BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25736_g1_i4 len=1473 path=[1451:0-103 1555:104-149 1601:150-164
1616:165-194 7813:195-200 1652:201-326 1778:327-332 1784:333-341
1793:342-394 1846:395-444 1896:445-463 7925:464-484 1936:485-518
7960:519-528 1980:529-682 2134:683-694 2146:695-718 2170:719-744
2196:745-757 2209:758-776 2228:777-800 8062:801-823 2275:824-856
2308:857-880 2332:881-895 2347:896-912 2364:913-943 8161:944-967
2419:968-971 2423:972-1027 2479:1028-1058 2510:1059-1089
8227:1090-1117 8252:1118-1131 2583:1132-1153 8285:1154-1157
2609:1158-1174 2626:1175-1293 2745:1294-1307 2759:1308-1358
2810:1359-1376 8343:1377-1391 2843:1392-1415 2867:1416-1472]

Length=1473
                                                                      Score     E

ref|XP_006443278.1|  hypothetical protein CICLE_v10020341mg             329   4e-104   
ref|XP_011038586.1|  PREDICTED: G-type lectin S-receptor-like ser...    328   8e-104   
gb|KDO52487.1|  hypothetical protein CISIN_1g014851mg                   327   3e-103   
ref|XP_007013194.1|  Serine/threonine-protein kinase PBS1, putative     335   7e-102   
ref|XP_010049703.1|  PREDICTED: G-type lectin S-receptor-like ser...    334   2e-101   
ref|XP_010049702.1|  PREDICTED: G-type lectin S-receptor-like ser...    334   2e-101   
ref|XP_009371483.1|  PREDICTED: G-type lectin S-receptor-like ser...    319   1e-95    
ref|XP_008354522.1|  PREDICTED: G-type lectin S-receptor-like ser...    311   3e-93    
ref|XP_008242619.1|  PREDICTED: G-type lectin S-receptor-like ser...    312   4e-93    
ref|XP_007204265.1|  hypothetical protein PRUPE_ppa002027mg             310   4e-93    
ref|XP_008363019.1|  PREDICTED: G-type lectin S-receptor-like ser...    308   5e-92    
ref|XP_008344096.1|  PREDICTED: G-type lectin S-receptor-like ser...    308   8e-92    
ref|XP_004289464.1|  PREDICTED: G-type lectin S-receptor-like ser...    307   1e-91    
ref|XP_008390321.1|  PREDICTED: G-type lectin S-receptor-like ser...    306   2e-91    
ref|XP_004287414.1|  PREDICTED: G-type lectin S-receptor-like ser...    296   3e-87    
ref|XP_009374013.1|  PREDICTED: G-type lectin S-receptor-like ser...    293   7e-86    
ref|XP_008390308.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    298   2e-85    
ref|XP_009371470.1|  PREDICTED: G-type lectin S-receptor-like ser...    291   2e-85    
ref|XP_008337429.1|  PREDICTED: G-type lectin S-receptor-like ser...    289   2e-84    
gb|KCW82456.1|  hypothetical protein EUGRSUZ_C03848                     278   1e-81    
ref|XP_010249751.1|  PREDICTED: G-type lectin S-receptor-like ser...    277   6e-80    
ref|XP_010249750.1|  PREDICTED: G-type lectin S-receptor-like ser...    277   7e-80    
ref|XP_010525291.1|  PREDICTED: G-type lectin S-receptor-like ser...    266   1e-79    
ref|XP_002871818.1|  hypothetical protein ARALYDRAFT_488726             259   3e-77    
ref|XP_010254131.1|  PREDICTED: G-type lectin S-receptor-like ser...    268   6e-77    
ref|XP_010254130.1|  PREDICTED: G-type lectin S-receptor-like ser...    268   6e-77    
ref|XP_002522015.1|  conserved hypothetical protein                     258   5e-75    Ricinus communis
gb|KDP23746.1|  hypothetical protein JCGZ_23579                         245   1e-73    
ref|XP_010250354.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    261   3e-72    
ref|NP_197348.1|  curculin-like (mannose-binding) lectin family p...    241   3e-70    Arabidopsis thaliana [mouse-ear cress]
gb|KDP37223.1|  hypothetical protein JCGZ_06279                         255   4e-70    
ref|XP_009126255.1|  PREDICTED: G-type lectin S-receptor-like ser...    240   5e-70    
ref|XP_003632790.1|  PREDICTED: G-type lectin S-receptor-like ser...    246   1e-68    
emb|CDY02627.1|  BnaC02g08080D                                          234   7e-68    
ref|XP_010454090.1|  PREDICTED: G-type lectin S-receptor-like ser...    234   9e-68    
ref|XP_010420610.1|  PREDICTED: G-type lectin S-receptor-like ser...    234   1e-67    
emb|CDY58115.1|  BnaA02g35160D                                          233   4e-67    
ref|XP_010666173.1|  PREDICTED: G-type lectin S-receptor-like ser...    240   1e-66    
gb|KDO56873.1|  hypothetical protein CISIN_1g0393451mg                  230   3e-66    
emb|CDX70821.1|  BnaC03g09050D                                          230   4e-66    
ref|XP_009131670.1|  PREDICTED: G-type lectin S-receptor-like ser...    229   7e-66    
ref|XP_006426982.1|  hypothetical protein CICLE_v10025426mg             231   1e-65    
ref|XP_009773566.1|  PREDICTED: G-type lectin S-receptor-like ser...    235   2e-65    
ref|XP_004304502.1|  PREDICTED: G-type lectin S-receptor-like ser...    236   2e-65    
ref|XP_009773565.1|  PREDICTED: G-type lectin S-receptor-like ser...    236   3e-65    
emb|CBI18329.3|  unnamed protein product                                234   4e-65    
ref|XP_002516064.1|  Serine/threonine-protein kinase PBS1, putative     234   1e-64    Ricinus communis
ref|XP_010652595.1|  PREDICTED: G-type lectin S-receptor-like ser...    234   2e-64    
emb|CAN64778.1|  hypothetical protein VITISV_043229                     236   2e-64    Vitis vinifera
ref|XP_009146177.1|  PREDICTED: G-type lectin S-receptor-like ser...    233   1e-63    
ref|XP_009146176.1|  PREDICTED: G-type lectin S-receptor-like ser...    232   1e-63    
gb|KDO56870.1|  hypothetical protein CISIN_1g036124mg                   224   2e-63    
ref|XP_004236409.1|  PREDICTED: G-type lectin S-receptor-like ser...    231   2e-63    
emb|CDX88936.1|  BnaA03g07130D                                          221   7e-63    
ref|XP_002516068.1|  receptor protein kinase, putative                  229   1e-62    Ricinus communis
emb|CDY50626.1|  BnaC01g44280D                                          229   1e-62    
ref|NP_188224.1|  G-type lectin S-receptor-like serine/threonine-...    229   2e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010545708.1|  PREDICTED: G-type lectin S-receptor-like ser...    229   2e-62    
ref|XP_006465591.1|  PREDICTED: G-type lectin S-receptor-like ser...    226   4e-62    
emb|CBI18331.3|  unnamed protein product                                225   4e-62    
ref|XP_006426987.1|  hypothetical protein CICLE_v10024887mg             223   6e-62    
ref|XP_010495280.1|  PREDICTED: G-type lectin S-receptor-like ser...    219   6e-62    
emb|CAN74670.1|  hypothetical protein VITISV_000269                     226   6e-62    Vitis vinifera
ref|XP_010652593.1|  PREDICTED: G-type lectin S-receptor-like ser...    227   6e-62    
emb|CAN61710.1|  hypothetical protein VITISV_034501                     221   6e-62    Vitis vinifera
emb|CAN61711.1|  hypothetical protein VITISV_034502                     227   1e-61    Vitis vinifera
ref|XP_010652582.1|  PREDICTED: G-type lectin S-receptor-like ser...    220   1e-61    
ref|XP_006426986.1|  hypothetical protein CICLE_v10024887mg             223   1e-61    
ref|XP_010652594.1|  PREDICTED: G-type lectin S-receptor-like ser...    226   2e-61    
ref|XP_006426988.1|  hypothetical protein CICLE_v10024887mg             223   2e-61    
ref|XP_006465590.1|  PREDICTED: G-type lectin S-receptor-like ser...    225   2e-61    
ref|XP_010511696.1|  PREDICTED: G-type lectin S-receptor-like ser...    224   2e-61    
ref|XP_002268342.1|  PREDICTED: G-type lectin S-receptor-like ser...    225   2e-61    Vitis vinifera
ref|XP_006465592.1|  PREDICTED: G-type lectin S-receptor-like ser...    225   2e-61    
ref|XP_006465588.1|  PREDICTED: G-type lectin S-receptor-like ser...    225   3e-61    
gb|AFO11038.1|  S domain subfamily receptor-like kinase                 225   3e-61    
ref|XP_010470661.1|  PREDICTED: G-type lectin S-receptor-like ser...    223   4e-61    
ref|XP_009628271.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    224   8e-61    
ref|XP_002882973.1|  CES101                                             223   9e-61    
ref|XP_010470660.1|  PREDICTED: G-type lectin S-receptor-like ser...    223   1e-60    
ref|XP_006465589.1|  PREDICTED: G-type lectin S-receptor-like ser...    223   1e-60    
ref|XP_010511695.1|  PREDICTED: G-type lectin S-receptor-like ser...    223   1e-60    
ref|XP_006366861.1|  PREDICTED: G-type lectin S-receptor-like ser...    223   2e-60    
ref|XP_010470659.1|  PREDICTED: G-type lectin S-receptor-like ser...    223   2e-60    
emb|CDY30129.1|  BnaC05g37330D                                          223   2e-60    
gb|KDO37222.1|  hypothetical protein CISIN_1g045212mg                   213   3e-60    
ref|XP_006426989.1|  hypothetical protein CICLE_v10024887mg             223   3e-60    
ref|XP_010249749.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    222   4e-60    
dbj|BAB02668.1|  receptor kinase 1                                      221   8e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008228523.1|  PREDICTED: G-type lectin S-receptor-like ser...    219   2e-59    
ref|XP_007216127.1|  hypothetical protein PRUPE_ppa018966mg             219   3e-59    
ref|XP_010652590.1|  PREDICTED: G-type lectin S-receptor-like ser...    218   3e-59    
emb|CDX97717.1|  BnaA05g23620D                                          219   4e-59    
ref|XP_002267797.3|  PREDICTED: S-locus-specific glycoprotein S6-...    214   5e-59    Vitis vinifera
gb|AFO11039.1|  S domain subfamily 1 receptor-like kinase               219   6e-59    
emb|CAN67086.1|  hypothetical protein VITISV_031091                     216   7e-59    Vitis vinifera
ref|XP_010545710.1|  PREDICTED: G-type lectin S-receptor-like ser...    218   9e-59    
ref|XP_010666132.1|  PREDICTED: G-type lectin S-receptor-like ser...    218   1e-58    
gb|KDO56866.1|  hypothetical protein CISIN_1g046791mg                   219   1e-58    
gb|KDO56868.1|  hypothetical protein CISIN_1g043278mg                   217   2e-58    
ref|XP_010545709.1|  PREDICTED: G-type lectin S-receptor-like ser...    218   2e-58    
emb|CDO98047.1|  unnamed protein product                                216   3e-58    
ref|XP_006299249.1|  hypothetical protein CARUB_v10015398mg             216   5e-58    
ref|XP_002888604.1|  predicted protein                                  214   2e-57    
ref|XP_006426994.1|  hypothetical protein CICLE_v10027600mg             213   5e-57    
ref|XP_010652616.1|  PREDICTED: G-type lectin S-receptor-like ser...    211   1e-56    
ref|XP_009804711.1|  PREDICTED: G-type lectin S-receptor-like ser...    207   1e-55    
ref|XP_002267352.1|  PREDICTED: G-type lectin S-receptor-like ser...    208   2e-55    Vitis vinifera
ref|XP_009804710.1|  PREDICTED: G-type lectin S-receptor-like ser...    208   3e-55    
ref|XP_010503680.1|  PREDICTED: G-type lectin S-receptor-like ser...    207   6e-55    
ref|NP_176919.2|  G-type lectin S-receptor-like serine/threonine-...    203   2e-54    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010272743.1|  PREDICTED: G-type lectin S-receptor-like ser...    194   1e-53    
gb|AAG52302.1|AC011020_9  putative receptor protein kinase              202   2e-53    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002298945.1|  hypothetical protein POPTR_0001s43270g             202   2e-53    Populus trichocarpa [western balsam poplar]
sp|O64793.3|Y1675_ARATH  RecName: Full=G-type lectin S-receptor-l...    202   2e-53    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007024153.1|  Serine/threonine-protein kinase PBS1, putative     202   3e-53    
ref|XP_008226124.1|  PREDICTED: G-type lectin S-receptor-like ser...    202   3e-53    
ref|XP_010927977.1|  PREDICTED: G-type lectin S-receptor-like ser...    201   7e-53    
ref|XP_011016330.1|  PREDICTED: G-type lectin S-receptor-like ser...    200   1e-52    
ref|XP_010927986.1|  PREDICTED: G-type lectin S-receptor-like ser...    200   1e-52    
ref|XP_008793685.1|  PREDICTED: G-type lectin S-receptor-like ser...    200   1e-52    
ref|XP_009619490.1|  PREDICTED: G-type lectin S-receptor-like ser...    200   2e-52    
ref|XP_011011051.1|  PREDICTED: G-type lectin S-receptor-like ser...    199   2e-52    
ref|XP_006352934.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    202   5e-52    
ref|XP_011012335.1|  PREDICTED: G-type lectin S-receptor-like ser...    198   6e-52    
ref|XP_011012334.1|  PREDICTED: G-type lectin S-receptor-like ser...    198   7e-52    
ref|XP_011012337.1|  PREDICTED: G-type lectin S-receptor-like ser...    198   8e-52    
ref|XP_011012338.1|  PREDICTED: G-type lectin S-receptor-like ser...    197   1e-51    
ref|XP_002298942.2|  hypothetical protein POPTR_0001s43260g             196   2e-51    Populus trichocarpa [western balsam poplar]
ref|XP_002300490.2|  hypothetical protein POPTR_0001s43180g             196   2e-51    Populus trichocarpa [western balsam poplar]
ref|XP_006370489.1|  hypothetical protein POPTR_0001s43180g             196   3e-51    
ref|XP_010489860.1|  PREDICTED: G-type lectin S-receptor-like ser...    196   3e-51    
ref|XP_002298946.2|  hypothetical protein POPTR_0001s43280g             196   3e-51    Populus trichocarpa [western balsam poplar]
ref|XP_010928155.1|  PREDICTED: G-type lectin S-receptor-like ser...    191   4e-51    
emb|CDP11734.1|  unnamed protein product                                196   4e-51    
ref|XP_011012340.1|  PREDICTED: G-type lectin S-receptor-like ser...    195   5e-51    
ref|XP_011012341.1|  PREDICTED: G-type lectin S-receptor-like ser...    195   5e-51    
gb|KDO56864.1|  hypothetical protein CISIN_1g039858mg                   188   5e-51    
ref|XP_006388896.1|  hypothetical protein POPTR_0080s002201g            191   6e-51    
ref|XP_011013017.1|  PREDICTED: G-type lectin S-receptor-like ser...    191   7e-51    
ref|XP_007021210.1|  S-locus lectin protein kinase family protein...    194   1e-50    
ref|XP_010652609.1|  PREDICTED: G-type lectin S-receptor-like ser...    185   1e-50    
emb|CAN74543.1|  hypothetical protein VITISV_029622                     194   2e-50    Vitis vinifera
emb|CBI20449.3|  unnamed protein product                                189   3e-50    
ref|XP_008778592.1|  PREDICTED: S-locus-specific glycoprotein S13...    190   3e-50    
ref|XP_002298944.2|  hypothetical protein POPTR_0001s42890g             193   3e-50    Populus trichocarpa [western balsam poplar]
ref|XP_008226187.1|  PREDICTED: G-type lectin S-receptor-like ser...    187   5e-50    
ref|XP_010927558.1|  PREDICTED: receptor-like serine/threonine-pr...    191   8e-50    
ref|XP_006452073.1|  hypothetical protein CICLE_v10007451mg             190   1e-49    
ref|XP_011002473.1|  PREDICTED: uncharacterized protein LOC105109448    194   1e-49    
ref|XP_010927549.1|  PREDICTED: G-type lectin S-receptor-like ser...    191   1e-49    
ref|XP_010927539.1|  PREDICTED: receptor-like serine/threonine-pr...    191   2e-49    
ref|XP_010927531.1|  PREDICTED: G-type lectin S-receptor-like ser...    191   2e-49    
gb|KDO74345.1|  hypothetical protein CISIN_1g003254mg                   188   2e-49    
ref|XP_006370396.1|  hypothetical protein POPTR_0001s42220g             190   3e-49    
ref|XP_009605162.1|  PREDICTED: G-type lectin S-receptor-like ser...    189   3e-49    
ref|XP_006452072.1|  hypothetical protein CICLE_v10007451mg             191   3e-49    
ref|XP_006475244.1|  PREDICTED: G-type lectin S-receptor-like ser...    191   3e-49    
ref|XP_011011049.1|  PREDICTED: G-type lectin S-receptor-like ser...    190   4e-49    
ref|XP_009605161.1|  PREDICTED: G-type lectin S-receptor-like ser...    190   4e-49    
ref|XP_009605160.1|  PREDICTED: G-type lectin S-receptor-like ser...    190   5e-49    
ref|XP_010644298.1|  PREDICTED: G-type lectin S-receptor-like ser...    189   5e-49    
gb|KDO74343.1|  hypothetical protein CISIN_1g003254mg                   188   6e-49    
gb|KGN45304.1|  hypothetical protein Csa_7G433330                       187   7e-49    
gb|KDO74342.1|  hypothetical protein CISIN_1g003254mg                   189   7e-49    
ref|XP_010927579.1|  PREDICTED: receptor-like serine/threonine-pr...    187   1e-48    
gb|KDO74338.1|  hypothetical protein CISIN_1g003832mg                   187   1e-48    
ref|XP_010325596.1|  PREDICTED: G-type lectin S-receptor-like ser...    192   1e-48    
ref|XP_011012339.1|  PREDICTED: G-type lectin S-receptor-like ser...    188   1e-48    
gb|KDO74341.1|  hypothetical protein CISIN_1g003254mg                   188   1e-48    
ref|XP_006300803.1|  hypothetical protein CARUB_v10019886mg             188   1e-48    
ref|XP_010928178.1|  PREDICTED: G-type lectin S-receptor-like ser...    188   1e-48    
gb|KDO74339.1|  hypothetical protein CISIN_1g003832mg                   186   1e-48    
ref|XP_009135846.1|  PREDICTED: G-type lectin S-receptor-like ser...    190   2e-48    
ref|XP_009135847.1|  PREDICTED: G-type lectin S-receptor-like ser...    189   2e-48    
gb|KDO74337.1|  hypothetical protein CISIN_1g003832mg                   187   2e-48    
ref|XP_009135845.1|  PREDICTED: G-type lectin S-receptor-like ser...    189   2e-48    
ref|XP_009406495.1|  PREDICTED: receptor-like serine/threonine-pr...    188   2e-48    
gb|KDO74340.1|  hypothetical protein CISIN_1g003254mg                   188   2e-48    
gb|KDO74335.1|  hypothetical protein CISIN_1g003832mg                   187   2e-48    
ref|XP_009417412.1|  PREDICTED: receptor-like serine/threonine-pr...    191   2e-48    
emb|CAH67725.1|  H0613A10.8                                             188   3e-48    Oryza sativa [red rice]
ref|XP_010644396.1|  PREDICTED: uncharacterized protein LOC100260657    191   3e-48    
ref|XP_010644274.1|  PREDICTED: receptor-like serine/threonine-pr...    191   3e-48    
ref|XP_008226191.1|  PREDICTED: G-type lectin S-receptor-like ser...    191   3e-48    
gb|KDO74334.1|  hypothetical protein CISIN_1g003832mg                   187   3e-48    
ref|XP_010927571.1|  PREDICTED: receptor-like serine/threonine-pr...    187   3e-48    
gb|KDO74333.1|  hypothetical protein CISIN_1g003832mg                   187   4e-48    
ref|XP_006475243.1|  PREDICTED: G-type lectin S-receptor-like ser...    187   4e-48    
gb|KDO74326.1|  hypothetical protein CISIN_1g003846mg                   187   5e-48    
ref|XP_011002474.1|  PREDICTED: G-type lectin S-receptor-like ser...    186   5e-48    
gb|EYU23280.1|  hypothetical protein MIMGU_mgv1a000166mg                189   6e-48    
gb|EEC78088.1|  hypothetical protein OsI_17567                          187   6e-48    Oryza sativa Indica Group [Indian rice]
ref|XP_008794829.1|  PREDICTED: G-type lectin S-receptor-like ser...    186   2e-47    
gb|KCW69727.1|  hypothetical protein EUGRSUZ_F031111                    181   2e-47    
ref|XP_006370493.1|  hypothetical protein POPTR_0001s43220g             176   2e-47    
ref|XP_010644397.1|  PREDICTED: uncharacterized protein LOC100262430    188   2e-47    
ref|XP_004151787.1|  PREDICTED: G-type lectin S-receptor-like ser...    180   2e-47    
ref|XP_010324437.1|  PREDICTED: uncharacterized protein LOC101244973    188   2e-47    
ref|XP_006370486.1|  hypothetical protein POPTR_0001s43160g             184   2e-47    
gb|KDP38980.1|  hypothetical protein JCGZ_00737                         184   3e-47    
ref|XP_006370395.1|  hypothetical protein POPTR_0001s42210g             184   4e-47    
ref|XP_006388898.1|  hypothetical protein POPTR_0080s00240g             184   4e-47    
ref|XP_008779293.1|  PREDICTED: G-type lectin S-receptor-like ser...    184   5e-47    
ref|XP_010240986.1|  PREDICTED: G-type lectin S-receptor-like ser...    184   5e-47    
ref|XP_010487446.1|  PREDICTED: G-type lectin S-receptor-like ser...    184   6e-47    
ref|XP_010327263.1|  PREDICTED: uncharacterized protein LOC101244232    187   6e-47    
ref|XP_010928020.1|  PREDICTED: S-locus-specific glycoprotein S13...    180   7e-47    
ref|XP_004308259.1|  PREDICTED: G-type lectin S-receptor-like ser...    186   7e-47    
gb|KCW74885.1|  hypothetical protein EUGRSUZ_E03623                     181   1e-46    
ref|XP_006362970.1|  PREDICTED: G-type lectin S-receptor-like ser...    183   1e-46    
ref|XP_007021203.1|  S-locus lectin protein kinase family protein...    182   1e-46    
ref|XP_008366279.1|  PREDICTED: G-type lectin S-receptor-like ser...    183   1e-46    
ref|XP_011097953.1|  PREDICTED: G-type lectin S-receptor-like ser...    183   1e-46    
gb|KCW74883.1|  hypothetical protein EUGRSUZ_E03623                     181   1e-46    
ref|XP_010644283.1|  PREDICTED: G-type lectin S-receptor-like ser...    180   1e-46    
ref|XP_006452078.1|  hypothetical protein CICLE_v10010587mg             182   2e-46    
gb|KHN17919.1|  G-type lectin S-receptor-like serine/threonine-pr...    182   2e-46    
ref|XP_006591790.1|  PREDICTED: G-type lectin S-receptor-like ser...    182   2e-46    
ref|XP_006451681.1|  hypothetical protein CICLE_v10010284mg             177   2e-46    
gb|KDO74352.1|  hypothetical protein CISIN_1g038934mg                   182   2e-46    
gb|KCW74886.1|  hypothetical protein EUGRSUZ_E03623                     181   2e-46    
emb|CAN61538.1|  hypothetical protein VITISV_030742                     182   3e-46    Vitis vinifera
ref|XP_004308260.1|  PREDICTED: G-type lectin S-receptor-like ser...    176   3e-46    
ref|XP_010644290.1|  PREDICTED: G-type lectin S-receptor-like ser...    182   3e-46    
ref|NP_001053997.2|  Os04g0633900                                       181   3e-46    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010647533.1|  PREDICTED: G-type lectin S-receptor-like ser...    182   3e-46    
gb|KHG07104.1|  G-type lectin S-receptor-like serine/threonine-pr...    182   3e-46    
ref|XP_004166621.1|  PREDICTED: G-type lectin S-receptor-like ser...    181   3e-46    
ref|XP_006452077.1|  hypothetical protein CICLE_v10007816mg             180   4e-46    
ref|XP_010064867.1|  PREDICTED: G-type lectin S-receptor-like ser...    182   4e-46    
ref|XP_007163418.1|  hypothetical protein PHAVU_001G233100g             181   4e-46    
gb|KCW74884.1|  hypothetical protein EUGRSUZ_E03623                     181   4e-46    
ref|XP_007021202.1|  S-locus lectin protein kinase family protein...    181   4e-46    
ref|XP_004136078.1|  PREDICTED: G-type lectin S-receptor-like ser...    181   5e-46    
emb|CAE02990.2|  OSJNBa0043L09.9                                        181   5e-46    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010062922.1|  PREDICTED: G-type lectin S-receptor-like ser...    181   5e-46    
emb|CAH67720.1|  H0613A10.3                                             178   6e-46    Oryza sativa [red rice]
gb|KDP38970.1|  hypothetical protein JCGZ_00727                         181   6e-46    
gb|KDO62849.1|  hypothetical protein CISIN_1g012654mg                   177   8e-46    
