BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25738_g4_i7 len=470 path=[7119:0-129 24141:130-130 20163:131-204
7249:205-214 4402:215-249 17718:250-369 24588:370-391 24610:392-393
17861:394-411 7589:412-469]

Length=470
                                                                      Score     E

ref|XP_010313267.1|  PREDICTED: topless-related protein 3 isoform X1  89.0    3e-17   
ref|XP_006344707.1|  PREDICTED: topless-related protein 3-like is...  89.0    4e-17   
ref|XP_006344708.1|  PREDICTED: topless-related protein 3-like is...  88.6    4e-17   
ref|XP_006344709.1|  PREDICTED: topless-related protein 3-like is...  88.6    5e-17   
ref|XP_011092107.1|  PREDICTED: topless-related protein 3-like        88.2    6e-17   
ref|XP_004230269.1|  PREDICTED: topless-related protein 3 isoform X3  88.2    6e-17   
ref|XP_010313271.1|  PREDICTED: topless-related protein 3 isoform X2  88.2    6e-17   
ref|XP_009785868.1|  PREDICTED: topless-related protein 3-like        88.2    6e-17   
ref|XP_009766750.1|  PREDICTED: topless-related protein 3-like is...  87.4    1e-16   
ref|XP_009766749.1|  PREDICTED: topless-related protein 3-like is...  87.4    1e-16   
ref|XP_009616373.1|  PREDICTED: topless-related protein 3-like        87.4    1e-16   
ref|XP_004494565.1|  PREDICTED: topless-related protein 3-like        86.7    2e-16   
ref|XP_010938347.1|  PREDICTED: topless-related protein 2-like is...  85.5    5e-16   
ref|XP_010938346.1|  PREDICTED: topless-related protein 2-like is...  85.5    5e-16   
ref|XP_007227035.1|  hypothetical protein PRUPE_ppa000503mg           85.5    5e-16   
ref|XP_008223259.1|  PREDICTED: topless-related protein 2             85.5    5e-16   
ref|XP_009346204.1|  PREDICTED: topless-related protein 2-like is...  85.5    5e-16   
ref|XP_007031065.1|  TOPLESS-related 3 isoform 2                      85.1    5e-16   
ref|XP_008390610.1|  PREDICTED: topless-related protein 2-like        85.5    5e-16   
emb|CDP17223.1|  unnamed protein product                              85.5    6e-16   
ref|XP_008340770.1|  PREDICTED: topless-related protein 2             85.5    6e-16   
ref|XP_008353208.1|  PREDICTED: topless-related protein 2-like        85.5    6e-16   
ref|XP_009346203.1|  PREDICTED: topless-related protein 2-like is...  85.5    6e-16   
gb|KDO71780.1|  hypothetical protein CISIN_1g001178mg                 84.7    9e-16   
gb|KDO71781.1|  hypothetical protein CISIN_1g001178mg                 84.7    9e-16   
ref|XP_007031064.1|  TOPLESS-related 3 isoform 1                      84.7    9e-16   
ref|XP_007031066.1|  TOPLESS-related 3 isoform 3                      84.3    1e-15   
emb|CDY50500.1|  BnaC01g44380D                                        82.4    2e-15   
ref|XP_010528913.1|  PREDICTED: topless-related protein 3-like        83.6    2e-15   
gb|ABD28351.1|  Lissencephaly type-1-like homology motif; CTLH, C...  83.6    3e-15   Medicago truncatula
ref|XP_003591186.1|  WD repeat-containing protein                     83.2    3e-15   
ref|XP_010674104.1|  PREDICTED: topless-related protein 3-like        83.2    3e-15   
ref|XP_006299477.1|  hypothetical protein CARUB_v10015642mg           83.2    3e-15   
gb|KHN03954.1|  Topless-related protein 3                             83.2    3e-15   
ref|XP_006577218.1|  PREDICTED: topless-related protein 3-like        83.2    3e-15   
gb|KFK39016.1|  hypothetical protein AALP_AA3G189500                  83.2    3e-15   
ref|XP_007031068.1|  TOPLESS-related 3                                82.8    4e-15   
ref|XP_010546752.1|  PREDICTED: topless-related protein 3 isoform X2  82.8    4e-15   
ref|XP_010546750.1|  PREDICTED: topless-related protein 3 isoform X1  82.8    4e-15   
ref|XP_010921588.1|  PREDICTED: topless-related protein 2-like is...  82.8    5e-15   
ref|XP_010921589.1|  PREDICTED: topless-related protein 2-like is...  82.8    5e-15   
ref|XP_002883029.1|  hypothetical protein ARALYDRAFT_479149           82.4    5e-15   
ref|XP_006406802.1|  hypothetical protein EUTSA_v10019939mg           82.4    6e-15   
ref|XP_009611828.1|  PREDICTED: topless-related protein 3-like is...  82.4    6e-15   
ref|XP_008790866.1|  PREDICTED: LOW QUALITY PROTEIN: topless-rela...  82.4    6e-15   
ref|XP_003626186.1|  hypothetical protein MTR_7g112460                82.4    6e-15   
ref|XP_009611827.1|  PREDICTED: topless-related protein 3-like is...  82.4    6e-15   
ref|XP_008655511.1|  PREDICTED: LOW QUALITY PROTEIN: topless-rela...  82.4    7e-15   
ref|XP_006489020.1|  PREDICTED: topless-related protein 2-like is...  82.4    7e-15   
ref|XP_006489019.1|  PREDICTED: topless-related protein 2-like is...  82.4    7e-15   
ref|XP_006419483.1|  hypothetical protein CICLE_v10004197mg           82.4    7e-15   
ref|XP_004495685.1|  PREDICTED: topless-related protein 3-like is...  82.0    7e-15   
ref|XP_004495684.1|  PREDICTED: topless-related protein 3-like is...  82.0    7e-15   
emb|CDX95900.1|  BnaC05g36510D                                        82.0    8e-15   
ref|XP_004495686.1|  PREDICTED: topless-related protein 3-like is...  82.0    8e-15   
ref|XP_007144973.1|  hypothetical protein PHAVU_007G198900g           82.0    8e-15   
ref|XP_009114175.1|  PREDICTED: topless-related protein 2             82.0    9e-15   
ref|XP_009146056.1|  PREDICTED: topless-related protein 2-like        82.0    9e-15   
emb|CDX92100.1|  BnaA05g23070D                                        82.0    9e-15   
gb|KDO81760.1|  hypothetical protein CISIN_1g001190mg                 81.6    1e-14   
ref|XP_004144768.1|  PREDICTED: topless-related protein 3-like        81.6    1e-14   
ref|XP_004158753.1|  PREDICTED: topless-related protein 3-like        81.6    1e-14   
ref|XP_002870186.1|  predicted protein                                81.6    1e-14   
ref|XP_008453896.1|  PREDICTED: topless-related protein 3-like        81.6    1e-14   
ref|XP_007035678.1|  TOPLESS-related 2 isoform 4                      81.6    1e-14   
ref|XP_010487553.1|  PREDICTED: topless-related protein 2-like        81.6    1e-14   
ref|XP_010465706.1|  PREDICTED: topless-related protein 2-like        81.6    1e-14   
ref|XP_010504697.1|  PREDICTED: topless-related protein 2             81.6    1e-14   
ref|XP_007035675.1|  TOPLESS-related 2 isoform 1                      81.6    1e-14   
ref|XP_007035676.1|  TOPLESS-related 2 isoform 2                      81.6    1e-14   
ref|XP_007035677.1|  TOPLESS-related 2 isoform 3                      81.3    1e-14   
gb|KDO81759.1|  hypothetical protein CISIN_1g001190mg                 81.3    1e-14   
gb|KDO81755.1|  hypothetical protein CISIN_1g001190mg                 81.3    1e-14   
ref|XP_006285940.1|  hypothetical protein CARUB_v10007460mg           81.3    1e-14   
ref|XP_006472151.1|  PREDICTED: topless-related protein 3-like        81.3    1e-14   
gb|KDO81757.1|  hypothetical protein CISIN_1g001190mg                 81.3    1e-14   
ref|XP_006433483.1|  hypothetical protein CICLE_v10000084mg           81.3    1e-14   
ref|XP_010462722.1|  PREDICTED: protein TOPLESS-like                  81.3    1e-14   
gb|KDO81756.1|  hypothetical protein CISIN_1g001190mg                 81.3    1e-14   
gb|KDO81758.1|  hypothetical protein CISIN_1g001190mg                 81.3    1e-14   
gb|EPS64433.1|  hypothetical protein M569_10348                       80.9    2e-14   
ref|XP_009369993.1|  PREDICTED: topless-related protein 2-like        81.3    2e-14   
ref|XP_010086586.1|  Topless-related protein 3                        81.3    2e-14   
emb|CDY50502.1|  BnaC01g44400D                                        81.3    2e-14   
ref|XP_010094719.1|  Topless-related protein 3                        80.9    2e-14   
gb|KFK27551.1|  hypothetical protein AALP_AA8G398300                  80.9    2e-14   
gb|EPS69182.1|  hypothetical protein M569_05580                       80.9    2e-14   
ref|XP_006606545.1|  PREDICTED: topless-related protein 3-like        80.9    2e-14   
ref|XP_010449856.1|  PREDICTED: topless-related protein 2-like        80.5    2e-14   
ref|XP_010259449.1|  PREDICTED: topless-related protein 2 isoform X2  80.5    2e-14   
ref|XP_010259450.1|  PREDICTED: topless-related protein 2 isoform X3  80.5    2e-14   
ref|XP_010259448.1|  PREDICTED: topless-related protein 2 isoform X1  80.5    2e-14   
ref|XP_010440213.1|  PREDICTED: topless-related protein 2-like        80.5    2e-14   
ref|XP_006841513.1|  hypothetical protein AMTR_s00003p00142040        80.1    3e-14   
ref|NP_188306.2|  Topless-related 2 protein                           80.5    3e-14   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA95777.1|  unnamed protein product                              80.1    3e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004508183.1|  PREDICTED: topless-related protein 2-like        80.1    3e-14   
ref|XP_007204953.1|  hypothetical protein PRUPE_ppa000487mg           79.7    5e-14   
ref|XP_011023731.1|  PREDICTED: topless-related protein 3-like        79.7    5e-14   
ref|XP_004967836.1|  PREDICTED: topless-related protein 2-like        79.7    5e-14   
ref|XP_002319498.2|  WD-40 repeat family protein                      79.7    5e-14   Populus trichocarpa [western balsam poplar]
ref|XP_008795824.1|  PREDICTED: topless-related protein 2-like        79.7    5e-14   
gb|KDP23429.1|  hypothetical protein JCGZ_23262                       78.6    5e-14   
ref|XP_010524852.1|  PREDICTED: topless-related protein 3-like is...  79.7    5e-14   
ref|XP_010524851.1|  PREDICTED: topless-related protein 3-like is...  79.3    6e-14   
ref|XP_009338219.1|  PREDICTED: topless-related protein 3 isoform X2  79.3    6e-14   
ref|XP_006644007.1|  PREDICTED: topless-related protein 2-like        79.3    6e-14   
ref|XP_009338217.1|  PREDICTED: topless-related protein 3 isoform X1  79.3    6e-14   
ref|XP_010043204.1|  PREDICTED: topless-related protein 3-like        79.3    6e-14   
ref|XP_008245640.1|  PREDICTED: topless-related protein 3             79.3    6e-14   
ref|XP_008370406.1|  PREDICTED: topless-related protein 3-like is...  79.3    7e-14   
ref|XP_008370405.1|  PREDICTED: topless-related protein 3-like is...  79.3    7e-14   
ref|XP_010024093.1|  PREDICTED: topless-related protein 3 isoform X1  79.3    7e-14   
gb|KCW60526.1|  hypothetical protein EUGRSUZ_H03269                   79.3    7e-14   
ref|XP_002307097.2|  WD-40 repeat family protein                      79.0    8e-14   Populus trichocarpa [western balsam poplar]
ref|XP_010024094.1|  PREDICTED: topless-related protein 3 isoform X2  79.0    8e-14   
gb|KCW60528.1|  hypothetical protein EUGRSUZ_H03269                   79.0    8e-14   
ref|XP_008388509.1|  PREDICTED: topless-related protein 3-like        78.6    1e-13   
ref|XP_004296880.1|  PREDICTED: topless-related protein 2-like        78.6    1e-13   
gb|KHG26583.1|  Topless-related 3 -like protein                       78.6    1e-13   
ref|XP_011036914.1|  PREDICTED: topless-related protein 3             78.2    1e-13   
ref|XP_009421409.1|  PREDICTED: topless-related protein 2-like        78.2    1e-13   
ref|XP_007031067.1|  Transducin family protein / WD-40 repeat fam...  78.2    2e-13   
ref|XP_010245461.1|  PREDICTED: topless-related protein 2-like is...  77.8    2e-13   
ref|NP_001042616.1|  Os01g0254100                                     77.8    2e-13   Oryza sativa Japonica Group [Japonica rice]
gb|EAY73338.1|  hypothetical protein OsI_01216                        77.8    2e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_010245460.1|  PREDICTED: topless-related protein 2-like is...  77.8    2e-13   
ref|XP_006414395.1|  hypothetical protein EUTSA_v10024263mg           77.8    2e-13   
ref|XP_006589131.1|  PREDICTED: topless-related protein 3-like is...  77.8    2e-13   
ref|XP_006589130.1|  PREDICTED: topless-related protein 3-like is...  77.4    3e-13   
gb|KHN16088.1|  Topless-related protein 3                             77.4    3e-13   
ref|XP_008673872.1|  PREDICTED: topless-related protein 2 isoform X2  77.4    3e-13   
gb|KHG04331.1|  Topless-related 2 -like protein                       77.4    3e-13   
ref|XP_008673871.1|  PREDICTED: topless-related protein 2 isoform X1  77.4    3e-13   
ref|XP_002512473.1|  WD-repeat protein, putative                      77.0    3e-13   Ricinus communis
ref|XP_006604796.1|  PREDICTED: topless-related protein 3-like        77.0    4e-13   
ref|XP_009382516.1|  PREDICTED: topless-related protein 2-like is...  77.0    4e-13   
ref|XP_009382518.1|  PREDICTED: topless-related protein 2-like is...  77.0    4e-13   
ref|XP_009382517.1|  PREDICTED: topless-related protein 2-like is...  77.0    4e-13   
tpg|DAA53973.1|  TPA: hypothetical protein ZEAMMB73_351755            76.6    6e-13   
ref|XP_007163344.1|  hypothetical protein PHAVU_001G227000g           75.5    1e-12   
ref|XP_007163345.1|  hypothetical protein PHAVU_001G227000g           75.5    1e-12   
ref|XP_002283157.1|  PREDICTED: topless-related protein 3             74.7    2e-12   Vitis vinifera
emb|CAN79774.1|  hypothetical protein VITISV_013612                   74.7    2e-12   Vitis vinifera
ref|XP_009129893.1|  PREDICTED: topless-related protein 3             73.9    5e-12   
gb|EMS62858.1|  Topless-related protein 2                             73.9    5e-12   
ref|XP_009151171.1|  PREDICTED: LOW QUALITY PROTEIN: topless-rela...  73.6    5e-12   
emb|CDX80607.1|  BnaC07g28370D                                        73.6    5e-12   
emb|CDX88252.1|  BnaA06g28430D                                        73.6    5e-12   
gb|EMT25315.1|  hypothetical protein F775_09004                       73.2    7e-12   
ref|XP_006382415.1|  WD-40 repeat family protein                      67.4    9e-12   
dbj|BAJ88304.1|  predicted protein                                    72.4    9e-12   
gb|AES91919.2|  topless-like protein                                  72.8    1e-11   
emb|CDY05552.1|  BnaA02g31390D                                        72.8    1e-11   
ref|XP_010230707.1|  PREDICTED: topless-related protein 2-like is...  72.4    1e-11   
ref|XP_003566431.1|  PREDICTED: topless-related protein 2-like is...  72.4    1e-11   
ref|XP_003609722.1|  WD repeat-containing protein                     72.4    1e-11   
ref|XP_010230706.1|  PREDICTED: topless-related protein 2-like is...  72.4    1e-11   
dbj|BAJ96033.1|  predicted protein                                    72.4    1e-11   
dbj|BAJ85297.1|  predicted protein                                    72.4    1e-11   
dbj|BAJ91882.1|  predicted protein                                    72.0    1e-11   
emb|CDM82632.1|  unnamed protein product                              72.0    2e-11   
gb|KEH37175.1|  topless-like protein                                  71.2    3e-11   
gb|AAD48936.1|AF160760_4  contains similarity to Pfam family PF00...  70.9    4e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004487868.1|  PREDICTED: topless-related protein 2-like        70.5    6e-11   
ref|XP_010933383.1|  PREDICTED: topless-related protein 1-like is...  69.7    1e-10   
ref|XP_010933382.1|  PREDICTED: topless-related protein 1-like is...  69.7    1e-10   
ref|XP_004245913.1|  PREDICTED: topless-related protein 1-like is...  69.7    1e-10   
ref|XP_010325597.1|  PREDICTED: topless-related protein 1-like is...  69.7    1e-10   
ref|XP_010325598.1|  PREDICTED: topless-related protein 1-like is...  69.7    1e-10   
emb|CDY25010.1|  BnaC02g39980D                                        69.3    1e-10   
ref|NP_001190409.1|  Topless-related protein 3                        69.3    1e-10   
ref|NP_198055.3|  Topless-related protein 3                           69.3    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001768092.1|  predicted protein                                69.3    1e-10   
ref|XP_001781989.1|  predicted protein                                69.3    2e-10   
ref|XP_006394928.1|  hypothetical protein EUTSA_v10003550mg           68.9    2e-10   
ref|XP_009395448.1|  PREDICTED: topless-related protein 1-like is...  68.6    2e-10   
ref|XP_009395446.1|  PREDICTED: topless-related protein 1-like is...  68.6    2e-10   
gb|ABG29319.1|  Beta transducin-like protein, putative                68.2    3e-10   Solanum bulbocastanum [ornamental nightshade]
ref|XP_008788808.1|  PREDICTED: protein TOPLESS-like                  68.6    3e-10   
ref|XP_009396116.1|  PREDICTED: protein TOPLESS-like isoform X2       68.2    4e-10   
ref|XP_009396112.1|  PREDICTED: protein TOPLESS-like isoform X1       68.2    4e-10   
ref|XP_009801466.1|  PREDICTED: topless-related protein 1-like is...  67.8    4e-10   
ref|XP_006352935.1|  PREDICTED: protein TOPLESS-like isoform X1       67.8    4e-10   
ref|XP_009801463.1|  PREDICTED: topless-related protein 1-like is...  67.8    4e-10   
ref|XP_006352936.1|  PREDICTED: protein TOPLESS-like isoform X2       67.8    4e-10   
ref|XP_009400780.1|  PREDICTED: topless-related protein 1-like        67.8    4e-10   
ref|XP_009396205.1|  PREDICTED: topless-related protein 1-like        67.0    7e-10   
ref|XP_010920062.1|  PREDICTED: protein TOPLESS-like                  67.0    8e-10   
ref|XP_010278758.1|  PREDICTED: topless-related protein 1-like is...  66.6    1e-09   
ref|XP_010278757.1|  PREDICTED: topless-related protein 1-like is...  66.6    1e-09   
ref|XP_009597375.1|  PREDICTED: topless-related protein 1-like is...  66.6    1e-09   
ref|XP_009597374.1|  PREDICTED: topless-related protein 1-like is...  66.6    1e-09   
ref|XP_009395323.1|  PREDICTED: protein TOPLESS-like isoform X3       66.6    1e-09   
ref|XP_009397650.1|  PREDICTED: topless-related protein 1-like        66.6    1e-09   
ref|XP_009395318.1|  PREDICTED: protein TOPLESS-like isoform X1       66.6    1e-09   
ref|XP_009395322.1|  PREDICTED: protein TOPLESS-like isoform X2       66.6    1e-09   
ref|XP_009597373.1|  PREDICTED: topless-related protein 1-like is...  66.2    1e-09   
ref|XP_009597371.1|  PREDICTED: topless-related protein 1-like is...  66.2    1e-09   
gb|KFK25571.1|  hypothetical protein AALP_AA8G132300                  65.9    1e-09   
ref|XP_010943653.1|  PREDICTED: topless-related protein 1-like is...  66.2    1e-09   
ref|XP_010943652.1|  PREDICTED: topless-related protein 1-like is...  66.2    1e-09   
ref|XP_007155033.1|  hypothetical protein PHAVU_003G167500g           66.2    1e-09   
ref|XP_007155035.1|  hypothetical protein PHAVU_003G167500g           66.2    1e-09   
ref|XP_006381123.1|  hypothetical protein POPTR_0006s06570g           66.2    1e-09   
ref|XP_002308068.1|  WD-40 repeat family protein                      66.2    2e-09   Populus trichocarpa [western balsam poplar]
ref|XP_010250290.1|  PREDICTED: protein TOPLESS-like isoform X4       65.9    2e-09   
ref|XP_010250289.1|  PREDICTED: protein TOPLESS-like isoform X3       65.9    2e-09   
ref|XP_010250288.1|  PREDICTED: protein TOPLESS-like isoform X2       65.9    2e-09   
ref|XP_010250287.1|  PREDICTED: protein TOPLESS-like isoform X1       65.9    2e-09   
ref|XP_010243111.1|  PREDICTED: protein TOPLESS-like                  65.9    2e-09   
ref|XP_008798009.1|  PREDICTED: topless-related protein 1-like is...  65.5    2e-09   
ref|XP_008798012.1|  PREDICTED: protein TOPLESS-like isoform X2       65.5    2e-09   
ref|XP_008803470.1|  PREDICTED: topless-related protein 1-like is...  65.5    3e-09   
ref|XP_008803471.1|  PREDICTED: topless-related protein 1-like is...  65.5    3e-09   
ref|XP_009595073.1|  PREDICTED: topless-related protein 4-like is...  65.5    3e-09   
ref|XP_009595072.1|  PREDICTED: topless-related protein 4-like is...  65.5    3e-09   
ref|XP_006659155.1|  PREDICTED: protein TOPLESS-like                  65.1    3e-09   
ref|XP_009803406.1|  PREDICTED: topless-related protein 4-like is...  65.1    3e-09   
ref|XP_009803412.1|  PREDICTED: topless-related protein 4-like is...  65.1    3e-09   
ref|XP_007155034.1|  hypothetical protein PHAVU_003G167500g           65.1    4e-09   
ref|XP_007155032.1|  hypothetical protein PHAVU_003G167500g           65.1    4e-09   
ref|XP_007220318.1|  hypothetical protein PRUPE_ppa000528m1g          64.7    4e-09   
gb|EYU23277.1|  hypothetical protein MIMGU_mgv1a000461mg              64.7    5e-09   
ref|XP_010662133.1|  PREDICTED: protein TOPLESS isoform X1            64.3    6e-09   
ref|XP_010662135.1|  PREDICTED: protein TOPLESS isoform X4            64.3    6e-09   
ref|XP_002275116.1|  PREDICTED: protein TOPLESS isoform X3            64.3    6e-09   Vitis vinifera
ref|XP_010662134.1|  PREDICTED: protein TOPLESS isoform X2            64.3    6e-09   
ref|XP_011092591.1|  PREDICTED: topless-related protein 1-like is...  63.9    8e-09   
ref|XP_011092592.1|  PREDICTED: topless-related protein 1-like is...  63.9    8e-09   
ref|XP_011092590.1|  PREDICTED: topless-related protein 1-like is...  63.9    8e-09   
gb|EMS49891.1|  Topless-related protein 1                             63.9    8e-09   
gb|KDP30260.1|  hypothetical protein JCGZ_17042                       63.9    8e-09   
ref|XP_010034955.1|  PREDICTED: protein TOPLESS-like isoform X2       63.9    9e-09   
ref|XP_006854127.1|  hypothetical protein AMTR_s00048p00159380        63.9    9e-09   
gb|EMT24067.1|  hypothetical protein F775_25939                       63.9    9e-09   
ref|XP_010034954.1|  PREDICTED: protein TOPLESS-like isoform X1       63.9    9e-09   
ref|XP_008242803.1|  PREDICTED: topless-related protein 4-like        63.2    1e-08   
ref|XP_008786937.1|  PREDICTED: topless-related protein 1-like        62.4    1e-08   
gb|AES91574.2|  topless-like protein                                  63.2    2e-08   
gb|KEH32128.1|  topless-like protein                                  63.2    2e-08   
ref|XP_003609377.1|  WD repeat-containing protein                     63.2    2e-08   
gb|KCW80030.1|  hypothetical protein EUGRSUZ_C013682                  61.6    2e-08   
gb|KCW80104.1|  hypothetical protein EUGRSUZ_C01431                   62.4    2e-08   
ref|XP_006358294.1|  PREDICTED: topless-related protein 4-like is...  62.8    2e-08   
