BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25737_g1_i2 len=705 path=[12068:0-218 2809:219-259 12996:260-268
2423:269-272 2427:273-297 12410:298-302 13009:303-334 2925:335-398
2989:399-427 1913:428-446 1932:447-487 12689:488-541 11325:542-575
3164:576-607 8709:608-665 3254:666-690 13179:691-700 12946:701-704]

Length=705
                                                                      Score     E

ref|XP_009595215.1|  PREDICTED: G-type lectin S-receptor-like ser...    284   1e-86   
ref|XP_009765718.1|  PREDICTED: G-type lectin S-receptor-like ser...    282   6e-86   
ref|XP_006351040.1|  PREDICTED: G-type lectin S-receptor-like ser...    278   2e-84   
ref|XP_004249884.1|  PREDICTED: G-type lectin S-receptor-like ser...    276   1e-83   
ref|XP_006351041.1|  PREDICTED: G-type lectin S-receptor-like ser...    275   5e-82   
gb|KDO38717.1|  hypothetical protein CISIN_1g0381681mg                  256   9e-82   
emb|CDP04778.1|  unnamed protein product                                259   7e-81   
emb|CBI37581.3|  unnamed protein product                                251   1e-78   
ref|XP_010649410.1|  PREDICTED: G-type lectin S-receptor-like ser...    262   2e-78   
ref|XP_006429020.1|  hypothetical protein CICLE_v10011255mg             256   3e-77   
ref|XP_006387860.1|  hypothetical protein POPTR_0518s002001g            246   4e-77   
ref|XP_007048280.1|  Receptor-like protein kinase 1                     257   1e-76   
ref|XP_006480848.1|  PREDICTED: G-type lectin S-receptor-like ser...    257   2e-76   
gb|KCW62250.1|  hypothetical protein EUGRSUZ_H04910                     254   2e-76   
ref|XP_006382828.1|  hypothetical protein POPTR_0005s058402g            249   2e-76   
ref|XP_002275615.1|  PREDICTED: G-type lectin S-receptor-like ser...    256   3e-76   Vitis vinifera
emb|CDP04775.1|  unnamed protein product                                239   1e-75   
ref|XP_010027353.1|  PREDICTED: G-type lectin S-receptor-like ser...    254   2e-75   
gb|KCW62265.1|  hypothetical protein EUGRSUZ_H04927                     253   2e-75   
emb|CDP04768.1|  unnamed protein product                                254   3e-75   
ref|XP_010649409.1|  PREDICTED: G-type lectin S-receptor-like ser...    252   1e-74   
emb|CDP04763.1|  unnamed protein product                                252   1e-74   
gb|KCW62264.1|  hypothetical protein EUGRSUZ_H04925                     249   1e-74   
ref|XP_006427825.1|  hypothetical protein CICLE_v10025158mg             249   2e-74   
ref|XP_006387862.1|  hypothetical protein POPTR_0518s00220g             251   4e-74   
ref|XP_006382827.1|  hypothetical protein POPTR_0005s05830g             250   6e-74   
ref|XP_010027360.1|  PREDICTED: G-type lectin S-receptor-like ser...    250   8e-74   
ref|XP_006464594.1|  PREDICTED: G-type lectin S-receptor-like ser...    249   2e-73   
ref|XP_010025552.1|  PREDICTED: G-type lectin S-receptor-like ser...    247   2e-73   
gb|KCW62267.1|  hypothetical protein EUGRSUZ_H04929                     247   7e-73   
ref|XP_010025551.1|  PREDICTED: G-type lectin S-receptor-like ser...    247   1e-72   
emb|CDP04766.1|  unnamed protein product                                246   2e-72   
ref|XP_006427826.1|  hypothetical protein CICLE_v10027040mg             246   2e-72   
ref|XP_008245126.1|  PREDICTED: G-type lectin S-receptor-like ser...    245   5e-72   
ref|XP_011032369.1|  PREDICTED: G-type lectin S-receptor-like ser...    244   6e-72   
ref|XP_011032370.1|  PREDICTED: G-type lectin S-receptor-like ser...    244   7e-72   
gb|KCW62266.1|  hypothetical protein EUGRSUZ_H04928                     242   8e-72   
ref|XP_010245281.1|  PREDICTED: G-type lectin S-receptor-like ser...    244   2e-71   
gb|KDP26121.1|  hypothetical protein JCGZ_22222                         243   2e-71   
ref|XP_010027361.1|  PREDICTED: G-type lectin S-receptor-like ser...    243   5e-71   
ref|XP_004289248.1|  PREDICTED: G-type lectin S-receptor-like ser...    242   5e-71   
ref|XP_002531801.1|  ATP binding protein, putative                      241   2e-70   Ricinus communis
ref|XP_004289247.1|  PREDICTED: G-type lectin S-receptor-like ser...    241   2e-70   
emb|CDP04764.1|  unnamed protein product                                242   2e-70   
ref|XP_002531799.1|  ATP binding protein, putative                      241   3e-70   Ricinus communis
ref|XP_008339042.1|  PREDICTED: G-type lectin S-receptor-like ser...    240   3e-70   
gb|KDP26126.1|  hypothetical protein JCGZ_22227                         240   3e-70   
gb|KDO40386.1|  hypothetical protein CISIN_1g041285mg                   239   3e-70   
ref|XP_007048279.1|  Receptor-like protein kinase 1                     240   4e-70   
emb|CDP04773.1|  unnamed protein product                                239   5e-70   
ref|XP_009366380.1|  PREDICTED: G-type lectin S-receptor-like ser...    240   5e-70   
ref|XP_010027416.1|  PREDICTED: G-type lectin S-receptor-like ser...    228   6e-70   
ref|XP_008338991.1|  PREDICTED: G-type lectin S-receptor-like ser...    239   9e-70   
ref|XP_010260907.1|  PREDICTED: G-type lectin S-receptor-like ser...    239   9e-70   
ref|XP_009366388.1|  PREDICTED: G-type lectin S-receptor-like ser...    238   2e-69   
ref|XP_009366381.1|  PREDICTED: G-type lectin S-receptor-like ser...    238   3e-69   
gb|KCW62458.1|  hypothetical protein EUGRSUZ_H05095                     225   5e-69   
ref|XP_010108660.1|  G-type lectin S-receptor-like serine/threoni...    236   9e-69   
gb|KDO41357.1|  hypothetical protein CISIN_1g038713mg                   223   1e-68   
ref|XP_006427827.1|  hypothetical protein CICLE_v10027123mg             224   5e-68   
emb|CDP04761.1|  unnamed protein product                                234   6e-68   
ref|XP_006844030.1|  hypothetical protein AMTR_s00006p00234620          233   1e-67   
ref|XP_010108661.1|  G-type lectin S-receptor-like serine/threoni...    229   2e-67   
ref|XP_008237620.1|  PREDICTED: G-type lectin S-receptor-like ser...    230   1e-66   
ref|XP_010042956.1|  PREDICTED: G-type lectin S-receptor-like ser...    218   3e-66   
emb|CDP04767.1|  unnamed protein product                                229   6e-66   
ref|XP_010103458.1|  G-type lectin S-receptor-like serine/threoni...    228   8e-66   
emb|CBI35502.3|  unnamed protein product                                224   2e-65   
ref|XP_007019455.1|  Receptor protein kinase 1                          225   2e-64   
ref|XP_007019453.1|  Uncharacterized protein TCM_035508                 222   2e-64   
ref|XP_002264274.2|  PREDICTED: G-type lectin S-receptor-like ser...    224   3e-64   Vitis vinifera
ref|XP_010093826.1|  G-type lectin S-receptor-like serine/threoni...    211   2e-63   
ref|XP_010030364.1|  PREDICTED: G-type lectin S-receptor-like ser...    221   3e-63   
ref|XP_010247281.1|  PREDICTED: G-type lectin S-receptor-like ser...    209   6e-63   
ref|XP_006427830.1|  hypothetical protein CICLE_v10027387mg             216   6e-63   
emb|CBI37577.3|  unnamed protein product                                218   2e-62   
ref|XP_004142231.1|  PREDICTED: G-type lectin S-receptor-like ser...    219   2e-62   
ref|XP_010112633.1|  G-type lectin S-receptor-like serine/threoni...    218   4e-62   
ref|XP_002275592.1|  PREDICTED: G-type lectin S-receptor-like ser...    218   6e-62   Vitis vinifera
ref|XP_008243606.1|  PREDICTED: G-type lectin S-receptor-like ser...    218   9e-62   
ref|XP_009802537.1|  PREDICTED: G-type lectin S-receptor-like ser...    217   1e-61   
ref|XP_006854572.1|  hypothetical protein AMTR_s00030p00110280          216   1e-61   
ref|XP_006354210.1|  PREDICTED: G-type lectin S-receptor-like ser...    214   1e-61   
ref|XP_006854581.1|  hypothetical protein AMTR_s00030p00115530          216   2e-61   
ref|XP_008243607.1|  PREDICTED: G-type lectin S-receptor-like ser...    215   4e-61   
gb|KCW54271.1|  hypothetical protein EUGRSUZ_I00234                     215   5e-61   
ref|XP_004162099.1|  PREDICTED: G-type lectin S-receptor-like ser...    215   5e-61   
ref|XP_009388136.1|  PREDICTED: G-type lectin S-receptor-like ser...    206   5e-61   
ref|XP_010030366.1|  PREDICTED: G-type lectin S-receptor-like ser...    215   5e-61   
ref|XP_004142232.1|  PREDICTED: G-type lectin S-receptor-like ser...    214   8e-61   
gb|KGN54146.1|  hypothetical protein Csa_4G289640                       214   9e-61   
ref|XP_004162098.1|  PREDICTED: G-type lectin S-receptor-like ser...    214   1e-60   
ref|XP_004142230.1|  PREDICTED: G-type lectin S-receptor-like ser...    214   1e-60   
gb|KDP25140.1|  hypothetical protein JCGZ_22675                         214   1e-60   
ref|XP_011037898.1|  PREDICTED: G-type lectin S-receptor-like ser...    214   1e-60   
ref|XP_011037899.1|  PREDICTED: G-type lectin S-receptor-like ser...    213   2e-60   
ref|XP_008243691.1|  PREDICTED: G-type lectin S-receptor-like ser...    213   2e-60   
ref|XP_010265966.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    213   2e-60   
ref|XP_006386080.1|  hypothetical protein POPTR_0003s21920g             207   2e-60   
ref|XP_006494278.1|  PREDICTED: G-type lectin S-receptor-like ser...    213   3e-60   
ref|XP_004142234.1|  PREDICTED: G-type lectin S-receptor-like ser...    213   3e-60   
ref|XP_002533013.1|  conserved hypothetical protein                     214   4e-60   Ricinus communis
ref|XP_010030363.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    212   5e-60   
ref|XP_010100590.1|  G-type lectin S-receptor-like serine/threoni...    212   6e-60   
gb|KDO56479.1|  hypothetical protein CISIN_1g037780mg                   206   6e-60   
ref|XP_004168531.1|  PREDICTED: G-type lectin S-receptor-like ser...    212   6e-60   
ref|XP_006445956.1|  hypothetical protein CICLE_v10017743mg             212   7e-60   
ref|XP_004228922.1|  PREDICTED: G-type lectin S-receptor-like ser...    211   1e-59   
ref|XP_006386087.1|  hypothetical protein POPTR_0003s21980g             198   1e-59   
ref|XP_010247280.1|  PREDICTED: G-type lectin S-receptor-like ser...    211   2e-59   
ref|XP_008231374.1|  PREDICTED: G-type lectin S-receptor-like ser...    211   2e-59   
ref|XP_006844855.1|  hypothetical protein AMTR_s00058p00102600          211   2e-59   
gb|AES91503.2|  S-locus lectin kinase family protein                    210   4e-59   
ref|XP_003609306.1|  Receptor like kinase                               210   4e-59   
ref|XP_010265967.1|  PREDICTED: G-type lectin S-receptor-like ser...    209   6e-59   
ref|XP_010257446.1|  PREDICTED: G-type lectin S-receptor-like ser...    209   6e-59   
ref|XP_010999793.1|  PREDICTED: G-type lectin S-receptor-like ser...    201   6e-59   
ref|XP_006494277.1|  PREDICTED: G-type lectin S-receptor-like ser...    209   7e-59   
ref|XP_008782878.1|  PREDICTED: G-type lectin S-receptor-like ser...    209   8e-59   
ref|XP_008232126.1|  PREDICTED: G-type lectin S-receptor-like ser...    209   9e-59   
ref|XP_008449746.1|  PREDICTED: G-type lectin S-receptor-like ser...    209   9e-59   
ref|XP_010087366.1|  G-type lectin S-receptor-like serine/threoni...    209   9e-59   
gb|EMT30664.1|  Putative receptor protein kinase ZmPK1                  209   1e-58   
ref|XP_007048277.1|  Receptor-like protein kinase 1, putative           208   1e-58   
ref|XP_008244883.1|  PREDICTED: G-type lectin S-receptor-like ser...    208   1e-58   
ref|XP_011037891.1|  PREDICTED: G-type lectin S-receptor-like ser...    208   2e-58   
ref|XP_002283224.1|  PREDICTED: G-type lectin S-receptor-like ser...    208   2e-58   Vitis vinifera
ref|XP_009778013.1|  PREDICTED: G-type lectin S-receptor-like ser...    194   2e-58   
ref|XP_002276127.1|  PREDICTED: G-type lectin S-receptor-like ser...    208   2e-58   Vitis vinifera
ref|XP_010108662.1|  G-type lectin S-receptor-like serine/threoni...    208   2e-58   
ref|XP_010027359.1|  PREDICTED: G-type lectin S-receptor-like ser...    208   2e-58   
gb|KCW62261.1|  hypothetical protein EUGRSUZ_H04921                     207   2e-58   
ref|XP_010943531.1|  PREDICTED: G-type lectin S-receptor-like ser...    207   2e-58   
gb|EMS50976.1|  G-type lectin S-receptor-like serine/threonine-pr...    207   3e-58   
ref|XP_010087369.1|  G-type lectin S-receptor-like serine/threoni...    207   3e-58   
gb|EMS65010.1|  G-type lectin S-receptor-like serine/threonine-pr...    207   3e-58   
ref|XP_008351773.1|  PREDICTED: G-type lectin S-receptor-like ser...    198   4e-58   
gb|EMT09901.1|  Putative receptor protein kinase ZmPK1                  207   4e-58   
ref|XP_008808085.1|  PREDICTED: G-type lectin S-receptor-like ser...    207   4e-58   
ref|XP_002269067.3|  PREDICTED: G-type lectin S-receptor-like ser...    207   4e-58   Vitis vinifera
ref|XP_002299254.1|  hypothetical protein POPTR_0001s05250g             207   4e-58   Populus trichocarpa [western balsam poplar]
ref|XP_008777350.1|  PREDICTED: G-type lectin S-receptor-like ser...    207   5e-58   
gb|EEE60505.1|  hypothetical protein OsJ_13807                          204   5e-58   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67715.1|  H0512B01.10                                            207   5e-58   Oryza sativa [red rice]
gb|KDP20397.1|  hypothetical protein JCGZ_05280                         206   5e-58   
ref|XP_006445954.1|  hypothetical protein CICLE_v10014312mg             207   5e-58   
ref|XP_008778887.1|  PREDICTED: G-type lectin S-receptor-like ser...    207   5e-58   
emb|CAN78998.1|  hypothetical protein VITISV_038238                     207   5e-58   Vitis vinifera
ref|XP_008352763.1|  PREDICTED: G-type lectin S-receptor-like ser...    197   5e-58   
ref|XP_010651293.1|  PREDICTED: G-type lectin S-receptor-like ser...    197   6e-58   
ref|XP_004142233.1|  PREDICTED: G-type lectin S-receptor-like ser...    206   6e-58   
ref|XP_006387441.1|  hypothetical protein POPTR_1037s002101g            206   6e-58   
ref|XP_006854585.1|  hypothetical protein AMTR_s00030p00117770          206   6e-58   
ref|XP_006445945.1|  hypothetical protein CICLE_v10014334mg             206   6e-58   
gb|KDO56493.1|  hypothetical protein CISIN_1g047263mg                   206   6e-58   
ref|XP_006494281.1|  PREDICTED: G-type lectin S-receptor-like ser...    206   6e-58   
ref|XP_006494283.1|  PREDICTED: G-type lectin S-receptor-like ser...    206   7e-58   
gb|KHN27126.1|  G-type lectin S-receptor-like serine/threonine-pr...    205   7e-58   
ref|XP_007014867.1|  CCHC-type integrase, putative                      206   8e-58   
ref|XP_009419167.1|  PREDICTED: G-type lectin S-receptor-like ser...    206   9e-58   
ref|XP_003581087.2|  PREDICTED: G-type lectin S-receptor-like ser...    206   9e-58   
gb|KDO56487.1|  hypothetical protein CISIN_1g041921mg                   206   9e-58   
ref|XP_008219597.1|  PREDICTED: G-type lectin S-receptor-like ser...    206   9e-58   
ref|XP_010245277.1|  PREDICTED: G-type lectin S-receptor-like ser...    206   1e-57   
ref|XP_003532956.1|  PREDICTED: G-type lectin S-receptor-like ser...    206   1e-57   
gb|KHN26772.1|  G-type lectin S-receptor-like serine/threonine-pr...    206   1e-57   
ref|XP_008777244.1|  PREDICTED: G-type lectin S-receptor-like ser...    206   1e-57   
gb|EYU18006.1|  hypothetical protein MIMGU_mgv1a001561mg                206   1e-57   
emb|CAE05486.2|  OSJNBa0022H21.6                                        205   1e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008384470.1|  PREDICTED: G-type lectin S-receptor-like ser...    197   1e-57   
gb|AIE56230.1|  lectin receptor kinase                                  205   1e-57   
gb|EAY93043.1|  hypothetical protein OsI_14842                          205   2e-57   Oryza sativa Indica Group [Indian rice]
ref|NP_001173790.1|  Os04g0202350                                       204   2e-57   
gb|EEC77471.1|  hypothetical protein OsI_16293                          205   2e-57   Oryza sativa Indica Group [Indian rice]
emb|CAE05487.2|  OSJNBa0022H21.7                                        205   2e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003555643.1|  PREDICTED: G-type lectin S-receptor-like ser...    205   2e-57   
emb|CAH67307.1|  OSIGBa0106G07.3                                        205   2e-57   Oryza sativa [red rice]
ref|XP_008352793.1|  PREDICTED: G-type lectin S-receptor-like ser...    204   2e-57   
ref|XP_006369448.1|  hypothetical protein POPTR_0001s23530g             204   2e-57   
ref|XP_010924062.1|  PREDICTED: G-type lectin S-receptor-like ser...    205   2e-57   
ref|XP_008367506.1|  PREDICTED: G-type lectin S-receptor-like ser...    202   2e-57   
ref|XP_009364697.1|  PREDICTED: G-type lectin S-receptor-like ser...    205   2e-57   
ref|XP_006445952.1|  hypothetical protein CICLE_v10017711mg             204   3e-57   
ref|XP_008349451.1|  PREDICTED: G-type lectin S-receptor-like ser...    201   3e-57   
ref|XP_004292535.1|  PREDICTED: G-type lectin S-receptor-like ser...    204   3e-57   
ref|XP_006386078.1|  hypothetical protein POPTR_0003s21900g             204   3e-57   
ref|XP_010909410.1|  PREDICTED: G-type lectin S-receptor-like ser...    204   3e-57   
emb|CAE03339.2|  OSJNBb0005B05.6                                        204   3e-57   Oryza sativa Japonica Group [Japonica rice]
gb|AIE56245.1|  lectin receptor kinase                                  204   3e-57   
ref|XP_006386090.1|  hypothetical protein POPTR_0003s220001g            202   3e-57   
ref|XP_009374772.1|  PREDICTED: G-type lectin S-receptor-like ser...    204   4e-57   
ref|XP_009387513.1|  PREDICTED: G-type lectin S-receptor-like ser...    204   4e-57   
ref|XP_010649413.1|  PREDICTED: G-type lectin S-receptor-like ser...    204   4e-57   
ref|XP_006386079.1|  hypothetical protein POPTR_0003s21910g             204   4e-57   
gb|AIE56238.1|  lectin receptor kinase                                  204   4e-57   
ref|XP_009364767.1|  PREDICTED: G-type lectin S-receptor-like ser...    204   4e-57   
ref|XP_009364783.1|  PREDICTED: G-type lectin S-receptor-like ser...    204   4e-57   
ref|XP_003572669.1|  PREDICTED: G-type lectin S-receptor-like ser...    204   5e-57   
ref|XP_004308204.1|  PREDICTED: G-type lectin S-receptor-like ser...    204   5e-57   
ref|XP_006577592.1|  PREDICTED: G-type lectin S-receptor-like ser...    206   5e-57   
ref|NP_001052227.1|  Os04g0202500                                       204   5e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010248194.1|  PREDICTED: G-type lectin S-receptor-like ser...    204   5e-57   
ref|XP_011013447.1|  PREDICTED: G-type lectin S-receptor-like ser...    204   6e-57   
ref|XP_008243609.1|  PREDICTED: G-type lectin S-receptor-like ser...    204   6e-57   
ref|XP_008219573.1|  PREDICTED: G-type lectin S-receptor-like ser...    203   7e-57   
ref|XP_008779807.1|  PREDICTED: G-type lectin S-receptor-like ser...    198   8e-57   
ref|XP_010087375.1|  G-type lectin S-receptor-like serine/threoni...    203   9e-57   
ref|XP_004508500.1|  PREDICTED: G-type lectin S-receptor-like ser...    203   1e-56   
ref|XP_006445947.1|  hypothetical protein CICLE_v10018049mg             195   1e-56   
ref|XP_008779999.1|  PREDICTED: G-type lectin S-receptor-like ser...    197   1e-56   
emb|CAH67716.1|  H0512B01.11                                            203   1e-56   Oryza sativa [red rice]
ref|XP_006388388.1|  hypothetical protein POPTR_0200s00200g             203   1e-56   
ref|XP_006445958.1|  hypothetical protein CICLE_v10014324mg             203   1e-56   
ref|XP_006368557.1|  hypothetical protein POPTR_0001s05190g             202   1e-56   
gb|KHN42673.1|  G-type lectin S-receptor-like serine/threonine-pr...    191   1e-56   
ref|XP_009769630.1|  PREDICTED: G-type lectin S-receptor-like ser...    202   1e-56   
gb|EYU18008.1|  hypothetical protein MIMGU_mgv1a023456mg                202   2e-56   
ref|XP_009418234.1|  PREDICTED: G-type lectin S-receptor-like ser...    202   2e-56   
ref|XP_010911349.1|  PREDICTED: G-type lectin S-receptor-like ser...    202   2e-56   
gb|EAY93045.1|  hypothetical protein OsI_14844                          202   2e-56   Oryza sativa Indica Group [Indian rice]
ref|XP_010673560.1|  PREDICTED: G-type lectin S-receptor-like ser...    202   2e-56   
ref|XP_011002948.1|  PREDICTED: G-type lectin S-receptor-like ser...    202   2e-56   
gb|KHN48904.1|  G-type lectin S-receptor-like serine/threonine-pr...    201   2e-56   
ref|XP_008231371.1|  PREDICTED: G-type lectin S-receptor-like ser...    202   2e-56   
gb|KDO56486.1|  hypothetical protein CISIN_1g037189mg                   202   2e-56   
gb|KCW87121.1|  hypothetical protein EUGRSUZ_B03649                     202   2e-56   
ref|XP_010044982.1|  PREDICTED: G-type lectin S-receptor-like ser...    202   2e-56   
ref|XP_006445951.1|  hypothetical protein CICLE_v10017816mg             201   2e-56   
ref|XP_009333680.1|  PREDICTED: G-type lectin S-receptor-like ser...    202   2e-56   
ref|XP_009364760.1|  PREDICTED: G-type lectin S-receptor-like ser...    202   2e-56   
ref|XP_007014864.1|  CCHC-type integrase, putative                      202   2e-56   
ref|XP_004309464.1|  PREDICTED: G-type lectin S-receptor-like ser...    202   3e-56   
ref|XP_009364724.1|  PREDICTED: G-type lectin S-receptor-like ser...    202   3e-56   
ref|XP_007134257.1|  hypothetical protein PHAVU_010G031900g             202   3e-56   
ref|XP_002275811.2|  PREDICTED: G-type lectin S-receptor-like ser...    202   3e-56   Vitis vinifera
gb|KDO56481.1|  hypothetical protein CISIN_1g046877mg                   194   3e-56   
gb|KDP25139.1|  hypothetical protein JCGZ_22674                         195   3e-56   
ref|XP_004508501.1|  PREDICTED: G-type lectin S-receptor-like ser...    202   3e-56   
ref|XP_009391880.1|  PREDICTED: G-type lectin S-receptor-like ser...    202   3e-56   
ref|XP_008243605.1|  PREDICTED: G-type lectin S-receptor-like ser...    201   4e-56   
ref|XP_006427819.1|  hypothetical protein CICLE_v10027067mg             200   4e-56   
ref|XP_011012006.1|  PREDICTED: G-type lectin S-receptor-like ser...    201   4e-56   
ref|XP_006652106.1|  PREDICTED: G-type lectin S-receptor-like ser...    201   5e-56   
emb|CAN84023.1|  hypothetical protein VITISV_004992                     201   5e-56   Vitis vinifera
ref|XP_006445948.1|  hypothetical protein CICLE_v10017506mg             201   5e-56   
gb|KDO56484.1|  hypothetical protein CISIN_1g042262mg                   201   5e-56   
ref|XP_011025239.1|  PREDICTED: G-type lectin S-receptor-like ser...    201   5e-56   
ref|XP_002446137.1|  hypothetical protein SORBIDRAFT_06g002200          201   5e-56   Sorghum bicolor [broomcorn]
emb|CDP04780.1|  unnamed protein product                                199   5e-56   
ref|XP_007014868.1|  Receptor-like protein kinase 1, putative           201   6e-56   
ref|XP_011025240.1|  PREDICTED: G-type lectin S-receptor-like ser...    201   6e-56   
ref|XP_011037892.1|  PREDICTED: G-type lectin S-receptor-like ser...    201   7e-56   
ref|XP_006371001.1|  hypothetical protein POPTR_0019s02510g             199   7e-56   
ref|XP_008231372.1|  PREDICTED: G-type lectin S-receptor-like ser...    201   7e-56   
ref|XP_011025246.1|  PREDICTED: G-type lectin S-receptor-like ser...    201   7e-56   
ref|XP_008352117.1|  PREDICTED: G-type lectin S-receptor-like ser...    197   7e-56   
gb|KCW45167.1|  hypothetical protein EUGRSUZ_L012162                    191   8e-56   
ref|XP_002283186.2|  PREDICTED: G-type lectin S-receptor-like ser...    203   9e-56   Vitis vinifera
ref|XP_006598212.1|  PREDICTED: G-type lectin S-receptor-like ser...    201   9e-56   
ref|XP_008392855.1|  PREDICTED: G-type lectin S-receptor-like ser...    200   1e-55   
ref|XP_006477574.1|  PREDICTED: G-type lectin S-receptor-like ser...    200   1e-55   
gb|KDO61313.1|  hypothetical protein CISIN_1g044281mg                   200   1e-55   
ref|XP_006445946.1|  hypothetical protein CICLE_v10017810mg             200   1e-55   
ref|XP_002446138.1|  hypothetical protein SORBIDRAFT_06g002210          200   1e-55   Sorghum bicolor [broomcorn]
ref|XP_002309889.2|  hypothetical protein POPTR_0007s03700g             199   1e-55   Populus trichocarpa [western balsam poplar]
gb|AAV92905.1|  Avr9/Cf-9 rapidly elicited protein 256                  190   1e-55   Nicotiana tabacum [American tobacco]
ref|XP_010025549.1|  PREDICTED: G-type lectin S-receptor-like ser...    200   1e-55   
ref|XP_008356883.1|  PREDICTED: G-type lectin S-receptor-like ser...    200   1e-55   
ref|XP_002513434.1|  ATP binding protein, putative                      200   1e-55   Ricinus communis
emb|CBI16443.3|  unnamed protein product                                202   2e-55   
ref|XP_004149038.1|  PREDICTED: G-type lectin S-receptor-like ser...    199   2e-55   
gb|KHN34903.1|  G-type lectin S-receptor-like serine/threonine-pr...    197   2e-55   
ref|XP_008243581.1|  PREDICTED: G-type lectin S-receptor-like ser...    199   2e-55   
ref|XP_006427834.1|  hypothetical protein CICLE_v10024921mg             199   2e-55   
ref|XP_006440230.1|  hypothetical protein CICLE_v10019159mg             198   2e-55   
ref|XP_009374910.1|  PREDICTED: G-type lectin S-receptor-like ser...    199   3e-55   
ref|XP_009364723.1|  PREDICTED: G-type lectin S-receptor-like ser...    199   3e-55   
ref|XP_004154674.1|  PREDICTED: G-type lectin S-receptor-like ser...    199   3e-55   
ref|XP_011012005.1|  PREDICTED: G-type lectin S-receptor-like ser...    199   3e-55   
ref|XP_006477122.1|  PREDICTED: G-type lectin S-receptor-like ser...    199   3e-55   
gb|KHN23696.1|  G-type lectin S-receptor-like serine/threonine-pr...    198   4e-55   
ref|NP_001052228.2|  Os04g0202800                                       198   4e-55   
gb|KDO56480.1|  hypothetical protein CISIN_1g045343mg                   199   4e-55   
ref|XP_006494291.1|  PREDICTED: G-type lectin S-receptor-like ser...    199   4e-55   
gb|AIE56246.1|  lectin receptor kinase                                  198   5e-55   
ref|XP_008366172.1|  PREDICTED: G-type lectin S-receptor-like ser...    196   5e-55   
ref|XP_011025245.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    198   5e-55   
ref|XP_003545892.1|  PREDICTED: G-type lectin S-receptor-like ser...    198   6e-55   
gb|AIE56229.1|  lectin receptor kinase                                  198   6e-55   
emb|CAE03338.2|  OSJNBb0005B05.5                                        198   6e-55   
ref|XP_007155004.1|  hypothetical protein PHAVU_003G164800g             198   6e-55   
gb|KCW45166.1|  hypothetical protein EUGRSUZ_L01215                     196   7e-55   
ref|XP_006370997.1|  hypothetical protein POPTR_0019s02480g             197   8e-55   
gb|AES91505.2|  S-locus lectin kinase family protein                    197   8e-55   
ref|XP_010247276.1|  PREDICTED: G-type lectin S-receptor-like ser...    197   8e-55   
ref|XP_003609308.1|  Kinase-like protein                                198   9e-55   
ref|NP_001052225.2|  Os04g0201900                                       198   9e-55   
emb|CAN84025.1|  hypothetical protein VITISV_004994                     197   9e-55   
ref|XP_008344689.1|  PREDICTED: G-type lectin S-receptor-like ser...    197   1e-54   
ref|XP_006361290.1|  PREDICTED: G-type lectin S-receptor-like ser...    197   1e-54   
ref|XP_008363356.1|  PREDICTED: G-type lectin S-receptor-like ser...    197   1e-54   
ref|XP_004511723.1|  PREDICTED: G-type lectin S-receptor-like ser...    197   1e-54   
gb|AFW57866.1|  putative D-mannose binding lectin family receptor...    197   1e-54   
ref|XP_003538753.1|  PREDICTED: G-type lectin S-receptor-like ser...    197   1e-54   
ref|XP_002513435.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    197   1e-54   
ref|XP_002283204.1|  PREDICTED: G-type lectin S-receptor-like ser...    197   1e-54   
ref|XP_008348731.1|  PREDICTED: G-type lectin S-receptor-like ser...    197   1e-54   
gb|KDP25138.1|  hypothetical protein JCGZ_22673                         197   1e-54   
ref|XP_008663071.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    197   2e-54   
ref|XP_010087367.1|  G-type lectin S-receptor-like serine/threoni...    197   2e-54   
gb|AIE56222.1|  lectin receptor kinase                                  197   2e-54   
ref|XP_008787371.1|  PREDICTED: G-type lectin S-receptor-like ser...    197   2e-54   
ref|XP_009588962.1|  PREDICTED: G-type lectin S-receptor-like ser...    197   2e-54   
ref|XP_010087364.1|  G-type lectin S-receptor-like serine/threoni...    196   2e-54   
ref|XP_010909411.1|  PREDICTED: G-type lectin S-receptor-like ser...    196   2e-54   
ref|XP_009588963.1|  PREDICTED: G-type lectin S-receptor-like ser...    196   2e-54   
ref|XP_010040493.1|  PREDICTED: G-type lectin S-receptor-like ser...    196   3e-54   
ref|XP_004975177.1|  PREDICTED: G-type lectin S-receptor-like ser...    196   3e-54   
emb|CAN59769.1|  hypothetical protein VITISV_011720                     196   3e-54   
ref|XP_004512201.1|  PREDICTED: G-type lectin S-receptor-like ser...    196   3e-54   
gb|KCW85884.1|  hypothetical protein EUGRSUZ_B02606                     196   4e-54   
ref|XP_010046456.1|  PREDICTED: G-type lectin S-receptor-like ser...    196   4e-54   
ref|XP_003611353.1|  Kinase-like protein                                196   4e-54   
ref|XP_008384503.1|  PREDICTED: G-type lectin S-receptor-like ser...    196   4e-54   
gb|EYU18007.1|  hypothetical protein MIMGU_mgv1a023406mg                195   5e-54   
ref|XP_010265861.1|  PREDICTED: G-type lectin S-receptor-like ser...    195   5e-54   
ref|XP_009364705.1|  PREDICTED: G-type lectin S-receptor-like ser...    195   6e-54   
ref|XP_009364740.1|  PREDICTED: G-type lectin S-receptor-like ser...    195   6e-54   
ref|XP_004975176.1|  PREDICTED: G-type lectin S-receptor-like ser...    195   6e-54   
ref|XP_006368559.1|  hypothetical protein POPTR_0001s05240g             195   6e-54   
ref|XP_009364739.1|  PREDICTED: G-type lectin S-receptor-like ser...    195   6e-54   
gb|KCW85883.1|  hypothetical protein EUGRSUZ_B02605                     195   6e-54   
ref|XP_004295222.1|  PREDICTED: G-type lectin S-receptor-like ser...    195   7e-54   
ref|XP_009364742.1|  PREDICTED: G-type lectin S-receptor-like ser...    195   7e-54   
ref|XP_010673551.1|  PREDICTED: G-type lectin S-receptor-like ser...    195   7e-54   
ref|XP_008392854.1|  PREDICTED: G-type lectin S-receptor-like ser...    195   8e-54   
ref|XP_010040492.1|  PREDICTED: G-type lectin S-receptor-like ser...    195   8e-54   
ref|XP_009374762.1|  PREDICTED: G-type lectin S-receptor-like ser...    195   8e-54   
ref|XP_006850042.1|  hypothetical protein AMTR_s00022p00195410          194   9e-54   
ref|XP_004308262.1|  PREDICTED: G-type lectin S-receptor-like ser...    194   9e-54   
emb|CAN84024.1|  hypothetical protein VITISV_004993                     196   1e-53   
emb|CDP14444.1|  unnamed protein product                                194   1e-53   
emb|CDM83846.1|  unnamed protein product                                194   1e-53   
gb|AES66383.2|  malectin/receptor-like kinase family protein            194   1e-53   
ref|XP_008243675.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    194   1e-53   
gb|KEH38324.1|  lectin kinase family protein                            196   1e-53   
ref|XP_004975942.1|  PREDICTED: G-type lectin S-receptor-like ser...    194   1e-53   
ref|XP_003611359.1|  Kinase-like protein                                194   1e-53   
ref|XP_010043873.1|  PREDICTED: G-type lectin S-receptor-like ser...    194   1e-53   
ref|XP_009379485.1|  PREDICTED: G-type lectin S-receptor-like ser...    194   2e-53   
ref|XP_008781376.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    191   2e-53   
ref|XP_006659229.1|  PREDICTED: G-type lectin S-receptor-like ser...    194   2e-53   
ref|XP_006427823.1|  hypothetical protein CICLE_v10027475mg             188   2e-53   
ref|XP_002269411.1|  PREDICTED: G-type lectin S-receptor-like ser...    194   2e-53   
emb|CDP04762.1|  unnamed protein product                                192   2e-53   
ref|XP_007156574.1|  hypothetical protein PHAVU_002G000200g             193   3e-53   
ref|XP_011087140.1|  PREDICTED: G-type lectin S-receptor-like ser...    193   3e-53   
ref|XP_010051756.1|  PREDICTED: G-type lectin S-receptor-like ser...    185   3e-53   
gb|KDO36845.1|  hypothetical protein CISIN_1g041576mg                   192   3e-53   
ref|XP_008352800.1|  PREDICTED: G-type lectin S-receptor-like ser...    193   3e-53   
ref|XP_006646722.1|  PREDICTED: G-type lectin S-receptor-like ser...    191   4e-53   
ref|XP_006445955.1|  hypothetical protein CICLE_v10014329mg             192   4e-53   
ref|XP_010051744.1|  PREDICTED: G-type lectin S-receptor-like ser...    192   4e-53   
ref|XP_004296340.1|  PREDICTED: G-type lectin S-receptor-like ser...    192   5e-53   
ref|XP_002268890.2|  PREDICTED: G-type lectin S-receptor-like ser...    192   5e-53   
ref|XP_002512149.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    193   5e-53   
emb|CDP14422.1|  unnamed protein product                                192   5e-53   
ref|XP_010674604.1|  PREDICTED: G-type lectin S-receptor-like ser...    192   5e-53   
emb|CDP12777.1|  unnamed protein product                                192   5e-53   
tpg|DAA46928.1|  TPA: putative D-mannose binding lectin family re...    192   5e-53   
ref|XP_010242295.1|  PREDICTED: G-type lectin S-receptor-like ser...    192   5e-53   
ref|XP_009772210.1|  PREDICTED: G-type lectin S-receptor-like ser...    192   5e-53   
ref|XP_010928440.1|  PREDICTED: G-type lectin S-receptor-like ser...    192   5e-53   
ref|XP_007048276.1|  Receptor-like protein kinase 1, putative           192   6e-53   
ref|XP_007014871.1|  Receptor protein kinase 1                          192   6e-53   
ref|XP_008660212.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    192   6e-53   
ref|XP_003516653.1|  PREDICTED: G-type lectin S-receptor-like ser...    192   7e-53   
ref|XP_006427803.1|  hypothetical protein CICLE_v10027404mg             191   7e-53   
ref|XP_010911509.1|  PREDICTED: G-type lectin S-receptor-like ser...    191   7e-53   
ref|XP_009407891.1|  PREDICTED: G-type lectin S-receptor-like ser...    192   7e-53   
gb|KDO58385.1|  hypothetical protein CISIN_1g047716mg                   184   8e-53   
ref|XP_011047592.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    192   8e-53   
ref|XP_010673564.1|  PREDICTED: G-type lectin S-receptor-like ser...    192   8e-53   
gb|KEH38325.1|  lectin kinase family protein                            194   8e-53   
ref|XP_006464872.1|  PREDICTED: G-type lectin S-receptor-like ser...    192   9e-53   
gb|KHN47153.1|  G-type lectin S-receptor-like serine/threonine-pr...    191   1e-52   
ref|XP_011025243.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    192   1e-52   
ref|XP_008451130.1|  PREDICTED: G-type lectin S-receptor-like ser...    192   1e-52   
ref|XP_008243680.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    194   1e-52   
ref|XP_004488803.1|  PREDICTED: G-type lectin S-receptor-like ser...    193   1e-52   
ref|XP_008392156.1|  PREDICTED: G-type lectin S-receptor-like ser...    191   1e-52   
ref|XP_003596132.1|  Kinase-like protein                                192   1e-52   
gb|KHN34904.1|  G-type lectin S-receptor-like serine/threonine-pr...    191   1e-52   
ref|XP_006594274.1|  PREDICTED: G-type lectin S-receptor-like ser...    191   1e-52   
emb|CDP14429.1|  unnamed protein product                                189   2e-52   
ref|XP_002446653.1|  hypothetical protein SORBIDRAFT_06g019890          191   2e-52   
ref|XP_006838476.1|  hypothetical protein AMTR_s00002p00152630          191   2e-52   
ref|XP_010040494.1|  PREDICTED: G-type lectin S-receptor-like ser...    190   2e-52   
ref|XP_010931143.1|  PREDICTED: G-type lectin S-receptor-like ser...    191   2e-52   
ref|XP_006494282.1|  PREDICTED: G-type lectin S-receptor-like ser...    191   2e-52   
gb|KCW82977.1|  hypothetical protein EUGRSUZ_C04367                     191   2e-52   
ref|XP_008354967.1|  PREDICTED: G-type lectin S-receptor-like ser...    190   2e-52   
gb|KDO56494.1|  hypothetical protein CISIN_1g003836mg                   191   2e-52   
ref|XP_002283213.1|  PREDICTED: G-type lectin S-receptor-like ser...    191   2e-52   
ref|XP_007157258.1|  hypothetical protein PHAVU_002G055600g             191   2e-52   
ref|XP_007134258.1|  hypothetical protein PHAVU_010G032000g             191   2e-52   
ref|XP_008799747.1|  PREDICTED: G-type lectin S-receptor-like ser...    190   3e-52   
ref|XP_009393789.1|  PREDICTED: G-type lectin S-receptor-like ser...    190   3e-52   
ref|XP_011011984.1|  PREDICTED: G-type lectin S-receptor-like ser...    190   3e-52   
emb|CAN72121.1|  hypothetical protein VITISV_031648                     190   4e-52   
ref|XP_010547742.1|  PREDICTED: G-type lectin S-receptor-like ser...    190   4e-52   
ref|XP_002533409.1|  serine-threonine protein kinase, plant-type,...    190   4e-52   
ref|XP_008350876.1|  PREDICTED: G-type lectin S-receptor-like ser...    190   4e-52   
ref|XP_010673550.1|  PREDICTED: G-type lectin S-receptor-like ser...    190   4e-52   
ref|XP_007133852.1|  hypothetical protein PHAVU_011G214400g             190   4e-52   
emb|CDP14424.1|  unnamed protein product                                189   4e-52   
ref|XP_008778128.1|  PREDICTED: G-type lectin S-receptor-like ser...    189   4e-52   
ref|XP_006386082.1|  hypothetical protein POPTR_0003s21940g             190   5e-52   
ref|XP_008358889.1|  PREDICTED: G-type lectin S-receptor-like ser...    189   5e-52   
ref|XP_010651295.1|  PREDICTED: G-type lectin S-receptor-like ser...    190   5e-52   
gb|KCW62262.1|  hypothetical protein EUGRSUZ_H04922                     187   5e-52   
gb|KDO56492.1|  hypothetical protein CISIN_1g004312mg                   189   6e-52   
ref|XP_010051749.1|  PREDICTED: G-type lectin S-receptor-like ser...    189   6e-52   
ref|XP_010651296.1|  PREDICTED: G-type lectin S-receptor-like ser...    189   6e-52   
ref|XP_006387439.1|  hypothetical protein POPTR_1037s00200g             184   7e-52   
ref|XP_010931037.1|  PREDICTED: G-type lectin S-receptor-like ser...    181   7e-52   
ref|XP_010087374.1|  G-type lectin S-receptor-like serine/threoni...    189   7e-52   
ref|XP_006477571.1|  PREDICTED: G-type lectin S-receptor-like ser...    189   8e-52   
gb|KHN19424.1|  G-type lectin S-receptor-like serine/threonine-pr...    189   8e-52   
gb|KDO43274.1|  hypothetical protein CISIN_1g0380021mg                  179   9e-52   
ref|XP_010051773.1|  PREDICTED: G-type lectin S-receptor-like ser...    189   9e-52   
ref|XP_003539656.1|  PREDICTED: G-type lectin S-receptor-like ser...    189   9e-52   
emb|CAN59770.1|  hypothetical protein VITISV_011721                     189   9e-52   
ref|XP_002283233.1|  PREDICTED: G-type lectin S-receptor-like ser...    189   1e-51   
ref|XP_006440220.1|  hypothetical protein CICLE_v10018902mg             189   1e-51   
ref|XP_006369449.1|  hypothetical protein POPTR_0001s23540g             189   1e-51   
ref|XP_010931011.1|  PREDICTED: G-type lectin S-receptor-like ser...    188   1e-51   
ref|XP_006440225.1|  hypothetical protein CICLE_v10018906mg             189   1e-51   
ref|XP_002532358.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    188   1e-51   
ref|XP_010265867.1|  PREDICTED: G-type lectin S-receptor-like ser...    188   1e-51   
gb|AET01339.2|  G-type lectin S-receptor-like Serine/Threonine-ki...    189   1e-51   
ref|XP_006354209.1|  PREDICTED: G-type lectin S-receptor-like ser...    188   1e-51   
gb|KEH38323.1|  lectin kinase family protein                            189   1e-51   
ref|XP_006380362.1|  hypothetical protein POPTR_0007s03670g             188   1e-51   
ref|XP_008366187.1|  PREDICTED: G-type lectin S-receptor-like ser...    191   2e-51   
ref|XP_010043872.1|  PREDICTED: G-type lectin S-receptor-like ser...    188   2e-51   
ref|XP_006368974.1|  hypothetical protein POPTR_0001s15360g             188   2e-51   
ref|XP_004162097.1|  PREDICTED: G-type lectin S-receptor-like ser...    190   2e-51   
ref|XP_006440216.1|  hypothetical protein CICLE_v10018901mg             188   2e-51   
ref|XP_006850041.1|  hypothetical protein AMTR_s00022p00194720          187   2e-51   
ref|XP_010265874.1|  PREDICTED: G-type lectin S-receptor-like ser...    187   3e-51   
ref|XP_010520634.1|  PREDICTED: G-type lectin S-receptor-like ser...    186   3e-51   
ref|XP_010648034.1|  PREDICTED: G-type lectin S-receptor-like ser...    181   3e-51   
ref|XP_002278071.1|  PREDICTED: G-type lectin S-receptor-like ser...    187   3e-51   
ref|XP_007014872.1|  Receptor-like protein kinase 1, putative           187   3e-51   
gb|KDO61312.1|  hypothetical protein CISIN_1g047292mg                   187   3e-51   
ref|XP_009376475.1|  PREDICTED: G-type lectin S-receptor-like ser...    187   4e-51   
ref|XP_006388211.1|  hypothetical protein POPTR_0280s00210g             187   4e-51   
ref|NP_001175447.1|  Os08g0230800                                       187   4e-51   
ref|XP_006354207.1|  PREDICTED: G-type lectin S-receptor-like ser...    186   5e-51   
gb|EYU46320.1|  hypothetical protein MIMGU_mgv1a026830mg                187   5e-51   
ref|XP_006440228.1|  hypothetical protein CICLE_v10024199mg             187   5e-51   
ref|XP_007020823.1|  Brassinosteroid insensitive 1-associated rec...    187   5e-51   
ref|XP_006439039.1|  hypothetical protein CICLE_v10030742mg             187   5e-51   
ref|XP_006850036.1|  hypothetical protein AMTR_s00022p00193430          187   6e-51   
ref|XP_003534701.1|  PREDICTED: G-type lectin S-receptor-like ser...    187   6e-51   
gb|EEE68268.1|  hypothetical protein OsJ_26496                          186   6e-51   
gb|KHN40895.1|  G-type lectin S-receptor-like serine/threonine-pr...    186   7e-51   
ref|XP_004228923.1|  PREDICTED: G-type lectin S-receptor-like ser...    186   1e-50   
ref|XP_007020825.1|  Brassinosteroid insensitive 1-associated rec...    186   1e-50   
ref|XP_011023014.1|  PREDICTED: G-type lectin S-receptor-like ser...    186   1e-50   
ref|XP_006850044.1|  hypothetical protein AMTR_s00022p00195970          186   1e-50   
ref|XP_010673549.1|  PREDICTED: G-type lectin S-receptor-like ser...    186   2e-50   
dbj|BAD01294.1|  putative S-receptor kinase homolog 2 precursor         185   2e-50   
dbj|BAJ85150.1|  predicted protein                                      185   2e-50   
ref|XP_010650034.1|  PREDICTED: G-type lectin S-receptor-like ser...    188   2e-50   
ref|XP_002278028.1|  PREDICTED: G-type lectin S-receptor-like ser...    185   2e-50   
ref|XP_007020824.1|  Brassinosteroid insensitive 1-associated rec...    185   2e-50   
ref|XP_009379487.1|  PREDICTED: G-type lectin S-receptor-like ser...    185   2e-50   
ref|XP_008351749.1|  PREDICTED: G-type lectin S-receptor-like ser...    178   2e-50   
ref|XP_007014873.1|  Receptor-like protein kinase 1                     187   3e-50   
gb|KDP40161.1|  hypothetical protein JCGZ_02159                         184   3e-50   
emb|CAN77456.1|  hypothetical protein VITISV_037411                     184   4e-50   
gb|KDO74634.1|  hypothetical protein CISIN_1g039817mg                   184   4e-50   
ref|XP_002268928.1|  PREDICTED: G-type lectin S-receptor-like ser...    184   4e-50   
ref|XP_011090091.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    179   6e-50   
emb|CAN79207.1|  hypothetical protein VITISV_039751                     183   8e-50   
ref|XP_010051776.1|  PREDICTED: G-type lectin S-receptor-like ser...    183   8e-50   
ref|XP_006482820.1|  PREDICTED: G-type lectin S-receptor-like ser...    184   9e-50   
ref|XP_003516654.1|  PREDICTED: G-type lectin S-receptor-like ser...    183   9e-50   
gb|KHN42674.1|  G-type lectin S-receptor-like serine/threonine-pr...    183   1e-49   
gb|EEC76454.1|  hypothetical protein OsI_14165                          183   1e-49   
ref|NP_001051778.1|  Os03g0828800                                       183   1e-49   
gb|EAZ06105.1|  hypothetical protein OsI_28341                          182   1e-49   
ref|XP_004980854.1|  PREDICTED: G-type lectin S-receptor-like ser...    183   1e-49   
ref|XP_006388392.1|  hypothetical protein POPTR_0200s00240g             173   1e-49   
emb|CAN83565.1|  hypothetical protein VITISV_030378                     184   1e-49   
ref|XP_010931012.1|  PREDICTED: G-type lectin S-receptor-like ser...    174   1e-49   
ref|XP_004963535.1|  PREDICTED: G-type lectin S-receptor-like ser...    183   1e-49   
ref|XP_006387361.1|  hypothetical protein POPTR_1172s00200g             172   1e-49   