ref|XP_010064917.1|  PREDICTED: G-type lectin S-receptor-like ser...    181   8e-46    
gb|KDO38116.1|  hypothetical protein CISIN_1g0448792mg                  178   8e-46    
ref|XP_010062920.1|  PREDICTED: G-type lectin S-receptor-like ser...    180   9e-46    
ref|XP_003526159.2|  PREDICTED: G-type lectin S-receptor-like ser...    180   1e-45    
ref|XP_009591715.1|  PREDICTED: G-type lectin S-receptor-like ser...    176   1e-45    
ref|XP_010324436.1|  PREDICTED: uncharacterized protein LOC101244686    183   1e-45    
emb|CBI20455.3|  unnamed protein product                                176   1e-45    
ref|XP_007021205.1|  S-locus lectin protein kinase family protein...    179   2e-45    
ref|XP_006382400.1|  hypothetical protein POPTR_0005s01780g             181   2e-45    
ref|XP_010644308.1|  PREDICTED: G-type lectin S-receptor-like ser...    179   2e-45    
ref|XP_010644302.1|  PREDICTED: G-type lectin S-receptor-like ser...    179   2e-45    
gb|KHN28396.1|  G-type lectin S-receptor-like serine/threonine-pr...    179   2e-45    
gb|ABG29323.1|  Receptor protein kinase, putative                       182   2e-45    Solanum bulbocastanum [ornamental nightshade]
ref|XP_006475274.1|  PREDICTED: uncharacterized protein LOC102626881    182   2e-45    
ref|XP_010644394.1|  PREDICTED: uncharacterized protein LOC100262308    182   2e-45    
ref|XP_004976939.1|  PREDICTED: receptor-like serine/threonine-pr...    179   3e-45    
ref|XP_004976938.1|  PREDICTED: receptor-like serine/threonine-pr...    179   3e-45    
ref|XP_007021223.1|  Serine/threonine kinases,protein kinases,ATP...    182   3e-45    
ref|XP_007021222.1|  Serine/threonine kinases,protein kinases,ATP...    182   3e-45    
ref|XP_008813305.1|  PREDICTED: uncharacterized protein LOC103723979    181   3e-45    
ref|XP_006370490.1|  hypothetical protein POPTR_0001s43190g             169   3e-45    
ref|XP_006370566.1|  hypothetical protein POPTR_0001s43850g             179   3e-45    
ref|XP_010644303.1|  PREDICTED: G-type lectin S-receptor-like ser...    178   3e-45    
ref|XP_008462448.1|  PREDICTED: G-type lectin S-receptor-like ser...    177   4e-45    
ref|XP_002534316.1|  S-locus-specific glycoprotein S6 precursor, ...    179   4e-45    Ricinus communis
ref|XP_002283476.3|  PREDICTED: G-type lectin S-receptor-like ser...    178   4e-45    Vitis vinifera
emb|CDP05828.1|  unnamed protein product                                178   4e-45    
ref|XP_007021182.1|  S-locus lectin protein kinase family protein       180   4e-45    
ref|XP_008789837.1|  PREDICTED: receptor-like serine/threonine-pr...    181   4e-45    
ref|XP_006475273.1|  PREDICTED: uncharacterized protein LOC102626595    181   5e-45    
gb|KCW70066.1|  hypothetical protein EUGRSUZ_F03370                     178   5e-45    
ref|XP_009377300.1|  PREDICTED: G-type lectin S-receptor-like ser...    178   5e-45    
ref|XP_009377299.1|  PREDICTED: G-type lectin S-receptor-like ser...    178   5e-45    
ref|XP_010644307.1|  PREDICTED: G-type lectin S-receptor-like ser...    178   5e-45    
ref|XP_010644306.1|  PREDICTED: G-type lectin S-receptor-like ser...    178   6e-45    
emb|CAN70182.1|  hypothetical protein VITISV_000007                     181   6e-45    Vitis vinifera
ref|XP_010644300.1|  PREDICTED: G-type lectin S-receptor-like ser...    178   7e-45    
ref|XP_010240989.1|  PREDICTED: G-type lectin S-receptor-like ser...    177   8e-45    
ref|XP_010644299.1|  PREDICTED: G-type lectin S-receptor-like ser...    177   8e-45    
gb|KCW70067.1|  hypothetical protein EUGRSUZ_F03370                     178   8e-45    
gb|KDO74349.1|  hypothetical protein CISIN_1g003391mg                   176   9e-45    
ref|XP_010644305.1|  PREDICTED: G-type lectin S-receptor-like ser...    177   1e-44    
ref|XP_010644304.1|  PREDICTED: G-type lectin S-receptor-like ser...    177   1e-44    
ref|XP_011009495.1|  PREDICTED: receptor-like serine/threonine-pr...    178   1e-44    
ref|XP_006490727.1|  PREDICTED: G-type lectin S-receptor-like ser...    177   1e-44    
gb|KCW70069.1|  hypothetical protein EUGRSUZ_F03372                     177   1e-44    
ref|XP_010240988.1|  PREDICTED: receptor-like serine/threonine-pr...    177   1e-44    
ref|XP_006490726.1|  PREDICTED: G-type lectin S-receptor-like ser...    177   1e-44    
gb|EEC78082.1|  hypothetical protein OsI_17558                          177   1e-44    
ref|XP_006490723.1|  PREDICTED: G-type lectin S-receptor-like ser...    177   1e-44    
ref|XP_006370367.1|  hypothetical protein POPTR_0001s42020g             177   1e-44    
ref|XP_006490725.1|  PREDICTED: G-type lectin S-receptor-like ser...    177   2e-44    
ref|XP_009385976.1|  PREDICTED: G-type lectin S-receptor-like ser...    177   2e-44    
ref|XP_006382401.1|  hypothetical protein POPTR_0005s01800g             172   2e-44    
ref|XP_004141846.1|  PREDICTED: G-type lectin S-receptor-like ser...    172   2e-44    
gb|KHN36762.1|  G-type lectin S-receptor-like serine/threonine-pr...    176   2e-44    
ref|XP_004295400.1|  PREDICTED: G-type lectin S-receptor-like ser...    177   2e-44    
ref|XP_010064914.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    178   2e-44    
ref|XP_004159019.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    176   2e-44    
ref|XP_008809554.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    177   3e-44    
gb|KDO74346.1|  hypothetical protein CISIN_1g003391mg                   176   3e-44    
gb|KDP38975.1|  hypothetical protein JCGZ_00732                         176   3e-44    
ref|XP_006360152.1|  PREDICTED: uncharacterized protein LOC102593625    178   3e-44    
ref|XP_010227299.1|  PREDICTED: putative serine/threonine-protein...    176   4e-44    
ref|XP_006594795.1|  PREDICTED: G-type lectin S-receptor-like ser...    176   4e-44    
gb|KDO74303.1|  hypothetical protein CISIN_1g003092mg                   174   4e-44    
ref|XP_006452042.1|  hypothetical protein CICLE_v10007443mg             174   4e-44    
ref|XP_003532567.1|  PREDICTED: G-type lectin S-receptor-like ser...    176   5e-44    
ref|XP_010040817.1|  PREDICTED: receptor-like serine/threonine-pr...    176   5e-44    
ref|XP_006452076.1|  hypothetical protein CICLE_v10007466mg             173   5e-44    
gb|KDO74302.1|  hypothetical protein CISIN_1g003092mg                   174   6e-44    
ref|XP_006370411.1|  hypothetical protein POPTR_0001s42340g             174   6e-44    
gb|KCW67255.1|  hypothetical protein EUGRSUZ_F01049                     175   7e-44    
gb|EYU23281.1|  hypothetical protein MIMGU_mgv1a018294mg                174   7e-44    
ref|XP_008794828.1|  PREDICTED: G-type lectin S-receptor-like ser...    175   7e-44    
emb|CAH67718.1|  H0613A10.1                                             175   8e-44    
ref|XP_002528886.1|  S-locus-specific glycoprotein S6 precursor, ...    173   8e-44    
ref|XP_009607193.1|  PREDICTED: G-type lectin S-receptor-like ser...    174   8e-44    
gb|KDO74301.1|  hypothetical protein CISIN_1g003092mg                   174   8e-44    
ref|XP_006452074.1|  hypothetical protein CICLE_v10007466mg             173   9e-44    
ref|XP_010064916.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    177   9e-44    
emb|CAE02982.2|  OSJNBa0043L09.1                                        175   9e-44    
ref|XP_002316682.1|  hypothetical protein POPTR_0011s03770g             175   9e-44    
ref|XP_006370410.1|  hypothetical protein POPTR_0001s42330g             174   1e-43    
ref|XP_004976940.1|  PREDICTED: receptor-like serine/threonine-pr...    175   1e-43    
ref|XP_010268933.1|  PREDICTED: G-type lectin S-receptor-like ser...    175   1e-43    
ref|XP_010040971.1|  PREDICTED: G-type lectin S-receptor-like ser...    174   1e-43    
ref|XP_006475239.1|  PREDICTED: receptor-like serine/threonine-pr...    175   1e-43    
ref|XP_008775776.1|  PREDICTED: G-type lectin S-receptor-like ser...    174   1e-43    
gb|KCW70064.1|  hypothetical protein EUGRSUZ_F03366                     175   1e-43    
gb|AIZ68213.1|  receptor-like serine/threonine-protein kinase SD1-8     174   1e-43    
ref|XP_006370409.1|  hypothetical protein POPTR_0001s42330g             174   1e-43    
ref|XP_006452044.1|  hypothetical protein CICLE_v10007443mg             174   1e-43    
ref|XP_006475240.1|  PREDICTED: receptor-like serine/threonine-pr...    174   1e-43    
emb|CAE02985.2|  OSJNBa0043L09.4                                        174   1e-43    
ref|XP_006452043.1|  hypothetical protein CICLE_v10007443mg             174   1e-43    
ref|XP_010268934.1|  PREDICTED: receptor-like serine/threonine-pr...    174   1e-43    
ref|XP_009605849.1|  PREDICTED: G-type lectin S-receptor-like ser...    174   2e-43    
ref|NP_001174105.1|  Os04g0632700                                       175   2e-43    
ref|XP_010644288.1|  PREDICTED: G-type lectin S-receptor-like ser...    173   2e-43    
dbj|BAJ99425.1|  predicted protein                                      174   2e-43    
emb|CAN77004.1|  hypothetical protein VITISV_027305                     174   2e-43    
ref|XP_010105613.1|  Receptor-like serine/threonine-protein kinas...    174   2e-43    
gb|KCW58376.1|  hypothetical protein EUGRSUZ_H01060                     173   2e-43    
gb|KDO74328.1|  hypothetical protein CISIN_1g040413mg                   173   3e-43    
ref|XP_010644286.1|  PREDICTED: G-type lectin S-receptor-like ser...    173   3e-43    
ref|XP_006452075.1|  hypothetical protein CICLE_v10007466mg             173   3e-43    
ref|XP_006370407.1|  hypothetical protein POPTR_0001s423101g            171   3e-43    
ref|XP_006452066.1|  hypothetical protein CICLE_v10007509mg             173   3e-43    
ref|NP_001053994.1|  Os04g0633200                                       174   3e-43    
ref|XP_007149657.1|  hypothetical protein PHAVU_005G088200g             173   3e-43    
ref|XP_010062923.1|  PREDICTED: G-type lectin S-receptor-like ser...    173   3e-43    
ref|XP_010064432.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    175   3e-43    
ref|XP_010644282.1|  PREDICTED: G-type lectin S-receptor-like ser...    175   4e-43    
gb|EEC78081.1|  hypothetical protein OsI_17557                          172   4e-43    
ref|XP_002448593.1|  hypothetical protein SORBIDRAFT_06g029780          172   4e-43    
ref|XP_010064438.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    176   4e-43    
ref|XP_010644287.1|  PREDICTED: G-type lectin S-receptor-like ser...    172   4e-43    
ref|XP_006475242.1|  PREDICTED: G-type lectin S-receptor-like ser...    173   4e-43    
ref|XP_010924050.1|  PREDICTED: receptor-like serine/threonine-pr...    172   5e-43    
ref|XP_003567183.1|  PREDICTED: receptor-like serine/threonine-pr...    173   5e-43    
emb|CDP06834.1|  unnamed protein product                                175   5e-43    
ref|XP_009794352.1|  PREDICTED: G-type lectin S-receptor-like ser...    172   5e-43    
gb|KHG05344.1|  hypothetical protein F383_30674                         172   5e-43    
ref|XP_006360151.1|  PREDICTED: uncharacterized protein LOC102593298    175   5e-43    
ref|XP_010927749.1|  PREDICTED: G-type lectin S-receptor-like ser...    172   5e-43    
gb|KEH16197.1|  G-type lectin S-receptor-like Serine/Threonine-ki...    172   6e-43    
ref|XP_007025869.1|  Receptor kinase 3                                  172   6e-43    
ref|XP_008777139.1|  PREDICTED: receptor-like serine/threonine-pr...    172   7e-43    
ref|XP_007213123.1|  hypothetical protein PRUPE_ppa023955mg             171   7e-43    
ref|XP_010026110.1|  PREDICTED: G-type lectin S-receptor-like ser...    174   7e-43    
ref|XP_010064920.1|  PREDICTED: G-type lectin S-receptor-like ser...    172   8e-43    
ref|XP_010646911.1|  PREDICTED: G-type lectin S-receptor-like ser...    172   8e-43    
ref|XP_004487351.1|  PREDICTED: G-type lectin S-receptor-like ser...    172   8e-43    
ref|XP_010054457.1|  PREDICTED: G-type lectin S-receptor-like ser...    173   9e-43    
ref|XP_004295873.1|  PREDICTED: uncharacterized protein LOC101296759    175   9e-43    
ref|XP_006388753.1|  hypothetical protein POPTR_0107s00260g             171   1e-42    
gb|KCW74888.1|  hypothetical protein EUGRSUZ_E03625                     169   1e-42    
ref|XP_008794830.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   1e-42    
ref|XP_006388750.1|  hypothetical protein POPTR_0107s002402g            170   1e-42    
ref|XP_002528881.1|  conserved hypothetical protein                     174   1e-42    
gb|KCW74887.1|  hypothetical protein EUGRSUZ_E03625                     170   1e-42    
ref|XP_010652587.1|  PREDICTED: G-type lectin S-receptor-like ser...    170   2e-42    
ref|XP_009771690.1|  PREDICTED: G-type lectin S-receptor-like ser...    170   2e-42    
ref|XP_010314052.1|  PREDICTED: G-type lectin S-receptor-like ser...    164   2e-42    
ref|XP_006447424.1|  hypothetical protein CICLE_v10014281mg             171   2e-42    
gb|KDO75664.1|  hypothetical protein CISIN_1g0030451mg                  169   2e-42    
ref|XP_010059454.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   2e-42    
ref|XP_009794346.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   2e-42    
ref|XP_008383964.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   2e-42    
ref|XP_002316694.2|  hypothetical protein POPTR_0011s03600g             171   2e-42    
ref|XP_007021188.1|  Serine/threonine kinases,protein kinases,ATP...    171   2e-42    
ref|XP_007213469.1|  hypothetical protein PRUPE_ppa023906mg             171   2e-42    
ref|XP_010052475.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   2e-42    
ref|XP_006594870.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   2e-42    
ref|XP_010060466.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   2e-42    
ref|XP_011014316.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   2e-42    
ref|XP_010106713.1|  Receptor-like serine/threonine-protein kinas...    171   2e-42    
ref|XP_010059445.1|  PREDICTED: G-type lectin S-receptor-like ser...    173   2e-42    
ref|XP_006383978.1|  hypothetical protein POPTR_0004s02790g             166   2e-42    
ref|XP_009408779.1|  PREDICTED: receptor-like serine/threonine-pr...    171   2e-42    
ref|XP_010324341.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   2e-42    
ref|XP_010052476.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   2e-42    
ref|XP_011092718.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    171   2e-42    
ref|XP_006378090.1|  hypothetical protein POPTR_0010s02010g             166   3e-42    
gb|AFW59578.1|  putative S-locus receptor-like protein kinase fam...    170   3e-42    
ref|XP_007021219.1|  S-locus lectin protein kinase family protein...    171   3e-42    
ref|XP_002304966.1|  Brassica self-incompatibility locus family p...    171   3e-42    
ref|XP_010064431.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   3e-42    
ref|XP_010928282.1|  PREDICTED: G-type lectin S-receptor-like ser...    170   3e-42    
gb|KCW69731.1|  hypothetical protein EUGRSUZ_F03112                     168   3e-42    
ref|XP_004978262.1|  PREDICTED: receptor-like serine/threonine-pr...    170   3e-42    
ref|XP_002513231.1|  s-receptor kinase, putative                        168   3e-42    
ref|NP_001147960.1|  receptor-like kinase precursor                     170   3e-42    
ref|XP_006452079.1|  hypothetical protein CICLE_v10007464mg             169   4e-42    
ref|XP_010924053.1|  PREDICTED: receptor-like serine/threonine-pr...    170   4e-42    
gb|KCW67072.1|  hypothetical protein EUGRSUZ_F00846                     169   4e-42    
ref|XP_010644387.1|  PREDICTED: receptor-like serine/threonine-pr...    170   4e-42    
ref|XP_009771688.1|  PREDICTED: G-type lectin S-receptor-like ser...    170   4e-42    
gb|AAC23542.1|  receptor protein kinase                                 170   5e-42    
ref|XP_011030956.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   5e-42    
gb|KHG04284.1|  Receptor-like serine/threonine-protein kinase SD1-8     168   5e-42    
ref|XP_010052478.1|  PREDICTED: G-type lectin S-receptor-like ser...    170   5e-42    
ref|XP_009771689.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   5e-42    
ref|XP_007213644.1|  hypothetical protein PRUPE_ppa001628mg             169   5e-42    
gb|KCW69729.1|  hypothetical protein EUGRSUZ_F03112                     168   5e-42    
gb|KCW67094.1|  hypothetical protein EUGRSUZ_F00872                     169   5e-42    
gb|KCW67242.1|  hypothetical protein EUGRSUZ_F01031                     169   6e-42    
ref|XP_007021216.1|  Serine/threonine-protein kinase receptor, pu...    172   6e-42    
gb|KHN45740.1|  Receptor-like serine/threonine-protein kinase SD1-8     170   6e-42    
ref|XP_002514693.1|  S-locus-specific glycoprotein S6 precursor, ...    169   6e-42    
emb|CAN70179.1|  hypothetical protein VITISV_000004                     169   6e-42    
ref|XP_003552873.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   6e-42    
ref|XP_010052477.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   7e-42    
ref|XP_009773006.1|  PREDICTED: G-type lectin S-receptor-like ser...    168   7e-42    
ref|XP_010060395.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   8e-42    
ref|XP_006452080.1|  hypothetical protein CICLE_v10007464mg             169   8e-42    
ref|XP_002514691.1|  S-locus-specific glycoprotein S6 precursor, ...    169   8e-42    
ref|XP_011011561.1|  PREDICTED: receptor-like serine/threonine-pr...    169   9e-42    
gb|KCW67093.1|  hypothetical protein EUGRSUZ_F00872                     169   9e-42    
ref|XP_011013923.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   9e-42    
ref|XP_006582203.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   9e-42    
ref|XP_007021187.1|  Serine/threonine kinases,protein kinases,ATP...    169   9e-42    
ref|XP_007132606.1|  hypothetical protein PHAVU_011G109100g             169   1e-41    
ref|XP_009766402.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   1e-41    
gb|KHN07569.1|  G-type lectin S-receptor-like serine/threonine-pr...    168   1e-41    
ref|XP_010247744.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   1e-41    
ref|XP_009597368.1|  PREDICTED: G-type lectin S-receptor-like ser...    163   1e-41    
ref|XP_010928119.1|  PREDICTED: receptor-like serine/threonine-pr...    171   1e-41    
ref|XP_010268957.1|  PREDICTED: G-type lectin S-receptor-like ser...    162   1e-41    
gb|KCW67241.1|  hypothetical protein EUGRSUZ_F01030                     167   1e-41    
ref|XP_006370392.1|  hypothetical protein POPTR_0001s42180g             168   1e-41    
ref|XP_010060474.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   1e-41    
gb|KCW69728.1|  hypothetical protein EUGRSUZ_F03112                     168   1e-41    
gb|KDO74327.1|  hypothetical protein CISIN_1g003786mg                   168   1e-41    
ref|XP_003597073.1|  Kinase-like protein                                168   1e-41    
gb|AAA97901.1|  secreted glycoprotein 1                                 165   1e-41    
ref|XP_006452065.1|  hypothetical protein CICLE_v10007525mg             168   2e-41    
ref|XP_007133111.1|  hypothetical protein PHAVU_011G152300g             167   2e-41    
ref|XP_011014317.1|  PREDICTED: G-type lectin S-receptor-like ser...    168   2e-41    
ref|XP_010064868.1|  PREDICTED: G-type lectin S-receptor-like ser...    168   2e-41    
ref|XP_002447170.1|  hypothetical protein SORBIDRAFT_06g029730          167   2e-41    
ref|XP_010644281.1|  PREDICTED: uncharacterized protein LOC100246941    170   2e-41    
ref|XP_009773004.1|  PREDICTED: G-type lectin S-receptor-like ser...    168   2e-41    
ref|XP_010060473.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   2e-41    
ref|XP_002448590.1|  hypothetical protein SORBIDRAFT_06g029725          170   2e-41    
ref|XP_007133110.1|  hypothetical protein PHAVU_011G152300g             167   2e-41    
gb|KCW69733.1|  hypothetical protein EUGRSUZ_F03113                     167   2e-41    
gb|KDO74288.1|  hypothetical protein CISIN_1g036419mg                   167   2e-41    
ref|XP_006389133.1|  hypothetical protein POPTR_0044s002701g            166   2e-41    
gb|KCW74900.1|  hypothetical protein EUGRSUZ_E03639                     167   2e-41    
ref|XP_010064361.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   2e-41    
gb|EMT28571.1|  Putative serine/threonine-protein kinase receptor       168   2e-41    
ref|XP_011048295.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   2e-41    
gb|KDP38985.1|  hypothetical protein JCGZ_00742                         166   2e-41    
gb|KCW67071.1|  hypothetical protein EUGRSUZ_F00845                     166   3e-41    
ref|XP_009610105.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   3e-41    
ref|XP_009766396.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   3e-41    
gb|KDP38979.1|  hypothetical protein JCGZ_00736                         167   3e-41    
gb|KDO75660.1|  hypothetical protein CISIN_1g0029691mg                  164   3e-41    
ref|XP_008372164.1|  PREDICTED: G-type lectin S-receptor-like ser...    163   3e-41    
ref|XP_006849529.1|  hypothetical protein AMTR_s00024p00153550          164   3e-41    
ref|XP_008813304.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    169   3e-41    
gb|KHN45738.1|  G-type lectin S-receptor-like serine/threonine-pr...    167   3e-41    
gb|KDO74353.1|  hypothetical protein CISIN_1g003272mg                   167   3e-41    
gb|KCW67083.1|  hypothetical protein EUGRSUZ_F00858                     167   3e-41    
ref|XP_011029379.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   3e-41    
ref|XP_010646910.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   3e-41    
ref|XP_009361872.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   3e-41    
ref|XP_007133103.1|  hypothetical protein PHAVU_011G151900g             167   3e-41    
ref|XP_002314393.2|  hypothetical protein POPTR_0010s020401g            166   4e-41    
ref|XP_009397154.1|  PREDICTED: receptor-like serine/threonine-pr...    167   4e-41    
ref|XP_008775529.1|  PREDICTED: receptor-like serine/threonine-pr...    167   4e-41    
ref|XP_011000517.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   4e-41    
ref|XP_007163417.1|  hypothetical protein PHAVU_001G233000g             166   4e-41    
ref|XP_010060471.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   4e-41    
ref|XP_008226123.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   4e-41    
ref|XP_003527472.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   4e-41    
ref|XP_006475267.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   5e-41    
ref|XP_010060470.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   5e-41    