ref|XP_006358293.1|  PREDICTED: topless-related protein 4-like is...  62.8    2e-08   
gb|EPS70365.1|  hypothetical protein M569_04393                       62.8    2e-08   
ref|XP_006443166.1|  hypothetical protein CICLE_v100185902mg          62.0    2e-08   
gb|KDO50585.1|  hypothetical protein CISIN_1g0011592mg                61.6    2e-08   
ref|XP_007138952.1|  hypothetical protein PHAVU_009G252100g           62.4    3e-08   
ref|XP_008337262.1|  PREDICTED: topless-related protein 4             62.4    3e-08   
ref|XP_006443164.1|  hypothetical protein CICLE_v100185902mg          61.6    3e-08   
ref|XP_007204297.1|  hypothetical protein PRUPE_ppa000492mg           62.4    3e-08   
ref|XP_010250163.1|  PREDICTED: protein TOPLESS-like                  62.4    3e-08   
gb|KDO50579.1|  hypothetical protein CISIN_1g0011592mg                62.0    3e-08   
gb|KDO50578.1|  hypothetical protein CISIN_1g0011592mg                61.6    3e-08   
ref|XP_009368882.1|  PREDICTED: topless-related protein 4-like        62.0    3e-08   
ref|XP_006584165.1|  PREDICTED: protein TOPLESS-like                  62.0    3e-08   
gb|KCW80034.1|  hypothetical protein EUGRSUZ_C013682                  61.6    3e-08   
gb|KHN22119.1|  Topless-related protein 4                             62.0    3e-08   
ref|XP_006443165.1|  hypothetical protein CICLE_v100185902mg          61.2    3e-08   
ref|XP_011020160.1|  PREDICTED: topless-related protein 4-like is...  62.0    3e-08   
ref|XP_011020157.1|  PREDICTED: topless-related protein 4-like is...  62.0    3e-08   
ref|XP_003549747.1|  PREDICTED: topless-related protein 4-like is...  62.0    3e-08   
ref|XP_006600746.1|  PREDICTED: topless-related protein 4-like is...  62.0    3e-08   
gb|KDO50584.1|  hypothetical protein CISIN_1g0011592mg                61.6    3e-08   
ref|XP_011020159.1|  PREDICTED: topless-related protein 4-like is...  62.0    3e-08   
ref|XP_006594237.1|  PREDICTED: topless-related protein 4-like is...  62.0    4e-08   
ref|XP_006594236.1|  PREDICTED: topless-related protein 4-like is...  62.0    4e-08   
ref|XP_006585625.1|  PREDICTED: protein TOPLESS-like isoform X1       62.0    4e-08   
gb|KDO50583.1|  hypothetical protein CISIN_1g0011592mg                61.6    4e-08   
ref|XP_007135775.1|  hypothetical protein PHAVU_010G157700g           62.0    4e-08   
gb|KHN38006.1|  Topless-related protein 1                             61.6    4e-08   
ref|XP_010047997.1|  PREDICTED: topless-related protein 4-like is...  61.2    4e-08   
gb|KCW80031.1|  hypothetical protein EUGRSUZ_C013682                  61.2    4e-08   
ref|XP_010691083.1|  PREDICTED: protein TOPLESS                       61.6    4e-08   
ref|XP_006478900.1|  PREDICTED: protein TOPLESS-like isoform X2       61.6    4e-08   
ref|XP_006478899.1|  PREDICTED: protein TOPLESS-like isoform X1       61.6    4e-08   
ref|XP_010942722.1|  PREDICTED: protein TOPLESS-like                  61.6    5e-08   
ref|XP_008801888.1|  PREDICTED: protein TOPLESS-like                  61.6    5e-08   
gb|KDO80172.1|  hypothetical protein CISIN_1g001163mg                 61.6    5e-08   
ref|XP_010906011.1|  PREDICTED: protein TOPLESS                       61.6    5e-08   
ref|XP_010050139.1|  PREDICTED: topless-related protein 4-like        61.6    5e-08   
ref|XP_006450874.1|  hypothetical protein CICLE_v10007287mg           61.6    5e-08   
ref|XP_010244892.1|  PREDICTED: topless-related protein 1-like is...  61.2    5e-08   
gb|KDO80173.1|  hypothetical protein CISIN_1g001163mg                 61.2    6e-08   
ref|XP_010244887.1|  PREDICTED: topless-related protein 1-like is...  61.2    6e-08   
ref|XP_008363005.1|  PREDICTED: topless-related protein 4-like        61.2    6e-08   
ref|XP_010244894.1|  PREDICTED: topless-related protein 1-like is...  61.2    6e-08   
ref|XP_010244893.1|  PREDICTED: topless-related protein 1-like is...  61.2    6e-08   
gb|KDO80174.1|  hypothetical protein CISIN_1g001163mg                 61.2    6e-08   
ref|XP_004508472.1|  PREDICTED: topless-related protein 4-like is...  61.2    7e-08   
ref|XP_004508471.1|  PREDICTED: topless-related protein 4-like is...  61.2    7e-08   
emb|CDP21023.1|  unnamed protein product                              60.1    7e-08   
gb|EYU29078.1|  hypothetical protein MIMGU_mgv1a000445mg              61.2    7e-08   
ref|XP_004165979.1|  PREDICTED: topless-related protein 4-like        60.8    7e-08   
ref|XP_010656455.1|  PREDICTED: topless-related protein 4 isoform X5  61.2    7e-08   
ref|NP_001061055.1|  Os08g0162100                                     61.2    7e-08   
ref|XP_003558327.1|  PREDICTED: topless-related protein 1-like        61.2    7e-08   
ref|XP_004139298.1|  PREDICTED: topless-related protein 4-like        60.8    7e-08   
ref|XP_008456978.1|  PREDICTED: topless-related protein 4-like is...  60.8    8e-08   
ref|XP_009611336.1|  PREDICTED: protein TOPLESS-like                  60.8    8e-08   
ref|XP_008456972.1|  PREDICTED: topless-related protein 4-like is...  60.8    8e-08   
ref|XP_008456966.1|  PREDICTED: topless-related protein 4-like is...  60.8    8e-08   
ref|XP_008456943.1|  PREDICTED: topless-related protein 4-like is...  60.8    8e-08   
dbj|BAC99788.1|  WD-40 repeat protein-like                            60.8    8e-08   
ref|XP_010656454.1|  PREDICTED: topless-related protein 4 isoform X4  60.8    8e-08   
ref|XP_002285341.2|  PREDICTED: topless-related protein 4 isoform X3  60.8    8e-08   
ref|XP_010656452.1|  PREDICTED: topless-related protein 4 isoform X1  60.8    8e-08   
ref|XP_009796750.1|  PREDICTED: protein TOPLESS-like                  60.8    8e-08   
ref|XP_010687938.1|  PREDICTED: topless-related protein 4             60.8    8e-08   
ref|XP_010656453.1|  PREDICTED: topless-related protein 4 isoform X2  60.8    8e-08   
ref|XP_002324641.2|  WD-40 repeat family protein                      60.8    9e-08   
ref|XP_010241551.1|  PREDICTED: topless-related protein 1-like is...  60.8    9e-08   
ref|XP_010241550.1|  PREDICTED: topless-related protein 4-like is...  60.8    9e-08   
gb|EPS69099.1|  hypothetical protein M569_05666                       60.8    9e-08   
ref|XP_010050618.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  60.8    1e-07   
ref|XP_011017797.1|  PREDICTED: topless-related protein 4-like is...  60.5    1e-07   
ref|XP_011017798.1|  PREDICTED: topless-related protein 4-like is...  60.5    1e-07   
ref|XP_010927352.1|  PREDICTED: protein TOPLESS                       60.5    1e-07   
ref|XP_009363995.1|  PREDICTED: topless-related protein 4-like        60.5    1e-07   
ref|XP_008813124.1|  PREDICTED: protein TOPLESS-like isoform X1       60.1    1e-07   
ref|XP_006306622.1|  hypothetical protein CARUB_v10008139mg           60.1    1e-07   
ref|XP_010533140.1|  PREDICTED: topless-related protein 4-like        60.1    2e-07   
ref|XP_010318715.1|  PREDICTED: protein TOPLESS-like isoform X1       60.1    2e-07   
ref|XP_010318717.1|  PREDICTED: protein TOPLESS-like isoform X2       59.7    2e-07   
gb|ACN26367.1|  unknown                                               59.3    2e-07   
ref|XP_004242769.1|  PREDICTED: topless-related protein 4-like is...  59.7    2e-07   
dbj|BAJ97681.1|  predicted protein                                    59.3    2e-07   
ref|XP_010323294.1|  PREDICTED: topless-related protein 4-like is...  59.7    2e-07   
ref|XP_009117812.1|  PREDICTED: protein TOPLESS                       59.7    2e-07   
gb|ABF48719.1|  WD-40 repeat protein-like                             58.9    2e-07   
gb|EMT12268.1|  hypothetical protein F775_05335                       59.7    2e-07   
emb|CDX81729.1|  BnaC08g38720D                                        59.7    2e-07   
ref|NP_563981.1|  protein TOPLESS                                     59.7    2e-07   
ref|XP_002892877.1|  wus-interacting protein 1                        59.3    2e-07   
emb|CDY53312.1|  BnaA09g56690D                                        59.3    2e-07   
ref|NP_001167872.2|  ramosa 1 enhancer locus 2                        59.3    2e-07   
ref|XP_010497362.1|  PREDICTED: protein TOPLESS                       59.3    2e-07   
ref|XP_009407206.1|  PREDICTED: protein TOPLESS-like                  59.3    2e-07   
ref|XP_010103710.1|  Topless-related protein 4                        59.3    3e-07   
ref|NP_001049587.1|  Os03g0254700                                     59.3    3e-07   
ref|XP_009386232.1|  PREDICTED: protein TOPLESS-like                  59.3    3e-07   
ref|XP_008380984.1|  PREDICTED: topless-related protein 1-like        59.3    3e-07   
gb|EMS60597.1|  Topless-related protein 1                             59.3    3e-07   
dbj|BAJ91520.1|  predicted protein                                    59.3    3e-07   
gb|KDO50581.1|  hypothetical protein CISIN_1g0011592mg                58.9    3e-07   
gb|EEC74885.1|  hypothetical protein OsI_10796                        59.3    3e-07   
gb|AAF82145.1|AC034256_9  Strong similarity to an unknown protein...  59.3    3e-07   
emb|CDO98186.1|  unnamed protein product                              59.3    3e-07   
gb|KGN60698.1|  hypothetical protein Csa_2G007420                     58.9    3e-07   
ref|XP_011017799.1|  PREDICTED: topless-related protein 4-like is...  58.9    3e-07   
ref|XP_006855163.1|  hypothetical protein AMTR_s00051p00079490        58.9    3e-07   
ref|XP_008788792.1|  PREDICTED: topless-related protein 1-like is...  58.9    3e-07   
ref|XP_008788791.1|  PREDICTED: topless-related protein 1-like is...  58.9    4e-07   
ref|XP_006649759.1|  PREDICTED: protein TOPLESS-like                  58.9    4e-07   
ref|XP_007013507.1|  WUS-interacting protein 2 isoform 2              58.9    4e-07   
ref|XP_007013508.1|  WUS-interacting protein 2 isoform 3              58.9    4e-07   
ref|XP_007013506.1|  WUS-interacting protein 2 isoform 1              58.9    4e-07   
ref|XP_009395915.1|  PREDICTED: topless-related protein 1-like        58.9    4e-07   
ref|XP_007013510.1|  WUS-interacting protein 2 isoform 5              58.9    4e-07   
gb|KCW59942.1|  hypothetical protein EUGRSUZ_H02668                   58.5    4e-07   
ref|XP_009348312.1|  PREDICTED: protein TOPLESS-like                  58.5    5e-07   
ref|XP_011011325.1|  PREDICTED: protein TOPLESS-like                  58.5    5e-07   
ref|XP_006341391.1|  PREDICTED: protein TOPLESS-like                  58.2    5e-07   
ref|XP_002527178.1|  WD-repeat protein, putative                      58.2    6e-07   
ref|XP_010026693.1|  PREDICTED: topless-related protein 4-like        58.2    6e-07   
ref|XP_004287287.1|  PREDICTED: topless-related protein 4-like        58.2    7e-07   
ref|XP_009338495.1|  PREDICTED: protein TOPLESS                       58.2    7e-07   
ref|XP_008372696.1|  PREDICTED: protein TOPLESS                       58.2    7e-07   
gb|AFW88943.1|  hypothetical protein ZEAMMB73_764411                  57.4    7e-07   
ref|XP_011073378.1|  PREDICTED: protein TOPLESS                       57.8    8e-07   
ref|XP_010476664.1|  PREDICTED: protein TOPLESS-like                  57.8    8e-07   
ref|XP_006416884.1|  hypothetical protein EUTSA_v10006622mg           57.8    8e-07   
ref|XP_009148962.1|  PREDICTED: protein TOPLESS                       57.8    8e-07   
emb|CDY36584.1|  BnaA06g10370D                                        57.8    8e-07   
emb|CDY33387.1|  BnaC05g11960D                                        57.8    8e-07   
ref|XP_002439315.1|  hypothetical protein SORBIDRAFT_09g004230        57.0    9e-07   
gb|AFW88942.1|  hypothetical protein ZEAMMB73_764411                  57.4    1e-06   
ref|XP_004984975.1|  PREDICTED: protein TOPLESS-like isoform X4       57.4    1e-06   
gb|KGN52925.1|  hypothetical protein Csa_4G006320                     57.4    1e-06   
ref|XP_008228737.1|  PREDICTED: protein TOPLESS                       57.4    1e-06   
ref|XP_004165893.1|  PREDICTED: LOW QUALITY PROTEIN: protein TOPL...  57.4    1e-06   
ref|XP_008454191.1|  PREDICTED: protein TOPLESS                       57.4    1e-06   
ref|XP_004152185.1|  PREDICTED: protein TOPLESS-like                  57.4    1e-06   
ref|XP_007214907.1|  hypothetical protein PRUPE_ppa000478mg           57.4    1e-06   
ref|XP_002443908.1|  hypothetical protein SORBIDRAFT_07g004180        57.4    1e-06   
ref|XP_010928279.1|  PREDICTED: protein TOPLESS-like                  57.4    1e-06   
ref|XP_007013513.1|  Transducin family protein / WD-40 repeat fam...  57.0    1e-06   
ref|XP_007013512.1|  Transducin family protein / WD-40 repeat fam...  57.0    1e-06   
ref|XP_004486641.1|  PREDICTED: protein TOPLESS-like isoform X2       57.0    1e-06   
ref|XP_007150781.1|  hypothetical protein PHAVU_005G180100g           57.0    1e-06   
ref|XP_004486640.1|  PREDICTED: protein TOPLESS-like isoform X1       57.0    1e-06   
ref|XP_007013509.1|  WUS-interacting protein 2 isoform 4              57.0    1e-06   
ref|XP_006301454.1|  hypothetical protein CARUB_v10021876mg           57.0    1e-06   
ref|XP_009405763.1|  PREDICTED: protein TOPLESS-like isoform X3       57.0    1e-06   
ref|XP_010928337.1|  PREDICTED: protein TOPLESS-like isoform X3       57.0    1e-06   
ref|XP_009405760.1|  PREDICTED: protein TOPLESS-like isoform X1       57.0    2e-06   
gb|KCW70755.1|  hypothetical protein EUGRSUZ_F03923                   57.0    2e-06   
ref|XP_010063532.1|  PREDICTED: protein TOPLESS isoform X2            57.0    2e-06   
ref|XP_010928338.1|  PREDICTED: protein TOPLESS-like isoform X4       57.0    2e-06   
ref|XP_010928336.1|  PREDICTED: protein TOPLESS-like isoform X2       57.0    2e-06   
ref|XP_010928335.1|  PREDICTED: protein TOPLESS-like isoform X1       57.0    2e-06   
ref|XP_009405761.1|  PREDICTED: protein TOPLESS-like isoform X2       56.6    2e-06   
gb|KCW80110.1|  hypothetical protein EUGRSUZ_C01437                   56.6    2e-06   
ref|XP_010928339.1|  PREDICTED: protein TOPLESS-like isoform X5       56.6    2e-06   
gb|KCW70760.1|  hypothetical protein EUGRSUZ_F03923                   56.6    2e-06   
gb|KCW70761.1|  hypothetical protein EUGRSUZ_F03923                   56.6    2e-06   
ref|XP_004506964.1|  PREDICTED: protein TOPLESS-like                  56.6    2e-06   
gb|KCW70759.1|  hypothetical protein EUGRSUZ_F03923                   56.6    2e-06   
gb|AES86542.2|  topless-like protein                                  56.6    2e-06   
ref|XP_003599718.1|  WD repeat-containing protein, putative           56.6    2e-06   
ref|XP_010545756.1|  PREDICTED: topless-related protein 4             56.6    2e-06   
ref|XP_003543688.1|  PREDICTED: protein TOPLESS-like isoform X1       56.6    2e-06   
ref|XP_010063530.1|  PREDICTED: protein TOPLESS isoform X1            56.6    2e-06   
gb|KCW70758.1|  hypothetical protein EUGRSUZ_F03923                   56.6    2e-06   
ref|XP_011044878.1|  PREDICTED: topless-related protein 1 isoform X2  56.6    2e-06   
ref|XP_010048001.1|  PREDICTED: topless-related protein 4-like is...  56.2    2e-06   
ref|XP_007023319.1|  TOPLESS-related 1 isoform 1                      56.6    2e-06   
ref|XP_011044877.1|  PREDICTED: topless-related protein 1 isoform X1  56.6    2e-06   
gb|KCW80076.1|  hypothetical protein EUGRSUZ_C01409                   56.2    2e-06   
gb|KHG11821.1|  Protein TOPLESS -like protein                         56.6    2e-06   
ref|XP_002967419.1|  hypothetical protein SELMODRAFT_439915           56.2    2e-06   
ref|XP_007023323.1|  Transducin family protein / WD-40 repeat fam...  56.2    2e-06   
ref|XP_002517701.1|  WD-repeat protein, putative                      56.2    2e-06   
ref|XP_004972767.1|  PREDICTED: topless-related protein 1-like        56.2    2e-06   
ref|XP_006595172.1|  PREDICTED: protein TOPLESS-like isoform X3       56.2    2e-06   
ref|XP_010047999.1|  PREDICTED: topless-related protein 4-like is...  56.2    2e-06   
ref|XP_004984974.1|  PREDICTED: protein TOPLESS-like isoform X3       56.2    2e-06   
ref|XP_004984972.1|  PREDICTED: protein TOPLESS-like isoform X1       56.2    2e-06   
ref|XP_002960294.1|  hypothetical protein SELMODRAFT_163891           56.2    2e-06   
ref|XP_010048000.1|  PREDICTED: topless-related protein 4-like is...  56.2    2e-06   
gb|EYU21655.1|  hypothetical protein MIMGU_mgv1a000483mg              56.2    2e-06   
ref|XP_010462721.1|  PREDICTED: protein TOPLESS-like                  56.2    2e-06   
ref|XP_002887825.1|  hypothetical protein ARALYDRAFT_895943           56.2    2e-06   
gb|KHN22427.1|  Topless-related protein 1                             56.2    2e-06   
ref|XP_006597113.1|  PREDICTED: protein TOPLESS-like isoform X1       56.2    3e-06   
ref|XP_010532341.1|  PREDICTED: protein TOPLESS                       56.2    3e-06   
gb|AES68183.2|  topless-like protein                                  56.2    3e-06   
ref|XP_003597933.1|  WD repeat-containing protein, putative           56.2    3e-06   
ref|XP_003597931.1|  WD repeat-containing protein, putative           56.2    3e-06   
tpg|DAA44432.1|  TPA: hypothetical protein ZEAMMB73_624785            56.2    3e-06   
gb|KDO52285.1|  hypothetical protein CISIN_1g0012242mg                55.8    3e-06   
gb|AES68182.2|  topless-like protein                                  56.2    3e-06   
gb|KEH39610.1|  topless-like protein                                  56.2    3e-06   
gb|KDO52286.1|  hypothetical protein CISIN_1g0012242mg                55.8    3e-06   
gb|KDO52287.1|  hypothetical protein CISIN_1g0012242mg                55.8    3e-06   
ref|XP_003597932.1|  WD repeat-containing protein, putative           56.2    3e-06   
ref|XP_010099861.1|  Topless-related protein 1                        56.2    3e-06   
gb|KEH39609.1|  topless-like protein                                  56.2    3e-06   
gb|ACN26165.1|  unknown                                               56.2    3e-06   
ref|XP_010539522.1|  PREDICTED: protein TOPLESS-like                  55.8    3e-06   
gb|KDP37032.1|  hypothetical protein JCGZ_06088                       55.8    3e-06   
ref|XP_006427465.1|  hypothetical protein CICLE_v10024745mg           55.8    3e-06   
gb|AAN62336.1|AF506028_3  CTV.2                                       55.8    3e-06   
ref|XP_006427463.1|  hypothetical protein CICLE_v10024745mg           55.8    3e-06   
gb|KCW80090.1|  hypothetical protein EUGRSUZ_C01417                   55.1    4e-06   
ref|XP_006427464.1|  hypothetical protein CICLE_v10024745mg           55.8    4e-06   
ref|XP_002981766.1|  hypothetical protein SELMODRAFT_115161           55.8    4e-06   
ref|XP_006492116.1|  PREDICTED: protein TOPLESS-like isoform X1       55.8    4e-06   
ref|XP_002967579.1|  hypothetical protein SELMODRAFT_88677            55.8    4e-06   
ref|XP_006492117.1|  PREDICTED: protein TOPLESS-like isoform X2       55.8    4e-06   
ref|XP_002465540.1|  hypothetical protein SORBIDRAFT_01g040800        55.5    4e-06   
ref|XP_006389801.1|  hypothetical protein EUTSA_v10018037mg           55.5    4e-06   
ref|XP_006389802.1|  hypothetical protein EUTSA_v10018037mg           55.5    4e-06   
emb|CDX79383.1|  BnaC06g19200D                                        55.5    4e-06   
ref|XP_009104466.1|  PREDICTED: LOW QUALITY PROTEIN: topless-rela...  55.5    4e-06   
emb|CDX67950.1|  BnaA07g19900D                                        55.5    4e-06   
ref|XP_010417699.1|  PREDICTED: topless-related protein 1-like        55.5    4e-06   
ref|XP_010472917.1|  PREDICTED: topless-related protein 1 isoform X2  55.5    4e-06   
ref|XP_006369294.1|  WD-40 repeat family protein                      55.5    4e-06   
ref|XP_010472920.1|  PREDICTED: topless-related protein 1 isoform X4  55.5    4e-06   
ref|XP_010472918.1|  PREDICTED: topless-related protein 1 isoform X3  55.5    4e-06   
dbj|BAE98958.1|  hypothetical protein                                 55.5    5e-06   
ref|NP_849913.2|  Topless-related protein 1                           55.5    5e-06   
ref|NP_178164.3|  Topless-related protein 1                           55.5    5e-06   
ref|XP_010472916.1|  PREDICTED: topless-related protein 1 isoform X1  55.5    5e-06   
ref|XP_009772956.1|  PREDICTED: topless-related protein 4 isoform X2  55.5    5e-06   
ref|XP_009772955.1|  PREDICTED: topless-related protein 4 isoform X1  55.5    5e-06   
gb|KCW80007.1|  hypothetical protein EUGRSUZ_C013433                  53.5    5e-06   
ref|XP_004303268.1|  PREDICTED: protein TOPLESS-like                  55.1    6e-06   
gb|KCW80072.1|  hypothetical protein EUGRSUZ_C01404                   55.1    6e-06   
ref|XP_010087497.1|  Protein TOPLESS                                  55.1    6e-06   
gb|KHG27106.1|  Topless-related 1 -like protein                       55.1    7e-06   
ref|XP_011073420.1|  PREDICTED: topless-related protein 4             55.1    7e-06   
emb|CDP11748.1|  unnamed protein product                              52.8    7e-06   
emb|CDX75851.1|  BnaC03g39340D                                        54.7    7e-06   
ref|XP_009135464.1|  PREDICTED: topless-related protein 4             54.7    8e-06   
emb|CDX82426.1|  BnaA03g33950D                                        54.7    8e-06   
gb|EYU21684.1|  hypothetical protein MIMGU_mgv1a000459mg              54.7    8e-06   
ref|XP_007023317.1|  TOPLESS-related 1 isoform 2                      53.9    8e-06   
ref|XP_002440623.1|  hypothetical protein SORBIDRAFT_09g004210        54.3    9e-06   
ref|XP_010047995.1|  PREDICTED: uncharacterized protein LOC104436835  54.7    9e-06   
ref|XP_010050604.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  54.3    1e-05   
ref|XP_002520011.1|  conserved hypothetical protein                   54.3    1e-05   
ref|XP_006406906.1|  hypothetical protein EUTSA_v10019944mg           54.3    1e-05   
gb|KHG04944.1|  Topless-related 1 -like protein                       54.3    1e-05   
ref|XP_010099862.1|  Protein TOPLESS                                  53.9    1e-05   
ref|XP_002268265.1|  PREDICTED: protein TOPLESS                       53.9    1e-05   
ref|XP_006364222.1|  PREDICTED: topless-related protein 4-like        53.9    1e-05   



