMFVSIPHANALFLKWILHDWNDED  2
             YVGGDMF  IP A+A+ LK I H W+DED
Sbjct  254  KYVGGDMFQHIPSADAVLLKLIFHGWSDED  283



>gb|ACV65500.1| deoxyhemigossypol-6-O-methyltransferase [Gossypium hirsutum]
Length=365

 Score =   276 bits (705),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/264 (50%), Positives = 180/264 (68%), Gaps = 10/264 (4%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIP-INK  596
            G+  IE L +  HIW + F+++   SLKCA++LGI DIIH HG+P+T+ +L  A+  +N 
Sbjct  8    GEDAIEALQAHAHIWRHAFNFVSFMSLKCALDLGILDIIHDHGKPMTITQLVGALQMLNP  67

Query  595  AKAGHLARLMRTLIHSGFFFHTK-------DAYALAQPSTLLLKDNPFSLRPFLLFLVDN  437
             KA  + RLM  L+HS FF   K       + Y L   S +LLK+NPF + P L   +D 
Sbjct  68   TKACDIYRLMHILVHSDFFARQKLDNDAQEEGYVLTNSSRILLKNNPFCITPTLKATMD-  126

Query  436  PILITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVV  257
            PI IT+PW+    WFQNDD  PF TA+G T+WDY  H P+   + N+ +ASD++LV +V+
Sbjct  127  PI-ITKPWSFLGTWFQNDDHTPFATAYGKTLWDYFTHDPQLKDLINDGLASDSQLVTSVL  185

Query  256  IKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGG  77
            +  CKG FEGL SLVDV GGTGT A+ IA+ FP ++CTVFDLPH++ GL+G+KNL YVGG
Sbjct  186  VDKCKGAFEGLESLVDVGGGTGTTAKAIADTFPHMECTVFDLPHIVAGLQGSKNLKYVGG  245

Query  76   DMFVSIPHANALFLKWILHDWNDE  5
            +MF + P  +A+ LK +LHDWND+
Sbjct  246  NMFEAFPTGDAILLKKVLHDWNDK  269



>ref|XP_006387382.1| hypothetical protein POPTR_1124s00200g, partial [Populus trichocarpa]
 gb|ERP46296.1| hypothetical protein POPTR_1124s00200g, partial [Populus trichocarpa]
Length=227

 Score =   270 bits (690),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 162/218 (74%), Gaps = 9/218 (4%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +Q H+WN+IF+++ S SLKCA++LGIPD+IH HG+P+TL EL   +PI+ +KA  +
Sbjct  12   ELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDVIHNHGKPMTLSELVAVLPIHPSKAPGI  71

Query  577  ARLMRTLIHSGFFFHTKDA-------YALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQ  419
             RLMR L+HSGFF    ++       Y L   S LL+KDNPFS+ PFLL ++D PIL TQ
Sbjct  72   YRLMRILVHSGFFATQNNSGETEGEGYVLTNASQLLIKDNPFSVTPFLLAMLD-PIL-TQ  129

Query  418  PWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKG  239
            PW++   WFQND P+ F TAH  T W+YAGH+ E NH FNEAMASD RLV +V++  CKG
Sbjct  130  PWHYVSVWFQNDAPSSFYTAHQRTCWEYAGHETELNHFFNEAMASDARLVSSVLVNECKG  189

Query  238  VFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPH  125
            VFEGLNSLVDV GGTGTVA+ IA+ F  L CTVFDLPH
Sbjct  190  VFEGLNSLVDVGGGTGTVAKAIAKEFQHLDCTVFDLPH  227



>ref|XP_002278127.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=354

 Score =   273 bits (699),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/262 (52%), Positives = 177/262 (68%), Gaps = 8/262 (3%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G    EL  +Q+ I+ ++FS++ S SLKCAV+LGIPD IH H +PITL ELA AI +   
Sbjct  6    GQGRSELFEAQSFIYKHVFSFMDSMSLKCAVQLGIPDAIHNHNQPITLPELASAIQVPPE  65