>ref|XP_006443278.1| hypothetical protein CICLE_v10020341mg [Citrus clementina]
 ref|XP_006478974.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101-like [Citrus sinensis]
 gb|ESR56518.1| hypothetical protein CICLE_v10020341mg [Citrus clementina]
Length=417

 Score =   329 bits (844),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 183/397 (46%), Positives = 242/397 (61%), Gaps = 31/397 (8%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVW  1212
             AESDTL QG  + DW+ L SA+ +FKLGFFS             RY+GIW+NKIP  P+W
Sbjct  24    AESDTLKQGQQLHDWDELVSAEGVFKLGFFSPGSKTVDIGVIAPRYIGIWFNKIPFYPLW  83

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGG-MITVSNVSIMSGN---NVGATLLDSGNLV  1044
             VAN ++P+PDSSG L +D DG LK +Y GG  I VS+      N   N+ ATLLDSGNL+
Sbjct  84    VANPNNPVPDSSGVLRMDTDGILKFAYKGGSRIAVSSNRAKKANSETNITATLLDSGNLL  143

Query  1043  VREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELG  864
             VR++  +G  G +LWQSFDYP+++L+P MKLG+NLKTGH W L+SWLS+++P  GAF LG
Sbjct  144   VRQIGADGIAGPILWQSFDYPSNMLLPEMKLGINLKTGHEWYLSSWLSEQLPSPGAFRLG  203

Query  863   LDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTK--------EFGFKLVSNEKEKY  708
             L+ NG + +L++ RRG+VYW SG WKNG FE AP++T+         + F+ V+NE E+Y
Sbjct  204   LNPNG-SRELMVWRRGEVYWRSGEWKNGKFELAPELTEGTFTKQLDAYQFRFVTNENERY  262

Query  707   FSYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNY  528
             FSYS K N+  ++W L+ LG IEQ     D S +I           + +T  C       
Sbjct  263   FSYSKKSNFILSRWLLNDLGQIEQ--FTRDTSGWI-----------WETTSPCTTNYTMN  309

Query  527   PRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCS  348
                VCL E P +CR  S+ F   +GY           +N+G    LALSDCH+ CW NCS
Sbjct  310   ATGVCLNEKPSNCRNGSEFFAPKKGYMNVSFTGDQIDDNAG----LALSDCHAKCWTNCS  365

Query  347   CTAYASSSTDGTGCILYTNAAHDFQLDENGELYIYRL  237
             C+AY+S   +GTGC  ++     F  DE     IY L
Sbjct  366   CSAYSSVFDNGTGCEFWSREVQ-FIPDEGFGREIYLL  401



>ref|XP_011038586.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 [Populus euphratica]
Length=411

 Score =   328 bits (841),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 191/409 (47%), Positives = 252/409 (62%), Gaps = 47/409 (11%)
 Frame = -2

Query  1412  SSYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNK  1233
             S+YV+  A++DTL +G  +RD+E L SA  +F+LGFFS + +         RYLGIW+ +
Sbjct  18    SNYVAY-AQNDTLKRGQQLRDYEQLISAGGVFRLGFFSPNPNVGLIGTAGARYLGIWFEQ  76

Query  1232  IPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNN----VGATL  1065
             IP   VWVANRD P+PDSSG L I  DGKLKI+Y GG   V N ++ S  N    + ATL
Sbjct  77    IPFYSVWVANRDIPVPDSSGVLTIGGDGKLKITYRGGPPIVINSNVESAKNLSGNITATL  136

Query  1064  LDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPG  885
             LDSGNLVVR+VD +G+ G VLWQSFDYP ++L+PGMKLG+N KTG  W LTSWLS+KVP 
Sbjct  137   LDSGNLVVRKVDCDGTPGTVLWQSFDYPHNILLPGMKLGMNHKTGKNWTLTSWLSEKVPA  196

Query  884   SGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE------FGFKLVSN  723
              GAF LGLD +G  NQL++ RR +VYW+SGVW+NGSF+ AP++T+       + FK V+N
Sbjct  197   PGAFRLGLDPSGA-NQLLVWRRDEVYWSSGVWQNGSFQSAPELTQLTKGYNIYDFKFVAN  255

Query  722   EKEKYFSYSAKHNYRFTKWTLDLLGHIE---------QSSLIYDPSFFIHYMPMYTWIGR  570
             E+E YFSYS K     ++  LD LG +           S  I++ S   HY       G 
Sbjct  256   EEETYFSYSIKERSILSRLDLDTLGEVTLLTVDRRDGNSRWIFETSGACHY-------GF  308

Query  569   YASTLECDPYIGNYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRL  390
               ST             VCL E P  CR  +  FV  RGY      N+S++    + + L
Sbjct  309   KNST------------SVCLTEKPTKCRNGTQSFVPKRGYI-----NVSEIWYDTD-TNL  350

Query  389   ALSDCHSICWKNCSCTAY-ASSSTDGTGCILYTNAAHDFQLDENGELYI  246
             +LSDCH+ CWKNC+C+AY A S +DG GC  ++NA+     D+   +Y+
Sbjct  351   SLSDCHARCWKNCTCSAYQALSPSDGIGCHFWSNASSFIPRDDFEFVYL  399



>gb|KDO52487.1| hypothetical protein CISIN_1g014851mg [Citrus sinensis]
Length=417

 Score =   327 bits (838),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 181/397 (46%), Positives = 244/397 (61%), Gaps = 31/397 (8%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVW  1212
             AESDTL QG  + DW+ L SA+ +FKLGFFS             RY+GIW+NKIP  P+W
Sbjct  24    AESDTLKQGQQLHDWDELVSAEGVFKLGFFSPGSKTVDIGVIAPRYIGIWFNKIPFYPLW  83

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGG-MITVSNVSIMSGN---NVGATLLDSGNLV  1044
             VAN ++P+PDSSG L +D DG LK +Y GG  I VS+      N   N+ ATLLDSGNL+
Sbjct  84    VANPNNPVPDSSGVLRMDTDGILKFAYKGGSRIAVSSNRAKKANSETNITATLLDSGNLL  143

Query  1043  VREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELG  864
             VR++  +G  G +LWQSFDYP+++L+P MKLG+NLKTGH W L+SWLS+++P  GAF LG
Sbjct  144   VRQIGADGIAGPILWQSFDYPSNMLLPEMKLGINLKTGHEWYLSSWLSEQLPSPGAFRLG  203

Query  863   LDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTK--------EFGFKLVSNEKEKY  708
             L+ NG + +L++ RRG+VYW SG WKNG FE AP++T+         + F+ V+NE E+Y
Sbjct  204   LNPNG-SRELMVWRRGEVYWRSGEWKNGKFELAPELTEGTFTKQLDAYQFRFVTNENERY  262

Query  707   FSYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNY  528
             FSYS + N+  ++W L+ LG IEQ     D S +I           + +T  C+      
Sbjct  263   FSYSKRSNFILSRWLLNDLGQIEQ--FTRDTSGWI-----------WETTSPCNTNYTMN  309

Query  527   PRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCS  348
                VCL E P +CR  S+ F   +G        ++  +N+G    LALSDCH+ CW NCS
Sbjct  310   ATGVCLNEKPSNCRNGSEFFAPRKGCMNVSFTYMNIDDNAG----LALSDCHAKCWTNCS  365

Query  347   CTAYASSSTDGTGCILYTNAAHDFQLDENGELYIYRL  237
             C+AY+S   +GTGC  ++     F  DE     IY L
Sbjct  366   CSAYSSVFDNGTGCEFWSREVQ-FIPDEGFGREIYLL  401



>ref|XP_007013194.1| Serine/threonine-protein kinase PBS1, putative [Theobroma cacao]
 gb|EOY30813.1| Serine/threonine-protein kinase PBS1, putative [Theobroma cacao]
Length=810

 Score =   335 bits (859),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 176/385 (46%), Positives = 247/385 (64%), Gaps = 30/385 (8%)
 Frame = -2

Query  1376  LMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEP--VWVAN  1203
             LMQG  +R+WEHL SAK IFKLGFFS       P ++ ++YLGIWY+K+P++P  VWVAN
Sbjct  31    LMQGQQLRNWEHLLSAKGIFKLGFFS-------PTSSTNQYLGIWYSKLPHDPEAVWVAN  83

Query  1202  RDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREVDGN  1023
              ++P+ D SG L +D DGKLKI++  G + + + S  S +N+ ATLLD+GN V+  V+ +
Sbjct  84    PENPILDKSGVLSLDGDGKLKITHSQGQVILFDFSQGSSHNLTATLLDTGNFVLERVNSD  143

Query  1022  GSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDINGCN  843
             G+ G +LWQSFDYPT+ L+PGMKLG+NLK G+ W L+SWLS +VP  GAF+LG+D +G  
Sbjct  144   GTGGQILWQSFDYPTNNLLPGMKLGMNLKNGYNWTLSSWLSSQVPIPGAFKLGMDPSGA-  202

Query  842   NQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE---FGFKLVSNEKEKYFSYSAKHNYRFT  672
              QLV+ RR  VYWTSG+WK G F+ AP++T+    + F+ +SN +E+YFS+SA ++   +
Sbjct  203   GQLVVWRREDVYWTSGMWKGGDFQMAPELTRRVDLYQFRFISNSEEQYFSFSAINSSTLS  262

Query  671   KWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKENPVS  492
             +W L+  G I Q +L  D +         TW      + + D     YP  VCL++   +
Sbjct  263   RWELNAWGQILQLTLAADRT---------TWQQTTIGSCKIDV---TYPNAVCLEQKLSN  310

Query  491   CRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSSTDGT  312
             CR  S++FV TRGY+     N S++  S N   LALSDCH  CW +CSC AY S   DGT
Sbjct  311   CRNGSELFVPTRGYY-----NSSELSYSNNNLNLALSDCHDSCWNDCSCIAYGSLYPDGT  365

Query  311   GCILYTNAAHDFQLDENGELYIYRL  237
             GC  +       Q ++ G +Y  +L
Sbjct  366   GCQFWRKQPSFVQNEKFGVVYSLKL  390



>ref|XP_010049703.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X2 [Eucalyptus grandis]
Length=803

 Score =   334 bits (856),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 178/382 (47%), Positives = 244/382 (64%), Gaps = 30/382 (8%)
 Frame = -2

Query  1376  LMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEP--VWVAN  1203
             L QG  +RDWEHL + K  FKLGFFS       P ++  RYLGIWY+K+P+ P  VWVAN
Sbjct  25    LTQGQQLRDWEHLLAPKGTFKLGFFS-------PGSSSYRYLGIWYSKLPHNPEAVWVAN  77

Query  1202  RDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREVDGN  1023
              ++P+ +SSG L +D+DG+LKI+  GG   V + +    N V  TLLD+GNL++REV+ +
Sbjct  78    PNNPISNSSGVLNLDSDGRLKITANGGQTIVVSSNDPVTNKVTLTLLDTGNLLLREVNSD  137

Query  1022  GSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDINGCN  843
             G+ G VLWQSFDYP+  L+PGMKLG+++K    W LTSWLSD+ P  GAF LG+D  G  
Sbjct  138   GTVGRVLWQSFDYPSSTLLPGMKLGLDIKARTNWTLTSWLSDRDPAPGAFRLGVD-PGSA  196

Query  842   NQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE---FGFKLVSNEKEKYFSYSAKHNYRFT  672
             NQLVI  R ++YWTSG W+NG F+ AP++T++   + F  VS+E EKYF++S K+N   T
Sbjct  197   NQLVIWHREEIYWTSGAWENGGFQMAPELTRDKTAYEFSFVSDENEKYFTFSLKNNSTIT  256

Query  671   KWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKENPVS  492
             +W ++L G I QS+L  D +         TW+  Y+ST  C+   GNY   VC+ + P +
Sbjct  257   RWEINLWGQIVQSTLAKDGT---------TWL--YSSTSSCNSN-GNYSGAVCVDQQPSA  304

Query  491   CRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSSTDGT  312
             CR  S++FV  +GY+     N  ++  S + S L LSDCHS+CW NCSC A+ S  TDGT
Sbjct  305   CRNGSELFVPQKGYY-----NKGELLYSDHNSSLTLSDCHSMCWNNCSCIAFGSLFTDGT  359

Query  311   GCILYTNAAHDFQLDENGELYI  246
             GC  ++        D    LY+
Sbjct  360   GCEFWSKGGTYIPNDNFDVLYV  381



>ref|XP_010049702.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X1 [Eucalyptus grandis]
Length=804

 Score =   334 bits (856),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 178/382 (47%), Positives = 244/382 (64%), Gaps = 30/382 (8%)
 Frame = -2

Query  1376  LMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEP--VWVAN  1203
             L QG  +RDWEHL + K  FKLGFFS       P ++  RYLGIWY+K+P+ P  VWVAN
Sbjct  25    LTQGQQLRDWEHLLAPKGTFKLGFFS-------PGSSSYRYLGIWYSKLPHNPEAVWVAN  77

Query  1202  RDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREVDGN  1023
              ++P+ +SSG L +D+DG+LKI+  GG   V + +    N V  TLLD+GNL++REV+ +
Sbjct  78    PNNPISNSSGVLNLDSDGRLKITANGGQTIVVSSNDPVTNKVTLTLLDTGNLLLREVNSD  137

Query  1022  GSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDINGCN  843
             G+ G VLWQSFDYP+  L+PGMKLG+++K    W LTSWLSD+ P  GAF LG+D  G  
Sbjct  138   GTVGRVLWQSFDYPSSTLLPGMKLGLDIKARTNWTLTSWLSDRDPAPGAFRLGVD-PGSA  196

Query  842   NQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE---FGFKLVSNEKEKYFSYSAKHNYRFT  672
             NQLVI  R ++YWTSG W+NG F+ AP++T++   + F  VS+E EKYF++S K+N   T
Sbjct  197   NQLVIWHREEIYWTSGAWENGGFQMAPELTRDKTAYEFSFVSDENEKYFTFSLKNNSTIT  256

Query  671   KWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKENPVS  492
             +W ++L G I QS+L  D +         TW+  Y+ST  C+   GNY   VC+ + P +
Sbjct  257   RWEINLWGQIVQSTLAKDGT---------TWL--YSSTSSCNSN-GNYSGAVCVDQQPSA  304

Query  491   CRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSSTDGT  312
             CR  S++FV  +GY+     N  ++  S + S L LSDCHS+CW NCSC A+ S  TDGT
Sbjct  305   CRNGSELFVPQKGYY-----NKGELLYSDHNSSLTLSDCHSMCWNNCSCIAFGSLFTDGT  359

Query  311   GCILYTNAAHDFQLDENGELYI  246
             GC  ++        D    LY+
Sbjct  360   GCEFWSKGGTYIPNDNFDVLYV  381



>ref|XP_009371483.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g67520 [Pyrus x bretschneideri]
Length=825

 Score =   319 bits (817),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 180/386 (47%), Positives = 239/386 (62%), Gaps = 28/386 (7%)
 Frame = -2

Query  1376  LMQGANIRDWEH---LTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEP--VW  1212
             L QG  + D E    ++    +FKLGF S   S S    T DRYLG++Y ++P+ P  VW
Sbjct  35    LKQGQGLADREKNFLVSENGGLFKLGFLSPGTS-SASGATSDRYLGMFYTRLPSHPDAVW  93

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
             +AN  +P+ DSSG   +D+DGKLKI Y GG I+VS+ +     NV A+LLD+GNLV++++
Sbjct  94    LANPKTPISDSSGVFTLDSDGKLKIVYGGGEISVSDSNQTVSGNVTASLLDTGNLVLQQL  153

Query  1031  DGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDIN  852
               NG+FG VLWQSFD+PT+ L+PGMKLG+N KTG  W L SWLSD+VP  GAF+LG+D  
Sbjct  154   ASNGAFGSVLWQSFDHPTNTLLPGMKLGMNFKTGQNWTLFSWLSDQVPEPGAFKLGVD-P  212

Query  851   GCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE---FGFKLVSNEKEKYFSYSAKHNY  681
             G  +QLVI RRG VYWTSGVWKNGSF  +P++T+    F F  VS+++EKYFSYS K+  
Sbjct  213   GAADQLVIWRRGDVYWTSGVWKNGSFLGSPELTRRVDLFQFTFVSSKEEKYFSYSVKNTS  272

Query  680   RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKEN  501
              +++W L L G I QS L  + +         TW      T  C  +  NYP  +C++E 
Sbjct  273   TYSRWELSLQGQISQSVLAPNKT---------TW--ESTVTGPCK-FNMNYPDAMCIEEK  320

Query  500   PVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSST  321
                CR  S++FV  RGYF       +D + S     LA+SDCH+ CW+NC+C  Y S  T
Sbjct  321   ITECRNGSELFVPIRGYFAAVKSLYADDDTS-----LAISDCHTACWRNCTCIGYESLYT  375

Query  320   D-GTGCILYTNAAHDFQLDENGELYI  246
             D GTGC+     A   + D  G  YI
Sbjct  376   DNGTGCVYMIEGAKFEENDYFGFTYI  401



>ref|XP_008354522.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 [Malus domestica]
Length=764

 Score =   311 bits (796),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 176/391 (45%), Positives = 232/391 (59%), Gaps = 28/391 (7%)
 Frame = -2

Query  1376  LMQGANIRDWEH---LTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEP--VW  1212
             L QG  + D +    ++     FKLGF S   S S    T DRYLG +Y  +P+ P  VW
Sbjct  25    LKQGQRLADQDKNFLVSENGGFFKLGFLSPGTS-SASGATSDRYLGXFYTXLPSHPDAVW  83

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
             +AN  +P+ DSSG   +D+ GKLKI Y GG I+VS+ +     NV A+  D+GNLV++E 
Sbjct  84    LANPKTPISDSSGVFTLDSXGKLKIXYSGGEISVSDSNQTVSGNVTASFQDTGNLVLQEF  143

Query  1031  DGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDIN  852
               NG+FG VLWQSFD+PT+ L+PGMKLG+N KTG  W L SWLSD+VP  GAF+LG D  
Sbjct  144   ASNGAFGSVLWQSFDHPTNTLLPGMKLGMNFKTGQNWTLFSWLSDQVPEPGAFKLGXD-P  202

Query  851   GCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE---FGFKLVSNEKEKYFSYSAKHNY  681
             G  +QLVI RRG VYWTSGVWKNGSF  +P++T+    F F  VS+++EKYFSYS K+  
Sbjct  203   GAABQLVIWRRGDVYWTSGVWKNGSFXGSPELTRRVDLFEFTFVSSKEEKYFSYSVKNTX  262

Query  680   RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKEN  501
              +++W L L G I QS L  + +         TW      T  C   + NYP  +C++E 
Sbjct  263   TYSRWELSLQGQISQSXLAPNKT---------TW--ESTVTGPCKLNM-NYPDAMCIEEK  310

Query  500   PVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSST  321
                CR  S++FV  RGYF        D + S     LA+SDCH+ CW+NC+C  Y S  T
Sbjct  311   ITECRNGSELFVPIRGYFAAVKFLYXDDDTS-----LAISDCHAXCWRNCTCIGYESLYT  365

Query  320   -DGTGCILYTNAAHDFQLDENGELYIYRLLK  231
              +GTGC+     A   + D  G  YI  + +
Sbjct  366   XNGTGCVYMMEGAKFEEXDYXGFTYILTIXR  396



>ref|XP_008242619.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Prunus mume]
Length=820

 Score =   312 bits (799),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 172/378 (46%), Positives = 237/378 (63%), Gaps = 26/378 (7%)
 Frame = -2

Query  1379  TLMQGANIRDWE--HLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEP--VW  1212
             TL QG  +RD +  HL S +  FKLGFFS   S +  I T +R+LGIWY+K+P+ P  VW
Sbjct  31    TLKQGEQLRDQDTDHLVSQQGHFKLGFFSPGASSNLGI-TSNRFLGIWYSKLPDHPDAVW  89

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
             VAN ++P+ DSSG   +D+DGKLKI + GG I +S+ +     NV A L+D+GN ++ EV
Sbjct  90    VANPETPVVDSSGVFTLDSDGKLKIIHGGGQIIISDPNQTVSGNVTAYLMDTGNFILSEV  149

Query  1031  DGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDIN  852
               +G+ G +LW+SFDYP++ L+PGMKLGVNLKTGH   L SW S + P SGAF LG+D +
Sbjct  150   TSDGTPGNILWESFDYPSNTLLPGMKLGVNLKTGHNQTLASWFSYQSPVSGAFRLGVDPS  209

Query  851   GCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE---FGFKLVSNEKEKYFSYSAKHNY  681
                N+L+I RR  VYWTSG+W+NGSF KAP++T     F F  VSNE+EKYF+YS K+N 
Sbjct  210   R-TNRLIIWRRDVVYWTSGIWENGSFPKAPELTTRTDLFDFNFVSNEEEKYFTYSVKNNS  268

Query  680   RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKEN  501
               ++W L+  G + QS L  + +         TW     S  + +PY   YP  VC+++ 
Sbjct  269   TLSRWELNTWGQLLQSILAPNGT---------TWETTVTSPCKFNPY---YPDAVCIEQK  316

Query  500   PVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSST  321
             P  CR  S++ V TRGY  D     +   +  N + L LSDCH+ CW +C+C  Y +  T
Sbjct  317   PSECRNGSELLVPTRGYLND-----AQFTHQDNNTNLDLSDCHATCWSDCTCIGYQNIHT  371

Query  320   DGTGCILYTNAAHDFQLD  267
             +G+GC+ +   AH  Q D
Sbjct  372   NGSGCLFFKKGAHFVQND  389



>ref|XP_007204265.1| hypothetical protein PRUPE_ppa002027mg [Prunus persica]
 gb|EMJ05464.1| hypothetical protein PRUPE_ppa002027mg [Prunus persica]
Length=727

 Score =   310 bits (793),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 169/373 (45%), Positives = 236/373 (63%), Gaps = 26/373 (7%)
 Frame = -2

Query  1379  TLMQGANIRDWE--HLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEP--VW  1212
             TL QG  +RD +  HL S    FKLGFFS   S +  I T +R+LGIWY+K+P+ P  VW
Sbjct  31    TLKQGEQLRDQDTDHLVSQHGHFKLGFFSPGASSNLGI-TSNRFLGIWYSKLPDHPDAVW  89

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
             VAN ++P+ DSSG   +D+DGKLKI + GG I +S+ +     NV A L+D+GN ++R+V
Sbjct  90    VANPETPVVDSSGVFTLDSDGKLKIIHGGGQIIISDPNQTVSGNVTAYLMDTGNFILRKV  149

Query  1031  DGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDIN  852
               +G+ G +LW+SFDYP++ L+PGMKLG+NLKTGH   L+SW S + P SGAF LG+D +
Sbjct  150   TSDGTPGNILWESFDYPSNTLLPGMKLGMNLKTGHNRTLSSWFSYQSPVSGAFRLGVDPS  209

Query  851   GCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE---FGFKLVSNEKEKYFSYSAKHNY  681
                N+L+I RR  VYWTSG+W+NGSF KAP++T     F F  VSNE+EKYF+YS K+N 
Sbjct  210   R-TNRLIIWRREVVYWTSGIWENGSFPKAPELTTRTDLFDFNFVSNEEEKYFTYSVKNNS  268

Query  680   RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKEN  501
               ++W L+  G + QS L  + +         TW     S  + +PY   YP  VC+++ 
Sbjct  269   TLSRWELNTWGQLLQSILAPNGT---------TWETTVTSPCKFNPY---YPDAVCIEQK  316

Query  500   PVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSST  321
             P  CR  S++ V TRGY  D     +   +  N + L LSDCH+ CW +C+C  Y +  T
Sbjct  317   PSECRNGSELLVPTRGYLND-----AQFTHQDNNTNLDLSDCHATCWNDCTCIGYQNIHT  371

Query  320   DGTGCILYTNAAH  282
             +G+GC+ +   AH
Sbjct  372   NGSGCLFFKKGAH  384



>ref|XP_008363019.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 [Malus domestica]
Length=769

 Score =   308 bits (789),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 177/386 (46%), Positives = 231/386 (60%), Gaps = 28/386 (7%)
 Frame = -2

Query  1376  LMQGANI--RDWEHLTSAKA-IFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEP--VW  1212
             L QG  +  RD  +L S    +FKLGF S   S S    T  RYLG++Y  +P+ P  VW
Sbjct  30    LKQGQRLADRDRNYLVSENGGLFKLGFLSPGTS-SASGATSYRYLGMFYTSLPSHPDAVW  88