>ref|XP_010313267.1| PREDICTED: topless-related protein 3 isoform X1 [Solanum lycopersicum]
Length=1155

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +I+DQ QCR+V+MP+ SD+  K+ARLLYTNSGV ILAL S+G QKLWKW+ NEQNPS
Sbjct  768  QLTEILDQAQCRLVTMPESSDSNNKVARLLYTNSGVGILALGSNGTQKLWKWTRNEQNPS  827



>ref|XP_006344707.1| PREDICTED: topless-related protein 3-like isoform X1 [Solanum 
tuberosum]
Length=1155

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +I+DQ QCR+V+MP+ SD+  K+ARLLYTNSGV ILAL S+G QKLWKW+ NEQNPS
Sbjct  768  QLTEILDQAQCRLVTMPESSDSNNKVARLLYTNSGVGILALGSNGTQKLWKWTRNEQNPS  827



>ref|XP_006344708.1| PREDICTED: topless-related protein 3-like isoform X2 [Solanum 
tuberosum]
Length=1132

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +I+DQ QCR+V+MP+ SD+  K+ARLLYTNSGV ILAL S+G QKLWKW+ NEQNPS
Sbjct  745  QLTEILDQAQCRLVTMPESSDSNNKVARLLYTNSGVGILALGSNGTQKLWKWTRNEQNPS  804



>ref|XP_006344709.1| PREDICTED: topless-related protein 3-like isoform X3 [Solanum 
tuberosum]
Length=1131

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +I+DQ QCR+V+MP+ SD+  K+ARLLYTNSGV ILAL S+G QKLWKW+ NEQNPS
Sbjct  744  QLTEILDQAQCRLVTMPESSDSNNKVARLLYTNSGVGILALGSNGTQKLWKWTRNEQNPS  803



>ref|XP_011092107.1| PREDICTED: topless-related protein 3-like [Sesamum indicum]
Length=1129

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 50/60 (83%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +IVD VQCR+V+MP  +DA  K+ARLLYTNSGV +LAL S+GIQKLWKW  NEQNPS
Sbjct  742  QLTEIVDPVQCRMVTMPDSADATNKVARLLYTNSGVGVLALGSNGIQKLWKWIRNEQNPS  801



>ref|XP_004230269.1| PREDICTED: topless-related protein 3 isoform X3 [Solanum lycopersicum]
Length=1131

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +I+DQ QCR+V+MP+ SD+  K+ARLLYTNSGV ILAL S+G QKLWKW+ NEQNPS
Sbjct  744  QLTEILDQAQCRLVTMPESSDSNNKVARLLYTNSGVGILALGSNGTQKLWKWTRNEQNPS  803



>ref|XP_010313271.1| PREDICTED: topless-related protein 3 isoform X2 [Solanum lycopersicum]
Length=1132

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +I+DQ QCR+V+MP+ SD+  K+ARLLYTNSGV ILAL S+G QKLWKW+ NEQNPS
Sbjct  745  QLTEILDQAQCRLVTMPESSDSNNKVARLLYTNSGVGILALGSNGTQKLWKWTRNEQNPS  804



>ref|XP_009785868.1| PREDICTED: topless-related protein 3-like [Nicotiana sylvestris]
Length=1129

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 53/63 (84%), Gaps = 2/63 (3%)
 Frame = +2

Query  284  NRTKLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQ  457
             + +L +I+D+VQCRI++MP+  ++  K+ARLLYTNSGV ILAL S+GIQKLWKW+ NEQ
Sbjct  738  TKPQLTEILDKVQCRIITMPESPESGNKVARLLYTNSGVGILALGSNGIQKLWKWARNEQ  797

Query  458  NPS  466
            NPS
Sbjct  798  NPS  800



>ref|XP_009766750.1| PREDICTED: topless-related protein 3-like isoform X2 [Nicotiana 
sylvestris]
Length=1131

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 51/60 (85%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +I+DQ QCR+V+MP+ SD+  K+ARLLYTNSGV +LAL S+G QKLWKW+ NEQNPS
Sbjct  744  QLTEILDQAQCRMVTMPESSDSSNKVARLLYTNSGVGVLALGSNGTQKLWKWARNEQNPS  803



>ref|XP_009766749.1| PREDICTED: topless-related protein 3-like isoform X1 [Nicotiana 
sylvestris]
Length=1132

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 51/60 (85%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +I+DQ QCR+V+MP+ SD+  K+ARLLYTNSGV +LAL S+G QKLWKW+ NEQNPS
Sbjct  745  QLTEILDQAQCRMVTMPESSDSSNKVARLLYTNSGVGVLALGSNGTQKLWKWARNEQNPS  804



>ref|XP_009616373.1| PREDICTED: topless-related protein 3-like [Nicotiana tomentosiformis]
Length=1132

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 51/60 (85%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +I+DQ QCR+V+MP+ SD+  K+ARLLYTNSGV +LAL S+G QKLWKW+ NEQNPS
Sbjct  745  QLTEILDQAQCRMVTMPESSDSSNKVARLLYTNSGVGVLALGSNGTQKLWKWARNEQNPS  804



>ref|XP_004494565.1| PREDICTED: topless-related protein 3-like [Cicer arietinum]
Length=1151

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 51/66 (77%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            +RTK W   +IVD VQCR+V+MP  +D+  K+ RLLYTNSG  ILAL S+G+QKLWKW  
Sbjct  757  DRTKSWQLSEIVDPVQCRLVTMPDSTDSSSKVVRLLYTNSGAGILALGSNGVQKLWKWVR  816

Query  449  NEQNPS  466
            NEQNPS
Sbjct  817  NEQNPS  822



>ref|XP_010938347.1| PREDICTED: topless-related protein 2-like isoform X2 [Elaeis 
guineensis]
Length=1134

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 55/67 (82%), Gaps = 5/67 (7%)
 Frame = +2

Query  281  PNRTKLWD---IVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWS  445
            P++TK W+   I++  QCR+V+MP+ +D+  K+ARLLYTNSGV +LAL S+G+QKLWKWS
Sbjct  740  PDKTKPWELAEILNPKQCRVVTMPESTDSAGKVARLLYTNSGVGLLALGSNGVQKLWKWS  799

Query  446  YNEQNPS  466
             +EQNPS
Sbjct  800  RSEQNPS  806



>ref|XP_010938346.1| PREDICTED: topless-related protein 2-like isoform X1 [Elaeis 
guineensis]
Length=1135

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 55/67 (82%), Gaps = 5/67 (7%)
 Frame = +2

Query  281  PNRTKLWD---IVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWS  445
            P++TK W+   I++  QCR+V+MP+ +D+  K+ARLLYTNSGV +LAL S+G+QKLWKWS
Sbjct  741  PDKTKPWELAEILNPKQCRVVTMPESTDSAGKVARLLYTNSGVGLLALGSNGVQKLWKWS  800

Query  446  YNEQNPS  466
             +EQNPS
Sbjct  801  RSEQNPS  807



>ref|XP_007227035.1| hypothetical protein PRUPE_ppa000503mg [Prunus persica]
 gb|EMJ28234.1| hypothetical protein PRUPE_ppa000503mg [Prunus persica]
Length=1125

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 2/62 (3%)
 Frame = +2

Query  287  RTKLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQN  460
            R +L +IVD V+CR+V+MP+  D   K+ARLLYTNSG  ILAL S+G+QKLWKWS NEQN
Sbjct  745  RWELAEIVDPVKCRVVTMPESKDPANKVARLLYTNSGSGILALGSNGVQKLWKWSRNEQN  804

Query  461  PS  466
            PS
Sbjct  805  PS  806



>ref|XP_008223259.1| PREDICTED: topless-related protein 2 [Prunus mume]
Length=1125

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 2/62 (3%)
 Frame = +2

Query  287  RTKLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQN  460
            R +L +IVD V+CR+V+MP+  D   K+ARLLYTNSG  ILAL S+G+QKLWKWS NEQN
Sbjct  745  RWELAEIVDPVKCRVVTMPESKDPANKVARLLYTNSGSGILALGSNGVQKLWKWSRNEQN  804

Query  461  PS  466
            PS
Sbjct  805  PS  806



>ref|XP_009346204.1| PREDICTED: topless-related protein 2-like isoform X2 [Pyrus x 
bretschneideri]
Length=1141

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 2/62 (3%)
 Frame = +2

Query  287  RTKLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQN  460
            R +L +IVD VQCR+ +MP+  D   K+ARLLYTNSG  ILAL S+G+QKLWKWS NEQN
Sbjct  760  RWELAEIVDPVQCRVATMPESKDPANKVARLLYTNSGSGILALGSNGVQKLWKWSRNEQN  819

Query  461  PS  466
            PS
Sbjct  820  PS  821



>ref|XP_007031065.1| TOPLESS-related 3 isoform 2 [Theobroma cacao]
 gb|EOY11567.1| TOPLESS-related 3 isoform 2 [Theobroma cacao]
Length=816

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 51/65 (78%), Gaps = 5/65 (8%)
 Frame = +2

Query  287  RTKLW---DIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSYN  451
            +TK W   +IVD +QCR+V++P  +D  +K+ RLLYTNSGV ILAL S+G+QKLWKW  N
Sbjct  740  KTKPWQLAEIVDPIQCRLVTLPDSTDTSSKVVRLLYTNSGVGILALGSNGVQKLWKWPRN  799

Query  452  EQNPS  466
            EQNPS
Sbjct  800  EQNPS  804



>ref|XP_008390610.1| PREDICTED: topless-related protein 2-like [Malus domestica]
Length=1146

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 2/62 (3%)
 Frame = +2

Query  287  RTKLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQN  460
            R +L +IVD VQCR+ +MP+  D   K+ARLLYTNSG  ILAL S+G+QKLWKWS NEQN
Sbjct  765  RWELAEIVDPVQCRVATMPESKDPANKVARLLYTNSGSGILALGSNGVQKLWKWSRNEQN  824

Query  461  PS  466
            PS
Sbjct  825  PS  826



>emb|CDP17223.1| unnamed protein product [Coffea canephora]
Length=1132

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 50/60 (83%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +IVD V CR+V+MP+ +DA  K+ARLLYTNSGV +LAL S+G+QKLWKW  NEQNPS
Sbjct  744  QLAEIVDPVHCRMVTMPESTDAGNKVARLLYTNSGVGLLALGSNGVQKLWKWVRNEQNPS  803



>ref|XP_008340770.1| PREDICTED: topless-related protein 2 [Malus domestica]
Length=1127

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 2/62 (3%)
 Frame = +2

Query  287  RTKLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQN  460
            R +L +IVD VQCR+ +MP+  D   K+ARLLYTNSG  ILAL S+G+QKLWKWS NEQN
Sbjct  746  RWELAEIVDPVQCRVATMPESKDPANKVARLLYTNSGSGILALGSNGVQKLWKWSRNEQN  805

Query  461  PS  466
            PS
Sbjct  806  PS  807



>ref|XP_008353208.1| PREDICTED: topless-related protein 2-like [Malus domestica]
Length=1137

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 2/62 (3%)
 Frame = +2

Query  287  RTKLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQN  460
            R +L +IVD VQCR+ +MP+  D   K+ARLLYTNSG  ILAL S+G+QKLWKWS NEQN
Sbjct  756  RWELAEIVDPVQCRVATMPESKDPANKVARLLYTNSGSGILALGSNGVQKLWKWSRNEQN  815

Query  461  PS  466
            PS
Sbjct  816  PS  817



>ref|XP_009346203.1| PREDICTED: topless-related protein 2-like isoform X1 [Pyrus x 
bretschneideri]
Length=1167

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 2/62 (3%)
 Frame = +2

Query  287  RTKLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQN  460
            R +L +IVD VQCR+ +MP+  D   K+ARLLYTNSG  ILAL S+G+QKLWKWS NEQN
Sbjct  786  RWELAEIVDPVQCRVATMPESKDPANKVARLLYTNSGSGILALGSNGVQKLWKWSRNEQN  845

Query  461  PS  466
            PS
Sbjct  846  PS  847



>gb|KDO71780.1| hypothetical protein CISIN_1g001178mg [Citrus sinensis]
Length=1131

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 54/66 (82%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLWD---IVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            ++TK W+   IVD +QCR+V+MP+ +D+  K+ARLLYTNSG+ ILAL S+G+QKLWKW+ 
Sbjct  739  DKTKPWELTEIVDPLQCRVVAMPESTDSASKVARLLYTNSGIGILALWSNGVQKLWKWNR  798

Query  449  NEQNPS  466
             EQNPS
Sbjct  799  TEQNPS  804



>gb|KDO71781.1| hypothetical protein CISIN_1g001178mg [Citrus sinensis]
Length=1130

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 54/66 (82%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLWD---IVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            ++TK W+   IVD +QCR+V+MP+ +D+  K+ARLLYTNSG+ ILAL S+G+QKLWKW+ 
Sbjct  739  DKTKPWELTEIVDPLQCRVVAMPESTDSASKVARLLYTNSGIGILALWSNGVQKLWKWNR  798

Query  449  NEQNPS  466
             EQNPS
Sbjct  799  TEQNPS  804



>ref|XP_007031064.1| TOPLESS-related 3 isoform 1 [Theobroma cacao]
 gb|EOY11566.1| TOPLESS-related 3 isoform 1 [Theobroma cacao]
Length=1132

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 51/65 (78%), Gaps = 5/65 (8%)
 Frame = +2

Query  287  RTKLW---DIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSYN  451
            +TK W   +IVD +QCR+V++P  +D  +K+ RLLYTNSGV ILAL S+G+QKLWKW  N
Sbjct  740  KTKPWQLAEIVDPIQCRLVTLPDSTDTSSKVVRLLYTNSGVGILALGSNGVQKLWKWPRN  799

Query  452  EQNPS  466
            EQNPS
Sbjct  800  EQNPS  804



>ref|XP_007031066.1| TOPLESS-related 3 isoform 3 [Theobroma cacao]
 gb|EOY11568.1| TOPLESS-related 3 isoform 3 [Theobroma cacao]
Length=1091

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 51/65 (78%), Gaps = 5/65 (8%)
 Frame = +2

Query  287  RTKLW---DIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSYN  451
            +TK W   +IVD +QCR+V++P  +D  +K+ RLLYTNSGV ILAL S+G+QKLWKW  N
Sbjct  740  KTKPWQLAEIVDPIQCRLVTLPDSTDTSSKVVRLLYTNSGVGILALGSNGVQKLWKWPRN  799

Query  452  EQNPS  466
            EQNPS
Sbjct  800  EQNPS  804



>emb|CDY50500.1| BnaC01g44380D [Brassica napus]
Length=505

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +IVD  QCR V+MP   D+  K+ARLLYTNSGV +LAL ++G+Q+LWKWS NEQNP+
Sbjct  118  ELTEIVDPTQCRQVTMPDSKDSVSKVARLLYTNSGVGVLALEANGVQRLWKWSRNEQNPT  177



>ref|XP_010528913.1| PREDICTED: topless-related protein 3-like [Tarenaya hassleriana]
Length=1106

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 40/72 (56%), Positives = 52/72 (72%), Gaps = 5/72 (7%)
 Frame = +2

Query  266  GHSSGPNRTKLWD---IVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQK  430
            G      +TK W+   I+D  QCR+V++P  +D  +K+ RLLYTNSGV ILAL S+GIQK
Sbjct  709  GGEDASEKTKPWELAEILDPAQCRLVALPDTTDTTSKVVRLLYTNSGVGILALGSNGIQK  768

Query  431  LWKWSYNEQNPS  466
            LWKW+ NEQNP+
Sbjct  769  LWKWARNEQNPT  780



>gb|ABD28351.1| Lissencephaly type-1-like homology motif; CTLH, C-terminal to 
LisH motif; Nitrous oxide reductase, N-terminal; WD40-like; 
Quinonprotein alcohol dehydrogenase-like [Medicago truncatula]
 gb|AES61437.2| topless-like protein [Medicago truncatula]
Length=1128

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            +RTK W   +I+D VQCR V+MP  +D+  K+ RLLYTNS V ILAL S+G+QKLWKW+ 
Sbjct  735  DRTKSWQLTEILDPVQCRSVTMPDTTDSFSKVVRLLYTNSAVGILALGSNGVQKLWKWAR  794

Query  449  NEQNPS  466
            NEQNP+
Sbjct  795  NEQNPT  800



>ref|XP_003591186.1| WD repeat-containing protein [Medicago truncatula]
Length=1140

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            +RTK W   +I+D VQCR V+MP  +D+  K+ RLLYTNS V ILAL S+G+QKLWKW+ 
Sbjct  747  DRTKSWQLTEILDPVQCRSVTMPDTTDSFSKVVRLLYTNSAVGILALGSNGVQKLWKWAR  806

Query  449  NEQNPS  466
            NEQNP+
Sbjct  807  NEQNPT  812



>ref|XP_010674104.1| PREDICTED: topless-related protein 3-like [Beta vulgaris subsp. 
vulgaris]
Length=1096

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 51/60 (85%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +IV+  QCR+V++P+ +++  K+ARLLYTN+GV ILAL S+GIQKLWKWS NEQNPS
Sbjct  709  QLTEIVEPAQCRLVTLPESTESFSKVARLLYTNNGVGILALGSNGIQKLWKWSRNEQNPS  768



>ref|XP_006299477.1| hypothetical protein CARUB_v10015642mg [Capsella rubella]
 gb|EOA32375.1| hypothetical protein CARUB_v10015642mg [Capsella rubella]
Length=1127

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +IVD  QCR V+MP   D+  K+ARLLYTNSGV +LAL S+G+Q+LWKWS NEQNPS
Sbjct  739  ELAEIVDPTQCRQVTMPDSKDSVSKVARLLYTNSGVGVLALGSNGVQRLWKWSRNEQNPS  798



>gb|KHN03954.1| Topless-related protein 3 [Glycine soja]
Length=1107

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 51/67 (76%), Gaps = 5/67 (7%)
 Frame = +2

Query  278  GPNRTKLW---DIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKW  442
            G +R K W   +IVD VQCR+V+MP  +D+  K+ RLLYTNSG  +LAL S+G+QKLWKW
Sbjct  711  GVDRAKPWQLSEIVDAVQCRLVTMPDSTDSSSKVVRLLYTNSGAGVLALGSNGVQKLWKW  770

Query  443  SYNEQNP  463
            + +EQNP
Sbjct  771  ARSEQNP  777



>ref|XP_006577218.1| PREDICTED: topless-related protein 3-like [Glycine max]
Length=1130

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 51/67 (76%), Gaps = 5/67 (7%)
 Frame = +2

Query  278  GPNRTKLW---DIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKW  442
            G +R K W   +IVD VQCR+V+MP  +D+  K+ RLLYTNSG  +LAL S+G+QKLWKW
Sbjct  734  GVDRAKPWQLSEIVDAVQCRLVTMPDSTDSSSKVVRLLYTNSGAGVLALGSNGVQKLWKW  793