Query  592  KAGHLARLMRTLIHSGFFFHTK-----DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPIL  428
            K   L +LMR L+HSGFF   K     + Y L  PS LL+K N  SL P +L ++D P+L
Sbjct  66   KTSRLHQLMRLLVHSGFFAMQKVDENQEGYVLTPPSRLLVKGNATSLAPIVLGMLD-PVL  124

Query  427  ITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKY  248
            +T PW+    W Q      F+ AHGM +W+Y    PEF  +  E MA+D+R+ M++ I+ 
Sbjct  125  VT-PWHFLGSWLQGSSLTAFEAAHGMDLWNYGNQNPEFFSLIGEIMATDSRM-MSLAIRE  182

Query  247  CKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMF  68
            CK +FEGL+SLVDV GGTGT+AR I EAFP LKCTV DLP V+  L  ++NLDYVGGDMF
Sbjct  183  CKEIFEGLSSLVDVGGGTGTMARGICEAFPHLKCTVLDLPQVVANLPKSENLDYVGGDMF  242

Query  67   VSIPHANALFLKWILHDWNDED  2
             SIP A+A+F+K +LH+W DED
Sbjct  243  QSIPSADAIFIKSVLHNWGDED  264



>gb|KCW89599.1| hypothetical protein EUGRSUZ_A01884 [Eucalyptus grandis]
Length=357

 Score =   273 bits (698),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 136/264 (52%), Positives = 181/264 (69%), Gaps = 9/264 (3%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G+   + L +Q HIWN+IF++I S  LKCA++L IPD IH H +P+TL  L  A+ I+ +
Sbjct  4    GEMGSQQLLAQAHIWNHIFNFINSMCLKCAIQLRIPDTIHHHDQPMTLDALVSALQIHPS  63

Query  592  KAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPI  431
            +A  L RLMR L+HSGFF   K       AY L + S LLL DNP ++ PF L ++D PI
Sbjct  64   RAHCLDRLMRILVHSGFFEQKKLAPDGRGAYVLNRVSKLLLTDNPSNVAPFALSMLD-PI  122

Query  430  LITQPWNHAREWFQND-DPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVI  254
            +I  PW+    WF N  DP PF+   GM+IW Y G +P  N +FN+ MA+D RLV ++V+
Sbjct  123  VI-NPWHGLSAWFHNHVDPTPFEMVQGMSIWRYVGQEPGLNRLFNDGMATDARLVASMVV  181

Query  253  KYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGD  74
               KG+FEG+ SLVDV GGTGT A+ IA +FP ++CT+FDLPHV+  LE ++N+  V GD
Sbjct  182  NEHKGMFEGITSLVDVGGGTGTTAKAIANSFPHMECTIFDLPHVVANLEVSENVRCVPGD  241

Query  73   MFVSIPHANALFLKWILHDWNDED  2
            MF SIP A+A+ LKWILHDW+DED
Sbjct  242  MFESIPPADAIILKWILHDWSDED  265



>ref|XP_010070255.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
Length=359

 Score =   273 bits (698),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 136/264 (52%), Positives = 181/264 (69%), Gaps = 9/264 (3%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G+   + L +Q HIWN+IF++I S  LKCA++L IPD IH H +P+TL  L  A+ I+ +
Sbjct  6    GEMGSQQLLAQAHIWNHIFNFINSMCLKCAIQLRIPDTIHHHDQPMTLDALVSALQIHPS  65

Query  592  KAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPI  431
            +A  L RLMR L+HSGFF   K       AY L + S LLL DNP ++ PF L ++D PI
Sbjct  66   RAHCLDRLMRILVHSGFFEQKKLAPDGRGAYVLNRVSKLLLTDNPSNVAPFALSMLD-PI  124

Query  430  LITQPWNHAREWFQND-DPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVI  254
            +I  PW+    WF N  DP PF+   GM+IW Y G +P  N +FN+ MA+D RLV ++V+
Sbjct  125  VI-NPWHGLSAWFHNHVDPTPFEMVQGMSIWRYVGQEPGLNRLFNDGMATDARLVASMVV  183

Query  253  KYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGD  74
               KG+FEG+ SLVDV GGTGT A+ IA +FP ++CT+FDLPHV+  LE ++N+  V GD
Sbjct  184  NEHKGMFEGITSLVDVGGGTGTTAKAIANSFPHMECTIFDLPHVVANLEVSENVRCVPGD  243