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
             +AN  +P+ DSSG   +D+DGKLKI Y GG I+VS+ +     NV A+  D+GNLV++E 
Sbjct  89    LANPKTPISDSSGVFTLDSDGKLKIVYSGGEISVSDSNQTVSGNVTASFXDTGNLVLQEF  148

Query  1031  DGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDIN  852
               NG+FG VLWQS D+PT+ L+PGMKLG+N KTG  W L SWLSD+VP  GAF+LG D  
Sbjct  149   ASNGAFGSVLWQSXDHPTNTLLPGMKLGMNFKTGQNWTLFSWLSDQVPEPGAFKLGXD-P  207

Query  851   GCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE---FGFKLVSNEKEKYFSYSAKHNY  681
             G  +QLVI RRG VYWTSGVW NGSF  +P++T+    F F  VS+++EKYFSYS K+  
Sbjct  208   GAABQLVIWRRGDVYWTSGVWXNGSFXGSPELTRRVDLFEFTFVSSKEEKYFSYSVKNTX  267

Query  680   RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKEN  501
              +++W L L G I QS L  + +         TW      T  C   + NYP  +C++E 
Sbjct  268   TYSRWELSLQGQISQSXLAPNKT---------TW--ESTVTGPCKLNM-NYPDAMCIEEK  315

Query  500   PVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSST  321
                CR  S++FV  RGYF        D + S     LA+SDCH+ CW+NC+C  Y S  T
Sbjct  316   ITECRNXSELFVPIRGYFAAVKFLYXDDDTS-----LAISDCHAXCWRNCTCIGYESLYT  370

Query  320   -DGTGCILYTNAAHDFQLDENGELYI  246
              +GTGC+     A   + D  G  YI
Sbjct  371   XNGTGCVYMMEGAKFEEXDYXGFTYI  396



>ref|XP_008344096.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 [Malus domestica]
Length=822

 Score =   308 bits (790),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 177/386 (46%), Positives = 231/386 (60%), Gaps = 28/386 (7%)
 Frame = -2

Query  1376  LMQGANI--RDWEHLTSAKA-IFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEP--VW  1212
             L QG  +  RD  +L S    +FKLGF S   S S    T  RYLG++Y  +P+ P  VW
Sbjct  83    LKQGQRLADRDRNYLVSENGGLFKLGFLSPGTS-SASGATSXRYLGMFYTSLPSHPDAVW  141

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
             +AN  +P+ DSSG   +D+DGKLKI Y GG I+VS+ +     NV A+  D+GNLV++E 
Sbjct  142   LANPKTPISDSSGVFTLDSDGKLKIVYSGGEISVSDSNQTVSGNVTASFXDTGNLVLQEF  201

Query  1031  DGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDIN  852
               NG+FG VLWQS D+PT+ L+PGMKLG+N KTG  W L SWLSD+VP  GAF+LG D  
Sbjct  202   ASNGAFGSVLWQSXDHPTNTLLPGMKLGMNFKTGQNWTLFSWLSDQVPEPGAFKLGXD-P  260

Query  851   GCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE---FGFKLVSNEKEKYFSYSAKHNY  681
             G  +QLVI RRG VYWTSGVW NGSF  +P++T+    F F  VS+++EKYFSYS K+  
Sbjct  261   GAABQLVIWRRGDVYWTSGVWXNGSFXGSPELTRRVDLFEFTFVSSKEEKYFSYSVKNTX  320

Query  680   RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKEN  501
              +++W L L G I QS L  + +         TW      T  C   + NYP  +C++E 
Sbjct  321   TYSRWELSLQGQISQSXLAPNKT---------TW--ESTVTGPCKLNM-NYPDAMCIEEK  368

Query  500   PVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSST  321
                CR  S++FV  RGYF        D + S     LA+SDCH+ CW+NC+C  Y S  T
Sbjct  369   ITECRNXSELFVPIRGYFAAVKFLYXDDDTS-----LAISDCHAXCWRNCTCIGYESLYT  423

Query  320   -DGTGCILYTNAAHDFQLDENGELYI  246
              +GTGC+     A   + D  G  YI
Sbjct  424   XNGTGCVYMMEGAKFEEXDYXGFTYI  449



>ref|XP_004289464.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101-like [Fragaria vesca subsp. vesca]
Length=770

 Score =   307 bits (786),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 166/397 (42%), Positives = 242/397 (61%), Gaps = 31/397 (8%)
 Frame = -2

Query  1379  TLMQGANI--RDWEHLTSAKAIFKLGFFSISDS--YSGPINTEDRYLGIWYNKIPNEP--  1218
             TL QG  +  +D ++L S   +FKLGFFS  +S  +   IN   RYLG+WY K+PN+P  
Sbjct  31    TLKQGQQLSDQDGDYLVSKNGLFKLGFFSPGNSSIFGATIN---RYLGVWYYKLPNDPDA  87

Query  1217  VWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVR  1038
             VWVAN ++P+ D+SG   + +D  LK+ + GG ++VS+ +     NV  +LLD+GNLV+R
Sbjct  88    VWVANPETPIIDTSGVFALASDATLKLIHGGGQVSVSDPNKTVSGNVTLSLLDTGNLVLR  147

Query  1037  EVDG-NGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGL  861
             EV   NG+ G V+W+SFD+PT+ L+PGMKLG+N+K G  W ++SW SD++P  GAF LG+
Sbjct  148   EVLATNGTAGNVIWESFDHPTNTLLPGMKLGMNVKAGENWTISSWFSDQIPAPGAFRLGI  207

Query  860   DINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE---FGFKLVSNEKEKYFSYSAK  690
             D  G NNQL+I RR +VYW+SG+W+NGSF+ A +MT+    F F  VSN+++KYFSY+AK
Sbjct  208   D-PGSNNQLIIWRRDEVYWSSGIWENGSFQNAHEMTRRVDLFEFTFVSNKEDKYFSYTAK  266

Query  689   HNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCL  510
             +    ++W L+  G I Q  L  + +         TW    AS   C   + N P  +C+
Sbjct  267   NRSTISRWELNAWGQIMQYILTVNGT---------TWERTEASA--CTFNLNN-PGAMCI  314

Query  509   KENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYAS  330
             +E P  CR  SD  V  RGYF     + +++    N + + +SDCH+ CW +CSC  + S
Sbjct  315   EEKPSECRNDSDGLVPVRGYF-----DGTEILKHDNNTNMTISDCHATCWSDCSCIGFKS  369

Query  329   SSTDGTGCILYTNAAHDFQLDENGELYIYRLLKEHKG  219
               ++GTGC+  + AA     D     Y+  +    KG
Sbjct  370   IYSNGTGCVFMSGAARFVANDYFDATYVLNIFNNSKG  406



>ref|XP_008390321.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 [Malus domestica]
Length=783

 Score =   306 bits (785),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 176/391 (45%), Positives = 232/391 (59%), Gaps = 28/391 (7%)
 Frame = -2

Query  1376  LMQGANI--RDWEHLTSAKA-IFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEP--VW  1212
             L QG  +  RD  +L S    +FKLGF S   S S    T  RYLG++Y  +P+ P  VW
Sbjct  44    LKQGQRLADRDRNYLVSENGGLFKLGFLSPGTS-SASGATSXRYLGMFYTSLPSHPDAVW  102

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
             +AN  +P+ DSSG   +D+ GKLKI Y GG I+VS+ +     NV A+  D+GNLV++E 
Sbjct  103   LANPKTPISDSSGVFTLDSXGKLKIXYSGGEISVSDSNQTVSGNVTASFXDTGNLVLQEF  162

Query  1031  DGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDIN  852
               NG+FG VLWQS D+PT+ L+PGMKLG+N KTG  W L SWLSD+VP  GAF+LG D  
Sbjct  163   ASNGAFGSVLWQSXDHPTNTLLPGMKLGMNFKTGQNWTLFSWLSDQVPEPGAFKLGXD-P  221

Query  851   GCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE---FGFKLVSNEKEKYFSYSAKHNY  681
             G  +QLVI RRG VYWTSGVW NGSF  +P++T+    F F  VS+++EKYFSYS K+  
Sbjct  222   GAABQLVIWRRGDVYWTSGVWXNGSFXGSPELTRRVDLFEFTFVSSKEEKYFSYSVKNTX  281

Query  680   RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKEN  501
              +++W L L G I QS L  + +         TW      T  C   + NYP  +C++E 
Sbjct  282   TYSRWELSLQGQISQSXLAPNKT---------TW--ESTVTGPCKLNM-NYPDAMCIEEK  329

Query  500   PVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSST  321
                CR  S++FV  RGYF        D + S     LA+SDCH+ CW+NC+C  Y S  T
Sbjct  330   ITECRNXSELFVPIRGYFAAVXFLYXDDDTS-----LAISDCHAXCWRNCTCIGYESLYT  384

Query  320   -DGTGCILYTNAAHDFQLDENGELYIYRLLK  231
              +GTGC+     A   + D  G  YI  + +
Sbjct  385   XNGTGCVYMMEGAKFEEXDYXGFTYILTIXR  415



>ref|XP_004287414.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330-like [Fragaria vesca subsp. vesca]
Length=821

 Score =   296 bits (758),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 172/411 (42%), Positives = 239/411 (58%), Gaps = 37/411 (9%)
 Frame = -2

Query  1415  FSSYVSVGAES--DTLMQGANIRDW--EHLTSAKAIFKLGFFSISDSYSGPINTEDRYLG  1248
               + +S  AE+   T+ QG  + D   +HL S    +K+GFFS   + S    T  R+LG
Sbjct  17    MQALLSCSAETLISTMKQGQQLSDLASDHLVSDNGFYKVGFFSPGFA-SNLGATTKRFLG  75

Query  1247  IWYNKIPNEP--VWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVG  1074
             IWY+K+PN P  +WV N +SP+ DSS   ++D+DGKLKI Y GG+I VS+V+     NV 
Sbjct  76    IWYSKLPNHPDAIWVGNPESPINDSSAVFMLDSDGKLKIVYDGGLIYVSDVNKTGSGNVT  135

Query  1073  ATLLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDK  894
              +LL +GNLV+REVD NG+ G VLW+SF   ++ L+PGMKLG NLKTG  W ++SWLSD+
Sbjct  136   LSLLGTGNLVLREVDSNGAAGNVLWESFSNASNTLLPGMKLGRNLKTGENWTISSWLSDQ  195

Query  893   VPGSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE---FGFKLVSN  723
              P  GAF+LG+D +G  +QL++ RR +VYW+SG+W NG+F  AP++TK    F F  VSN
Sbjct  196   SPAPGAFKLGVDPSGA-DQLIVWRREEVYWSSGIWVNGNFLDAPELTKRDDLFWFTFVSN  254

Query  722   EKEKYFSYSAKHNYRF---------TKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGR  570
              +EKYFSY  K+N            ++W L+  G I +S L  + S         TW   
Sbjct  255   SEEKYFSYYLKNNLTLDDPENNTTISRWELNPWGQILESILSANGS---------TWETT  305

Query  569   YASTLECDPYIGNYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRL  390
               S    +P    YP  VC++E    CR  S++FV T G+      N ++   S N + L
Sbjct  306   TISPCTFNP---KYPDAVCIEEKTSECRNGSELFVPTNGFL-----NGTEFTYSDNSTNL  357

Query  389   ALSDCHSICWKNCSCTAYASSSTDGTGCILYTNAAHDFQLDENGELYIYRL  237
             ALSDCHS CW +C+C  Y    T+G+GC+     A     D  G  Y+  +
Sbjct  358   ALSDCHSTCWSDCTCIGYQPIYTNGSGCLFLKEGAKFVPNDYFGVTYLLTI  408



>ref|XP_009374013.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330 [Pyrus x bretschneideri]
Length=819

 Score =   293 bits (749),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 223/373 (60%), Gaps = 26/373 (7%)
 Frame = -2

Query  1379  TLMQGANIRDWE--HLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEP--VW  1212
             TL QG  +RD +  HL S    FKLGFFS   S S    T +R+LGIWY+K+PN P  VW
Sbjct  31    TLKQGDQLRDQDADHLVSPHGYFKLGFFSPGTS-SDLGATSNRFLGIWYSKLPNHPDAVW  89

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
             VAN ++P+ DSSG  ++D DGK+KI + GG I + + +     NV   ++D+GN ++REV
Sbjct  90    VANPETPVVDSSGVFMLDGDGKMKIKHGGGEIILWDHNQTVSGNVTGYMMDTGNFMLREV  149

Query  1031  DGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDIN  852
               +G+ G +LW+SFDYP++ L+PGMKLG++ +TG    ++SW S +VP  GAF LG+D N
Sbjct  150   ASDGTPGKILWESFDYPSNTLLPGMKLGLDFRTGRNRTVSSWFSGQVPTPGAFRLGVDPN  209

Query  851   GCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE---FGFKLVSNEKEKYFSYSAKHNY  681
                N+L+I RR  VYWTSG+W++GSF+ AP +T     F F  VSN +EKYF+YS K N 
Sbjct  210   R-TNRLIIWRRDVVYWTSGIWESGSFQMAPQLTSRADLFEFSFVSNAEEKYFTYSVKDNS  268

Query  680   RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKEN  501
               ++W L+  G + QS L  D +         TW          +P   +YP  VC+K+ 
Sbjct  269   TLSRWELNTWGQLLQSILASDGT---------TWNTTATGPCTFNP---DYPDAVCIKQT  316

Query  500   PVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSST  321
                CR  S++F+  +GY  D     +D     +   L LSDCH+ICW++C+C  Y     
Sbjct  317   TSECRNGSELFLPIKGYLIDAQLTYND-----SNPNLDLSDCHAICWRDCACIGYGPFHP  371

Query  320   DGTGCILYTNAAH  282
             +G+GC+     AH
Sbjct  372   NGSGCLYMREGAH  384



>ref|XP_008390308.1| PREDICTED: LOW QUALITY PROTEIN: G-type lectin S-receptor-like 
serine/threonine-protein kinase B120 [Malus domestica]
Length=1484

 Score =   298 bits (763),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 172/386 (45%), Positives = 226/386 (59%), Gaps = 28/386 (7%)
 Frame = -2

Query  1376  LMQGANIRDWEH---LTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEP--VW  1212
             L QG  + D +    ++     FKLGF S   S S    T DRYLGI+Y ++P+ P  VW
Sbjct  30    LQQGQLLPDQDKNFLVSENGGFFKLGFLSPGTS-SASGATSDRYLGIFYTRLPSHPDAVW  88

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
             +AN  +P+ DSSG   +D+DGKLKI Y GG I+VS+ +     NV A+LLD+GNLV++E 
Sbjct  89    LANPKTPISDSSGVFTLDSDGKLKIMYSGGEISVSDSNQTVSGNVTASLLDTGNLVLQEF  148

Query  1031  DGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDIN  852
               NG+FG VLWQSFD+PT+ L+PGMKLG+N KTG  W L SWLSD+VP  GAF+LG+D  
Sbjct  149   ASNGAFGSVLWQSFDHPTNTLLPGMKLGMNFKTGQNWTLFSWLSDQVPEPGAFKLGMD-P  207

Query  851   GCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE---FGFKLVSNEKEKYFSYSAKHNY  681
             G  +QLVI RRG VY TSGVWKNGSF  +P++T+    F F  VS ++E Y         
Sbjct  208   GAADQLVIWRRGDVYXTSGVWKNGSFRGSPELTRRVDLFEFTFVSXKEEXYXXXXXXXXS  267

Query  680   RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKEN  501
              +++W L L G I QS L  + +         TW        + +    NYP  +C++E 
Sbjct  268   TYSRWELSLQGQISQSILAPNKT---------TWESTVTGPCKLNM---NYPDAMCIEEK  315

Query  500   PVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSST  321
                CR  S++FV  RGYF        D + S     LA+SDCH+ CW+NC+C  Y S  T
Sbjct  316   ITECRNGSELFVPIRGYFAAVKFLYDDDDTS-----LAISDCHAACWRNCTCIGYESLYT  370

Query  320   D-GTGCILYTNAAHDFQLDENGELYI  246
             D GTGC+     A   + D  G  YI
Sbjct  371   DNGTGCVYMMEGAKFEENDYYGFTYI  396


 Score =   296 bits (759),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 158/378 (42%), Positives = 228/378 (60%), Gaps = 26/378 (7%)
 Frame = -2

Query  1379  TLMQGANIRDWE--HLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEP--VW  1212
             TL QG  +RD E  HL S +  FKLGFFS   S S    T +R+LGIWY+K+PN P  VW
Sbjct  787   TLKQGEQLRDQESDHLVSQRGDFKLGFFSPGAS-SNLGATSNRFLGIWYSKLPNHPDAVW  845

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
             V N ++P+ DSSG  ++D+DGK+KI + GG I V + +     NV   ++D+GN ++REV
Sbjct  846   VGNPETPVVDSSGVFVLDSDGKMKIKHGGGEIIVWDYNQTXSGNVTGYMMDTGNFMLREV  905

Query  1031  DGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDIN  852
               +G+ G +LW+SFDYP++ L+PGMKLG++L+TG    ++SW SD+VP  GAF L +D +
Sbjct  906   ASDGTPGKILWESFDYPSNTLLPGMKLGLDLRTGRNRTISSWFSDQVPTPGAFRLSVDPS  965

Query  851   GCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE---FGFKLVSNEKEKYFSYSAKHNY  681
                N+L+I RR  VYWTSG+W++GSF++AP++T     F F  VSN +EKYF+Y+ K+N 
Sbjct  966   S-TNRLIIWRRDVVYWTSGIWESGSFQRAPELTSRADLFEFNFVSNAEEKYFTYTVKNNS  1024

Query  680   RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKEN  501
               ++W L+  G + QS L  D +         TW     S    +P   NY   VC+K+ 
Sbjct  1025  TLSRWELNTWGQLMQSILGSDGT---------TWETTATSPCTSNP---NYLDAVCIKQT  1072

Query  500   PVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSST  321
                CR  S++F+  RGY  D     +D     + + L LSDCH+ CW +C+C  Y     
Sbjct  1073  TSECRNGSELFLPMRGYSXDAKLTYND-----SNTNLDLSDCHATCWSDCTCVGYGPLYH  1127

Query  320   DGTGCILYTNAAHDFQLD  267
             +G+GC+      H  + D
Sbjct  1128  NGSGCLYMREGVHYVKXD  1145



>ref|XP_009371470.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330 [Pyrus x bretschneideri]
Length=820

 Score =   291 bits (746),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 155/373 (42%), Positives = 227/373 (61%), Gaps = 26/373 (7%)
 Frame = -2

Query  1379  TLMQGANIRDWE--HLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEP--VW  1212
             TL QG  +RD E  HL S +  FKLGFFS   S S    T +R+LGIWY+K+PN P  VW
Sbjct  31    TLKQGEQLRDQENDHLISQRGDFKLGFFSPGAS-SNLGATSNRFLGIWYSKLPNHPDAVW  89

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
             V N + P+ DSSG  ++D+DGK+KI + GG I V + +     NV   L+D+GN ++REV
Sbjct  90    VGNPEIPVVDSSGVFVLDSDGKMKIKHGGGEIIVWDYNQTVSGNVTCYLMDTGNFMLREV  149

Query  1031  DGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDIN  852
               +G+ G +LW+SFDYP++ L+PGMKLG++ +TG    ++SW SD++P +GAF L +D N
Sbjct  150   ASDGTPGKILWESFDYPSNTLLPGMKLGLDFRTGRNRTISSWFSDQLPTAGAFRLSVDPN  209

Query  851   GCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE---FGFKLVSNEKEKYFSYSAKHNY  681
                N+L+I +R  VYWTSG+W++GSF++ P++T     F F  VSN +EKYF+Y+ K++ 
Sbjct  210   R-TNRLIIWQRDVVYWTSGIWESGSFQRTPELTSRADLFEFNFVSNAEEKYFTYAVKNSS  268

Query  680   RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKEN  501
               ++W L+  G + QS L  D +         TW     S    +P   +YP  VC+K+ 
Sbjct  269   TLSRWELNTWGQLLQSILGSDGT---------TWETTVTSPCTSNP---DYPDAVCIKQT  316

Query  500   PVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSST  321
                CR  S++F+  RGY  D     +D     + + L LSDCH+ CW +C+C  Y   + 
Sbjct  317   TSECRNGSELFLPMRGYSGDAKLTYND-----SNTNLDLSDCHATCWSDCTCVGYRPLNP  371

Query  320   DGTGCILYTNAAH  282
             +G+GC+     AH
Sbjct  372   NGSGCLYMREGAH  384



>ref|XP_008337429.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 [Malus domestica]
Length=819

 Score =   289 bits (739),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 156/373 (42%), Positives = 222/373 (60%), Gaps = 26/373 (7%)
 Frame = -2

Query  1379  TLMQGANIRDWE--HLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEP--VW  1212
             TL QG  +RD +  HL S    FKLGFFS   S S    T +R+LGIWY+K+PN P  VW
Sbjct  31    TLKQGDQLRDQDTDHLVSPHGYFKLGFFSPGAS-SDLGATSNRFLGIWYSKLPNHPDAVW  89

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
             VAN  +P+ DSSG  ++D+DGK+KI + GG I + + +     NV   ++DSGN ++REV
Sbjct  90    VANPATPVVDSSGVFMLDSDGKMKIKHGGGEIILWDHNQTVSGNVTGYMMDSGNFMLREV  149

Query  1031  DGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDIN  852
               +G+ G +LW+SFDYP++ L+PGMKLG + +TG     +SW S +VP  GAF LG+D N
Sbjct  150   ASDGTPGKILWESFDYPSNTLLPGMKLGWDFRTGRNRTXSSWFSGQVPTPGAFRLGVDPN  209

Query  851   GCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE---FGFKLVSNEKEKYFSYSAKHNY  681
                N+L+I RR  VYWTSG+W++GSF+  P++T     F F  VSN +EKYF+YS K N 
Sbjct  210   R-TNRLIIWRRDVVYWTSGIWESGSFQMXPELTSRADLFEFSFVSNAEEKYFTYSVKDNS  268

Query  680   RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKEN  501
               ++W L+  G + QS L  D +          W  + +     +P   +YP  VC+K+ 
Sbjct  269   TLSRWELNTWGQLLQSILASDGT---------XWETKASGPCTFNP---DYPDAVCIKQT  316

Query  500   PVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSST  321
                CR  S++F+  RGY  D     +D   + +     LSDCH+ICW++C+C  Y     
Sbjct  317   TSECRNGSELFLPIRGYLIDAQLTYNDSNPNSD-----LSDCHAICWRDCACIGYGPLQL  371

Query  320   DGTGCILYTNAAH  282
             +G+GC+     AH
Sbjct  372   NGSGCLYMREGAH  384



>gb|KCW82456.1| hypothetical protein EUGRSUZ_C03848 [Eucalyptus grandis]
Length=656

 Score =   278 bits (711),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 147/307 (48%), Positives = 203/307 (66%), Gaps = 25/307 (8%)
 Frame = -2

Query  1376  LMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEP--VWVAN  1203
             L QG  +RDWEHL + K  FKLGFFS       P ++  RYLGIWY+K+P+ P  VWVAN
Sbjct  25    LTQGQQLRDWEHLLAPKGTFKLGFFS-------PGSSSYRYLGIWYSKLPHNPEAVWVAN  77

Query  1202  RDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREVDGN  1023
              ++P+ +SSG L +D+DG+LKI+  GG   V + +    N V  TLLD+GNL++REV+ +
Sbjct  78    PNNPISNSSGVLNLDSDGRLKITANGGQTIVVSSNDPVTNKVTLTLLDTGNLLLREVNSD  137

Query  1022  GSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDINGCN  843
             G+ G VLWQSFDYP+  L+PGMKLG+++K    W LTSWLSD+ P  GAF LG+D  G  
Sbjct  138   GTVGRVLWQSFDYPSSTLLPGMKLGLDIKARTNWTLTSWLSDRDPAPGAFRLGVD-PGSA  196

Query  842   NQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE---FGFKLVSNEKEKYFSYSAKHNYRFT  672
             NQLVI  R ++YWTSG W+NG F+ AP++T++   + F  VS+E EKYF++S K+N   T
Sbjct  197   NQLVIWHREEIYWTSGAWENGGFQMAPELTRDKTAYEFSFVSDENEKYFTFSLKNNSTIT  256