Query  443  SYNEQNP  463
            + +EQNP
Sbjct  794  ARSEQNP  800



>gb|KFK39016.1| hypothetical protein AALP_AA3G189500 [Arabis alpina]
Length=1131

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +IVD  QCR V+MP   D+  K+ARLLYTNSGV ILAL ++G+Q+LWKWS NEQNPS
Sbjct  743  ELTEIVDPTQCRQVTMPDSKDSVSKVARLLYTNSGVGILALGANGVQRLWKWSRNEQNPS  802



>ref|XP_007031068.1| TOPLESS-related 3 [Theobroma cacao]
 gb|EOY11570.1| TOPLESS-related 3 [Theobroma cacao]
Length=715

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 50/65 (77%), Gaps = 5/65 (8%)
 Frame = +2

Query  287  RTKLW---DIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSYN  451
            +TK W   +IVD +QCR+V++P  +D  +K+ RLLYTNSG  ILAL S+G+QKLWKW  N
Sbjct  303  KTKPWQLAEIVDPLQCRLVNLPDSTDTSSKVVRLLYTNSGFGILALGSNGVQKLWKWPRN  362

Query  452  EQNPS  466
            EQNPS
Sbjct  363  EQNPS  367



>ref|XP_010546752.1| PREDICTED: topless-related protein 3 isoform X2 [Tarenaya hassleriana]
Length=1108

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 39/66 (59%), Positives = 52/66 (79%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            ++TK W   +I+D VQCR +++P+ SD+  K+ RLLYTNSGV ILAL S+GIQ+LW+W  
Sbjct  721  DKTKPWQLAEILDPVQCRQITLPESSDSSTKVIRLLYTNSGVGILALGSNGIQRLWRWPR  780

Query  449  NEQNPS  466
            NEQNPS
Sbjct  781  NEQNPS  786



>ref|XP_010546750.1| PREDICTED: topless-related protein 3 isoform X1 [Tarenaya hassleriana]
Length=1110

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 39/66 (59%), Positives = 52/66 (79%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            ++TK W   +I+D VQCR +++P+ SD+  K+ RLLYTNSGV ILAL S+GIQ+LW+W  
Sbjct  723  DKTKPWQLAEILDPVQCRQITLPESSDSSTKVIRLLYTNSGVGILALGSNGIQRLWRWPR  782

Query  449  NEQNPS  466
            NEQNPS
Sbjct  783  NEQNPS  788



>ref|XP_010921588.1| PREDICTED: topless-related protein 2-like isoform X1 [Elaeis 
guineensis]
Length=1136

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 54/67 (81%), Gaps = 5/67 (7%)
 Frame = +2

Query  281  PNRTKLWD---IVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWS  445
            P++TK W+   I++  QCR+V+MP+ +D+  K+ARLLYTNSGV +LAL S+ +Q+LWKWS
Sbjct  742  PDKTKPWELAEILNPQQCRVVTMPESTDSASKVARLLYTNSGVGLLALGSNAVQRLWKWS  801

Query  446  YNEQNPS  466
             +EQNPS
Sbjct  802  RSEQNPS  808



>ref|XP_010921589.1| PREDICTED: topless-related protein 2-like isoform X2 [Elaeis 
guineensis]
Length=1135

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 54/67 (81%), Gaps = 5/67 (7%)
 Frame = +2

Query  281  PNRTKLWD---IVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWS  445
            P++TK W+   I++  QCR+V+MP+ +D+  K+ARLLYTNSGV +LAL S+ +Q+LWKWS
Sbjct  741  PDKTKPWELAEILNPQQCRVVTMPESTDSASKVARLLYTNSGVGLLALGSNAVQRLWKWS  800

Query  446  YNEQNPS  466
             +EQNPS
Sbjct  801  RSEQNPS  807



>ref|XP_002883029.1| hypothetical protein ARALYDRAFT_479149 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59288.1| hypothetical protein ARALYDRAFT_479149 [Arabidopsis lyrata subsp. 
lyrata]
Length=1131

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +IVD  QCR V+MP   D+  K+ARLLYTNSGV +LAL S+G+Q+LWKWS NEQNP+
Sbjct  743  ELTEIVDPTQCRQVTMPDSKDSVSKVARLLYTNSGVGVLALGSNGVQRLWKWSRNEQNPT  802



>ref|XP_006406802.1| hypothetical protein EUTSA_v10019939mg [Eutrema salsugineum]
 gb|ESQ48255.1| hypothetical protein EUTSA_v10019939mg [Eutrema salsugineum]
Length=1131

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +IVD  QCR V+MP   D+  K+ARLLYTNSGV ILAL ++G+Q+LWKWS NEQNP+
Sbjct  743  ELTEIVDPTQCRQVTMPDSKDSVSKVARLLYTNSGVGILALGANGVQRLWKWSRNEQNPT  802



>ref|XP_009611828.1| PREDICTED: topless-related protein 3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=1101

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 51/63 (81%), Gaps = 2/63 (3%)
 Frame = +2

Query  284  NRTKLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQ  457
             +  L +I+D+ QCR++SMP+  ++  K+ARLLYTNSGV IL+L S+GIQKLWKW+ NEQ
Sbjct  710  TKPHLTEILDKDQCRVISMPESLESGNKVARLLYTNSGVGILSLGSNGIQKLWKWARNEQ  769

Query  458  NPS  466
            NPS
Sbjct  770  NPS  772



>ref|XP_008790866.1| PREDICTED: LOW QUALITY PROTEIN: topless-related protein 2-like 
[Phoenix dactylifera]
Length=1138

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 53/67 (79%), Gaps = 5/67 (7%)
 Frame = +2

Query  281  PNRTKLWD---IVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWS  445
            P++ K W+   I++  QCR+V+MP+ +D+  K+ARLLYTNSGV +LAL S+G+Q+LWKWS
Sbjct  742  PDKIKPWELAEILNPQQCRVVTMPESTDSATKVARLLYTNSGVGLLALGSNGVQRLWKWS  801

Query  446  YNEQNPS  466
              EQNPS
Sbjct  802  RREQNPS  808



>ref|XP_003626186.1| hypothetical protein MTR_7g112460 [Medicago truncatula]
 gb|AES82404.1| topless-like protein [Medicago truncatula]
Length=1129

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTK---LWDIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            +RTK   L++IVD   CR+V+MP  +D  +K+ RLLYTNSG  +LAL S+G+QKLWKWS 
Sbjct  737  DRTKSWQLFEIVDPAHCRLVTMPDSTDTSSKVVRLLYTNSGAGLLALGSNGVQKLWKWSR  796

Query  449  NEQNPS  466
            N+QNPS
Sbjct  797  NDQNPS  802



>ref|XP_009611827.1| PREDICTED: topless-related protein 3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=1129

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 51/63 (81%), Gaps = 2/63 (3%)
 Frame = +2

Query  284  NRTKLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQ  457
             +  L +I+D+ QCR++SMP+  ++  K+ARLLYTNSGV IL+L S+GIQKLWKW+ NEQ
Sbjct  738  TKPHLTEILDKDQCRVISMPESLESGNKVARLLYTNSGVGILSLGSNGIQKLWKWARNEQ  797

Query  458  NPS  466
            NPS
Sbjct  798  NPS  800



>ref|XP_008655511.1| PREDICTED: LOW QUALITY PROTEIN: topless-related protein 2-like 
[Zea mays]
Length=1462

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 56/85 (66%), Gaps = 7/85 (8%)
 Frame = +2

Query  218   ESIDGDEDVEEYKSDAGHSSGPNRTKLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSG  391
              SID    + E KSD   +S     +L ++++  QCR+ +MP+  D   K+ RLLYTNSG
Sbjct  1061  RSIDIKARISEEKSDKAKAS-----ELMEVLNPQQCRVATMPETPDQARKVVRLLYTNSG  1115

Query  392   VSILALSSDGIQKLWKWSYNEQNPS  466
             V +LAL S+ IQ+LWKWS NEQNPS
Sbjct  1116  VGLLALGSNAIQRLWKWSRNEQNPS  1140



>ref|XP_006489020.1| PREDICTED: topless-related protein 2-like isoform X2 [Citrus 
sinensis]
Length=1131

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 53/66 (80%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLWD---IVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            ++TK W+   IVD +QCR+V+MP+ +D+  K+ARLLYTNSG+ ILAL S+G+QKLWKW+ 
Sbjct  739  DKTKPWELTEIVDPLQCRVVAMPESTDSASKVARLLYTNSGIGILALWSNGVQKLWKWNR  798

Query  449  NEQNPS  466
             E NPS
Sbjct  799  TELNPS  804



>ref|XP_006489019.1| PREDICTED: topless-related protein 2-like isoform X1 [Citrus 
sinensis]
Length=1130

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 53/66 (80%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLWD---IVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            ++TK W+   IVD +QCR+V+MP+ +D+  K+ARLLYTNSG+ ILAL S+G+QKLWKW+ 
Sbjct  739  DKTKPWELTEIVDPLQCRVVAMPESTDSASKVARLLYTNSGIGILALWSNGVQKLWKWNR  798

Query  449  NEQNPS  466
             E NPS
Sbjct  799  TELNPS  804



>ref|XP_006419483.1| hypothetical protein CICLE_v10004197mg [Citrus clementina]
 gb|ESR32723.1| hypothetical protein CICLE_v10004197mg [Citrus clementina]
Length=1131

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 53/66 (80%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLWD---IVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            ++TK W+   IVD +QCR+V+MP+ +D+  K+ARLLYTNSG+ ILAL S+G+QKLWKW+ 
Sbjct  739  DKTKPWELTEIVDPLQCRVVAMPESTDSTSKVARLLYTNSGIGILALWSNGVQKLWKWNR  798

Query  449  NEQNPS  466
             E NPS
Sbjct  799  TELNPS  804



>ref|XP_004495685.1| PREDICTED: topless-related protein 3-like isoform X2 [Cicer arietinum]
Length=1123

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            +RTK W   +I+D VQCR V+MP  +D+  K+ RLLYTNS V ILAL S+G+QKLWKW+ 
Sbjct  735  DRTKPWQLSEILDPVQCRSVTMPDNADSFSKVVRLLYTNSAVGILALGSNGVQKLWKWAR  794

Query  449  NEQNPS  466
            NEQNP+
Sbjct  795  NEQNPT  800



>ref|XP_004495684.1| PREDICTED: topless-related protein 3-like isoform X1 [Cicer arietinum]
Length=1124

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            +RTK W   +I+D VQCR V+MP  +D+  K+ RLLYTNS V ILAL S+G+QKLWKW+ 
Sbjct  736  DRTKPWQLSEILDPVQCRSVTMPDNADSFSKVVRLLYTNSAVGILALGSNGVQKLWKWAR  795

Query  449  NEQNPS  466
            NEQNP+
Sbjct  796  NEQNPT  801



>emb|CDX95900.1| BnaC05g36510D [Brassica napus]
Length=1136

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +IVD  QCR V+MP   D+  K+ARLLYTNSGV +LAL ++G+Q+LWKWS NEQNP+
Sbjct  747  ELTEIVDPTQCRQVTMPDSKDSVSKVARLLYTNSGVGVLALGANGVQRLWKWSRNEQNPT  806



>ref|XP_004495686.1| PREDICTED: topless-related protein 3-like isoform X3 [Cicer arietinum]
Length=1115

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            +RTK W   +I+D VQCR V+MP  +D+  K+ RLLYTNS V ILAL S+G+QKLWKW+ 
Sbjct  734  DRTKPWQLSEILDPVQCRSVTMPDNADSFSKVVRLLYTNSAVGILALGSNGVQKLWKWAR  793

Query  449  NEQNPS  466
            NEQNP+
Sbjct  794  NEQNPT  799



>ref|XP_007144973.1| hypothetical protein PHAVU_007G198900g [Phaseolus vulgaris]
 gb|ESW16967.1| hypothetical protein PHAVU_007G198900g [Phaseolus vulgaris]
Length=1132

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 50/64 (78%), Gaps = 5/64 (8%)
 Frame = +2

Query  290  TKLW---DIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNE  454
            TK W   +I+D VQCR V+MP+ +D+  K+ RLLYTNSGV ILAL S+G QKLWKW+ NE
Sbjct  741  TKPWQLSEILDPVQCRSVTMPESTDSSSKVVRLLYTNSGVGILALGSNGTQKLWKWARNE  800

Query  455  QNPS  466
            QNP+
Sbjct  801  QNPT  804



>ref|XP_009114175.1| PREDICTED: topless-related protein 2 [Brassica rapa]
Length=1135

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +IVD  QCR V+MP   D+  K+ARLLYTNSGV +LAL ++G+Q+LWKWS NEQNP+
Sbjct  746  ELTEIVDPTQCRQVTMPDSKDSVSKVARLLYTNSGVGVLALGANGVQRLWKWSRNEQNPT  805



>ref|XP_009146056.1| PREDICTED: topless-related protein 2-like [Brassica rapa]
Length=1132

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +IVD  QCR V+MP   D+  K+ARLLYTNSGV +LAL ++G+Q+LWKWS NEQNP+
Sbjct  742  ELTEIVDPTQCRQVTMPDSKDSVSKVARLLYTNSGVGVLALGANGVQRLWKWSRNEQNPT  801



>emb|CDX92100.1| BnaA05g23070D [Brassica napus]
Length=1132

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +IVD  QCR V+MP   D+  K+ARLLYTNSGV +LAL ++G+Q+LWKWS NEQNP+
Sbjct  742  ELTEIVDPTQCRQVTMPDSKDSVSKVARLLYTNSGVGVLALGANGVQRLWKWSRNEQNPT  801



>gb|KDO81760.1| hypothetical protein CISIN_1g001190mg [Citrus sinensis]
Length=945

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 2/64 (3%)
 Frame = +2

Query  281  PNRTKLWDIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSYNE  454
            P   +L +IVD  QCR+V+MP+ +D  +K+ RLLYTNS V +LAL S+G+QKLWKW  NE
Sbjct  738  PKPWQLAEIVDSGQCRLVTMPESTDTSSKVVRLLYTNSAVGLLALGSNGVQKLWKWHRNE  797

Query  455  QNPS  466
            QNPS
Sbjct  798  QNPS  801



>ref|XP_004144768.1| PREDICTED: topless-related protein 3-like [Cucumis sativus]
 gb|KGN60972.1| hypothetical protein Csa_2G033270 [Cucumis sativus]
Length=1127

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +IVD   CR+V+MP  +D+  K+ RLLYTNSGV +LAL S+GIQKLWKW+ NEQNPS
Sbjct  740  QLAEIVDPASCRLVTMPDNADSSHKVVRLLYTNSGVGLLALGSNGIQKLWKWTRNEQNPS  799



>ref|XP_004158753.1| PREDICTED: topless-related protein 3-like [Cucumis sativus]
Length=1126

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +IVD   CR+V+MP  +D+  K+ RLLYTNSGV +LAL S+GIQKLWKW+ NEQNPS
Sbjct  739  QLAEIVDPASCRLVTMPDNADSSHKVVRLLYTNSGVGLLALGSNGIQKLWKWTRNEQNPS  798



>ref|XP_002870186.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46445.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1125

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 49/61 (80%), Gaps = 2/61 (3%)
 Frame = +2

Query  290  TKLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNP  463
            ++L +IVD  QCR V+MP   D+  K+ARLLYTNSGV ILAL ++G+Q+LWKWS +EQNP
Sbjct  741  SELMEIVDPAQCRQVTMPDSKDSVSKVARLLYTNSGVGILALGTNGVQRLWKWSRSEQNP  800

Query  464  S  466
            +
Sbjct  801  T  801



>ref|XP_008453896.1| PREDICTED: topless-related protein 3-like [Cucumis melo]
Length=1127

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +IVD   CR+V+MP  +D+  K+ RLLYTNSGV +LAL S+GIQKLWKW+ NEQNPS
Sbjct  740  QLAEIVDPASCRLVTMPDNADSSHKVVRLLYTNSGVGLLALGSNGIQKLWKWTRNEQNPS  799



>ref|XP_007035678.1| TOPLESS-related 2 isoform 4 [Theobroma cacao]
 gb|EOY06604.1| TOPLESS-related 2 isoform 4 [Theobroma cacao]
Length=1101

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLWD---IVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            ++TK W+   IVD  QCR V+MP   D  +K+ARLLYTNSGV +LAL ++GIQKLWKWS 
Sbjct  744  DKTKPWELTEIVDPSQCRTVTMPDNLDTASKVARLLYTNSGVGVLALGTNGIQKLWKWSR  803

Query  449  NEQNPS  466
            +EQNPS
Sbjct  804  SEQNPS  809



>ref|XP_010487553.1| PREDICTED: topless-related protein 2-like [Camelina sativa]
Length=1131

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +IVD  QCR V+MP   D+  K+ARLLYTNSGV +LAL S+G+Q++WKWS NEQNP+
Sbjct  743  ELTEIVDPTQCRQVTMPDSKDSVSKVARLLYTNSGVGVLALGSNGVQRIWKWSRNEQNPT  802



>ref|XP_010465706.1| PREDICTED: topless-related protein 2-like [Camelina sativa]
Length=1131

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +IVD  QCR V+MP   D+  K+ARLLYTNSGV +LAL S+G+Q++WKWS NEQNP+
Sbjct  743  ELTEIVDPTQCRQVTMPDSKDSVSKVARLLYTNSGVGVLALGSNGVQRIWKWSRNEQNPT  802



>ref|XP_010504697.1| PREDICTED: topless-related protein 2 [Camelina sativa]
Length=1131

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +IVD  QCR V+MP   D+  K+ARLLYTNSGV +LAL S+G+Q++WKWS NEQNP+
Sbjct  743  ELTEIVDPTQCRQVTMPDSKDSVSKVARLLYTNSGVGVLALGSNGVQRIWKWSRNEQNPT  802



>ref|XP_007035675.1| TOPLESS-related 2 isoform 1 [Theobroma cacao]
 gb|EOY06601.1| TOPLESS-related 2 isoform 1 [Theobroma cacao]
Length=1133

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLWD---IVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            ++TK W+   IVD  QCR V+MP   D  +K+ARLLYTNSGV +LAL ++GIQKLWKWS 
Sbjct  744  DKTKPWELTEIVDPSQCRTVTMPDNLDTASKVARLLYTNSGVGVLALGTNGIQKLWKWSR  803

Query  449  NEQNPS  466
            +EQNPS
Sbjct  804  SEQNPS  809



>ref|XP_007035676.1| TOPLESS-related 2 isoform 2 [Theobroma cacao]
 gb|EOY06602.1| TOPLESS-related 2 isoform 2 [Theobroma cacao]
Length=1139

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLWD---IVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            ++TK W+   IVD  QCR V+MP   D  +K+ARLLYTNSGV +LAL ++GIQKLWKWS 
Sbjct  750  DKTKPWELTEIVDPSQCRTVTMPDNLDTASKVARLLYTNSGVGVLALGTNGIQKLWKWSR  809

Query  449  NEQNPS  466
            +EQNPS
Sbjct  810  SEQNPS  815



>ref|XP_007035677.1| TOPLESS-related 2 isoform 3 [Theobroma cacao]
 gb|EOY06603.1| TOPLESS-related 2 isoform 3 [Theobroma cacao]
Length=1107

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLWD---IVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            ++TK W+   IVD  QCR V+MP   D  +K+ARLLYTNSGV +LAL ++GIQKLWKWS 
Sbjct  750  DKTKPWELTEIVDPSQCRTVTMPDNLDTASKVARLLYTNSGVGVLALGTNGIQKLWKWSR  809

Query  449  NEQNPS  466
            +EQNPS
Sbjct  810  SEQNPS  815



>gb|KDO81759.1| hypothetical protein CISIN_1g001190mg [Citrus sinensis]
Length=1012

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 2/64 (3%)
 Frame = +2

Query  281  PNRTKLWDIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSYNE  454
            P   +L +IVD  QCR+V+MP+ +D  +K+ RLLYTNS V +LAL S+G+QKLWKW  NE
Sbjct  738  PKPWQLAEIVDSGQCRLVTMPESTDTSSKVVRLLYTNSAVGLLALGSNGVQKLWKWHRNE  797

Query  455  QNPS  466
            QNPS
Sbjct  798  QNPS  801



>gb|KDO81755.1| hypothetical protein CISIN_1g001190mg [Citrus sinensis]
Length=1101

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 2/64 (3%)
 Frame = +2

Query  281  PNRTKLWDIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSYNE  454
            P+   L +IVD  QCR+V+MP+ +D  +K+ RLLYTNS V +LAL S+G+QKLWKW  NE
Sbjct  711  PSPIILAEIVDSGQCRLVTMPESTDTSSKVVRLLYTNSAVGLLALGSNGVQKLWKWHRNE  770

Query  455  QNPS  466
            QNPS
Sbjct  771  QNPS  774



>ref|XP_006285940.1| hypothetical protein CARUB_v10007460mg [Capsella rubella]
 gb|EOA18838.1| hypothetical protein CARUB_v10007460mg [Capsella rubella]
Length=1107

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L ++VD  QCR V+MP   D+  K+ARLLYTNSGV ILAL ++G+Q+LWKWS +EQNPS
Sbjct  724  ELMEVVDPAQCRQVTMPDSKDSVSKVARLLYTNSGVGILALGTNGVQRLWKWSRSEQNPS  783



>ref|XP_006472151.1| PREDICTED: topless-related protein 3-like [Citrus sinensis]
Length=1128

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 2/64 (3%)
 Frame = +2

Query  281  PNRTKLWDIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSYNE  454
            P   +L +IVD  QCR+V+MP+ +D  +K+ RLLYTNS V +LAL S+G+QKLWKW  NE
Sbjct  738  PKPWQLAEIVDSGQCRLVTMPESTDTSSKVVRLLYTNSAVGLLALGSNGVQKLWKWHRNE  797

Query  455  QNPS  466
            QNPS
Sbjct  798  QNPS  801



>gb|KDO81757.1| hypothetical protein CISIN_1g001190mg [Citrus sinensis]
Length=1128

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 2/64 (3%)
 Frame = +2

Query  281  PNRTKLWDIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSYNE  454
            P   +L +IVD  QCR+V+MP+ +D  +K+ RLLYTNS V +LAL S+G+QKLWKW  NE
Sbjct  738  PKPWQLAEIVDSGQCRLVTMPESTDTSSKVVRLLYTNSAVGLLALGSNGVQKLWKWHRNE  797

Query  455  QNPS  466
            QNPS
Sbjct  798  QNPS  801



>ref|XP_006433483.1| hypothetical protein CICLE_v10000084mg [Citrus clementina]
 gb|ESR46723.1| hypothetical protein CICLE_v10000084mg [Citrus clementina]
Length=1130

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 2/64 (3%)
 Frame = +2

Query  281  PNRTKLWDIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSYNE  454
            P   +L +IVD  QCR+V+MP+ +D  +K+ RLLYTNS V +LAL S+G+QKLWKW  NE
Sbjct  740  PKPWQLAEIVDSGQCRLVTMPESTDTSSKVVRLLYTNSAVGLLALGSNGVQKLWKWHRNE  799

Query  455  QNPS  466
            QNPS
Sbjct  800  QNPS  803



>ref|XP_010462722.1| PREDICTED: protein TOPLESS-like, partial [Camelina sativa]
Length=1144