>ref|XP_009595215.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nicotiana tomentosiformis]
Length=777

 Score =   284 bits (727),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLH+ECDTQIIHCDIKPQNILMD+ F AKISDFG+AK +K+DQTRTYT VRGT+
Sbjct  597  IARGLLYLHDECDTQIIHCDIKPQNILMDDNFCAKISDFGMAKLLKKDQTRTYTGVRGTR  656

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHRK+ VTVKADVYSFG+VLLELI RRK VDWSL ++E++LE WVY+CFEAGE+
Sbjct  657  GYVAPEWHRKLPVTVKADVYSFGVVLLELICRRKCVDWSLAEDESILEYWVYSCFEAGEL  716

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+VG+EEVE+RQ ERMV+IS+WCIQ+EPSLRPSMKK+LLMLEGTVDIPVPPSPTSFLS 
Sbjct  717  GKLVGDEEVERRQFERMVKISIWCIQDEPSLRPSMKKILLMLEGTVDIPVPPSPTSFLST  776

Query  164  V  162
            +
Sbjct  777  I  777



>ref|XP_009765718.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 isoform X1 [Nicotiana sylvestris]
 ref|XP_009765719.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 isoform X2 [Nicotiana sylvestris]
 ref|XP_009765720.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 isoform X3 [Nicotiana sylvestris]
Length=777

 Score =   282 bits (722),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLH+ECDTQIIHCDIKPQNILMD+ F AKISDFG+AK +K+DQTRTYT VRGT+
Sbjct  597  IARGLLYLHDECDTQIIHCDIKPQNILMDDHFCAKISDFGMAKLLKKDQTRTYTGVRGTR  656

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR++ VTVKADVYSFGIVLLELI RRK VDWSL ++E++LE WVY+CFEAGE+
Sbjct  657  GYVAPEWHRQLPVTVKADVYSFGIVLLELICRRKCVDWSLAEDESILEYWVYSCFEAGEL  716

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+VG+EEVE+RQ ERMV+IS+WCIQ+EPSLRPSMKKVLLMLEGTV+IPVPPSPTSFLS 
Sbjct  717  GKLVGDEEVERRQFERMVKISIWCIQDEPSLRPSMKKVLLMLEGTVEIPVPPSPTSFLST  776

Query  164  V  162
            +
Sbjct  777  I  777



>ref|XP_006351040.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Solanum tuberosum]
Length=790

 Score =   278 bits (712),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLH+EC+TQIIHCDIKPQNILM++QF AKI DFG+AK +K+DQTRTYT +RGT+
Sbjct  610  IARGLLYLHDECETQIIHCDIKPQNILMNDQFCAKICDFGMAKLLKKDQTRTYTGIRGTR  669

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR + VTVKADVYSFG+VLLELI RRK VDWSL + EA+LE WVYNCF+AGE+
Sbjct  670  GYVAPEWHRNLPVTVKADVYSFGVVLLELICRRKCVDWSLDENEAILEYWVYNCFDAGEL  729

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+VG+EEV++RQ ERMV+IS+WCIQEEPSLRPSMKKVLLMLEGTV+IPVPPSPTSFLS 
Sbjct  730  DKLVGDEEVDRRQFERMVKISIWCIQEEPSLRPSMKKVLLMLEGTVEIPVPPSPTSFLSA  789

Query  164  V  162
            +
Sbjct  790  I  790



>ref|XP_004249884.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Solanum lycopersicum]
Length=777

 Score =   276 bits (705),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLH+ECDTQIIHCDIKPQNILMD+Q+ AKISDFG+AK +K+DQTRTYT +RGT+
Sbjct  597  IARGLLYLHDECDTQIIHCDIKPQNILMDDQYCAKISDFGMAKLLKKDQTRTYTGIRGTR  656

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHRK+ VTVKADVYSFG+VLLELI RRK VD SL + E++LE WVY+CF+AGE+
Sbjct  657  GYVAPEWHRKLPVTVKADVYSFGVVLLELICRRKCVDSSLDENESILEYWVYDCFDAGEL  716

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+V +E+V++RQ ERMV+IS+WCIQ+EPSLRPSMKKVLLMLEGTV+IPVPPSPTSFLS 
Sbjct  717  DKLVKDEDVDRRQFERMVKISIWCIQDEPSLRPSMKKVLLMLEGTVEIPVPPSPTSFLSA  776

Query  164  V  162
            +
Sbjct  777  I  777



>ref|XP_006351041.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Solanum tuberosum]
Length=970

 Score =   275 bits (702),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLH+ECDTQIIHCDIKPQNILMD+Q+ AKISDFG+AK +K+DQTRTYT +RGT+
Sbjct  790  IARGLLYLHDECDTQIIHCDIKPQNILMDDQYCAKISDFGMAKLLKKDQTRTYTGIRGTR  849

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHRK+ VTVKADVYSFG++LLELI RRK VD SL + E++LE WVY+CF AGE+
Sbjct  850  GYVAPEWHRKLPVTVKADVYSFGVLLLELICRRKCVDMSLDENESILEYWVYDCFAAGEL  909

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+VG+EEV++RQ ERMV+IS+WCIQ+EPSLRPSMKKVLLMLEGTV+IPVPPSPTSFLS 
Sbjct  910  DKLVGDEEVDRRQFERMVKISIWCIQDEPSLRPSMKKVLLMLEGTVEIPVPPSPTSFLSA  969

Query  164  V  162
            +
Sbjct  970  I  970



>gb|KDO38717.1| hypothetical protein CISIN_1g0381681mg, partial [Citrus sinensis]
Length=247

 Score =   256 bits (655),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLH+EC+TQIIHCDIKPQNILMD    AKISDFGLAK MK DQTRT+T +RGT+
Sbjct  67   IARGILYLHDECETQIIHCDIKPQNILMDENRCAKISDFGLAKLMKPDQTRTFTGIRGTR  126

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR + +TVKADVYSFG+VLLE+I RR+ +D +L D++ +LEEWVY CFE G +
Sbjct  127  GYVAPEWHRNLPITVKADVYSFGVVLLEIICRRRCLDPNLPDDQVILEEWVYQCFENGNL  186

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
            S++V +EEV+++Q+ERM++++LWCI +EPSLRPSMKKVLLMLEGTV+IP+PP+PTSFLS 
Sbjct  187  SQLVEDEEVDEKQLERMIKVALWCILDEPSLRPSMKKVLLMLEGTVEIPIPPNPTSFLSA  246

Query  164  V  162
            +
Sbjct  247  I  247



>emb|CDP04778.1| unnamed protein product [Coffea canephora]
Length=402

 Score =   259 bits (662),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 148/179 (83%), Gaps = 17/179 (9%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLHEEC+TQIIHCDIKPQNILMD    AKISDFGLAK +K DQT+T+T +RGTK
Sbjct  239  IARGILYLHEECETQIIHCDIKPQNILMDEHRCAKISDFGLAKLLKHDQTKTFTAIRGTK  298

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWH+K+ VTVKADVYS+GIVLLE+I RRK++DWS  +++A+LEE+ Y+CFEA   
Sbjct  299  GYVAPEWHKKLPVTVKADVYSYGIVLLEIICRRKNIDWSFPEDQAILEEYAYDCFEA---  355

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLS  168
                          + M++I++WCIQ EPSLRPSMKKVLLMLEGTVDIP+PP+PTSFLS
Sbjct  356  --------------QEMIKIAIWCIQGEPSLRPSMKKVLLMLEGTVDIPIPPNPTSFLS  400



>emb|CBI37581.3| unnamed protein product [Vitis vinifera]
Length=321

 Score =   251 bits (640),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARG+LYLHEEC+T IIHCDIKPQNILMD    AKISDFGLAK +  DQT T T +RGT+
Sbjct  103  VARGILYLHEECETCIIHCDIKPQNILMDEYRCAKISDFGLAKLLMHDQTNTSTGIRGTR  162

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHRK  V+VKADVYS+GIVLLE I  R++VDWSL DEE +LEEWVY CFEAGE+
Sbjct  163  GYVAPEWHRKQPVSVKADVYSYGIVLLETICCRRNVDWSLPDEEVILEEWVYQCFEAGEL  222

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+VG+EEV++RQ++ MV++ LWCI ++PSLRPSMKKVLLMLEGTVDIPVPPSP SFLS 
Sbjct  223  GKLVGDEEVDRRQLDMMVKVGLWCILDDPSLRPSMKKVLLMLEGTVDIPVPPSPVSFLSS  282

Query  164  V  162
            +
Sbjct  283  I  283



>ref|XP_010649410.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 isoform X1 [Vitis vinifera]
 ref|XP_010649411.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 isoform X2 [Vitis vinifera]
Length=767

 Score =   262 bits (670),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARG+LYLHEEC+TQIIHCDIKPQNILMD    AKISDFGLAK +  DQT T+T +RGT+
Sbjct  587  VARGVLYLHEECETQIIHCDIKPQNILMDEYKRAKISDFGLAKLLMHDQTNTFTGIRGTR  646

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHRK+ VTVKADVYS+GIVLLE I  RK+VDWSL +EEA+LEEWVY+CFEAGE+
Sbjct  647  GYVAPEWHRKLPVTVKADVYSYGIVLLETICCRKNVDWSLPEEEAILEEWVYHCFEAGEL  706

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+VG+EEV+KRQ+ERMV++ LWCI +EPSLRPSMKKVLLMLEGTVDIPVPPSP SFLS 
Sbjct  707  GKLVGDEEVDKRQLERMVKVGLWCILDEPSLRPSMKKVLLMLEGTVDIPVPPSPVSFLSA  766

Query  164  V  162
            +
Sbjct  767  I  767



>ref|XP_006429020.1| hypothetical protein CICLE_v10011255mg [Citrus clementina]
 gb|ESR42260.1| hypothetical protein CICLE_v10011255mg [Citrus clementina]
Length=651

 Score =   256 bits (655),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLH+EC+TQIIHCDIKPQNILMD    AKISDFGLAK MK DQTRT+T +RGT+
Sbjct  471  IARGILYLHDECETQIIHCDIKPQNILMDENRCAKISDFGLAKLMKPDQTRTFTGIRGTR  530

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR + +TVKADVYSFG+VLLE+I RR+ +D +L D++ +LEEWVY CFE G +
Sbjct  531  GYVAPEWHRNLPITVKADVYSFGVVLLEIICRRRCLDPNLPDDQVILEEWVYQCFENGNL  590

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
            S++V +EEV+++Q+ERM++++LWCI +EPSLRPSMKKVLLMLEGTV+IP+PP+PTSFLS 
Sbjct  591  SQLVEDEEVDEKQLERMIKVALWCILDEPSLRPSMKKVLLMLEGTVEIPIPPNPTSFLSA  650

Query  164  V  162
            +
Sbjct  651  I  651



>ref|XP_006387860.1| hypothetical protein POPTR_0518s002001g, partial [Populus trichocarpa]
 gb|ERP46774.1| hypothetical protein POPTR_0518s002001g, partial [Populus trichocarpa]
Length=295

 Score =   246 bits (628),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG++YLHEEC+TQIIHCDIKPQNIL+D     K+SDFGLAK +K DQT+T+T +RGT+
Sbjct  115  IARGIVYLHEECETQIIHCDIKPQNILIDESRCPKVSDFGLAKLLKSDQTKTFTGIRGTR  174

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR M VTVKADVYSFG++LLE+   RK+VDW L ++EAVLE+WVY CF+ G++
Sbjct  175  GYVAPEWHRNMPVTVKADVYSFGVMLLEITCCRKNVDWLLPEDEAVLEQWVYQCFQDGDM  234

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+VG+E V+K++++RMV++ LWC  +EPSLRPSMKKVLLMLEGTV+IP+PPSPTSF + 
Sbjct  235  DKLVGDEIVDKKELDRMVKVGLWCTLDEPSLRPSMKKVLLMLEGTVEIPIPPSPTSFFTA  294

Query  164  V  162
            +
Sbjct  295  I  295



>ref|XP_007048280.1| Receptor-like protein kinase 1 [Theobroma cacao]
 gb|EOX92437.1| Receptor-like protein kinase 1 [Theobroma cacao]
Length=777

 Score =   257 bits (657),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 163/182 (90%), Gaps = 1/182 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEECDTQIIHCDIK QNIL+D Q  AKISDFGLAK +K DQT+T+T +RGT+
Sbjct  596  IARGLLYLHEECDTQIIHCDIKSQNILLDEQGNAKISDFGLAKLLKPDQTKTFTGIRGTR  655

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHRK+ VTVKADVYSFG+V+LE+I  R+SV+WSL +EEAVLEEWVY+CF+ GE+
Sbjct  656  GYVAPEWHRKLPVTVKADVYSFGVVVLEIICCRRSVNWSLPEEEAVLEEWVYDCFQGGEL  715

Query  344  skvvg-eeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLS  168
             K+VG +EEV+++Q+ERMVR+ LWCI +EP+LRPSMKKVLLMLEGTV IPVPPSPTSF S
Sbjct  716  RKLVGDDEEVDEKQLERMVRVGLWCILDEPTLRPSMKKVLLMLEGTVAIPVPPSPTSFFS  775

Query  167  VV  162
             +
Sbjct  776  AI  777



>ref|XP_006480848.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Citrus sinensis]
Length=782

 Score =   257 bits (656),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLH+EC+TQIIHCDIKPQNILMD    AKISDFGLAK MK DQTRT+T +RGT+
Sbjct  602  IARGILYLHDECETQIIHCDIKPQNILMDENRCAKISDFGLAKLMKPDQTRTFTGIRGTR  661

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR + +TVKADVYSFG+VLLE+I RR+ +D +L D++ +LEEWVY CFE G +
Sbjct  662  GYVAPEWHRNLPITVKADVYSFGVVLLEIICRRRCLDPNLPDDQVILEEWVYQCFENGNL  721

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
            S++V +EEV+++Q+ERM++++LWCI +EPSLRPSMKKVLLMLEGTV+IP+PP+PTSFLS 
Sbjct  722  SQLVEDEEVDEKQLERMIKVALWCILDEPSLRPSMKKVLLMLEGTVEIPIPPNPTSFLSA  781

Query  164  V  162
            +
Sbjct  782  I  782



>gb|KCW62250.1| hypothetical protein EUGRSUZ_H04910 [Eucalyptus grandis]
Length=659

 Score =   254 bits (650),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC+TQIIHCDIKPQNIL+D    AKISDFGL+K MK DQT T T +RGT+
Sbjct  479  IARGLLYLHEECETQIIHCDIKPQNILIDKCRRAKISDFGLSKLMKPDQTNTMTRIRGTR  538

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWH+ + VTVKADVYSFGIVLLE+I  R+SVDWSL D+EAVLEEW Y+CF+  E+
Sbjct  539  GYVAPEWHKNLPVTVKADVYSFGIVLLEIICCRRSVDWSLPDDEAVLEEWAYSCFQEREL  598

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+V +E  ++RQ+ERMV+++LWCI EEPSLRPSM+KVLLMLEGTVDIP+PP P+SFLS 
Sbjct  599  EKLVNDESTDRRQLERMVKVALWCILEEPSLRPSMRKVLLMLEGTVDIPIPPCPSSFLSA  658

Query  164  V  162
            +
Sbjct  659  I  659



>ref|XP_006382828.1| hypothetical protein POPTR_0005s058402g, partial [Populus trichocarpa]
 gb|ERP60625.1| hypothetical protein POPTR_0005s058402g, partial [Populus trichocarpa]
Length=443

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG++YLHEEC+TQIIHCDIKPQNIL+D     K+SDFGLAK +K DQT+T+T +RGT+
Sbjct  263  IARGIVYLHEECETQIIHCDIKPQNILIDESRCPKVSDFGLAKLLKSDQTKTFTGIRGTR  322

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR M VTVKADVYSFG++LLE+   RK+VDWSL ++EAVLE+WVY CF+ G++
Sbjct  323  GYVAPEWHRNMPVTVKADVYSFGVLLLEITCCRKNVDWSLPEDEAVLEQWVYQCFQDGDM  382

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+VG+E VEK+Q++RMV++ +WC  +EPSLRPSMKKVLLMLEGTV+IP+PPSPTSF + 
Sbjct  383  DKLVGDEIVEKKQLDRMVKVGIWCTLDEPSLRPSMKKVLLMLEGTVEIPIPPSPTSFFTA  442

Query  164  V  162
            +
Sbjct  443  I  443



>ref|XP_002275615.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Vitis vinifera]
Length=768

 Score =   256 bits (654),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +A+G+LYLHEEC+TQIIHCDIKPQNILMD    AKISDFGLAK +  DQT T+T +RGT+
Sbjct  588  VAKGVLYLHEECETQIIHCDIKPQNILMDEYRCAKISDFGLAKLLMHDQTNTFTGIRGTR  647

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHRK+AVTVKADVYS+GIVLLE I  R++VDWSL +EEA+LEEWVY+C EAGE+
Sbjct  648  GYVAPEWHRKLAVTVKADVYSYGIVLLETICCRRNVDWSLPEEEAILEEWVYHCLEAGEL  707

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+VG+EEV+KRQ+ERMV++ LWCI +EPSLRPSM KVLL+LEGTVDIPVPPSP SFLS 
Sbjct  708  GKLVGDEEVDKRQLERMVKVGLWCILDEPSLRPSMNKVLLILEGTVDIPVPPSPGSFLSS  767

Query  164  V  162
            +
Sbjct  768  I  768



>emb|CDP04775.1| unnamed protein product [Coffea canephora]
Length=210

 Score =   239 bits (611),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 153/182 (84%), Gaps = 1/182 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARG+LYLHEEC+TQIIHCDIKPQNILMD+   AKISDFGLAK +  D+TRTYT VRGT+
Sbjct  29   VARGILYLHEECETQIIHCDIKPQNILMDDSRCAKISDFGLAKPLDHDRTRTYTAVRGTR  88

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR + VTVKADVYS+GIVLLE+I  RK+VD    +E+++LE W Y+CF  GE+
Sbjct  89   GYVAPEWHRNLPVTVKADVYSYGIVLLEIICCRKNVDSRFPEEQSILEVWAYDCFMDGEL  148

Query  344  skvv-geeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLS  168
             K+V  EE V+  ++ERM+RI+LWCIQ EP+LRPSMKKV+LMLEGTVD+PVPPSP SF S
Sbjct  149  HKLVGEEEAVDMTKLERMIRIALWCIQNEPTLRPSMKKVVLMLEGTVDVPVPPSPDSFFS  208

Query  167  VV  162
             +
Sbjct  209  AM  210



>ref|XP_010027353.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Eucalyptus grandis]
Length=796

 Score =   254 bits (650),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC+TQIIHCDIKPQNIL+D    AKISDFGL+K MK DQT T T +RGT+
Sbjct  616  IARGLLYLHEECETQIIHCDIKPQNILIDKCRRAKISDFGLSKLMKPDQTNTMTRIRGTR  675

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWH+ + VTVKADVYSFGIVLLE+I  R+SVDWSL D+EAVLEEW Y+CF+  E+
Sbjct  676  GYVAPEWHKNLPVTVKADVYSFGIVLLEIICCRRSVDWSLPDDEAVLEEWAYSCFQEREL  735

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+V +E  ++RQ+ERMV+++LWCI EEPSLRPSM+KVLLMLEGTVDIP+PP P+SFLS 
Sbjct  736  EKLVNDESTDRRQLERMVKVALWCILEEPSLRPSMRKVLLMLEGTVDIPIPPCPSSFLSA  795

Query  164  V  162
            +
Sbjct  796  I  796



>gb|KCW62265.1| hypothetical protein EUGRSUZ_H04927, partial [Eucalyptus grandis]
Length=717

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC+TQIIHCDIKPQNIL+D    AKISDFGL+K +K DQT T T +RGT+
Sbjct  540  IARGLLYLHEECETQIIHCDIKPQNILIDEHKHAKISDFGLSKLLKPDQTNTMTRIRGTR  599

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWH+K+ VTVKADVYSFGI+LLE+I  R+SVDW L DEEAVLEEWV+NCF AGE+
Sbjct  600  GYVAPEWHKKLPVTVKADVYSFGIMLLEIICCRRSVDWKLPDEEAVLEEWVHNCFRAGEL  659

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFL  171
             K+V +E +++RQ+ RMV++ LWCI EEPSLRPSMKKVLLMLEGTVDIP+PP P+S +
Sbjct  660  EKLVDDELMDRRQLGRMVKVGLWCILEEPSLRPSMKKVLLMLEGTVDIPIPPYPSSII  717



>emb|CDP04768.1| unnamed protein product [Coffea canephora]
Length=782

 Score =   254 bits (648),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLHEEC+TQIIHCDIKPQN+LM+    AKISDFGLAK +K DQTRTYT VRGT+
Sbjct  601  IARGILYLHEECETQIIHCDIKPQNVLMNENRCAKISDFGLAKILKHDQTRTYTAVRGTR  660

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEW R + V+VKADVYSFGI+LLE+I  RK+ DW+   +EA+LEEW Y CFEA E+
Sbjct  661  GYVAPEWFRNLPVSVKADVYSFGIMLLEIICYRKNADWTYSGDEAILEEWAYQCFEAREL  720

Query  344  skvvg-eeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLS  168
             K+VG  E ++ R++ERM++I+LWCIQ+EP+LRPSMKKV+LMLEGTVDIPVPPSPTSFLS
Sbjct  721  YKLVGDREVLDVRELERMIKIALWCIQDEPALRPSMKKVVLMLEGTVDIPVPPSPTSFLS  780

Query  167  VV  162
             +
Sbjct  781  AI  782



>ref|XP_010649409.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Vitis vinifera]
Length=773

 Score =   252 bits (644),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARG+LYLHEEC+T IIHCDIKPQNILMD    AKISDFGLAK +  DQT T T +RGT+
Sbjct  593  VARGILYLHEECETCIIHCDIKPQNILMDEYRCAKISDFGLAKLLMHDQTNTSTGIRGTR  652

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHRK  V+VKADVYS+GIVLLE I  R++VDWSL DEE +LEEWVY CFEAGE+
Sbjct  653  GYVAPEWHRKQPVSVKADVYSYGIVLLETICCRRNVDWSLPDEEVILEEWVYQCFEAGEL  712

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+VG+EEV++RQ++ MV++ LWCI ++PSLRPSMKKVLLMLEGTVDIPVPPSP SFLS 
Sbjct  713  GKLVGDEEVDRRQLDMMVKVGLWCILDDPSLRPSMKKVLLMLEGTVDIPVPPSPVSFLSS  772

Query  164  V  162
            +
Sbjct  773  I  773



>emb|CDP04763.1| unnamed protein product [Coffea canephora]
Length=780

 Score =   252 bits (644),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 154/180 (86%), Gaps = 1/180 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IA G+LYLHEEC+TQIIHC IKPQNILMD     KISDFGLAK +K+DQTRT+T  RGTK
Sbjct  599  IAGGILYLHEECETQIIHCVIKPQNILMDENRCPKISDFGLAKLLKRDQTRTHTTFRGTK  658

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEW+RKM VTVKADVYSFGIVLLE+I  RKS+DWS  +++AVLE+W Y CF+AGE+
Sbjct  659  GYVAPEWYRKMPVTVKADVYSFGIVLLEIICCRKSLDWSFSEDQAVLEDWAYQCFKAGEL  718

Query  344  -skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLS  168
               V  +E V+ R++ERM +I+LWCIQ+EP+LRPSMKKVLLMLEGTVDIP PPSPTSFLS
Sbjct  719  HKLVGDQEVVDMRKLERMTKIALWCIQDEPALRPSMKKVLLMLEGTVDIPDPPSPTSFLS  778



>gb|KCW62264.1| hypothetical protein EUGRSUZ_H04925 [Eucalyptus grandis]
Length=662

 Score =   249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC+TQIIHCDIKPQNIL+D+   AKI+DFGL+K +K DQT T T++RGT+
Sbjct  482  VARGLLYLHEECETQIIHCDIKPQNILIDDNMQAKIADFGLSKLLKPDQTNTTTMIRGTR  541

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWH+++ VTVKAD YSFG+VLLE+I  R+ VD SL +EEA+LE+WVY+CFEAGE+
Sbjct  542  GYVAPEWHKQLPVTVKADTYSFGVVLLEIICGRRCVDSSLPEEEAILEDWVYHCFEAGEL  601

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+V  + ++++Q+ERMV+++LWCI+EEP+LRPSM+KVLLMLEGTVDIP+PP  TSF SV
Sbjct  602  DKLVHYQTIDQKQLERMVKVALWCIREEPALRPSMRKVLLMLEGTVDIPIPPCLTSFPSV  661

Query  164  V  162
            +
Sbjct  662  I  662



>ref|XP_006427825.1| hypothetical protein CICLE_v10025158mg [Citrus clementina]
 gb|ESR41065.1| hypothetical protein CICLE_v10025158mg [Citrus clementina]
Length=625

 Score =   249 bits (635),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLH+EC+TQIIHCDIKPQNILMD    AKISDFGLAK MK DQT+T+T +RGT+
Sbjct  445  IARGILYLHDECETQIIHCDIKPQNILMDENRCAKISDFGLAKLMKPDQTKTFTGIRGTR  504

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR + +TVKAD+YSFG+VLLE+I  R+ +D +L +++ +LEEWVY CFE G +
Sbjct  505  GYVAPEWHRNLPITVKADIYSFGVVLLEIICLRRCLDQNLPEDQVILEEWVYQCFEGGNL  564

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
            S++V  EEV++RQ+ER+++++LWCI +EPSLRPSMKKVLLMLEG V+IP+PP+PTSFLS 
Sbjct  565  SQLVEGEEVDQRQLERIIKVALWCILDEPSLRPSMKKVLLMLEGPVEIPIPPNPTSFLSA  624

Query  164  V  162
            +
Sbjct  625  I  625



>ref|XP_006387862.1| hypothetical protein POPTR_0518s00220g [Populus trichocarpa]
 gb|ERP46776.1| hypothetical protein POPTR_0518s00220g [Populus trichocarpa]
Length=779

 Score =   251 bits (640),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG++YLHEEC+TQIIHCDIKPQNIL+D     K+SDFGLAK +K DQT+T+T +RGT+
Sbjct  599  IARGIVYLHEECETQIIHCDIKPQNILIDESRCPKVSDFGLAKLLKSDQTKTFTGIRGTR  658

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR M VTVKADVYSFG++LLE+   RK+VDWSL ++EAVLE+WVY CF+ G++
Sbjct  659  GYVAPEWHRNMPVTVKADVYSFGVMLLEITCCRKNVDWSLPEDEAVLEQWVYQCFQDGDM  718

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+VGEE  EK+Q++RMV++ +WC  +EPSLRPSMKKVLLMLEGTV+IP+PPSPTSF++ 
Sbjct  719  DKLVGEEVAEKKQLDRMVKVGIWCTLDEPSLRPSMKKVLLMLEGTVEIPIPPSPTSFITA  778

Query  164  V  162
            +
Sbjct  779  I  779



>ref|XP_006382827.1| hypothetical protein POPTR_0005s05830g [Populus trichocarpa]
 gb|ERP60624.1| hypothetical protein POPTR_0005s05830g [Populus trichocarpa]
Length=776

 Score =   250 bits (639),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG++YLHEEC+TQIIHCDIKPQNIL+D     K+SDFGLAK +K DQT+T+T +RGT+
Sbjct  596  IARGIVYLHEECETQIIHCDIKPQNILIDESRCPKVSDFGLAKLLKSDQTKTFTGIRGTR  655

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR M VTVKADVYSFG++LLE+   RK+VDWSL ++EAVLE+WVY CF+ G++
Sbjct  656  GYVAPEWHRNMPVTVKADVYSFGVMLLEITCCRKNVDWSLPEDEAVLEQWVYQCFQDGDM  715

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+VGEE  EK+Q++RMV++ +WC  +EPSLRPSMKKVLLMLEGTV+IP+PPSPTSF + 
Sbjct  716  DKLVGEEVAEKKQLDRMVKVGIWCTLDEPSLRPSMKKVLLMLEGTVEIPIPPSPTSFFTA  775

Query  164  V  162
            +
Sbjct  776  I  776



>ref|XP_010027360.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Eucalyptus grandis]
Length=799

 Score =   250 bits (639),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC+TQIIHCDIKPQNIL+D+   AKI+DFGL+K +K DQT T T++RGT+
Sbjct  619  VARGLLYLHEECETQIIHCDIKPQNILIDDNMQAKIADFGLSKLLKPDQTNTTTMIRGTR  678

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWH+++ VTVKAD YSFG+VLLE+I  R+ VD SL +EEA+LE+WVY+CFEAGE+
Sbjct  679  GYVAPEWHKQLPVTVKADTYSFGVVLLEIICGRRCVDSSLPEEEAILEDWVYHCFEAGEL  738

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+V  + ++++Q+ERMV+++LWCI+EEP+LRPSM+KVLLMLEGTVDIP+PP  TSF SV
Sbjct  739  DKLVHYQTIDQKQLERMVKVALWCIREEPALRPSMRKVLLMLEGTVDIPIPPCLTSFPSV  798

Query  164  V  162
            +
Sbjct  799  I  799



>ref|XP_006464594.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Citrus sinensis]
Length=781

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLH+EC+TQIIHCDIKPQNILMD    AKISDFGLAK MK DQT+T+T +RGT+
Sbjct  601  IARGILYLHDECETQIIHCDIKPQNILMDENRCAKISDFGLAKLMKPDQTKTFTGIRGTR  660

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR + +TVKAD+YSFG+VLLE+I  R+ +D +L +++ +LEEWVY CFE G +
Sbjct  661  GYVAPEWHRNLPITVKADIYSFGVVLLEIICLRRCLDQNLPEDQVILEEWVYQCFEGGNL  720

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
            S++V  EEV++RQ+ER+++++LWCI +EPSLRPSMKKVLLMLEG V+IP+PP+PTSFLS 
Sbjct  721  SQLVEGEEVDQRQLERIIKVALWCILDEPSLRPSMKKVLLMLEGPVEIPIPPNPTSFLSA  780

Query  164  V  162
            +
Sbjct  781  I  781



>ref|XP_010025552.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 isoform X2 [Eucalyptus grandis]
Length=675

 Score =   247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC+TQIIHCDIKPQNIL+D+   AKI+DFGL+K +K DQ+ T T++RGT+
Sbjct  495  VARGLLYLHEECETQIIHCDIKPQNILIDDNMQAKIADFGLSKLLKPDQSNTTTMIRGTR  554

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWH+++ VTVKAD YSFG+VLLE+I  R+ VD SL +EEAVLE+WVY+CF+AGE+
Sbjct  555  GYVAPEWHKQLPVTVKADTYSFGVVLLEIICGRRCVDSSLPEEEAVLEDWVYHCFQAGEL  614

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+V  + ++++Q+ERMV+++L CIQEEP+LRPSM+KVLLMLEGTVD+P+PP  TSFLSV
Sbjct  615  DKIVHYQTIDQKQLERMVKVALLCIQEEPALRPSMRKVLLMLEGTVDVPIPPCLTSFLSV  674

Query  164  V  162
            +
Sbjct  675  I  675



>gb|KCW62267.1| hypothetical protein EUGRSUZ_H04929 [Eucalyptus grandis]
Length=767

 Score =   247 bits (631),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC+TQIIHCDIKPQNIL+D+   AKI+DFGL+K +K DQ+ T T++RGT+
Sbjct  587  VARGLLYLHEECETQIIHCDIKPQNILIDDNMQAKIADFGLSKLLKPDQSNTTTMIRGTR  646

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWH+++ VTVKAD YSFG+VLLE+I  R+ VD SL +EEAVLE+WVY+CF+AGE+
Sbjct  647  GYVAPEWHKQLPVTVKADTYSFGVVLLEIICGRRCVDSSLPEEEAVLEDWVYHCFQAGEL  706

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+V  + ++++Q+ERMV+++L CIQEEP+LRPSM+KVLLMLEGTVD+P+PP  TSFLSV
Sbjct  707  DKIVHYQTIDQKQLERMVKVALLCIQEEPALRPSMRKVLLMLEGTVDVPIPPCLTSFLSV  766

Query  164  V  162
            +
Sbjct  767  I  767



>ref|XP_010025551.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 isoform X1 [Eucalyptus grandis]
Length=779

 Score =   247 bits (630),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC+TQIIHCDIKPQNIL+D+   AKI+DFGL+K +K DQ+ T T++RGT+
Sbjct  599  VARGLLYLHEECETQIIHCDIKPQNILIDDNMQAKIADFGLSKLLKPDQSNTTTMIRGTR  658