Query  671   KWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKENPVS  492
             +W ++L G I QS+L  D +         TW+  Y+ST  C+   GNY   VC+ + P +
Sbjct  257   RWEINLWGQIVQSTLAKDGT---------TWL--YSSTSSCNSN-GNYSGAVCVDQQPSA  304

Query  491   CRKSSDV  471
             CR  S++
Sbjct  305   CRNGSEL  311



>ref|XP_010249751.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X2 [Nelumbo nucifera]
Length=835

 Score =   277 bits (708),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 175/412 (42%), Positives = 230/412 (56%), Gaps = 49/412 (12%)
 Frame = -2

Query  1415  FSSYVSVGA-ESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWY  1239
             FS + +  A  SDTL+Q   +RDWE L SA  +F+LGFF+       P N+++RY GI Y
Sbjct  29    FSCFCAAAALASDTLIQNQLLRDWEQLVSANGVFRLGFFT-------PGNSKNRYFGISY  81

Query  1238  NKIPN-EPVWVANRDSPLPDSSGSLIIDADGKLKISY--VGGMITVSNVSIMSGNNVGAT  1068
              K  N   VWVANRD+P+ DSSG+L ID +G LKI Y  V  ++  SN S   G+N+ A 
Sbjct  82    AKATNLTVVWVANRDTPITDSSGALTIDNNGTLKILYSGVSPIVLSSNQSTTRGSNLTAM  141

Query  1067  LLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVP  888
             LLDSGNLV+REVD +G+   VLWQSFDYPTD L+PGMKLG N KTGH W LTSWLS   P
Sbjct  142   LLDSGNLVLREVDSDGTAERVLWQSFDYPTDTLLPGMKLGFNSKTGHNWSLTSWLSTGDP  201

Query  887   GSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE---FGFKLVSNEK  717
               GA+ LG D      QL+  RRG +YW +G+W N SFE  P++T +   + F  +SNE 
Sbjct  202   SGGAYSLGGDPTR-TTQLMGWRRGDIYWKTGIWSNQSFESVPELTSDNVRYNFSYISNEN  260

Query  716   EKYFSYSAKHNYR-FTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYAS-TLECDP  543
             E YF+YS  ++Y   + W L+ LG   Q                Y    +Y S +++C P
Sbjct  261   ETYFTYSLVNSYSPPSLWVLNWLGGFNQ-------------FKFYELEDKYLSLSIQCPP  307

Query  542   YIGNYPRPV---------CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRL  390
             +  +              C+ +  V CR S D F + RG+          VEN+     L
Sbjct  308   HFSSASPASSSDEDRLMGCVNQTVVECR-SGDQFDRRRGFV--SGSPYRAVENTS----L  360

Query  389   ALSDCHSICWKNCSCTAYASSSTDGTGCILYTNAAHDFQLDEN--GELYIYR  240
              L DC  +CW NCSC AY +   + TGC  + N    F+ D N  G++YI R
Sbjct  361   GLVDCDQMCWSNCSCIAYNTLYDNATGCRFW-NRDSGFREDNNYPGDVYILR  411



>ref|XP_010249750.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X1 [Nelumbo nucifera]
Length=836

 Score =   277 bits (708),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 175/412 (42%), Positives = 230/412 (56%), Gaps = 49/412 (12%)
 Frame = -2

Query  1415  FSSYVSVGA-ESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWY  1239
             FS + +  A  SDTL+Q   +RDWE L SA  +F+LGFF+       P N+++RY GI Y
Sbjct  29    FSCFCAAAALASDTLIQNQLLRDWEQLVSANGVFRLGFFT-------PGNSKNRYFGISY  81

Query  1238  NKIPN-EPVWVANRDSPLPDSSGSLIIDADGKLKISY--VGGMITVSNVSIMSGNNVGAT  1068
              K  N   VWVANRD+P+ DSSG+L ID +G LKI Y  V  ++  SN S   G+N+ A 
Sbjct  82    AKATNLTVVWVANRDTPITDSSGALTIDNNGTLKILYSGVSPIVLSSNQSTTRGSNLTAM  141

Query  1067  LLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVP  888
             LLDSGNLV+REVD +G+   VLWQSFDYPTD L+PGMKLG N KTGH W LTSWLS   P
Sbjct  142   LLDSGNLVLREVDSDGTAERVLWQSFDYPTDTLLPGMKLGFNSKTGHNWSLTSWLSTGDP  201

Query  887   GSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE---FGFKLVSNEK  717
               GA+ LG D      QL+  RRG +YW +G+W N SFE  P++T +   + F  +SNE 
Sbjct  202   SGGAYSLGGDPTR-TTQLMGWRRGDIYWKTGIWSNQSFESVPELTSDNVRYNFSYISNEN  260

Query  716   EKYFSYSAKHNYR-FTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYAS-TLECDP  543
             E YF+YS  ++Y   + W L+ LG   Q                Y    +Y S +++C P
Sbjct  261   ETYFTYSLVNSYSPPSLWVLNWLGGFNQ-------------FKFYELEDKYLSLSIQCPP  307

Query  542   YIGNYPRPV---------CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRL  390
             +  +              C+ +  V CR S D F + RG+          VEN+     L
Sbjct  308   HFSSASPASSSDEDRLMGCVNQTVVECR-SGDQFDRRRGFV--SGSPYRAVENTS----L  360

Query  389   ALSDCHSICWKNCSCTAYASSSTDGTGCILYTNAAHDFQLDEN--GELYIYR  240
              L DC  +CW NCSC AY +   + TGC  + N    F+ D N  G++YI R
Sbjct  361   GLVDCDQMCWSNCSCIAYNTLYDNATGCRFW-NRDSGFREDNNYPGDVYILR  411



>ref|XP_010525291.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 [Tarenaya hassleriana]
Length=411

 Score =   266 bits (679),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 162/398 (41%), Positives = 228/398 (57%), Gaps = 23/398 (6%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTE-DRYLGIWYNKIP  1227
             VS  AE++TL  G  +RDWE L S   IF+LGFF+   + S  +     RY+GIW+++I 
Sbjct  23    VSSPAETNTLNPGQMLRDWEQLISPSGIFRLGFFTPEKTPSSLLGPAGPRYIGIWFDRIQ  82

Query  1226  NEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNV--SIMSGNNVGATLLDSG  1053
               PVWV N  +P+ DSSG+L I  DG LKI+   G   + N    +    NV ATLLDSG
Sbjct  83    INPVWVGNPMNPVIDSSGALTIGPDGILKITQANGSPIMVNPKPQLSLAGNVSATLLDSG  142

Query  1052  NLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAF  873
             N +VREV   G  G VLWQSFDYP++VL+PGMK+G NLKTG    + SW+ ++VP  GAF
Sbjct  143   NFIVREVGAGGVPGRVLWQSFDYPSNVLLPGMKIGFNLKTGKEVSVKSWICNQVPSPGAF  202

Query  872   ELGLDINGCNNQLVISRRGKVYWTSGVWKNG-SFEKAPDMTKE---FGFKLVSNEKEKYF  705
              LGLD +G  +QL+I RR +VYW+SG+WKNG S     ++++E   + FK  S++ ++YF
Sbjct  203   RLGLDPSGA-DQLLIWRRNEVYWSSGIWKNGTSSHLNLELSREYIDYEFKFHSDKYDRYF  261

Query  704   SYSAKHNYR--FTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGN  531
             +Y  K   +   ++W LD LG +  +++I              WI   + T  C   + N
Sbjct  262   TYFIKDTNQSVLSRWYLDTLGQVTVNNVISSNG-------STHWILESSET--CRTGLKN  312

Query  530   YPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNC  351
                 +C+ E P +CRK S+ F   RGY   +    +D+      S L LSDCH+ CW+NC
Sbjct  313   -ASALCISEKPTACRKGSEYFEPKRGYMLQE-LGKNDLSYYDGNSSLDLSDCHASCWRNC  370

Query  350   SCTAYASSSTDGTGCILYTNAAHDFQLDENGELYIYRL  237
             SC A+ + S  G GC  +   +  F  +E  +   Y L
Sbjct  371   SCIAFQTFS-GGFGCQFWPKGSK-FTPEETSDQLTYVL  406



>ref|XP_002871818.1| hypothetical protein ARALYDRAFT_488726 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48077.1| hypothetical protein ARALYDRAFT_488726 [Arabidopsis lyrata subsp. 
lyrata]
Length=413

 Score =   259 bits (662),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 154/364 (42%), Positives = 210/364 (58%), Gaps = 23/364 (6%)
 Frame = -2

Query  1388  ESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTE-DRYLGIWYNKIPNEPVW  1212
             ++DTL  G  +RDWE L SA  IF LGFF+  +S +  + +   RYLGIW  +IP  PVW
Sbjct  29    KTDTLKPGQQLRDWEQLISAGGIFALGFFTPKESSTSELGSAGPRYLGIWPQRIPINPVW  88

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNV----SIMSGNNVGATLLDSGNLV  1044
             V N    + DSSG+L ID +G LKI+       + N      +    NV ATLLDSGN V
Sbjct  89    VGNPIESISDSSGALSIDTNGVLKITQENAFPILVNQRPARQLSLSGNVSATLLDSGNFV  148

Query  1043  VREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELG  864
             VRE+   G  G VLWQSFD+PT+ L+PGMK+G NL+T     +TSW+SD+VP  GAF LG
Sbjct  149   VREIRPGGVPGRVLWQSFDHPTNTLLPGMKIGFNLRTKKEVSVTSWISDQVPVPGAFRLG  208

Query  863   LDINGCNNQLVISRRGKVYWTSGVW-KNGSFEKAPDMTK---EFGFKLVSNEKEKYFSYS  696
             LD +G  NQL++ RRG++YW+SG+   NGS     ++++   ++ FK  SN+  +YFSYS
Sbjct  209   LDPSGA-NQLLVWRRGEIYWSSGILTNNGSSHLTLELSRHYIDYEFKFDSNKYMRYFSYS  267

Query  695   AK--HNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPR  522
              K  +N   + W LD LG I  ++++              WI    S+  C   + N   
Sbjct  268   IKEANNSVLSSWFLDTLGQITVTNVLSSNK-------SSNWISE--SSEPCKTDLKN-SS  317

Query  521   PVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCT  342
              +C+KE P +CRK S+ F   RGY  D+N          + S   LSDCH  CW+NCSC 
Sbjct  318   AICIKEKPTACRKGSEYFEPRRGYMMDNNNGYYPFYYDDSLSA-GLSDCHGNCWRNCSCI  376

Query  341   AYAS  330
             A+ +
Sbjct  377   AFQA  380



>ref|XP_010254131.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X2 [Nelumbo nucifera]
Length=823

 Score =   268 bits (686),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 174/396 (44%), Positives = 223/396 (56%), Gaps = 43/396 (11%)
 Frame = -2

Query  1385  SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN-EPVWV  1209
             +DTL Q   +RDWE L SA   F+LGFFS       P ++ +RYLGI Y +  N   VWV
Sbjct  38    TDTLAQNQLLRDWEQLISANGTFRLGFFS-------PGSSSNRYLGISYYQAQNLTVVWV  90

Query  1208  ANRDSPLPDSSGSLIIDADGKLKISYVGG---MITVSNVSIMSGNNVGATLLDSGNLVVR  1038
             ANR  P+ DSSGSL I +DG L+I + G    ++  SN +   G+N+ ATLLDSGN V R
Sbjct  91    ANRRIPITDSSGSLTISSDGSLEIIHSGQSSPIMLSSNATATKGSNLTATLLDSGNFVFR  150

Query  1037  EVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLD  858
             E+D NG+   VLWQSFDYPTD L+PGMKLG N  TG  W LTSWLS   P  GAF LG D
Sbjct  151   ELDSNGTVLQVLWQSFDYPTDTLLPGMKLGFNSDTGLNWSLTSWLSTDDPSPGAFSLGGD  210

Query  857   INGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE---FGFKLVSNEKEKYFSYSAKH  687
               G   QL+  RRG VYW SG+W N SFE  PD+T +   + +  +SNE E YF+YS K+
Sbjct  211   PTG-TTQLMAWRRGNVYWKSGIWNNQSFENVPDLTSDDVRYNYSYISNENETYFTYSLKN  269

Query  686   NYR-FTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYAS-TLECDPY--IGNYPRP  519
             +    + W L  LG  +Q                Y    +Y S  ++C P+   G+  + 
Sbjct  270   SSSPPSLWVLIWLGGFDQ-------------YKFYESDDKYLSLRIQCPPHNSSGDKAKL  316

Query  518   V-CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCT  342
             + C+ +  V CR S D F + RGY          VEN+  G    L DC  +CW NCSC 
Sbjct  317   MGCVNQTVVECR-SGDDFDRKRGYVSGTPYRY--VENTSMG----LIDCDELCWNNCSCV  369

Query  341   AYASSSTDGTGCILYTNAAHDFQLDEN--GELYIYR  240
             AY +   + TGC L+T  A  F+ D N  G++YI R
Sbjct  370   AYGTLYDNATGCRLWTTDA-GFREDNNSPGDIYILR  404



>ref|XP_010254130.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X1 [Nelumbo nucifera]
Length=824

 Score =   268 bits (686),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 174/396 (44%), Positives = 223/396 (56%), Gaps = 43/396 (11%)
 Frame = -2

Query  1385  SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN-EPVWV  1209
             +DTL Q   +RDWE L SA   F+LGFFS       P ++ +RYLGI Y +  N   VWV
Sbjct  38    TDTLAQNQLLRDWEQLISANGTFRLGFFS-------PGSSSNRYLGISYYQAQNLTVVWV  90

Query  1208  ANRDSPLPDSSGSLIIDADGKLKISYVGG---MITVSNVSIMSGNNVGATLLDSGNLVVR  1038
             ANR  P+ DSSGSL I +DG L+I + G    ++  SN +   G+N+ ATLLDSGN V R
Sbjct  91    ANRRIPITDSSGSLTISSDGSLEIIHSGQSSPIMLSSNATATKGSNLTATLLDSGNFVFR  150

Query  1037  EVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLD  858
             E+D NG+   VLWQSFDYPTD L+PGMKLG N  TG  W LTSWLS   P  GAF LG D
Sbjct  151   ELDSNGTVLQVLWQSFDYPTDTLLPGMKLGFNSDTGLNWSLTSWLSTDDPSPGAFSLGGD  210

Query  857   INGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE---FGFKLVSNEKEKYFSYSAKH  687
               G   QL+  RRG VYW SG+W N SFE  PD+T +   + +  +SNE E YF+YS K+
Sbjct  211   PTG-TTQLMAWRRGNVYWKSGIWNNQSFENVPDLTSDDVRYNYSYISNENETYFTYSLKN  269

Query  686   NYR-FTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYAS-TLECDPY--IGNYPRP  519
             +    + W L  LG  +Q                Y    +Y S  ++C P+   G+  + 
Sbjct  270   SSSPPSLWVLIWLGGFDQ-------------YKFYESDDKYLSLRIQCPPHNSSGDKAKL  316

Query  518   V-CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCT  342
             + C+ +  V CR S D F + RGY          VEN+  G    L DC  +CW NCSC 
Sbjct  317   MGCVNQTVVECR-SGDDFDRKRGYVSGTPYRY--VENTSMG----LIDCDELCWNNCSCV  369

Query  341   AYASSSTDGTGCILYTNAAHDFQLDEN--GELYIYR  240
             AY +   + TGC L+T  A  F+ D N  G++YI R
Sbjct  370   AYGTLYDNATGCRLWTTDA-GFREDNNSPGDIYILR  404



>ref|XP_002522015.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40419.1| conserved hypothetical protein [Ricinus communis]
Length=593

 Score =   258 bits (660),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 156/384 (41%), Positives = 206/384 (54%), Gaps = 72/384 (19%)
 Frame = -2

Query  1415  FSSYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTE-DRYLGIWY  1239
             FSS     AE+DT+ QG  +RDWE L SA  +F+LGFFS + +YS  + +   R+LGIW+
Sbjct  16    FSSNCISFAETDTIKQGQLLRDWEQLVSAGGVFRLGFFSPNPTYSIELGSSGPRHLGIWF  75

Query  1238  NKIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLD  1059
             N IP   VWVANR  P+PDSSG+L +D DGKLKI+Y GG   V N ++ S ++       
Sbjct  76    NYIPFYSVWVANRKDPIPDSSGALTVDGDGKLKITYQGGSPIVINSNMASKSS-------  128

Query  1058  SGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSG  879
                                                       G  W L+SWLS+K+P  G
Sbjct  129   -----------------------------------------PGQNWTLSSWLSEKIPAPG  147

Query  878   AFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE---FGFKLVSNEKEKY  708
             AF+LGLD +G N QL+I RR ++YW+SGVW+NGSFE AP++TK      F+ V+NE+E+Y
Sbjct  148   AFKLGLDPSGAN-QLLIWRRDEIYWSSGVWQNGSFESAPELTKRNDLLDFRFVANEEERY  206

Query  707   FSYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNY  528
             F+YS K     ++W LD LG I    L  + S  I       WI  Y +   C  Y    
Sbjct  207   FTYSIKKKSVLSRWDLDTLGQITAFILERNDSSSI-------WI--YDTVGPCQ-YASKN  256

Query  527   PRPVCLKENPVSCRKSSDVFVQTRGY--FRDDNRNISDVENSGNGSRLALSDCHSICWKN  354
                VCL E P  CR  S++FV  RGY  +  D    SD         L+LSDCH+ CWKN
Sbjct  257   STAVCLTEKPTKCRNGSEMFVPKRGYIDYTADWYYDSDFN-------LSLSDCHAKCWKN  309

Query  353   CSCTAYASSSTDGTGCILYTNAAH  282
             CSC AY  +S D TGC  ++  ++
Sbjct  310   CSCVAYKPASNDDTGCHFWSKLSN  333



>gb|KDP23746.1| hypothetical protein JCGZ_23579 [Jatropha curcas]
Length=281

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 141/297 (47%), Positives = 177/297 (60%), Gaps = 27/297 (9%)
 Frame = -2

Query  1094  MSGNNVGATLLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKL  915
             +SG N   TLLDSGNLVVR+V+ +G  G V+WQSFDYP ++ +PGMKLG+NLKTG  W L
Sbjct  6     ISGGNFTVTLLDSGNLVVRQVNSDGFTGSVIWQSFDYPHNIFLPGMKLGMNLKTGKNWTL  65

Query  914   TSWLSDKVPGSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE---F  744
             TSWLS+K P  GAF LGLD NG  NQL+I RR   YW+SGVW NGSFE AP +TK    +
Sbjct  66    TSWLSEKNPSPGAFRLGLDPNGA-NQLIIWRRDSRYWSSGVWVNGSFELAPQLTKRNDIY  124

Query  743   GFKLVSNEKEKYFSYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYA  564
              F+   NE EKYFSYS K+    ++W+ D +G IE  +L     +        TWI  + 
Sbjct  125   DFRFFENEDEKYFSYSVKNKSVLSRWSFDTIGEIEVFTLDKRGDY-------STWI--FE  175

Query  563   STLECDPYIGNYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNI---SDVENSGNGSR  393
             S   C    G     VCL E P  CR   DVFV  R Y  +D R     SD+        
Sbjct  176   SVGPCQN--GFNSSAVCLTEKPNKCRNDLDVFVPKRAYVENDERFFYYDSDLS-------  226

Query  392   LALSDCHSICWKNCSCTAYASSSTDGTGCILYTNAAHDFQLDENGELYIYRLLKEHK  222
             L +SDCH+ CW NC+C AY SSS DGTGC  ++  +  F  D+N + ++Y L  + K
Sbjct  227   LGVSDCHAKCWGNCTCIAYQSSSRDGTGCQYWSKGSK-FTPDDNAD-FVYLLSHQGK  281



>ref|XP_010250354.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104592606 
[Nelumbo nucifera]
Length=1641

 Score =   261 bits (667),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 171/399 (43%), Positives = 223/399 (56%), Gaps = 49/399 (12%)
 Frame = -2

Query  1412  SSYVSVGAESDTLM-QGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYN  1236
             +S+ +V A  DT++ +G  ++DW+HL SA  IF+LGFFS       P  + +RYLGI YN
Sbjct  852   TSHDAVAATRDTIITEGEGVQDWDHLESAGGIFRLGFFS-------PGASRNRYLGISYN  904

Query  1235  KIPNEPV-WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLD  1059
             K  +  V WV NR++P+ DSSG L ID DGKLKI++ GG   +   S  +  NV ATLLD
Sbjct  905   KARDATVVWVXNRNTPIADSSGLLTIDGDGKLKITHSGGS-AIMLYSKQTAGNVTATLLD  963

Query  1058  SGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSG  879
             SGN V+REVD NG+   VLWQSFDYPT+ L+PGMKLG N KTGH W LTSWL+++   SG
Sbjct  964   SGNFVLREVDSNGTATRVLWQSFDYPTNTLLPGMKLGFNSKTGHNWSLTSWLTNEDLSSG  1023

Query  878   AFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE---FGFKLVSNEKEKY  708
              F LG D  G  NQL+  RR  VYW SGVW   SF+  P++T +   + F  V +E E+Y
Sbjct  1024  DFSLGGDPMG-TNQLLAWRRRDVYWKSGVWDGRSFKSVPELTSDNVTYNFSYVWSEDERY  1082

Query  707   FSYSAKHNYRFTK-WTLDLLGHIEQSSL------IYDPSFFIHYMPMYTWIGRYASTLEC  549
             F+YS K N      W LD  G+I Q          YD SF I   P +            
Sbjct  1083  FTYSLKQNSSPPSFWVLDSEGNIRQYKFYNWNDDTYD-SFSI-LCPTHL-----------  1129

Query  548   DPYIGNYPRPV---CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSD  378
              PY  NY R     C+++    CR+  ++F   +GY        + +  S     L L D
Sbjct  1130  -PY--NYSRENKRGCVEQKVPGCRR-GELFYSKQGYMDGPGSFYTSLNAS-----LRLRD  1180

Query  377   CHSICWKNCSCTAYASSSTDGTGCILYTNAAHDFQLDEN  261
             C  +CW NCSC AY +   + TGC L+     DF   E+
Sbjct  1181  CADMCWSNCSCIAYKTYYAEETGCQLWN---RDFTFRES  1216


 Score =   256 bits (653),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 172/428 (40%), Positives = 228/428 (53%), Gaps = 47/428 (11%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEP--  1218
             A  DT+ QG  ++DW+ L SA  IF+LGFFS       P  +++RYLGI YNK   +   
Sbjct  37    ATEDTITQGQELKDWQKLVSANGIFRLGFFS-------PGASKNRYLGISYNKYQGDVTV  89

Query  1217  VWVANRDSPLPDSSGSLIIDADGKLKISYVGG--MITVSNVSIMSGNNVGATLLDSGNLV  1044
             VWVANRD+P+ DSSG+L ID DG LKI+  GG  +I  SN    + +NV ATLLDSGN V
Sbjct  90    VWVANRDTPIGDSSGALTIDGDGILKITSRGGNPIILCSN---QTTSNVTATLLDSGNFV  146

Query  1043  VREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELG  864
             +REV+ NGS   V+WQSFDYPT  L+PGMKLG N KTG  W LTSWL+   P  GAF LG
Sbjct  147   LREVNPNGSPKRVVWQSFDYPTSSLLPGMKLGFNSKTGQSWTLTSWLTGDDPSPGAFSLG  206

Query  863   LDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE---FGFKLVSNEKEKYFSYSA  693
             LD  G  +QL+   R   YW SGVW    F+  P +T +   + F  VS E E+YF+Y  
Sbjct  207   LDPTG-KSQLLAWYRRDAYWNSGVWDGRGFKSVPKLTSDDVRYNFSFVSTEDERYFTYIP  265

Query  692   KHNYRFTK-WTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPV  516
             K N      W L+  G+I Q                Y W   Y S+    P I + P P 
Sbjct  266   KRNSSPPSFWVLNYDGYIYQ-------------FKFYDWGVTYQSSSIICP-ISHSPFPT  311

Query  515   CLKENPVSCRKSSDVFVQTRG--YFRDDNRNISD------VENSGNGSRLALSDCHSICW  360
               +EN   C    +     RG  +F  + R +        VEN+     L + DC  +CW
Sbjct  312   -FEENKKGCLAEQNAPECRRGDQWFHLEVRYVGVSLPYRYVENAS----LRIDDCDKMCW  366

Query  359   KNCSCTAYASSSTDGTGCILYTNAAHDFQLDE-NGELYIYRLLKEHKG*ILVNVRYCCFT  183
              NCSC AYA+   + TGC L+++ +   +    N ++++ R   ++K  I         T
Sbjct  367   SNCSCIAYATLYDNATGCQLWSSGSTFRESSNYNDQIFLLRSTGKNKRWIWCTAAAVVAT  426