Query  73   MFVSIPHANALFLKWILHDWNDED  2
            MF SIP A+A+ LKWILHDW+DED
Sbjct  244  MFESIPPADAIILKWILHDWSDED  267



>ref|XP_010111159.1| 6a-hydroxymaackiain methyltransferase 1 [Morus notabilis]
 gb|EXC30550.1| 6a-hydroxymaackiain methyltransferase 1 [Morus notabilis]
Length=409

 Score =   275 bits (703),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 184/269 (68%), Gaps = 15/269 (6%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G    EL  +Q+H++++IF +I S SLKCAV+LGIPDII  HG+PITL EL  A+ I+  
Sbjct  6    GQGSNELFQAQSHLYSHIFRFISSMSLKCAVQLGIPDIISNHGQPITLSELVSALDIHPT  65

Query  592  KAGHLARLMRTLIHSGFFFHTK-----------DAYALAQPSTLLLKDNPFSLRPFLLFL  446
            KAG + RLMR L+H GFF  TK            +Y L   S LLLKD   SL PFL+ +
Sbjct  66   KAGFIYRLMRLLVHDGFFTSTKIGENEEEEEEEASYDLTPSSRLLLKDKIPSLSPFLVAM  125

Query  445  VDNPILITQPWNHAREWFQND-DPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLV  269
            ++  I  T PW+    WFQ + D  PF++AHG++ W Y     EF ++FN+AMASD+ + 
Sbjct  126  LEPAI--TTPWHSLGNWFQREEDMTPFESAHGISFWAYGNKNSEFGNLFNQAMASDSGM-  182

Query  268  MNVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLD  89
            MN+V+K CK +FEGL+SLVDV GGTGTV++ I EAFP L CTV DLPHV+  L  T+NL 
Sbjct  183  MNLVVKDCKLLFEGLSSLVDVGGGTGTVSKIITEAFPHLICTVLDLPHVVANLPDTENLK  242

Query  88   YVGGDMFVSIPHANALFLKWILHDWNDED  2
            +VGGDMF  IP A+A+FLKW++H W+DE+
Sbjct  243  FVGGDMFQDIPSADAIFLKWLVHAWSDEE  271



>gb|KDP21023.1| hypothetical protein JCGZ_21494 [Jatropha curcas]
Length=358

 Score =   273 bits (698),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 135/261 (52%), Positives = 178/261 (68%), Gaps = 12/261 (5%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            E+L +Q H+ N++ +Y+ S +LKCAV+LGIPDI+H HG+PITL EL  A+ I   K  ++
Sbjct  11   EILQAQVHLINHMLNYMNSMALKCAVQLGIPDILHSHGKPITLPELLSALHIPPTKLSNM  70

Query  577  ARLMRTLIHSGFFFHTK---------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILI  425
             RLMR L+ SGFF  TK         +AY L   S LL+K NP  L PF+  L+    + 
Sbjct  71   YRLMRMLVFSGFFSTTKVLNGQGDGQEAYVLTPSSRLLVKGNPNCLAPFVNSLLKAEFV-  129

Query  424  TQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYC  245
              P +   +WFQ ++   F+ AHGM  W+Y   +PEFN +FNEAMA D+R+ MN+VI+ C
Sbjct  130  -SPGHLLGDWFQGNELTVFEKAHGMAFWEYNERKPEFNQLFNEAMACDSRM-MNLVIRDC  187

Query  244  KGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFV  65
            K +FEG+NSLVDV GG G++AR I+EAFPD+KCTV DLP VI  LEGTKNL YVGGDMF 
Sbjct  188  KQIFEGVNSLVDVGGGNGSLARIISEAFPDMKCTVLDLPQVIANLEGTKNLSYVGGDMFK  247

Query  64   SIPHANALFLKWILHDWNDED  2
             IP  + + LK ILH W+D++
Sbjct  248  HIPSGDCIILKLILHGWSDDE  268



>ref|XP_008343875.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Malus 
domestica]
Length=382