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWH+++ VTVKAD YSFG+VLLE+I  R+ VD SL +EEAVLE+WVY+CF+AGE+
Sbjct  659  GYVAPEWHKQLPVTVKADTYSFGVVLLEIICGRRCVDSSLPEEEAVLEDWVYHCFQAGEL  718

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+V  + ++++Q+ERMV+++L CIQEEP+LRPSM+KVLLMLEGTVD+P+PP  TSFLSV
Sbjct  719  DKIVHYQTIDQKQLERMVKVALLCIQEEPALRPSMRKVLLMLEGTVDVPIPPCLTSFLSV  778

Query  164  V  162
            +
Sbjct  779  I  779



>emb|CDP04766.1| unnamed protein product [Coffea canephora]
Length=780

 Score =   246 bits (629),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 151/179 (84%), Gaps = 1/179 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLHEEC+TQIIHCDIKPQNILMD    AKISDFGLAK +K DQTRTYT VRGT+
Sbjct  599  IARGILYLHEECETQIIHCDIKPQNILMDESRCAKISDFGLAKLLKNDQTRTYTGVRGTR  658

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEW RK+ VTVKADVYSFGIVLLE+I  RKSVD +  +  A+LEEW Y CFEAGE+
Sbjct  659  GYVAPEWFRKLPVTVKADVYSFGIVLLEIICCRKSVDCTSPESVAILEEWAYQCFEAGEL  718

Query  344  -skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFL  171
               V  +E  + R++ERMV+I+LWC+Q+EP+LRPSMKKVLLMLEGTVDIP PPS TSFL
Sbjct  719  YKLVGDQEVDDVRELERMVKIALWCVQDEPALRPSMKKVLLMLEGTVDIPDPPSLTSFL  777



>ref|XP_006427826.1| hypothetical protein CICLE_v10027040mg [Citrus clementina]
 ref|XP_006464593.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Citrus sinensis]
 gb|ESR41066.1| hypothetical protein CICLE_v10027040mg [Citrus clementina]
Length=781

 Score =   246 bits (628),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLH+EC TQIIHCDIKPQNILMD    AKISDFGLAK MK DQT+T+T +RGT+
Sbjct  601  IARGILYLHDECLTQIIHCDIKPQNILMDENRCAKISDFGLAKLMKPDQTKTFTGIRGTR  660

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR + +TVKAD+YSFG+VLLE+I  R+ +D +L +++ +LEEWVY CFE G +
Sbjct  661  GYVAPEWHRNLPITVKADIYSFGVVLLEIICLRRCLDQNLPEDQVILEEWVYQCFEDGNL  720

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
            S++V  EEV++RQ+ER+++++LWCI +EPSLRPSMKK+LLMLEG+V+IP+PP+PTSFLS 
Sbjct  721  SQLVEGEEVDQRQLERIIKVALWCILDEPSLRPSMKKILLMLEGSVEIPIPPNPTSFLSA  780

Query  164  V  162
            +
Sbjct  781  I  781



>ref|XP_008245126.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Prunus mume]
Length=775

 Score =   245 bits (625),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG LYLHEECDTQIIHCDIKPQNIL+D     KISDFGLAK +K DQTRT T +RGTK
Sbjct  595  IARGFLYLHEECDTQIIHCDIKPQNILLDEFMCPKISDFGLAKLLKADQTRTTTGIRGTK  654

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHRKM +TVKADVYSFGIVLLE+I  R++VDWSL +EEA+L+E  YNCFE GE+
Sbjct  655  GYVAPEWHRKMPITVKADVYSFGIVLLEIICCRRNVDWSLPEEEAILDELAYNCFEKGEL  714

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+ G+EE+E+RQ ERM+++ LWCIQ+EPSLRPSMKKVLLMLEGTVDIP PPSP+SF S 
Sbjct  715  GKLAGDEEIERRQFERMIKVGLWCIQDEPSLRPSMKKVLLMLEGTVDIPTPPSPSSFFSA  774

Query  164  V  162
            +
Sbjct  775  I  775



>ref|XP_011032369.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Populus euphratica]
Length=776

 Score =   244 bits (624),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG++YLHEEC+TQIIHCDIKPQNIL+D     K+SDFGLAK ++ DQT+T+T +RGT+
Sbjct  596  IARGIVYLHEECETQIIHCDIKPQNILIDESRCPKVSDFGLAKLLRSDQTKTFTGIRGTR  655

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR M VTVKADVYSFG++LLE+   RK+VD +L ++EAVLE+WVY CF+ G++
Sbjct  656  GYVAPEWHRNMPVTVKADVYSFGVMLLEITCCRKNVDSNLPEDEAVLEQWVYQCFQDGDM  715

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+VGEE VEK+Q++RMV++ LWC  +EPSLRPSMKKVLLMLEGTV+IP+PPSPTSF + 
Sbjct  716  EKLVGEEVVEKKQLDRMVKVGLWCTLDEPSLRPSMKKVLLMLEGTVEIPIPPSPTSFFTA  775

Query  164  V  162
            +
Sbjct  776  I  776



>ref|XP_011032370.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Populus euphratica]
Length=775

 Score =   244 bits (624),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG++YLHEEC+TQIIHCDIKPQNIL+D     K+SDFGLAK ++ DQT+T+T +RGT+
Sbjct  595  IARGIVYLHEECETQIIHCDIKPQNILIDESRCPKVSDFGLAKLLRSDQTKTFTGIRGTR  654

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR M VTVKADVYSFG++LLE+   RK+VD +L ++EAVLE+WVY CF+ G++
Sbjct  655  GYVAPEWHRNMPVTVKADVYSFGVMLLEITCCRKNVDSNLPEDEAVLEQWVYQCFQDGDM  714

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+VGEE VEK+Q++RMV++ LWC  +EPSLRPSMKKVLLMLEGTV+IP+PPSPTSF + 
Sbjct  715  EKLVGEEVVEKKQLDRMVKVGLWCTLDEPSLRPSMKKVLLMLEGTVEIPIPPSPTSFFTA  774

Query  164  V  162
            +
Sbjct  775  I  775



>gb|KCW62266.1| hypothetical protein EUGRSUZ_H04928 [Eucalyptus grandis]
Length=662

 Score =   242 bits (618),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC+TQIIHCDIKPQNIL+D+   AKI+DFGL+K +K DQT T T++RGT+
Sbjct  482  VARGLLYLHEECETQIIHCDIKPQNILIDDNMQAKIADFGLSKLLKPDQTNTTTMIRGTR  541

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWH+++ VTVKAD YSFG+VLLE+I  R+ VD +L +EEAVLE+WVY+CF+ GE+
Sbjct  542  GYVAPEWHKQLPVTVKADTYSFGVVLLEIICGRRYVDSNLPEEEAVLEDWVYHCFQVGEL  601

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+V  + ++++Q+ERMV+++L CIQEEP+LRPSM+KVLLMLEGTVD+P+PP  TSF SV
Sbjct  602  DKLVHYQTIDQKQLERMVKVALLCIQEEPALRPSMRKVLLMLEGTVDVPIPPCLTSFSSV  661

Query  164  V  162
            +
Sbjct  662  I  662



>ref|XP_010245281.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nelumbo nucifera]
Length=782

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLH+EC+TQIIHCDIKPQNILMD     KI+DFGLAK +K DQ+ T+T +RGT+
Sbjct  602  IARGILYLHDECETQIIHCDIKPQNILMDEFNCPKIADFGLAKLLKPDQSGTFTAIRGTR  661

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR M +TVKAD+YSFG+VLLEL+  R+SVD ++ ++E VL +WVY+CF+AGE+
Sbjct  662  GYVAPEWHRNMPITVKADIYSFGVVLLELVCCRRSVDVNVPEDEIVLTDWVYDCFKAGEL  721

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+VG+E V+K+++ERMV + LWCIQ+EPSLRP MKKV+LMLEGTVDIPVPPSP+SF S 
Sbjct  722  QKLVGDEVVDKKRLERMVSVGLWCIQDEPSLRPFMKKVVLMLEGTVDIPVPPSPSSFFST  781

Query  164  V  162
            +
Sbjct  782  I  782



>gb|KDP26121.1| hypothetical protein JCGZ_22222 [Jatropha curcas]
Length=763

 Score =   243 bits (620),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 152/182 (84%), Gaps = 1/182 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IA+G+LYLHEECD QIIHCDIKP+NILMD     KISDFGLAK +K  Q  T T++RGT+
Sbjct  582  IAKGILYLHEECDAQIIHCDIKPENILMDESNNPKISDFGLAKLLKPGQANTNTVIRGTR  641

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGe-  348
            GYVAPEWHRK+ VTVKADVYSFGI+LLE+ S R++VD SL + E VL +WVYNCFEAGE 
Sbjct  642  GYVAPEWHRKLPVTVKADVYSFGIMLLEIASCRRNVDHSLQENECVLVDWVYNCFEAGEI  701

Query  347  vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLS  168
               V G+EEV+ +Q++RM++I LWC  +EPSLRPSMKKVLLMLEGTVDIP+PPSPTSF+S
Sbjct  702  QKLVSGDEEVDMKQMDRMIKIGLWCTLDEPSLRPSMKKVLLMLEGTVDIPIPPSPTSFIS  761

Query  167  VV  162
             +
Sbjct  762  SI  763



>ref|XP_010027361.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Eucalyptus grandis]
Length=782

 Score =   243 bits (619),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC+TQIIHCDIKPQNIL+D+   AKI+DFGL+K +K DQT T T++RGT+
Sbjct  602  VARGLLYLHEECETQIIHCDIKPQNILIDDNMQAKIADFGLSKLLKPDQTNTTTMIRGTR  661

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWH+++ VTVKAD YSFG+VLLE+I  R+ VD +L +EEAVLE+WVY+CF+ GE+
Sbjct  662  GYVAPEWHKQLPVTVKADTYSFGVVLLEIICGRRYVDSNLPEEEAVLEDWVYHCFQVGEL  721

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+V  + ++++Q+ERMV+++L CIQEEP+LRPSM+KVLLMLEGTVD+P+PP  TSF SV
Sbjct  722  DKLVHYQTIDQKQLERMVKVALLCIQEEPALRPSMRKVLLMLEGTVDVPIPPCLTSFSSV  781

Query  164  V  162
            +
Sbjct  782  I  782



>ref|XP_004289248.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SRK-like [Fragaria vesca subsp. vesca]
Length=784

 Score =   242 bits (618),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG LYLHEECDTQIIHCDIKPQNILMD     KI+DFGL+K ++ D+T+  T +RGTK
Sbjct  604  IARGFLYLHEECDTQIIHCDIKPQNILMDEYMCPKITDFGLSKLLQPDETQICTGIRGTK  663

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHRK+ VTVK DVYSFGIVLLE++  R++VDWSL  +EA+L+E VY+ FE+GE+
Sbjct  664  GYVAPEWHRKIPVTVKVDVYSFGIVLLEIVFCRRNVDWSLPHDEAILDELVYHYFESGEL  723

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+VG+E+++ RQ+ER+V++ +WCIQ+EPSLRPSMKKVLLMLEGTV+IPVPPSP SFLS 
Sbjct  724  RKLVGDEDMDSRQLERVVKVGIWCIQDEPSLRPSMKKVLLMLEGTVEIPVPPSPVSFLST  783

Query  164  V  162
            +
Sbjct  784  I  784



>ref|XP_002531801.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF30589.1| ATP binding protein, putative [Ricinus communis]
Length=783

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 149/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLHEEC+TQIIHCDIKP+NILMD     KISDFGLAK +K DQT+T T +RGT+
Sbjct  602  IARGILYLHEECETQIIHCDIKPENILMDAYMCPKISDFGLAKLLKPDQTKTMTDIRGTR  661

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHRK+ VTVKADVYSFGIVLLE+   RK+VD S  + E +L EWVY+CF +GE+
Sbjct  662  GYVAPEWHRKLPVTVKADVYSFGIVLLEITCCRKNVDLSAPERECILVEWVYDCFASGEL  721

Query  344  skvvgeeevekrqvermv-RISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLS  168
             K+VG++E   ++    + ++ LWC  +EPSLRPSMKKVLLMLEGTVDIP+PPSPTSFLS
Sbjct  722  DKLVGDDEEVDKRQMNRMIKVGLWCTLDEPSLRPSMKKVLLMLEGTVDIPIPPSPTSFLS  781

Query  167  VV  162
             +
Sbjct  782  CI  783



>ref|XP_004289247.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Fragaria vesca subsp. vesca]
Length=778

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG LY+HEECDTQIIHCDIKPQNILMD     KISDFGLAK ++QDQTRT T +RGTK
Sbjct  598  IARGFLYMHEECDTQIIHCDIKPQNILMDENMCPKISDFGLAKLLQQDQTRTTTGIRGTK  657

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHRKM +TVKADVYSFGIVLLE++  R++VDWSL  EEA+L+E VY+ FE+GE+
Sbjct  658  GYVAPEWHRKMPITVKADVYSFGIVLLEIVCCRRNVDWSLPQEEAILDELVYHYFESGEL  717

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
            SK+V +E++ +RQ ER +++ LWCIQ+EPSLRPSMKKVLLMLEGTVDI VPP+P+SFLS 
Sbjct  718  SKLVRDEDINRRQFERAIKVGLWCIQDEPSLRPSMKKVLLMLEGTVDIRVPPNPSSFLST  777

Query  164  V  162
            +
Sbjct  778  I  778



>emb|CDP04764.1| unnamed protein product [Coffea canephora]
Length=915

 Score =   242 bits (618),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 151/182 (83%), Gaps = 1/182 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLHEEC+TQIIHCDIKPQN+LMD    AKISDFGLAK +K DQTRTYT VRGT+
Sbjct  593  IARGILYLHEECETQIIHCDIKPQNVLMDESRCAKISDFGLAKLLKNDQTRTYTGVRGTR  652

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEW R + VTVKADVYSFGI+LLE+I  RKSVD +  + EA+LEEW   CFEAGE+
Sbjct  653  GYVAPEWFRNLPVTVKADVYSFGIMLLEIICCRKSVDCTSPENEAILEEWANQCFEAGEL  712

Query  344  skvvgeeevekrqvermv-RISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLS  168
             K+VG+EEV+  +    + +I+LWCIQEEP+LRPSMKKVLLMLEGT DIP+PPS  SF S
Sbjct  713  YKLVGDEEVDDVRELERMIKIALWCIQEEPALRPSMKKVLLMLEGTGDIPIPPSLPSFSS  772

Query  167  VV  162
            ++
Sbjct  773  LI  774


 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 83/101 (82%), Gaps = 1/101 (1%)
 Frame = -2

Query  461  FGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGevskvvgeeevekrqv-ermvRI  285
            FGI+LLE+I  RKSV+ +  + EA+LEEW Y CFEAGE+ K+VG++EV+  +  ERM++I
Sbjct  813  FGIMLLEIICCRKSVECTSPENEAILEEWAYQCFEAGELYKLVGDQEVDDVREPERMIKI  872

Query  284  SLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSVV  162
            +LWCIQEEP+LRPSMKKVLLMLEG VDIP+PPS  SF S +
Sbjct  873  ALWCIQEEPALRPSMKKVLLMLEGIVDIPIPPSLPSFSSAI  913



>ref|XP_002531799.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF30587.1| ATP binding protein, putative [Ricinus communis]
Length=817

 Score =   241 bits (614),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 149/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLHEEC+TQIIHCDIKP+NILMD     KISDFGLAK +K DQT+T T +RGT+
Sbjct  602  IARGILYLHEECETQIIHCDIKPENILMDAYMCPKISDFGLAKLLKPDQTKTMTGIRGTR  661

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHRK+ VT KADVYSFGIVLLE+   RK VD S  + E +L EWVYNCFE GE+
Sbjct  662  GYVAPEWHRKLPVTTKADVYSFGIVLLEIACCRKHVDLSAPEHECILVEWVYNCFENGEL  721

Query  344  -skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLS  168
               V  ++EV+KRQ+ RM+++ LWC  +EPSLRPSMKKVLLMLEGTVDIP PPSPTSFLS
Sbjct  722  DELVGDDKEVDKRQMNRMIKVGLWCTLDEPSLRPSMKKVLLMLEGTVDIPTPPSPTSFLS  781

Query  167  VV  162
             +
Sbjct  782  CI  783



>ref|XP_008339042.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Malus domestica]
Length=789

 Score =   240 bits (613),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG LYLHEECDTQIIHCDIKPQNILMD     KI+DFGLAK +K DQTRT T  RGT+
Sbjct  609  IARGFLYLHEECDTQIIHCDIKPQNILMDEYMCPKIADFGLAKLLKADQTRTTTGFRGTR  668

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHRKM +TVKADVYSFG+VLLE+I  R++VDWSL DEEA+L+E  Y+CFE GE+
Sbjct  669  GYVAPEWHRKMPITVKADVYSFGVVLLEIICCRRNVDWSLPDEEAILDELAYHCFETGEL  728

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+VGEEEV  RQ ERM+++ LWCIQ+EPSLRPSMKKVLLMLEGTVDIP+PP+P SFLS 
Sbjct  729  GKLVGEEEVNTRQFERMIKVGLWCIQDEPSLRPSMKKVLLMLEGTVDIPIPPNPISFLST  788

Query  164  V  162
            +
Sbjct  789  I  789



>gb|KDP26126.1| hypothetical protein JCGZ_22227 [Jatropha curcas]
Length=786

 Score =   240 bits (613),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 152/182 (84%), Gaps = 1/182 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IA+G+LYLHEEC+ QIIHCDIKP+NILMD     KISDFGLAK +K  Q  T T++RGT+
Sbjct  605  IAKGILYLHEECEAQIIHCDIKPENILMDEYNNPKISDFGLAKLLKPGQANTNTVIRGTR  664

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGe-  348
            GYVAPEWHRK+ VTVKADVYSFGI+LLE+ S R++VD SL + E VL +WVYNCFEAGE 
Sbjct  665  GYVAPEWHRKLPVTVKADVYSFGIMLLEIASCRRNVDHSLQENECVLVDWVYNCFEAGEI  724

Query  347  vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLS  168
               V G+EEV+ +Q++RM++I LWC  +EPSLRPSMKKVLLMLEGTVDIP+PPSPTSF+S
Sbjct  725  QKLVSGDEEVDMKQMDRMIKIGLWCTLDEPSLRPSMKKVLLMLEGTVDIPIPPSPTSFIS  784

Query  167  VV  162
             +
Sbjct  785  CI  786



>gb|KDO40386.1| hypothetical protein CISIN_1g041285mg, partial [Citrus sinensis]
Length=724

 Score =   239 bits (611),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLH+EC++QIIHCDIKPQNILMD    AKISDF LAK MK DQTRT+T +RGT+
Sbjct  544  IARGILYLHDECESQIIHCDIKPQNILMDENRYAKISDFALAKLMKPDQTRTFTGIRGTR  603

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWH  + +T KADVYSFG+VLLE+I  R+  D +L +++ +LEEWVY CFE G +
Sbjct  604  GYVAPEWHWNLPITAKADVYSFGVVLLEIICCRRCFDQNLPEDQVILEEWVYQCFENGNL  663

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             +++ +E+V+K+Q+ERM++++LWCI +EPSLRPSMKKVLLMLEGT+DIP+PP+PTS L+ 
Sbjct  664  GQLIEDEDVDKKQLERMIKVALWCILDEPSLRPSMKKVLLMLEGTMDIPIPPNPTSLLTT  723

Query  164  V  162
            +
Sbjct  724  I  724



>ref|XP_007048279.1| Receptor-like protein kinase 1 [Theobroma cacao]
 gb|EOX92436.1| Receptor-like protein kinase 1 [Theobroma cacao]
Length=777

 Score =   240 bits (612),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 163/182 (90%), Gaps = 1/182 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEECDTQIIHCDIK QNILMD Q  AKISDFGLAK +K DQ++T+T +RGT+
Sbjct  596  IARGLLYLHEECDTQIIHCDIKSQNILMDEQGNAKISDFGLAKLLKPDQSKTFTGIRGTR  655

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWH K+ +TVKADVYSFG+V+LE+I  R+SV+WSL +EEAVLEEWVY+CF+ GE+
Sbjct  656  GYVAPEWHMKLPITVKADVYSFGVVVLEIICCRRSVNWSLLEEEAVLEEWVYDCFQGGEL  715

Query  344  skvvg-eeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLS  168
             K+VG +EEV+++Q+ERMVR+ LWCI +EP+LRPSMKKVLLMLEGTVDIPVPPSPTSF S
Sbjct  716  RKLVGDDEEVDEKQLERMVRVGLWCILDEPTLRPSMKKVLLMLEGTVDIPVPPSPTSFFS  775

Query  167  VV  162
             +
Sbjct  776  AI  777



>emb|CDP04773.1| unnamed protein product [Coffea canephora]
Length=779

 Score =   239 bits (611),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 151/182 (83%), Gaps = 1/182 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARG+LYLHEEC+TQIIHCDIKP+NILMD+   AKISDFGLAK +  D+TRTYT VRGT+
Sbjct  598  VARGILYLHEECETQIIHCDIKPENILMDDSRCAKISDFGLAKPLDHDRTRTYTAVRGTR  657

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR + VTVKADVYS+GI+LLE+I  RK+VD    +E+++LE W Y+CF  GE+
Sbjct  658  GYVAPEWHRNLPVTVKADVYSYGILLLEIICCRKNVDSRFPEEQSILEVWAYDCFVDGEL  717

Query  344  -skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLS  168
               V  EE V+  ++ERM+RI+LWCIQ EP+LRPSMKKV+LMLEGTVD+PVPPSP SF S
Sbjct  718  HKLVGEEEAVDMTKLERMIRIALWCIQNEPTLRPSMKKVVLMLEGTVDVPVPPSPDSFFS  777

Query  167  VV  162
             +
Sbjct  778  AM  779



>ref|XP_009366380.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Pyrus x bretschneideri]
Length=795

 Score =   240 bits (612),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG LYLHEECDTQIIHCDIKPQNILMD     KISDFGLAK +K DQTRT T +RGTK
Sbjct  615  IARGFLYLHEECDTQIIHCDIKPQNILMDEYMCPKISDFGLAKLLKADQTRTTTGIRGTK  674

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHRKM +TVKADVYSFG+VLLE+I  R++VDWSL +EEAVL+E  Y CFE+GE 
Sbjct  675  GYVAPEWHRKMPITVKADVYSFGVVLLEIICCRRNVDWSLPEEEAVLDELAYPCFESGEH  734

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+VGE+EV+ RQ ERM++++LWCIQ+EPSLRPSMKK+LLMLEGTV+IP+PPSP S L  
Sbjct  735  GKLVGEQEVDTRQFERMIKVALWCIQDEPSLRPSMKKILLMLEGTVEIPIPPSPDSILGT  794

Query  164  V  162
            +
Sbjct  795  I  795



>ref|XP_010027416.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Eucalyptus grandis]
Length=288

 Score =   228 bits (580),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 153/181 (85%), Gaps = 3/181 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC+ QIIHCDIKPQNIL+D+   AKISDFGL+K +K DQT T T++RGT+
Sbjct  111  VARGLLYLHEECEMQIIHCDIKPQNILIDDNMQAKISDFGLSKLLKPDQTNTITMIRGTR  170

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWH+++ VTVK D YSFG++LLE+I  R+ VD SL +EEAVLE+WVY+CF+AGE+
Sbjct  171  GYVAPEWHKQLPVTVKVDTYSFGVMLLEIICGRRCVDVSLPEEEAVLEDWVYHCFQAGEL  230

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+V  + ++++Q+ERMV+++LWCIQEEP+ RPSMK+VLLMLEGTV +P     TSF SV
Sbjct  231  DKLVHYQTIDQKQLERMVKVALWCIQEEPAHRPSMKEVLLMLEGTVYVPC---LTSFSSV  287

Query  164  V  162
            +
Sbjct  288  I  288



>ref|XP_008338991.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Malus domestica]
Length=776

 Score =   239 bits (609),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG LYLHEECDTQIIHCDIKPQNILMD     KI+DFGLAK +K DQTRT T +RGTK
Sbjct  596  IARGFLYLHEECDTQIIHCDIKPQNILMDEYMCPKIADFGLAKLLKADQTRTTTGIRGTK  655

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHRKM +TVKADVYSFG+VLLE+I  R++VDWSL +EEA+L+E  Y CFE+GE 
Sbjct  656  GYVAPEWHRKMPITVKADVYSFGVVLLEIICCRRNVDWSLPEEEAILDELAYPCFESGEH  715

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+VGE+EV+ RQ ERM++++LWCIQ+EPSLRP MKKVLLMLEGTV+IP+PPSP S LS 
Sbjct  716  GKLVGEQEVDTRQFERMIKVALWCIQDEPSLRPCMKKVLLMLEGTVEIPIPPSPNSILST  775

Query  164  V  162
            +
Sbjct  776  I  776



>ref|XP_010260907.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nelumbo nucifera]
Length=789

 Score =   239 bits (610),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 145/183 (79%), Gaps = 2/183 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLHEEC+TQIIHCDIKPQNILMD     KI+DFGLAK +K DQ+ T+T +RGT+
Sbjct  606  IARGILYLHEECETQIIHCDIKPQNILMDEYQCPKIADFGLAKLLKPDQSGTFTSIRGTR  665

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHRK+ +TVKADVYSFGIVLLE++  R+SVD     EEA+L +W Y+CF+ GE+
Sbjct  666  GYVAPEWHRKLPITVKADVYSFGIVLLEIVCCRRSVDNDNSGEEAILVDWAYDCFKGGEL  725

Query  344  skvvgeeevekrqvermvRI--SLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFL  171
             K++  EE    + +    I   LWCIQ+EPSLRPSMKKV+LMLEGTVDIP+PP P+SFL
Sbjct  726  HKLMRNEEEVVDKRKFERMIRVGLWCIQDEPSLRPSMKKVVLMLEGTVDIPIPPCPSSFL  785

Query  170  SVV  162
            S  
Sbjct  786  SAA  788



>ref|XP_009366388.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Pyrus x bretschneideri]
 ref|XP_009366389.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Pyrus x bretschneideri]
 ref|XP_009366390.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Pyrus x bretschneideri]
 ref|XP_009366391.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Pyrus x bretschneideri]
Length=790

 Score =   238 bits (607),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG LYLHEECDTQIIHCDIKP NILMD     KISDFGLAK +K DQTRT T  RGT+
Sbjct  610  IARGFLYLHEECDTQIIHCDIKPHNILMDEYMCPKISDFGLAKLLKADQTRTTTGFRGTR  669

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHRKM +TVKADVYSFG+VLLE+I  R++VDWSL DEEA+L+E  Y+CFE GE+
Sbjct  670  GYVAPEWHRKMPITVKADVYSFGVVLLEIICCRRNVDWSLPDEEAILDELAYHCFETGEL  729

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+VGEEEV  RQ ERM+++ LWCIQ+EPSLRPS KKVLLMLEGTVDIP+PP+P SFLS 
Sbjct  730  GKLVGEEEVNTRQFERMLKVGLWCIQDEPSLRPSTKKVLLMLEGTVDIPIPPNPISFLST  789

Query  164  V  162
            +
Sbjct  790  I  790



>ref|XP_009366381.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Pyrus x bretschneideri]
Length=781

 Score =   238 bits (606),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG LYLHEECDTQIIHCDIKPQNIL+D     KISDFGLAK +K DQTRT T +RGTK
Sbjct  601  IARGFLYLHEECDTQIIHCDIKPQNILIDEYMCPKISDFGLAKLLKADQTRTTTGIRGTK  660

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHRKM +TVKADVYSFGIVLLE+I  R++VDWSL +EEAVL+E  Y CFE+GE+
Sbjct  661  GYVAPEWHRKMPITVKADVYSFGIVLLEIICCRRNVDWSLPEEEAVLDELAYTCFESGEL  720

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+VGE+EV+ RQ ERM++++LWC+Q+EPSLRPSMKKVLLMLEGTV+IP+PPS  S LS 
Sbjct  721  GKLVGEQEVDTRQFERMIKVALWCVQDEPSLRPSMKKVLLMLEGTVEIPIPPSLNSILST  780

Query  164  V  162
            +
Sbjct  781  I  781



>gb|KCW62458.1| hypothetical protein EUGRSUZ_H05095, partial [Eucalyptus grandis]
Length=279

 Score =   225 bits (573),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC+ QIIHCDIKPQNIL+D+   AKISDFGL+K +K DQT T T++RGT+
Sbjct  111  VARGLLYLHEECEMQIIHCDIKPQNILIDDNMQAKISDFGLSKLLKPDQTNTITMIRGTR  170

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWH+++ VTVK D YSFG++LLE+I  R+ VD SL +EEAVLE+WVY+CF+AGE+
Sbjct  171  GYVAPEWHKQLPVTVKVDTYSFGVMLLEIICGRRCVDVSLPEEEAVLEDWVYHCFQAGEL  230

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIP  198
             K+V  + ++++Q+ERMV+++LWCIQEEP+ RPSMK+VLLMLEGTV +P
Sbjct  231  DKLVHYQTIDQKQLERMVKVALWCIQEEPAHRPSMKEVLLMLEGTVYVP  279



>ref|XP_010108660.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Morus notabilis]
 gb|EXC19916.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Morus notabilis]
Length=784

 Score =   236 bits (603),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 152/181 (84%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+ YLHEEC+TQIIHCDIKP+NILMD Q  AKI+DFGL+K +  DQTRTYT  RGT+
Sbjct  601  IARGIHYLHEECETQIIHCDIKPENILMDEQNRAKIADFGLSKLLIPDQTRTYTGFRGTR  660

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR M +TVKADVYSFGIVLLE+I  R+SVD  + +++ VL  WVY+CF  GE+
Sbjct  661  GYVAPEWHRNMPITVKADVYSFGIVLLEIICCRRSVDMDVPEDKVVLANWVYDCFLDGEL  720

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+V +E+VE+ ++++M+++ LWCIQEEPS+RPSMKKV LMLEGT++IP PPSPTS +S 
Sbjct  721  DKLVEDEDVEENELQKMIKLGLWCIQEEPSVRPSMKKVCLMLEGTIEIPTPPSPTSSVSN  780

Query  164  V  162
            V
Sbjct  781  V  781



>gb|KDO41357.1| hypothetical protein CISIN_1g038713mg [Citrus sinensis]
Length=252

 Score =   223 bits (568),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+ YLH+EC+ QIIH DIKPQNILMD +  AKISDFGLAK MK DQTRT+T +RGT+
Sbjct  72   IARGIRYLHDECEAQIIHGDIKPQNILMDEKRCAKISDFGLAKLMKPDQTRTFTGIRGTR  131

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
             YVA EWHR + +TVKADVYSFG+VLLE++  R+ +D +L ++ A+L+EW+  CFE G +
Sbjct  132  AYVAAEWHRNLPITVKADVYSFGVVLLEIVCLRRCLDQNLLEDRAILQEWICQCFENGNL  191

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
            S++V +EEV+++Q++RM+++ L CI +EPSLR +MKKVLLMLEGTV+IP+P +PTSFLS 
Sbjct  192  SQLVEDEEVDQKQLQRMIKVGLRCILDEPSLRRAMKKVLLMLEGTVEIPIPQNPTSFLST  251

Query  164  V  162
            +
Sbjct  252  I  252



>ref|XP_006427827.1| hypothetical protein CICLE_v10027123mg [Citrus clementina]
 gb|ESR41067.1| hypothetical protein CICLE_v10027123mg [Citrus clementina]
Length=338

 Score =   224 bits (571),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+ YLH+EC+ QIIH DIKPQNILMD +  AKISDFGLAK MK DQTRT+T +RGT+
Sbjct  158  IARGIRYLHDECEAQIIHGDIKPQNILMDEKRCAKISDFGLAKLMKPDQTRTFTGIRGTR  217

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
             YVA EWHR + +TVKADVYSFG+VLLE++  R+ +D +L ++ A+L+EW+  CFE G +
Sbjct  218  AYVAAEWHRNLPITVKADVYSFGVVLLEIVCLRRCLDQNLLEDRAILQEWICQCFENGNL  277

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
            S++V +EEV+++Q++RM+++ L CI +EPSLR +MKKVLLMLEGTV+IP+P +PTSFLS 
Sbjct  278  SQLVEDEEVDQKQLQRMIKVGLRCILDEPSLRRAMKKVLLMLEGTVEIPIPQNPTSFLST  337

Query  164  V  162
            +
Sbjct  338  I  338



>emb|CDP04761.1| unnamed protein product [Coffea canephora]
Length=780

 Score =   234 bits (597),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 145/169 (86%), Gaps = 1/169 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IA G+LYLHEEC+TQIIHCDIKPQNILMD     KISDFGLAK +K DQTRT+T  RGTK
Sbjct  599  IAGGILYLHEECETQIIHCDIKPQNILMDENRCPKISDFGLAKLLKHDQTRTHTTFRGTK  658

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEW+RKM VTVKADVYSFGIVLLE+I  RKS+DWS  +++AVLE+W Y CF+AGE+
Sbjct  659  GYVAPEWYRKMPVTVKADVYSFGIVLLEIICCRKSLDWSFSEDQAVLEDWAYQCFKAGEL  718

Query  344  -skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDI  201
               V  +E V+ R++ERM++I+LWC+Q+EP+LRPSMKKVLLMLEGTVDI
Sbjct  719  HKLVGDQEVVDMRKLERMMKIALWCVQDEPALRPSMKKVLLMLEGTVDI  767



>ref|XP_006844030.1| hypothetical protein AMTR_s00006p00234620 [Amborella trichopoda]
 gb|ERN05705.1| hypothetical protein AMTR_s00006p00234620 [Amborella trichopoda]
Length=777

 Score =   233 bits (595),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 147/178 (83%), Gaps = 0/178 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLHEEC+TQIIHCDIKPQNIL+DN F  KISDFGLAK M +DQTRT+T +RGT+
Sbjct  600  IARGVLYLHEECETQIIHCDIKPQNILLDNNFTPKISDFGLAKLMGEDQTRTFTDMRGTR  659

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR + +TVK DVYSFGI+LLE+I  RK ++    +EE +L EWVYNCFE   +
Sbjct  660  GYVAPEWHRNLPITVKVDVYSFGIMLLEIICCRKRIEMDAPEEEIILFEWVYNCFETRNL  719

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFL  171
             K+VG EEVE R ++RMV + LWC+QE+PS+RPSM+KV+ ML+GT+D+  PP+P+ FL
Sbjct  720  KKLVGVEEVEMRGLQRMVMVGLWCVQEDPSVRPSMRKVVSMLDGTLDVQSPPNPSQFL  777



>ref|XP_010108661.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Morus notabilis]
 gb|EXC19917.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Morus notabilis]
Length=600

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 151/181 (83%), Gaps = 1/181 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLHEEC+TQIIHCDIKP+NILMD Q  AKI+DFGLAK +  DQ+RTYT  RGT+
Sbjct  418  IARGILYLHEECETQIIHCDIKPENILMDEQNCAKIADFGLAKLLMPDQSRTYTGFRGTR  477

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR M +TVKADVYSFGIVL E+I  R SVD  + +++ VL  WVY+CF  GE+
Sbjct  478  GYVAPEWHRNMPITVKADVYSFGIVLFEIICCR-SVDMDVPEDKVVLANWVYDCFLDGEL  536

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+V +E++E+ ++++M+++ LWCIQEEP +RPSMKKV LMLEGT++IP PP+PTS +S+
Sbjct  537  DKLVEDEDLEENELQKMIKLGLWCIQEEPFVRPSMKKVCLMLEGTIEIPPPPNPTSSVSI  596

Query  164  V  162
            V
Sbjct  597  V  597



>ref|XP_008237620.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Prunus mume]
Length=773

 Score =   230 bits (587),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +A+G+LYLHEEC+TQIIHCDIKP+NILM  Q  AK++DFGLAK +K +QTRT+T  RGT+
Sbjct  592  VAQGILYLHEECETQIIHCDIKPENILMSEQKCAKLADFGLAKLLKSEQTRTHTRFRGTR  651

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR M +TVKADVYSFG+VLLE+I  R+SV+  + +++ VLE WVY+C EA E+
Sbjct  652  GYVAPEWHRNMPITVKADVYSFGVVLLEIICCRRSVNMDIPEDQVVLENWVYHCLEADEL  711

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
             K+V +EEV+K ++ RM++I LWCIQ EPSLRPSMKKV+LMLEGTV+I  PP+P SF S 
Sbjct  712  HKLVQDEEVDKTKLGRMIKIGLWCIQYEPSLRPSMKKVVLMLEGTVEILAPPNPDSFFSS  771

Query  164  V  162
            +
Sbjct  772  I  772



>ref|XP_010042956.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Eucalyptus grandis]
Length=282

 Score =   218 bits (554),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 143/176 (81%), Gaps = 1/176 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLHEEC+TQIIHCDIKPQNILM  +  AKISDFGLAK +  DQTRT+T +RGT+
Sbjct  82   IARGVLYLHEECETQIIHCDIKPQNILM-GENSAKISDFGLAKLLNADQTRTFTGIRGTR  140

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR   VTVKADVYSFGI+LLE+I  RKS++    + EA+LEEWV  CF  G +
Sbjct  141  GYVAPEWHRNQPVTVKADVYSFGIMLLEIICCRKSLELEFPEREAILEEWVCECFWNGGI  200

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
             K+ G+E+V++ +++  ++++LWC+ ++P LRP+MK+VLLMLEG+  IP+PP P+S
Sbjct  201  EKLTGDEKVDEDELKAAIKVALWCVSDDPLLRPTMKRVLLMLEGSTQIPMPPIPSS  256



>emb|CDP04767.1| unnamed protein product [Coffea canephora]
Length=821

 Score =   229 bits (583),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 149/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLHEEC+TQIIHCDIKPQNILMD    AKISDFGLAK +K DQTRTYT VRGT+
Sbjct  640  IARGILYLHEECETQIIHCDIKPQNILMDESRCAKISDFGLAKLLKNDQTRTYTGVRGTR  699

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
             +   EW R + VTVKADVYSFGI+LLE+I  RKSVD +  + EA+LEEW   CFEAGE+
Sbjct  700  AWFKVEWCRNLPVTVKADVYSFGIMLLEIICCRKSVDCTSPENEAILEEWANQCFEAGEL  759

Query  344  skvvg-eeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLS  168
             K+VG EE  + R++ERM++I+LWCIQEEP+LRPSMKKVLLMLEGT DIP+PPS  SF S
Sbjct  760  YKLVGDEEVDDVRELERMIKIALWCIQEEPALRPSMKKVLLMLEGTGDIPIPPSLPSFSS  819

Query  167  VV  162
             +
Sbjct  820  AL  821



>ref|XP_010103458.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Morus notabilis]
 gb|EXB95903.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Morus notabilis]
Length=808

 Score =   228 bits (582),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 150/178 (84%), Gaps = 1/178 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG++YLHEEC+TQ+IHCDIKPQNILMD +  AKISDFGLAK ++ DQT+T+T +RGT+
Sbjct  630  IARGIVYLHEECETQMIHCDIKPQNILMDEKICAKISDFGLAKLLRPDQTQTFTGIRGTR  689

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWH+K  VTVKADVYSFGIVLLE+I RR++V   + +EEA+LEEW   CFE GE+
Sbjct  690  GYVAPEWHKKFPVTVKADVYSFGIVLLEIICRRRNVAMDVPEEEAILEEWARYCFENGEL  749

Query  344  skvvg-eeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSF  174
             K+V  +E V++ Q+ERMV+++LWC++EEPSLRPSMK VLLMLEG +D+  P SP SF
Sbjct  750  RKLVVDDENVDESQLERMVKVALWCLEEEPSLRPSMKNVLLMLEGILDVSSPLSPNSF  807



>emb|CBI35502.3| unnamed protein product [Vitis vinifera]
Length=597

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 150/179 (84%), Gaps = 1/179 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARG+LYLHEEC+TQIIHCDIKP+NILMD +  AKI+DFGLAK +  +QTRTYT +RGT+
Sbjct  412  VARGILYLHEECETQIIHCDIKPENILMDEKGCAKIADFGLAKLLMPNQTRTYTGIRGTR  471

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR + +TVKADVYSFGI+L+E+I  R+S+D  + + E VL ++VY+CFEA E+
Sbjct  472  GYVAPEWHRNLPITVKADVYSFGIMLMEIICCRRSLDMDVSENEVVLVDYVYDCFEAREL  531

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLS  168
             K+V +EEV+  +++RMV++ LWCIQ+EPS+RP MKKV+LM+EGTVDIP PP   SF S
Sbjct  532  DKLVRDEEVDGMKLQRMVKVGLWCIQDEPSVRPLMKKVVLMMEGTVDIPAPPR-ASFAS  589



>ref|XP_007019455.1| Receptor protein kinase 1 [Theobroma cacao]
 gb|EOY16680.1| Receptor protein kinase 1 [Theobroma cacao]
Length=884

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+ YLHEEC+TQIIHCDIKP+NILMD++  AKI+DFGLAK +  +QT+TYT +RGT+
Sbjct  704  IARGIFYLHEECETQIIHCDIKPENILMDDKGSAKIADFGLAKLLMPNQTKTYTGIRGTR  763

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR + +TVKADVYS+GI+L E+I  R+SV+  + ++EAVL  WVY+CF+A E+
Sbjct  764  GYVAPEWHRNLPITVKADVYSYGIMLFEIICCRRSVEADVPEDEAVLAHWVYDCFKANEL  823

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLS  168
             K+V  EEVE  ++ RMV++ LWC Q+EPS RPSMKKV+LMLEGTV+IP PP  +SF+S
Sbjct  824  EKLVPNEEVEMSKLGRMVKVGLWCTQDEPSSRPSMKKVILMLEGTVNIPDPPLLSSFVS  882