Query  182   VIQVFCVF  159
             VI +  +F
Sbjct  427   VIILLGIF  434



>ref|NP_197348.1| curculin-like (mannose-binding) lectin family protein [Arabidopsis 
thaliana]
 gb|AAK44038.1|AF370223_1 unknown protein [Arabidopsis thaliana]
 gb|AAM20653.1| putative protein [Arabidopsis thaliana]
 gb|AAM51333.1| unknown protein [Arabidopsis thaliana]
 gb|AED92567.1| curculin-like (mannose-binding) lectin family protein [Arabidopsis 
thaliana]
Length=413

 Score =   241 bits (615),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 153/364 (42%), Positives = 208/364 (57%), Gaps = 23/364 (6%)
 Frame = -2

Query  1388  ESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTED-RYLGIWYNKIPNEPVW  1212
             ++DTL  G  +RDWE L SA  IF LGFF+  DS +  + +   RYLGIW   IP   VW
Sbjct  29    KTDTLKPGQQLRDWEQLISADGIFTLGFFTPKDSSTSELGSAGLRYLGIWPQSIPINLVW  88

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSN----VSIMSGNNVGATLLDSGNLV  1044
             V N    + DSSGSL ID +G LKI+    +  + N      +    NV A LLD+GN V
Sbjct  89    VGNPTESVSDSSGSLSIDTNGVLKITQANAIPILVNQRPAAQLSLVGNVSAILLDTGNFV  148

Query  1043  VREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELG  864
             VRE+   G  G VLWQSFD+PT+ L+PGMK+G NL+T     +TSW++D+VP  GAF LG
Sbjct  149   VREIRPGGVPGRVLWQSFDHPTNTLLPGMKIGFNLRTKKEVSVTSWITDQVPVPGAFRLG  208

Query  863   LDINGCNNQLVISRRGKVYWTSGVW-KNGSFEKAPDMTK---EFGFKLVSNEKEKYFSYS  696
             LD +G  NQL++ RRG++YW+SG+   NGS     ++++   ++ FK  SN+  KYFSYS
Sbjct  209   LDPSGA-NQLLVWRRGEIYWSSGILTNNGSSHLNLEVSRHYIDYEFKFDSNKYMKYFSYS  267

Query  695   AK--HNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPR  522
              K  ++  F+ W LD LG I         +F +      TWI    S+  C   + N   
Sbjct  268   IKKANSSVFSSWFLDTLGQITV-------TFSLSSNNSSTWISE--SSEPCKTDLKN-SS  317

Query  521   PVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCT  342
              +C+ E P +CRK S+ F   RGY  ++N          + S   LSDCH  CW+NCSC 
Sbjct  318   AICITEKPTACRKGSEYFEPRRGYMMENNTGYYPFYYDDSLSA-GLSDCHGTCWRNCSCI  376

Query  341   AYAS  330
             A+ +
Sbjct  377   AFQA  380



>gb|KDP37223.1| hypothetical protein JCGZ_06279 [Jatropha curcas]
Length=2223

 Score =   255 bits (652),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 154/388 (40%), Positives = 214/388 (55%), Gaps = 44/388 (11%)
 Frame = -2

Query  1376  LMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPV-----W  1212
             ++QG  ++DWEHL S +  F LGFFS+           +RYLGI  N IP++ V     W
Sbjct  1493  IVQGQQLKDWEHLVSEEGTFNLGFFSLG-------TPSNRYLGI-TNNIPDDSVREKVVW  1544

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
             VANR++P+ DSSG L ID  GKLKISY      V + S+ +  NV AT+ DSGN V+RE+
Sbjct  1545  VANRNNPIYDSSGILHIDEFGKLKISYSASSPIVLS-SVQAVGNVSATIYDSGNFVLREL  1603

Query  1031  DGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDIN  852
               +G+   VLWQSFD+PTD L+PGMKLG+N KTG  W LTSW+S + P  G+   G D N
Sbjct  1604  HSDGTVRRVLWQSFDHPTDTLLPGMKLGINFKTGQTWSLTSWISLENPAPGSLTFGGDPN  1663

Query  851   GCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFG--FKLVSNEKEKYFSYSAKHNYR  678
             G  +QL++  RG V+WTSG+W+NG FE  P ++ E    F  +SNE EKYF ++   N  
Sbjct  1664  G-TSQLIVWWRGNVFWTSGLWQNGHFEFVPKLSYEDAKIFSYISNENEKYFMFNVIKNRT  1722

Query  677   FTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKENP  498
              +++ + L G I +S  +                   +    C  +I N  R  C++E  
Sbjct  1723  ASQYRIGLHGQITESRGL-------------------SPFCRCSEFIRN--RIGCVQEKL  1761

Query  497   VSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSSTD  318
              +CRK  D F   +G        ISD         L++ DC + C  NCSC AYAS++ +
Sbjct  1762  PNCRKPEDWFEPRKG------NTISDGFKFDGSHNLSIFDCQANCLANCSCIAYASTNDN  1815

Query  317   GTGCILYTNAAHDFQLDENGELYIYRLL  234
             GTGC +++      + D      IY L+
Sbjct  1816  GTGCEIWSQGKDFIEFDSPLSREIYFLV  1843


 Score =   211 bits (538),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 145/380 (38%), Positives = 206/380 (54%), Gaps = 49/380 (13%)
 Frame = -2

Query  1385  SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYN-----KIPNE  1221
             +DTL+QG  +++ ++L SA  IF+LGFF     +         Y+GIWYN     +I  +
Sbjct  8     TDTLLQGQYLKNGDYLMSASGIFRLGFFETRGKH---------YVGIWYNVTTEQEISYD  58

Query  1220  P----VWVANRDSPLPDSSGSLIIDADGKLKI-SYVGGMITVSNVSIMSGNNVGATLLDS  1056
             P    VWVANR++PL D+SG L I +D  L+I    G    ++  S+ +     ATLLDS
Sbjct  59    PSSKVVWVANRNTPLFDNSGILTIGSDRNLEILCNRGDGDPIALTSVEASGYTIATLLDS  118

Query  1055  GNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGA  876
             GNL++ E+  NGS   +LWQSFDYPT  L+PGMKLG NL T H W LTSW+ +  P  G+
Sbjct  119   GNLILSELYSNGSIKSLLWQSFDYPTHTLLPGMKLGFNLHTAHNWSLTSWIDNWSPAIGS  178

Query  875   FELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMT--KEFGFKLVSNEKEKYFS  702
             F  G+D N   NQL I   G +YWTSG W++G F  + ++    ++ F+ VSNE EKYF+
Sbjct  179   FTFGMDRNE-TNQLKIWWAGDLYWTSGTWEDGRFSLSHELAYQDQYHFRYVSNENEKYFT  237

Query  701   YSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPR  522
             Y A  N   T + +  +     SS   +P   I     Y     Y +T+ C     +   
Sbjct  238   YYA--NDATTSFPMLSINDFILSSGFANP--LISCRSSYD----YMNTVGC----VDQKH  285

Query  521   PVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCT  342
             P+C K         SD F  TRG+   D    ++ +N      L+++DC   C +NCSC 
Sbjct  286   PICWKH-------VSD-FEYTRGFVFGDVFKFNESDN------LSINDCLEKCLRNCSCV  331

Query  341   AYA-SSSTDGTGCILYTNAA  285
             AYA ++  DGTGC +++   
Sbjct  332   AYAPTNEIDGTGCEIWSKVT  351


 Score =   187 bits (475),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 132/400 (33%), Positives = 200/400 (50%), Gaps = 79/400 (20%)
 Frame = -2

Query  1382  DTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPV----  1215
             +T++QG  ++D ++L SA   FK GFFS       P  +  RYLGIWYN +  + V    
Sbjct  815   NTILQGQKLKDSDYLISADGTFKFGFFS-------PGTSRSRYLGIWYNVVDEKSVSIAK  867

Query  1214  ----WVANRDSPLPDSSGSLIIDADGKLKISYVGG-MITVSNVSIMSGNNVGATLLDSGN  1050
                 WVANR++P+PD+SG L ID  GKL+ISY GG  IT+S  +  S  NV ATLL+SGN
Sbjct  868   RSVVWVANRNNPIPDASGILTIDKLGKLRISYNGGSFITLSYAAATS--NVSATLLNSGN  925

Query  1049  LVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFE  870
              V++E++ +GS   +LW+SFDYPTD L                         +PGS +  
Sbjct  926   FVLKEMNFDGSTKHILWESFDYPTDTL-------------------------LPGSFSLT  960

Query  869   LGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE----FGFKLVSNEKEKYFS  702
             +G+     ++QLVI  +G +YWTSG+W+N  F+  P ++ E    F F   +++   Y++
Sbjct  961   IGVSEEARSSQLVIWWKGSIYWTSGMWQNDHFKLLPRLSNEGNRNFSFTANNDDILYYYT  1020

Query  701   Y--SAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNY  528
             Y  S   N+  +++ +D  G I +   I  P+ F             A + + D      
Sbjct  1021  YALSESENHSLSRYMIDSSGSILE---IGGPAPF------------GACSYKFD------  1059

Query  527   PRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCS  348
               P C+++    CR  +D F   +G+            N      L+L DC   C  NCS
Sbjct  1060  --PGCVEQTLPLCRSKNDWFEAKKGFMSAQGLKFDRSYN------LSLFDCQEKCLNNCS  1111

Query  347   CTAYASSSTDGTGCILY-TNAAHDFQLDENGELYIYRLLK  231
             CTAYA S+++ T C ++        + DE   +Y+  + K
Sbjct  1112  CTAYAYSNSNLTACEIWGQGVVFTEKYDETRVIYVLNIAK  1151



>ref|XP_009126255.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g67520 [Brassica rapa]
Length=402

 Score =   240 bits (612),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 155/381 (41%), Positives = 214/381 (56%), Gaps = 27/381 (7%)
 Frame = -2

Query  1388  ESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTED-RYLGIWYNKIPNEPVW  1212
             ++DTL  G  +RDWE L S+  +F LGFF+ ++S +  + +   RY+GIWY   P  PVW
Sbjct  27    KTDTLKPGQQLRDWEQLISSGGVFTLGFFTPTESSTFLLGSAGVRYIGIWYQYGPINPVW  86

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
             V N    + DSSGSL ID +G LKI+       + N  +    NV ATLLDSGN V+R++
Sbjct  87    VGNPTESVSDSSGSLSIDTNGNLKITRANASPIMVNQHLSLAGNVSATLLDSGNFVIRDM  146

Query  1031  DGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDIN  852
                G  G VLWQSFD+PT +L+PGMK+G NLKT     +TSW S++VP SGAF LGLD +
Sbjct  147   GRGGVPGRVLWQSFDHPTSMLLPGMKIGFNLKTKKEISVTSWTSNQVPASGAFRLGLDPS  206

Query  851   GCNNQLVISRRGKVYWTSGVW-KNGSFEKAPDMTKE---FGFKLVSNEKEKYFSYSAK--  690
             G   QL++ R G++YW+SGV   NGS +   ++++E   + FK  S++  KYFSYS K  
Sbjct  207   GA-KQLLVWRHGEIYWSSGVLTNNGSSQLTLELSREYLDYEFKFGSDKYMKYFSYSIKKT  265

Query  689   HNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCL  510
             +   ++ W LD LG I  ++++   +          WI    S+  C   + N    VC+
Sbjct  266   NGSVYSNWLLDNLGQITVTNVLRSNT-------SNRWISE--SSQPCTTDLKN-SSAVCI  315

Query  509   KENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYAS  330
              E P +CRK S+ F   RGY              G+     LSDCH  CW+NCSC A+ S
Sbjct  316   TEKPTACRKGSEYFEPRRGYMTGSGY-------YGDSLSFGLSDCHGSCWRNCSCIAFQS  368

Query  329   SSTDGTGCILYTNAAHDFQLD  267
              S DG  C  +   +  F  D
Sbjct  369   FS-DGQ-CQYWGKGSKFFPYD  387



>ref|XP_003632790.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 [Vitis vinifera]
Length=789

 Score =   246 bits (627),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 149/399 (37%), Positives = 214/399 (54%), Gaps = 67/399 (17%)
 Frame = -2

Query  1382  DTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVWVAN  1203
             DTL+QG  +RDWE L SA   F LGFF+   S       ++RYLGIWY       VWVAN
Sbjct  28    DTLLQGKPLRDWERLVSANYAFTLGFFTQGSS-------DNRYLGIWYTSFEVRRVWVAN  80

Query  1202  RDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREVDGN  1023
             R+ P+PD+SG+L+ID   KLKI+Y GG I VSN S ++ +N  A L D+GN ++RE   +
Sbjct  81    RNDPVPDTSGNLMIDHAWKLKITYNGGFIAVSNYSQIA-SNTSAILQDNGNFILREHMSD  139

Query  1022  GSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDINGCN  843
             G+   VLWQSFDYPTD L+PGMKLG+NL+TGH W LTSWL++++P +G F  G D    N
Sbjct  140   GT-TRVLWQSFDYPTDTLLPGMKLGINLRTGHQWSLTSWLTNQIPATGYFSFGADFRN-N  197

Query  842   NQLVISRRGKVYWTSGVWKNG---------SFEKAPDMTKEFGFKLVSNEKEKYFSYSAK  690
             +QL+   RGK+YWTSG W NG         S  +       +GF+ +SN+KE YFS+   
Sbjct  198   SQLITWWRGKIYWTSGFWHNGNLSFDNLRASLPQKDHWNDGYGFRYMSNKKEMYFSFHPN  257

Query  689   HNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCL  510
              +  F               L+  PS  +  + + T++        C+ +I    R  C+
Sbjct  258   ESVFF-------------PMLVLLPSGVLKSL-LRTYV-------HCESHI---ERQGCV  293

Query  509   KENPVSCRKSSDV--------FVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKN  354
             K +   CR  +          +V + G+  DDN                  DCH  CW N
Sbjct  294   KPDLPKCRNPASQRFQYTDGGYVVSEGFMFDDNA--------------TSVDCHFRCWNN  339

Query  353   CSCTAYASSSTDGTGCILYTN-AAHDFQLDENGELYIYR  240
             CSC A++    + T C++++      + + E+ ++Y+ +
Sbjct  340   CSCVAFSLHLAE-TRCVIWSRIQPRKYFVGESQQIYVLQ  377



>emb|CDY02627.1| BnaC02g08080D [Brassica napus]
Length=404

 Score =   234 bits (598),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 158/392 (40%), Positives = 215/392 (55%), Gaps = 28/392 (7%)
 Frame = -2

Query  1388  ESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTED-RYLGIWYNKIPNEPVW  1212
             ++DTL  G  +RDWE L S+  +F LGFF+ ++S +  + +   RY+GIW    P  PVW
Sbjct  29    KTDTLKPGQQLRDWEQLISSGGVFTLGFFTPTESSTFLLGSAGVRYIGIWSQHGPINPVW  88

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
             V N    + DSSGSL ID +G LKI+       + N  +    NV ATLLDSGN VVR++
Sbjct  89    VGNPTESVSDSSGSLSIDTNGNLKITRANASPIMVNQHLSLAGNVSATLLDSGNFVVRDI  148

Query  1031  DGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDIN  852
                G  G VLWQSFD+PT +L+PGMK+G +LKT     +TSW S+ VP SGAF LGLD +
Sbjct  149   GPGGVPGRVLWQSFDHPTSILLPGMKIGFSLKTKKEISVTSWTSNLVPASGAFRLGLDPS  208

Query  851   GCNNQLVISRRGKVYWTSGVW-KNGSFEKAPDMTKE---FGFKLVSNEKEKYFSYSAK--  690
             G  NQL++ R   +YW+SGV   NGS +   ++++E   + FK  S++  KYFSYS K  
Sbjct  209   GV-NQLLVWRHDDIYWSSGVLTNNGSSQLTLELSREYLDYEFKFGSDKYMKYFSYSIKKT  267

Query  689   HNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCL  510
             +   ++ W+LD LG I  ++++   +          WI    S+  C   + N    VC+
Sbjct  268   NGSVYSSWSLDTLGQITVTNVLRSNT-------SNRWISE--SSQPCTTDLKN-SSAVCI  317

Query  509   KENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYAS  330
              E P +CRK S+ F   RGY              G      LSDCH  CW+NCSC A+ S
Sbjct  318   TEKPTACRKGSEYFEPRRGYMTGSGYY-------GYSLSFGLSDCHGSCWRNCSCIAFQS  370

Query  329   SSTDGTGCILYTNAAHDFQLDE-NGELYIYRL  237
              S DG  C  +   +  F  D    E  IY L
Sbjct  371   FS-DGQ-CQYWGKGSKFFPYDSFTFEQKIYVL  400



>ref|XP_010454090.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g67520 [Camelina sativa]
Length=414

 Score =   234 bits (598),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 153/372 (41%), Positives = 217/372 (58%), Gaps = 29/372 (8%)
 Frame = -2

Query  1388  ESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTED-RYLGIWYNKIPNEPVW  1212
             ++DTL  G  +RDWE L SA  IF LGFF+  +S +  + +   RYLGIW  + P  PVW
Sbjct  29    KTDTLEPGQQLRDWEQLMSAGGIFTLGFFTPKESSTFELGSAGLRYLGIWPQRSPFNPVW  88

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSG----NNVGATLLDSGNLV  1044
             V N    + DSSGSL ID +G LKI+       + N  +        NV ATLLDSGN V
Sbjct  89    VGNPTESISDSSGSLSIDVNGVLKITQANAFPILVNQRLAGQLSLVGNVSATLLDSGNFV  148

Query  1043  VREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELG  864
             VRE+   G  G VLWQSFD+PT+ L+PGMK+G NL+T     +TSW+SD+VP  GAF LG
Sbjct  149   VREIGPRGVSGRVLWQSFDHPTNTLLPGMKIGFNLRTKKEVSVTSWISDQVPLPGAFRLG  208

Query  863   LDINGCNNQLVISRRGKVYWTSGVW-KNGSFEKAPDMTK---EFGFKLVSNEKEKYFSYS  696
             LD +G  NQL++ R G++YW+SG+   NGS     ++++   ++ FK  S++  KYFSYS
Sbjct  209   LDPSGA-NQLLVWRHGEIYWSSGILTNNGSSHLTLELSRSYIDYEFKFDSDKYMKYFSYS  267

Query  695   AK--HNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPR  522
              K  ++   + W LD LG I  ++++   +   +Y+          S+  C   + N   
Sbjct  268   IKKANSSVLSSWFLDTLGQITVTNVL-SSNKSTNYIS--------ESSEPCKTDLKN-SS  317

Query  521   PVCLKENPVSCRKSSDVFVQTRGYFRDDNR---NISDVENSGNGSRLALSDCHSICWKNC  351
              VC+ E P +CRK S+ F   RGY  ++ +   N   V++  +G    LSDCH  CW+NC
Sbjct  318   AVCITEKPTACRKGSEYFEPRRGYMMENKKGYFNSYYVDSLSSG----LSDCHQNCWRNC  373

Query  350   SCTAYASSSTDG  315
             SC A+ + S++G
Sbjct  374   SCIAFQAFSSNG  385



>ref|XP_010420610.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g67520 [Camelina sativa]
Length=414

 Score =   234 bits (596),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 154/372 (41%), Positives = 214/372 (58%), Gaps = 29/372 (8%)
 Frame = -2

Query  1388  ESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTED-RYLGIWYNKIPNEPVW  1212
             + DTL  G  +RDWE L SA  IF LGFF+  +S +  + +   RYLGIW    P  PVW
Sbjct  29    KPDTLEPGQQLRDWEQLISAGGIFTLGFFTPKESTTFELGSAGLRYLGIWPQMSPFNPVW  88

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSG----NNVGATLLDSGNLV  1044
             V N    + DSSGSL ID +G LKI+       + N  +        NV ATLLDSGN V
Sbjct  89    VGNPTESISDSSGSLSIDVNGVLKITQANAFPILVNQRLAGQLSLVGNVSATLLDSGNFV  148

Query  1043  VREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELG  864
             VRE+   G  G VLWQSFD+PT+ L+PGMK+G NL+T     +TSW+SD+VP  GAF LG
Sbjct  149   VREIGPRGVSGRVLWQSFDHPTNTLLPGMKIGFNLRTKKEVSVTSWISDQVPLPGAFRLG  208

Query  863   LDINGCNNQLVISRRGKVYWTSGVW-KNGSFEKAPDMTK---EFGFKLVSNEKEKYFSYS  696
             LD +G  NQL++ R G++YW+SG+   NGS     ++++   ++ FK  S++  KYFSYS
Sbjct  209   LDPSGA-NQLLVWRHGEIYWSSGILTNNGSSHLTLELSRSYIDYEFKFDSDKYMKYFSYS  267

Query  695   AK--HNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPR  522
              K  ++   + W LD LG I  ++++             T+I    S+  C   + N   
Sbjct  268   IKKANSSVLSSWFLDTLGQITVTNVLSSNK-------STTYISE--SSEPCKTDLKN-SS  317

Query  521   PVCLKENPVSCRKSSDVFVQTRGYFRDDNR---NISDVENSGNGSRLALSDCHSICWKNC  351
              VC+ E P +CRK S+ F   RGY  ++ +   N   V++  +G    LSDCH  CW+NC
Sbjct  318   AVCITEKPTACRKGSEYFEPRRGYMMENKKGYFNSYYVDSLSSG----LSDCHQNCWRNC  373

Query  350   SCTAYASSSTDG  315
             SC A+ + S++G
Sbjct  374   SCIAFQAFSSNG  385



>emb|CDY58115.1| BnaA02g35160D [Brassica napus]
Length=405

 Score =   233 bits (593),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 153/382 (40%), Positives = 214/382 (56%), Gaps = 28/382 (7%)
 Frame = -2

Query  1388  ESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTED-RYLGIWYNKIPNEPVW  1212
             ++DTL  G  +RDWE L S+  +F LGFF+ ++S +  + +   RY+GIWY   P  PVW
Sbjct  29    KTDTLKPGQQLRDWEQLISSGGVFTLGFFTPTESSTFLLGSAGVRYIGIWYQYGPINPVW  88

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMS-GNNVGATLLDSGNLVVRE  1035
             V N    + DSSGSL ID +G LKI+       + N   +S   NV ATLL SGN V+R+
Sbjct  89    VGNPTESVSDSSGSLSIDTNGNLKITRANASPIMLNQQHLSLAGNVSATLLYSGNFVIRD  148

Query  1034  VDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDI  855
             +   G  G V+WQSFD+PT+VL+PGMK+G NL+T     +TSW S++VP SGAF LGLD 
Sbjct  149   IGPRGVPGRVIWQSFDHPTNVLLPGMKIGFNLRTKKEVSVTSWTSNQVPASGAFRLGLDP  208

Query  854   NGCNNQLVISRRGKVYWTSGVW-KNGSFEKAPDMTKE---FGFKLVSNEKEKYFSYSAKH  687
             +G  NQL++ R G++YW+SGV   NGS +   ++++E   + FK  S++  KYFSYS K 
Sbjct  209   SGV-NQLLVWRHGEIYWSSGVLTNNGSSQLTLELSREYLDYEFKFGSDKYMKYFSYSIKK  267

Query  686   NYRF--TKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVC  513
                   + W LD LG I  ++++   +          WI    S+  C   + N    +C
Sbjct  268   TNGSVDSSWLLDNLGQITVTNVLRSNT-------SNRWISE--SSQPCTTDLKN-SSAIC  317

Query  512   LKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYA  333
             + E P +CRK S+ F   RGY              G+     +SDCH  CW+NCSC A+ 
Sbjct  318   ITEKPTACRKGSEYFEPRRGYMTGSGY-------YGDSLSFGISDCHGSCWRNCSCIAFQ  370

Query  332   SSSTDGTGCILYTNAAHDFQLD  267
             S S DG  C  +   +  F  D
Sbjct  371   SFS-DGQ-CQYWGKGSKFFPYD  390



>ref|XP_010666173.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g67520 [Beta vulgaris subsp. vulgaris]
Length=856

 Score =   240 bits (613),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 155/405 (38%), Positives = 217/405 (54%), Gaps = 23/405 (6%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDS----YSGPINTEDRYLGIWYN  1236
             +S  AE+DTL Q   ++  E L SA  +F LGFF++       Y  P N +  Y+GIWY 
Sbjct  21    ISSYAETDTLKQSDQLKYGEFLVSAGKVFTLGFFNLQKEQEIGYFNPENAQICYIGIWYT  80