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +IVD  QCR V+MP   D+  K+ARLLYTNSGV +LAL S+G+Q++WKWS NEQNP+
Sbjct  901  ELTEIVDPTQCRQVTMPDSKDSVSKVARLLYTNSGVGVLALGSNGVQRIWKWSRNEQNPT  960



>gb|KDO81756.1| hypothetical protein CISIN_1g001190mg [Citrus sinensis]
Length=1096

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 2/64 (3%)
 Frame = +2

Query  281  PNRTKLWDIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSYNE  454
            P   +L +IVD  QCR+V+MP+ +D  +K+ RLLYTNS V +LAL S+G+QKLWKW  NE
Sbjct  738  PKPWQLAEIVDSGQCRLVTMPESTDTSSKVVRLLYTNSAVGLLALGSNGVQKLWKWHRNE  797

Query  455  QNPS  466
            QNPS
Sbjct  798  QNPS  801



>gb|KDO81758.1| hypothetical protein CISIN_1g001190mg [Citrus sinensis]
Length=1058

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 2/64 (3%)
 Frame = +2

Query  281  PNRTKLWDIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSYNE  454
            P   +L +IVD  QCR+V+MP+ +D  +K+ RLLYTNS V +LAL S+G+QKLWKW  NE
Sbjct  738  PKPWQLAEIVDSGQCRLVTMPESTDTSSKVVRLLYTNSAVGLLALGSNGVQKLWKWHRNE  797

Query  455  QNPS  466
            QNPS
Sbjct  798  QNPS  801



>gb|EPS64433.1| hypothetical protein M569_10348, partial [Genlisea aurea]
Length=799

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 51/68 (75%), Gaps = 6/68 (9%)
 Frame = +2

Query  278  GPNRTKLW---DIVDQVQCRIVSMPKCSDA---KIARLLYTNSGVSILALSSDGIQKLWK  439
            G ++TK W   +IVD  QCR V+MP+ SDA   K+ARLLYTNSGV +LAL S+G QKLWK
Sbjct  729  GIDKTKPWQLSEIVDPSQCRSVTMPESSDAASNKVARLLYTNSGVGLLALGSNGSQKLWK  788

Query  440  WSYNEQNP  463
            W  N+QNP
Sbjct  789  WLRNDQNP  796



>ref|XP_009369993.1| PREDICTED: topless-related protein 2-like [Pyrus x bretschneideri]
Length=1140

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 54/82 (66%), Gaps = 2/82 (2%)
 Frame = +2

Query  227  DGDEDVEEYKSDAGHSSGPNRTKLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSI  400
            D    +E+ +S    S    R +L +IVD VQCR+ +MP   D   K+ARLLYTNSG  I
Sbjct  739  DMARSLEKRRSLDDVSDKIKRWELAEIVDPVQCRVATMPASKDPTNKVARLLYTNSGSGI  798

Query  401  LALSSDGIQKLWKWSYNEQNPS  466
            LAL S+G+QKLWKWS NEQN S
Sbjct  799  LALGSNGVQKLWKWSRNEQNLS  820



>ref|XP_010086586.1| Topless-related protein 3 [Morus notabilis]
 gb|EXB21430.1| Topless-related protein 3 [Morus notabilis]
Length=1132

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 2/59 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNP  463
            +L +I+D  QCR+V+MP  +D  +K+ RLLYTNSGV +LAL S+G+QKLWKW  NEQNP
Sbjct  745  QLTEILDPAQCRLVTMPDSTDTSSKVVRLLYTNSGVGVLALGSNGVQKLWKWVRNEQNP  803



>emb|CDY50502.1| BnaC01g44400D [Brassica napus]
Length=1272

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +IVD  QCR V+MP   D+  K+ARLLYTNSGV +LAL ++G+Q+LWKWS NEQNP+
Sbjct  883  ELTEIVDPTQCRQVTMPDSKDSVSKVARLLYTNSGVGVLALGANGVQRLWKWSRNEQNPT  942



>ref|XP_010094719.1| Topless-related protein 3 [Morus notabilis]
 gb|EXB56799.1| Topless-related protein 3 [Morus notabilis]
Length=1117

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 2/59 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNP  463
            +L +I+D  QCR+V+MP  +D  +K+ RLLYTNSGV +LAL S+G+QKLWKW  NEQNP
Sbjct  745  QLTEILDPAQCRLVTMPDSTDTSSKVVRLLYTNSGVGVLALGSNGVQKLWKWVRNEQNP  803



>gb|KFK27551.1| hypothetical protein AALP_AA8G398300 [Arabis alpina]
Length=1125

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP--KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +IVD   CR V+MP  K S +K+ARLLYTNSGV ILAL ++G+Q+LWKWS NEQNP+
Sbjct  742  ELMEIVDPAHCRQVTMPDSKDSASKVARLLYTNSGVGILALGTNGLQRLWKWSRNEQNPT  801



>gb|EPS69182.1| hypothetical protein M569_05580, partial [Genlisea aurea]
Length=1123

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 48/59 (81%), Gaps = 2/59 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNP  463
            +L +IVD  QCR ++MP+ +DA  K+ARLLYTNSGV +LAL S+G+QKLWKW  N+QNP
Sbjct  746  QLTEIVDPAQCRSLTMPESTDATNKVARLLYTNSGVGLLALGSNGVQKLWKWLRNDQNP  804



>ref|XP_006606545.1| PREDICTED: topless-related protein 3-like [Glycine max]
 gb|KHN20263.1| Topless-related protein 3 [Glycine soja]
Length=1130

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            +R K W   +I+D VQCR V+MP+ +D+  K+ RLLYTNS V ILAL S+GIQKLWKW+ 
Sbjct  737  DRAKPWQLSEILDPVQCRSVTMPESTDSSSKVVRLLYTNSAVGILALGSNGIQKLWKWAR  796

Query  449  NEQNPS  466
            +EQNP+
Sbjct  797  SEQNPT  802



>ref|XP_010449856.1| PREDICTED: topless-related protein 2-like [Camelina sativa]
Length=1125

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 49/61 (80%), Gaps = 2/61 (3%)
 Frame = +2

Query  290  TKLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNP  463
            ++L +IVD  QCR V+MP   D+  K+ARLLYTNSGV +LAL ++G+Q+LWKWS +EQNP
Sbjct  741  SELMEIVDPAQCRQVTMPDSKDSVSKVARLLYTNSGVGVLALGTNGVQRLWKWSRSEQNP  800

Query  464  S  466
            +
Sbjct  801  T  801



>ref|XP_010259449.1| PREDICTED: topless-related protein 2 isoform X2 [Nelumbo nucifera]
Length=1135

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 51/67 (76%), Gaps = 5/67 (7%)
 Frame = +2

Query  281  PNRTKLWD---IVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWS  445
            P++ K W+   I++  QCR+VSM   +D+  K+ RLLYT+SGV ILAL S+GIQKLWKWS
Sbjct  742  PDKAKPWELTEILEPAQCRVVSMGDSADSPSKVVRLLYTSSGVGILALGSNGIQKLWKWS  801

Query  446  YNEQNPS  466
             NEQNPS
Sbjct  802  RNEQNPS  808



>ref|XP_010259450.1| PREDICTED: topless-related protein 2 isoform X3 [Nelumbo nucifera]
Length=1099

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 51/67 (76%), Gaps = 5/67 (7%)
 Frame = +2

Query  281  PNRTKLWD---IVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWS  445
            P++ K W+   I++  QCR+VSM   +D+  K+ RLLYT+SGV ILAL S+GIQKLWKWS
Sbjct  705  PDKAKPWELTEILEPAQCRVVSMGDSADSPSKVVRLLYTSSGVGILALGSNGIQKLWKWS  764

Query  446  YNEQNPS  466
             NEQNPS
Sbjct  765  RNEQNPS  771



>ref|XP_010259448.1| PREDICTED: topless-related protein 2 isoform X1 [Nelumbo nucifera]
Length=1136

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 51/67 (76%), Gaps = 5/67 (7%)
 Frame = +2

Query  281  PNRTKLWD---IVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWS  445
            P++ K W+   I++  QCR+VSM   +D+  K+ RLLYT+SGV ILAL S+GIQKLWKWS
Sbjct  742  PDKAKPWELTEILEPAQCRVVSMGDSADSPSKVVRLLYTSSGVGILALGSNGIQKLWKWS  801

Query  446  YNEQNPS  466
             NEQNPS
Sbjct  802  RNEQNPS  808



>ref|XP_010440213.1| PREDICTED: topless-related protein 2-like [Camelina sativa]
Length=1115

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 49/61 (80%), Gaps = 2/61 (3%)
 Frame = +2

Query  290  TKLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNP  463
            ++L +IVD  QCR V+MP   D+  K+ARLLYTNSGV +LAL ++G+Q+LWKWS +EQNP
Sbjct  731  SELMEIVDPAQCRQVTMPDSKDSVSKVARLLYTNSGVGVLALGTNGVQRLWKWSRSEQNP  790

Query  464  S  466
            +
Sbjct  791  T  791



>ref|XP_006841513.1| hypothetical protein AMTR_s00003p00142040 [Amborella trichopoda]
 gb|ERN03188.1| hypothetical protein AMTR_s00003p00142040 [Amborella trichopoda]
Length=801

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 5/67 (7%)
 Frame = +2

Query  281  PNRTKLWD---IVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWS  445
            P + K W+   I+D + CR+V+MP  +D   K++RLLYTNSGV +LAL S+ IQKLWKWS
Sbjct  447  PEKAKPWELTEILDPILCRVVTMPDSTDPAGKVSRLLYTNSGVGLLALGSNAIQKLWKWS  506

Query  446  YNEQNPS  466
             +EQNP+
Sbjct  507  RSEQNPT  513



>ref|NP_188306.2| Topless-related 2 protein [Arabidopsis thaliana]
 sp|Q9LRZ0.2|TPR2_ARATH RecName: Full=Topless-related protein 2 [Arabidopsis thaliana]
 gb|AEE75871.1| Topless-related 2 protein [Arabidopsis thaliana]
Length=1131

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +IVD  QCR V+MP   D+  K+ARLLYTNSGV +LAL S+G+Q+LWKW  NEQNP+
Sbjct  743  ELTEIVDPTQCRQVTMPDSKDSVSKVARLLYTNSGVGVLALGSNGVQRLWKWIRNEQNPT  802



>dbj|BAA95777.1| unnamed protein product [Arabidopsis thaliana]
Length=1161

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +IVD  QCR V+MP   D+  K+ARLLYTNSGV +LAL S+G+Q+LWKW  NEQNP+
Sbjct  743  ELTEIVDPTQCRQVTMPDSKDSVSKVARLLYTNSGVGVLALGSNGVQRLWKWIRNEQNPT  802



>ref|XP_004508183.1| PREDICTED: topless-related protein 2-like [Cicer arietinum]
Length=1125

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +IVD V CR+V++P  SD   K+ RLLYTNSG  +LAL + GIQKLWKWS NEQNP+
Sbjct  745  ELTEIVDPVHCRVVTLPDSSDPTNKVIRLLYTNSGTGLLALGAKGIQKLWKWSRNEQNPT  804



>ref|XP_007204953.1| hypothetical protein PRUPE_ppa000487mg [Prunus persica]
 gb|EMJ06152.1| hypothetical protein PRUPE_ppa000487mg [Prunus persica]
Length=1134

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 49/66 (74%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            +++K+W   DI D  QCR+ +MP  +D  +K+ RLLYTNSG  ILAL S+G+QKLWKW  
Sbjct  739  DKSKIWQLTDIQDCAQCRLATMPDTTDTSSKVIRLLYTNSGTGILALGSNGVQKLWKWVR  798

Query  449  NEQNPS  466
            NEQNPS
Sbjct  799  NEQNPS  804



>ref|XP_011023731.1| PREDICTED: topless-related protein 3-like [Populus euphratica]
Length=1124

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 51/66 (77%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            ++TK W   +IVD  +CR+V++P  +D  +K+ RLLYTNSGV +LAL ++GIQKLWKW  
Sbjct  737  DKTKPWQLAEIVDPGECRLVTLPDSTDTSSKVVRLLYTNSGVGMLALGANGIQKLWKWQR  796

Query  449  NEQNPS  466
            NEQNPS
Sbjct  797  NEQNPS  802



>ref|XP_004967836.1| PREDICTED: topless-related protein 2-like [Setaria italica]
Length=1130

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 50/67 (75%), Gaps = 5/67 (7%)
 Frame = +2

Query  281  PNRTKLWDIVDQV---QCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWS  445
            P++ K W++++ +   QCR+ +MP+  D   K+ RLLYTNSGV +LAL S+ IQ+LWKWS
Sbjct  736  PDKAKPWELMEVLNPQQCRVATMPETPDQPRKVVRLLYTNSGVGLLALGSNAIQRLWKWS  795

Query  446  YNEQNPS  466
             NEQNPS
Sbjct  796  RNEQNPS  802



>ref|XP_002319498.2| WD-40 repeat family protein [Populus trichocarpa]
 gb|EEE95421.2| WD-40 repeat family protein [Populus trichocarpa]
Length=1124

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 51/66 (77%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            ++TK W   +IVD  +CR+V++P  +D  +K+ RLLYTNSGV +LAL ++GIQKLWKW  
Sbjct  737  DKTKPWQLAEIVDPGECRLVTLPDSTDTSSKVVRLLYTNSGVGMLALGANGIQKLWKWPR  796

Query  449  NEQNPS  466
            NEQNPS
Sbjct  797  NEQNPS  802



>ref|XP_008795824.1| PREDICTED: topless-related protein 2-like [Phoenix dactylifera]
Length=1029

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 53/67 (79%), Gaps = 5/67 (7%)
 Frame = +2

Query  281  PNRTKLWD---IVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWS  445
            P++TK W+   I++  QCR+V+MP+ +D+  K+ARLLYTNSG  +LAL S+ +Q+LWKWS
Sbjct  635  PDKTKPWELAEILNPKQCRVVTMPESTDSASKVARLLYTNSGGGLLALGSNAVQRLWKWS  694

Query  446  YNEQNPS  466
             +EQNPS
Sbjct  695  RSEQNPS  701



>gb|KDP23429.1| hypothetical protein JCGZ_23262 [Jatropha curcas]
Length=516

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 51/66 (77%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            ++TK W   +I+D  +CR+V++P   D  +K+ RLLYTNSGV ILAL S+GIQKLWKW+ 
Sbjct  123  DKTKPWQLAEILDSGECRLVTLPDSRDTSSKVVRLLYTNSGVGILALGSNGIQKLWKWTR  182

Query  449  NEQNPS  466
            N+QNP+
Sbjct  183  NDQNPT  188



>ref|XP_010524852.1| PREDICTED: topless-related protein 3-like isoform X2 [Tarenaya 
hassleriana]
Length=1115

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 38/66 (58%), Positives = 51/66 (77%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            ++TK W   +I+D VQCR V++   +D+  K+ RLLYTNSGV IL+L S+GIQ+LWKW+ 
Sbjct  728  DKTKPWQLSEILDSVQCRQVTLADSTDSSTKVIRLLYTNSGVGILSLGSNGIQRLWKWAR  787

Query  449  NEQNPS  466
            NEQNPS
Sbjct  788  NEQNPS  793



>ref|XP_010524851.1| PREDICTED: topless-related protein 3-like isoform X1 [Tarenaya 
hassleriana]
Length=1117

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 38/66 (58%), Positives = 51/66 (77%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            ++TK W   +I+D VQCR V++   +D+  K+ RLLYTNSGV IL+L S+GIQ+LWKW+ 
Sbjct  730  DKTKPWQLSEILDSVQCRQVTLADSTDSSTKVIRLLYTNSGVGILSLGSNGIQRLWKWAR  789

Query  449  NEQNPS  466
            NEQNPS
Sbjct  790  NEQNPS  795



>ref|XP_009338219.1| PREDICTED: topless-related protein 3 isoform X2 [Pyrus x bretschneideri]
Length=1123

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 2/59 (3%)
 Frame = +2

Query  296  LWDIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            L +I D +QCR+V+MP  +D  +K+ RLLYTNSG  ILAL S G+QKLWKW  NEQNP+
Sbjct  736  LTEIQDPIQCRLVTMPDTTDTSSKVVRLLYTNSGAGILALGSHGVQKLWKWVRNEQNPT  794



>ref|XP_006644007.1| PREDICTED: topless-related protein 2-like [Oryza brachyantha]
Length=1128

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 51/67 (76%), Gaps = 5/67 (7%)
 Frame = +2

Query  281  PNRTKLWDIVDQV---QCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWS  445
            P++ K W++++ +   QCR+ +MP+  D  +K+ RLLYTNSGV +LAL S+ IQ+LWKW+
Sbjct  734  PDKAKPWELMEVLNPQQCRVATMPETPDQTSKVVRLLYTNSGVGLLALGSNAIQRLWKWA  793

Query  446  YNEQNPS  466
             NEQNPS
Sbjct  794  RNEQNPS  800



>ref|XP_009338217.1| PREDICTED: topless-related protein 3 isoform X1 [Pyrus x bretschneideri]
Length=1135

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 2/59 (3%)
 Frame = +2

Query  296  LWDIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            L +I D +QCR+V+MP  +D  +K+ RLLYTNSG  ILAL S G+QKLWKW  NEQNP+
Sbjct  748  LTEIQDPIQCRLVTMPDTTDTSSKVVRLLYTNSGAGILALGSHGVQKLWKWVRNEQNPT  806



>ref|XP_010043204.1| PREDICTED: topless-related protein 3-like [Eucalyptus grandis]
 gb|KCW85231.1| hypothetical protein EUGRSUZ_B02075 [Eucalyptus grandis]
Length=1131

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 51/66 (77%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            ++T+ W   +I D   CR+V+MP  SD  +K+ RLLYTNSGV ILAL+++G+QKLWKW+ 
Sbjct  738  DKTRPWQLAEITDPGHCRLVTMPDSSDTSSKVVRLLYTNSGVGILALAANGVQKLWKWAR  797

Query  449  NEQNPS  466
            N+QNPS
Sbjct  798  NDQNPS  803



>ref|XP_008245640.1| PREDICTED: topless-related protein 3 [Prunus mume]
Length=1134

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            +++K+W   DI D  QCR+ +MP  ++  +K+ RLLYTNSG  ILAL S+G+QKLWKW  
Sbjct  739  DKSKIWQLTDIQDSAQCRLATMPDTTETSSKVIRLLYTNSGTGILALGSNGVQKLWKWVR  798

Query  449  NEQNPS  466
            NEQNPS
Sbjct  799  NEQNPS  804



>ref|XP_008370406.1| PREDICTED: topless-related protein 3-like isoform X2 [Malus domestica]
Length=1123

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = +2

Query  296  LWDIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            L +I D +QCR+V+MP  +D  +K+ RLLYTNSG  ILAL S+G+QKLWKW  N+QNPS
Sbjct  736  LTEIQDPIQCRLVTMPDTTDTSSKVVRLLYTNSGAGILALGSNGVQKLWKWVRNDQNPS  794



>ref|XP_008370405.1| PREDICTED: topless-related protein 3-like isoform X1 [Malus domestica]
Length=1135

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = +2

Query  296  LWDIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            L +I D +QCR+V+MP  +D  +K+ RLLYTNSG  ILAL S+G+QKLWKW  N+QNPS
Sbjct  748  LTEIQDPIQCRLVTMPDTTDTSSKVVRLLYTNSGAGILALGSNGVQKLWKWVRNDQNPS  806



>ref|XP_010024093.1| PREDICTED: topless-related protein 3 isoform X1 [Eucalyptus grandis]
 gb|KCW60527.1| hypothetical protein EUGRSUZ_H03269 [Eucalyptus grandis]
Length=1137

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +I+D   CR+V+MP  +D  +K+ RLLYTNSG+ +LAL ++G+QKLWKW+ NEQNP+
Sbjct  750  QLAEILDPAHCRLVTMPDSTDTSSKVVRLLYTNSGIGLLALGANGVQKLWKWARNEQNPA  809



>gb|KCW60526.1| hypothetical protein EUGRSUZ_H03269 [Eucalyptus grandis]
Length=1138

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +I+D   CR+V+MP  +D  +K+ RLLYTNSG+ +LAL ++G+QKLWKW+ NEQNP+
Sbjct  751  QLAEILDPAHCRLVTMPDSTDTSSKVVRLLYTNSGIGLLALGANGVQKLWKWARNEQNPA  810



>ref|XP_002307097.2| WD-40 repeat family protein [Populus trichocarpa]
 gb|EEE94093.2| WD-40 repeat family protein [Populus trichocarpa]
Length=1133

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 51/66 (77%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            ++TK W   +I D  +CR+V++P+ +D  +K+ RLLYTNSGV +LAL ++GIQKLWKW  
Sbjct  746  DKTKPWQLAEIADPSECRLVTLPESADTSSKVVRLLYTNSGVGMLALGANGIQKLWKWPR  805

Query  449  NEQNPS  466
            NEQNPS
Sbjct  806  NEQNPS  811



>ref|XP_010024094.1| PREDICTED: topless-related protein 3 isoform X2 [Eucalyptus grandis]
Length=1130

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +I+D   CR+V+MP  +D  +K+ RLLYTNSG+ +LAL ++G+QKLWKW+ NEQNP+
Sbjct  743  QLAEILDPAHCRLVTMPDSTDTSSKVVRLLYTNSGIGLLALGANGVQKLWKWARNEQNPA  802



>gb|KCW60528.1| hypothetical protein EUGRSUZ_H03269 [Eucalyptus grandis]
Length=1066

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +I+D   CR+V+MP  +D  +K+ RLLYTNSG+ +LAL ++G+QKLWKW+ NEQNP+
Sbjct  750  QLAEILDPAHCRLVTMPDSTDTSSKVVRLLYTNSGIGLLALGANGVQKLWKWARNEQNPA  809



>ref|XP_008388509.1| PREDICTED: topless-related protein 3-like [Malus domestica]
Length=1135

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 46/64 (72%), Gaps = 2/64 (3%)
 Frame = +2

Query  281  PNRTKLWDIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSYNE  454
            P    L +I D +QCR V+MP  +D  +K+ RLLYTNSG  ILAL S+G+QKLWKW  NE
Sbjct  743  PKPWLLTEIQDPIQCRQVTMPDTTDTSSKVVRLLYTNSGAGILALGSNGVQKLWKWVRNE  802

Query  455  QNPS  466
            QNPS
Sbjct  803  QNPS  806



>ref|XP_004296880.1| PREDICTED: topless-related protein 2-like [Fragaria vesca subsp. 
vesca]
Length=1124

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 2/62 (3%)
 Frame = +2

Query  287  RTKLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQN  460
            R +L +IVD V CR+ +MP   D   K+ARLLYTNSG  ILAL S+G+QKLWKW  N++N
Sbjct  743  RWELAEIVDPVHCRVATMPDSKDPANKVARLLYTNSGAGILALGSNGVQKLWKWRSNDEN  802