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 60/79 (76%), Gaps = 5/79 (6%)
 Frame = -2

Query  401  DEEAVLEEWVYNCFEAGevskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLM  222
            ++EAVL    Y+CF   E+ K+V  EEVEK  +E+MV + LWCIQ++PS+RPSMKKV+LM
Sbjct  5    EDEAVL----YDCFIGKELEKLVKNEEVEKNMLEKMVEVGLWCIQDDPSMRPSMKKVILM  60

Query  221  LEGTVDIPVPP-SPTSFLS  168
            LE TVD+P PP  P+SF+ 
Sbjct  61   LEQTVDVPGPPCRPSSFIG  79



>ref|XP_007019453.1| Uncharacterized protein TCM_035508 [Theobroma cacao]
 gb|EOY16678.1| Uncharacterized protein TCM_035508 [Theobroma cacao]
Length=597

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+ YLHEEC+ +IIHCDIKP+N LMD++  AKI+DFGLAK +  +Q++TYT +RGT+
Sbjct  405  IARGIFYLHEECEIRIIHCDIKPENKLMDDKGYAKIADFGLAKLLMPNQSKTYTGIRGTR  464

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR + +TVKADVYSFGI+L E+I  R++V+  + D EAVL  WVY+C +A E+
Sbjct  465  GYVAPEWHRNLPITVKADVYSFGIMLFEIICCRRNVEADVPDNEAVLVNWVYDCLKANEL  524

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLS  168
             K++ E+EVEK ++ER+V++ LWC Q+EPS RPSMKKV+LMLEGTV++P PP PTSFL+
Sbjct  525  EKLLQEDEVEKEKLERVVKVGLWCTQDEPSSRPSMKKVILMLEGTVNVPDPPCPTSFLA  583



>ref|XP_002264274.2| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Vitis vinifera]
Length=815

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 150/179 (84%), Gaps = 1/179 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARG+LYLHEEC+TQIIHCDIKP+NILMD +  AKI+DFGLAK +  +QTRTYT +RGT+
Sbjct  630  VARGILYLHEECETQIIHCDIKPENILMDEKGCAKIADFGLAKLLMPNQTRTYTGIRGTR  689

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR + +TVKADVYSFGI+L+E+I  R+S+D  + + E VL ++VY+CFEA E+
Sbjct  690  GYVAPEWHRNLPITVKADVYSFGIMLMEIICCRRSLDMDVSENEVVLVDYVYDCFEAREL  749

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLS  168
             K+V +EEV+  +++RMV++ LWCIQ+EPS+RP MKKV+LM+EGTVDIP PP   SF S
Sbjct  750  DKLVRDEEVDGMKLQRMVKVGLWCIQDEPSVRPLMKKVVLMMEGTVDIPAPPR-ASFAS  807



>ref|XP_010093826.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Morus notabilis]
 gb|EXB54677.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Morus notabilis]
Length=308

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 143/177 (81%), Gaps = 1/177 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARG+LYLHEEC T IIHCDIKPQNILMD+ + AKISDFGLAK +  DQTRT+T +RGT+
Sbjct  129  VARGILYLHEECKTPIIHCDIKPQNILMDDFWTAKISDFGLAKFLMPDQTRTFTGIRGTR  188

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCD-EEAVLEEWVYNCFEAGe  348
            GY+APEW + + ++VKADVYS+GI+LLE++  R+S+D ++ D +E VL  WVY CF + E
Sbjct  189  GYLAPEWQKNVPISVKADVYSYGIMLLEIVCCRRSLDVNVSDADEIVLANWVYKCFVSRE  248

Query  347  vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            ++K+V  EE +K+ +E MV++ LWCIQ+EP+LRPSMK V+ MLEG  D+ +PP PTS
Sbjct  249  LNKLVAGEEADKKTLENMVKVGLWCIQDEPALRPSMKSVVFMLEGIKDVSIPPCPTS  305



>ref|XP_010030364.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Eucalyptus grandis]
Length=771

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 145/176 (82%), Gaps = 1/176 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLHEEC+TQIIHCDIKPQNILMD    AKISDFGLAK +  DQTRT+T +RGT+
Sbjct  592  IARGVLYLHEECETQIIHCDIKPQNILMDKN-RAKISDFGLAKLLNADQTRTFTGIRGTR  650

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR   VTVKADVYSFGI+LLE+I  R+S++    + E +LEEWV  CF  GE+
Sbjct  651  GYVAPEWHRNQPVTVKADVYSFGIMLLEIICCRRSMELDFPEREGILEEWVCECFWNGEI  710

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
             K+ G+E+V++ +++  ++I+LWCI ++P+LRP+MK+VLLM+EG+ +IP+PP P+S
Sbjct  711  GKLTGDEKVDEDELKAAIKIALWCISDDPTLRPTMKRVLLMIEGSAEIPMPPIPSS  766



>ref|XP_010247281.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nelumbo nucifera]
Length=263

 Score =   209 bits (531),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 139/180 (77%), Gaps = 3/180 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLHEEC+T IIHCDIKPQNILMD  + AKISDFGLAK +  +QTR++T VRGT 
Sbjct  83   IARGILYLHEECETHIIHCDIKPQNILMDEFWTAKISDFGLAKLLMPNQTRSFTRVRGTG  142

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSL-CDEEAVLEEWVYNCFEAGe  348
            GY+APEW   + +TVKADVYSFG+VLLE+I RR +++ ++   +E +L  WVY CF A E
Sbjct  143  GYLAPEWQNNILITVKADVYSFGVVLLEIICRRSNMEVNVSTTDEIILSSWVYKCFVAKE  202

Query  347  --vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSF  174
                    +EEV+  ++E+MV+++LWCIQ+EP+LRPSMK V+LMLEGTVD P PP   SF
Sbjct  203  LDKLVDDDDEEVDMNKLEKMVKVALWCIQDEPALRPSMKNVILMLEGTVDTPTPPPSLSF  262



>ref|XP_006427830.1| hypothetical protein CICLE_v10027387mg, partial [Citrus clementina]
 gb|ESR41070.1| hypothetical protein CICLE_v10027387mg, partial [Citrus clementina]
Length=519

 Score =   216 bits (549),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = -2

Query  659  IIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTKGYVAPEWHRKMAVTV  480
            IIHCDIKPQNILMD    AKISDFGLAK MK DQTRT+T +RGT+GYVAPEW R + +T 
Sbjct  354  IIHCDIKPQNILMDENRYAKISDFGLAKLMKPDQTRTFTGIRGTRGYVAPEWPRNLPITA  413

Query  479  KADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGevskvvgeeevekrqve  300
            KADVYSFG+VLLE+I  R+ +D +L +++ +LEEWVY CFE G + +++ +E+V+K+Q+E
Sbjct  414  KADVYSFGVVLLEIICCRRCLDQNLPEDQVILEEWVYQCFENGNLGQLIEDEDVDKKQLE  473

Query  299  rmvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSVV  162
            RM++++LWCI +EPSLRPSMKKVLLMLEGT+DIP+PP+PTS L+ +
Sbjct  474  RMIKVALWCILDEPSLRPSMKKVLLMLEGTMDIPIPPNPTSLLTTI  519



>emb|CBI37577.3| unnamed protein product [Vitis vinifera]
Length=653

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 147/183 (80%), Gaps = 2/183 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARG+LYLHEEC+TQI+HCDIKPQNILMD    AKIS FGLAK +K  QT T   +RGTK
Sbjct  471  VARGILYLHEECETQIMHCDIKPQNILMDEYGGAKISSFGLAKRLKHGQTSTLAEIRGTK  530

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GY+APEW R   VTVK DVYSFGI+LL++I  RK+ D SL DEE  L EWV +CFEAGE+
Sbjct  531  GYIAPEWFRNQPVTVKVDVYSFGIMLLQIICCRKNFDLSLPDEEIGLNEWVSHCFEAGEL  590

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGT-VDIPVPPS-PTSFL  171
             K+V +EEV+KR++ERMV++ LWCIQ+EP  RPS+KKVLLMLEG+ +DIPVPPS  T++ 
Sbjct  591  GKLVDDEEVDKRELERMVKVGLWCIQDEPLFRPSIKKVLLMLEGSIIDIPVPPSTSTTYF  650

Query  170  SVV  162
            S V
Sbjct  651  SAV  653



>ref|XP_004142231.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Cucumis sativus]
Length=812

 Score =   219 bits (558),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 142/185 (77%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGL YLHEEC TQIIHCDIKPQNIL+D+++ AKISDFGLAK +K+DQTRT T +RGTK
Sbjct  627  IARGLSYLHEECSTQIIHCDIKPQNILLDDRYGAKISDFGLAKLLKKDQTRTTTAIRGTK  686

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDE-EAVLEEWVYNCFEAGe  348
            GYVAPEW R + +TVK DVYSFGI+LLE+I  RK+ +    DE E +L +W Y+C   G+
Sbjct  687  GYVAPEWFRSLPITVKVDVYSFGIMLLEMICCRKNFEMETEDEDERILSDWAYDCMNEGK  746

Query  347  vsk---vvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            + K      E   + ++VER V+I +WCIQEEPSLRPSMKKV+ MLEG V++  PP P+S
Sbjct  747  MEKLIREDEEGRSDMKRVERFVKIGIWCIQEEPSLRPSMKKVIQMLEGVVEVSTPPDPSS  806

Query  176  FLSVV  162
            F+S +
Sbjct  807  FISAI  811



>ref|XP_010112633.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Morus notabilis]
 gb|EXC34488.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Morus notabilis]
Length=792

 Score =   218 bits (555),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 143/183 (78%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGL YLHEEC TQIIHCDIKPQNIL+D  F A+ISDFGLAK +K DQTRT T +RGTK
Sbjct  609  IARGLFYLHEECSTQIIHCDIKPQNILLDENFTARISDFGLAKILKMDQTRTATGIRGTK  668

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDE-EAVLEEWVYNCFEAGe  348
            GYVAPEW + + +TVK DVYS+GI+LLELI  RKS +    DE + VL +W Y+C++ G+
Sbjct  669  GYVAPEWFKNVPITVKVDVYSYGILLLELICCRKSFEADAKDESKMVLADWAYDCYKDGK  728

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               + +  GE   + + VE+ V +S+WCIQE+PS+RP+MKKV+ MLEG++++P+PP+P+S
Sbjct  729  LYILMENDGEAMSDMKMVEKYVMVSIWCIQEDPSIRPTMKKVIQMLEGSIEVPIPPNPSS  788

Query  176  FLS  168
             LS
Sbjct  789  ILS  791



>ref|XP_002275592.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Vitis vinifera]
Length=772

 Score =   218 bits (554),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 147/183 (80%), Gaps = 2/183 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARG+LYLHEEC+TQI+HCDIKPQNILMD    AKIS FGLAK +K  QT T   +RGTK
Sbjct  590  VARGILYLHEECETQIMHCDIKPQNILMDEYGGAKISSFGLAKRLKHGQTSTLAEIRGTK  649

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GY+APEW R   VTVK DVYSFGI+LL++I  RK+ D SL DEE  L EWV +CFEAGE+
Sbjct  650  GYIAPEWFRNQPVTVKVDVYSFGIMLLQIICCRKNFDLSLPDEEIGLNEWVSHCFEAGEL  709

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGT-VDIPVPPS-PTSFL  171
             K+V +EEV+KR++ERMV++ LWCIQ+EP  RPS+KKVLLMLEG+ +DIPVPPS  T++ 
Sbjct  710  GKLVDDEEVDKRELERMVKVGLWCIQDEPLFRPSIKKVLLMLEGSIIDIPVPPSTSTTYF  769

Query  170  SVV  162
            S V
Sbjct  770  SAV  772



>ref|XP_008243606.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Prunus mume]
Length=827

 Score =   218 bits (554),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 139/181 (77%), Gaps = 4/181 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC TQIIHCDIKPQNIL+D+ + A+ISDFGLAK +  DQ++T+T +RGTK
Sbjct  634  VARGLLYLHEECSTQIIHCDIKPQNILLDDYYTARISDFGLAKLLMMDQSKTHTAIRGTK  693

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDW-SLCDEEAVLEEWVYNCFEAGe  348
            GYVAPEW R M +T K DVYSFG+VLLE+I  R+SVD  + C+E+A+L +WVY+CF  G 
Sbjct  694  GYVAPEWFRNMPITTKVDVYSFGVVLLEIICCRRSVDAENDCEEKAILTDWVYDCFLEGA  753

Query  347  vsk---vvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +        +   +K  +E  V +++WCIQE+PSLRP+M+KV+ MLEG V++ VPP P+ 
Sbjct  754  LDAIVDYEVQALGDKTTLENFVMVAIWCIQEDPSLRPNMRKVVQMLEGVVEVQVPPCPSP  813

Query  176  F  174
            F
Sbjct  814  F  814



>ref|XP_009802537.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nicotiana sylvestris]
Length=806

 Score =   217 bits (552),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 137/180 (76%), Gaps = 3/180 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLH EC TQIIHCDIKPQNIL+DNQ+  +ISDFGLAK ++ DQ+ T T +RGTK
Sbjct  617  IARGLLYLHNECSTQIIHCDIKPQNILLDNQYDPRISDFGLAKLLRMDQSETQTAIRGTK  676

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEW R MA+TVKADVYSFG++LLE+I  R++VD    +++A+L  W Y+C++ G +
Sbjct  677  GYVAPEWFRNMAITVKADVYSFGVLLLEIICCRRNVDIEAGEDKAILTYWAYDCYQEGTI  736

Query  344  skvvgeeevekrqvermv---RISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSF  174
             ++V  +       +++     +++WCIQE+PSLRP+MKK++LMLE  V++P PP P  F
Sbjct  737  YQLVENDSDAISDRKKLERFLMVAIWCIQEDPSLRPTMKKIVLMLEEIVEVPSPPCPNPF  796



>ref|XP_006854572.1| hypothetical protein AMTR_s00030p00110280 [Amborella trichopoda]
 gb|ERN16039.1| hypothetical protein AMTR_s00030p00110280 [Amborella trichopoda]
Length=777

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC+TQIIHCDIKPQNIL+D + + KISDFGLAK M  DQTRT T++RGT+
Sbjct  600  IARGLLYLHEECETQIIHCDIKPQNILLDEKKMPKISDFGLAKLMGPDQTRTMTVLRGTR  659

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GY APEWH+ M +T K DVYS+GI+LLE+I  RK ++  + DEE +L +WV +CFE GE+
Sbjct  660  GYWAPEWHKNMPITAKVDVYSYGIMLLEIICCRKRLEIGVADEEILLSDWVNDCFERGEL  719

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPT  180
             K+V EEEVE+ ++ER+V + LWC+Q+ P++RPSM+KV+ MLEG V+IP PP+P+
Sbjct  720  EKLVREEEVEQCELERLVMVGLWCMQDNPNMRPSMRKVVSMLEGLVEIPRPPNPS  774



>ref|XP_006354210.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Solanum tuberosum]
Length=619

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 144/182 (79%), Gaps = 3/182 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLH+EC TQIIHCDIKPQNIL+D+QF  +ISDFGLAK ++ DQ+ T T +RGTK
Sbjct  430  IARGLLYLHDECITQIIHCDIKPQNILLDDQFEPRISDFGLAKLLRMDQSETQTAIRGTK  489

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEW R M +T+K DVYSFG++LLE+I  R++VD+ + +++A+L  WVY+C++ G +
Sbjct  490  GYVAPEWFRNMPITLKVDVYSFGVLLLEIICCRRNVDYEVGEDKAILTYWVYDCYQEGTI  549

Query  344  skvvge---eevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSF  174
             +++        +++++E+ + +++WCIQE+PSLRP+MKKV+LMLE  V++P PP P  +
Sbjct  550  YELIENDLDAMSDRKKLEKFIMVAIWCIQEDPSLRPTMKKVVLMLEEIVEVPNPPCPNPY  609

Query  173  LS  168
             S
Sbjct  610  RS  611



>ref|XP_006854581.1| hypothetical protein AMTR_s00030p00115530 [Amborella trichopoda]
 gb|ERN16048.1| hypothetical protein AMTR_s00030p00115530 [Amborella trichopoda]
Length=773

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 143/171 (84%), Gaps = 3/171 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC TQIIHCDIKPQNIL+D+   AKISDFGLAK +K +QTRTYT VRGT+
Sbjct  590  IARGLLYLHEECVTQIIHCDIKPQNILLDDFQTAKISDFGLAKILKPEQTRTYTGVRGTR  649

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAG--  351
            GYVAPEW++  ++TVKADVYSFGI+L+E+I  RK+++    ++E VL +WVYNCFEAG  
Sbjct  650  GYVAPEWYKNQSITVKADVYSFGIMLVEIICCRKAIESGAPEDEVVLIDWVYNCFEAGEL  709

Query  350  -evskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDI  201
             ++ +V   E VE +++ERMV + LWC+Q++P+LRPSMKKV+LMLEGTVDI
Sbjct  710  EKLERVAETEGVENKRLERMVMVGLWCVQDDPALRPSMKKVVLMLEGTVDI  760



>ref|XP_008243607.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Prunus mume]
Length=802

 Score =   215 bits (548),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 137/178 (77%), Gaps = 1/178 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +A+GLLYLHEEC TQ+IHCDIKPQNIL+D+ + A+ISDFGLAK +  +Q+ T+T +RGTK
Sbjct  621  VAKGLLYLHEECSTQVIHCDIKPQNILLDDYYTARISDFGLAKLLMMNQSHTHTAIRGTK  680

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVD-WSLCDEEAVLEEWVYNCFEAGe  348
            GYVAPEW R M +T K DVYSFG+VLLE+I  R+SVD  + C+E A+L +WVY+C+  G 
Sbjct  681  GYVAPEWFRNMPITAKVDVYSFGVVLLEIICCRRSVDVENSCEERAILTDWVYDCYREGI  740

Query  347  vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSF  174
            +  V+  E       +++V I +WCIQE+PSLRP+M+KV+ MLEG V++ VPP P+ +
Sbjct  741  LDAVLDYEVEALDDRKKLVMIGIWCIQEDPSLRPTMRKVVQMLEGVVEVHVPPCPSPY  798



>gb|KCW54271.1| hypothetical protein EUGRSUZ_I00234 [Eucalyptus grandis]
Length=762

 Score =   215 bits (547),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 144/176 (82%), Gaps = 1/176 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLHEEC+TQIIHCDIKPQNILM  +  AKISDFGLAK + +DQTRT+T +RGT+
Sbjct  576  IARGVLYLHEECETQIIHCDIKPQNILM-GENRAKISDFGLAKLLNEDQTRTFTGIRGTR  634

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR   VTVKADVYSFGI+LLE+I  RKS++    + EA+LEEWV  CF  GE+
Sbjct  635  GYVAPEWHRNQPVTVKADVYSFGIMLLEIICCRKSLELEFPEREAILEEWVCECFWNGEI  694

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
             K+ G+E+V++ +++  ++++LWC+ ++P LRP+MK+VLLMLEG+  I +PP P+S
Sbjct  695  EKLTGDEKVDEDELKAAIKVALWCVSDDPLLRPTMKRVLLMLEGSAQILMPPIPSS  750



>ref|XP_004162099.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Cucumis sativus]
Length=859

 Score =   215 bits (548),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 142/185 (77%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGL YLHEEC TQIIHCDIKPQNIL+D+ + AKI+DFGLAK +K+DQTRT T +RGT+
Sbjct  673  IARGLSYLHEECSTQIIHCDIKPQNILLDDSYGAKIADFGLAKLLKKDQTRTMTAIRGTR  732

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDE-EAVLEEWVYNCFEAGe  348
            GYVAPEW R + +TVK DVYSFGI+LLE+I  RK+ +    +E E +L +WVY+C    +
Sbjct  733  GYVAPEWFRSLPITVKVDVYSFGILLLEMICCRKNFEMETENEDEMILSDWVYDCMNERK  792

Query  347  vskvvg---eeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +  ++    E   + ++VER V+I +WCIQEEPSLRPSMKKV+ MLEG VD+  PP P+S
Sbjct  793  METLMREDEEGRSDMKRVERFVKIGIWCIQEEPSLRPSMKKVVQMLEGAVDVSTPPDPSS  852

Query  176  FLSVV  162
            F+S +
Sbjct  853  FISAI  857



>ref|XP_009388136.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1, partial [Musa acuminata subsp. malaccensis]
Length=350

 Score =   206 bits (525),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 140/185 (76%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGL YLHEEC +Q+IHCDIKPQNIL+D+ F A+ISDFGLAK ++ DQTRT T +RGTK
Sbjct  165  IARGLQYLHEECFSQVIHCDIKPQNILLDDNFTARISDFGLAKLLRIDQTRTKTNIRGTK  224

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVD-WSLCDEEAVLEEWVYNCFEAGe  348
            GYVAPEW R   +T K DVYSFG+VLLE+I  R++V   +  DEE++L  WV +CF  G 
Sbjct  225  GYVAPEWFRNTGITTKVDVYSFGVVLLEIICFRRNVRPEAQNDEESILAYWVNDCFRDGR  284

Query  347  vskvvg---eeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +  VV    +   + ++VER V+++LWCIQE+PSLRP+M+KV  ML+G+  +P PP P+S
Sbjct  285  LDLVVEGDDQAIYDMKRVERFVKVALWCIQEDPSLRPTMQKVTQMLDGSTAVPGPPDPSS  344

Query  176  FLSVV  162
            ++S +
Sbjct  345  YISSI  349



>ref|XP_010030366.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Eucalyptus grandis]
Length=777

 Score =   215 bits (547),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 144/176 (82%), Gaps = 1/176 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLHEEC+TQIIHCDIKPQNILM  +  AKISDFGLAK + +DQTRT+T +RGT+
Sbjct  591  IARGVLYLHEECETQIIHCDIKPQNILM-GENRAKISDFGLAKLLNEDQTRTFTGIRGTR  649

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR   VTVKADVYSFGI+LLE+I  RKS++    + EA+LEEWV  CF  GE+
Sbjct  650  GYVAPEWHRNQPVTVKADVYSFGIMLLEIICCRKSLELEFPEREAILEEWVCECFWNGEI  709

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
             K+ G+E+V++ +++  ++++LWC+ ++P LRP+MK+VLLMLEG+  I +PP P+S
Sbjct  710  EKLTGDEKVDEDELKAAIKVALWCVSDDPLLRPTMKRVLLMLEGSAQILMPPIPSS  765



>ref|XP_004142232.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Cucumis sativus]
Length=794

 Score =   214 bits (546),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 143/186 (77%), Gaps = 6/186 (3%)
 Frame = -2

Query  701  ARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTKG  522
            ARGL YLHEEC TQIIHCDIKPQNIL+D    A+ISDFGLAK +K++QTRT T +RGTKG
Sbjct  608  ARGLCYLHEECKTQIIHCDIKPQNILLDESLRARISDFGLAKLLKENQTRTTTAIRGTKG  667

Query  521  YVAPEWHR-KMAVTVKADVYSFGIVLLELISRRKSVDWSLCDE-EAVLEEWVYNCFEAGe  348
            YVAPEW R  + +TVK DVYSFGIVLLE+IS R+S +  + DE E VL +W Y+CF+   
Sbjct  668  YVAPEWFRSNLPITVKVDVYSFGIVLLEIISCRRSFELEVEDENEMVLADWAYDCFKERR  727

Query  347  vskvvge----eevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPT  180
            V  +V +     + + + VE++V I++WCIQEEPSLRPSMKKVL MLEG V++ +PP P+
Sbjct  728  VDMLVRKDDDEAKGDMKTVEKLVMIAIWCIQEEPSLRPSMKKVLQMLEGVVEVSIPPDPS  787

Query  179  SFLSVV  162
            SF+S +
Sbjct  788  SFISTI  793



>gb|KGN54146.1| hypothetical protein Csa_4G289640 [Cucumis sativus]
Length=807

 Score =   214 bits (546),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 143/186 (77%), Gaps = 6/186 (3%)
 Frame = -2

Query  701  ARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTKG  522
            ARGL YLHEEC TQIIHCDIKPQNIL+D    A+ISDFGLAK +K++QTRT T +RGTKG
Sbjct  621  ARGLCYLHEECKTQIIHCDIKPQNILLDESLRARISDFGLAKLLKENQTRTTTAIRGTKG  680

Query  521  YVAPEWHR-KMAVTVKADVYSFGIVLLELISRRKSVDWSLCDE-EAVLEEWVYNCFEAGe  348
            YVAPEW R  + +TVK DVYSFGIVLLE+IS R+S +  + DE E VL +W Y+CF+   
Sbjct  681  YVAPEWFRSNLPITVKVDVYSFGIVLLEIISCRRSFELEVEDENEMVLADWAYDCFKERR  740

Query  347  vskvvge----eevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPT  180
            V  +V +     + + + VE++V I++WCIQEEPSLRPSMKKVL MLEG V++ +PP P+
Sbjct  741  VDMLVRKDDDEAKGDMKTVEKLVMIAIWCIQEEPSLRPSMKKVLQMLEGVVEVSIPPDPS  800

Query  179  SFLSVV  162
            SF+S +
Sbjct  801  SFISTI  806



>ref|XP_004162098.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Cucumis sativus]
Length=806

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 141/185 (76%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGL YLHEEC TQ+IHCDIKPQNIL+D ++ AKISDFGLAK +K+DQTRT T +RGTK
Sbjct  620  IARGLSYLHEECSTQVIHCDIKPQNILLDERYGAKISDFGLAKLLKKDQTRTTTAIRGTK  679

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDE-EAVLEEWVYNCFEAGe  348
            GYVAPEW R + +TVK DVYSFGI+LLE+I  RK+ +    DE E +L +W Y+C   G+
Sbjct  680  GYVAPEWFRSLPITVKVDVYSFGIMLLEMICCRKNFEIETEDEDERILSDWAYDCMNEGK  739

Query  347  vsk---vvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            + K      E   + ++VER V+I +WCIQE+PSLRPSMKKV+ +LEG V++  PP P+S
Sbjct  740  MEKLIREDEEARSDMKRVERFVKIGIWCIQEDPSLRPSMKKVIQLLEGAVEVSTPPDPSS  799

Query  176  FLSVV  162
            F++ +
Sbjct  800  FINTI  804



>ref|XP_004142230.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Cucumis sativus]
Length=806

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 141/185 (76%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGL YLHEEC TQ+IHCDIKPQNIL+D ++ AKISDFGLAK +K+DQTRT T +RGTK
Sbjct  620  IARGLSYLHEECSTQVIHCDIKPQNILLDERYGAKISDFGLAKLLKKDQTRTTTAIRGTK  679

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDE-EAVLEEWVYNCFEAGe  348
            GYVAPEW R + +TVK DVYSFGI+LLE+I  RK+ +    DE E +L +W Y+C   G+
Sbjct  680  GYVAPEWFRSLPITVKVDVYSFGIMLLEMICCRKNFEIETEDEDERILSDWAYDCMNEGK  739

Query  347  vsk---vvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            + K      E   + ++VER V+I +WCIQE+PSLRPSMKKV+ +LEG V++  PP P+S
Sbjct  740  MEKLIREDEEARSDMKRVERFVKIGIWCIQEDPSLRPSMKKVIQLLEGAVEVSTPPDPSS  799

Query  176  FLSVV  162
            F++ +
Sbjct  800  FINTI  804



>gb|KDP25140.1| hypothetical protein JCGZ_22675 [Jatropha curcas]
Length=807

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 142/185 (77%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGL YLHEEC TQIIHCDIKPQNIL+D+ F A+ISDFG+AK +  DQTRT T +RGT+
Sbjct  620  IARGLFYLHEECSTQIIHCDIKPQNILLDDSFTARISDFGIAKLLMTDQTRTTTAIRGTR  679

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDE-EAVLEEWVYNCFEAGe  348
            GYVAPEW + + VT K DVYSFGI+LLEL   RK+ +  + DE + VL +W Y+C++ GE
Sbjct  680  GYVAPEWFKNLPVTAKFDVYSFGILLLELTCCRKNFEAEVEDENQMVLADWAYDCYKGGE  739

Query  347  vs---kvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +    +   E + + ++VE+ V I++WCIQE+PSLRP+MKKV  MLEGTV++ VPP P+S
Sbjct  740  LYLLIQNDEEAKQDIKRVEKFVMIAIWCIQEDPSLRPAMKKVTQMLEGTVEVSVPPDPSS  799

Query  176  FLSVV  162
            F+S +
Sbjct  800  FMSSI  804



>ref|XP_011037898.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 isoform X1 [Populus euphratica]
Length=797

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 139/180 (77%), Gaps = 3/180 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLH+EC TQIIHCDIKPQNIL+D  + A+I+DFGLAK +  DQ++T+T +RGTK
Sbjct  614  IARGLLYLHDECSTQIIHCDIKPQNILLDEHYDARIADFGLAKLLSLDQSQTFTAIRGTK  673

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEW R   +TVK DVYSFG++LLE+I  R+SVD  + +E A+L +W Y+C++ G +
Sbjct  674  GYVAPEWFRNKLITVKVDVYSFGVLLLEIICCRRSVDTEVVEERAILTDWAYDCYQQGMM  733

Query  344  skvvge---eevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSF  174
              +V        + +++ER V +++WCIQE+P+LRP+MK V+LMLEG + +PVPP P+ F
Sbjct  734  HALVENDEEALNDMKKLERFVMVAIWCIQEDPNLRPTMKMVMLMLEGIIQVPVPPCPSPF  793



>ref|XP_011037899.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 isoform X2 [Populus euphratica]
Length=785

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 139/180 (77%), Gaps = 3/180 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLH+EC TQIIHCDIKPQNIL+D  + A+I+DFGLAK +  DQ++T+T +RGTK
Sbjct  602  IARGLLYLHDECSTQIIHCDIKPQNILLDEHYDARIADFGLAKLLSLDQSQTFTAIRGTK  661

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEW R   +TVK DVYSFG++LLE+I  R+SVD  + +E A+L +W Y+C++ G +
Sbjct  662  GYVAPEWFRNKLITVKVDVYSFGVLLLEIICCRRSVDTEVVEERAILTDWAYDCYQQGMM  721

Query  344  skvvge---eevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSF  174
              +V        + +++ER V +++WCIQE+P+LRP+MK V+LMLEG + +PVPP P+ F
Sbjct  722  HALVENDEEALNDMKKLERFVMVAIWCIQEDPNLRPTMKMVMLMLEGIIQVPVPPCPSPF  781



>ref|XP_008243691.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Prunus mume]
Length=783

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 145/177 (82%), Gaps = 1/177 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTI-VRGT  528
            +A+G+LYLHEEC+TQIIHCDIKP+NIL   +  AK+SDFGLAK +K +QT T+T   RGT
Sbjct  591  VAQGILYLHEECETQIIHCDIKPENILTSERKCAKLSDFGLAKLLKSEQTGTHTTGFRGT  650

Query  527  KGYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGe  348
            +GYVAPEW R M +TVKADVYSFG+VLLE+I  R+SV   + +++ VLE WVY+C EA E
Sbjct  651  RGYVAPEWLRNMPITVKADVYSFGVVLLEIICCRRSVYMDIPEDQVVLENWVYHCLEADE  710

Query  347  vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            + K+V +EEV+K ++ RM++I LWCIQ EPSLRPSMKKV+LMLEGTV+IP PP+P S
Sbjct  711  LHKLVQDEEVDKTKLGRMIKIGLWCIQYEPSLRPSMKKVVLMLEGTVEIPAPPNPDS  767



>ref|XP_010265966.1| PREDICTED: LOW QUALITY PROTEIN: G-type lectin S-receptor-like 
serine/threonine-protein kinase RLK1 [Nelumbo nucifera]
Length=787

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 141/184 (77%), Gaps = 4/184 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGL+YLHEEC TQIIHCDIKPQNIL+D+ + A+ISDFGLAK M  +Q+RT T +RGTK
Sbjct  603  IARGLMYLHEECSTQIIHCDIKPQNILLDDYYTARISDFGLAKLMMTNQSRTRTTIRGTK  662

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSL-CDEEAVLEEWVYNCFEAG-  351
            GYVAPEW R M +TVK DVYS+G++LLE+I  RKSV+  +  +EEA+L +W Y+C++ G 
Sbjct  663  GYVAPEWFRSMXITVKVDVYSYGVMLLEIICCRKSVELEMGSEEEAILTDWAYDCYQHGR  722

Query  350  --evskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               + +   +   +  ++ER+V++++WCIQEEPSLRP+MKKV  MLEG +++ +PP P  
Sbjct  723  LDALVENDTDAMNDMIRLERLVKVAIWCIQEEPSLRPTMKKVTQMLEGIIEVSIPPCPFP  782

Query  176  FLSV  165
            F S 
Sbjct  783  FSSA  786



>ref|XP_006386080.1| hypothetical protein POPTR_0003s21920g [Populus trichocarpa]
 gb|ERP63877.1| hypothetical protein POPTR_0003s21920g [Populus trichocarpa]
Length=417

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 134/180 (74%), Gaps = 3/180 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC TQIIHCDIKPQNIL+D+ + A+ISDFGLAK +  +Q++T T +RGTK
Sbjct  232  IARGLLYLHEECSTQIIHCDIKPQNILIDDYYNARISDFGLAKLLAINQSQTKTAIRGTK  291

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEW R   VTVK DVYSFG++LLE+I  R+SVD  +    A+L +W Y+C+  G +
Sbjct  292  GYVAPEWFRNTPVTVKVDVYSFGVLLLEIICCRRSVDLEISGTGAILIDWAYDCYRHGTL  351

Query  344  skvv---geeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSF  174
              ++    E   +   +ER +++++WCIQE PSLRP+M+KV  MLEG V++P PP+P  F
Sbjct  352  DALIEDDMEAMNDVSTLERAMKVAIWCIQEVPSLRPTMRKVTQMLEGVVEVPAPPNPFPF  411



>ref|XP_006494278.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Citrus sinensis]
 gb|KDO56495.1| hypothetical protein CISIN_1g003759mg [Citrus sinensis]
Length=797

 Score =   213 bits (542),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 142/185 (77%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGL YLHEEC TQIIHCDIKPQNIL+D+ F A+ISDFGLAK +K DQTRT T +RGT+
Sbjct  613  IARGLFYLHEECTTQIIHCDIKPQNILLDDSFTARISDFGLAKILKADQTRTTTAIRGTR  672

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDE-EAVLEEWVYNCF---E  357
            GYVAPEW + + +T+K D+YSFG++LLELI  RK  + ++ +E + +L +W Y+C+   +
Sbjct  673  GYVAPEWFKSLPITMKVDIYSFGVMLLELICCRKKFEQNVENENQMILVDWAYDCYIDEK  732

Query  356  AGevskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               + +   E   +  ++++ V I++WCIQE+PSLRP+MKKV LMLEG V++P+PP P+S
Sbjct  733  LHLLVENDEEALHDMMRLKKYVMIAIWCIQEDPSLRPTMKKVTLMLEGVVEVPIPPDPSS  792

Query  176  FLSVV  162
            F+S +
Sbjct  793  FISSI  797



>ref|XP_004142234.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Cucumis sativus]
Length=768

 Score =   213 bits (541),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 139/183 (76%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGL YLHEEC TQ IHCDIKP NIL+D+ F A+I+DFGLAK +K+DQTRT T +RGTK
Sbjct  581  IARGLCYLHEECSTQTIHCDIKPHNILLDDSFTARIADFGLAKLLKKDQTRTLTAIRGTK  640

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEA-VLEEWVYNCF---E  357
            GYVAPEW R + +TVK DVYSFGI++LE+I  R+S +  + DEE  VL +W Y+CF   +
Sbjct  641  GYVAPEWFRSLPITVKVDVYSFGIIMLEIICCRRSYEKKVEDEEQMVLTDWAYDCFKDMK  700

Query  356  AGevskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               + +   E +++ ++V++ V I++WCIQEEPSLRP+MKKVL MLEG +++  PP P S
Sbjct  701  VEMLVENDEEAKMDLKRVKKFVMIAIWCIQEEPSLRPTMKKVLQMLEGAIEVSFPPDPCS  760

Query  176  FLS  168
            F S
Sbjct  761  FTS  763



>ref|XP_002533013.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29367.1| conserved hypothetical protein [Ricinus communis]
Length=1031

 Score =   214 bits (545),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARG+ YLHEEC T IIHCDIKP+NILMD +  AKI+DFGL+K +  +Q++TYT VRGT+
Sbjct  581  VARGIFYLHEECSTPIIHCDIKPENILMDEKEGAKIADFGLSKLLMPNQSKTYTGVRGTR  640

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWH  + +TVKADVYS+GI+LLE+I  R++VD S+ D+E VL  WVY+CFEA E+
Sbjct  641  GYVAPEWHTNLPITVKADVYSYGIMLLEIICCRENVDMSVPDDEIVLANWVYDCFEAKEL  700

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDI  201
             K++ +E VE+ + ERMV++ LWCIQ+EPSLRPSMKKVLLMLEGT+DI
Sbjct  701  DKLMQDEVVEEGKFERMVKVGLWCIQDEPSLRPSMKKVLLMLEGTIDI  748



>ref|XP_010030363.1| PREDICTED: LOW QUALITY PROTEIN: G-type lectin S-receptor-like 
serine/threonine-protein kinase RLK1 [Eucalyptus grandis]
Length=787

 Score =   212 bits (540),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 144/176 (82%), Gaps = 1/176 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLHEEC+TQIIHCDIKPQNILMD    AKISDFGLAK +  DQTRT+T +RGT+
Sbjct  608  IARGVLYLHEECETQIIHCDIKPQNILMDEN-RAKISDFGLAKLLNADQTRTFTGIRGTR  666

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEWHR   VTVKADVYSFGI+LLE+I  R++++    + EA+LEEWV  CF  GE+
Sbjct  667  GYVAPEWHRNQPVTVKADVYSFGIMLLEIICCRRNMELDFPEREAILEEWVCKCFWNGEI  726

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
             K+ G+E+V++ +++  ++++LWCI ++ +LRP+MK+VLLM+EG+ +I +PP P+S
Sbjct  727  GKLTGDEKVDEDELKAAIKVALWCILDDLTLRPTMKRVLLMMEGSAEILMPPIPSS  782



>ref|XP_010100590.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Morus notabilis]
 gb|EXB82944.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Morus notabilis]
Length=825

 Score =   212 bits (540),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 141/177 (80%), Gaps = 1/177 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARG+LYLHEEC   IIHCDIKPQNILMD  + AKISDFGLAK +  DQTRT+T++RGT+
Sbjct  648  VARGILYLHEECKVPIIHCDIKPQNILMDEVWSAKISDFGLAKLLMPDQTRTFTVIRGTR  707

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCD-EEAVLEEWVYNCFEAGe  348
            GY+APEWH+   ++VKADVYS+GIVLLE++  R++ D ++ D +E VL  WV  CF A E
Sbjct  708  GYMAPEWHKNTPISVKADVYSYGIVLLEIVCCRRNFDANVSDADEIVLSSWVCKCFAARE  767

Query  347  vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            + K+V  EEV+ + +E +V+++LWCIQ+EP+LRPSMK V+LMLEG  D+ +PP PTS
Sbjct  768  LKKLVNGEEVDNKTLENVVKVALWCIQDEPALRPSMKSVVLMLEGITDVAIPPCPTS  824



>gb|KDO56479.1| hypothetical protein CISIN_1g037780mg, partial [Citrus sinensis]
Length=455

 Score =   206 bits (525),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 139/181 (77%), Gaps = 4/181 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTY-TIVRGT  528
            IARGLLYLHE+C +QIIHCDIKPQNIL+D+ + A+ISDFGLAK +  +Q++T  T +RGT
Sbjct  273  IARGLLYLHEDCSSQIIHCDIKPQNILLDDHYNARISDFGLAKLLTLNQSKTIKTAIRGT  332

Query  527  KGYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGe  348
            KGYVAPEW+RK  +T K DVYSFG++LLE+IS RKS D  + +E A+L +W ++C+  G+
Sbjct  333  KGYVAPEWYRKSTITAKVDVYSFGVLLLEIISCRKSFDIEMGEEYAILTDWAFDCYRNGK  392

Query  347  vskvvgeeevekrqve---rmvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +  +V  +      ++   +++ +S+WCIQE+PSLRP+M+KV  MLEG V++ VPP+P+ 
Sbjct  393  LDDLVEGDMEAMNDIKCVEKLLMVSIWCIQEDPSLRPTMRKVSQMLEGVVEVDVPPNPSP  452

Query  176  F  174
            F
Sbjct  453  F  453



>ref|XP_004168531.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Cucumis sativus]
Length=832

 Score =   212 bits (540),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 139/183 (76%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGL YLHEEC TQ IHCDIKP NIL+D+ F A+I+DFGLAK +K+DQTRT T +RGTK
Sbjct  645  IARGLCYLHEECSTQTIHCDIKPHNILLDDSFTARIADFGLAKLLKKDQTRTLTAIRGTK  704

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEA-VLEEWVYNCF---E  357
            GYVAPEW R + +TVK DVYSFGI++LE+I  R+S +  + DEE  VL +W Y+CF   +
Sbjct  705  GYVAPEWFRSLPITVKVDVYSFGIIMLEIICCRRSYEKKVEDEEQMVLTDWAYDCFKDMK  764

Query  356  AGevskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               + +   E +++ ++V++ V I++WCIQEEPSLRP+MKKVL MLEG +++  PP P S
Sbjct  765  VEMLVENDEEAKMDLKRVKKFVMIAIWCIQEEPSLRPTMKKVLQMLEGAIEVSFPPDPCS  824