 Score =   274 bits (700),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 138/274 (50%), Positives = 180/274 (66%), Gaps = 24/274 (9%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +Q H+WN++F +I S SLKCAV+LGIPD+IH HG+PI+L EL   + I+ +KA  +
Sbjct  14   ELLGAQAHVWNHMFQFINSMSLKCAVQLGIPDVIHNHGQPISLSELVARLNIHPSKAHFM  73

Query  577  ARLMRTLIHSGFFFHTKDA---------------YALAQPSTLLLKDNPFSLRPFLLFLV  443
            +RLMR L+HS FF                     Y+L   S L LKD P +  PFLL ++
Sbjct  74   SRLMRILVHSDFFAQHDHVHHDRDDAEEEVAVVLYSLTPASGLFLKDGPLNTTPFLLMIL  133

Query  442  DNPILITQPWNHAREWFQ---NDD---PAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASD  281
            D   +IT P++    W Q    DD     PF+ A+GM  W+ +  +P F  +FNEAM +D
Sbjct  134  DQ--VITDPFHTMGNWLQMNCGDDLVPCTPFEVANGMPFWELSAKKPRFGDLFNEAMEAD  191

Query  280  TRLVMNVVIKYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEG-  104
            ++L+  VV++ C GVFEGL SLVDV GGTGT+A+ IA AFP++ CTVFD PHV+  LEG 
Sbjct  192  SKLIAGVVVEECGGVFEGLKSLVDVGGGTGTMAKAIANAFPNINCTVFDQPHVVADLEGM  251

Query  103  TKNLDYVGGDMFVSIPHANALFLKWILHDWNDED  2
            T NL +VGGDMF  IP ANA+ LKWILHDWNDE+
Sbjct  252  THNLGFVGGDMFEEIPPANAILLKWILHDWNDEE  285



>ref|XP_004169298.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
sativus]
 gb|KGN43482.1| hypothetical protein Csa_7G039790 [Cucumis sativus]
Length=357

 Score =   273 bits (698),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/254 (52%), Positives = 176/254 (69%), Gaps = 4/254 (2%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHG-RPITLLELADAIPINKAKAGH  581
            ELL +Q+H+WN+IF++I S SLKCA++LGIPD IH HG  P+ L  L  ++ ++  K   
Sbjct  15   ELLEAQSHVWNHIFNFINSMSLKCAIQLGIPDAIHSHGPNPVPLSILVSSLQLHPNKTQF  74

Query  580  LARLMRTLIHSGFFFHTKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQPWNHAR  401
            + RLMR L HSGFF   ++ Y L   S LLLKDNP ++ PFLL ++  P L T PW    
Sbjct  75   IYRLMRLLTHSGFFVQQEEGYILTNSSRLLLKDNPCAVSPFLLSML-QPAL-TDPWQFLS  132

Query  400  EWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGVFEGLN  221
             WFQ DD  PF+TAHG+  W Y  ++P+   +FN  MASD RLV+NV+++  + VFEG+ 
Sbjct  133  IWFQTDDQTPFETAHGVPFWKYMRNKPKEGEVFNAGMASDARLVINVLLEKHRSVFEGVE  192

Query  220  SLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTK-NLDYVGGDMFVSIPHANA  44
            SLVDV GGTGTVA+ I++AFP ++CTV DLP V+  L+G + N  YV GDMF  IP A+ 
Sbjct  193  SLVDVGGGTGTVAKAISQAFPQMECTVLDLPQVVAHLKGDQPNFKYVEGDMFTLIPPADT  252

Query  43   LFLKWILHDWNDED  2
            + LKWILHDW+DE+
Sbjct  253  ILLKWILHDWSDEE  266



>dbj|BAI79244.1| O-methyltransferase [Carapichea ipecacuanha]
 dbj|BAJ05386.1| O-methyltransferase [Carapichea ipecacuanha]
Length=350

 Score =   273 bits (697),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 129/252 (51%), Positives = 172/252 (68%), Gaps = 2/252 (1%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +QTH    +FS+   +SLKCA+ LGIPD I +HG+P+ L EL  A+PIN +KA ++
Sbjct  11   ELLRAQTHFSTQLFSFQNYASLKCALHLGIPDAIKQHGKPMNLSELTSALPINPSKAPYI  70