Query  1235  -KIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLD  1059
                  +PVW+ANR+ P+  +SG L ID++G  KI   G    +   S      V A L D
Sbjct  81    YDQSKKPVWIANRNKPISKTSGVLKIDSNGDFKIIDKGLTRMILKSSEGVARRV-AMLQD  139

Query  1058  SGNLVVREVDGNGSF-GGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGS  882
             +GN V++E++ N S    VLWQSFDYPTD L+ GM+LG N+K G  W LTS +SDK P  
Sbjct  140   TGNFVLQELNSNNSTRDKVLWQSFDYPTDTLLLGMRLGFNIKNGQKWSLTSRVSDKFPAP  199

Query  881   GAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFS  702
             G+F LGLD NG  +QL+I RRG++ W SG+WKNG F    D   +F +  VSN+ E+YF+
Sbjct  200   GSFSLGLDPNG-TSQLIIWRRGEIQWKSGIWKNGKFPNLRDFLYKFDY--VSNDDERYFT  256

Query  701   YSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPR  522
              SA+  +++   +  +   I+    +          P Y    R  +TL       ++P 
Sbjct  257   LSAESTWQWRYISFPMY-QIDHKGAVLHFQSSTSSRPQYLRSERSENTLTTVVDCKSFPY  315

Query  521   PVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSR-LALSDCHSICWKNCSC  345
             P CL+     CR +S  F  +RGY       +S+    G G++ L ++DC   C KNC C
Sbjct  316   PGCLEPKLPRCRNNS-FFYSSRGY------ALSEGLQYGKGNQILGMADCEDKCLKNCFC  368

Query  344   TAYASSSTDGTGCILYTNAAHDFQ----LDENGELYIYRLLKEHK  222
              AYAS   +GTGC L++N     Q         ELYI +   E+K
Sbjct  369   VAYASIYPNGTGCELWSNLTQLVQDPYPYVSQRELYIQQEYGENK  413



>gb|KDO56873.1| hypothetical protein CISIN_1g0393451mg, partial [Citrus sinensis]
Length=405

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 150/407 (37%), Positives = 215/407 (53%), Gaps = 61/407 (15%)
 Frame = -2

Query  1388  ESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWY----------  1239
             ++D L+ G  ++D + L SA   F++GFFS       P  +E+RYLG+WY          
Sbjct  7     QTDKLLPGQLLKDGDELVSAFGNFRMGFFS-------PDGSENRYLGVWYYRPTDPSVLG  59

Query  1238  --NKIPNEPVWVANRDSPLPDSSGSLIIDA-DGKLKISYVGGMITVSNVSIMSGNNVGAT  1068
               N   N+PVWVANR++P+ D SGSL ID+ DG LKI   GG   V   S+ +  N  AT
Sbjct  60    GYNSKRNKPVWVANRNNPILDKSGSLAIDSNDGNLKILLNGGNPIVI-TSVKAEGNTSAT  118

Query  1067  LLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVP  888
             LL +GNLV+ E++ +GS    LWQSFDYPTD L+PGMKLG+NL+TGH W L SW+SD  P
Sbjct  119   LLKTGNLVLYEMNSDGSERRELWQSFDYPTDTLLPGMKLGINLQTGHEWFLQSWISDISP  178

Query  887   GSGAFELGLDINGCNNQLVISRRGKV-YWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEK  711
               G++ LG+D N  +NQL+I  RG + YWT G+W NG F+    ++  + F   SNE EK
Sbjct  179   AQGSYTLGIDPN-VSNQLIIRWRGDIIYWTKGIWLNGEFDFLGLVSDGYNFSYASNEHEK  237

Query  710   YFSYSAKH---NYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPY  540
             YF+YSA     ++   + T D L        +++                    ++C   
Sbjct  238   YFNYSASETITSFPELRLTADGLRGALSVPCLHE--------------------IQCVSV  277

Query  539   IGNYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICW  360
               N  RP         CRK    F    G+   D     + +N      + LSDC   C+
Sbjct  278   SVNVKRP--------RCRKDFSKFEYKYGFMNGDGFKFKESDN------MTLSDCEVKCF  323

Query  359   KNCSCTAYAS-SSTDGTGCILYTNAAHDFQLDENGELYIYRLLKEHK  222
             +NCSC AYAS ++++ TGC ++++     +     +  I  + +E K
Sbjct  324   QNCSCVAYASINASNDTGCEIWSSGTKFTETSFTDDHRIIFMAREPK  370



>emb|CDX70821.1| BnaC03g09050D [Brassica napus]
Length=406

 Score =   230 bits (586),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 142/362 (39%), Positives = 201/362 (56%), Gaps = 30/362 (8%)
 Frame = -2

Query  1388  ESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTED-RYLGIWYNKIPNEPVW  1212
             ++DTL  G  +RDWE L SA   F L FF+  +S +  + +   RY+GIW     ++PVW
Sbjct  27    KTDTLKPGQQLRDWEQLISAGEAFTLRFFTPRESSTFLLGSAGLRYIGIWSQ---SDPVW  83

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
             V N   P+ DSSGSL ID +G LKI+       + +  +    NV ATLLDSGN V+R+ 
Sbjct  84    VGNPTEPVSDSSGSLSIDTNGALKITRANASPIMVSPHLSLAGNVSATLLDSGNFVIRDT  143

Query  1031  DGNGSFGG-VLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDI  855
                G   G VLWQSFD+PT++L+PGMK+G NLKT     +TSW S++VP  GAF LGLD 
Sbjct  144   GRGGRGPGRVLWQSFDHPTNILLPGMKIGFNLKTKKEISVTSWTSNQVPTPGAFRLGLDP  203

Query  854   NGCNNQLVISRRGKVYWTSGVW-KNGSFEKAPDMTKEFG----FKLVSNEKEKYFSYSAK  690
             +G N QL++ R G++YW+SG+   NGS +   ++++ +     FK  S+++  YFSYS K
Sbjct  204   SGAN-QLLVWRHGEIYWSSGILTNNGSSQLTLELSRRYNIDYEFKFHSDKRMNYFSYSVK  262

Query  689   HNY--RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPV  516
                    + W LD LG I  ++          +       G   S+  C   + +    +
Sbjct  263   KTKGSVSSSWFLDTLGQITVTN---------SFRSSTCAGGTSESSGPCKKDLKS-SSAI  312

Query  515   CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAY  336
             C+ E P +CRK S+ F   RGY  D+          G+G    +SDCH  CW+NCSC A+
Sbjct  313   CIAEKPTACRKGSEYFEPRRGYMMDN-------AYYGDGLSSGISDCHGSCWRNCSCIAF  365

Query  335   AS  330
              S
Sbjct  366   QS  367



>ref|XP_009131670.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g67520 [Brassica rapa]
Length=405

 Score =   229 bits (584),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 141/364 (39%), Positives = 201/364 (55%), Gaps = 32/364 (9%)
 Frame = -2

Query  1388  ESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTED--RYLGIWYNKIPNEPV  1215
             ++DTL  G  +RDWE L SA   F L FF+  +S +  + +    RY+ IW      +PV
Sbjct  27    KTDTLKPGQQLRDWEQLISAGEAFTLRFFTPRESSTFLLGSGAGLRYICIWSQ---TDPV  83

Query  1214  WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVRE  1035
             WV N   P+ DSSGSL ID +G LKI+       + +  +    NV ATLLDSGN V+R+
Sbjct  84    WVGNPTEPVSDSSGSLSIDTNGALKITRANASPIMVSPHLSLAGNVSATLLDSGNFVIRD  143

Query  1034  VDGNGSFGG--VLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGL  861
                 G  G   +LWQSFD+PT++L+PGMK+G NLKT     +TSW S++VP  GAF LGL
Sbjct  144   AGRGGGGGPGRILWQSFDHPTNILLPGMKIGFNLKTKKEISVTSWTSNQVPTPGAFRLGL  203

Query  860   DINGCNNQLVISRRGKVYWTSGVW-KNGSFEKAPDMTKEFG----FKLVSNEKEKYFSYS  696
             D +G  NQL++ R G++YW+SG+   NGS + A ++++ +     FK  S+++  YFSYS
Sbjct  204   DPSGA-NQLLVWRHGEIYWSSGILTNNGSSQLALELSRRYNIDYEFKFHSDKRMNYFSYS  262

Query  695   AKHNY--RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPR  522
              K       + W LD LG I  ++          +       G   S+  C  Y+ +   
Sbjct  263   VKKTKGSVSSSWFLDTLGQITVTT---------SFRSNTCAGGTSESSGPCKKYLKS-SS  312

Query  521   PVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCT  342
              +C+ E P +CRK ++ F   RGY  D+          G+G    +SDCH  CW+NCSC 
Sbjct  313   AICIAEKPTACRKGTEYFEPRRGYMMDN-------AYYGDGLSSGISDCHGSCWRNCSCI  365

Query  341   AYAS  330
             A+ S
Sbjct  366   AFQS  369



>ref|XP_006426982.1| hypothetical protein CICLE_v10025426mg [Citrus clementina]
 ref|XP_006426983.1| hypothetical protein CICLE_v10025426mg [Citrus clementina]
 ref|XP_006426984.1| hypothetical protein CICLE_v10025426mg [Citrus clementina]
 gb|ESR40222.1| hypothetical protein CICLE_v10025426mg [Citrus clementina]
 gb|ESR40223.1| hypothetical protein CICLE_v10025426mg [Citrus clementina]
 gb|ESR40224.1| hypothetical protein CICLE_v10025426mg [Citrus clementina]
Length=504

 Score =   231 bits (590),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 150/407 (37%), Positives = 219/407 (54%), Gaps = 58/407 (14%)
 Frame = -2

Query  1388  ESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWY----------  1239
             ++D L+ G  ++D + L SA   F++GFFS       P  +E+R+LG+WY          
Sbjct  55    QTDKLLPGQLLKDGDELVSAFGNFRMGFFS-------PDGSENRHLGVWYYRPTDPSVLG  107

Query  1238  --NKIPNEPVWVANRDSPLPDSSGSLIIDA-DGKLKISYVGGMITVSNVSIMSGNNVGAT  1068
               N   N+PVWVANR++P+ D SGSL ID+ DG LKI   GG   V   S+ +  N  AT
Sbjct  108   GYNSKRNKPVWVANRNNPILDKSGSLAIDSNDGNLKILLNGGNPIVI-TSVKAEGNTSAT  166

Query  1067  LLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVP  888
             LL +GNLV+ E++ +GS    LWQSFDYPTD L+PGMKLG+NL+TGH W L SW+SD  P
Sbjct  167   LLKTGNLVLYEMNSDGSERRELWQSFDYPTDTLLPGMKLGINLQTGHEWFLQSWISDISP  226

Query  887   GSGAFELGLDINGCNNQLVISRRGKV-YWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEK  711
               G++ LG+D N  +NQL+I  RG + YWT G+W NG F+    ++  + F   SNE EK
Sbjct  227   AQGSYTLGIDPN-VSNQLIIRWRGDIIYWTKGIWLNGEFDFLGLVSDGYNFSYASNEHEK  285

Query  710   YFSYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGN  531
             YF+YSA         T+     +  ++     +  +H +            ++C     N
Sbjct  286   YFNYSASE-------TITSFPELRLTADGLRGALSVHCL----------HEIQCVSVSVN  328

Query  530   YPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNC  351
               RP         CRK    F    G+   D     + +N      + LSDC   C++NC
Sbjct  329   VKRP--------RCRKDFSKFEYKYGFMNGDGFKFKESDN------MTLSDCEVKCFQNC  374

Query  350   SCTAYAS-SSTDGTGCILYTNAAHDFQ---LDENGELYIYRLLKEHK  222
             SC AYAS ++++ TGC ++++     +    D++  +++ R  KE K
Sbjct  375   SCVAYASINASNDTGCEIWSSGTKFTETSFTDDHRIIFMAREPKEKK  421



>ref|XP_009773566.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X2 [Nicotiana sylvestris]
Length=706

 Score =   235 bits (600),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 148/386 (38%), Positives = 205/386 (53%), Gaps = 67/386 (17%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN----  1224
             A+   + +  N+ D++ L S   +FK+ FFS       P  + +RYLGI+    P+    
Sbjct  22    ADLAEISKEQNLTDYQQLFSESRLFKMEFFS-------PGKSRNRYLGIFARPSPDMYSD  74

Query  1223  -------EPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATL  1065
                    + VW+ANRD PL D+S SL+ID DG+L IS+  G + + + +  +  N+ A L
Sbjct  75    VIEGGDEKAVWIANRDDPLTDTSASLMIDRDGRLMISHSEGTVILLSATPTAATNLTAIL  134

Query  1064  LDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPG  885
             LD+GN V+R++  NGS    LWQSFDYPTD L+PGMKLG+NL+TGH W LTSW +++ P 
Sbjct  135   LDNGNFVLRDLYFNGSGHRTLWQSFDYPTDTLLPGMKLGINLRTGHNWSLTSWATEQAPA  194

Query  884   SGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYF  705
             SG+F  GLD NG  NQL+I   GKVYW SG   NG           FGFK VSN  EKYF
Sbjct  195   SGSFTFGLDPNG-TNQLIILWMGKVYWKSGPLPNG----------HFGFKYVSNADEKYF  243

Query  704   SYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGN--  531
              Y+A HN  + ++T+   G I+                            E +   GN  
Sbjct  244   MYTA-HNSVYGRYTVSPSGSIQDG-------------------------FERNKVFGNCI  277

Query  530   --YPRPVCLKENPVSCRKSSDVFVQTRG-YFRDDNRNISDVENSGNGSRLALSDCHSICW  360
                P   C+K+    CR +   + + R  Y   D+  I +         L+LSDC + C 
Sbjct  278   DGIPDAGCVKQVLPQCRTAKKYWFELRQVYMFGDSFKIEE------NYTLSLSDCKAKCE  331

Query  359   KNCSCTAYAS-SSTDGTGCILYTNAA  285
              +CSC AYAS  S DGTGC ++ N++
Sbjct  332   NDCSCVAYASVDSNDGTGCQIWGNSS  357



>ref|XP_004304502.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101-like [Fragaria vesca subsp. vesca]
Length=786

 Score =   236 bits (603),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 154/390 (39%), Positives = 205/390 (53%), Gaps = 39/390 (10%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVW  1212
             ++SDTL QG  ++D   L SA  IF+LGFF        P +  + YLGIWYN+   + VW
Sbjct  27    SQSDTLAQGQELKDGMQLFSASGIFRLGFFK-------PGDVSNSYLGIWYNRNNEKAVW  79

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMIT-VSNVSIMSGNNVGATLLDSGNLVVRE  1035
             VANRD+P+ +S+G L ID  G LKIS    M+  +   S++   N  A LLDSGN V+ E
Sbjct  80    VANRDNPILNSTGVLRIDQYGNLKISQ--KMVDDIVLYSVIKAINTSAVLLDSGNFVLSE  137

Query  1034  VDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDI  855
             ++ +GS    LWQSFDYPTD L+P MKLG N KTG  W L SW +  +P  G+F LGLD 
Sbjct  138   LNPDGSIKQELWQSFDYPTDTLLPEMKLGFNSKTGLNWTLKSWRTGDLPSIGSFTLGLDP  197

Query  854   NGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTK--EFGFKLVSNEKEKYFSYSA-KHN  684
             +G   Q+VIS RG +YWTSG W    F    +     +F F  +SNE E Y SYS  K  
Sbjct  198   SGVK-QMVISWRGNLYWTSGSWHTWCFSLTDEFCSNYKFNFSYISNENETYLSYSVDKGT  256

Query  683   YRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKE  504
               F +  L   G  E      D  F               + + C     +  +  C+++
Sbjct  257   TIFPRLLLSEEG--ELRGFGTDAMF---------------TGVSCTSSTNSTLKRGCVEQ  299

Query  503   NPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSS  324
                 CRKS++ FV   G        I + EN      L L DC  +C+K CSC AYAS++
Sbjct  300   RLPDCRKSNNKFVSKLGVMSSSGIKIPENEN------LTLIDCWDVCFKMCSCLAYASAN  353

Query  323   TDGTGCILYTNAAHDFQLDENG--ELYIYR  240
              DGTGC ++   A   Q +  G  E+YI +
Sbjct  354   DDGTGCEIWKKGASFTQYNLGGLREIYILK  383



>ref|XP_009773565.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X1 [Nicotiana sylvestris]
Length=778

 Score =   236 bits (601),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 148/386 (38%), Positives = 205/386 (53%), Gaps = 67/386 (17%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN----  1224
             A+   + +  N+ D++ L S   +FK+ FFS       P  + +RYLGI+    P+    
Sbjct  22    ADLAEISKEQNLTDYQQLFSESRLFKMEFFS-------PGKSRNRYLGIFARPSPDMYSD  74

Query  1223  -------EPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATL  1065
                    + VW+ANRD PL D+S SL+ID DG+L IS+  G + + + +  +  N+ A L
Sbjct  75    VIEGGDEKAVWIANRDDPLTDTSASLMIDRDGRLMISHSEGTVILLSATPTAATNLTAIL  134

Query  1064  LDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPG  885
             LD+GN V+R++  NGS    LWQSFDYPTD L+PGMKLG+NL+TGH W LTSW +++ P 
Sbjct  135   LDNGNFVLRDLYFNGSGHRTLWQSFDYPTDTLLPGMKLGINLRTGHNWSLTSWATEQAPA  194

Query  884   SGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYF  705
             SG+F  GLD NG  NQL+I   GKVYW SG   NG           FGFK VSN  EKYF
Sbjct  195   SGSFTFGLDPNG-TNQLIILWMGKVYWKSGPLPNG----------HFGFKYVSNADEKYF  243

Query  704   SYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGN--  531
              Y+A HN  + ++T+   G I+                            E +   GN  
Sbjct  244   MYTA-HNSVYGRYTVSPSGSIQDG-------------------------FERNKVFGNCI  277

Query  530   --YPRPVCLKENPVSCRKSSDVFVQTRG-YFRDDNRNISDVENSGNGSRLALSDCHSICW  360
                P   C+K+    CR +   + + R  Y   D+  I +         L+LSDC + C 
Sbjct  278   DGIPDAGCVKQVLPQCRTAKKYWFELRQVYMFGDSFKIEE------NYTLSLSDCKAKCE  331

Query  359   KNCSCTAYAS-SSTDGTGCILYTNAA  285
              +CSC AYAS  S DGTGC ++ N++
Sbjct  332   NDCSCVAYASVDSNDGTGCQIWGNSS  357



>emb|CBI18329.3| unnamed protein product [Vitis vinifera]
Length=711

 Score =   234 bits (598),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 159/392 (41%), Positives = 207/392 (53%), Gaps = 51/392 (13%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHL-TSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIP-NEP  1218
             A++DT+  G  ++  E L  SAK  F LGFFS+             YLGIWY     ++ 
Sbjct  40    AQTDTIKPGEELQFSEKLLVSAKGTFTLGFFSLESG---------SYLGIWYTTDDYHKK  90

Query  1217  VWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVR  1038
             VWVANRD  +  +  +L +DADGKL I++ GG   V N S  +  N  ATLLDSGN V++
Sbjct  91    VWVANRDKAISGTDANLTLDADGKLMITHSGGDPIVLN-SNQAARNSTATLLDSGNFVLK  149

Query  1037  EVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLD  858
             E + +GS    LW+SFD PTD L+PGMKLG+NLKTG  W L SW+S++VP  G F   L+
Sbjct  150   EFNSDGSVKEKLWESFDNPTDTLLPGMKLGINLKTGRNWSLASWISEQVPAPGTFT--LE  207

Query  857   INGCNNQLVISRRGKVYWTSGVWKNGSFE-----KAPD-MTKEFGFKLVSNEKEKYFSYS  696
              NG   QLV+ RRG  YW+SG  K+ SFE      +PD     + F  VSN  E YFSYS
Sbjct  208   WNG--TQLVMKRRGGTYWSSGTLKDRSFEFITWLMSPDTFNNIYSFNSVSNANEIYFSYS  265

Query  695   AKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPV  516
                    ++W L   G +  +S    P F +  +              CD Y      P 
Sbjct  266   VPDGV-VSEWVLTSEGGLFDTS---RPVFVLDDL--------------CDRY---EEYPG  304

Query  515   CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAY  336
             C  +NP +CR   D F++          +I +       S L LSDC +ICW NCSCTAY
Sbjct  305   CAVQNPPTCRTRKDGFMKQSVLISGSPSSIKE------NSSLGLSDCQAICWNNCSCTAY  358

Query  335   ASSSTDGTGCILY-TNAAHDFQLDENG-ELYI  246
              S  T+GTGC  + T  A   + D N  ELY+
Sbjct  359   NSIYTNGTGCRFWSTKFAQALKDDANQEELYV  390



>ref|XP_002516064.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
 gb|EEF46484.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
Length=795

 Score =   234 bits (598),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 157/418 (38%), Positives = 218/418 (52%), Gaps = 34/418 (8%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNE-PV  1215
             +++ T++QG  ++  + L SA  +FKL F ++ +S      + D YLGIWYN I  + PV
Sbjct  26    SQTRTILQGGELKYDQELVSADGMFKLKFGTVGESGE----SSDSYLGIWYNYIEEKFPV  81

Query  1214  WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVRE  1035
             WVANRD+P+  +SG L +D+ G LKI    G   V      +  N  ATL D+GN ++RE
Sbjct  82    WVANRDTPIFGNSGILTVDSQGNLKILRDKGRSIVLYSVQKAIYNAIATLEDTGNFILRE  141

Query  1034  VDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDI  855
             ++ NGS   VLWQSFDYPTD  +PGMKLG+NLKTG  W + SW S + P  G F LG D 
Sbjct  142   LNSNGSIKQVLWQSFDYPTDTFLPGMKLGINLKTGQQWSVISWRSFESPARGTFVLGTDP  201

Query  854   NGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFSYSA-KHN  684
             +   NQLVI R+G +YW SG W  G F     ++    + F   S+E E YF YS  K N
Sbjct  202   DS-KNQLVIWRQGHIYWASGSWV-GQFSLLGGLSFNVLYNFSYFSDENESYFIYSINKAN  259

Query  683   YRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKE  504
               F + T++  G +    L YD    +  +  Y ++          P +G      CL++
Sbjct  260   SIFPRLTINAEG-VLIGFLKYDYHEEVKCITSYDYMS---------PTVG------CLEQ  303

Query  503   NPVSCRKSSDVFV--QTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYAS  330
             N  +CR  SD F+     GY   D    SD EN      L + DC   C KNCSC AYAS
Sbjct  304   NLPNCRSPSDAFLFKPRTGYMYSDGFKYSDSEN------LTMIDCKLNCLKNCSCIAYAS  357

Query  329   SSTDGTGCILYTNAAHDFQLDENGELYIYRLLKEHKG*ILVNVRYCCFTVIQVFCVFV  156
              + DGTGC ++ +A        +    IY   + +K  + V +      +I   C F+
Sbjct  358   KNEDGTGCEIWRSARSFIGSSSDDSRKIYIFDEVNKWWLPVTITLGGIFLIPALCAFL  415



>ref|XP_010652595.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g67520 [Vitis vinifera]
Length=789

 Score =   234 bits (597),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 159/392 (41%), Positives = 207/392 (53%), Gaps = 51/392 (13%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHL-TSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIP-NEP  1218
             A++DT+  G  ++  E L  SAK  F LGFFS+             YLGIWY     ++ 
Sbjct  30    AQTDTIKPGEELQFSEKLLVSAKGTFTLGFFSLESG---------SYLGIWYTTDDYHKK  80

Query  1217  VWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVR  1038
             VWVANRD  +  +  +L +DADGKL I++ GG   V N S  +  N  ATLLDSGN V++
Sbjct  81    VWVANRDKAISGTDANLTLDADGKLMITHSGGDPIVLN-SNQAARNSTATLLDSGNFVLK  139

Query  1037  EVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLD  858
             E + +GS    LW+SFD PTD L+PGMKLG+NLKTG  W L SW+S++VP  G F   L+
Sbjct  140   EFNSDGSVKEKLWESFDNPTDTLLPGMKLGINLKTGRNWSLASWISEQVPAPGTFT--LE  197

Query  857   INGCNNQLVISRRGKVYWTSGVWKNGSFE-----KAPD-MTKEFGFKLVSNEKEKYFSYS  696
              NG   QLV+ RRG  YW+SG  K+ SFE      +PD     + F  VSN  E YFSYS
Sbjct  198   WNG--TQLVMKRRGGTYWSSGTLKDRSFEFITWLMSPDTFNNIYSFNSVSNANEIYFSYS  255