Query  176  FLS  168
            F S
Sbjct  825  FTS  827


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -2

Query  287  ISLWCIQEEPSLRPSMKKVLLMLEGTVDI  201
            I++WCIQEEPSLRPSMKKVL M+EG +++
Sbjct  26   IAIWCIQEEPSLRPSMKKVLQMMEGAIEL  54



>ref|XP_006445956.1| hypothetical protein CICLE_v10017743mg [Citrus clementina]
 gb|ESR59196.1| hypothetical protein CICLE_v10017743mg [Citrus clementina]
Length=799

 Score =   212 bits (539),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 142/185 (77%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGL YLHEEC TQIIHCDIKPQNIL+D+ F A+ISDFGLAK +K DQTRT T +RGT+
Sbjct  612  IARGLFYLHEECTTQIIHCDIKPQNILLDDSFTARISDFGLAKILKADQTRTTTAIRGTR  671

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDE-EAVLEEWVYNCF---E  357
            GYVAPEW + + +T+K D+YSFG++LLELI  RK  + ++ +E + +L +W Y+C+   +
Sbjct  672  GYVAPEWFKSLPITMKVDIYSFGVMLLELICCRKKFEQNVENENQMILVDWAYDCYIDEK  731

Query  356  AGevskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               + +   E   +  ++++ V I++WCIQ++PSLRP+MKKV LMLEG V++P+PP P+S
Sbjct  732  LHLLVENDEEALHDMMRLKKYVMIAIWCIQDDPSLRPTMKKVTLMLEGVVEVPIPPDPSS  791

Query  176  FLSVV  162
            F+S +
Sbjct  792  FISSI  796



>ref|XP_004228922.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Solanum lycopersicum]
Length=805

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 142/182 (78%), Gaps = 3/182 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLH+EC TQIIHCDIKPQNIL+D+Q+  +ISDFGL+K ++ DQ+ T T +RGTK
Sbjct  616  IARGLLYLHDECITQIIHCDIKPQNILLDDQYEPRISDFGLSKLLRMDQSETQTAIRGTK  675

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEW R M +T+K DVYSFG++LLE+I  R++VD+ + +++A+L  W Y+C++ G +
Sbjct  676  GYVAPEWFRNMPITLKVDVYSFGVLLLEIICCRRNVDYEVGEDKAILTYWAYDCYQQGTM  735

Query  344  skvvge---eevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSF  174
             ++V        + +++E+ + +++WCIQE+PSLRP+MKKV+LMLE  V++P PP P  +
Sbjct  736  YQLVENDFDAMSDMKKLEKFLMVAIWCIQEDPSLRPTMKKVVLMLEEIVEVPSPPCPNPY  795

Query  173  LS  168
             S
Sbjct  796  RS  797



>ref|XP_006386087.1| hypothetical protein POPTR_0003s21980g, partial [Populus trichocarpa]
 gb|ERP63884.1| hypothetical protein POPTR_0003s21980g, partial [Populus trichocarpa]
Length=200

 Score =   198 bits (503),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 136/185 (74%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC +Q IHCDIKPQNIL+D    A+ISDFG+AK +K DQT+T T +RGTK
Sbjct  16   IARGLLYLHEECSSQTIHCDIKPQNILLDESLNARISDFGIAKLLKTDQTKTTTAIRGTK  75

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDE-EAVLEEWVYNCFEAGe  348
            GYVAPEW + + VT K D YSFGI+LLEL+  RK+ + +   E + VL +W  +C + G+
Sbjct  76   GYVAPEWFKNLPVTTKVDTYSFGILLLELVCCRKNFEINAMQEHQIVLADWACDCLKEGK  135

Query  347  vskvv---geeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            ++ +V    E   + ++VER V +++WCI E+PSLRP MKKV+ MLEG V + +PP P+S
Sbjct  136  LNLLVEEDEEATEDMKRVERFVMVAIWCIHEDPSLRPGMKKVVQMLEGAVQVSIPPDPSS  195

Query  176  FLSVV  162
            F+S +
Sbjct  196  FISTI  200



>ref|XP_010247280.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nelumbo nucifera]
Length=782

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 143/175 (82%), Gaps = 1/175 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLHEEC+T+IIHCDIKPQN+LMD  + AKISDFGLAK +  +QTRT+T  RGT 
Sbjct  601  IARGILYLHEECETRIIHCDIKPQNVLMDEFWTAKISDFGLAKLLMPNQTRTFTGFRGTG  660

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCD-EEAVLEEWVYNCFEAGe  348
            GYVAPEW + + +TVKADVYSFGIVLLE++  R +++ ++   +E +L  WVYNCF AGE
Sbjct  661  GYVAPEWQKNVPITVKADVYSFGIVLLEIVCCRSNMEVNVSSADEIILSSWVYNCFVAGE  720

Query  347  vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSP  183
            + K+VG EEV+ + +ERMV+I+LWCIQ+EP+ RPSMK V+LM+EG VD  +PPSP
Sbjct  721  LDKLVGYEEVDMKALERMVKIALWCIQDEPAHRPSMKTVILMIEGIVDTSIPPSP  775



>ref|XP_008231374.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Prunus mume]
Length=807

 Score =   211 bits (537),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 142/183 (78%), Gaps = 3/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG++YLHEEC TQIIHCDIKP NIL+D+ F A+ISDFGLAK +  DQT T+T++RGT+
Sbjct  624  IARGIMYLHEECSTQIIHCDIKPHNILLDDSFTARISDFGLAKLLLSDQTLTHTVIRGTR  683

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEA---  354
            GYVAPEW R + +  K DVYS+G++LLE+I  R+S++    +EE +L +WVY+C++A   
Sbjct  684  GYVAPEWFRNVPINAKVDVYSYGVMLLEIICCRRSLEMDRENEEVILTDWVYDCYKAKTL  743

Query  353  GevskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSF  174
             ++ +   E   + +++ER+V++S+WCIQE+PSLRP+MKKV  MLEG VD+ VPP P+ F
Sbjct  744  NKLVEDDEEARNDMKRLERLVKVSIWCIQEDPSLRPTMKKVTQMLEGVVDVSVPPCPSPF  803

Query  173  LSV  165
             S+
Sbjct  804  SSI  806



>ref|XP_006844855.1| hypothetical protein AMTR_s00058p00102600 [Amborella trichopoda]
 gb|ERN06530.1| hypothetical protein AMTR_s00058p00102600 [Amborella trichopoda]
Length=796

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 136/178 (76%), Gaps = 4/178 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEECDTQIIHCDIKPQNIL+D    A+ISDFGLAK +K DQTRT T  RGT+
Sbjct  609  IARGLLYLHEECDTQIIHCDIKPQNILLDEFQTARISDFGLAKRLKPDQTRTLTGARGTR  668

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAG--  351
            GYVAPEWHR + VT K DVYS+G +LLE+I  RKS+     ++E +L +WVY C + G  
Sbjct  669  GYVAPEWHRNVPVTAKVDVYSYGAMLLEIICCRKSLMVDAPEDEIILSDWVYKCVQDGCL  728

Query  350  --evskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSP  183
               ++    E + E +++ERMV + LWCIQEEP+LRPSMKKV+L+LEGTV++ VPP P
Sbjct  729  EKLIAPEELEVQEETKRLERMVMVGLWCIQEEPALRPSMKKVVLILEGTVEVHVPPDP  786



>gb|AES91503.2| S-locus lectin kinase family protein [Medicago truncatula]
Length=812

 Score =   210 bits (534),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 143/177 (81%), Gaps = 1/177 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLHEECD  IIHCD+KPQNILMD  + AKISDFGLAK +  DQTRT+T+VRGT+
Sbjct  633  IARGILYLHEECDAPIIHCDLKPQNILMDKFWTAKISDFGLAKLLMPDQTRTFTMVRGTR  692

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCD-EEAVLEEWVYNCFEAGe  348
            GY+APEW++ +A++VK DVYS+GIVLLE++  R+++D ++ + EE +L  W Y CF AG+
Sbjct  693  GYMAPEWNKNVAISVKTDVYSYGIVLLEILCCRRNLDVNVLEPEEILLAGWTYKCFIAGD  752

Query  347  vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            V+K+V  E ++K  +E MV+++LWCIQ++P LRP+MK V+LMLEG  DI +PP P S
Sbjct  753  VNKLVPSEAIDKNVMENMVKVALWCIQDDPFLRPTMKGVVLMLEGITDIAIPPCPNS  809



>ref|XP_003609306.1| Receptor like kinase [Medicago truncatula]
 ref|XP_003609329.1| Receptor like kinase [Medicago truncatula]
Length=854

 Score =   210 bits (534),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 143/177 (81%), Gaps = 1/177 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLHEECD  IIHCD+KPQNILMD  + AKISDFGLAK +  DQTRT+T+VRGT+
Sbjct  631  IARGILYLHEECDAPIIHCDLKPQNILMDKFWTAKISDFGLAKLLMPDQTRTFTMVRGTR  690

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCD-EEAVLEEWVYNCFEAGe  348
            GY+APEW++ +A++VK DVYS+GIVLLE++  R+++D ++ + EE +L  W Y CF AG+
Sbjct  691  GYMAPEWNKNVAISVKTDVYSYGIVLLEILCCRRNLDVNVLEPEEILLAGWTYKCFIAGD  750

Query  347  vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            V+K+V  E ++K  +E MV+++LWCIQ++P LRP+MK V+LMLEG  DI +PP P S
Sbjct  751  VNKLVPSEAIDKNVMENMVKVALWCIQDDPFLRPTMKGVVLMLEGITDIAIPPCPNS  807



>ref|XP_010265967.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nelumbo nucifera]
Length=805

 Score =   209 bits (532),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 139/184 (76%), Gaps = 4/184 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGL+YLHEEC TQIIHCDIKPQNIL+D+ + A+ISDFGLAK M  +Q+RT T +RGTK
Sbjct  621  IARGLMYLHEECSTQIIHCDIKPQNILLDDYYTARISDFGLAKLMMTNQSRTRTTIRGTK  680

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSL-CDEEAVLEEWVYNCFEAG-  351
            GYVAPEW R M +TVK DVYS+G++LLE+I  RKSV+  +  +EEA+L +W Y+C++ G 
Sbjct  681  GYVAPEWFRSMPITVKVDVYSYGVMLLEIICCRKSVELEMGSEEEAILTDWAYDCYQHGR  740

Query  350  --evskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               + +   +   +  ++ER+V++++WCI EEPSLRP+MKKV  MLEG  ++ +PP P  
Sbjct  741  LDALVENDTDAMNDMIRLERLVKVAIWCIHEEPSLRPTMKKVTQMLEGITEVSIPPCPFP  800

Query  176  FLSV  165
            F S 
Sbjct  801  FSSA  804



>ref|XP_010257446.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nelumbo nucifera]
Length=809

 Score =   209 bits (532),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 141/184 (77%), Gaps = 4/184 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGL+YLHEEC TQIIHCDIKPQNIL+D+ F A+ISDFGLAK +  +Q+RT   +RGTK
Sbjct  625  IARGLVYLHEECSTQIIHCDIKPQNILLDDHFTARISDFGLAKLLMTNQSRTLASIRGTK  684

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDW-SLCDEEAVLEEWVYNCFEAGe  348
            GYVAPEW R M +TVK DVYSFG+++LE+I  RKSV+  ++ D   +L +W Y+C++ G 
Sbjct  685  GYVAPEWFRNMPITVKVDVYSFGVMMLEIICCRKSVEQETVADHRVILTDWAYDCYQQGR  744

Query  347  vskvvgeeevekr---qvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            + ++V  +        ++ER+VRI++WCIQEEPSL+P+MK V+ MLEG V++P+PP P  
Sbjct  745  LDELVENDMDAMNDICRLERLVRIAIWCIQEEPSLKPTMKNVIQMLEGIVEVPLPPCPYP  804

Query  176  FLSV  165
            + SV
Sbjct  805  YSSV  808



>ref|XP_010999793.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Populus euphratica]
Length=366

 Score =   201 bits (512),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 138/184 (75%), Gaps = 4/184 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC TQIIHCDIKPQNIL+DN + A+ISDFGLAK +  DQ++T T +RGTK
Sbjct  172  IARGLLYLHEECGTQIIHCDIKPQNILLDNYYNARISDFGLAKLLVMDQSKTQTAIRGTK  231

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCD-EEAVLEEWVYNCFEAGe  348
            GYVAPEW R   +TVK DVYSFG++L+E+I  R++VD  + + E  VL +W Y+C+  G 
Sbjct  232  GYVAPEWFRNRPITVKVDVYSFGVMLIEIICCRRNVDLEIGEAENPVLTDWAYDCYMNGS  291

Query  347  vskvv---geeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +  ++    E + +   +ER++++ +WCIQE+PS+RP+M+KV  MLEG V++P  P+P  
Sbjct  292  LDVLIGDDMEAKNDISTLERLLKVGIWCIQEDPSVRPTMRKVTQMLEGVVEVPAAPNPFP  351

Query  176  FLSV  165
            + ++
Sbjct  352  YSTI  355



>ref|XP_006494277.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Citrus sinensis]
 gb|KDO56497.1| hypothetical protein CISIN_1g003818mg [Citrus sinensis]
Length=793

 Score =   209 bits (532),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 137/184 (74%), Gaps = 4/184 (2%)
 Frame = -2

Query  701  ARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTKG  522
            ARGL YLHEEC +QIIHCDIKPQNIL+D  F A+ISDFGLAK +K DQT+T T +RGTKG
Sbjct  610  ARGLFYLHEECKSQIIHCDIKPQNILLDGTFNARISDFGLAKLLKTDQTQTTTAIRGTKG  669

Query  521  YVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDE-EAVLEEWVYNCF---EA  354
            YVAPEW + + +T K DVYSFGI+LLEL+  RK+ +    +E + +L +W Y+CF   + 
Sbjct  670  YVAPEWFKNLPITAKVDVYSFGILLLELVCCRKNFEVDATEECQMILADWAYDCFRERKL  729

Query  353  GevskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSF  174
            G + +   E   + ++VE+ V I++WCIQE+PSLRP+MKKV  M+EG VD+ +PP P SF
Sbjct  730  GLLVENDEEAMDDIKRVEKFVMIAIWCIQEDPSLRPAMKKVTQMIEGAVDVSIPPDPASF  789

Query  173  LSVV  162
            +S +
Sbjct  790  ISSI  793



>ref|XP_008782878.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Phoenix dactylifera]
Length=811

 Score =   209 bits (531),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 135/185 (73%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGL YLH+EC TQ+IHCDIKPQNIL+D  FVA+ISDFGLAK ++ DQ+RT T +RGT+
Sbjct  626  IARGLAYLHDECSTQVIHCDIKPQNILLDENFVARISDFGLAKLLRTDQSRTSTGIRGTR  685

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEE-AVLEEWVYNCFEAGe  348
            GYVAPEW R  A+T K DVYSFG++LLE+I  RK+++    DE+ AVL  W Y+C+  G 
Sbjct  686  GYVAPEWFRNTAITAKVDVYSFGVMLLEIICCRKNLEAEAGDEDRAVLVYWAYDCYREGN  745

Query  347  vskvvge---eevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +  + G       +    E +V +++WCIQEEPSLRPSMKKV  MLEG V + VPP P+S
Sbjct  746  LELLAGNDEEAMADMGMFETLVMVAIWCIQEEPSLRPSMKKVNQMLEGAVMVSVPPDPSS  805

Query  176  FLSVV  162
             ++ +
Sbjct  806  HITPI  810



>ref|XP_008232126.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Prunus mume]
Length=804

 Score =   209 bits (531),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC   IIHCDIKPQNILMD  + AKISDFGLAK +  DQTRT+T +RGT+
Sbjct  626  VARGLLYLHEECKAPIIHCDIKPQNILMDEFWNAKISDFGLAKLLMPDQTRTFTGIRGTR  685

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GY+APEW +   ++VKADVYS+GIVLLE++  R+++D ++  EE +L  WVY CF   E+
Sbjct  686  GYLAPEWQKNTPISVKADVYSYGIVLLEIVCCRRNMDINVRAEEIILSTWVYKCFVGREL  745

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
             K+VG EEV+K+ +E MV++ LWCIQ+EP+LRPSMK V+LML+G  DI +PP PT+
Sbjct  746  HKLVGGEEVDKKTLENMVKVGLWCIQDEPALRPSMKSVVLMLQGITDIAIPPCPTT  801



>ref|XP_008449746.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Cucumis melo]
Length=800

 Score =   209 bits (531),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 141/185 (76%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGL YLHEEC TQIIHCDIKPQNIL+D+ + AKI+DFGLAK +K+DQTRT T +RGTK
Sbjct  615  IARGLSYLHEECSTQIIHCDIKPQNILLDDSYGAKIADFGLAKLLKKDQTRTMTAIRGTK  674

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSV-DWSLCDEEAVLEEWVYNCF---E  357
            GYVAPEW R   +TVK DVYSFGI+LLE+I  RK+    +  ++E +L +WVY+C    E
Sbjct  675  GYVAPEWFRSFPITVKVDVYSFGILLLEIICCRKNFEMETEDEDEMILSDWVYDCMNEKE  734

Query  356  AGevskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
              ++ +   E   + ++VER V+I +WCIQEEPSLRPSMKKV+ MLEG V++  PP P+S
Sbjct  735  IEKLVRDDEEARDDMKRVERFVKIGIWCIQEEPSLRPSMKKVVQMLEGAVEVSTPPDPSS  794

Query  176  FLSVV  162
            F+S +
Sbjct  795  FISAI  799



>ref|XP_010087366.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Morus notabilis]
 gb|EXB28976.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Morus notabilis]
Length=798

 Score =   209 bits (531),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 140/183 (77%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGL YL EEC  QIIHCDIKP NIL+D+ + A+ISDFGLAK +K DQTRT T +RGTK
Sbjct  614  IARGLFYLQEECSMQIIHCDIKPHNILLDDSYTARISDFGLAKILKIDQTRTVTGIRGTK  673

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDE-EAVLEEWVYNCF---E  357
            GYVAPEW R M VTVK DVYS+GI+LLELI  R++V+  + D+ + +L +W Y+C+   +
Sbjct  674  GYVAPEWFRNMPVTVKVDVYSYGILLLELICCRRNVEQEIEDDAQMILADWAYDCYACRK  733

Query  356  AGevskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               + +   E   + ++VE+ V +++WCIQE+PSLRPSMKKV+ MLEGTV++ VPP+PTS
Sbjct  734  LDFLVEDDDEAMEDLKRVEKYVMVAIWCIQEDPSLRPSMKKVVQMLEGTVEVSVPPNPTS  793

Query  176  FLS  168
             +S
Sbjct  794  LIS  796



>gb|EMT30664.1| Putative receptor protein kinase ZmPK1 [Aegilops tauschii]
Length=880

 Score =   209 bits (531),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 138/183 (75%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC TQIIHC+IKPQNIL+D+ F+AKI+DFGLAK ++ +QT+TYT +RGT+
Sbjct  695  VARGLLYLHEECSTQIIHCNIKPQNILLDDNFMAKIADFGLAKLLRANQTQTYTGIRGTR  754

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEE-AVLEEWVYNCFEAGe  348
            GYVAPEW + + +T K DVYSFG++LLEL+  R++V+  + DEE ++L  W  +C+  G 
Sbjct  755  GYVAPEWFKNIGITSKVDVYSFGVILLELVCCRRNVELEIADEERSILTYWANDCYRCGR  814

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               + +   E     ++ ER V ++LWC+QEEP++RP+M KV  ML+G V IP PP P+S
Sbjct  815  IDLLVEGDDEANFNIKKAERFVAVALWCLQEEPTMRPTMLKVTQMLDGAVQIPTPPDPSS  874

Query  176  FLS  168
            F+S
Sbjct  875  FIS  877


 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRG  531
            +ARGLLYLHEEC TQIIHC+IKPQNIL+D+ F+AKI+DFGLAK ++ +QT+TYT + G
Sbjct  626  VARGLLYLHEECSTQIIHCNIKPQNILLDDNFMAKIADFGLAKPLRANQTQTYTGIPG  683



>ref|XP_007048277.1| Receptor-like protein kinase 1, putative [Theobroma cacao]
 gb|EOX92434.1| Receptor-like protein kinase 1, putative [Theobroma cacao]
Length=805

 Score =   208 bits (530),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 143/177 (81%), Gaps = 1/177 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARG+LYLHEEC++ IIHCDIKPQNILMD+ + AKISDFGLAK +  DQTRT+T VRGT+
Sbjct  626  VARGILYLHEECESPIIHCDIKPQNILMDDTWTAKISDFGLAKFLMGDQTRTFTGVRGTR  685

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCD-EEAVLEEWVYNCFEAGe  348
            GY+APEW +   ++VKAD+YSFGIVLLE++  R+++D ++   EE +L  WVY CF   E
Sbjct  686  GYMAPEWQKNTPISVKADIYSFGIVLLEIVCCRRNLDTTVSKTEEIILSNWVYRCFVEKE  745

Query  347  vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            + K+V  EEV+K+ +E+MV ++LWCIQ+EP+LRPS+K V++MLEG  DI +PP P++
Sbjct  746  LDKLVLGEEVDKKNLEKMVMVALWCIQDEPALRPSIKSVVMMLEGITDISIPPCPSA  802



>ref|XP_008244883.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Prunus mume]
Length=817

 Score =   208 bits (530),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC   IIHCDIKPQNILMD  + AKISDFGLAK +  DQTRT+T VRGT+
Sbjct  639  VARGLLYLHEECKAPIIHCDIKPQNILMDEFWNAKISDFGLAKLLMPDQTRTFTGVRGTR  698

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GY+APEW +   ++VKADVYS+GIVLLE++  R+++D ++  EE +L  WVY CF   E+
Sbjct  699  GYLAPEWQKNTPISVKADVYSYGIVLLEIVCCRRNMDVNVRAEEIILSTWVYKCFVGREL  758

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
             K+VG EEV+K+ +E MV++ LWCIQ+EP+LRPSMK V+LML+G  DI +PP PT+
Sbjct  759  HKLVGGEEVDKKTLENMVKVGLWCIQDEPALRPSMKSVVLMLQGITDIAIPPCPTA  814



>ref|XP_011037891.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Populus euphratica]
Length=827

 Score =   208 bits (530),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 135/178 (76%), Gaps = 4/178 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGL YLHEEC TQIIHCDIKPQNIL+D  F A ISDFG+AK +K DQTRT T +RGTK
Sbjct  640  VARGLFYLHEECSTQIIHCDIKPQNILLDESFRAIISDFGIAKLLKADQTRTSTAIRGTK  699

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDE-EAVLEEWVYNCFEAGe  348
            GYVAPEW + + VTVK DVYSFGI+LLELI  RK+ +  + DE + VL  W Y+C+  G+
Sbjct  700  GYVAPEWFKNLPVTVKVDVYSFGILLLELICCRKNFEPEVKDEYQMVLAYWAYDCYRDGK  759

Query  347  vskvvge---eevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSP  183
            VS +V       ++ ++V + V I++WCIQE+PSLRP+MKKV LMLEGTV++  PP P
Sbjct  760  VSLLVANDEDAVLDMKRVVKFVMIAIWCIQEDPSLRPTMKKVTLMLEGTVEVSAPPDP  817



>ref|XP_002283224.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Vitis vinifera]
Length=816

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 136/182 (75%), Gaps = 4/182 (2%)
 Frame = -2

Query  701  ARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTKG  522
            ARGLLYLHEEC TQIIHCDIKPQNIL+D+ F A+IS+FGLAK +K DQTRT T +RGT+G
Sbjct  622  ARGLLYLHEECSTQIIHCDIKPQNILLDDGFTARISNFGLAKLLKSDQTRTMTGIRGTRG  681

Query  521  YVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDE-EAVLEEWVYNCFEAGev  345
            Y+APEW + + +TVK DVYSFGI+LLELI  RK+ +  L DE + VL +W Y+C++ G++
Sbjct  682  YLAPEWFKTVPITVKVDVYSFGILLLELIFCRKNFELELEDEDQVVLADWAYDCYKEGKL  741

Query  344  sk---vvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSF  174
             +      E   +   V + + I+ WCIQE+PS RP+MK V  MLEG +++ VPP P+SF
Sbjct  742  DQILENDKEALNDIETVRKFLMIAFWCIQEDPSKRPTMKTVTQMLEGALEVSVPPDPSSF  801

Query  173  LS  168
            +S
Sbjct  802  IS  803



>ref|XP_009778013.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nicotiana sylvestris]
Length=187

 Score =   194 bits (494),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 135/185 (73%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGL YLHEEC TQIIHCDIKPQNIL+D+ ++A+ISDFGL+K +  +Q+RT T +RGT+
Sbjct  3    IARGLAYLHEECSTQIIHCDIKPQNILLDDYYIARISDFGLSKLLMINQSRTLTDIRGTR  62

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLC-DEEAVLEEWVYNCFEAGe  348
            GYVAPEW R   VTVK DVYSFG++LLE+I+ RKS++       EA+L +WV +CF  G+
Sbjct  63   GYVAPEWFRNSQVTVKVDVYSFGVLLLEIITCRKSLENEESYGPEAILTDWVLDCFHDGK  122

Query  347  vskvvgeeevekrqverm---vRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +  +V  +       +++   V + +WCIQE+ ++RP+M+KV  MLEG+V++  PP P +
Sbjct  123  LEALVETDTEALNDKKQLERFVMVGIWCIQEDSTMRPTMRKVTQMLEGSVEVTTPPCPYT  182

Query  176  FLSVV  162
            F + +
Sbjct  183  FSTTI  187



>ref|XP_002276127.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Vitis vinifera]
Length=791

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 144/177 (81%), Gaps = 1/177 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARG+LYLHEEC+  IIHCDIKPQNILMD+ + AKISDFGLAK +  DQTRT+T VRGT+
Sbjct  612  VARGILYLHEECEAPIIHCDIKPQNILMDDFWTAKISDFGLAKLLMPDQTRTFTGVRGTR  671

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCD-EEAVLEEWVYNCFEAGe  348
            GY+APEW + + ++VKADVYS+GIVLLEL+  R++++ ++   EE VL  W Y CF AGE
Sbjct  672  GYLAPEWQQNIPISVKADVYSYGIVLLELVCCRRNLEVNVSKPEEIVLSNWAYKCFVAGE  731

Query  347  vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            + K++G EEVE++ +E MV++ LWCIQ+EP+LRPS+K ++LMLEG  +I VPP PT+
Sbjct  732  LYKLLGGEEVERKSLEEMVKLGLWCIQDEPALRPSIKSIVLMLEGITEIAVPPCPTT  788



>ref|XP_010108662.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Morus notabilis]
 gb|EXC19918.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Morus notabilis]
Length=788

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IA+G+LYLHE+C+ QI+HCDI P NIL+D     KI+DFGLAK +  DQTRT T +RGT+
Sbjct  605  IAKGILYLHEDCEHQILHCDINPNNILIDENHSPKIADFGLAKLLMPDQTRTITGIRGTR  664

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            G+VAPEWH+ + +T KADVYSFGIVLL +I  R+SVD +L D EA+L +WV+ CF+  EV
Sbjct  665  GFVAPEWHKNLPITAKADVYSFGIVLLVIICCRRSVDINLPDREAILVDWVHECFKRNEV  724

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
              +V +EEV+ +++ERM+RI LWCIQEEP +RP+MK V+ M EGTV+IPVPP P S
Sbjct  725  RNLVQDEEVDAQELERMLRIGLWCIQEEPIVRPTMKNVVAMFEGTVNIPVPPYPNS  780



>ref|XP_010027359.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Eucalyptus grandis]
Length=790

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 142/177 (80%), Gaps = 1/177 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLHEECDT IIHCDIKPQNILMD+ +  KISDFGLAK +  DQTRT+T++RGT+
Sbjct  611  IARGILYLHEECDTPIIHCDIKPQNILMDDFWAVKISDFGLAKLLMPDQTRTFTVIRGTR  670

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCD-EEAVLEEWVYNCFEAGe  348
            GY+APEWH+   ++VK DVYS+GI+LLE++  R+ +D +    EE VL  WVY  F  GE
Sbjct  671  GYMAPEWHKGTPISVKTDVYSYGIMLLEIVFCRRHMDVNASTPEEIVLSSWVYGHFRDGE  730

Query  347  vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            + K+V  EEV+K  +E++V++SLWCIQ+EP+LRPSMK V++ML+GT +I VPP PT+
Sbjct  731  LDKLVLGEEVDKWLLEKLVKVSLWCIQDEPALRPSMKSVVMMLDGTTEISVPPCPTA  787



>gb|KCW62261.1| hypothetical protein EUGRSUZ_H04921 [Eucalyptus grandis]
Length=752

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 142/177 (80%), Gaps = 1/177 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLHEECDT IIHCDIKPQNILMD+ +  KISDFGLAK +  DQTRT+T++RGT+
Sbjct  573  IARGILYLHEECDTPIIHCDIKPQNILMDDFWAVKISDFGLAKLLMPDQTRTFTVIRGTR  632

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCD-EEAVLEEWVYNCFEAGe  348
            GY+APEWH+   ++VK DVYS+GI+LLE++  R+ +D +    EE VL  WVY  F  GE
Sbjct  633  GYMAPEWHKGTPISVKTDVYSYGIMLLEIVFCRRHMDVNASTPEEIVLSSWVYGHFRDGE  692

Query  347  vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            + K+V  EEV+K  +E++V++SLWCIQ+EP+LRPSMK V++ML+GT +I VPP PT+
Sbjct  693  LDKLVLGEEVDKWLLEKLVKVSLWCIQDEPALRPSMKSVVMMLDGTTEISVPPCPTA  749



>ref|XP_010943531.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Elaeis guineensis]
Length=803

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 141/185 (76%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGL YLHEEC +QIIHCDIKPQNIL+D+  VA+ISDFGLAK ++ DQTRT T +RGT+
Sbjct  618  IARGLTYLHEECSSQIIHCDIKPQNILLDDNLVARISDFGLAKLLRTDQTRTNTGIRGTR  677

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEA-VLEEWVYNCFEAGe  348
            GYVAPEW + M +T K DVYSFG++LLE++  RK+V+  + +EEA +L  WV +C+  G 
Sbjct  678  GYVAPEWFKSMGITAKVDVYSFGVMLLEIVCCRKNVEQEVGNEEALILTYWVNDCYRDGM  737

Query  347  vskvvge---eevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +  VV       ++ ++VER V+++LWCIQEEPS+RP+M+KV  ML+G   IP PP P+S
Sbjct  738  LELVVEGDDEGALDMKRVERFVKVALWCIQEEPSMRPTMQKVTQMLDGATSIPEPPDPSS  797

Query  176  FLSVV  162
            ++S +
Sbjct  798  YISSI  802



>gb|EMS50976.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Triticum urartu]
Length=755

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 138/183 (75%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC+TQIIHCDIKPQNIL+D   VAKISDFGLAK ++ +QT+T T +RGT+
Sbjct  570  VARGLLYLHEECNTQIIHCDIKPQNILLDENLVAKISDFGLAKMLRTNQTQTNTGIRGTR  629

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEE-AVLEEWVYNCFEAGe  348
            GYVAPEW + + +T K D+YSFG++LLE++  R++V+    DEE A+L  W  +C+ +G 
Sbjct  630  GYVAPEWFKNIGITSKVDIYSFGVILLEIVCCRRNVELETADEEQAILTYWANDCYRSGR  689

Query  347  vs---kvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +    K   E     ++VER V ++LWC+QEEP++RP+M KV  ML+G+V IP PP P+S
Sbjct  690  LDLLIKGDEEAIFNIKKVERFVAVALWCLQEEPTMRPTMLKVTQMLDGSVTIPTPPDPSS  749

Query  176  FLS  168
            F+S
Sbjct  750  FIS  752



>ref|XP_010087369.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Morus notabilis]
 gb|EXB28979.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Morus notabilis]
Length=798

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 139/183 (76%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGL YLHEEC  QIIHCDIKPQNIL+D+ + A+ISDFGLAK +K +QTRT T +RGTK
Sbjct  614  IARGLFYLHEECRMQIIHCDIKPQNILLDDSYTARISDFGLAKILKINQTRTMTGIRGTK  673

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDE-EAVLEEWVYNCF---E  357
            GYVA EW R MAVTVK DVYS+GI+LLELI  R++ +  + D  + +L +W Y+C+   +
Sbjct  674  GYVAAEWFRNMAVTVKVDVYSYGILLLELICCRRNFEHEIEDATQMILADWAYDCYACRK  733

Query  356  AGevskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               + +   E   + + VE+ V +++WCIQE+PSLRPSMKKV+ MLEGTV++ VPP+PTS
Sbjct  734  LDFLVEDDDEAMEDLKMVEKYVMVAIWCIQEDPSLRPSMKKVVQMLEGTVEVSVPPNPTS  793

Query  176  FLS  168
             +S
Sbjct  794  SIS  796



>gb|EMS65010.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Triticum urartu]
Length=817

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 138/183 (75%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC TQIIHCDIKPQNIL+D+ F+AKI+DFGLAK ++ +QT+T T +RGT+
Sbjct  632  VARGLLYLHEECSTQIIHCDIKPQNILLDDNFMAKIADFGLAKLLRANQTQTNTGIRGTR  691

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEE-AVLEEWVYNCFEAGe  348
            GYVAPEW + + +T K DVYSFG++LLEL+  R++V+  + DEE A+L  W  +C+ +G 
Sbjct  692  GYVAPEWFKNIGITSKVDVYSFGVILLELVCCRRNVEVEIDDEEQAILTYWANDCYRSGR  751

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               + +   E     ++ ER V ++LWC+QEEP++RP+M KV  ML+G V IP PP P+S
Sbjct  752  IDLLVEGDDEANFNIKKAERFVAVALWCLQEEPTMRPTMLKVTQMLDGAVQIPTPPDPSS  811

Query  176  FLS  168
            F+S
Sbjct  812  FIS  814



>ref|XP_008351773.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Malus domestica]
Length=308

 Score =   198 bits (503),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 134/181 (74%), Gaps = 4/181 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +A+GLLYLHEEC TQIIHCDIKPQNIL+++ +   ISDFGLAK +  +Q++T T +RGT 
Sbjct  126  VAKGLLYLHEECRTQIIHCDIKPQNILLBDYYTPLISDFGLAKLLLMNQSQTLTAIRGTX  185

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVD-WSLCDEEAVLEEWVYNCFEAGe  348
            GYVAPEW R + +T K DVYSFG+VLLE+I  R+SVD    C+E+A+L  WVY+C+  G 
Sbjct  186  GYVAPEWFRXLXITTKVDVYSFGVVLLEIICCRRSVDNEGNCEEKAILTYWVYDCYIEGA  245

Query  347  vskvvgeeeve---krqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +  VV  E      +  +E+ V +++WCIQE+PSLRP+M KV+ MLEG  ++PVPP P+ 
Sbjct  246  LDDVVDHEVEALCDRTILEKFVMVAIWCIQEDPSLRPTMMKVVQMLEGVAEVPVPPCPSP  305

Query  176  F  174
            +
Sbjct  306  Y  306



>gb|EMT09901.1| Putative receptor protein kinase ZmPK1 [Aegilops tauschii]
Length=802

 Score =   207 bits (527),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 138/183 (75%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC+TQIIHCDIKPQNIL+D   VAKISDFGLAK ++ +QT+T T +RGT+
Sbjct  617  VARGLLYLHEECNTQIIHCDIKPQNILLDENLVAKISDFGLAKLLRTNQTQTNTGIRGTR  676

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEE-AVLEEWVYNCFEAGe  348
            GYVAPEW + + +T K D+YSFG++LLE++  R++V+    DEE A+L  W  +C+ +G 
Sbjct  677  GYVAPEWFKNIGITSKVDIYSFGVILLEIVCCRRNVELETADEEQAILTYWANDCYRSGR  736

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               + K   E     ++VER V ++LWC+QEEP++RP+M KV  ML+G+V IP PP P+S
Sbjct  737  LDLLIKGDEEAIFNIKKVERFVAVALWCLQEEPTMRPTMLKVTQMLDGSVTIPTPPDPSS  796

Query  176  FLS  168
            F+S
Sbjct  797  FIS  799



>ref|XP_008808085.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Phoenix dactylifera]
Length=803

 Score =   207 bits (527),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 138/185 (75%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC  QIIHCDIKPQNIL+D+  VA+ISDFGLAK ++ DQTRT T +RGT+
Sbjct  618  IARGLLYLHEECSNQIIHCDIKPQNILLDDNLVARISDFGLAKLLRTDQTRTNTAIRGTR  677

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEA-VLEEWVYNCFEAGe  348
            GYVAPEW + + +T K DVYSFG++LLE++  RK V+  + +EE  +L  WV +C+  G 
Sbjct  678  GYVAPEWFKNIGITAKVDVYSFGVMLLEIVCCRKCVEQEVGNEEGLILTYWVSDCYRDGM  737

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               V +   E   + ++VER V+++LWCIQEEPS+RP+M+KV  ML+G   IP PP P+S
Sbjct  738  LELVVEGDEEAAFDMKRVERFVKVALWCIQEEPSMRPTMQKVTQMLDGATSIPEPPDPSS  797

Query  176  FLSVV  162
            ++S +
Sbjct  798  YMSSI  802



>ref|XP_002269067.3| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Vitis vinifera]
Length=827

 Score =   207 bits (527),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 136/178 (76%), Gaps = 4/178 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGL+YLHEEC TQIIHCDIKPQN+L+D+ F A+ISDFGLAK +  DQTRT T +RGTK
Sbjct  643  VARGLMYLHEECSTQIIHCDIKPQNVLLDDSFTARISDFGLAKLLMSDQTRTLTAIRGTK  702

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSL-CDEEAVLEEWVYNCFEA--  354
            GYVAPEW R   +T K DVYS+G++LLE+IS RK +D+    +EEA+L +W Y+C+    
Sbjct  703  GYVAPEWFRSKPITAKVDVYSYGVMLLEIISCRKCIDFQTENEEEAILTDWAYDCYRGHR  762

Query  353  -GevskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSP  183
              ++ +   +   + R++E++V +++WCIQE+PSLRPSM+ V  MLEG V++P+PP P
Sbjct  763  LDKLVENDDDARNDMRRLEKLVMVAIWCIQEDPSLRPSMRNVTQMLEGVVEVPMPPCP  820



>ref|XP_002299254.1| hypothetical protein POPTR_0001s05250g [Populus trichocarpa]
 gb|EEE84059.1| hypothetical protein POPTR_0001s05250g [Populus trichocarpa]
Length=812

 Score =   207 bits (526),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 134/178 (75%), Gaps = 4/178 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGL YLHEEC TQIIHCDIKPQNIL+D  F A ISDFG+AK +K DQTRT T +RGTK
Sbjct  625  VARGLFYLHEECSTQIIHCDIKPQNILLDESFRAIISDFGIAKLLKADQTRTSTAIRGTK  684

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEA-VLEEWVYNCF---E  357
            GY+APEW + + VTVK DVYSFGI+LLELI  RK+ +  + +E+  VL  W Y+C+   +
Sbjct  685  GYLAPEWFKNLPVTVKVDVYSFGILLLELICCRKNFEPEVKNEDQMVLAYWAYDCYRDGK  744

Query  356  AGevskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSP  183
            AG +     +  ++ ++V + V I++WCIQE+PSLRP+MKKV LMLEGTV++  PP P
Sbjct  745  AGLLVANDDDAVLDMKRVVKFVMIAIWCIQEDPSLRPTMKKVTLMLEGTVEVSAPPDP  802



>ref|XP_008777350.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Phoenix dactylifera]
Length=802

 Score =   207 bits (526),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 137/183 (75%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGL YLHEEC +Q IHCDIKP+NIL+D+ F A+ISDFGLAK + Q+QTRT T +RGTK
Sbjct  617  VARGLSYLHEECSSQTIHCDIKPENILLDDCFTARISDFGLAKLLMQEQTRTQTDIRGTK  676

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSL-CDEEAVLEEWVYNCFEAGe  348
            GYVAPEW +K A+T K DVYSFG++LLE++  RK+++     D   +L EW Y+C+    
Sbjct  677  GYVAPEWFKKRAITAKVDVYSFGVMLLEIVCCRKNIELEFGSDAGPILTEWAYDCYSEKR  736

Query  347  vskvvgeeevekrq---vermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +  VV  +E  +     +ER+V ++LWCIQEEPS+RPSMKKV  MLEG V++ VPP PTS
Sbjct  737  LDVVVEHDEEARSNWRMLERLVAVALWCIQEEPSMRPSMKKVTQMLEGAVEVSVPPDPTS  796

Query  176  FLS  168
            F+S
Sbjct  797  FIS  799



>gb|EEE60505.1| hypothetical protein OsJ_13807 [Oryza sativa Japonica Group]
Length=584

 Score =   204 bits (519),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 136/183 (74%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC+ QIIHCD+KPQNIL+D+ FVAKISDFGLAK +  +QT+T T +RGT+
Sbjct  399  VARGLLYLHEECNKQIIHCDMKPQNILLDDNFVAKISDFGLAKLLPVNQTQTNTGIRGTR  458

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEE-AVLEEWVYNCFEAGe  348
            GYVAPEW + + +T K DVYSFG++LLEL+  RK+V+  + DEE  +L  W  +C++ G 
Sbjct  459  GYVAPEWFKNIGITSKVDVYSFGVILLELVCCRKNVELEVLDEEQTILTYWANDCYKCGR  518