Query  577  ARLMRTLIHSGFFFHTKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQPWNHARE  398
             RLMR L+ +G+F    + + L     LLLKD+P ++R  +L  +   +L+  PW    E
Sbjct  71   HRLMRMLVKAGYFAQENECFDLTPIGLLLLKDDPINIRALVLLELHPALLM--PWIALSE  128

Query  397  WFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGVFEGLNS  218
            WFQNDD  PF TAHG + WDY    PEF  +F+EAMA D+ L+  V++   K VFEGL S
Sbjct  129  WFQNDDATPFVTAHGKSFWDYTSRDPEFRKLFDEAMAGDSELISKVLVTEFKYVFEGLKS  188

Query  217  LVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSIPHANALF  38
            LVDV GG GT+AR+IA+AFP+LKCTVFDLP  +   +G  NLD+V GDMF  +P A+A+ 
Sbjct  189  LVDVGGGNGTLARSIAKAFPNLKCTVFDLPEAVANEQGDGNLDFVAGDMFDRVPSADAIL  248

Query  37   LKWILHDWNDED  2
            LK ILHDW+DE+
Sbjct  249  LKIILHDWSDEN  260



>ref|XP_004151735.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
sativus]
Length=357

 Score =   273 bits (697),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 132/254 (52%), Positives = 176/254 (69%), Gaps = 4/254 (2%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHG-RPITLLELADAIPINKAKAGH  581
            ELL +Q+H+WN+IF++I S SLKCA++LGIPD IH HG  P+ L  L  ++ ++  K   
Sbjct  15   ELLEAQSHVWNHIFNFINSMSLKCAIQLGIPDAIHSHGPNPVPLSILVSSLQLHPNKTQF  74

Query  580  LARLMRTLIHSGFFFHTKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQPWNHAR  401
            + RLMR L HSGFF   ++ Y L   S LLLKDNP ++ PFLL ++  P L T PW    
Sbjct  75   IYRLMRLLTHSGFFVQQEEGYILTNSSRLLLKDNPCAVSPFLLSML-QPAL-TDPWQFLS  132

Query  400  EWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGVFEGLN  221
             WFQ DD  PF+TAHG+  W Y  ++P+   +FN  MASD RLV+NV+++  + VFEG+ 
Sbjct  133  IWFQTDDQTPFETAHGVPFWKYMRNKPKEGEVFNAGMASDARLVINVLLEKHRSVFEGVE  192

Query  220  SLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTK-NLDYVGGDMFVSIPHANA  44
            SLVDV GGTGTVA+ I++AFP ++CTV DLP V+  L+G + N  YV GDMF  IP A+ 
Sbjct  193  SLVDVGGGTGTVAKAISQAFPQMECTVLDLPQVVAHLKGDQPNFKYVEGDMFTLIPPADT  252

Query  43   LFLKWILHDWNDED  2
            + LKWILHDW+DE+
Sbjct  253  ILLKWILHDWSDEE  266



>ref|XP_011091579.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=358

 Score =   273 bits (697),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 134/263 (51%), Positives = 188/263 (71%), Gaps = 12/263 (5%)
 Frame = -2

Query  766  QDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIP-INKAK  590
            Q +ELL ++  IW  + + I   SLKCA ELGIPD+IHKHG P+TLLEL DA+P ++KAK
Sbjct  8    QSLELLEAEAQIWKQMLNCINPMSLKCATELGIPDVIHKHGGPMTLLELVDALPGVDKAK  67

Query  589  AGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPIL  428
            A  + RLMR L+HSGFF   K      + Y+L   S LL+ D+P S++P++  +  +PIL
Sbjct  68   ADCMYRLMRILVHSGFFVLEKINSSNEEGYSLTPASRLLVGDHPMSMKPYVSQI--HPIL  125

Query  427  ITQPWNHAREWFQN-DDPAPFDTAH-GMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVI  254
            +  P +H   WFQ+ ++P PF T + GM++W+     P F+H+F+++MASDT +V +V+ 
Sbjct  126  L-DPMHHWSRWFQDANNPTPFHTVNNGMSLWELKERHPGFSHLFDQSMASDTSVVADVIT  184