Query  461  PS  466
            PS
Sbjct  803  PS  804



>gb|KHG26583.1| Topless-related 3 -like protein [Gossypium arboreum]
Length=1134

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 49/66 (74%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            ++TK W   +IVD   CR+V++P  +D  +K+ RLLYTNS V ILAL S+G+QKLWKW  
Sbjct  740  DKTKPWQLAEIVDPGHCRLVTLPDSTDTSSKVVRLLYTNSAVGILALGSNGVQKLWKWPR  799

Query  449  NEQNPS  466
            NEQNPS
Sbjct  800  NEQNPS  805



>ref|XP_011036914.1| PREDICTED: topless-related protein 3 [Populus euphratica]
Length=1127

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 52/66 (79%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            ++TK W   +IVD  +CR+V++P+ +D  +K+ RLLYTNSGV +LAL ++GIQKLWKW  
Sbjct  740  DKTKPWQLAEIVDPGECRLVTLPESADTSSKVVRLLYTNSGVGMLALGANGIQKLWKWPR  799

Query  449  NEQNPS  466
            +EQNPS
Sbjct  800  SEQNPS  805



>ref|XP_009421409.1| PREDICTED: topless-related protein 2-like [Musa acuminata subsp. 
malaccensis]
Length=1134

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA-KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +I++  QCR+ SMP    A K+ARLLYTNSGV +LAL S+ IQ+LWKWS NEQNPS
Sbjct  748  ELAEILNAKQCRVASMPDTDSACKVARLLYTNSGVGLLALGSNAIQRLWKWSRNEQNPS  806



>ref|XP_007031067.1| Transducin family protein / WD-40 repeat family protein [Theobroma 
cacao]
 gb|EOY11569.1| Transducin family protein / WD-40 repeat family protein [Theobroma 
cacao]
Length=1761

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query  293   KLWDIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
             KL +IV  +QCR+V++P  +D  +K+ RLLYTNSGV ILAL SDG++KLWKW  +E+NPS
Sbjct  1339  KLAEIVYPIQCRLVTLPDNTDTSSKVVRLLYTNSGVGILALGSDGVRKLWKWLRDEENPS  1398



>ref|XP_010245461.1| PREDICTED: topless-related protein 2-like isoform X2 [Nelumbo 
nucifera]
Length=1126

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 50/66 (76%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLWD---IVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            ++TK W+   I++  QCR VS+   +D  +K+ RLLYTNSGV ILAL S+GIQ+LWKWS 
Sbjct  741  DKTKPWELTEILEPAQCRAVSLGDSADPSSKVVRLLYTNSGVGILALGSNGIQRLWKWSR  800

Query  449  NEQNPS  466
            NEQNPS
Sbjct  801  NEQNPS  806



>ref|NP_001042616.1| Os01g0254100 [Oryza sativa Japonica Group]
 dbj|BAD81067.1| putative CTV.2 [Oryza sativa Japonica Group]
 dbj|BAF04530.1| Os01g0254100 [Oryza sativa Japonica Group]
 gb|EEE54253.1| hypothetical protein OsJ_01134 [Oryza sativa Japonica Group]
 dbj|BAL44268.1| ASPR2 protein [Oryza sativa Japonica Group]
Length=1129

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 51/67 (76%), Gaps = 5/67 (7%)
 Frame = +2

Query  281  PNRTKLWDIVDQV---QCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWS  445
            P++ K W++++ +   QCR+ +MP+  D  +K+ RLLYTNSGV +LAL S+ IQ+LWKW+
Sbjct  735  PDKAKPWELMEVLNAQQCRVATMPETPDQASKVVRLLYTNSGVGLLALGSNAIQRLWKWA  794

Query  446  YNEQNPS  466
             N+QNPS
Sbjct  795  RNDQNPS  801



>gb|EAY73338.1| hypothetical protein OsI_01216 [Oryza sativa Indica Group]
Length=1118

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 51/67 (76%), Gaps = 5/67 (7%)
 Frame = +2

Query  281  PNRTKLWDIVDQV---QCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWS  445
            P++ K W++++ +   QCR+ +MP+  D  +K+ RLLYTNSGV +LAL S+ IQ+LWKW+
Sbjct  724  PDKAKPWELMEVLNAQQCRVATMPETPDQASKVVRLLYTNSGVGLLALGSNAIQRLWKWA  783

Query  446  YNEQNPS  466
             N+QNPS
Sbjct  784  RNDQNPS  790



>ref|XP_010245460.1| PREDICTED: topless-related protein 2-like isoform X1 [Nelumbo 
nucifera]
Length=1129

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 50/66 (76%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLWD---IVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            ++TK W+   I++  QCR VS+   +D  +K+ RLLYTNSGV ILAL S+GIQ+LWKWS 
Sbjct  741  DKTKPWELTEILEPAQCRAVSLGDSADPSSKVVRLLYTNSGVGILALGSNGIQRLWKWSR  800

Query  449  NEQNPS  466
            NEQNPS
Sbjct  801  NEQNPS  806



>ref|XP_006414395.1| hypothetical protein EUTSA_v10024263mg [Eutrema salsugineum]
 gb|ESQ55848.1| hypothetical protein EUTSA_v10024263mg [Eutrema salsugineum]
Length=1120

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L  ++D  QCR V+MP   D+  K+ARLLYTNSGV ILAL ++G+Q+LWKWS +EQNP+
Sbjct  740  ELITVIDPAQCRQVTMPDSKDSVSKVARLLYTNSGVGILALGTNGVQRLWKWSRSEQNPT  799



>ref|XP_006589131.1| PREDICTED: topless-related protein 3-like isoform X2 [Glycine 
max]
Length=1153

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 50/66 (76%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            +R K W   +I+D VQCR V+MP+ +D+  K+ RLLYTNS V ILAL S+GIQKLWKW+ 
Sbjct  760  DRAKPWQLSEILDPVQCRSVTMPESTDSSSKVIRLLYTNSAVGILALGSNGIQKLWKWAR  819

Query  449  NEQNPS  466
            +E NP+
Sbjct  820  SELNPT  825



>ref|XP_006589130.1| PREDICTED: topless-related protein 3-like isoform X1 [Glycine 
max]
Length=1129

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 50/66 (76%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            +R K W   +I+D VQCR V+MP+ +D+  K+ RLLYTNS V ILAL S+GIQKLWKW+ 
Sbjct  736  DRAKPWQLSEILDPVQCRSVTMPESTDSSSKVIRLLYTNSAVGILALGSNGIQKLWKWAR  795

Query  449  NEQNPS  466
            +E NP+
Sbjct  796  SELNPT  801



>gb|KHN16088.1| Topless-related protein 3 [Glycine soja]
Length=1121

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 50/66 (76%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            +R K W   +I+D VQCR V+MP+ +D+  K+ RLLYTNS V ILAL S+GIQKLWKW+ 
Sbjct  736  DRAKPWQLSEILDPVQCRSVTMPESTDSSSKVIRLLYTNSAVGILALGSNGIQKLWKWAR  795

Query  449  NEQNPS  466
            +E NP+
Sbjct  796  SELNPT  801



>ref|XP_008673872.1| PREDICTED: topless-related protein 2 isoform X2 [Zea mays]
Length=1109

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 49/67 (73%), Gaps = 5/67 (7%)
 Frame = +2

Query  281  PNRTKLWDIVDQV---QCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWS  445
            P++ K W++++ +   QC + +MP+  D   K+ RLLYTNSGV +LAL S+ IQ+LWKWS
Sbjct  720  PDKAKPWELMEVLNPQQCHVATMPETPDQARKVVRLLYTNSGVGLLALGSNAIQRLWKWS  779

Query  446  YNEQNPS  466
             NEQNPS
Sbjct  780  RNEQNPS  786



>gb|KHG04331.1| Topless-related 2 -like protein [Gossypium arboreum]
Length=1039

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 51/66 (77%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLWD---IVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            ++TK W+   IVD  QCR V++P  S+  +K+ARLLYTNSGV +LAL ++G+QKLWKWS 
Sbjct  650  DKTKPWELTEIVDPTQCRTVTLPDNSEIASKVARLLYTNSGVGVLALYTNGVQKLWKWSR  709

Query  449  NEQNPS  466
            +EQN S
Sbjct  710  SEQNSS  715



>ref|XP_008673871.1| PREDICTED: topless-related protein 2 isoform X1 [Zea mays]
Length=1125

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 49/67 (73%), Gaps = 5/67 (7%)
 Frame = +2

Query  281  PNRTKLWDIVDQV---QCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWS  445
            P++ K W++++ +   QC + +MP+  D   K+ RLLYTNSGV +LAL S+ IQ+LWKWS
Sbjct  736  PDKAKPWELMEVLNPQQCHVATMPETPDQARKVVRLLYTNSGVGLLALGSNAIQRLWKWS  795

Query  446  YNEQNPS  466
             NEQNPS
Sbjct  796  RNEQNPS  802



>ref|XP_002512473.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF49925.1| WD-repeat protein, putative [Ricinus communis]
Length=1132

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 52/66 (79%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            ++TK W   +IV+  +CR+V++P  +D+  K+ RLLYTNSGV ILAL S+GIQKLWKW+ 
Sbjct  739  DKTKPWQLAEIVEPDECRLVTLPDSTDSSSKVVRLLYTNSGVGILALGSNGIQKLWKWAR  798

Query  449  NEQNPS  466
            ++QNPS
Sbjct  799  SDQNPS  804



>ref|XP_006604796.1| PREDICTED: topless-related protein 3-like [Glycine max]
 gb|KHN43327.1| Topless-related protein 3 [Glycine soja]
Length=1130

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 49/67 (73%), Gaps = 5/67 (7%)
 Frame = +2

Query  278  GPNRTKLW---DIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKW  442
            G ++ K W   +IVD VQCR+V+ P  +D+  K+ RLLYTNSG  +LAL S+G+QKLWKW
Sbjct  734  GIDKAKPWQLSEIVDAVQCRLVTTPDSTDSSSKVVRLLYTNSGAGLLALGSNGVQKLWKW  793

Query  443  SYNEQNP  463
            +  EQNP
Sbjct  794  ARCEQNP  800



>ref|XP_009382516.1| PREDICTED: topless-related protein 2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=1164

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 49/66 (74%), Gaps = 4/66 (6%)
 Frame = +2

Query  281  PNRTKLWDIVDQV---QCRIVSMPKC-SDAKIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            P++ K W++ +     QCR+ +MP+  S +K+ RLLYTNSGV +LAL S+ IQ++WKWS 
Sbjct  750  PDKMKSWELAEVFNPQQCRVATMPETDSASKVTRLLYTNSGVGLLALGSNAIQRVWKWSR  809

Query  449  NEQNPS  466
            NEQNPS
Sbjct  810  NEQNPS  815



>ref|XP_009382518.1| PREDICTED: topless-related protein 2-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=1142

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 49/66 (74%), Gaps = 4/66 (6%)
 Frame = +2

Query  281  PNRTKLWDIVDQV---QCRIVSMPKC-SDAKIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            P++ K W++ +     QCR+ +MP+  S +K+ RLLYTNSGV +LAL S+ IQ++WKWS 
Sbjct  750  PDKMKSWELAEVFNPQQCRVATMPETDSASKVTRLLYTNSGVGLLALGSNAIQRVWKWSR  809

Query  449  NEQNPS  466
            NEQNPS
Sbjct  810  NEQNPS  815



>ref|XP_009382517.1| PREDICTED: topless-related protein 2-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=1143

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 49/66 (74%), Gaps = 4/66 (6%)
 Frame = +2

Query  281  PNRTKLWDIVDQV---QCRIVSMPKC-SDAKIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            P++ K W++ +     QCR+ +MP+  S +K+ RLLYTNSGV +LAL S+ IQ++WKWS 
Sbjct  751  PDKMKSWELAEVFNPQQCRVATMPETDSASKVTRLLYTNSGVGLLALGSNAIQRVWKWSR  810

Query  449  NEQNPS  466
            NEQNPS
Sbjct  811  NEQNPS  816



>tpg|DAA53973.1| TPA: hypothetical protein ZEAMMB73_351755 [Zea mays]
Length=1086

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 35/67 (52%), Positives = 49/67 (73%), Gaps = 5/67 (7%)
 Frame = +2

Query  281  PNRTKLWDIVDQV---QCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWS  445
            P++ K W++++ +   QC + +MP+  D   K+ RLLYTNSGV +LAL S+ IQ+LWKWS
Sbjct  736  PDKAKPWELMEVLNPQQCHVATMPETPDQARKVVRLLYTNSGVGLLALGSNAIQRLWKWS  795

Query  446  YNEQNPS  466
             NEQNPS
Sbjct  796  RNEQNPS  802



>ref|XP_007163344.1| hypothetical protein PHAVU_001G227000g [Phaseolus vulgaris]
 gb|ESW35338.1| hypothetical protein PHAVU_001G227000g [Phaseolus vulgaris]
Length=1102

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 49/66 (74%), Gaps = 5/66 (8%)
 Frame = +2

Query  278  GPNRTKLW---DIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKW  442
            G +R K W   +IVD VQC+ V+MP  +D+  K+ RLLYTNSG  +LAL S+G+QKLWKW
Sbjct  707  GIDRGKPWQLAEIVDPVQCQSVTMPDSTDSSSKVVRLLYTNSGAGLLALGSNGVQKLWKW  766

Query  443  SYNEQN  460
            S +EQN
Sbjct  767  SRSEQN  772



>ref|XP_007163345.1| hypothetical protein PHAVU_001G227000g [Phaseolus vulgaris]
 gb|ESW35339.1| hypothetical protein PHAVU_001G227000g [Phaseolus vulgaris]
Length=1130

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 49/66 (74%), Gaps = 5/66 (8%)
 Frame = +2

Query  278  GPNRTKLW---DIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKW  442
            G +R K W   +IVD VQC+ V+MP  +D+  K+ RLLYTNSG  +LAL S+G+QKLWKW
Sbjct  735  GIDRGKPWQLAEIVDPVQCQSVTMPDSTDSSSKVVRLLYTNSGAGLLALGSNGVQKLWKW  794

Query  443  SYNEQN  460
            S +EQN
Sbjct  795  SRSEQN  800



>ref|XP_002283157.1| PREDICTED: topless-related protein 3 [Vitis vinifera]
 emb|CBI39553.3| unnamed protein product [Vitis vinifera]
Length=1132

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 50/66 (76%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            +R+K W   +IV+  QCR V+M   SD+  K++RLLYTNSGV ILAL S+G+QKLWKW  
Sbjct  739  DRSKPWQLAEIVEPGQCRQVTMSDNSDSSSKVSRLLYTNSGVGILALGSNGVQKLWKWFR  798

Query  449  NEQNPS  466
            N+QNPS
Sbjct  799  NDQNPS  804



>emb|CAN79774.1| hypothetical protein VITISV_013612 [Vitis vinifera]
Length=1088

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 50/66 (76%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            +R+K W   +IV+  QCR V+M   SD+  K++RLLYTNSGV ILAL S+G+QKLWKW  
Sbjct  695  DRSKPWQLAEIVEPGQCRQVTMSDNSDSSSKVSRLLYTNSGVGILALGSNGVQKLWKWFR  754

Query  449  NEQNPS  466
            N+QNPS
Sbjct  755  NDQNPS  760



>ref|XP_009129893.1| PREDICTED: topless-related protein 3 [Brassica rapa]
Length=1116

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 43/64 (67%), Gaps = 2/64 (3%)
 Frame = +2

Query  281  PNRTKLWDIVDQVQCRIVSMPKC--SDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNE  454
            P   +L +IVD  QCR  ++P    S  K+ RLLYTNSG  ILAL  +GIQ+LWKW  NE
Sbjct  733  PRPWQLAEIVDPAQCRQATLPDTAGSSTKVVRLLYTNSGAGILALGLNGIQRLWKWVRNE  792

Query  455  QNPS  466
            QNPS
Sbjct  793  QNPS  796



>gb|EMS62858.1| Topless-related protein 2 [Triticum urartu]
Length=1197

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 50/67 (75%), Gaps = 5/67 (7%)
 Frame = +2

Query  281  PNRTKLWDIVDQV---QCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWS  445
            P++ K W++++ +   Q R+ ++P+  D  +K+ RLLYTNSGV +LAL S+ IQ+LWKW+
Sbjct  773  PDKAKPWELMEVLNPQQFRVATLPETPDQTSKVVRLLYTNSGVGLLALGSNAIQRLWKWN  832

Query  446  YNEQNPS  466
             NEQNPS
Sbjct  833  RNEQNPS  839



>ref|XP_009151171.1| PREDICTED: LOW QUALITY PROTEIN: topless-related protein 3 [Brassica 
rapa]
Length=1112

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = +2

Query  272  SSGPNRTKLWDIVDQVQCRIVSMPKC-SDAKIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            +  P   +L +I+D  QCR  ++P   S  K+ RLLYTNSG  ILAL  +GIQ+LWKW  
Sbjct  730  ADNPRPWQLAEILDPAQCRQATLPDTGSSTKVVRLLYTNSGAGILALGFNGIQRLWKWVR  789

Query  449  NEQNPS  466
            NEQNPS
Sbjct  790  NEQNPS  795



>emb|CDX80607.1| BnaC07g28370D [Brassica napus]
Length=1117

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 35/64 (55%), Positives = 43/64 (67%), Gaps = 2/64 (3%)
 Frame = +2

Query  281  PNRTKLWDIVDQVQCRIVSMPKC--SDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNE  454
            P   +L +I+D  QCR  ++P    S  K+ RLLYTNSG  ILAL  +GIQ+LWKW  NE
Sbjct  735  PKPWQLAEILDHAQCRQATLPDTTGSSTKVVRLLYTNSGAGILALGFNGIQRLWKWVRNE  794

Query  455  QNPS  466
            QNPS
Sbjct  795  QNPS  798



>emb|CDX88252.1| BnaA06g28430D [Brassica napus]
Length=1109

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = +2

Query  272  SSGPNRTKLWDIVDQVQCRIVSMPKC-SDAKIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            +  P   +L +I+D  QCR  ++P   S  K+ RLLYTNSG  ILAL  +GIQ+LWKW  
Sbjct  730  ADNPRPWQLAEILDPAQCRQATLPDTGSSTKVVRLLYTNSGAGILALGFNGIQRLWKWVR  789

Query  449  NEQNPS  466
            NEQNPS
Sbjct  790  NEQNPS  795



>gb|EMT25315.1| hypothetical protein F775_09004 [Aegilops tauschii]
Length=1081

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 50/67 (75%), Gaps = 5/67 (7%)
 Frame = +2

Query  281  PNRTKLWDIVDQV---QCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWS  445
            P++ K W++++ +   Q R+ ++P+  D  +K+ RLLYTNSGV +LAL S+ IQ+LWKW+
Sbjct  768  PDKAKPWELMEVLNPQQFRVATLPETPDQTSKVVRLLYTNSGVGLLALGSNAIQRLWKWN  827

Query  446  YNEQNPS  466
             NEQNPS
Sbjct  828  RNEQNPS  834



>ref|XP_006382415.1| WD-40 repeat family protein [Populus trichocarpa]
 gb|ERP60212.1| WD-40 repeat family protein [Populus trichocarpa]
Length=75

 Score = 67.4 bits (163),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 43/57 (75%), Gaps = 2/57 (4%)
 Frame = +2

Query  302  DIVDQVQCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +IVD   C +V++P  +D  +K+ RLLYTNSG  +LA  ++GIQKLWKW ++EQNPS
Sbjct  3    EIVDPGDCGLVTLPSSTDTSSKVVRLLYTNSGAGMLAPGANGIQKLWKWPHDEQNPS  59



>dbj|BAJ88304.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=609

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 49/66 (74%), Gaps = 5/66 (8%)
 Frame = +2

Query  281  PNRTKLWDIVDQV---QCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWS  445
            P++ K W++++ +   Q R+ ++P+  D  +K+ RLLYTNSGV +LAL S+ IQ+LWKW+
Sbjct  215  PDKAKPWELMEVLNPQQFRVATLPETPDQASKVVRLLYTNSGVGLLALGSNAIQRLWKWN  274

Query  446  YNEQNP  463
             NEQNP
Sbjct  275  RNEQNP  280



>gb|AES91919.2| topless-like protein [Medicago truncatula]
Length=1122

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = +2

Query  296  LWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            L +I D   CR+V++P   D   K+ RLLYTNSG  +LAL + GIQKLWKWS N+QNPS
Sbjct  743  LTEIADPGHCRVVTLPDTIDPTNKVVRLLYTNSGTGLLALGAKGIQKLWKWSRNDQNPS  801



>emb|CDY05552.1| BnaA02g31390D [Brassica napus]
Length=1111

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 35/64 (55%), Positives = 43/64 (67%), Gaps = 2/64 (3%)
 Frame = +2

Query  281  PNRTKLWDIVDQVQCRIVSMPKC--SDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNE  454
            P   +L +I+D  QCR  ++P    S  K+ RLLYTNSG  ILAL  +GIQ+LWKW  NE
Sbjct  729  PRPWQLAEIMDPAQCRQATLPDTAGSSTKVVRLLYTNSGAGILALGLNGIQRLWKWVRNE  788

Query  455  QNPS  466
            QNPS
Sbjct  789  QNPS  792



>ref|XP_010230707.1| PREDICTED: topless-related protein 2-like isoform X3 [Brachypodium 
distachyon]
Length=1116

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 51/67 (76%), Gaps = 5/67 (7%)
 Frame = +2

Query  281  PNRTKLWDIVDQV---QCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWS  445
            P++ K W++++ +   Q R+V+MP+  D  +K+ RLLYTNSGV +LAL S+ IQ+LWKW+
Sbjct  722  PDKVKPWELMEILNTQQFRVVTMPQTPDQASKVVRLLYTNSGVGLLALGSNAIQRLWKWN  781

Query  446  YNEQNPS  466
             ++QNP+
Sbjct  782  RSDQNPT  788



>ref|XP_003566431.1| PREDICTED: topless-related protein 2-like isoform X1 [Brachypodium 
distachyon]
Length=1132

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 51/67 (76%), Gaps = 5/67 (7%)
 Frame = +2

Query  281  PNRTKLWDIVDQV---QCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWS  445
            P++ K W++++ +   Q R+V+MP+  D  +K+ RLLYTNSGV +LAL S+ IQ+LWKW+
Sbjct  738  PDKVKPWELMEILNTQQFRVVTMPQTPDQASKVVRLLYTNSGVGLLALGSNAIQRLWKWN  797

Query  446  YNEQNPS  466
             ++QNP+
Sbjct  798  RSDQNPT  804



>ref|XP_003609722.1| WD repeat-containing protein [Medicago truncatula]
Length=991

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = +2

Query  296  LWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            L +I D   CR+V++P   D   K+ RLLYTNSG  +LAL + GIQKLWKWS N+QNPS
Sbjct  612  LTEIADPGHCRVVTLPDTIDPTNKVVRLLYTNSGTGLLALGAKGIQKLWKWSRNDQNPS  670



>ref|XP_010230706.1| PREDICTED: topless-related protein 2-like isoform X2 [Brachypodium 
distachyon]
Length=1121