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               +     E     ++VER V ++LWC+QEEPS+RP+M KV  ML+G V IP PP P+S
Sbjct  519  IDLLVAGDDEAIFNIKKVERFVAVALWCLQEEPSMRPTMLKVTQMLDGAVQIPTPPDPSS  578

Query  176  FLS  168
            ++S
Sbjct  579  YIS  581



>emb|CAH67715.1| H0512B01.10 [Oryza sativa Indica Group]
Length=811

 Score =   207 bits (526),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 138/183 (75%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            ++RGLLYLHEEC+ QIIHCD+KPQNIL+D+ FVAKISDFGLAK +  +QT+T T +RGT+
Sbjct  626  VSRGLLYLHEECNKQIIHCDMKPQNILLDDNFVAKISDFGLAKLLPVNQTQTNTGIRGTR  685

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEE-AVLEEWVYNCFEAGe  348
            GYVAPEW +K+ +T K DVYSFG++LLEL+  RK+V+  + DEE  +L  W  +C+  G 
Sbjct  686  GYVAPEWFKKIGITSKVDVYSFGVILLELVCCRKNVELEVADEEQTILTYWANDCYRCGR  745

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               + +   E     ++VER V ++LWC+QEEPS+RP+M KV+ ML+G V IP PP P+S
Sbjct  746  IDLLVEGDDEAIFNIKKVERFVAVALWCLQEEPSMRPTMHKVMQMLDGAVQIPTPPDPSS  805

Query  176  FLS  168
            ++S
Sbjct  806  YIS  808



>gb|KDP20397.1| hypothetical protein JCGZ_05280 [Jatropha curcas]
Length=785

 Score =   206 bits (525),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 137/184 (74%), Gaps = 4/184 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGL YLHEEC TQIIHCDIKPQNIL+D+ F A+ISDFGLAK +  DQTRT T++RGT+
Sbjct  601  IARGLTYLHEECSTQIIHCDIKPQNILLDDTFTARISDFGLAKLLMSDQTRTQTVIRGTR  660

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSL-CDEEAVLEEWVYNCFEA--  354
            GYVAPEW R M +T K DVYS+G++LLE+I  RK +D     +EE +L +W Y+C++   
Sbjct  661  GYVAPEWFRNMPITAKVDVYSYGVMLLEIICCRKGLDMERENEEEVILADWAYDCYKQKR  720

Query  353  -GevskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
              ++ +   E   + +++E++V +++WCIQE+PSLRPSM+ V  MLEG V + VPP P+ 
Sbjct  721  LDKLVEDEEEARNDSKRLEKLVMVAIWCIQEDPSLRPSMRTVTQMLEGVVQVSVPPCPSP  780

Query  176  FLSV  165
            F S+
Sbjct  781  FSSI  784



>ref|XP_006445954.1| hypothetical protein CICLE_v10014312mg [Citrus clementina]
 gb|ESR59194.1| hypothetical protein CICLE_v10014312mg [Citrus clementina]
Length=804

 Score =   207 bits (526),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 136/180 (76%), Gaps = 3/180 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC TQIIHCDIKPQNIL+D+ + A+ISDFGLAK +  DQ++TYT +RGTK
Sbjct  621  IARGLLYLHEECSTQIIHCDIKPQNILLDDYYNARISDFGLAKLLLLDQSQTYTAIRGTK  680

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAG--  351
            GYVAPEW R M +TVK DVYSFG++LLE+I  R++VD  + + EA+L +W Y+C+  G  
Sbjct  681  GYVAPEWFRNMPITVKVDVYSFGVLLLEIICCRRNVDMEVNEAEALLTDWAYDCYCEGII  740

Query  350  -evskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSF  174
              + +   E   +K++V R V +++WCIQE+PSLRP+M+KV  MLEG  ++  PP P  F
Sbjct  741  EALVEFDIEALNDKKKVARFVMVAIWCIQEDPSLRPTMRKVTQMLEGVAEVLDPPCPCPF  800



>ref|XP_008778887.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Phoenix dactylifera]
Length=802

 Score =   207 bits (526),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 138/185 (75%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC  QIIHCDIKPQNIL+D+  VA+ISDFGLAK ++ DQTRT T +RGT+
Sbjct  617  IARGLLYLHEECSNQIIHCDIKPQNILLDDNLVARISDFGLAKLLRTDQTRTNTAIRGTR  676

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEA-VLEEWVYNCFEAGe  348
            GYVAPEW + + +T K DVYSFG++LLE++  RK V+  + +EE  +L  WV +C+  G 
Sbjct  677  GYVAPEWFKNIGITAKVDVYSFGVMLLEIVCCRKCVEQEVGNEEGLILTYWVSDCYRDGM  736

Query  347  vs---kvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +    +   E   + ++VER V+++LWCIQEEPS+RP+M+KV  ML+G   IP PP P+S
Sbjct  737  LELVVEGDEEAAFDMKRVERFVKVALWCIQEEPSMRPTMQKVTQMLDGATSIPEPPDPSS  796

Query  176  FLSVV  162
            ++S +
Sbjct  797  YMSSI  801



>emb|CAN78998.1| hypothetical protein VITISV_038238 [Vitis vinifera]
Length=930

 Score =   207 bits (527),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 144/177 (81%), Gaps = 1/177 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARG+LYLHEEC+  IIHCDIKPQNILMD+ + AKISDFGLAK +  DQTRT+T VRGT+
Sbjct  751  VARGILYLHEECEAPIIHCDIKPQNILMDDFWTAKISDFGLAKLLMPDQTRTFTGVRGTR  810

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCD-EEAVLEEWVYNCFEAGe  348
            GY+APEW + + ++VKADVYS+GIVLLEL+  R++++ ++   EE VL  W Y CF AGE
Sbjct  811  GYLAPEWQQNIPISVKADVYSYGIVLLELVCCRRNLEVNVSKPEEIVLSNWAYKCFVAGE  870

Query  347  vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            + K++G EEVE++ +E MV++ LWCIQ+EP+LRPS+K ++LMLEG  +I VPP PT+
Sbjct  871  LYKLLGGEEVERKSLEEMVKLGLWCIQDEPALRPSIKSIVLMLEGITEIAVPPCPTT  927



>ref|XP_008352763.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Malus domestica]
 ref|XP_008355016.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Malus domestica]
Length=312

 Score =   197 bits (502),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 135/181 (75%), Gaps = 4/181 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IA+GLLYLHEEC TQIIHCDIKPQNIL+D+ +  +ISDFGLAK +  +Q++T+T +RGTK
Sbjct  128  IAKGLLYLHEECSTQIIHCDIKPQNILLDDYYTPRISDFGLAKLLMMNQSQTHTAIRGTK  187

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDW-SLCDEEAVLEEWVYNCFEAGe  348
            GYVAPEW R + +T K DVYSFG+VLLE+I  R++VD     +E A+L +WVY+C+  G 
Sbjct  188  GYVAPEWFRNLXITTKVDVYSFGVVLLEIICCRRNVDVEGNLEERAILTDWVYDCYVEGV  247

Query  347  vskvv---geeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +  VV    E   ++  +E+ V + +WCIQE+PSLRP+M++V+ M E  V++ VPP P+ 
Sbjct  248  LDAVVDHEVEALGDRATLEKFVMVGIWCIQEDPSLRPTMRRVVQMFEAVVEVHVPPCPSP  307

Query  176  F  174
            +
Sbjct  308  Y  308



>ref|XP_010651293.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Vitis vinifera]
Length=308

 Score =   197 bits (501),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 132/182 (73%), Gaps = 4/182 (2%)
 Frame = -2

Query  701  ARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTKG  522
            A+GLLYLHEEC TQII CDIKPQNIL+D+   A+ISDFGLAK +K DQT+T T +RGT G
Sbjct  125  AKGLLYLHEECSTQIIQCDIKPQNILLDSFLTARISDFGLAKLLKTDQTQTMTAIRGTNG  184

Query  521  YVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDE-EAVLEEWVYNCFEAGe-  348
            YVAPEW + + +T K DVYSFGIV LELI  RK+ +  L DE   VL EW Y+C+  G+ 
Sbjct  185  YVAPEWFKTVPITFKVDVYSFGIVQLELIFCRKNFEPELEDEYRMVLAEWAYDCYHKGKL  244

Query  347  --vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSF  174
              + +   E   +  ++E+ V I++WCIQE+PS RP+MKKV+ MLEG + +P+PP  +S 
Sbjct  245  DLLLENDQETLNKMEKLEKFVMIAIWCIQEDPSRRPTMKKVIQMLEGAIQVPLPPDLSSS  304

Query  173  LS  168
            +S
Sbjct  305  IS  306



>ref|XP_004142233.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Cucumis sativus]
Length=810

 Score =   206 bits (525),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 140/183 (77%), Gaps = 3/183 (2%)
 Frame = -2

Query  701  ARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTKG  522
            ARGL YLHEEC+ QIIHCDIKPQNIL+D+  VA+ISDFGLAK +K++QTRT T +RGTKG
Sbjct  627  ARGLCYLHEECEIQIIHCDIKPQNILLDDSLVARISDFGLAKLLKENQTRTMTGIRGTKG  686

Query  521  YVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGevs  342
            YVAPEW R +A+T K DVYSFGIVLLE+IS RKS++    DE  VL +  Y+ F+  ++ 
Sbjct  687  YVAPEWFRNLAITTKVDVYSFGIVLLEIISCRKSLEVEGEDELVVLADLAYDWFQERKLE  746

Query  341  kvvge---eevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFL  171
             +V      + + ++VE+ V+I++WC+QEEPS RPSMKKV+ MLEG V++  PP P SF+
Sbjct  747  MLVRNDEEAKEDMKRVEKFVKIAIWCVQEEPSFRPSMKKVVQMLEGAVEVSTPPHPYSFI  806

Query  170  SVV  162
            + +
Sbjct  807  TAI  809



>ref|XP_006387441.1| hypothetical protein POPTR_1037s002101g, partial [Populus trichocarpa]
 gb|ERP46355.1| hypothetical protein POPTR_1037s002101g, partial [Populus trichocarpa]
Length=796

 Score =   206 bits (525),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 132/180 (73%), Gaps = 3/180 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC TQIIHCDIKPQNIL+D+ + A+ISDFGLAK +  +Q++T T +RGTK
Sbjct  607  IARGLLYLHEECSTQIIHCDIKPQNILIDDYYNARISDFGLAKLLAINQSQTKTAIRGTK  666

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEW R   VTVK DVYSFG++LLE+I  R+SVD  +    A+L +W Y+C+  G +
Sbjct  667  GYVAPEWFRNTPVTVKVDVYSFGVLLLEIICCRRSVDLEISGTGAILIDWAYDCYRHGTL  726

Query  344  skv---vgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSF  174
              +     E   +   +E  +++++WCIQE PSLRP+M+KV  MLEG V++P PP+P  F
Sbjct  727  DALIEDDMEAMNDVSTLEGAMKVAIWCIQEVPSLRPTMRKVTQMLEGVVEVPAPPNPFPF  786



>ref|XP_006854585.1| hypothetical protein AMTR_s00030p00117770 [Amborella trichopoda]
 gb|ERN16052.1| hypothetical protein AMTR_s00030p00117770 [Amborella trichopoda]
Length=822

 Score =   206 bits (525),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 135/178 (76%), Gaps = 4/178 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC TQIIHCDIKPQNIL+D    AKISDFGLAK +  DQTRT T+ RGT+
Sbjct  635  IARGLLYLHEECVTQIIHCDIKPQNILLDEFHTAKISDFGLAKLLTPDQTRTLTVARGTR  694

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAG--  351
            GY APEWHR + VT K DVYS+G +L+E+I  RKS+   + ++E +L EWVY CF+ G  
Sbjct  695  GYEAPEWHRNVPVTAKVDVYSYGAMLMEIICCRKSLVVDVPEDEIILSEWVYKCFQDGCL  754

Query  350  --evskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSP  183
               ++    E   EK+++ERMV ++LWC QEEP+LRPSMK V+LMLEGTV++ VPP P
Sbjct  755  EKLITPEELEVREEKQRLERMVLVALWCKQEEPTLRPSMKTVVLMLEGTVEVQVPPHP  812



>ref|XP_006445945.1| hypothetical protein CICLE_v10014334mg [Citrus clementina]
 gb|ESR59185.1| hypothetical protein CICLE_v10014334mg [Citrus clementina]
Length=784

 Score =   206 bits (525),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 139/181 (77%), Gaps = 4/181 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTY-TIVRGT  528
            IARGLLYLHE+C +QIIHCDIKPQNIL+D+ + A+ISDFGLAK +  +Q++T  T +RGT
Sbjct  602  IARGLLYLHEDCSSQIIHCDIKPQNILLDDHYNARISDFGLAKLLTLNQSKTIKTAIRGT  661

Query  527  KGYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGe  348
            KGYVAPEW+RK  +T K DVYSFG++LLE+IS RKS D  + +E A+L +W ++C+  G+
Sbjct  662  KGYVAPEWYRKSTITAKVDVYSFGVLLLEIISCRKSFDIEMGEEYAILTDWAFDCYRNGK  721

Query  347  vskvvgeeevekrqve---rmvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +  +V  +      ++   ++V +S+WCIQE+PSLRP+M+KV  MLEG V++ VPP+P+ 
Sbjct  722  LDDLVEGDMEAMNDIKCVEKLVMVSIWCIQEDPSLRPTMRKVSQMLEGVVEVDVPPNPSP  781

Query  176  F  174
            F
Sbjct  782  F  782



>gb|KDO56493.1| hypothetical protein CISIN_1g047263mg [Citrus sinensis]
Length=804

 Score =   206 bits (525),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 137/180 (76%), Gaps = 3/180 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC TQIIHCDIKPQNIL+D+ + A+ISDFGLAK +  DQ++T+T +RGTK
Sbjct  621  IARGLLYLHEECSTQIIHCDIKPQNILLDDYYNARISDFGLAKLLLLDQSQTHTAIRGTK  680

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEW R M +TVK DVYSFG++LLE+I  R++VD  + + EA+L +W Y+C+  G  
Sbjct  681  GYVAPEWFRNMPITVKVDVYSFGVLLLEIICCRRNVDMEVNEAEALLTDWAYDCYCEGIT  740

Query  344  skvvg---eeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSF  174
              +V    E   +K+++ R V +++WCIQE+PSLRP+M+KV  MLEG V++  PP P  F
Sbjct  741  EALVEFDIEALNDKKKLARFVMVAIWCIQEDPSLRPTMRKVTQMLEGVVEVLDPPCPCPF  800



>ref|XP_006494281.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Citrus sinensis]
Length=804

 Score =   206 bits (525),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 137/180 (76%), Gaps = 3/180 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC TQIIHCDIKPQNIL+D+ + A+ISDFGLAK +  DQ++T+T +RGTK
Sbjct  621  IARGLLYLHEECSTQIIHCDIKPQNILLDDYYNARISDFGLAKLLLLDQSQTHTAIRGTK  680

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEW R M +TVK DVYSFG++LLE+I  R++VD  + + EA+L +W Y+C+  G  
Sbjct  681  GYVAPEWFRNMPITVKVDVYSFGVLLLEIICCRRNVDMEVNEAEALLTDWAYDCYCEGIT  740

Query  344  skvvg---eeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSF  174
              +V    E   +K+++ R V +++WCIQE+PSLRP+M+KV  MLEG V++  PP P  F
Sbjct  741  EALVEFDIEALNDKKKLARFVMVAIWCIQEDPSLRPTMRKVTQMLEGVVEVLDPPCPCPF  800



>ref|XP_006494283.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Citrus sinensis]
Length=743

 Score =   206 bits (524),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 140/183 (77%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTY-TIVRGT  528
            IARGLLYLHE+C  QIIHCDIKPQNIL+D+ + A+ISDFGLAK +  +Q++T  T +RGT
Sbjct  556  IARGLLYLHEDCRAQIIHCDIKPQNILLDDYYTARISDFGLAKLLTLNQSKTIKTAIRGT  615

Query  527  KGYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGe  348
            KGYVAPEW R   +T K DVYSFG++LLE+IS RKS D  + +E A+L +W ++C+  G+
Sbjct  616  KGYVAPEWFRNSKITAKVDVYSFGVLLLEIISCRKSFDIEMGEEYAILTDWAFDCYRNGK  675

Query  347  vskvvgeeevekrq---vermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            ++ +VGE++        + ++V +S+WCIQE+PSLRP+MKKVL MLEG V++ VPP+P  
Sbjct  676  LNVLVGEDKEAMNDIECLGKLVMVSIWCIQEDPSLRPTMKKVLQMLEGVVEVSVPPNPYP  735

Query  176  FLS  168
            F S
Sbjct  736  FSS  738



>gb|KHN27126.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Glycine soja]
Length=676

 Score =   205 bits (522),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 139/184 (76%), Gaps = 4/184 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGL+YLHEEC TQIIHCDIKPQNIL+D Q+ A+ISDFGL+K +K +++ T T +RGTK
Sbjct  488  IARGLVYLHEECCTQIIHCDIKPQNILLDEQYNARISDFGLSKLLKINESHTETGIRGTK  547

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEE-AVLEEWVYNCFEAGe  348
            GYVAP+W R   +T K DVYSFG++LLE+I  R++VD  + +EE A+L +W Y+C+ AG 
Sbjct  548  GYVAPDWFRSAPITTKVDVYSFGVLLLEIICCRRNVDGEVGNEEKAILTDWAYDCYRAGR  607

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               + +   E   +  ++ER V +++WC+QE+PSLRP MKKV+LMLEG   + +PPSP+ 
Sbjct  608  IDILLENDDEAIDDTNRLERFVMVAIWCLQEDPSLRPPMKKVMLMLEGIAPVTIPPSPSP  667

Query  176  FLSV  165
            + SV
Sbjct  668  YTSV  671



>ref|XP_007014867.1| CCHC-type integrase, putative [Theobroma cacao]
 gb|EOY32486.1| CCHC-type integrase, putative [Theobroma cacao]
Length=803

 Score =   206 bits (524),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 135/179 (75%), Gaps = 6/179 (3%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC TQIIHCDIKPQNIL+D  + AKISDFGLAK +  +Q+ T T +RGTK
Sbjct  617  IARGLLYLHEECSTQIIHCDIKPQNILLDEHYNAKISDFGLAKLLLLNQSHTNTAIRGTK  676

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCD--EEAVLEEWVYNCFEAG  351
            GYVAPEW R + +TVK DVYSFG+VLLEL   R+SVD + CD  E A+L +W Y+C+  G
Sbjct  677  GYVAPEWFRNLPITVKIDVYSFGVVLLELTCCRRSVDRN-CDLEERAILTDWAYDCYREG  735

Query  350  ---evskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSP  183
                + +   +   ++ +VER V++++WCIQE+PSLRP+M+K   MLEG V++P+PP P
Sbjct  736  ILDALVENDTDALNDRGKVERFVQVAIWCIQEDPSLRPTMRKATQMLEGVVEVPIPPCP  794



>ref|XP_009419167.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Musa acuminata subsp. malaccensis]
Length=801

 Score =   206 bits (524),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 139/183 (76%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC +QIIHCDIKPQN+L+D+  V +ISDFGLAK +K DQTRT T +RGTK
Sbjct  616  IARGLLYLHEECISQIIHCDIKPQNVLLDDNLVPRISDFGLAKLLKTDQTRTKTDIRGTK  675

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCD-EEAVLEEWVYNCFEAGe  348
            GYVAPEW +   VT K DVYSFG++LLE+I  R++VD  L + EEA+L  W  + F  G 
Sbjct  676  GYVAPEWFKNAGVTAKVDVYSFGVMLLEIICCRRNVDLELGEAEEAILTFWANDRFRDGR  735

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               + +   E  ++ R+VER V+++LWCIQEEPS+RP+M KV  ML+GTV +P+PP P+S
Sbjct  736  LDLLVEGDEEATLDMRRVERFVKVALWCIQEEPSMRPTMHKVAQMLDGTVAVPIPPDPSS  795

Query  176  FLS  168
            ++S
Sbjct  796  YIS  798



>ref|XP_003581087.2| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Brachypodium distachyon]
Length=843

 Score =   206 bits (524),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 137/183 (75%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC TQIIHCDIKP NIL+D  FVAKI+DFGLAK ++ +QT+T T +RGT+
Sbjct  658  VARGLLYLHEECSTQIIHCDIKPPNILLDENFVAKIADFGLAKLLRANQTQTNTGIRGTR  717

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEE-AVLEEWVYNCFEAGe  348
            GYVAPEW + +A+T K DVYSFG++LLEL+  R++V+  + DEE ++L  W  +C+  G 
Sbjct  718  GYVAPEWFKNIAITSKVDVYSFGVILLELVCCRRNVELEIADEEQSILTYWANDCYRCGR  777

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               + +   E     ++VER V ++LWC+QEEP++RP+M KV  ML+G V IP PP P+S
Sbjct  778  IDLLVEGDDEANFNIKKVERFVAVALWCLQEEPTMRPTMLKVTQMLDGAVQIPTPPDPSS  837

Query  176  FLS  168
            F+S
Sbjct  838  FIS  840



>gb|KDO56487.1| hypothetical protein CISIN_1g041921mg [Citrus sinensis]
Length=814

 Score =   206 bits (524),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 140/183 (77%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTY-TIVRGT  528
            IARGLLYLHE+C  QIIHCDIKPQNIL+D+ + A+ISDFGLAK +  +Q++T  T +RGT
Sbjct  627  IARGLLYLHEDCRAQIIHCDIKPQNILLDDYYTARISDFGLAKLLTLNQSKTIKTAIRGT  686

Query  527  KGYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGe  348
            KGYVAPEW R   +T K DVYSFG++LLE+IS RKS D  + +E A+L +W ++C+  G+
Sbjct  687  KGYVAPEWFRNSKITAKVDVYSFGVLLLEIISCRKSFDIEMGEEYAILTDWAFDCYRNGK  746

Query  347  vskvvgeeevekrq---vermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            ++ +VGE++        + ++V +S+WCIQE+PSLRP+MKKVL MLEG V++ VPP+P  
Sbjct  747  LNVLVGEDKEAMNDIECLGKLVMVSIWCIQEDPSLRPTMKKVLQMLEGVVEVSVPPNPYP  806

Query  176  FLS  168
            F S
Sbjct  807  FSS  809



>ref|XP_008219597.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Prunus mume]
Length=795

 Score =   206 bits (524),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 141/185 (76%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC++QIIHCDIKPQNIL+D+ F A+ISDFGLAK +K DQT T T +RGT+
Sbjct  610  IARGLLYLHEECNSQIIHCDIKPQNILLDDSFTARISDFGLAKFLKMDQTHTTTGMRGTR  669

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEA-VLEEWVYNCFEAGe  348
            GY+APEW + M +T K DVYS+GI+LLE+I  R++      DE+  VL +W Y+C+E  +
Sbjct  670  GYLAPEWFKNMPITGKVDVYSYGIMLLEIICCRRNFQEEAEDEDQMVLADWAYDCYEQKK  729

Query  347  vskvvgeeevek---rqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            V  ++  ++      +++E+ V I++WCIQE+PSLRP+ KK+ +MLEGTV++ +PP P+S
Sbjct  730  VHLLLQNDDEAMEDIKKLEKYVMIAIWCIQEDPSLRPTAKKLTMMLEGTVEVSIPPDPSS  789

Query  176  FLSVV  162
            F S +
Sbjct  790  FTSSI  794



>ref|XP_010245277.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 isoform X1 [Nelumbo nucifera]
Length=786

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 139/176 (79%), Gaps = 2/176 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IA+G+LYLHEEC+TQIIHCDIKPQNILM +    KI+DFGLA+ +KQDQT   T ++GT+
Sbjct  602  IAKGILYLHEECETQIIHCDIKPQNILMGHHQCPKIADFGLARLLKQDQTGILTGIKGTR  661

Query  524  GYVAPEWHR-KMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGe  348
            GYVAPEWHR  + +T K DVYSFG+VLLE+I  R+SVD +L + + VL +WVY+CFEAG 
Sbjct  662  GYVAPEWHRINVPITAKVDVYSFGVVLLEIICCRRSVDVNLPEGQVVLVDWVYDCFEAG-  720

Query  347  vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPT  180
                +  +EV  +++ERM+ + LWCIQ+EPS+RPSMKKV+++LEG  ++ VPP P+
Sbjct  721  EVGKLVGDEVIDKKLERMIWLGLWCIQDEPSIRPSMKKVVMVLEGNAEVAVPPGPS  776



>ref|XP_003532956.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Glycine max]
Length=816

 Score =   206 bits (524),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 137/181 (76%), Gaps = 4/181 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC TQIIHCDIKPQNIL+D+ + A+ISDFGLAK +  +Q+RT T +RGTK
Sbjct  631  IARGLLYLHEECSTQIIHCDIKPQNILLDDYYNARISDFGLAKLLNMNQSRTNTAIRGTK  690

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEE-AVLEEWVYNCFEAGe  348
            GYVA EW + M +T K DVYS+G++LLE++S RKSV++   DEE A+L EW Y+C+  G 
Sbjct  691  GYVALEWFKNMPITAKVDVYSYGVLLLEIVSCRKSVEFEAEDEEKAILAEWAYDCYIEGT  750

Query  347  vskvvgeeeve---krqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +  +V  ++      +  E++V I+LWC+QE+PSLRP+M+ V  MLEG V++ +PP P+ 
Sbjct  751  LHALVEGDKEALDDMKTFEKLVMIALWCVQEDPSLRPTMRNVTQMLEGVVEVKMPPCPSQ  810

Query  176  F  174
            F
Sbjct  811  F  811



>gb|KHN26772.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Glycine soja]
Length=816

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 137/181 (76%), Gaps = 4/181 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC TQIIHCDIKPQNIL+D+ + A+ISDFGLAK +  +Q+RT T +RGTK
Sbjct  631  IARGLLYLHEECSTQIIHCDIKPQNILLDDYYNARISDFGLAKLLNMNQSRTNTAIRGTK  690

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEE-AVLEEWVYNCFEAGe  348
            GYVA EW + M +T K DVYS+G++LLE++S RKSV++   DEE A+L EW Y+C+  G 
Sbjct  691  GYVALEWFKNMPITAKVDVYSYGVLLLEIVSCRKSVEFEAEDEEKAILAEWAYDCYIEGT  750

Query  347  vskvvgeeeve---krqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +  +V  ++      +  E++V I+LWC+QE+PSLRP+M+ V  MLEG V++ +PP P+ 
Sbjct  751  LHALVEGDKEALDDMKTFEKLVMIALWCVQEDPSLRPTMRNVTQMLEGVVEVKMPPCPSQ  810

Query  176  F  174
            F
Sbjct  811  F  811



>ref|XP_008777244.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Phoenix dactylifera]
Length=802

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 138/185 (75%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC  QIIHCDIKPQNIL+D+  VA+ISDFGLAK ++ DQTRT T +RGT+
Sbjct  617  IARGLLYLHEECSNQIIHCDIKPQNILLDDNLVARISDFGLAKLLRTDQTRTNTAIRGTR  676

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEA-VLEEWVYNCFEAGe  348
            GYVAPEW + + +T K DVYSFG++LLE++  RK V+  + +EE  +L  WV +C+  G 
Sbjct  677  GYVAPEWFKNIGITAKVDVYSFGVMLLEIVCCRKCVEQEVGNEERLILTYWVSDCYRDGM  736

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               V +   E   + ++VER V+++LWCIQEEPS+RP+M+KV  ML+G   IP PP P+S
Sbjct  737  LELVVEGDEEAAFDMKRVERFVKVALWCIQEEPSMRPTMQKVTQMLDGATSIPEPPDPSS  796

Query  176  FLSVV  162
            ++S +
Sbjct  797  YMSSI  801



>gb|EYU18006.1| hypothetical protein MIMGU_mgv1a001561mg [Erythranthe guttata]
Length=795

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 135/182 (74%), Gaps = 4/182 (2%)
 Frame = -2

Query  701  ARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTKG  522
            ARGL YLHEEC  QIIHCDIKPQN+L+D   VAKISDFGLAK ++ DQTRT T +RGT+G
Sbjct  614  ARGLCYLHEECTMQIIHCDIKPQNVLLDGSHVAKISDFGLAKLLRADQTRTNTGIRGTRG  673

Query  521  YVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEE-AVLEEWVYNCFEAGev  345
            YVAPEW R M +T K DVYS+GI+LLEL+  RK+    + DE   VL +W Y+C+  G +
Sbjct  674  YVAPEWFRNMPITAKVDVYSYGILLLELLCCRKNFLPDVEDENVVVLADWAYDCYRGGAI  733

Query  344  skvvgeeevek---rqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSF  174
              +  ++EV     +  E+ V +++WC+QE+P+LRP MK+V+ MLEG+V++P PP PTSF
Sbjct  734  RSLAADDEVAVDDLKLFEKFVMVAIWCVQEDPALRPHMKRVMHMLEGSVEVPAPPDPTSF  793

Query  173  LS  168
            ++
Sbjct  794  VT  795



>emb|CAE05486.2| OSJNBa0022H21.6 [Oryza sativa Japonica Group]
 gb|EAZ31072.1| hypothetical protein OsJ_15168 [Oryza sativa Japonica Group]
Length=794

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 138/181 (76%), Gaps = 4/181 (2%)
 Frame = -2

Query  698  RGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTKGY  519
            RGLLYLHEEC TQIIHCDIKPQNIL+DN   AKISDFGLAK ++ DQT+T T +RGT+GY
Sbjct  611  RGLLYLHEECSTQIIHCDIKPQNILLDNNLTAKISDFGLAKLLQMDQTQTTTGIRGTRGY  670

Query  518  VAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEE-AVLEEWVYNCFEAGe--  348
            VAPEW + +AVT K DVYSFG++LLE++  R++V+  + DE+ A+L +W  +C+ +G   
Sbjct  671  VAPEWFKNIAVTAKVDVYSFGVILLEIVCCRRNVEQDIIDEDRAILTDWANDCYRSGRID  730

Query  347  -vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFL  171
             + +   E   + ++V+R + ++LWCIQE+P++RP+M KV  ML+G V+I VPP P S++
Sbjct  731  LLVEGDEEASFDIKRVQRFLAVALWCIQEDPAMRPTMHKVTQMLDGAVEIAVPPDPASYI  790

Query  170  S  168
            S
Sbjct  791  S  791



>ref|XP_008384470.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Malus domestica]
Length=347

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 133/181 (73%), Gaps = 4/181 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +A+GLLYLHEEC TQIIHCDIKPQNIL+D+ +   ISDFGLAK +  +Q++T T +RGT+
Sbjct  165  VAKGLLYLHEECRTQIIHCDIKPQNILLDDYYTPLISDFGLAKLLLMNQSQTLTAIRGTR  224

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVD-WSLCDEEAVLEEWVYNCFEAGe  348
            GYVAPEW R + +T K DVYSFG+ LLE+I  R+SVD    C E+A+L  WVY+C+  GE
Sbjct  225  GYVAPEWFRSLPITTKVDVYSFGVXLLEIICCRRSVDNEGNCVEKAILTYWVYDCYIEGE  284

Query  347  vskvv---geeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +  VV    E   ++  +E+ V ++ WC QE+PSLRP+M KV+ MLEG  ++PVPP P+ 
Sbjct  285  LDAVVDHEVEALGDRTTLEKFVMVAJWCTQEDPSLRPTMMKVVQMLEGVAEVPVPPCPSP  344

Query  176  F  174
            +
Sbjct  345  Y  345



>gb|AIE56230.1| lectin receptor kinase [Oryza sativa Indica Group]
 gb|AIE56231.1| lectin receptor kinase [Oryza sativa Indica Group]
 gb|AIE56232.1| lectin receptor kinase [Oryza sativa Indica Group]
 gb|AIE56233.1| lectin receptor kinase [Oryza sativa Indica Group]
 gb|AIE56234.1| lectin receptor kinase [Oryza sativa Indica Group]
 gb|AIE56235.1| lectin receptor kinase [Oryza sativa Indica Group]
 gb|AIE56236.1| lectin receptor kinase [Oryza sativa Indica Group]
Length=811

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 137/183 (75%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            ++RGLLYLHEEC+ QIIHCD+KPQNIL+D+ FVAKISDFGLAK +  +QT+T T +RGT+
Sbjct  626  VSRGLLYLHEECNKQIIHCDMKPQNILLDDNFVAKISDFGLAKLLPVNQTQTNTGIRGTR  685

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEE-AVLEEWVYNCFEAGe  348
            GYVAPEW + + +T K DVYSFG++LLEL+  RK+V+  + DEE  +L  W  +C+  G 
Sbjct  686  GYVAPEWFKNIGITSKVDVYSFGVILLELVCCRKNVELEVADEEQTILTYWANDCYRCGR  745

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               +     E  +  ++VER V ++LWC+QEEPS+RP+M KV+ ML+G V IP PP P+S
Sbjct  746  IDLLVAGDDEAILNIKKVERFVAVALWCLQEEPSMRPTMHKVMQMLDGAVQIPTPPDPSS  805

Query  176  FLS  168
            ++S
Sbjct  806  YIS  808



>gb|EAY93043.1| hypothetical protein OsI_14842 [Oryza sativa Indica Group]
Length=811

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 136/183 (74%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            ++RGLLYLHEEC+ QIIHCD+KPQNIL+D+ FVAKISDFGLAK +  +QT+T T +RGT+
Sbjct  626  VSRGLLYLHEECNKQIIHCDMKPQNILLDDNFVAKISDFGLAKLLPVNQTQTNTGIRGTR  685

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEE-AVLEEWVYNCFEAGe  348
            GYVAPEW + + +T K DVYSFG++LLEL+  RK+V+  + DEE  +L  W  +C+  G 
Sbjct  686  GYVAPEWFKNIGITSKVDVYSFGVILLELVCCRKNVELEVADEEQTILTYWANDCYRCGR  745

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               +     E     ++VER V ++LWC+QEEPS+RP+M KV+ ML+G V IP PP P+S
Sbjct  746  IDLLVAGDDEAIFNIKKVERFVAVALWCLQEEPSMRPTMHKVMQMLDGAVQIPTPPDPSS  805

Query  176  FLS  168
            ++S
Sbjct  806  YIS  808



>ref|NP_001173790.1| Os04g0202350 [Oryza sativa Japonica Group]
 dbj|BAH92518.1| Os04g0202350 [Oryza sativa Japonica Group]
Length=680

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 135/183 (74%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            ++RGL YLHEEC+ QIIHCD+KPQNIL+D+ FVAKISDFGLAK +  +QT+T T +RGT+
Sbjct  495  VSRGLFYLHEECNKQIIHCDMKPQNILLDDNFVAKISDFGLAKLLPVNQTQTNTGIRGTR  554

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEE-AVLEEWVYNCFEAGe  348
            GYVAPEW + + +T K DVYSFG++LLEL+  RK+V+  + DEE  +L  W  +C+  G 
Sbjct  555  GYVAPEWFKNIGITSKVDVYSFGVILLELVCCRKNVELEVADEEQTILTYWANDCYRCGR  614

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               +     E     ++VER V ++LWC+QEEPS+RP+M KV+ ML+G V IP PP P+S
Sbjct  615  IDLLVASDDEAIFNIKKVERFVAVALWCLQEEPSMRPTMHKVMQMLDGAVQIPTPPDPSS  674

Query  176  FLS  168
            ++S
Sbjct  675  YIS  677



>gb|EEC77471.1| hypothetical protein OsI_16293 [Oryza sativa Indica Group]
Length=801

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 139/183 (76%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC TQIIHCDIKPQNIL+DN   AKISDFGLAK ++ DQT+T+T +RGT+
Sbjct  616  VARGLLYLHEECSTQIIHCDIKPQNILLDNNLTAKISDFGLAKLLRMDQTQTHTGIRGTR  675

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLC-DEEAVLEEWVYNCFEAGe  348
            GYVAPEW + +A+T K DVYSFG++LLE+I  R++V+  +  D+  +L +W  +C+ +G 
Sbjct  676  GYVAPEWFKNIAITAKVDVYSFGVILLEIICCRRNVEKDMTNDDREILTDWANDCYRSGR  735

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               + +   E   + ++V+R + ++LWCIQE+P++RP+M KV  ML+G V+I +PP P S
Sbjct  736  IDLLVEGDEEASFDIKRVQRFLAVALWCIQEDPAMRPTMHKVTQMLDGAVEIAMPPDPAS  795

Query  176  FLS  168
            ++S
Sbjct  796  YIS  798



>emb|CAE05487.2| OSJNBa0022H21.7 [Oryza sativa Japonica Group]
 gb|EAZ31073.1| hypothetical protein OsJ_15170 [Oryza sativa Japonica Group]
Length=801

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 139/183 (76%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC TQIIHCDIKPQNIL+DN   AKISDFGLAK ++ DQT+T+T +RGT+
Sbjct  616  VARGLLYLHEECSTQIIHCDIKPQNILLDNNLTAKISDFGLAKLLRMDQTQTHTGIRGTR  675

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLC-DEEAVLEEWVYNCFEAGe  348
            GYVAPEW + +A+T K DVYSFG++LLE+I  R++V+  +  D+  +L +W  +C+ +G 
Sbjct  676  GYVAPEWFKNIAITAKVDVYSFGVILLEIICCRRNVEKDMTNDDREILTDWANDCYRSGR  735

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               + +   E   + ++V+R + ++LWCIQE+P++RP+M KV  ML+G V+I +PP P S
Sbjct  736  IDLLVEGDEEASFDIKRVQRFLAVALWCIQEDPAMRPTMHKVTQMLDGAVEIAMPPDPAS  795

Query  176  FLS  168
            ++S
Sbjct  796  YIS  798



>ref|XP_003555643.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Glycine max]
Length=800

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 139/184 (76%), Gaps = 4/184 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGL+YLHEEC TQIIHCDIKPQNIL+D Q+ A+ISDFGL+K +K +++ T T +RGTK
Sbjct  612  IARGLVYLHEECCTQIIHCDIKPQNILLDEQYNARISDFGLSKLLKINESHTETGIRGTK  671

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEE-AVLEEWVYNCFEAGe  348
            GYVAP+W R   +T K DVYSFG++LLE+I  R++VD  + +EE A+L +W Y+C+ AG 
Sbjct  672  GYVAPDWFRSAPITTKVDVYSFGVLLLEIICCRRNVDGEVGNEEKAILTDWAYDCYRAGR  731

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               + +   E   +  ++ER V +++WC+QE+PSLRP MKKV+LMLEG   + +PPSP+ 
Sbjct  732  IDILLENDDEAIDDTNRLERFVMVAIWCLQEDPSLRPPMKKVMLMLEGIAPVTIPPSPSP  791

Query  176  FLSV  165
            + SV
Sbjct  792  YTSV  795



>emb|CAH67307.1| OSIGBa0106G07.3 [Oryza sativa Indica Group]
Length=800

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 139/183 (76%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC TQIIHCDIKPQNIL+DN   AKISDFGLAK ++ DQT+T+T +RGT+
Sbjct  615  VARGLLYLHEECSTQIIHCDIKPQNILLDNNLTAKISDFGLAKLLRMDQTQTHTGIRGTR  674

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLC-DEEAVLEEWVYNCFEAGe  348
            GYVAPEW + +A+T K DVYSFG++LLE+I  R++V+  +  D+  +L +W  +C+ +G 
Sbjct  675  GYVAPEWFKNIAITAKVDVYSFGVILLEIICCRRNVEKDMTNDDREILTDWANDCYRSGR  734

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               + +   E   + ++V+R + ++LWCIQE+P++RP+M KV  ML+G V+I +PP P S
Sbjct  735  IDLLVEGDEEASFDIKRVQRFLAVALWCIQEDPAMRPTMHKVTQMLDGAVEIAMPPDPAS  794

Query  176  FLS  168
            ++S
Sbjct  795  YIS  797



>ref|XP_008352793.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Malus domestica]
Length=688

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 138/185 (75%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC  +I+HCDIKPQNI +D+ F A+ISDFGLAK +K DQT T T +RGTK
Sbjct  503  IARGLLYLHEECSRKIVHCDIKPQNIJLDDSFTARISDFGLAKLLKIDQTLTTTGIRGTK  562

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAV-LEEWVYNCFEAGe  348
            GYVAPEW  ++ +T K D+YS+GI+LLE+I  RK  + +  DE+ V L +W Y+C++   
Sbjct  563  GYVAPEWLNRLPITAKVDIYSYGILLLEIIFCRKHFEXAAEDEDKVILADWAYDCYKQNN  622

Query  347  vskvvgeeevek---rqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            + ++   ++      +++E+ V I++WCIQE+PSLRP+MKKV LMLEGTV++  PP P S
Sbjct  623  LHQLFKNDDEAMHDIKKMEKYVMIAIWCIQEDPSLRPTMKKVALMLEGTVEVSAPPDPCS  682

Query  176  FLSVV  162
            F+S +
Sbjct  683  FISSI  687



>ref|XP_006369448.1| hypothetical protein POPTR_0001s23530g [Populus trichocarpa]
 gb|ERP66017.1| hypothetical protein POPTR_0001s23530g [Populus trichocarpa]
Length=714

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 137/184 (74%), Gaps = 4/184 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IAR L YLHEEC TQIIHCDIKPQNIL+D  F A+ISDFGLAK +  +QTRT+T +RGT+
Sbjct  530  IARALTYLHEECSTQIIHCDIKPQNILLDGTFTARISDFGLAKLLMNEQTRTHTAIRGTR  589