Query  253  KYCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGD  74
            + C+ VFEGL+SLVDV GGTGT+A+ IAEAFP + CTV DL  V+ G++GTKNL Y+ G+
Sbjct  185  RDCRQVFEGLDSLVDVGGGTGTLAKAIAEAFPQIHCTVLDLAPVVAGMDGTKNLKYIEGN  244

Query  73   MFVSIPHANALFLKWILHDWNDE  5
            MF  IP ++A+ LKWILHDW+DE
Sbjct  245  MFEYIPPSDAVLLKWILHDWSDE  267



>ref|XP_010052318.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW89580.1| hypothetical protein EUGRSUZ_A01863 [Eucalyptus grandis]
Length=357

 Score =   273 bits (697),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 133/263 (51%), Positives = 181/263 (69%), Gaps = 10/263 (4%)
 Frame = -2

Query  772  GDQDIELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKA  593
            G+   ELL +Q H+WN++F+ +    LKCAV+L IPD IHKHG+P+T+ EL  A+ I   
Sbjct  6    GEHTGELLKAQAHVWNSVFN-LTGMFLKCAVQLNIPDAIHKHGQPMTVSELVAALQIQPT  64

Query  592  KAGHLARLMRTLIHSGFFFHTK------DAYALAQPSTLLLKDNPFSLRPFLLFLVDNPI  431
            K+G + RLMR L+HSGFF   +        YAL   S LL+KD+PF+    +L ++D  +
Sbjct  65   KSGCVHRLMRVLVHSGFFEERRLEPSDQIGYALNHASELLVKDSPFNSAAMVLAMLDPSV  124

Query  430  LITQPWNHAREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIK  251
            +  + ++    WF N+D   F+TA+GM +W+Y    P+FN +FN+AMASD+RL+  VVI 
Sbjct  125  M--KAYDCLSAWFLNNDRTTFETAYGMKVWEYTAQDPKFNQLFNDAMASDSRLLATVVIN  182

Query  250  YCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDM  71
             C GVFE +NSLVDV GGTG +A+ IA+AF  L+CTVFDLPHV+  L G+ N+ YVGGDM
Sbjct  183  ECAGVFEDINSLVDVGGGTGLMAKAIADAFT-LECTVFDLPHVVADLPGSNNMKYVGGDM  241

Query  70   FVSIPHANALFLKWILHDWNDED  2
            F  IP A+A+ LK +LHDWNDED
Sbjct  242  FKGIPPADAIILKMVLHDWNDED  264



>gb|KGN43480.1| hypothetical protein Csa_7G039280 [Cucumis sativus]
Length=380

 Score =   273 bits (699),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 135/254 (53%), Positives = 176/254 (69%), Gaps = 4/254 (2%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHG-RPITLLELADAIPINKAKAGH  581
            ELL +Q+HIWN+IF++I S SLKCA++LGIPD IH HG  P+ L  L  ++ ++  K   
Sbjct  40   ELLEAQSHIWNHIFNFINSMSLKCAIQLGIPDAIHSHGPNPVPLSILVSSLQLHPNKTQF  99

Query  580  LARLMRTLIHSGFFFHTKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQPWNHAR  401
            + RLMR L HSGFF   ++ Y L   S LLLKDNP ++ PFLL ++  P L T PW    
Sbjct  100  IYRLMRLLTHSGFFVQQEEGYILTNSSRLLLKDNPCAVSPFLLSMLQ-PAL-TDPWQFLS  157

Query  400  EWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGVFEGLN  221
             WFQ DD  PF+TAHG+  W Y  ++P+   +FN  MASD RLV +V++   K VFEG+ 
Sbjct  158  IWFQTDDQTPFETAHGVPFWKYMRNKPKEGEVFNAGMASDARLVNSVLLGKHKSVFEGVK  217

Query  220  SLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTK-NLDYVGGDMFVSIPHANA  44
            SLVDV GGTGT+A+ I++AFP ++CTVFDLP V+  L G + NL+YV GDMF  IP A+ 
Sbjct  218  SLVDVGGGTGTMAKAISQAFPQMECTVFDLPQVVAHLRGDQPNLNYVEGDMFKRIPPADV  277

Query  43   LFLKWILHDWNDED  2
            L LKWILHDW+DE+
Sbjct  278  LLLKWILHDWSDEE  291



>ref|XP_009779391.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=351

 Score =   272 bits (696),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 131/255 (51%), Positives = 181/255 (71%), Gaps = 4/255 (2%)
 Frame = -2