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 51/67 (76%), Gaps = 5/67 (7%)
 Frame = +2

Query  281  PNRTKLWDIVDQV---QCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWS  445
            P++ K W++++ +   Q R+V+MP+  D  +K+ RLLYTNSGV +LAL S+ IQ+LWKW+
Sbjct  727  PDKVKPWELMEILNTQQFRVVTMPQTPDQASKVVRLLYTNSGVGLLALGSNAIQRLWKWN  786

Query  446  YNEQNPS  466
             ++QNP+
Sbjct  787  RSDQNPT  793



>dbj|BAJ96033.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03414.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1130

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 49/66 (74%), Gaps = 5/66 (8%)
 Frame = +2

Query  281  PNRTKLWDIVDQV---QCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWS  445
            P++ K W++++ +   Q R+ ++P+  D  +K+ RLLYTNSGV +LAL S+ IQ+LWKW+
Sbjct  736  PDKAKPWELMEVLNPQQFRVATLPETPDQASKVVRLLYTNSGVGLLALGSNAIQRLWKWN  795

Query  446  YNEQNP  463
             NEQNP
Sbjct  796  RNEQNP  801



>dbj|BAJ85297.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1130

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 49/66 (74%), Gaps = 5/66 (8%)
 Frame = +2

Query  281  PNRTKLWDIVDQV---QCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWS  445
            P++ K W++++ +   Q R+ ++P+  D  +K+ RLLYTNSGV +LAL S+ IQ+LWKW+
Sbjct  736  PDKAKPWELMEVLNPQQFRVATLPETPDQASKVVRLLYTNSGVGLLALGSNAIQRLWKWN  795

Query  446  YNEQNP  463
             NEQNP
Sbjct  796  RNEQNP  801



>dbj|BAJ91882.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=770

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 49/66 (74%), Gaps = 5/66 (8%)
 Frame = +2

Query  281  PNRTKLWDIVDQV---QCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWS  445
            P++ K W++++ +   Q R+ ++P+  D  +K+ RLLYTNSGV +LAL S+ IQ+LWKW+
Sbjct  376  PDKAKPWELMEVLNPQQFRVATLPETPDQASKVVRLLYTNSGVGLLALGSNAIQRLWKWN  435

Query  446  YNEQNP  463
             NEQNP
Sbjct  436  RNEQNP  441



>emb|CDM82632.1| unnamed protein product [Triticum aestivum]
Length=1130

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 50/67 (75%), Gaps = 5/67 (7%)
 Frame = +2

Query  281  PNRTKLWDIVDQV---QCRIVSMPKCSD--AKIARLLYTNSGVSILALSSDGIQKLWKWS  445
            P++ K W++++ +   Q R+ ++P+  +  +K+ RLLYTNSGV +LAL S+ IQ+LWKW+
Sbjct  736  PDKAKPWELMEVLNPQQFRVATLPETPEQTSKVVRLLYTNSGVGLLALGSNAIQRLWKWN  795

Query  446  YNEQNPS  466
             NEQNPS
Sbjct  796  RNEQNPS  802



>gb|KEH37175.1| topless-like protein [Medicago truncatula]
Length=972

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 43/67 (64%), Gaps = 2/67 (3%)
 Frame = +2

Query  272  SSGPNRTKLWDIVDQVQCRIVSMPKCSDA--KIARLLYTNSGVSILALSSDGIQKLWKWS  445
            S  P  TK+  IVD VQCRIV+MP       K+ RL YTN G  +LA  S GIQKLWKWS
Sbjct  610  SKEPVDTKIGVIVDSVQCRIVTMPDSMGPTNKVIRLRYTNHGDGLLAFGSKGIQKLWKWS  669

Query  446  YNEQNPS  466
             NE NP+
Sbjct  670  PNELNPT  676



>gb|AAD48936.1|AF160760_4 contains similarity to Pfam family PF0040 - WD domain, G-beta 
repeat; score=10.8, E=3.2, N-2 [Arabidopsis thaliana]
Length=892

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 43/64 (67%), Gaps = 2/64 (3%)
 Frame = +2

Query  281  PNRTKLWDIVDQVQCRIVSMPKC--SDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNE  454
            P   +L +I+D  QC   ++P    S  K+ +LLYTNSG  ILAL S+GIQ+LWKW  NE
Sbjct  744  PKSWQLAEILDPSQCFQATLPDTAGSSTKVVQLLYTNSGAGILALGSNGIQRLWKWVPNE  803

Query  455  QNPS  466
            QNPS
Sbjct  804  QNPS  807



>ref|XP_004487868.1| PREDICTED: topless-related protein 2-like [Cicer arietinum]
Length=1122

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKC--SDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            +L +IV  VQCRIV++P+   S+ K+A L+YTNSG  +LAL S G+QKLWKWS++E NP+
Sbjct  754  ELTEIVHPVQCRIVTVPEGMGSNNKVACLVYTNSGNGLLALGSKGVQKLWKWSFSELNPT  813



>ref|XP_010933383.1| PREDICTED: topless-related protein 1-like isoform X2 [Elaeis 
guineensis]
Length=1137

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 47/66 (71%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKC--SDAKIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            N+ K+W   DIVD  Q + + +P    + +K+ RLLYTNSG+++LAL+S+ I KLWKW  
Sbjct  744  NKIKIWKLADIVDSTQLKALRLPDTVSTTSKVVRLLYTNSGLAVLALASNAIHKLWKWQR  803

Query  449  NEQNPS  466
            +E+NPS
Sbjct  804  SERNPS  809



>ref|XP_010933382.1| PREDICTED: topless-related protein 1-like isoform X1 [Elaeis 
guineensis]
Length=1138

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 47/66 (71%), Gaps = 5/66 (8%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKC--SDAKIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            N+ K+W   DIVD  Q + + +P    + +K+ RLLYTNSG+++LAL+S+ I KLWKW  
Sbjct  745  NKIKIWKLADIVDSTQLKALRLPDTVSTTSKVVRLLYTNSGLAVLALASNAIHKLWKWQR  804

Query  449  NEQNPS  466
            +E+NPS
Sbjct  805  SERNPS  810



>ref|XP_004245913.1| PREDICTED: topless-related protein 1-like isoform X2 [Solanum 
lycopersicum]
Length=1135

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            K  DI D  Q + + +P   S +K+ RLLYTNSG+S+LALSS+ I KLWKW  NE+NPS
Sbjct  749  KFSDIADSSQLKTLKLPDPLSASKVLRLLYTNSGLSVLALSSNAIHKLWKWQRNERNPS  807



>ref|XP_010325597.1| PREDICTED: topless-related protein 1-like isoform X1 [Solanum 
lycopersicum]
Length=1136

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            K  DI D  Q + + +P   S +K+ RLLYTNSG+S+LALSS+ I KLWKW  NE+NPS
Sbjct  749  KFSDIADSSQLKTLKLPDPLSASKVLRLLYTNSGLSVLALSSNAIHKLWKWQRNERNPS  807



>ref|XP_010325598.1| PREDICTED: topless-related protein 1-like isoform X3 [Solanum 
lycopersicum]
Length=1134

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            K  DI D  Q + + +P   S +K+ RLLYTNSG+S+LALSS+ I KLWKW  NE+NPS
Sbjct  747  KFSDIADSSQLKTLKLPDPLSASKVLRLLYTNSGLSVLALSSNAIHKLWKWQRNERNPS  805



>emb|CDY25010.1| BnaC02g39980D [Brassica napus]
Length=1112

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/64 (52%), Positives = 43/64 (67%), Gaps = 2/64 (3%)
 Frame = +2

Query  281  PNRTKLWDIVDQVQCRIVSMPKC--SDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNE  454
            P   +L +I+D  QCR  ++P    S  K+ RLLYTNSG  I+AL  +GIQ+LWKW  +E
Sbjct  730  PRPWQLAEIMDPAQCRKATLPDTAGSSTKVVRLLYTNSGAGIVALGLNGIQRLWKWVRSE  789

Query  455  QNPS  466
            QNPS
Sbjct  790  QNPS  793



>ref|NP_001190409.1| Topless-related protein 3 [Arabidopsis thaliana]
 gb|AED93643.1| Topless-related protein 3 [Arabidopsis thaliana]
Length=1134

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 43/64 (67%), Gaps = 2/64 (3%)
 Frame = +2

Query  281  PNRTKLWDIVDQVQCRIVSMPKC--SDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNE  454
            P   +L +I+D  QC   ++P    S  K+ +LLYTNSG  ILAL S+GIQ+LWKW  NE
Sbjct  753  PKSWQLAEILDPSQCFQATLPDTAGSSTKVVQLLYTNSGAGILALGSNGIQRLWKWVPNE  812

Query  455  QNPS  466
            QNPS
Sbjct  813  QNPS  816



>ref|NP_198055.3| Topless-related protein 3 [Arabidopsis thaliana]
 sp|Q84JM4.1|TPR3_ARATH RecName: Full=Topless-related protein 3 [Arabidopsis thaliana]
 gb|AAO42071.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50698.1| unknown protein [Arabidopsis thaliana]
 gb|AED93642.1| Topless-related protein 3 [Arabidopsis thaliana]
Length=1108

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 43/64 (67%), Gaps = 2/64 (3%)
 Frame = +2

Query  281  PNRTKLWDIVDQVQCRIVSMPKC--SDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNE  454
            P   +L +I+D  QC   ++P    S  K+ +LLYTNSG  ILAL S+GIQ+LWKW  NE
Sbjct  727  PKSWQLAEILDPSQCFQATLPDTAGSSTKVVQLLYTNSGAGILALGSNGIQRLWKWVPNE  786

Query  455  QNPS  466
            QNPS
Sbjct  787  QNPS  790



>ref|XP_001768092.1| predicted protein [Physcomitrella patens]
 gb|EDQ67164.1| predicted protein [Physcomitrella patens]
Length=1158

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 47/66 (71%), Gaps = 4/66 (6%)
 Frame = +2

Query  281  PNRTKLW---DIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            P+R+K W   +I +Q QCR + +P      K+ARL+YTN+GV++LAL+S+ + KLWKW  
Sbjct  766  PDRSKSWKLTEITEQNQCRTIRLPDSLPPNKVARLIYTNAGVALLALASNAVHKLWKWQR  825

Query  449  NEQNPS  466
            NE+N S
Sbjct  826  NERNVS  831



>ref|XP_001781989.1| predicted protein [Physcomitrella patens]
 gb|EDQ53213.1| predicted protein [Physcomitrella patens]
Length=1102

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 46/64 (72%), Gaps = 4/64 (6%)
 Frame = +2

Query  281  PNRTKLW---DIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSY  448
            P+R+K W   +I +Q QCR + +P      K+ARL+YTN+GV++LAL+S+ + KLWKW  
Sbjct  710  PDRSKSWKLTEITEQNQCRTIRLPDSLPPNKVARLIYTNAGVALLALASNAVHKLWKWQR  769

Query  449  NEQN  460
            NE+N
Sbjct  770  NERN  773



>ref|XP_006394928.1| hypothetical protein EUTSA_v10003550mg [Eutrema salsugineum]
 gb|ESQ32214.1| hypothetical protein EUTSA_v10003550mg [Eutrema salsugineum]
Length=1136

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/64 (52%), Positives = 42/64 (66%), Gaps = 2/64 (3%)
 Frame = +2

Query  281  PNRTKLWDIVDQVQCRIVSMPKC--SDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNE  454
            P   +L +I+D  QCR  ++P    S  K+ RLLYTNSG  ILAL  +GIQ+ WKW  +E
Sbjct  754  PKSWQLAEILDPTQCRQATLPDTAGSSIKVVRLLYTNSGSGILALGFNGIQRFWKWVRSE  813

Query  455  QNPS  466
            QNPS
Sbjct  814  QNPS  817



>ref|XP_009395448.1| PREDICTED: topless-related protein 1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=1135

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPK--CSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL DIVD    + + +P    + +K+ RLLYTNSG+++LAL S+ I KLWKW+ NE+NPS
Sbjct  748  KLADIVDSAHLKALRLPDPVTTSSKVVRLLYTNSGLAVLALGSNAIHKLWKWTRNERNPS  807



>ref|XP_009395446.1| PREDICTED: topless-related protein 1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=1137

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPK--CSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL DIVD    + + +P    + +K+ RLLYTNSG+++LAL S+ I KLWKW+ NE+NPS
Sbjct  750  KLADIVDSAHLKALRLPDPVTTSSKVVRLLYTNSGLAVLALGSNAIHKLWKWTRNERNPS  809



>gb|ABG29319.1| Beta transducin-like protein, putative [Solanum bulbocastanum]
Length=600

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            K  DI D  Q + + +P   S +K+ RLLYTNSG+S+LAL S+ I KLWKW  NE+NPS
Sbjct  222  KFSDIADSSQLKTLKLPDPLSASKVLRLLYTNSGLSVLALGSNAIHKLWKWQRNERNPS  280



>ref|XP_008788808.1| PREDICTED: protein TOPLESS-like [Phoenix dactylifera]
 ref|XP_008788818.1| PREDICTED: protein TOPLESS-like [Phoenix dactylifera]
Length=1137

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP--KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL DIVD  + + + +P    + +K+ RLLYTNSG+++LAL+S  I KLWKW  NE+NPS
Sbjct  750  KLADIVDSAELKALRLPDTMSTTSKVVRLLYTNSGMAVLALASSAIHKLWKWQRNERNPS  809



>ref|XP_009396116.1| PREDICTED: protein TOPLESS-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=1136

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKC--SDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL DIVD    R + +P    +  K+ RLLYTNSG++ILAL S+ + KLWKW+ NE+NPS
Sbjct  750  KLADIVDSAHLRTLRLPDTVTNSTKVVRLLYTNSGLAILALGSNAVHKLWKWTRNERNPS  809



>ref|XP_009396112.1| PREDICTED: protein TOPLESS-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009396113.1| PREDICTED: protein TOPLESS-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009396115.1| PREDICTED: protein TOPLESS-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=1138

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKC--SDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL DIVD    R + +P    +  K+ RLLYTNSG++ILAL S+ + KLWKW+ NE+NPS
Sbjct  752  KLADIVDSAHLRTLRLPDTVTNSTKVVRLLYTNSGLAILALGSNAVHKLWKWTRNERNPS  811



>ref|XP_009801466.1| PREDICTED: topless-related protein 1-like isoform X2 [Nicotiana 
sylvestris]
Length=1136

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 45/65 (69%), Gaps = 4/65 (6%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYN  451
            ++TK W   DI D  Q + + +P   S +K+ RLLYTNSG+++LAL S+ I KLWKW  N
Sbjct  743  DKTKSWKVSDIADSSQLKTLKLPDPLSASKVLRLLYTNSGLAVLALGSNAIHKLWKWQRN  802

Query  452  EQNPS  466
            E+NPS
Sbjct  803  ERNPS  807



>ref|XP_006352935.1| PREDICTED: protein TOPLESS-like isoform X1 [Solanum tuberosum]
Length=1136

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            K  DI D  Q + + +P   S +K+ RLLYTNSG+S+LAL S+ I KLWKW  NE+NPS
Sbjct  749  KFSDIADSSQLKTLKLPDPLSASKVLRLLYTNSGLSVLALGSNAIHKLWKWQRNERNPS  807



>ref|XP_009801463.1| PREDICTED: topless-related protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009801464.1| PREDICTED: topless-related protein 1-like isoform X1 [Nicotiana 
sylvestris]
Length=1137

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 45/65 (69%), Gaps = 4/65 (6%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYN  451
            ++TK W   DI D  Q + + +P   S +K+ RLLYTNSG+++LAL S+ I KLWKW  N
Sbjct  743  DKTKSWKVSDIADSSQLKTLKLPDPLSASKVLRLLYTNSGLAVLALGSNAIHKLWKWQRN  802

Query  452  EQNPS  466
            E+NPS
Sbjct  803  ERNPS  807



>ref|XP_006352936.1| PREDICTED: protein TOPLESS-like isoform X2 [Solanum tuberosum]
Length=1135

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            K  DI D  Q + + +P   S +K+ RLLYTNSG+S+LAL S+ I KLWKW  NE+NPS
Sbjct  749  KFSDIADSSQLKTLKLPDPLSASKVLRLLYTNSGLSVLALGSNAIHKLWKWQRNERNPS  807



>ref|XP_009400780.1| PREDICTED: topless-related protein 1-like [Musa acuminata subsp. 
malaccensis]
Length=1138

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA-KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL DIVD    + + +P    A K+ RLLYTNSG ++LAL S+ I KLWKW  NE+NPS
Sbjct  753  KLADIVDSAHLKALRLPDSMTASKVVRLLYTNSGFAVLALGSNAIHKLWKWVRNERNPS  811



>ref|XP_009396205.1| PREDICTED: topless-related protein 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009396206.1| PREDICTED: topless-related protein 1-like [Musa acuminata subsp. 
malaccensis]
Length=1138

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 31/60 (52%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKC--SDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL DIVD    + + +P    + +K+ RLLYTNSG+++LAL S+ I KLWKW+ NE+NPS
Sbjct  752  KLADIVDSAHLKALRLPDSMTTSSKVVRLLYTNSGLAVLALGSNAIHKLWKWTRNERNPS  811



>ref|XP_010920062.1| PREDICTED: protein TOPLESS-like [Elaeis guineensis]
Length=1137

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP--KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL DIVD  + + + +P    + +K+ RLLYTN+G+++L LSS+ I KLWKW  NE+NPS
Sbjct  750  KLADIVDSAELKTLRLPDTMSTTSKVVRLLYTNNGMAVLVLSSNAIHKLWKWQRNERNPS  809



>ref|XP_010278758.1| PREDICTED: topless-related protein 1-like isoform X2 [Nelumbo 
nucifera]
Length=1133

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL DI+D  Q + + +P   +  KI RL+YTNSG+++LAL+S+ + KLWKW   E+NPS
Sbjct  750  KLPDIIDSAQLKALRLPDPMATGKIVRLIYTNSGLAVLALASNAVHKLWKWQRTERNPS  808



>ref|XP_010278757.1| PREDICTED: topless-related protein 1-like isoform X1 [Nelumbo 
nucifera]
Length=1134

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL DI+D  Q + + +P   +  KI RL+YTNSG+++LAL+S+ + KLWKW   E+NPS
Sbjct  750  KLPDIIDSAQLKALRLPDPMATGKIVRLIYTNSGLAVLALASNAVHKLWKWQRTERNPS  808



>ref|XP_009597375.1| PREDICTED: topless-related protein 1-like isoform X4 [Nicotiana 
tomentosiformis]
Length=1136

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            K+ DI D  Q + + +P   S +K+ RLLYTNSG+++LAL S+ I KLWKW  NE+NPS
Sbjct  749  KVSDIADSSQLKTLKLPDSLSASKVLRLLYTNSGLAVLALGSNAIHKLWKWQRNERNPS  807



>ref|XP_009597374.1| PREDICTED: topless-related protein 1-like isoform X3 [Nicotiana 
tomentosiformis]
Length=1137

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            K+ DI D  Q + + +P   S +K+ RLLYTNSG+++LAL S+ I KLWKW  NE+NPS
Sbjct  749  KVSDIADSSQLKTLKLPDSLSASKVLRLLYTNSGLAVLALGSNAIHKLWKWQRNERNPS  807



>ref|XP_009395323.1| PREDICTED: protein TOPLESS-like isoform X3 [Musa acuminata subsp. 
malaccensis]
Length=1129

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPK--CSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL DIVD    R + +P    +  K+ RLLYTNSG+ +LAL S+ I KLWKW+  E+NPS
Sbjct  742  KLVDIVDSANPRTLRLPDTLATSTKVVRLLYTNSGLGVLALGSNAIHKLWKWTRTERNPS  801



>ref|XP_009397650.1| PREDICTED: topless-related protein 1-like [Musa acuminata subsp. 
malaccensis]
Length=1142

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP--KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL D+VD    + + +P    + +K+ RLLYTNSG+S+LAL S+ + KLWKW+ N++NPS
Sbjct  753  KLADVVDSAHIKALHLPDSTSTKSKVMRLLYTNSGLSVLALGSNAVHKLWKWTRNDRNPS  812



>ref|XP_009395318.1| PREDICTED: protein TOPLESS-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395319.1| PREDICTED: protein TOPLESS-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395321.1| PREDICTED: protein TOPLESS-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=1145

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPK--CSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL DIVD    R + +P    +  K+ RLLYTNSG+ +LAL S+ I KLWKW+  E+NPS
Sbjct  758  KLVDIVDSANPRTLRLPDTLATSTKVVRLLYTNSGLGVLALGSNAIHKLWKWTRTERNPS  817



>ref|XP_009395322.1| PREDICTED: protein TOPLESS-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=1143

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPK--CSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL DIVD    R + +P    +  K+ RLLYTNSG+ +LAL S+ I KLWKW+  E+NPS
Sbjct  756  KLVDIVDSANPRTLRLPDTLATSTKVVRLLYTNSGLGVLALGSNAIHKLWKWTRTERNPS  815



>ref|XP_009597373.1| PREDICTED: topless-related protein 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=1170

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            K+ DI D  Q + + +P   S +K+ RLLYTNSG+++LAL S+ I KLWKW  NE+NPS
Sbjct  783  KVSDIADSSQLKTLKLPDSLSASKVLRLLYTNSGLAVLALGSNAIHKLWKWQRNERNPS  841



>ref|XP_009597371.1| PREDICTED: topless-related protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009597372.1| PREDICTED: topless-related protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=1171

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            K+ DI D  Q + + +P   S +K+ RLLYTNSG+++LAL S+ I KLWKW  NE+NPS
Sbjct  783  KVSDIADSSQLKTLKLPDSLSASKVLRLLYTNSGLAVLALGSNAIHKLWKWQRNERNPS  841



>gb|KFK25571.1| hypothetical protein AALP_AA8G132300 [Arabis alpina]
Length=568

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = +2

Query  302  DIVDQVQCRIVSMPKC--SDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNP  463
            +I+D   CR +++P    S  K+  LLY NSGV ILAL SDGIQ+LW+W  +EQNP
Sbjct  217  EILDSSGCRQITLPNTAGSPTKVVGLLYMNSGVGILALGSDGIQRLWRWVPHEQNP  272



>ref|XP_010943653.1| PREDICTED: topless-related protein 1-like isoform X2 [Elaeis 
guineensis]
Length=1133

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP--KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL +IVD    + + +P    + +KI RLLYTNSG+++LAL+S+ I KLWKW  +E+NPS
Sbjct  747  KLAEIVDSAHLKTLRLPDSMTATSKIVRLLYTNSGLAVLALASNAIHKLWKWQRSERNPS  806



>ref|XP_010943652.1| PREDICTED: topless-related protein 1-like isoform X1 [Elaeis 
guineensis]
Length=1135

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP--KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL +IVD    + + +P    + +KI RLLYTNSG+++LAL+S+ I KLWKW  +E+NPS
Sbjct  749  KLAEIVDSAHLKTLRLPDSMTATSKIVRLLYTNSGLAVLALASNAIHKLWKWQRSERNPS  808