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDW-SLCDEEAVLEEWVYNCFEAGe  348
            GYVAPEW R M +T K DVYS+GI+LLE+I  RKS+D  +  +EE +L +W ++C++ G+
Sbjct  590  GYVAPEWFRNMPITAKVDVYSYGIMLLEIICCRKSLDMENEKEEEIILADWAHDCYKGGK  649

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               + K   E + + + +ER+V +S+WCIQE+PSLRPSM+ V  MLEG V +  PP P+ 
Sbjct  650  LDELVKADEEAKNDMKTLERLVMVSIWCIQEDPSLRPSMRTVTQMLEGIVQVSAPPCPSP  709

Query  176  FLSV  165
            F S+
Sbjct  710  FSSI  713



>ref|XP_010924062.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Elaeis guineensis]
Length=810

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 137/183 (75%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGL YLHEEC +QIIHCDIKP+NIL+D+ F A+ISDFGLAK + ++QTRT T +RGTK
Sbjct  625  VARGLSYLHEECSSQIIHCDIKPENILLDDCFTARISDFGLAKLLMREQTRTQTDIRGTK  684

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSL-CDEEAVLEEWVYNCFEAGe  348
            GYVAPEW +K A+T K DVYSFG++LLE++  RK++      D   +L +W Y+C+    
Sbjct  685  GYVAPEWFKKKAITAKVDVYSFGVMLLEIVCCRKNIAPEFGSDVRVILTDWAYDCYSEKR  744

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               + +   E    +R +ER+V ++LWCIQEEPS+RPSMKKV  MLEG V++PVPP+PTS
Sbjct  745  LDILVERDEEAMSNRRMLERLVAVALWCIQEEPSMRPSMKKVTQMLEGAVEVPVPPAPTS  804

Query  176  FLS  168
             +S
Sbjct  805  LIS  807



>ref|XP_008367506.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Malus domestica]
Length=601

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 135/181 (75%), Gaps = 4/181 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +A+GLLYLHEEC TQIIHCDIKPQNIL+++ +   ISDFGLAK +  +Q++T T +RGTK
Sbjct  419  VAKGLLYLHEECRTQIIHCDIKPQNILLBDYYTPLISDFGLAKLLLMNQSQTLTAIRGTK  478

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDW-SLCDEEAVLEEWVYNCFEAGe  348
            GYVAPEW R +A+T K DVYSFG+VLLE+I  R+SVD    C+E+A+L  WVY+C+  G 
Sbjct  479  GYVAPEWFRNLAITTKVDVYSFGVVLLEIICCRRSVDREGNCEEKAILMYWVYDCYIEGV  538

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               V     E   ++  +E+ V +++WCIQE+PSLRP+M KV+ MLEG  ++PVPP P+ 
Sbjct  539  LDDVVDHEVEALGDRTTLEKFVMVAIWCIQEDPSLRPTMMKVVQMLEGVAEVPVPPCPSP  598

Query  176  F  174
            +
Sbjct  599  Y  599



>ref|XP_009364697.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Pyrus x bretschneideri]
Length=803

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 140/185 (76%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC +QI+HCDIKPQNIL+D+   A+ISDFGLAK ++ DQT T T +RGTK
Sbjct  618  IARGLLYLHEECSSQIVHCDIKPQNILLDDSLTARISDFGLAKLLRIDQTLTTTGIRGTK  677

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDE-EAVLEEWVYNCFEAGe  348
            GYVAPEW +++ +T K D+YS+GI+LLE+I  RK  +  + DE + +L +W Y+C++  +
Sbjct  678  GYVAPEWWKRLPITAKVDIYSYGILLLEIIFCRKHFEAEVEDEGQMILADWAYDCYKQNK  737

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               + K   E   + + VE+ V I++WCIQE+PSLRP+MKKV LMLEGTV++  PP P+S
Sbjct  738  LHELFKNNDEAMHDMKMVEKYVMIAIWCIQEDPSLRPTMKKVTLMLEGTVEVSAPPDPSS  797

Query  176  FLSVV  162
            F+S +
Sbjct  798  FISSI  802



>ref|XP_006445952.1| hypothetical protein CICLE_v10017711mg [Citrus clementina]
 gb|ESR59192.1| hypothetical protein CICLE_v10017711mg [Citrus clementina]
Length=789

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 140/183 (77%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTY-TIVRGT  528
            IARGLLYLHE+C  QIIHCDIKPQNIL+D+ + A+ISDFGLAK +  +Q++T  T +RGT
Sbjct  602  IARGLLYLHEDCRAQIIHCDIKPQNILLDDYYTARISDFGLAKLLTLNQSKTIKTAIRGT  661

Query  527  KGYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGe  348
            KGYVAPEW R   +T K DVYSFG++LLE+IS RKS D  + ++ A+L +W ++C+  G+
Sbjct  662  KGYVAPEWFRNSKITAKVDVYSFGVLLLEIISCRKSFDIEMGEQYAILTDWAFDCYRNGK  721

Query  347  vskvvgeeevekrq---vermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            ++ +VGE++        + ++V +S+WCIQE+PSLRP+MKKVL MLEG V++ VPP+P  
Sbjct  722  LNVLVGEDKEAMNDIECLGKLVMVSIWCIQEDPSLRPTMKKVLQMLEGVVEVSVPPNPYP  781

Query  176  FLS  168
            F S
Sbjct  782  FSS  784



>ref|XP_008349451.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Malus domestica]
Length=503

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 139/185 (75%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGL YLHEEC +QI+HCDIKPQNIL+D+ F A ISDFGLAK ++ DQT T T +RGTK
Sbjct  318  IARGLFYLHEECSSQIVHCDIKPQNILLDDSFTAXISDFGLAKLLRIDQTLTMTGIRGTK  377

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEA-VLEEWVYNCF---E  357
            GYVAPEW +++ +T K D+YS+GI+LLE+I  +K  + +  DE+  +L +W Y+C+   E
Sbjct  378  GYVAPEWWKRLPITAKVDIYSYGILLLEIIFCKKHFEAAAEDEDPMILADWAYDCYKQNE  437

Query  356  AGevskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
              ++ K   E   + +++E+ V I++WCIQE+P LRP+MKKV LMLEGTV++  PP P+S
Sbjct  438  LHQLLKNDDEAMHDMKEMEKYVMIAIWCIQEDPLLRPTMKKVTLMLEGTVEVSAPPDPSS  497

Query  176  FLSVV  162
            F+S +
Sbjct  498  FISSI  502



>ref|XP_004292535.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Fragaria vesca subsp. vesca]
Length=775

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 140/177 (79%), Gaps = 2/177 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQD-QTRTYTIVRGT  528
            +ARG+LYLHEECDTQIIHCDIKP+NILM  Q  AK++DFGLAK +K D Q+ T T  RGT
Sbjct  593  VARGILYLHEECDTQIIHCDIKPENILMSEQKCAKLADFGLAKLLKADHQSGTNTGFRGT  652

Query  527  KGYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGe  348
            +GYVAPEWHR + ++VKADVYSFG+VLLE+I  ++ ++ ++ D E  LE W+Y C EA E
Sbjct  653  RGYVAPEWHRNLTISVKADVYSFGVVLLEIICCQRGMNMAIPD-EVTLENWMYRCLEANE  711

Query  347  vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            + K+V ++E++  ++  MV++ L CIQE+PS RPSMKKV+LMLEG ++IP PP+P S
Sbjct  712  LEKLVKDDEIDTSKLREMVKLGLCCIQEKPSFRPSMKKVVLMLEGILEIPSPPNPFS  768



>ref|XP_006386078.1| hypothetical protein POPTR_0003s21900g [Populus trichocarpa]
 gb|ERP63875.1| hypothetical protein POPTR_0003s21900g [Populus trichocarpa]
Length=791

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 139/183 (76%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC  QIIHCDIKPQNIL+D  + A+ISDFGLAK +  DQ++T+T +RGTK
Sbjct  603  VARGLLYLHEECSNQIIHCDIKPQNILLDEYYNARISDFGLAKLLLLDQSQTHTAIRGTK  662

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLC-DEEAVLEEWVYNCFEAGe  348
            GYVAPEW R + VTVK DVYS+G++LLE+I  R++V+  +  +E+A+L +W Y+C+  G 
Sbjct  663  GYVAPEWFRNLPVTVKVDVYSYGVLLLEIICCRRNVESKVTIEEQAILTDWAYDCYREGT  722

Query  347  vskvvgeeevek---rqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +  +VG +        ++ER + I+ WCIQE+PSLRP+M+KV  MLEG V++PVPPS  +
Sbjct  723  LDALVGSDTGALDDIEKLERFLMIAFWCIQEDPSLRPTMRKVTQMLEGVVEVPVPPSLPA  782

Query  176  FLS  168
             LS
Sbjct  783  LLS  785



>ref|XP_010909410.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Elaeis guineensis]
Length=774

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 137/176 (78%), Gaps = 1/176 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARG+LYLHEECDT+IIHCDIKPQNILMD+ + AK+SDFGLAK +   QTRT+T +RGT+
Sbjct  598  VARGILYLHEECDTRIIHCDIKPQNILMDDNWTAKLSDFGLAKLLTPSQTRTFTCIRGTR  657

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GY+APEWH+   +TVKADVYSFGIVLLE++  RK+++     +  VL +WV  CF +G  
Sbjct  658  GYLAPEWHKNAPITVKADVYSFGIVLLEIVCCRKNMELEAEVDAIVLLDWVSQCFASG-E  716

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
             + +  +EV+  +++R+V++ LWC Q EP+LRP+MK V++MLEG +++ +PP P S
Sbjct  717  LEKLISDEVDMTELDRLVKVGLWCTQSEPALRPAMKNVVMMLEGNIEVSLPPRPDS  772



>emb|CAE03339.2| OSJNBb0005B05.6 [Oryza sativa Japonica Group]
 gb|EAZ29746.1| hypothetical protein OsJ_13805 [Oryza sativa Japonica Group]
Length=811

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 135/183 (74%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            ++RGL YLHEEC+ QIIHCD+KPQNIL+D+ FVAKISDFGLAK +  +QT+T T +RGT+
Sbjct  626  VSRGLFYLHEECNKQIIHCDMKPQNILLDDNFVAKISDFGLAKLLPVNQTQTNTGIRGTR  685

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEE-AVLEEWVYNCFEAGe  348
            GYVAPEW + + +T K DVYSFG++LLEL+  RK+V+  + DEE  +L  W  +C+  G 
Sbjct  686  GYVAPEWFKNIGITSKVDVYSFGVILLELVCCRKNVELEVADEEQTILTYWANDCYRCGR  745

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               +     E     ++VER V ++LWC+QEEPS+RP+M KV+ ML+G V IP PP P+S
Sbjct  746  IDLLVASDDEAIFNIKKVERFVAVALWCLQEEPSMRPTMHKVMQMLDGAVQIPTPPDPSS  805

Query  176  FLS  168
            ++S
Sbjct  806  YIS  808



>gb|AIE56245.1| lectin receptor kinase [Oryza sativa Japonica Group]
Length=810

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 137/183 (75%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC+ QIIHCD+KPQNIL+D+ FVAKISDFGLAK +  +QT+T T +RGT+
Sbjct  625  VARGLLYLHEECNKQIIHCDMKPQNILLDDNFVAKISDFGLAKLLPVNQTQTNTGIRGTR  684

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEE-AVLEEWVYNCFEAGe  348
            GYVAPEW + + +T K DVYSFG++LLEL+  RK+V+  + DEE  +L  W  +C++ G 
Sbjct  685  GYVAPEWFKNIGITSKVDVYSFGVILLELVCCRKNVELEVLDEEQTILTYWANDCYKCGR  744

Query  347  vskvvge---eevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +  +V          ++VER V ++LWC+QEEPS+RP+M KV  ML+G V IP PP P+S
Sbjct  745  IDLLVAGDDEAIFNIKKVERFVAVALWCLQEEPSMRPTMLKVTQMLDGAVQIPTPPDPSS  804

Query  176  FLS  168
            ++S
Sbjct  805  YIS  807



>ref|XP_006386090.1| hypothetical protein POPTR_0003s220001g, partial [Populus trichocarpa]
 gb|ERP63887.1| hypothetical protein POPTR_0003s220001g, partial [Populus trichocarpa]
Length=572

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 134/183 (73%), Gaps = 3/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC +QIIHCDIKPQNIL+D  F A+ISDFGLAK +K DQT+T T +RGTK
Sbjct  382  IARGLLYLHEECSSQIIHCDIKPQNILLDKSFNARISDFGLAKLLKTDQTKTTTAIRGTK  441

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGe-  348
            GYVAPEW + + VT K D YSFGI+LLEL+  RK+ D    + + VL +W  +C + G+ 
Sbjct  442  GYVAPEWFKNLPVTTKVDTYSFGILLLELVCCRKNFDIDKKEGQIVLADWACDCLKEGKL  501

Query  347  --vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSF  174
              + +   E   + + VER V +++WCIQ++PS+RP MKKV+ MLEG V + +PP  +SF
Sbjct  502  DLLVEEDEEATEDMKTVERFVMVAIWCIQDDPSVRPGMKKVVQMLEGAVQVSIPPDFSSF  561

Query  173  LSV  165
            +S+
Sbjct  562  ISI  564



>ref|XP_009374772.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Pyrus x bretschneideri]
Length=798

 Score =   204 bits (519),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 138/185 (75%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC  +I+HCDIKPQNIL+D+ F A+ISDFGLAK +K DQT T T +RGTK
Sbjct  613  IARGLLYLHEECSRKIVHCDIKPQNILLDDSFAARISDFGLAKLLKIDQTLTTTGIRGTK  672

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEA-VLEEWVYNCFEAGe  348
            GYVAPEW  ++ +T K D+YS+GI+LLE+I  RK  + +  DE+  +L +W Y+C++   
Sbjct  673  GYVAPEWLNRLPITAKVDIYSYGILLLEIIFCRKHFEAAAEDEDQMILADWAYDCYKQNN  732

Query  347  vskvvgeeevek---rqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            + ++   +       +++E+ V I++WCIQE+PSLRP+MKKV LMLEGTV++  PP P S
Sbjct  733  LHQLFKNDHEAMHDIKKMEKYVMIAIWCIQEDPSLRPTMKKVALMLEGTVEVSAPPDPCS  792

Query  176  FLSVV  162
            F+S +
Sbjct  793  FISSI  797



>ref|XP_009387513.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Musa acuminata subsp. malaccensis]
Length=791

 Score =   204 bits (519),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 135/176 (77%), Gaps = 1/176 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+ YLH+EC+  IIHCDIKPQNILMD+ + AKISDFGLAK +   QTRT+T +RGT+
Sbjct  615  IARGIHYLHDECEASIIHCDIKPQNILMDDNWTAKISDFGLAKLLMPSQTRTFTGIRGTR  674

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GY+APEWH+   +TVKADVYSFGI+LLE++  RK+++     +E +L +WVY CF  G  
Sbjct  675  GYLAPEWHKNAPITVKADVYSFGIMLLEIVCCRKNMELEAEVDEIMLLDWVYGCFVTG-A  733

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
             + +  +E +  ++ R+V++ LWCIQ EP+ RP+MK V++MLEG++DI +PP PTS
Sbjct  734  LENLVPDEADMTELNRLVKVGLWCIQSEPASRPNMKNVVMMLEGSIDISIPPPPTS  789



>ref|XP_010649413.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 isoform X1 [Vitis vinifera]
 ref|XP_010649414.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 isoform X2 [Vitis vinifera]
Length=796

 Score =   204 bits (519),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 140/177 (79%), Gaps = 1/177 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARG+LYLHEEC+T IIHCDIKPQNILMD    AKISDFGLAK +  DQTRT+T VRGT+
Sbjct  617  VARGILYLHEECETPIIHCDIKPQNILMDEFLNAKISDFGLAKLLMPDQTRTFTGVRGTR  676

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCD-EEAVLEEWVYNCFEAGe  348
            GY+APEW R   ++VKAD+YS+GIVLLE++  RK+++  + + EE +L  WVY C  + E
Sbjct  677  GYLAPEWQRNTPISVKADIYSYGIVLLEIVCCRKNMEVQVKNPEEIILSNWVYQCMVSRE  736

Query  347  vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            + K+V +E  +K+ +ERMV++ LWCIQ+EP+LRPSMK V+L+LEG  DI VPP PT+
Sbjct  737  LDKLVADEVADKKTLERMVKVGLWCIQDEPALRPSMKSVVLILEGITDIVVPPCPTT  793



>ref|XP_006386079.1| hypothetical protein POPTR_0003s21910g [Populus trichocarpa]
 gb|ERP63876.1| hypothetical protein POPTR_0003s21910g [Populus trichocarpa]
Length=791

 Score =   204 bits (519),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 136/184 (74%), Gaps = 4/184 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC TQIIHCDIKPQNIL+DN + A+ISDFGLAK +  DQ++T T +RGTK
Sbjct  603  IARGLLYLHEECGTQIIHCDIKPQNILLDNYYNARISDFGLAKLLVMDQSKTQTAIRGTK  662

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCD-EEAVLEEWVYNCFEAGe  348
            GYVAPEW R   +TVK DVYSFG++LLE+I  R++VD  + + E  VL +W Y+C+  G 
Sbjct  663  GYVAPEWFRNRPITVKVDVYSFGVMLLEIICCRRNVDLEIGEVENPVLTDWAYDCYMDGS  722

Query  347  vs---kvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +        E + +   +ER++++ +WCIQE+PSLRP+M+KV  MLEG V++P  P+P  
Sbjct  723  LDVLIGDDTEAKNDISTLERLLKVGIWCIQEDPSLRPTMRKVTQMLEGVVEVPAAPNPFP  782

Query  176  FLSV  165
            + S+
Sbjct  783  YSSI  786



>gb|AIE56238.1| lectin receptor kinase [Oryza sativa Indica Group]
 gb|AIE56239.1| lectin receptor kinase [Oryza sativa Indica Group]
 gb|AIE56240.1| lectin receptor kinase [Oryza sativa Indica Group]
 gb|AIE56241.1| lectin receptor kinase [Oryza sativa Indica Group]
 gb|AIE56242.1| lectin receptor kinase [Oryza sativa Indica Group]
 gb|AIE56243.1| lectin receptor kinase [Oryza sativa Indica Group]
 gb|AIE56244.1| lectin receptor kinase [Oryza sativa Indica Group]
Length=811

 Score =   204 bits (519),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 136/183 (74%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC+ QIIHCD+KPQNIL+D+ FVAKISDFGLAK +  +QT+T T +RGT+
Sbjct  626  VARGLLYLHEECNKQIIHCDMKPQNILLDDNFVAKISDFGLAKLLPVNQTQTNTGIRGTR  685

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEE-AVLEEWVYNCFEAGe  348
            GYVAPEW + + +T K DVYSFG++LLEL+  RK+V+  + DEE  +L  W  +C++ G 
Sbjct  686  GYVAPEWFKNIGITSKVDVYSFGVILLELVCCRKNVELEVLDEEQTILTYWANDCYKCGR  745

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               +     E     ++VER V ++LWC+QEEPS+RP+M KV  ML+G V IP PP P+S
Sbjct  746  IDLLVAGDDEAIFNIKKVERFVAVALWCLQEEPSMRPTMLKVTQMLDGAVQIPTPPDPSS  805

Query  176  FLS  168
            ++S
Sbjct  806  YIS  808



>ref|XP_009364767.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Pyrus x bretschneideri]
Length=804

 Score =   204 bits (519),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 140/185 (76%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC +QI+HCDIKPQNIL+D+   A+ISDFGLAK ++ DQT T T +RGTK
Sbjct  619  IARGLLYLHEECSSQIVHCDIKPQNILLDDSLTARISDFGLAKLLRIDQTLTTTGIRGTK  678

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDE-EAVLEEWVYNCFEAGe  348
            GYVAPEW +++ +T K D+YS+GI+LLE+I  RK  +  + DE + +L +W Y+C++  +
Sbjct  679  GYVAPEWWKRLPITAKVDIYSYGILLLEIIFCRKHFEAKVEDEGQMILADWAYDCYKQNK  738

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               + K   E   + + VE+ V I++WCIQE+PSLRP+MKKV LMLEGT+++  PP P+S
Sbjct  739  LHELFKNNDEAMHDMKMVEKYVMIAIWCIQEDPSLRPTMKKVALMLEGTIEVSAPPDPSS  798

Query  176  FLSVV  162
            F+S +
Sbjct  799  FISSI  803



>ref|XP_009364783.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Pyrus x bretschneideri]
Length=793

 Score =   204 bits (519),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 140/185 (76%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC +QI+HCDIKPQNIL+D+   A+ISDFGLAK ++ DQT T T +RGTK
Sbjct  608  IARGLLYLHEECSSQIVHCDIKPQNILLDDSLTARISDFGLAKLLRIDQTLTTTGIRGTK  667

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDE-EAVLEEWVYNCFEAGe  348
            GYVAPEW +++ +T K D+YS+GI+LLE+I  RK  +  + DE + +L +W Y+C++  +
Sbjct  668  GYVAPEWWKRLPITAKVDIYSYGILLLEIIFCRKHFEAKVEDEGQMILADWAYDCYKQNK  727

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               + K   E   + + VE+ V I++WCIQE+PSLRP+MKKV LMLEGT+++  PP P+S
Sbjct  728  LHELFKNNDEAMHDMKMVEKYVMIAIWCIQEDPSLRPTMKKVALMLEGTIEVSAPPDPSS  787

Query  176  FLSVV  162
            F+S +
Sbjct  788  FISSI  792



>ref|XP_003572669.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Brachypodium distachyon]
Length=796

 Score =   204 bits (519),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 137/183 (75%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC+TQIIHCDIKPQNIL+D   VAKISDFGLAK ++ +QT+T T +RGT+
Sbjct  611  VARGLLYLHEECNTQIIHCDIKPQNILLDENLVAKISDFGLAKLLRTNQTQTNTGIRGTR  670

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEE-AVLEEWVYNCFEAGe  348
            GYVAPEW + + +T K D+YSFG++LLE +  R++V+    DEE A+L  W  +C+ +G 
Sbjct  671  GYVAPEWFKNIGITSKVDIYSFGVILLETVCCRRNVELETDDEEQAILTYWANDCYRSGR  730

Query  347  vskvvge---eevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +  +V          ++VER V ++LWC+QEEP++RP+M KV  ML+G+V IP PP P+S
Sbjct  731  LDLLVEGDDEAIFNMKKVERFVAVALWCLQEEPTMRPTMLKVTQMLDGSVTIPTPPDPSS  790

Query  176  FLS  168
            F+S
Sbjct  791  FIS  793



>ref|XP_004308204.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Fragaria vesca subsp. vesca]
Length=800

 Score =   204 bits (519),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 140/184 (76%), Gaps = 4/184 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGL+YLH+EC TQIIHCDIKP NIL+D+ F A+ISDFGLAK +  DQT T+T++RGT+
Sbjct  616  IARGLMYLHDECSTQIIHCDIKPPNILLDDSFTARISDFGLAKLLLTDQTLTHTVIRGTR  675

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAV-LEEWVYNCFEA--  354
            GYVAPEW R   VT K DVYS+G++LLE+I  R+S++    +EE V L +WVY+C++   
Sbjct  676  GYVAPEWFRNTPVTAKVDVYSYGVMLLEIICCRRSLEIERENEEQVILTDWVYDCYKQRR  735

Query  353  -GevskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
              E+ +   E   + ++VER+V +++WCIQE+PSLRP MKKV  MLEG VD+ VPPSP+ 
Sbjct  736  LNELIEDDEEARNDMKRVERLVMVAIWCIQEDPSLRPPMKKVTQMLEGVVDVSVPPSPSH  795

Query  176  FLSV  165
            F S+
Sbjct  796  FSSI  799



>ref|XP_006577592.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Glycine max]
Length=1166

 Score =   206 bits (525),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 139/183 (76%), Gaps = 3/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC TQIIHCDIKPQNIL+D+ + A+ISDFGLAK +  +Q+RT T +RGTK
Sbjct  620  VARGLLYLHEECSTQIIHCDIKPQNILLDDYYNARISDFGLAKILNMNQSRTNTAIRGTK  679

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGe-  348
            GYVA EW + M +T K DVYS+G++LLE++S RKSV++   +E+A+L EW ++C+  G  
Sbjct  680  GYVALEWFKNMPITAKVDVYSYGVLLLEIVSCRKSVEFEADEEKAILTEWAFDCYTEGVL  739

Query  347  --vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSF  174
              + +   E   + + +E++V I+LWC+QE+P LRP+M+ V  MLEG V++ +PP P+S 
Sbjct  740  HDLVENDKEALDDMKTLEKLVMIALWCVQEDPGLRPTMRNVTQMLEGVVEVQIPPCPSSQ  799

Query  173  LSV  165
            LS+
Sbjct  800  LSI  802



>ref|NP_001052227.1| Os04g0202500 [Oryza sativa Japonica Group]
 dbj|BAF14141.1| Os04g0202500 [Oryza sativa Japonica Group]
Length=807

 Score =   204 bits (518),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 136/183 (74%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC+ QIIHCD+KPQNIL+D+ FVAKISDFGLAK +  +QT+T T +RGT+
Sbjct  622  VARGLLYLHEECNKQIIHCDMKPQNILLDDNFVAKISDFGLAKLLPVNQTQTNTGIRGTR  681

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEE-AVLEEWVYNCFEAGe  348
            GYVAPEW + + +T K DVYSFG++LLEL+  RK+V+  + DEE  +L  W  +C++ G 
Sbjct  682  GYVAPEWFKNIGITSKVDVYSFGVILLELVCCRKNVELEVLDEEQTILTYWANDCYKCGR  741

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               +     E     ++VER V ++LWC+QEEPS+RP+M KV  ML+G V IP PP P+S
Sbjct  742  IDLLVAGDDEAIFNIKKVERFVAVALWCLQEEPSMRPTMLKVTQMLDGAVQIPTPPDPSS  801

Query  176  FLS  168
            ++S
Sbjct  802  YIS  804



>ref|XP_010248194.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nelumbo nucifera]
Length=800

 Score =   204 bits (518),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 142/181 (78%), Gaps = 2/181 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +A+G+LYLHEEC+  IIHCDIKPQNILMD+ + AKISDFGLAK +  DQTRT+T VRGT+
Sbjct  612  VAKGILYLHEECEAPIIHCDIKPQNILMDDFWTAKISDFGLAKLLMPDQTRTFTQVRGTR  671

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCD-EEAVLEEWVYNCFEAGe  348
            GY+APEW R   ++VK DVYS+G+VLLE++  R+++D +    +E VL  WVY CF   +
Sbjct  672  GYLAPEWQRNTPISVKTDVYSYGVVLLEIVCCRRNMDVTASTPDEIVLSTWVYYCFVTRQ  731

Query  347  vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPT-SFL  171
            +  ++ +E+V+ R +E MV++ LWCIQ+EP LRPSMK V+LMLEG +++PVPP+P  SF+
Sbjct  732  LKMLIRDEDVDMRTLETMVKVGLWCIQDEPVLRPSMKAVVLMLEGIIEVPVPPTPNPSFV  791

Query  170  S  168
            S
Sbjct  792  S  792



>ref|XP_011013447.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Populus euphratica]
Length=811

 Score =   204 bits (518),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 139/185 (75%), Gaps = 6/185 (3%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IAR L YLHEEC TQIIHCDIKPQNIL+D+ F A+ISDFGLAK +  +QTRT+T +RGT+
Sbjct  627  IARALTYLHEECSTQIIHCDIKPQNILLDDTFTARISDFGLAKLLMNEQTRTHTAIRGTR  686

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLC--DEEAVLEEWVYNCFEAG  351
            GYVAPEW R M +T K DVYS+GI+LLE+I  RKS+    C  +EE +L +W ++C++ G
Sbjct  687  GYVAPEWFRNMPITAKVDVYSYGIMLLEIICCRKSLAME-CEKEEEIILADWAHDCYKGG  745

Query  350  e---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPT  180
            +   + K   E + + + +ER+V +S+WCIQE+PSLRPSM+ V  MLEG V++ VPP P+
Sbjct  746  KLDELVKADVEAKNDMKTLERLVMVSIWCIQEDPSLRPSMRTVTQMLEGIVEVSVPPCPS  805

Query  179  SFLSV  165
             F S+
Sbjct  806  PFSSI  810



>ref|XP_008243609.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Prunus mume]
Length=807

 Score =   204 bits (518),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 136/181 (75%), Gaps = 4/181 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IA+GL YLHEEC T IIHCDIKPQNIL+D+ + A+I+DFGLAK +  +Q+ T+T +RGTK
Sbjct  623  IAKGLEYLHEECSTPIIHCDIKPQNILLDDYYTARIADFGLAKLLMMNQSHTHTAIRGTK  682

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVD-WSLCDEEAVLEEWVYNCFEAGe  348
            GYVAPEW R M +T K DVYSFG+VLLE+I  R+SVD  + C+ +A+L  WVY+C++ G+
Sbjct  683  GYVAPEWFRNMPITTKVDVYSFGVVLLEIICCRRSVDVENSCEGKAILTNWVYDCYQEGK  742

Query  347  vskvvgeeevekrqvermvRI---SLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +  V+  E       + + +I   ++WCIQE+P+LRP+M+KV+ MLEG V++  PP P+S
Sbjct  743  IDAVLDHETEALHDKKNLEKIVMVAIWCIQEDPALRPTMRKVVQMLEGVVEVHAPPCPSS  802

Query  176  F  174
            +
Sbjct  803  Y  803



>ref|XP_008219573.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Prunus mume]
Length=797

 Score =   203 bits (517),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 140/185 (76%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHE+C +QI+HCDIKPQNIL+D+   A+ISDFGLAK +K DQT T T +RGTK
Sbjct  612  IARGLLYLHEDCSSQIVHCDIKPQNILLDDSIGARISDFGLAKLLKMDQTHTTTRIRGTK  671

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEA-VLEEWVYNCFEAGe  348
            GYVAPEW + + +T+K DVYS+GI+LLE++  R++ +    DE+  +L +W Y+C+E  +
Sbjct  672  GYVAPEWFKNLPITLKVDVYSYGILLLEILCCRRNFEQQAEDEDQMILADWAYDCYEQKK  731

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               + K   E   + + +E+ V I++WCIQE+PSLRP+ KK+ LMLEGTV++ +PP+P+S
Sbjct  732  LHLLFKNDNEAMEDMKTMEKYVMIAIWCIQEDPSLRPTTKKLTLMLEGTVEVSIPPNPSS  791

Query  176  FLSVV  162
            F S +
Sbjct  792  FTSSI  796



>ref|XP_008779807.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Phoenix dactylifera]
Length=437

 Score =   198 bits (503),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 134/174 (77%), Gaps = 1/174 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+ YLHE+C+T+IIHCDIKP+NILMD+ + AKISDFGLAK +   QTRT+T +RGT+
Sbjct  261  IARGIHYLHEDCETRIIHCDIKPENILMDDNWTAKISDFGLAKLLMPSQTRTFTGIRGTR  320

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GY+APEWH+   ++VKADVYSFGIVLLE++  R++++     +  +L +WV++CF  G  
Sbjct  321  GYLAPEWHKNAPISVKADVYSFGIVLLEIVCCRRNMELEAEADAIILLDWVHDCFMNG-E  379

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSP  183
             + +  +EV+  ++ R+VR+ LWCIQ EP  RPSMK V++MLEG V IP+PP P
Sbjct  380  LEKLVPDEVDTTELNRLVRVGLWCIQSEPGSRPSMKNVVMMLEGNVGIPLPPPP  433



>ref|XP_010087375.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Morus notabilis]
 gb|EXB28985.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Morus notabilis]
Length=821

 Score =   203 bits (517),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 137/185 (74%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IA+GLLYLHEEC +QIIHCDIKPQNIL+D+ + AKISDFGLAK +  +Q++T+T +RGTK
Sbjct  636  IAKGLLYLHEECSSQIIHCDIKPQNILLDDYYNAKISDFGLAKLLMMNQSQTHTAIRGTK  695

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDE-EAVLEEWVYNCFEAGe  348
            GYVAPEW R M +T K DVYSFG+VLLE+I  R+SVD    DE + +L +W Y+CF  G 
Sbjct  696  GYVAPEWFRNMPITAKVDVYSFGVVLLEIICCRRSVDSESNDEGKEILTDWAYDCFVEGA  755

Query  347  vskv---vgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            ++ +     E   + +++E  +++S+WCIQE P+LRP+M+KV+ MLEG V++  PP P  
Sbjct  756  LNVLVNWEAEALDDIKKLETYLKVSMWCIQENPALRPTMRKVVQMLEGVVEVHAPPCPYP  815

Query  176  FLSVV  162
              SV 
Sbjct  816  AYSVT  820



>ref|XP_004508500.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Cicer arietinum]
Length=808

 Score =   203 bits (516),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 140/177 (79%), Gaps = 1/177 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLHEEC+  IIHCDIKPQNILMD  + AKISDFGLAK +  DQTRT+T++RGT+
Sbjct  629  IARGILYLHEECEAPIIHCDIKPQNILMDEFWTAKISDFGLAKLLMPDQTRTFTVIRGTR  688

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCD-EEAVLEEWVYNCFEAGe  348
            GY+APEW++   +++KADVYS+GIVLLE +  R+++D ++ + EE +L  W Y CF A E
Sbjct  689  GYMAPEWNKNTPISLKADVYSYGIVLLETLCCRRNLDVNVLEPEEILLSGWAYKCFVARE  748

Query  347  vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            V+K+V  E +++  +E MV+++LWCIQ+EP LRP+MK V+LMLEG  DI +PP P S
Sbjct  749  VNKLVPSEVIDENVMENMVKVALWCIQDEPLLRPTMKGVVLMLEGITDIAIPPCPDS  805



>ref|XP_006445947.1| hypothetical protein CICLE_v10018049mg [Citrus clementina]
 gb|ESR59187.1| hypothetical protein CICLE_v10018049mg [Citrus clementina]
Length=353

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 136/181 (75%), Gaps = 4/181 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTY-TIVRGT  528
            IAR LLYLHE+C TQIIHCDIKPQNIL+++++ A+ISDFGLAK +  +Q +T  T +RGT
Sbjct  171  IARVLLYLHEDCSTQIIHCDIKPQNILLNDRYNARISDFGLAKLLTLNQRKTIKTAIRGT  230

Query  527  KGYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGe  348
            KGYVAPEW RK  ++ K DVYSFG++LLE+IS RKS D  + +E A+L +W ++C+  G+
Sbjct  231  KGYVAPEWFRKSTISAKVDVYSFGVLLLEIISCRKSFDIEMGEEYAILTDWAFDCYRNGK  290

Query  347  vskvvgeeevekrqve---rmvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +  +V  +      ++   +++ IS+WCIQE+PSLRP+M+KV  ML+  V++ VPP+P+ 
Sbjct  291  LDDLVEGDMEAMNDIKCVEKLLMISIWCIQEDPSLRPTMRKVSQMLQEVVEVDVPPNPSP  350

Query  176  F  174
            F
Sbjct  351  F  351



>ref|XP_008779999.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Phoenix dactylifera]
Length=443

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IA+G+ YLHE+C+T+IIHCDIKP+NILMD+ + AKISDFGLAK +   QTRT+T +RGT+
Sbjct  267  IAKGIHYLHEDCETRIIHCDIKPENILMDDNWTAKISDFGLAKLLMPSQTRTFTGIRGTR  326

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GY+APEWH+   ++VKADVYSFGIVLLE++  R++++    ++  +L +WV++CF  G  
Sbjct  327  GYLAPEWHKNAPISVKADVYSFGIVLLEIVCCRRNMELEAEEDAIILLDWVHDCFMNG-E  385

Query  344  skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSP  183
             +++  +EV+  ++ R+V++ LWCIQ EP  RPSMK V++MLEG V IP+PP P
Sbjct  386  LEMLVPDEVDTTELNRLVKVGLWCIQSEPGSRPSMKNVVMMLEGNVGIPLPPPP  439



>emb|CAH67716.1| H0512B01.11 [Oryza sativa Indica Group]
 emb|CAH66271.1| OSIGBa0147O06.1 [Oryza sativa Indica Group]
Length=811

 Score =   203 bits (516),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 136/183 (74%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            ++RGLLYLHEEC+ QIIHCD+KPQNIL+D+ FVAKISDFGLAK +  +QT+T T +RGT+
Sbjct  626  VSRGLLYLHEECNKQIIHCDMKPQNILLDDNFVAKISDFGLAKLLPVNQTQTNTGIRGTR  685

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEE-AVLEEWVYNCFEAGe  348
            GYVAPEW + + +T K DVYSFG++LLEL+  RK+V+  + DEE  +L  W  +C++ G 
Sbjct  686  GYVAPEWFKNIGITSKVDVYSFGVILLELVCCRKNVELEVLDEEQTILTYWANDCYKCGR  745

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               +     E     ++VER V ++LWC+QEEPS+RP+M KV  ML+G V IP PP P+S
Sbjct  746  IDLLVAGDDEAIFNIKKVERFVAVALWCLQEEPSMRPTMLKVTQMLDGAVQIPTPPDPSS  805

Query  176  FLS  168
            ++S
Sbjct  806  YIS  808



>ref|XP_006388388.1| hypothetical protein POPTR_0200s00200g [Populus trichocarpa]
 gb|ERP47302.1| hypothetical protein POPTR_0200s00200g [Populus trichocarpa]
Length=795

 Score =   203 bits (516),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 139/185 (75%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC +QIIHCDIKPQNIL+D    A+ISDFGLAK +K DQT+T T +RGTK
Sbjct  611  VARGLLYLHEECSSQIIHCDIKPQNILLDESLNARISDFGLAKLLKTDQTKTTTAIRGTK  670

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDE-EAVLEEWVYNCFEAGe  348
            GYVAPEW + + VT K D+YSFGI+LLEL+  RK+ + +   E + VL +W  +C + G+
Sbjct  671  GYVAPEWFKNLPVTTKVDIYSFGILLLELVCCRKNFEINAMQEHQIVLADWACDCLKEGK  730

Query  347  vs---kvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            ++   +  GE   + ++VER V +++WCIQE+PSLRP MKKV+ MLEG V + VPP P+S
Sbjct  731  LNLLVEEDGEAMEDMKRVERFVMVAIWCIQEDPSLRPGMKKVVQMLEGGVQVSVPPDPSS  790

Query  176  FLSVV  162
            F+S +
Sbjct  791  FISTI  795



>ref|XP_006445958.1| hypothetical protein CICLE_v10014324mg [Citrus clementina]
 gb|ESR59198.1| hypothetical protein CICLE_v10014324mg [Citrus clementina]
Length=793

 Score =   203 bits (516),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 136/184 (74%), Gaps = 4/184 (2%)
 Frame = -2

Query  701  ARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTKG  522
            ARGL YLHEEC +QIIHCDIKPQNIL+D+ F A+ISDFGLAK +K DQT+T T +RGTKG
Sbjct  610  ARGLFYLHEECKSQIIHCDIKPQNILLDDTFNARISDFGLAKLLKTDQTQTTTAIRGTKG  669

Query  521  YVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDE-EAVLEEWVYNCF---EA  354
            YVAPEW + + +T K DVYSFGI+LLEL+  RK+ +    +E + +L +W  +CF   + 
Sbjct  670  YVAPEWFKNLPITAKVDVYSFGILLLELVCCRKNFEVDATEECQMILADWACDCFRERKL  729

Query  353  GevskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSF  174
              + +   E   + ++VE+ V I++WCIQE+PSLRP+MKKV  M+EG VD+ +PP P SF
Sbjct  730  DVLVENDEEAMDDIKRVEKFVMIAIWCIQEDPSLRPAMKKVTQMIEGAVDVSIPPDPASF  789

Query  173  LSVV  162
            +S +
Sbjct  790  ISSI  793



>ref|XP_006368557.1| hypothetical protein POPTR_0001s05190g [Populus trichocarpa]
 gb|ERP65126.1| hypothetical protein POPTR_0001s05190g [Populus trichocarpa]
Length=804

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 134/184 (73%), Gaps = 4/184 (2%)
 Frame = -2

Query  701  ARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTKG  522
             +GLLYLHEEC TQIIHCDIKPQNIL+D  + A+ISDFGLAK +  +QT T T +RGT+G
Sbjct  620  GKGLLYLHEECSTQIIHCDIKPQNILLDGSYNARISDFGLAKLLMINQTHTKTNIRGTRG  679

Query  521  YVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLC-DEEAVLEEWVYNCFEAGev  345
            YVAPEW R   +TVK DVYSFG++LLE+IS R+SV      ++  +L +W Y+CF  G +
Sbjct  680  YVAPEWFRSKPITVKVDVYSFGVMLLEIISCRRSVGIETGENDREILTDWAYDCFHRGTL  739

Query  344  skvvg---eeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSF  174
              +V    E   +  ++E+ V I+LWCIQE+PSLRP+MKKV+LMLEG V + +PP P SF
Sbjct  740  DALVDDDPEATSDMERLEKYVMIALWCIQEDPSLRPTMKKVMLMLEGIVQVAIPPCPCSF  799

Query  173  LSVV  162
              ++
Sbjct  800  SGII  803



>gb|KHN42673.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Glycine soja]
Length=210

 Score =   191 bits (484),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 130/180 (72%), Gaps = 5/180 (3%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGL+YLHEECD+ IIHCDIKPQNIL+D  F AKISDFGLAK +  DQ+RT T++RGT+
Sbjct  28   IARGLVYLHEECDSAIIHCDIKPQNILIDEHFNAKISDFGLAKLLLFDQSRTNTMIRGTR  87