Query  760  IELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLEL-ADAIPINKAKAG  584
            I+LL +QT  WN++F++I SS+ KCA++LGIPD+++KHG+PI+L +L A+   I+++K  
Sbjct  9    IDLLLAQTQTWNHMFNFISSSAAKCAIQLGIPDVVYKHGKPISLSDLTAELSLIDRSKVS  68

Query  583  HLARLMRTLIHSGFF-FHTKDAYALAQPSTLLLKDNPFSLRPFLLFLVDNPILITQPWNH  407
             L  LMR L+HSGF   H  + Y+L   S LL+KD+P S+R + L + D P+L+ + W+ 
Sbjct  69   FLPILMRFLVHSGFLNQHENEHYSLTPASQLLVKDDPLSMRSYFLIIHD-PVLL-KAWSC  126

Query  406  AREWFQNDDPAPFDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIKYCKGVFEG  227
              +W QND    F TAH  ++WDY   +P     FNE+MASD+RL+ NV+I  CK VFEG
Sbjct  127  LNDWLQNDSSTAFHTAHEKSLWDYYVQEPRVGDSFNESMASDSRLIANVLITECKHVFEG  186

Query  226  LNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVIRGLEGTKNLDYVGGDMFVSIPHAN  47
            L SLVDV GGTGTVA  IA+AFP +KCTV DLP V+   +G  N+++VGG MF  IP+AN
Sbjct  187  LTSLVDVGGGTGTVAIAIAKAFPAIKCTVLDLPRVVGNFKGNGNVEFVGGSMFEKIPNAN  246

Query  46   ALFLKWILHDWNDED  2
            A+  KWILH+W+DED
Sbjct  247  AILFKWILHNWSDED  261



>ref|XP_006469063.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X1 [Citrus sinensis]
 ref|XP_006469064.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X2 [Citrus sinensis]
Length=378

 Score =   273 bits (698),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 137/268 (51%), Positives = 186/268 (69%), Gaps = 18/268 (7%)
 Frame = -2

Query  757  ELLNSQTHIWNNIFSYIKSSSLKCAVELGIPDIIHKHGRPITLLELADAIPINKAKAGHL  578
            ELL +Q  +WN  F+YI S SLKCAVELGIPD+IHKHG+P+TL ++A A+ I K KA  +
Sbjct  21   ELLKAQAQVWNCAFNYINSMSLKCAVELGIPDVIHKHGQPMTLSQIASALDIQKNKAHCI  80

Query  577  ARLMRTLIHSGFFFHT----KDA----YALAQPSTLLLKDNPFSLRPFLLFLVDNPILIT  422
             RLMR L+HSGFF       KD     Y+L   S LLLKD P    PF+ FL+ +P  IT
Sbjct  81   QRLMRILVHSGFFAQQNKIDKDESEVYYSLTLASRLLLKDEPSRAAPFM-FLITHPT-IT  138

Query  421  QPWNHAREWFQNDDPAP---FDTAHGMTIWDYAGHQPEFNHMFNEAMASDTRLVMNVVIK  251
             P+N    WF+NDDP+    F++ HG  IW     + +F ++F +AM +D++ + +V+IK
Sbjct  139  TPFNFLSSWFKNDDPSTPTVFESTHGKDIWGCLAQEAKFKNVFYDAMMADSQFISSVLIK  198

Query  250  YCKGVFEGLNSLVDVAGGTGTVARTIAEAFPDLKCTVFDLPHVI----RGLEGT-KNLDY  86
             CK VF+GL  LVD+ GGTGT+A+ IAEAFP++KC VFDLPHV+    +  +GT KNL++
Sbjct  199  DCKEVFKGLKCLVDLGGGTGTMAKAIAEAFPEMKCIVFDLPHVVDNNLQQQQGTNKNLEF  258

Query  85   VGGDMFVSIPHANALFLKWILHDWNDED  2
            +GGDMF +IP A+A+ LKW+LH+W DE+
Sbjct  259  LGGDMFEAIPPADAVLLKWVLHNWGDEE  286



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1590667407420