>ref|XP_007155033.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris]
 gb|ESW27027.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris]
Length=1129

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL +I +  QCR + +P   S  +++RL+YTN GV+ILAL+++ + KLWKW  NE+NPS
Sbjct  751  KLTEINEPSQCRSLKLPDSLSSMRVSRLIYTNQGVAILALATNAVHKLWKWQRNERNPS  809



>ref|XP_007155035.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris]
 gb|ESW27029.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris]
Length=1132

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL +I +  QCR + +P   S  +++RL+YTN GV+ILAL+++ + KLWKW  NE+NPS
Sbjct  754  KLTEINEPSQCRSLKLPDSLSSMRVSRLIYTNQGVAILALATNAVHKLWKWQRNERNPS  812



>ref|XP_006381123.1| hypothetical protein POPTR_0006s06570g [Populus trichocarpa]
 gb|ERP58920.1| hypothetical protein POPTR_0006s06570g [Populus trichocarpa]
Length=1131

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL +I +  QCR + +P   +  +++RL+YTNSGV+ILAL+S+ + KLWKW  N++NPS
Sbjct  752  KLTEINEPSQCRSLRLPDSLTSMRVSRLIYTNSGVAILALASNAVHKLWKWQRNDRNPS  810



>ref|XP_002308068.1| WD-40 repeat family protein [Populus trichocarpa]
 gb|EEE91591.1| WD-40 repeat family protein [Populus trichocarpa]
Length=1132

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL +I +  QCR + +P   +  +++RL+YTNSGV+ILAL+S+ + KLWKW  N++NPS
Sbjct  752  KLTEINEPSQCRSLRLPDSLTSMRVSRLIYTNSGVAILALASNAVHKLWKWQRNDRNPS  810



>ref|XP_010250290.1| PREDICTED: protein TOPLESS-like isoform X4 [Nelumbo nucifera]
Length=1134

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL +I +QVQCR + +P      KI+RL+YTNSG +ILAL+S+ I  LWKW  NE+N S
Sbjct  753  KLTEISEQVQCRSLRLPDNLRTNKISRLIYTNSGTAILALASNAIHLLWKWQRNERNTS  811



>ref|XP_010250289.1| PREDICTED: protein TOPLESS-like isoform X3 [Nelumbo nucifera]
Length=1135

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL +I +QVQCR + +P      KI+RL+YTNSG +ILAL+S+ I  LWKW  NE+N S
Sbjct  754  KLTEISEQVQCRSLRLPDNLRTNKISRLIYTNSGTAILALASNAIHLLWKWQRNERNTS  812



>ref|XP_010250288.1| PREDICTED: protein TOPLESS-like isoform X2 [Nelumbo nucifera]
Length=1136

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP---KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNP  463
            KL +I +QVQCR + +P   + +  +I+RL+YTNSG +ILAL+S+ I  LWKW  NE+N 
Sbjct  753  KLTEISEQVQCRSLRLPDNLRTNKPQISRLIYTNSGTAILALASNAIHLLWKWQRNERNT  812

Query  464  S  466
            S
Sbjct  813  S  813



>ref|XP_010250287.1| PREDICTED: protein TOPLESS-like isoform X1 [Nelumbo nucifera]
Length=1137

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP---KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNP  463
            KL +I +QVQCR + +P   + +  +I+RL+YTNSG +ILAL+S+ I  LWKW  NE+N 
Sbjct  754  KLTEISEQVQCRSLRLPDNLRTNKPQISRLIYTNSGTAILALASNAIHLLWKWQRNERNT  813

Query  464  S  466
            S
Sbjct  814  S  814



>ref|XP_010243111.1| PREDICTED: protein TOPLESS-like [Nelumbo nucifera]
 ref|XP_010243113.1| PREDICTED: protein TOPLESS-like [Nelumbo nucifera]
Length=1138

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL DIVD  Q + + +P   +  K+ RL+YTNSG+++LAL+S+ + KLWKW   E+NPS
Sbjct  750  KLPDIVDSSQLKALRLPDPITAGKVVRLIYTNSGLAVLALASNAVHKLWKWQRTERNPS  808



>ref|XP_008798009.1| PREDICTED: topless-related protein 1-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008798011.1| PREDICTED: topless-related protein 1-like isoform X1 [Phoenix 
dactylifera]
Length=1137

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP--KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL DIVD  Q + + +P    + +K+ RLLY NSG+++LAL+S+ I KLWKW   E+NPS
Sbjct  750  KLADIVDSSQLKALRLPDSMSTTSKVVRLLYANSGLAVLALASNAIHKLWKWQRGERNPS  809



>ref|XP_008798012.1| PREDICTED: protein TOPLESS-like isoform X2 [Phoenix dactylifera]
Length=1129

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP--KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL DIVD  Q + + +P    + +K+ RLLY NSG+++LAL+S+ I KLWKW   E+NPS
Sbjct  742  KLADIVDSSQLKALRLPDSMSTTSKVVRLLYANSGLAVLALASNAIHKLWKWQRGERNPS  801



>ref|XP_008803470.1| PREDICTED: topless-related protein 1-like isoform X1 [Phoenix 
dactylifera]
Length=1136

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL +IVD    + + +P   + +K+ RLLYTNSG+++LAL+S+ I KLWKW   E+NPS
Sbjct  751  KLPEIVDSAHLKALRLPDSMTTSKVVRLLYTNSGLAVLALASNAIHKLWKWQRTERNPS  809



>ref|XP_008803471.1| PREDICTED: topless-related protein 1-like isoform X2 [Phoenix 
dactylifera]
Length=1134

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL +IVD    + + +P   + +K+ RLLYTNSG+++LAL+S+ I KLWKW   E+NPS
Sbjct  749  KLPEIVDSAHLKALRLPDSMTTSKVVRLLYTNSGLAVLALASNAIHKLWKWQRTERNPS  807



>ref|XP_009595073.1| PREDICTED: topless-related protein 4-like isoform X2 [Nicotiana 
tomentosiformis]
Length=1134

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 48/65 (74%), Gaps = 4/65 (6%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYN  451
            +++++W   +I +  QCR + +P   +  +I+RL+YTNSG++ILAL+S+ + KLWKW  N
Sbjct  750  DKSRIWKPTEINEPSQCRSLKLPDSLTATRISRLIYTNSGLAILALASNAVHKLWKWPRN  809

Query  452  EQNPS  466
            E+NP+
Sbjct  810  ERNPT  814



>ref|XP_009595072.1| PREDICTED: topless-related protein 4-like isoform X1 [Nicotiana 
tomentosiformis]
Length=1137

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 48/65 (74%), Gaps = 4/65 (6%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYN  451
            +++++W   +I +  QCR + +P   +  +I+RL+YTNSG++ILAL+S+ + KLWKW  N
Sbjct  753  DKSRIWKPTEINEPSQCRSLKLPDSLTATRISRLIYTNSGLAILALASNAVHKLWKWPRN  812

Query  452  EQNPS  466
            E+NP+
Sbjct  813  ERNPT  817



>ref|XP_006659155.1| PREDICTED: protein TOPLESS-like [Oryza brachyantha]
Length=1133

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 40/59 (68%), Gaps = 2/59 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCS--DAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNP  463
            KL DIVD    R + MP  S   +K+ RLLYTN+G+++LAL S+ + KLWKW   E+NP
Sbjct  751  KLADIVDSGHLRALRMPDTSATSSKVVRLLYTNNGIALLALGSNAVHKLWKWQRTERNP  809



>ref|XP_009803406.1| PREDICTED: topless-related protein 4-like isoform X1 [Nicotiana 
sylvestris]
Length=1137

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 48/65 (74%), Gaps = 4/65 (6%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYN  451
            +++++W   +I +  QCR + +P   +  +I+RL+YTNSG++ILAL+S+ + KLWKW  N
Sbjct  753  DKSRIWKPTEINEPSQCRSLKLPDNLTATRISRLIYTNSGLAILALASNAVHKLWKWPRN  812

Query  452  EQNPS  466
            E+NP+
Sbjct  813  ERNPT  817



>ref|XP_009803412.1| PREDICTED: topless-related protein 4-like isoform X2 [Nicotiana 
sylvestris]
Length=1134

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 48/65 (74%), Gaps = 4/65 (6%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYN  451
            +++++W   +I +  QCR + +P   +  +I+RL+YTNSG++ILAL+S+ + KLWKW  N
Sbjct  750  DKSRIWKPTEINEPSQCRSLKLPDNLTATRISRLIYTNSGLAILALASNAVHKLWKWPRN  809

Query  452  EQNPS  466
            E+NP+
Sbjct  810  ERNPT  814



>ref|XP_007155034.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris]
 gb|ESW27028.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris]
Length=1131

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL +I +  QCR + +P   S  +++RL+YTN GV+ILAL+++ + KLWKW  NE+NPS
Sbjct  753  KLTEINEPSQCRSLKLPDSLSSMRVSRLIYTNQGVAILALATNAVHKLWKWQRNERNPS  811



>ref|XP_007155032.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris]
 gb|ESW27026.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris]
Length=1128

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL +I +  QCR + +P   S  +++RL+YTN GV+ILAL+++ + KLWKW  NE+NPS
Sbjct  750  KLTEINEPSQCRSLKLPDSLSSMRVSRLIYTNQGVAILALATNAVHKLWKWQRNERNPS  808



>ref|XP_007220318.1| hypothetical protein PRUPE_ppa000528m1g, partial [Prunus persica]
 gb|EMJ21517.1| hypothetical protein PRUPE_ppa000528m1g, partial [Prunus persica]
Length=736

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPKCSDA-KIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            K+ DI D  Q + + +P  + A KI RL+YTN+G+++LAL+S+ + KLWKW  NE+NPS
Sbjct  352  KISDIADPSQMKALRLPDSTTAGKIVRLMYTNNGLALLALTSNAVHKLWKWQRNERNPS  410



>gb|EYU23277.1| hypothetical protein MIMGU_mgv1a000461mg [Erythranthe guttata]
Length=1136

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            K  DI +  Q + + +P   + +K+ RL+YTNSG+++LAL+S+ + KLWKW  NE+NPS
Sbjct  750  KFPDIAESTQLKTLKLPDPLAASKVVRLIYTNSGLAVLALASNAVHKLWKWQRNERNPS  808



>ref|XP_010662133.1| PREDICTED: protein TOPLESS isoform X1 [Vitis vinifera]
Length=1139

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNP  463
            K+ DIVDQ Q + + +P   +  K+ RL+YTNSG+++LAL S+ + KLWKW  +E+NP
Sbjct  754  KIPDIVDQSQLKALRLPDPVTTGKVVRLIYTNSGLALLALISNAVHKLWKWQRSERNP  811



>ref|XP_010662135.1| PREDICTED: protein TOPLESS isoform X4 [Vitis vinifera]
Length=1134

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNP  463
            K+ DIVDQ Q + + +P   +  K+ RL+YTNSG+++LAL S+ + KLWKW  +E+NP
Sbjct  750  KIPDIVDQSQLKALRLPDPVTTGKVVRLIYTNSGLALLALISNAVHKLWKWQRSERNP  807



>ref|XP_002275116.1| PREDICTED: protein TOPLESS isoform X3 [Vitis vinifera]
 emb|CBI26554.3| unnamed protein product [Vitis vinifera]
Length=1135

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNP  463
            K+ DIVDQ Q + + +P   +  K+ RL+YTNSG+++LAL S+ + KLWKW  +E+NP
Sbjct  750  KIPDIVDQSQLKALRLPDPVTTGKVVRLIYTNSGLALLALISNAVHKLWKWQRSERNP  807



>ref|XP_010662134.1| PREDICTED: protein TOPLESS isoform X2 [Vitis vinifera]
Length=1138

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNP  463
            K+ DIVDQ Q + + +P   +  K+ RL+YTNSG+++LAL S+ + KLWKW  +E+NP
Sbjct  754  KIPDIVDQSQLKALRLPDPVTTGKVVRLIYTNSGLALLALISNAVHKLWKWQRSERNP  811



>ref|XP_011092591.1| PREDICTED: topless-related protein 1-like isoform X2 [Sesamum 
indicum]
Length=1137

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL +I D  Q + + +P     +K+ RLLYTNSG+++LAL+S+ + KLWKW  NE+NPS
Sbjct  751  KLPEISDSSQLKTLKLPDPLVASKVVRLLYTNSGLAVLALASNAVHKLWKWQRNERNPS  809



>ref|XP_011092592.1| PREDICTED: topless-related protein 1-like isoform X3 [Sesamum 
indicum]
Length=1136

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL +I D  Q + + +P     +K+ RLLYTNSG+++LAL+S+ + KLWKW  NE+NPS
Sbjct  750  KLPEISDSSQLKTLKLPDPLVASKVVRLLYTNSGLAVLALASNAVHKLWKWQRNERNPS  808



>ref|XP_011092590.1| PREDICTED: topless-related protein 1-like isoform X1 [Sesamum 
indicum]
Length=1139

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL +I D  Q + + +P     +K+ RLLYTNSG+++LAL+S+ + KLWKW  NE+NPS
Sbjct  753  KLPEISDSSQLKTLKLPDPLVASKVVRLLYTNSGLAVLALASNAVHKLWKWQRNERNPS  811



>gb|EMS49891.1| Topless-related protein 1 [Triticum urartu]
Length=1101

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSM-PKCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQN  460
            KL +I D  QCR + +      AKI+RL+YTNSGV+ILAL+S+ +  LWKW  NE+N
Sbjct  718  KLMEITDTAQCRSLKLGDSIRTAKISRLIYTNSGVAILALASNAVHLLWKWPRNERN  774



>gb|KDP30260.1| hypothetical protein JCGZ_17042 [Jatropha curcas]
Length=1130

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNP  463
            K+ +I +  QCR + +P   +  +IARL+YTNSG++ILAL+S+ + KLWKW  N++NP
Sbjct  751  KVTEINEPSQCRSLRLPDNMTAMRIARLIYTNSGLAILALASNAVHKLWKWQRNDRNP  808



>ref|XP_010034955.1| PREDICTED: protein TOPLESS-like isoform X2 [Eucalyptus grandis]
Length=1102

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            K+ D+VD  Q +   +P   S  K+ RL+YTNSG+++LAL S+ + KLWKW  +E+NPS
Sbjct  714  KIPDVVDPSQLKAARLPDSVSTGKVVRLIYTNSGLAVLALGSNAVHKLWKWQRSERNPS  772



>ref|XP_006854127.1| hypothetical protein AMTR_s00048p00159380 [Amborella trichopoda]
 gb|ERN15594.1| hypothetical protein AMTR_s00048p00159380 [Amborella trichopoda]
Length=991

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL DI D    +++ +P   S  K+ RLLYTNSG ++LAL+S+ I KLWKW  +++NPS
Sbjct  751  KLSDIADSSLLKVLRLPDPFSTGKVVRLLYTNSGFAVLALASNAIHKLWKWQRSDRNPS  809



>gb|EMT24067.1| hypothetical protein F775_25939 [Aegilops tauschii]
Length=1140

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSM-PKCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQN  460
            KL +I D  QCR + +      AKI+RL+YTNSGV+ILAL+S+ +  LWKW  NE+N
Sbjct  757  KLMEITDTAQCRSLKLGDSIRTAKISRLIYTNSGVAILALASNAVHLLWKWPRNERN  813



>ref|XP_010034954.1| PREDICTED: protein TOPLESS-like isoform X1 [Eucalyptus grandis]
 gb|KCW46189.1| hypothetical protein EUGRSUZ_K00093 [Eucalyptus grandis]
 gb|KCW46190.1| hypothetical protein EUGRSUZ_K00093 [Eucalyptus grandis]
Length=1136

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            K+ D+VD  Q +   +P   S  K+ RL+YTNSG+++LAL S+ + KLWKW  +E+NPS
Sbjct  748  KIPDVVDPSQLKAARLPDSVSTGKVVRLIYTNSGLAVLALGSNAVHKLWKWQRSERNPS  806



>ref|XP_008242803.1| PREDICTED: topless-related protein 4-like [Prunus mume]
Length=1131

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPSR  469
            KL +I +  QCR + +P   +  +++RL+YTNSG+++LALSS+ + KLWKW  NE+N ++
Sbjct  754  KLTEINEPSQCRSLRLPDSLTATRVSRLIYTNSGLAVLALSSNAVHKLWKWQRNERNTTK  813



>ref|XP_008786937.1| PREDICTED: topless-related protein 1-like [Phoenix dactylifera]
Length=438

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 2/60 (3%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP--KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL +I D    + + +P    + +KI RLLYTNSG+++LAL+S+ I KLWKW   E+NPS
Sbjct  30   KLAEIGDSAHLKTLRLPDSMTTTSKIVRLLYTNSGLAVLALASNAIHKLWKWQRTERNPS  89



>gb|AES91574.2| topless-like protein [Medicago truncatula]
Length=1134

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPK-CSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL +I +Q QCR + +P   S  +++RL+YTN GV+ILAL+++ + KLWKW  N++N S
Sbjct  755  KLTEINEQSQCRSLKLPDGLSSMRVSRLIYTNQGVAILALAANAVHKLWKWQKNDRNTS  813



>gb|KEH32128.1| topless-like protein [Medicago truncatula]
Length=1114

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPK-CSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL +I +Q QCR + +P   S  +++RL+YTN GV+ILAL+++ + KLWKW  N++N S
Sbjct  735  KLTEINEQSQCRSLKLPDGLSSMRVSRLIYTNQGVAILALAANAVHKLWKWQKNDRNTS  793



>ref|XP_003609377.1| WD repeat-containing protein [Medicago truncatula]
Length=1132

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMPK-CSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            KL +I +Q QCR + +P   S  +++RL+YTN GV+ILAL+++ + KLWKW  N++N S
Sbjct  753  KLTEINEQSQCRSLKLPDGLSSMRVSRLIYTNQGVAILALAANAVHKLWKWQKNDRNTS  811



>gb|KCW80030.1| hypothetical protein EUGRSUZ_C013682, partial [Eucalyptus grandis]
Length=295

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 43/57 (75%), Gaps = 1/57 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQN  460
            KL +I + +QCR + +P   +  +++RL+YTNSG++ILALSS+ + KLWKW  +++N
Sbjct  230  KLTEINESLQCRSIKLPDNLTAMRVSRLIYTNSGLAILALSSNAVHKLWKWQKSDRN  286



>gb|KCW80104.1| hypothetical protein EUGRSUZ_C01431 [Eucalyptus grandis]
Length=650

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 54/79 (68%), Gaps = 5/79 (6%)
 Frame = +2

Query  236  EDVEEYKSDAGHSSGPNRTKLW---DIVDQVQCRIVSMPKCSDA-KIARLLYTNSGVSIL  403
            E + + K      SG +++++W   +I +  QCR + +P  S A +++RL+YTNSG++IL
Sbjct  465  ESMADVKPGIADESG-DKSRIWRLTEINEPFQCRSIRLPDDSMATRVSRLIYTNSGLAIL  523

Query  404  ALSSDGIQKLWKWSYNEQN  460
            ALSS+G+ KLWKW  +++N
Sbjct  524  ALSSNGVHKLWKWQISDRN  542



>ref|XP_006358294.1| PREDICTED: topless-related protein 4-like isoform X2 [Solanum 
tuberosum]
Length=1133

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 47/65 (72%), Gaps = 4/65 (6%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKCSDA-KIARLLYTNSGVSILALSSDGIQKLWKWSYN  451
            +++K+W   +I D  QCR + +P  + A K+ RL+YTNSG +ILAL+++ + KLWKW  N
Sbjct  749  DKSKIWKPTEINDPSQCRSLKLPDSATAPKVTRLIYTNSGYAILALAANAVHKLWKWPRN  808

Query  452  EQNPS  466
            +++P+
Sbjct  809  DRHPT  813



>ref|XP_006358293.1| PREDICTED: topless-related protein 4-like isoform X1 [Solanum 
tuberosum]
Length=1134

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 47/65 (72%), Gaps = 4/65 (6%)
 Frame = +2

Query  284  NRTKLW---DIVDQVQCRIVSMPKCSDA-KIARLLYTNSGVSILALSSDGIQKLWKWSYN  451
            +++K+W   +I D  QCR + +P  + A K+ RL+YTNSG +ILAL+++ + KLWKW  N
Sbjct  750  DKSKIWKPTEINDPSQCRSLKLPDSATAPKVTRLIYTNSGYAILALAANAVHKLWKWPRN  809

Query  452  EQNPS  466
            +++P+
Sbjct  810  DRHPT  814



>gb|EPS70365.1| hypothetical protein M569_04393, partial [Genlisea aurea]
Length=1140

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            K  DI D  Q + + +P   + +K+ RLLYTNSG+++LAL S+ + KLWKW  N++NPS
Sbjct  779  KFPDISDASQLKTLKLPDSLAPSKVLRLLYTNSGLAVLALGSNAVHKLWKWQRNDRNPS  837



>ref|XP_006443166.1| hypothetical protein CICLE_v100185902mg, partial [Citrus clementina]
 gb|ESR56406.1| hypothetical protein CICLE_v100185902mg, partial [Citrus clementina]
Length=446

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +2

Query  293  KLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALSSDGIQKLWKWSYNEQNPS  466
            ++ DI D  Q + + +P   + +K+ RL+YTNSG+S+LAL+S+ + KLWKW   E+NPS
Sbjct  62   RIPDISDPSQIKALRLPDSIAASKVVRLIYTNSGLSLLALASNAVHKLWKWQRTERNPS  120



>gb|KDO50585.1| hypothetical protein CISIN_1g0011592mg, partial [Citrus sinensis]
Length=360

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 49/78 (63%), Gaps = 11/78 (14%)
 Frame = +2

Query  236  EDVEEYKSDAGHSSGPNRTKLWDIVDQVQCRIVSMP-KCSDAKIARLLYTNSGVSILALS  412
            EDV++ KS           ++ DI D  Q + + +P   + +K+ RL+YTNSG+S+LAL+
Sbjct  187  EDVDKIKS----------WRIPDISDPSQIKALRLPDSIAASKVVRLIYTNSGLSLLALA  236

Query  413  SDGIQKLWKWSYNEQNPS  466
            S+ + KLWKW   E+NPS
Sbjct  237  SNAVHKLWKWQRTERNPS  254



>ref|XP_007138952.1| hypothetical protein PHAVU_009G252100g [Phaseolus vulgaris]
 gb|ESW10946.1| hypothetical protein PHAVU_009G252100g [Phaseolus vulgaris]
Length=1047

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 47/67 (70%), Gaps = 6/67 (9%)
 Frame = +2

Query  284  NRTKLWDI---VDQVQCRIVSMPKCS---DAKIARLLYTNSGVSILALSSDGIQKLWKWS  445
            +++K+W+I   V+ +QC+ +++   S     K+ RL+YTNSGV ++AL S G Q+LWKWS
Sbjct  684  HKSKVWEITEIVNPLQCQTMTILADSVDPTNKVVRLIYTNSGVGLIALDSKGTQRLWKWS  743

Query  446  YNEQNPS  466
             NE NPS
Sbjct  744  RNELNPS  750



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512662103758