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEE--AVLEEWVYNCFEAG  351
            GYVAPEW + +AVTVK DVYSFG++LLE I  R+SV     +EE  A+L +W Y+C   G
Sbjct  88   GYVAPEWFKNVAVTVKVDVYSFGVMLLENICCRRSVMTMEPEEEEKAILTDWAYDCCVEG  147

Query  350  evskvvgeeevekrqvermv---RISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPT  180
             +  +V  +      + R+    +I++WCIQE+P +RP+M KV  MLEG V++  PPSP 
Sbjct  148  RLHALVENDREALSDIGRLQRWVKIAIWCIQEDPEMRPTMGKVNQMLEGLVEVANPPSPN  207



>ref|XP_009769630.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nicotiana sylvestris]
Length=790

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 131/177 (74%), Gaps = 4/177 (2%)
 Frame = -2

Query  701  ARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTKG  522
            A+GL Y+HEEC TQIIHCDIKPQN+L+D    AKI+DFG+AK ++ DQTRT T +RGT+G
Sbjct  610  AKGLCYMHEECSTQIIHCDIKPQNVLLDESLTAKIADFGIAKLLRNDQTRTTTKIRGTRG  669

Query  521  YVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDE-EAVLEEWVYNCF---EA  354
            YVAPEW R M +TVK DVYSFGI+LLELI  RKS +  + +E E +L EW  +C+   E 
Sbjct  670  YVAPEWFRNMPITVKVDVYSFGILLLELICCRKSYEQDVANEDEMILVEWACDCYRRKEF  729

Query  353  GevskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSP  183
              ++    E   + ++ E  + +++WCIQE P+LRP+MKKV+LMLEG++DI VPP P
Sbjct  730  RLLAGDDEEAIEDIKRFENFLMVAIWCIQENPALRPNMKKVMLMLEGSIDISVPPEP  786



>gb|EYU18008.1| hypothetical protein MIMGU_mgv1a023456mg [Erythranthe guttata]
Length=804

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 137/183 (75%), Gaps = 3/183 (2%)
 Frame = -2

Query  701  ARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTKG  522
            ARGL YLHEEC TQIIHCDIKPQN+L+D   VAKISDFGLAK ++ DQTRT T +RGT+G
Sbjct  622  ARGLCYLHEECTTQIIHCDIKPQNVLLDGSHVAKISDFGLAKLLRADQTRTNTGIRGTRG  681

Query  521  YVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGevs  342
            YVAPEW R M +TVK DVYS+GI+LLEL+  R++    + DE+ VL +W Y+C+  G + 
Sbjct  682  YVAPEWFRNMPITVKVDVYSYGILLLELLCCRRNFLPDVEDEKVVLADWAYDCYRGGAIR  741

Query  341  kvvgeeevekrqve---rmvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFL  171
             +  ++EV    ++   R V +++WC+QE+P+LRP MK+V+ MLEG+V +P PP PTSF 
Sbjct  742  SLAADDEVAADDLKRFERFVMVAIWCVQEDPALRPHMKRVMHMLEGSVQVPAPPDPTSFA  801

Query  170  SVV  162
            + +
Sbjct  802  TPI  804



>ref|XP_009418234.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Musa acuminata subsp. malaccensis]
Length=784

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 138/185 (75%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGL YLHEEC +Q+IHCDIKPQNIL+D+ F  +ISDFGLAK ++ DQTRT T +RGTK
Sbjct  599  IARGLQYLHEECFSQVIHCDIKPQNILLDDNFTTRISDFGLAKLLRTDQTRTKTDIRGTK  658

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVD-WSLCDEEAVLEEWVYNCFEAGe  348
            GYVAPEW R   +T K DVYSFG+VLLE+I  R++V   +  +EE++L  WV +CF  G 
Sbjct  659  GYVAPEWFRNTGITSKVDVYSFGVVLLEIICCRRNVRPEAQNEEESILAYWVNDCFRDGR  718

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               V +   +   + R+VER V+++LWCIQE+PSLRP+M+KV  ML+G+  +P PP P+S
Sbjct  719  LDLVVEGDDQAISDMRRVERFVKVALWCIQEDPSLRPTMQKVTQMLDGSTAVPGPPDPSS  778

Query  176  FLSVV  162
            ++S +
Sbjct  779  YISSI  783



>ref|XP_010911349.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1, partial [Elaeis guineensis]
Length=778

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 131/180 (73%), Gaps = 4/180 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IA+GL YLH+EC TQIIHCDIKPQNIL+D   +A+ISDFGLAK ++ DQ+RT T +RGT+
Sbjct  593  IAKGLAYLHDECATQIIHCDIKPQNILLDENLIARISDFGLAKLLRTDQSRTSTGIRGTR  652

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEE-AVLEEWVYNCFEAGe  348
            GYVAPEW R   +T K DVYSFG++LLE+I  RK+V+    DE+ AVL  W Y+C+  G 
Sbjct  653  GYVAPEWFRNTVITAKVDVYSFGVMLLEIICCRKNVEAEAGDEDRAVLTFWAYDCYREGS  712

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               +     E   + R +E  V++++WCIQEEPSLRPSMKKV  MLEG V + +PP P+S
Sbjct  713  LDLLVGNDEEAMADMRMLETFVKVAIWCIQEEPSLRPSMKKVNQMLEGAVVVSIPPDPSS  772



>gb|EAY93045.1| hypothetical protein OsI_14844 [Oryza sativa Indica Group]
Length=788

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 135/183 (74%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC+ QIIHCD+KPQNIL+D+ F AKISDFGLAK +  +QT+T T +RGT+
Sbjct  603  VARGLLYLHEECNKQIIHCDMKPQNILLDDNFAAKISDFGLAKLLPVNQTQTNTGIRGTR  662

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEE-AVLEEWVYNCFEAGe  348
            GYVAPEW + + +T K DVYSFG++LLEL+  RK+V+  + DEE  +L  W  +C++ G 
Sbjct  663  GYVAPEWFKNIGITSKVDVYSFGVILLELVCCRKNVELEVLDEEQTILTYWANDCYKCGR  722

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               +     E     ++VER V ++LWC+QEEPS+RP+M KV  ML+G V IP PP P+S
Sbjct  723  IDLLVAGDDEAIFNIKKVERFVAVALWCLQEEPSMRPTMLKVTQMLDGAVQIPTPPDPSS  782

Query  176  FLS  168
            ++S
Sbjct  783  YIS  785



>ref|XP_010673560.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Beta vulgaris subsp. vulgaris]
Length=822

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 133/180 (74%), Gaps = 3/180 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC TQIIHCDIKPQNIL+D  + A++SDFGLAK +  +QT+T T VRGTK
Sbjct  637  IARGLLYLHEECITQIIHCDIKPQNILLDEYYNARVSDFGLAKLLVLNQTQTITAVRGTK  696

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEA---  354
            GY+APEW R   VTVK DVYSFG++LLE+I  R++V  ++  EEA+L +W ++C+++   
Sbjct  697  GYLAPEWFRNKPVTVKVDVYSFGVLLLEIICCRRNVCMNIGAEEAILTDWAFDCYQSNTL  756

Query  353  GevskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSF  174
            G +     E   +   +ER + ++LWCIQE+P LRP+MKKV  MLEG  ++  PP PTSF
Sbjct  757  GTLVIDDMEALNDMLGLERYIMVALWCIQEDPRLRPTMKKVTQMLEGVAEVDNPPIPTSF  816



>ref|XP_011002948.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Populus euphratica]
Length=790

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 137/177 (77%), Gaps = 1/177 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLHEEC+  IIHCDIKPQNILMD+ + AKISDFGLAK +  DQTRT+TIVRGT+
Sbjct  611  IARGILYLHEECEAPIIHCDIKPQNILMDDFWNAKISDFGLAKLLVPDQTRTFTIVRGTR  670

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCD-EEAVLEEWVYNCFEAGe  348
            GY+APEWH+   ++VKADVYS+G++LLE++  R++++ ++   EE  L  W Y    A E
Sbjct  671  GYLAPEWHKNTPISVKADVYSYGVMLLEIVFCRRNIETNVSRPEEVQLSNWAYQLMVARE  730

Query  347  vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            + K+   E+V+ + +E+MV + +WCIQ+EP +RPSMK VLLMLEG  D+ VPP PTS
Sbjct  731  LDKLDLGEDVDLQNLEKMVMVGMWCIQDEPGIRPSMKSVLLMLEGIADVSVPPHPTS  787



>gb|KHN48904.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Glycine soja]
Length=669

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 134/178 (75%), Gaps = 4/178 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGL+YLHEEC TQIIHCDIKPQNIL+D+Q+ A+ISDFGLAK +  +Q+RT T +RGTK
Sbjct  483  IARGLVYLHEECCTQIIHCDIKPQNILLDDQYNARISDFGLAKLLLINQSRTETGIRGTK  542

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEE-AVLEEWVYNCFEAGe  348
            GYVAP+W R   +T K D YSFG++LLE+I  RK+V+  L +EE  +L +W Y+C++   
Sbjct  543  GYVAPDWFRSAPITAKVDTYSFGVLLLEIICCRKNVEKELVNEEKGILTDWAYDCYKTRR  602

Query  347  vskvvge---eevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSP  183
            +  ++        + +  E++V I++WCIQE PSLRP+MKKVLLMLEG V++  PPSP
Sbjct  603  LEILLENDDEAINDIKSFEKLVMIAIWCIQEHPSLRPTMKKVLLMLEGNVEVLTPPSP  660



>ref|XP_008231371.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Prunus mume]
Length=805

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 143/184 (78%), Gaps = 4/184 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG++YLHEEC TQIIHCDIKPQNIL+D+ F A+ISDFGLAK +  DQT T+T++RGT+
Sbjct  621  IARGIMYLHEECSTQIIHCDIKPQNILLDDSFTARISDFGLAKLLLSDQTLTHTVIRGTR  680

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAV-LEEWVYNCFEA--  354
            GYVAPEW R + +T K DVYS+G++LLE+I  R+S++    +EE V L +WVY+C++   
Sbjct  681  GYVAPEWFRNVPITAKVDVYSYGVMLLEIICCRRSLEMERENEEEVILTDWVYDCYKEKT  740

Query  353  -GevskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
              ++ +   E   + +++ER+V++S+WCIQE+PSLRP+MKKV  MLEG VD+ VPP P+ 
Sbjct  741  LNKLIEDDEEARNDMKRLERLVKVSIWCIQEDPSLRPTMKKVTQMLEGVVDVSVPPCPSP  800

Query  176  FLSV  165
            F S+
Sbjct  801  FSSI  804



>gb|KDO56486.1| hypothetical protein CISIN_1g037189mg, partial [Citrus sinensis]
Length=766

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 138/181 (76%), Gaps = 4/181 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTY-TIVRGT  528
            IARGLLYLHE+C +QIIHCD+KPQNIL+D+ + A+ISDFGLAK +  +Q++T  T +RGT
Sbjct  586  IARGLLYLHEDCSSQIIHCDMKPQNILLDDHYNARISDFGLAKLLTLNQSKTIKTSIRGT  645

Query  527  KGYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGe  348
            KGYVAPEW R   +T K DVYSFG++LLE+I+ RKS D  + +E A+L +W ++C+  G+
Sbjct  646  KGYVAPEWFRNSKITAKVDVYSFGVLLLEIIACRKSFDIEMVEEYAILTDWAFDCYRNGK  705

Query  347  vskvvgeeevekrqv---ermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +  +VG +      V   E++V +S+WCIQE+PSLRP++KKVL MLEG V++ VPP+P  
Sbjct  706  LDALVGGDMEAMNDVECLEKLVMVSIWCIQEDPSLRPTIKKVLQMLEGVVEVSVPPNPYP  765

Query  176  F  174
            F
Sbjct  766  F  766



>gb|KCW87121.1| hypothetical protein EUGRSUZ_B03649 [Eucalyptus grandis]
Length=860

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 136/184 (74%), Gaps = 5/184 (3%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            I RGLLYLHEEC TQIIHCDIKPQNIL+D  + A+ISDFGLAK +   QT T+T +RGT+
Sbjct  675  IGRGLLYLHEECKTQIIHCDIKPQNILLDEYYNARISDFGLAKLLIS-QTHTHTAIRGTR  733

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAV-LEEWVYNCFEAGe  348
            GYVAPEW R M +TVK DVYSFG++LLE I  R+S+D    +EE V L +W Y+C+  G 
Sbjct  734  GYVAPEWFRNMPITVKVDVYSFGVLLLETICCRRSIDIEAGNEERVILADWAYDCYREGA  793

Query  347  vs---kvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +    +       + +++ER VR+++WCIQE+P+LRP+MKKV+LMLEG + +  PPSP +
Sbjct  794  LEELVEKDEAALNDMKKLERFVRVAIWCIQEDPALRPTMKKVMLMLEGIIQVSAPPSPFA  853

Query  176  FLSV  165
            F ++
Sbjct  854  FSTI  857



>ref|XP_010044982.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Eucalyptus grandis]
Length=801

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 138/184 (75%), Gaps = 5/184 (3%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            I RGLLYLHEEC TQIIHCDIKPQNIL+D  + A+ISDFGLAK +   QT T+T +RGT+
Sbjct  616  IGRGLLYLHEECKTQIIHCDIKPQNILLDEYYNARISDFGLAKLLIS-QTHTHTAIRGTR  674

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAV-LEEWVYNCFEAGe  348
            GYVAPEW R M +TVK DVYSFG++LLE I  R+S+D    +EE V L +W Y+C+  G 
Sbjct  675  GYVAPEWFRNMPITVKVDVYSFGVLLLETICCRRSIDIEAGNEERVILADWAYDCYREGA  734

Query  347  vskvvgeeevekrqvermv---RISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            + ++V ++E     ++++    R+++WCIQE+P+LRP+MKKV+LMLEG + +  PPSP +
Sbjct  735  LEELVEKDEAALNDMKKLERFVRVAIWCIQEDPALRPTMKKVMLMLEGIIQVSAPPSPFA  794

Query  176  FLSV  165
            F ++
Sbjct  795  FSTI  798



>ref|XP_006445951.1| hypothetical protein CICLE_v10017816mg [Citrus clementina]
 gb|ESR59191.1| hypothetical protein CICLE_v10017816mg [Citrus clementina]
Length=697

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 139/183 (76%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTY-TIVRGT  528
            IARGLLYLHE+C +QIIHCD+KPQNIL+D+ + A+ISDFGLAK +  +Q++T  T +RGT
Sbjct  510  IARGLLYLHEDCSSQIIHCDMKPQNILLDDHYNARISDFGLAKLLTLNQSKTIKTSIRGT  569

Query  527  KGYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGe  348
            KGYVAPEW R   +T K DVYSFG++LLE+I+ RKS D  + +E A+L +W ++C+  G+
Sbjct  570  KGYVAPEWLRNSKITAKVDVYSFGVLLLEIIACRKSFDIEMVEEYAILTDWAFDCYRNGK  629

Query  347  vskvvgeeevekrqv---ermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +  +VG +      V   E++V +S+WCIQE+PSLRP++KKVL MLEG V++ VPP+P  
Sbjct  630  LDALVGGDMEAMNDVECLEKLVMVSIWCIQEDPSLRPTIKKVLKMLEGVVEVSVPPNPYP  689

Query  176  FLS  168
            F S
Sbjct  690  FSS  692



>ref|XP_009333680.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Pyrus x bretschneideri]
Length=751

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 138/185 (75%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEE  +QIIHCDIKPQNIL+D+   A+ISDFGLAK ++ DQT T T +RGTK
Sbjct  566  IARGLLYLHEESSSQIIHCDIKPQNILLDDSLTARISDFGLAKLLRIDQTLTTTGIRGTK  625

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEA-VLEEWVYNCFEAGe  348
            GYVAPEW +++ +T K D+YS+GI+LLE+I  RK  + +  DE   +L +W Y+C++  +
Sbjct  626  GYVAPEWFKRLPITAKVDIYSYGILLLEIIFCRKHFEAAAEDEGPMILADWAYDCYKQNK  685

Query  347  vskvvgeeeve---krqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            + ++    +      + VE+ V I++WCIQE+PSLRP+MKKV LMLEGTV++  PP P+S
Sbjct  686  LHQLFKNNDEAMHDMKMVEKYVMIAIWCIQEDPSLRPNMKKVTLMLEGTVEVSAPPDPSS  745

Query  176  FLSVV  162
            F+S +
Sbjct  746  FISSI  750



>ref|XP_009364760.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Pyrus x bretschneideri]
Length=744

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 138/185 (75%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEE  +QIIHCDIKPQNIL+D+   A+ISDFGLAK ++ DQT T T +RGTK
Sbjct  559  IARGLLYLHEESSSQIIHCDIKPQNILLDDSLTARISDFGLAKLLRIDQTLTTTGIRGTK  618

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEA-VLEEWVYNCFEAGe  348
            GYVAPEW +++ +T K D+YS+GI+LLE+I  RK  + +  DE   +L +W Y+C++  +
Sbjct  619  GYVAPEWFKRLPITAKVDIYSYGILLLEIIFCRKHFEAAAEDEGPMILADWAYDCYKQNK  678

Query  347  vskvvgeeevek---rqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            + ++    +      + VE+ V I++WCIQE+PSLRP+MKKV LMLEGTV++  PP P+S
Sbjct  679  LHQLFKNNDETMHDLKMVEKYVMIAIWCIQEDPSLRPNMKKVTLMLEGTVEVSAPPDPSS  738

Query  176  FLSVV  162
            F+S +
Sbjct  739  FISSI  743



>ref|XP_007014864.1| CCHC-type integrase, putative [Theobroma cacao]
 gb|EOY32483.1| CCHC-type integrase, putative [Theobroma cacao]
Length=811

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 134/185 (72%), Gaps = 5/185 (3%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGL+YLHEEC TQIIHCDIKPQNIL+D+ + A+ISDFGL+K +  DQT+T T +RGTK
Sbjct  626  VARGLVYLHEECSTQIIHCDIKPQNILLDDNYDARISDFGLSKLLMMDQTQTKTAIRGTK  685

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELI-SRRKSVDWSLCDE-EAVLEEWVYNCFEAG  351
            GYVAPEW R + VTVK DVYSFG++LLE+I  RR  VD  + DE   +L  W Y+C+  G
Sbjct  686  GYVAPEWFRNLPVTVKVDVYSFGVLLLEIICCRRSVVDEEMGDEGNIILTYWAYDCYSEG  745

Query  350  evskvvgeeevekrqvermv---RISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPT  180
            ++  +V E+       + +     ++ WCIQE+P LRPSM+KV+ MLEG V + VPP+P+
Sbjct  746  KIDALVSEDMEVMNDTKSLERFLMVAFWCIQEDPCLRPSMRKVIQMLEGVVHVTVPPNPS  805

Query  179  SFLSV  165
             F ++
Sbjct  806  PFSTI  810



>ref|XP_004309464.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Fragaria vesca subsp. vesca]
Length=832

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 137/181 (76%), Gaps = 4/181 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +A+GLLYLHEEC TQIIHCDIKPQNIL+D+   A+I+DFGLAK +  +Q++T T +RGTK
Sbjct  648  VAKGLLYLHEECSTQIIHCDIKPQNILLDDYCNARIADFGLAKLLMMNQSQTQTAIRGTK  707

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDW-SLCDEEAVLEEWVYNCFEAGe  348
            GYVAPEW R M +T K DVYSFG+VLLE I  R+SVD  ++ +E A+L +WVY+C+  G 
Sbjct  708  GYVAPEWFRNMPITTKVDVYSFGVVLLECICCRRSVDMENVSEESAILTDWVYDCYLEGA  767

Query  347  vskvvgeeeve---krqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +  VV  E      K ++ER+V ++LWCIQE PSLRP+MKKV+ MLEG V++  PP P+ 
Sbjct  768  LDAVVDYEVEALHEKTKLERLVMVALWCIQENPSLRPTMKKVIQMLEGLVEVHAPPCPSP  827

Query  176  F  174
            +
Sbjct  828  Y  828



>ref|XP_009364724.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Pyrus x bretschneideri]
Length=787

 Score =   202 bits (513),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 138/185 (75%), Gaps = 4/185 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEE  +QIIHCDIKPQNIL+D+   A+ISDFGLAK ++ DQT T T +RGTK
Sbjct  602  IARGLLYLHEESSSQIIHCDIKPQNILLDDSLTARISDFGLAKLLRIDQTLTMTGIRGTK  661

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEA-VLEEWVYNCFEAGe  348
            GYVAPEW +++ +T K D+YS+GI+LLE+I  RK  + +  DE   +L +W Y+C++  +
Sbjct  662  GYVAPEWFKRLPITAKVDIYSYGILLLEIIFCRKHFEAAAEDEGPMILADWAYDCYKQNK  721

Query  347  vskvvgeeeve---krqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            + ++    +      + VE+ V I++WCIQE+PSLRP+MKKV LMLEGTV++  PP P+S
Sbjct  722  LHQLFKNNDEAMHDMKMVEKYVMIAIWCIQEDPSLRPNMKKVTLMLEGTVEVSAPPDPSS  781

Query  176  FLSVV  162
            F+S +
Sbjct  782  FISSI  786



>ref|XP_007134257.1| hypothetical protein PHAVU_010G031900g [Phaseolus vulgaris]
 gb|ESW06251.1| hypothetical protein PHAVU_010G031900g [Phaseolus vulgaris]
Length=812

 Score =   202 bits (513),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 135/179 (75%), Gaps = 4/179 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC TQIIHCDIKPQNIL+D+ +VA+ISDFGLAK +  +Q+RT T +RGTK
Sbjct  625  VARGLLYLHEECITQIIHCDIKPQNILLDDYYVARISDFGLAKLLNMNQSRTNTAIRGTK  684

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDE-EAVLEEWVYNCFEAGe  348
            GYVA EW + M +T K DVYS+G+VLLE++S RKSV++   DE  A+L EW Y+C+  G 
Sbjct  685  GYVALEWFKNMPITAKVDVYSYGMVLLEIVSCRKSVEFDEEDESRAILSEWAYDCYSEGS  744

Query  347  vskvvgeeeve---krqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPT  180
            +  +V  ++      + VE++V I+LWC+QE+P  RP+M+ V  MLEG V++ VPP P+
Sbjct  745  LHTLVEGDKEALDDMKTVEKLVMIALWCVQEDPGFRPTMRNVTQMLEGVVEVEVPPCPS  803



>ref|XP_002275811.2| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Vitis vinifera]
Length=792

 Score =   202 bits (513),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 140/176 (80%), Gaps = 1/176 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARG+LYLHEEC++QI+HCDIKPQNILMD+ + AKISDFG +K +  +Q    T +RGT 
Sbjct  615  LARGILYLHEECESQIVHCDIKPQNILMDDAWTAKISDFGFSKLLMPNQEGIVTGIRGTA  674

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCD-EEAVLEEWVYNCFEAGe  348
            GY APEWH+   ++VKAD+YSFG+VLLE++  R+S++  +   +E +L  WVY C  A E
Sbjct  675  GYSAPEWHKNTLISVKADIYSFGVVLLEIVCCRRSIEVKVSTADEIILSSWVYGCLVARE  734

Query  347  vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPT  180
            + K+VG+E+VE + +ERMV++ LWC+Q++P+LRPSMK V+LMLEGTVDIP PPSPT
Sbjct  735  LDKLVGDEQVEFKSLERMVKVGLWCVQDDPALRPSMKNVILMLEGTVDIPFPPSPT  790



>gb|KDO56481.1| hypothetical protein CISIN_1g046877mg, partial [Citrus sinensis]
Length=350

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 136/181 (75%), Gaps = 4/181 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTY-TIVRGT  528
            IAR LLYLHE+C +QIIHCDIKPQNIL+++++ A+ISDFGLAK +  +Q +T  T +RGT
Sbjct  168  IARVLLYLHEDCSSQIIHCDIKPQNILLNDRYNARISDFGLAKLLTLNQRKTIKTAIRGT  227

Query  527  KGYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGe  348
            KGYVAPEW RK  ++ K DVYSFG++LLE+IS RKS D  + +E A+L +W ++C+  G+
Sbjct  228  KGYVAPEWFRKSTISAKVDVYSFGVLLLEIISCRKSFDIEMGEEYAILTDWAFDCYRNGK  287

Query  347  vskvvgeeevekrqve---rmvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +  +V  +      ++   +++ IS+WCIQE+PSLRP+M+KV  ML+  V++ VPP+P+ 
Sbjct  288  LDDLVEGDMEAMNDIKCVEKLLMISIWCIQEDPSLRPTMRKVSQMLQEVVEVDVPPNPSP  347

Query  176  F  174
            F
Sbjct  348  F  348



>gb|KDP25139.1| hypothetical protein JCGZ_22674 [Jatropha curcas]
Length=380

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 133/170 (78%), Gaps = 4/170 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC TQIIHCDIKPQNIL+D+ + AKI+DFGLAK M  +Q++T+T +RGTK
Sbjct  196  IARGLLYLHEECSTQIIHCDIKPQNILLDDYYDAKIADFGLAKLMVLNQSKTFTNIRGTK  255

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVA EW R + +TVK DVYSFG++LLE+I  R++ D  + +E A+L +W Y+C+  G++
Sbjct  256  GYVAAEWFRNIPITVKVDVYSFGVLLLEIICCRRNADTEISEERAILTDWAYDCYAEGKI  315

Query  344  skvvg----eeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTV  207
            S ++     E   + +++ER V +++WCIQE+P+LRP+MK V+LMLEG +
Sbjct  316  SALIEDDDDEALKDVKKLERFVMVAIWCIQEDPNLRPTMKIVMLMLEGII  365



>ref|XP_004508501.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Cicer arietinum]
Length=813

 Score =   202 bits (513),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 141/177 (80%), Gaps = 1/177 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLH+ECD  IIHCD+KPQNILMD  + AKI+DFGLAK +  DQTRT+T++RGT+
Sbjct  634  IARGILYLHDECDGPIIHCDLKPQNILMDEFWTAKIADFGLAKLLMPDQTRTFTVIRGTR  693

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCD-EEAVLEEWVYNCFEAGe  348
            GY+APEW++ + +++KADVYS+GIVLLE +  R+++D ++ + EE +L  W Y CF A E
Sbjct  694  GYMAPEWNKNIPISLKADVYSYGIVLLETLCCRRNLDVNVLEPEEILLSGWAYKCFVARE  753

Query  347  vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            V+K+V  E +++  +E MV+++LWCIQ+EP LRP+MK V+LMLEG  DI +PP P S
Sbjct  754  VNKLVPSEVIDENVMENMVKVALWCIQDEPLLRPTMKGVVLMLEGITDIAIPPCPDS  810



>ref|XP_009391880.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Musa acuminata subsp. malaccensis]
Length=809

 Score =   202 bits (513),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 139/184 (76%), Gaps = 4/184 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLH+EC T IIHCDIKPQN+L+D+ FVA+ISDFGLAK ++ DQTRT T +RGT+
Sbjct  625  IARGLLYLHDECSTPIIHCDIKPQNVLLDDNFVARISDFGLAKLLRADQTRTNTGIRGTR  684

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEA-VLEEWVYNCFEAGe  348
            GYVAPEW + MA+T K DVYSFG+++LE+I  RK+++  + +EE  VL  W Y+CF+ G 
Sbjct  685  GYVAPEWFKSMAITKKVDVYSFGVMMLEIICCRKNLETEIGEEEEPVLIYWAYDCFKDGM  744

Query  347  v---skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
                 +   +   +  +VER V+I+ WCIQE+PSLRPSM+KV  MLEG V++ +PP P+ 
Sbjct  745  ADLLVQHDKDALADMEEVERFVKIAFWCIQEDPSLRPSMQKVTQMLEGAVEVSLPPDPSP  804

Query  176  FLSV  165
            FL+ 
Sbjct  805  FLTT  808



>ref|XP_008243605.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Prunus mume]
Length=812

 Score =   201 bits (512),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 135/181 (75%), Gaps = 6/181 (3%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +A+GLLYLHEEC TQ+IHCDIKPQNIL+D+ + A+ISDFGLAK +  +Q+ T+T +RGTK
Sbjct  625  VAKGLLYLHEECSTQVIHCDIKPQNILLDDYYTARISDFGLAKLLMMNQSHTHTAIRGTK  684

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEE-AVLEEWVYNCFEAGe  348
            GYVAPEW   M +T K DVYSFG+VLLE+I  R+S+D +   EE A+L +WVY+C+  G 
Sbjct  685  GYVAPEWFSNMPITAKVDVYSFGVVLLEIICCRRSIDVNNSREERAILTDWVYDCYCGGM  744

Query  347  vskvvgeeevekrqvermv-----RISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSP  183
            +  V+  +   +   +RM       I++WCIQ++PSLRP+M+KV+ MLEG V++ VPP P
Sbjct  745  LDAVLVLDNEVQALDDRMKPEKLVMIAIWCIQDDPSLRPTMRKVVQMLEGVVEVHVPPCP  804

Query  182  T  180
            +
Sbjct  805  S  805



>ref|XP_006427819.1| hypothetical protein CICLE_v10027067mg [Citrus clementina]
 gb|ESR41059.1| hypothetical protein CICLE_v10027067mg [Citrus clementina]
Length=681

 Score =   200 bits (509),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 135/180 (75%), Gaps = 3/180 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IA+GL YLH+ECDT+IIHCDIKPQNILMD    AKISDFGL+K +K DQTRTYT+ RGT+
Sbjct  501  IAKGLHYLHDECDTRIIHCDIKPQNILMDESRTAKISDFGLSKLLKPDQTRTYTMARGTR  560

Query  524  GYVAPEWHRKMA-VTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGe  348
            GY APEW+   A +T KADVYSFG++LLE+I  RK VD SL DEE VL +WVY C+ AGE
Sbjct  561  GYAAPEWYNNNAPITSKADVYSFGVMLLEIICCRKKVDASLRDEEVVLVDWVYQCYRAGE  620

Query  347  vskvvgeee-vekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFL  171
            +  +  EE      + E+MV+I LWC++ E SLRP+MK+V+ M+EG V  P PP   SF+
Sbjct  621  LQLLKSEELDASMEEFEKMVKIGLWCVEPELSLRPAMKQVISMMEGIVVTP-PPLSYSFV  679



>ref|XP_011012006.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Populus euphratica]
Length=794

 Score =   201 bits (512),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 137/177 (77%), Gaps = 1/177 (1%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARG+LYLHEEC+  IIHCDIKPQNILMD+ + AK+SDFGLAK +  DQTRT+T+VRGT+
Sbjct  615  IARGILYLHEECEAPIIHCDIKPQNILMDDFWNAKMSDFGLAKLLVPDQTRTFTVVRGTR  674

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCD-EEAVLEEWVYNCFEAGe  348
            GY+APEWH+   ++VKADVYS+G++LLE++  R++V+ ++   EE  L  W Y    A E
Sbjct  675  GYLAPEWHKNTPISVKADVYSYGVMLLEIVFCRRNVETNVSRPEEVQLSNWAYQLMVARE  734

Query  347  vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            + K+   E+V+ + +E+MV + +WCIQ+EP +RPSMK VLLMLEG  D+ VPP PTS
Sbjct  735  LDKLDLGEDVDLQNLEKMVMVGMWCIQDEPGIRPSMKSVLLMLEGIADVSVPPHPTS  791



>ref|XP_006652106.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Oryza brachyantha]
Length=812

 Score =   201 bits (511),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 135/183 (74%), Gaps = 4/183 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC+ QIIHCD+KPQNIL+DN F AKISDFGLAK ++ +QT+T T +RGT+
Sbjct  627  VARGLLYLHEECNKQIIHCDMKPQNILLDNNFAAKISDFGLAKLLQLNQTQTNTGIRGTR  686

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEE-AVLEEWVYNCFEAGe  348
            GYVAPEW + + +T K DVYSFG++LLE++  R++V     DEE A+L  W  +C+  G 
Sbjct  687  GYVAPEWFKNIGITSKVDVYSFGVILLEIVCCRQNVVLEAMDEEKAILTYWANDCYRCGR  746

Query  347  ---vskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               + +   E     ++VER V ++LWC+QEEP++RP+M KV  ML+G V IP PP P+S
Sbjct  747  IDLLVEGDDEAIFNIKKVERFVAVALWCLQEEPTMRPTMLKVTQMLDGAVQIPTPPDPSS  806

Query  176  FLS  168
            ++S
Sbjct  807  YIS  809



>emb|CAN84023.1| hypothetical protein VITISV_004992 [Vitis vinifera]
Length=761

 Score =   201 bits (511),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 139/184 (76%), Gaps = 4/184 (2%)
 Frame = -2

Query  701  ARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTKG  522
            ARGL YLHEEC TQIIHCDIKPQNIL+D+ F A+ISDFGLAK +K DQTRT T +RGTKG
Sbjct  578  ARGLFYLHEECSTQIIHCDIKPQNILLDDSFSARISDFGLAKLLKTDQTRTTTGIRGTKG  637

Query  521  YVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDE-EAVLEEWVYNCFEAG--  351
            YVAPEW + M +TVK DVYSFGI+LLELI  RK++++   DE + +L +W Y+C++ G  
Sbjct  638  YVAPEWFKSMPITVKVDVYSFGILLLELICCRKNLEFEAKDETQMILADWAYDCYKGGLL  697

Query  350  -evskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSF  174
              +     E     +++E+ V I++WCIQE+PSLRP+MKKV  MLEG V++ VPP P SF
Sbjct  698  EVLVGYDQEAIXXMKRLEKFVMIAIWCIQEDPSLRPTMKKVTQMLEGAVEVSVPPDPCSF  757

Query  173  LSVV  162
            +S +
Sbjct  758  ISSI  761



>ref|XP_006445948.1| hypothetical protein CICLE_v10017506mg [Citrus clementina]
 gb|ESR59188.1| hypothetical protein CICLE_v10017506mg [Citrus clementina]
Length=814

 Score =   201 bits (511),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 134/181 (74%), Gaps = 4/181 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTY-TIVRGT  528
            IARGLLYLHE+C  QIIHCDIKPQNIL+D+ + A+ISDFGLAK +  +Q++   T +RGT
Sbjct  629  IARGLLYLHEDCSAQIIHCDIKPQNILLDDYYNARISDFGLAKLLTLNQSKAIKTAIRGT  688

Query  527  KGYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGe  348
            KGYVAPEW R   +T K DVYSFG++LLE+IS RKS D  + +E A+L +W ++C+  G+
Sbjct  689  KGYVAPEWFRNSTITAKVDVYSFGVLLLEIISCRKSFDIEMGEEYAILTDWAFDCYRNGK  748

Query  347  vskvvgeeevekrq---vermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +  +V  +          E++V +S+WCIQE+PSLRP+M+KV  MLEG V++ VPP+P+ 
Sbjct  749  LDDLVEGDTEAMNDIKCAEKLVMVSIWCIQEDPSLRPTMRKVSQMLEGVVEVDVPPNPSP  808

Query  176  F  174
            F
Sbjct  809  F  809



>gb|KDO56484.1| hypothetical protein CISIN_1g042262mg [Citrus sinensis]
Length=814

 Score =   201 bits (511),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 134/181 (74%), Gaps = 4/181 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTY-TIVRGT  528
            IARGLLYLHE+C  QIIHCDIKPQNIL+D+ + A+ISDFGLAK +  +Q++   T +RGT
Sbjct  629  IARGLLYLHEDCSAQIIHCDIKPQNILLDDYYNARISDFGLAKLLTLNQSKAIKTAIRGT  688

Query  527  KGYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGe  348
            KGYVAPEW R   +T K DVYSFG++LLE+IS RKS D  + +E A+L +W ++C+  G+
Sbjct  689  KGYVAPEWFRNSTITAKVDVYSFGVLLLEIISCRKSFDIEMGEEYAILTDWAFDCYRNGK  748

Query  347  vskvvgeeevekrq---vermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +  +V  +          E++V +S+WCIQE+PSLRP+M+KV  MLEG V++ VPP+P+ 
Sbjct  749  LDDLVEGDTEAMNDIKCTEKLVMVSIWCIQEDPSLRPTMRKVSQMLEGVVEVDVPPNPSP  808

Query  176  F  174
            F
Sbjct  809  F  809



>ref|XP_011025239.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 isoform X1 [Populus euphratica]
Length=805

 Score =   201 bits (511),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 136/184 (74%), Gaps = 4/184 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC TQIIHCDIKPQNIL+DN + A+ISDFGLAK +  DQ++T T +RGTK
Sbjct  617  IARGLLYLHEECGTQIIHCDIKPQNILLDNYYNARISDFGLAKLLVMDQSKTQTAIRGTK  676

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCD-EEAVLEEWVYNCFEAGe  348
            GYVAPEW R   +TVK DVYSFG++L+E+I  R++VD  + + E  VL +W Y+C+  G 
Sbjct  677  GYVAPEWFRNRPITVKVDVYSFGVMLIEIICCRRNVDLEIGEAENPVLTDWAYDCYMNGS  736

Query  347  vs---kvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
            +        E + +   +ER++++ +WCIQE+PS+RP+M+KV  MLEG V++P  P+P  
Sbjct  737  LDVLIGDDMEAKNDISTLERLLKVGIWCIQEDPSVRPTMRKVTQMLEGVVEVPAAPNPFP  796

Query  176  FLSV  165
            + ++
Sbjct  797  YSTI  800



>ref|XP_002446137.1| hypothetical protein SORBIDRAFT_06g002200 [Sorghum bicolor]
 gb|EES10465.1| hypothetical protein SORBIDRAFT_06g002200 [Sorghum bicolor]
Length=808

 Score =   201 bits (511),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 134/184 (73%), Gaps = 3/184 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            +ARGLLYLHEEC TQIIHCDIKPQNIL+D++  AKISDFGLAK ++ +QT+T T +RGT+
Sbjct  625  VARGLLYLHEECSTQIIHCDIKPQNILLDDKLTAKISDFGLAKLLQTNQTQTNTGIRGTR  684

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCDEEAVLEEWVYNCFEAGev  345
            GYVAPEW + + +T K DVYS+G++LLELISRR++V+    +++ +L  W  +C+  G V
Sbjct  685  GYVAPEWFKSIGITAKVDVYSYGVILLELISRRRNVELEAAEDKKILTYWASDCYRCGRV  744

Query  344  ---skvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSF  174
                +   E     + VER V ++LWC+QE+P++RP+M KV  ML+G   IP P  P+SF
Sbjct  745  DLLVEADAEAISNLKVVERFVAVALWCLQEDPTIRPTMLKVTQMLDGAEAIPSPLDPSSF  804

Query  173  LSVV  162
             S V
Sbjct  805  FSSV  808



>emb|CDP04780.1| unnamed protein product [Coffea canephora]
Length=573

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 139/178 (78%), Gaps = 1/178 (1%)
 Frame = -2

Query  695  GLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTKGYV  516
            G+LYLHEEC++ IIHCDIKPQN+L+D  + AKISDFGLAK +  +QTRT T  RGT+GY+
Sbjct  394  GILYLHEECESAIIHCDIKPQNLLLDESWRAKISDFGLAKLLMPEQTRTNTHARGTRGYM  453

Query  515  APEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLCD-EEAVLEEWVYNCFEAGevsk  339
            APEW + + ++VK D+YSFGIVLLE++  RK++ ++L   EE +L  W YNCFEA E+ K
Sbjct  454  APEWFKNIPISVKVDIYSFGIVLLEIVCCRKNLAYNLSRPEETLLPAWAYNCFEANELDK  513

Query  338  vvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFLSV  165
            ++  EEV++R  ERM+ ++LWCIQ+EP+LR  MK V++MLEG +D+P+PP P+   SV
Sbjct  514  LIRGEEVDRRTFERMITVALWCIQDEPALRFPMKTVMMMLEGIIDVPIPPCPSDEFSV  571



>ref|XP_007014868.1| Receptor-like protein kinase 1, putative [Theobroma cacao]
 gb|EOY32487.1| Receptor-like protein kinase 1, putative [Theobroma cacao]
Length=799

 Score =   201 bits (511),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 134/182 (74%), Gaps = 4/182 (2%)
 Frame = -2

Query  704  IARGLLYLHEECDTQIIHCDIKPQNILMDNQFVAKISDFGLAKHMKQDQTRTYTIVRGTK  525
            IARGLLYLHEEC  QIIHCDIKPQNIL+D  + A+ISDFGLAK +  DQ++T T +RGTK
Sbjct  615  IARGLLYLHEECSNQIIHCDIKPQNILLDEYYNARISDFGLAKLLFLDQSQTSTAIRGTK  674

Query  524  GYVAPEWHRKMAVTVKADVYSFGIVLLELISRRKSVDWSLC-DEEAVLEEWVYNCFEA--  354
            GYVAPEW R + +TVK DVYSFG++LLE+I  R+SVD      E+ +L  W ++C++   
Sbjct  675  GYVAPEWFRNLPITVKVDVYSFGVLLLEIICCRRSVDTDASGSEKIILTYWAFDCYQERT  734

Query  353  -GevskvvgeeevekrqvermvRISLWCIQEEPSLRPSMKKVLLMLEGTVDIPVPPSPTS  177
               + +   E   ++ ++ER V I++WCIQE+PSLRP+MKKV  MLEG + +P+PP PT 
Sbjct  735  LDALVENDMEALNDREKLERFVAIAIWCIQEDPSLRPTMKKVTQMLEGVLQVPIPPCPTP  794

Query  176  FL  171
            F+
Sbjct  795  FI  796



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1129260521844