Query  695   AKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPV  516
                    ++W L   G +  +S    P F +  +              CD Y      P 
Sbjct  256   VPDGV-VSEWVLTSEGGLFDTS---RPVFVLDDL--------------CDRY---EEYPG  294

Query  515   CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAY  336
             C  +NP +CR   D F++          +I +       S L LSDC +ICW NCSCTAY
Sbjct  295   CAVQNPPTCRTRKDGFMKQSVLISGSPSSIKE------NSSLGLSDCQAICWNNCSCTAY  348

Query  335   ASSSTDGTGCILY-TNAAHDFQLDENG-ELYI  246
              S  T+GTGC  + T  A   + D N  ELY+
Sbjct  349   NSIYTNGTGCRFWSTKFAQALKDDANQEELYV  380



>emb|CAN64778.1| hypothetical protein VITISV_043229 [Vitis vinifera]
Length=1091

 Score =   236 bits (602),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 160/392 (41%), Positives = 203/392 (52%), Gaps = 51/392 (13%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHL-TSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI-PNEP  1218
             A++DT+  G  ++  E L  SAK  F LGFFS+             YLGIWY     N+ 
Sbjct  30    AQTDTIKPGEELQFSEKLLVSAKGTFTLGFFSLESG---------SYLGIWYTTDDSNKK  80

Query  1217  VWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVR  1038
             VWVANRD P+  +  +L +DADGKL I + GG   V N S  +  N  ATLLDSGN V+ 
Sbjct  81    VWVANRDKPISGTDANLTLDADGKLMIMHGGGDPIVLN-SNQAARNSTATLLDSGNFVLE  139

Query  1037  EVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLD  858
             E + +GS    LW+SFD PTD L+PGMKLG+NLKTG  W L SW+  +VP +G F   L+
Sbjct  140   EFNSDGSVKEKLWESFDNPTDTLLPGMKLGINLKTGRSWSLASWIGKEVPAAGTFT--LE  197

Query  857   INGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE------FGFKLVSNEKEKYFSYS  696
              NG   QLVI RRG  YW+SG  K+ SFE  P +         + F  VSN  E YFSYS
Sbjct  198   WNG--TQLVIKRRGDTYWSSGTLKDRSFEFIPWLMSSDTFNNIYSFNSVSNANEIYFSYS  255

Query  695   AKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPV  516
                    +KW L   G +  +S    P F +  +              CD Y      P 
Sbjct  256   VPDGV-VSKWVLTSEGGLFDTS---RPVFVLDDL--------------CDSY---EEYPG  294

Query  515   CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAY  336
             C  +NP +CR   D F++          +I +       S L LSDC +ICW NCSC AY
Sbjct  295   CAVQNPPTCRTRKDGFMKQSVLISGSPSSIKE------NSSLGLSDCQAICWNNCSCPAY  348

Query  335   ASSSTDGTGCILY-TNAAHDFQLDENG-ELYI  246
              S  T+GTGC  + T  A   + D N  ELY+
Sbjct  349   NSIYTNGTGCRFWSTKFAQALKDDANQEELYV  380



>ref|XP_009146177.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X2 [Brassica rapa]
Length=860

 Score =   233 bits (593),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 147/391 (38%), Positives = 205/391 (52%), Gaps = 59/391 (15%)
 Frame = -2

Query  1385  SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYN----------  1236
             +DTL+QG  ++D + L SA  IFKL FFS         N+ + YLGIWYN          
Sbjct  25    TDTLLQGQYLKDGQELVSAFNIFKLKFFSFE-------NSSNLYLGIWYNDLYLNGNKQY  77

Query  1235  -KIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLD  1059
               I +  VW+ANR+SP+   SGSL +D+ G+LKIS       +   S  +  N    LLD
Sbjct  78    AHIQDRAVWIANRNSPISGRSGSLTVDSLGRLKISGGASKSLLEITSTETTGNTTLKLLD  137

Query  1058  SGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSG  879
             +GNL ++E+D +GS   ++W+SFDYPTD  +PGMKLG N+KTG  W+LTSWL D +P SG
Sbjct  138   TGNLQLQEMDSDGSVRRIVWESFDYPTDTFLPGMKLGFNVKTGKRWELTSWLGDTLPASG  197

Query  878   AFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSY  699
             +F  G+D N   N+L+I  RG +YW SG+W    F      + EF F  VS E E YF  
Sbjct  198   SFVFGMDAN-ITNRLIILWRGNMYWASGLWFKDRFSLEEFNSYEFVFSYVSTESEHYFML  256

Query  698   SAKHNYR---FTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPY-IGN  531
             S   +Y    F   T+D  G +  + L                  R  + + C P+ IG 
Sbjct  257   SVDRHYSDTVFPTITIDQKGILHINRL-----------------DREVTHVRCSPFTIGE  299

Query  530   YPRPVCLKENPVSCRKSS----DVFVQTRG-------YFRDDNRNISDVENSG-----NG  399
                  C +++P  C  +     D+    R        YFR+    +S   ++G      G
Sbjct  300   EVDNECYRKDPRMCLNAGCIVPDMLSGHRNCSPSGYTYFRE---TVSAFSSNGFVLNETG  356

Query  398   SRLALSDCHSICWKNCSCTAYASSSTDGTGC  306
              RL+ +DC ++C +NCSC AYAS++ DGTGC
Sbjct  357   GRLSSADCRAMCIQNCSCLAYASTNGDGTGC  387



>ref|XP_009146176.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X1 [Brassica rapa]
Length=883

 Score =   232 bits (592),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 147/391 (38%), Positives = 205/391 (52%), Gaps = 59/391 (15%)
 Frame = -2

Query  1385  SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYN----------  1236
             +DTL+QG  ++D + L SA  IFKL FFS         N+ + YLGIWYN          
Sbjct  25    TDTLLQGQYLKDGQELVSAFNIFKLKFFSFE-------NSSNLYLGIWYNDLYLNGNKQY  77

Query  1235  -KIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLD  1059
               I +  VW+ANR+SP+   SGSL +D+ G+LKIS       +   S  +  N    LLD
Sbjct  78    AHIQDRAVWIANRNSPISGRSGSLTVDSLGRLKISGGASKSLLEITSTETTGNTTLKLLD  137

Query  1058  SGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSG  879
             +GNL ++E+D +GS   ++W+SFDYPTD  +PGMKLG N+KTG  W+LTSWL D +P SG
Sbjct  138   TGNLQLQEMDSDGSVRRIVWESFDYPTDTFLPGMKLGFNVKTGKRWELTSWLGDTLPASG  197

Query  878   AFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSY  699
             +F  G+D N   N+L+I  RG +YW SG+W    F      + EF F  VS E E YF  
Sbjct  198   SFVFGMDAN-ITNRLIILWRGNMYWASGLWFKDRFSLEEFNSYEFVFSYVSTESEHYFML  256

Query  698   SAKHNYR---FTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPY-IGN  531
             S   +Y    F   T+D  G +  + L                  R  + + C P+ IG 
Sbjct  257   SVDRHYSDTVFPTITIDQKGILHINRL-----------------DREVTHVRCSPFTIGE  299

Query  530   YPRPVCLKENPVSCRKSS----DVFVQTRG-------YFRDDNRNISDVENSG-----NG  399
                  C +++P  C  +     D+    R        YFR+    +S   ++G      G
Sbjct  300   EVDNECYRKDPRMCLNAGCIVPDMLSGHRNCSPSGYTYFRE---TVSAFSSNGFVLNETG  356

Query  398   SRLALSDCHSICWKNCSCTAYASSSTDGTGC  306
              RL+ +DC ++C +NCSC AYAS++ DGTGC
Sbjct  357   GRLSSADCRAMCIQNCSCLAYASTNGDGTGC  387



>gb|KDO56870.1| hypothetical protein CISIN_1g036124mg [Citrus sinensis]
Length=429

 Score =   224 bits (570),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 149/405 (37%), Positives = 212/405 (52%), Gaps = 66/405 (16%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWY---------  1239
             +++D L++G +++D + L SA   F++GFFS       P  +E+RYLG+WY         
Sbjct  53    SQTDKLLRGQHLKDGDELVSAFGYFRMGFFS-------PDGSENRYLGVWYYRPTDPSVF  105

Query  1238  ---NKIPNEPVWVANRDSPLPDSSGSLIIDA-DGKLKISYVGGMITVSNVSIMSGNNVGA  1071
                N   N+PVWVANR++P+ D SGSL ID+ DG LKI + GG   V   S+ +  N  A
Sbjct  106   DYYNSERNKPVWVANRNNPILDKSGSLTIDSTDGNLKILHNGGNPIVI-TSVKADGNTSA  164

Query  1070  TLLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKV  891
             +LL +GNLV+ E++ +GS    LWQSFDYPTD L+PGMKLG+NL+TGH W L SW+SD  
Sbjct  165   SLLKTGNLVLYEMNSDGSERRELWQSFDYPTDTLLPGMKLGINLQTGHQWFLQSWISDFS  224

Query  890   PGSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEK  711
             P  G++ LG+D N   NQL+I  RG VYWTS +W  G F     ++  + F   S+E EK
Sbjct  225   PAQGSYTLGIDPN-VPNQLIIWWRGDVYWTSEIWPKGWFHSYSLVSDGYNFGYTSSEHEK  283

Query  710   YFSYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGN  531
             YF+YSA  N   T + +  L     S  +                  YA  +   P    
Sbjct  284   YFNYSA--NETITSFPVLRLTANGLSGAL------------------YADGIVKSP----  319

Query  530   YPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNC  351
                         SC K         G+   D     + +N      + LSDC   C++NC
Sbjct  320   ------------SCSKDFSYIEYKYGFMNGDGFKFKESDN------MTLSDCKVKCFQNC  361

Query  350   SCTAYAS-SSTDGTGCILYTNAAHDFQLDENGELYIYRLLKEHKG  219
             SC AYAS + ++ TGC ++++    F +    +  I  + +E KG
Sbjct  362   SCVAYASINESNDTGCEIWSSGTK-FTVTSITDRRIIFMAREAKG  405



>ref|XP_004236409.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 [Solanum lycopersicum]
Length=787

 Score =   231 bits (589),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 142/380 (37%), Positives = 201/380 (53%), Gaps = 59/380 (16%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIP-----  1227
             A ++++M+G ++ D++ L SA   FK+ FFS       P  + +RYLGI+Y +       
Sbjct  24    ANNNSIMKGQSLADYQQLVSANGFFKMQFFS-------PGKSRNRYLGIFYTQPSLDMYS  76

Query  1226  -------NEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGAT  1068
                     + +W+ANRD P+ D+SGSL+I  DG+L IS+  G +T+ + +  +  N+ A 
Sbjct  77    DVNGGGDEKALWIANRDDPITDTSGSLMIAPDGRLIISHKEGNVTLFSATPTTATNLTAI  136

Query  1067  LLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVP  888
             LLD+GN V+RE++ N      LWQSFDYPTD L+PGMKLG+NL+TGH W LTSW++D+ P
Sbjct  137   LLDNGNFVLRELNTNSFVNRTLWQSFDYPTDTLLPGMKLGINLRTGHKWSLTSWVNDQAP  196

Query  887   GSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKY  708
              SG+F  GLD NG  NQL+I   GKVYW SG W  G              K VSNE EKY
Sbjct  197   ASGSFTFGLDPNG-TNQLIILWMGKVYWKSGPWSTG----------HLALKYVSNEDEKY  245

Query  707   FSYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNY  528
             F Y+ + +Y   ++ +   G I+                      R A    C       
Sbjct  246   FLYTVEVDY--LRYFVSPFGIIQDG------------------FKRNAVFGNCS---NET  282

Query  527   PRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCS  348
             P   C+K+    CR +   + + R  +   N +I   EN      L+LSDC + C  +C 
Sbjct  283   PHAGCVKQELPQCRAAKKYWFELRQVYMFGN-SIKVDENYT----LSLSDCKAKCVNDCW  337

Query  347   CTAYAS-SSTDGTGCILYTN  291
             C AYAS  S  G GC ++ N
Sbjct  338   CVAYASVDSETGIGCQIWGN  357



>emb|CDX88936.1| BnaA03g07130D [Brassica napus]
Length=404

 Score =   221 bits (564),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 139/363 (38%), Positives = 199/363 (55%), Gaps = 31/363 (9%)
 Frame = -2

Query  1388  ESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTED--RYLGIWYNKIPNEPV  1215
             ++DTL  G  +RDWE L SA   F L FF+  +S +  + +    RY+ IW     + PV
Sbjct  27    KTDTLKPGQQLRDWEQLISAGEAFTLRFFTPRESSTFLLGSGAGLRYICIWSQ---SRPV  83

Query  1214  WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVRE  1035
             WV N   P+ DSSGSL ID +G LKI+       + +  +    NV ATLLDSGN V+R+
Sbjct  84    WVGNPTEPVSDSSGSLSIDTNGALKITRANASPIMVSPHLSLAGNVSATLLDSGNFVIRD  143

Query  1034  VDGNGSFGG--VLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGL  861
                 G  G   +LWQSFD+PT++L+PGMK+G NLKT     +TSW S++VP  GAF LGL
Sbjct  144   AGRGGGGGPGRILWQSFDHPTNILLPGMKIGFNLKTKKEISVTSWTSNQVPTPGAFRLGL  203

Query  860   DINGCNNQLVISRRGKVYWTSGVW-KNGSFEKAPDMTK---EFGFKLVSNEKEKYFSYSA  693
             D +G N QL++ R G++YW+SG+   NGS +   ++++   ++ FK  S++   YFSYS 
Sbjct  204   DPSGAN-QLLVWRHGEIYWSSGILTNNGSSQLTLELSRRYIDYEFKFHSDKHTNYFSYSV  262

Query  692   KHNY--RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRP  519
             K       + W LD LG I  ++ +   +            G   +   C   + +    
Sbjct  263   KKTKGSVSSSWFLDTLGQITVTNSLRSNT---------CARGTSENNGPCRKDLKS-SSA  312

Query  518   VCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTA  339
             +C+ E P +CRK S+ F   RGY  D+          G+G    +SDCH  CW+NCSC A
Sbjct  313   ICIAEKPTACRKGSEYFEPRRGYMMDN-------AYYGDGLSSGISDCHGSCWRNCSCIA  365

Query  338   YAS  330
             + S
Sbjct  366   FQS  368



>ref|XP_002516068.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF46488.1| receptor protein kinase, putative [Ricinus communis]
Length=789

 Score =   229 bits (583),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 150/406 (37%), Positives = 213/406 (52%), Gaps = 57/406 (14%)
 Frame = -2

Query  1385  SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYN----------  1236
             +DTL+QG  ++D + L SA  IF L FF           ++  YLGIWYN          
Sbjct  27    TDTLLQGQKLKDGDQLVSASGIFLLRFF----------RSDKHYLGIWYNMTDEQESINE  76

Query  1235  -KIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIM-SGNN--VGAT  1068
              ++ ++ VWVANR++P+ D SG L I  DG LKISY  G   +S  S+  SGNN  + AT
Sbjct  77    FELSSKVVWVANRNNPIVDKSGILTIGRDGNLKISYGSGGDNISLTSVQKSGNNTNITAT  136

Query  1067  LLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVP  888
             LLDSGNLV+RE+  N S   +LWQSFDYPT  L PGMK+G+NL+TGH W LTSW++ + P
Sbjct  137   LLDSGNLVLRELYTNRSASRLLWQSFDYPTHALFPGMKIGINLQTGHSWSLTSWINTQSP  196

Query  887   GSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFG--FKLVSNEKE  714
               G+F  G+D NG  NQL+I   G VYW SG W +G F+    ++ + G  F+  SNE E
Sbjct  197   AIGSFTFGMDRNGM-NQLIIWWAGDVYWISGNWVDGGFKFWHMLSAQEGYHFRYFSNENE  255

Query  713   KYFSYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIG  534
              YF+Y+A  N +                  Y P  +I+   + +   R    + C     
Sbjct  256   TYFTYNASENAK------------------YFPMLWINDFGLSSSFAR--PLISCRSQYD  295

Query  533   NYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNR-NISDVENSGNGSRLALSDCHSICWK  357
                   C++  P+  +K+++   +T     D  + N SD         L+L DC   C +
Sbjct  296   YMNTIGCVQSRPICPKKATEFEYETAAVSGDSFKFNESD--------HLSLDDCLEKCLR  347

Query  356   NCSCTAYA-SSSTDGTGCILYTNAAHDFQLDENGELYIYRLLKEHK  222
             NCSC AY+ ++  DGTGC +++    +   D      ++ L  E K
Sbjct  348   NCSCVAYSPTNEIDGTGCEIWSKVTIESSADGRHWRPVFVLKSEEK  393



>emb|CDY50626.1| BnaC01g44280D [Brassica napus]
Length=876

 Score =   229 bits (584),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 166/474 (35%), Positives = 230/474 (49%), Gaps = 83/474 (18%)
 Frame = -2

Query  1388  ESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI-------  1230
             E+DTL+QG  ++D + L SA  IF+L FF+I        N+ + YLGIWY+ +       
Sbjct  24    ETDTLLQGQYLKDGQELVSAFNIFRLKFFNIK-------NSRNYYLGIWYDSLYLNDNSN  76

Query  1229  ----PNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLL  1062
                  ++PVW+ANRD+P+P  SGSL +D+ G+LKI   G    +   S  +  N    LL
Sbjct  77    YDASQDKPVWIANRDNPIPGRSGSLTVDSLGRLKI-LTGASSLIDLSSTETTRNTTLKLL  135

Query  1061  DSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGS  882
             DSGNL ++E+  +GS   +LWQSFDYPTD L+PGMK+G + KTG  W L SWL    P S
Sbjct  136   DSGNLQLQEMASDGSVKQILWQSFDYPTDTLLPGMKIGFSAKTGKRWMLRSWLGADSPAS  195

Query  881   GAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFS  702
             G+F  G+D N   N+L I  RGK+YW SG+W  G F         F F  VS E E+YF 
Sbjct  196   GSFVFGMDAN-ITNRLTILWRGKMYWGSGLWFKGQFSLEKLNQNGFFFSFVSTENEEYFM  254

Query  701   YSA--------KHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECD  546
             +            N R    T   L   E+ +L             + WI      + C 
Sbjct  255   HDGTAFPYFMYSANERHDGTTFPRLVINEKGTL------------QFNWINGRKDHVRCS  302

Query  545   PY-------IGNYPR--PVCLKEN-----PVS----CRKSSD-----------VFVQTRG  453
             P+       +G Y +   VCL+ +     PVS    C +SS             F  + G
Sbjct  303   PFVFGEDLEVGCYRKHSSVCLRASYVFPEPVSEFWDCMRSSSNYNFKEMTSGKTFCSSFG  362

Query  452   Y-FRDDNRNISDVENSG-----NGSRLALSDCHSICWKNCSCTAYASSSTDGTGCILY-T  294
             Y FRD    +S V  +G      G +L+  DC   C +NCSC AYAS+  DGTGC ++ T
Sbjct  363   YTFRD---AVSSVSGNGFVLNETGGKLSSYDCCVKCLQNCSCVAYASTRMDGTGCQIWNT  419

Query  293   NAAHDF---QLDENGELYIYRLLKE-HKG*ILVNVRYCCFTVIQVFCVFVNVPF  144
             +   D        +  + I+  +KE  K    + V    F +I V C  + + F
Sbjct  420   DPTIDLTGNMTSSHSPITIHIRVKEIEKAATWLVVVVSVFLMISVVCFIIYLVF  473



>ref|NP_188224.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
CES101 [Arabidopsis thaliana]
 sp|Q9LW83.2|CE101_ARATH RecName: Full=G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101; AltName: Full=Protein CALLUS EXPRESSION 
OF RBCS 101; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE75764.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
CES101 [Arabidopsis thaliana]
Length=850

 Score =   229 bits (583),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 155/398 (39%), Positives = 212/398 (53%), Gaps = 46/398 (12%)
 Frame = -2

Query  1415  FSSYVSVG---AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGI  1245
             F+ Y+ +G    ++DTL+QG  ++D + L SA  IFKL FF+         N+ + YLGI
Sbjct  11    FTFYLFLGQSCCQTDTLLQGQYLKDGQELVSAFNIFKLKFFNFE-------NSSNWYLGI  63

Query  1244  WYNKI-PNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGAT  1068
             WYN    +  VW+ANR++P+   SGSL +D+ G+L+I   G    +   S  +  N    
Sbjct  64    WYNNFYLSGAVWIANRNNPVLGRSGSLTVDSLGRLRI-LRGASSLLELSSTETTGNTTLK  122

Query  1067  LLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVP  888
             LLDSGNL ++E+D +GS    LWQSFDYPTD L+PGMKLG N+KTG  W+LTSWL D +P
Sbjct  123   LLDSGNLQLQEMDSDGSMKRTLWQSFDYPTDTLLPGMKLGFNVKTGKRWELTSWLGDTLP  182

Query  887   GSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKY  708
              SG+F  G+D N   N+L I   G VYW SG+W  G F      T  F F  VS E E Y
Sbjct  183   ASGSFVFGMDDN-ITNRLTILWLGNVYWASGLWFKGGFSLEKLNTNGFIFSFVSTESEHY  241

Query  707   FSYSAKHNY---RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYI  537
             F YS   NY    F +  +D  G +++ +L       +H  P       +   LE   Y 
Sbjct  242   FMYSGDENYGGPLFPRIRIDQQGSLQKINLD-GVKKHVHCSP-----SVFGEELEYGCYQ  295

Query  536   GNYPRPVCLKENPVS--------------CRKSSDVFVQTR-GY-FRDDNRNISDVENSG  405
              N+   V  +   V+               RK+ D+   +R GY FR+    +S    +G
Sbjct  296   QNFRNCVPARYKEVTGSWDCSPFGFGYTYTRKTYDLSYCSRFGYTFRE---TVSPSAENG  352

Query  404   N-----GSRLALSDCHSICWKNCSCTAYASSSTDGTGC  306
                   G RL+  DC+  C +NCSC AYAS++ DGTGC
Sbjct  353   FVFNEIGRRLSSYDCYVKCLQNCSCVAYASTNGDGTGC  390



>ref|XP_010545708.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X1 [Tarenaya hassleriana]
Length=861

 Score =   229 bits (583),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 148/397 (37%), Positives = 208/397 (52%), Gaps = 67/397 (17%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI------  1230
             +E+DTL++G  ++D + L SA  IFKLGFFS       P  +   YLGIWYN +      
Sbjct  22    SETDTLLKGQFLKDEQELVSAFRIFKLGFFS-------PGKSGKWYLGIWYNNVYLNGNS  74

Query  1229  -----PNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATL  1065
                   +  VW+ANR+ P+ + SGSLIID+ GKLKI   G +  V   S  +  N    +
Sbjct  75    TFGDLRDRVVWIANRNDPISNHSGSLIIDSLGKLKI-LRGAVDPVELSSTETTGNTTLKM  133

Query  1064  LDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPG  885
             LDSGNL ++E+D +GS   +LWQSFDYPTD L+PGMKLG N++TG +W+LTSWL   +P 
Sbjct  134   LDSGNLQLQEMDSDGSVKRILWQSFDYPTDTLLPGMKLGFNVRTGKIWELTSWLEKDLPA  193

Query  884   SGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPD-MTKEFGFKLVSNEKEKY  708
             SG+F  G+D N   N+L+   RG +YW SG+W  G F    +   + F F  VS E E+ 
Sbjct  194   SGSFTFGMDPN-VTNRLISLWRGNLYWASGLWFKGLFSLQGNWENRNFVFSFVSTESEES  252

Query  707   FSYSAKHNY---RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYI  537
             F YSA H Y    F +  +D  G ++  SL  +                  S ++C P+ 
Sbjct  253   FLYSA-HLYGATSFPRIMIDNQGVLQIISLHGE-----------------ESHVDCSPFA  294

Query  536   GNYPRPVCLKENPV--SCRKSS------------------DVFVQTRGYFRDDNRNISDV  417
              +  +  C +E     + RKS+                  + F +T   F      +S+ 
Sbjct  295   KDEAKYQCYRERQYNNTYRKSTVYQFGCSGQEFPECLGLCNFFTETEAPFSSKGFQLSE-  353

Query  416   ENSGNGSRLALSDCHSICWKNCSCTAYASSSTDGTGC  306
                  G R++  DC++ C  NCSC AYAS + DGTGC
Sbjct  354   ----TGGRVSSYDCYNACVHNCSCLAYASVNADGTGC  386



>ref|XP_006465591.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g67520-like isoform X4 [Citrus sinensis]
Length=671

 Score =   226 bits (575),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 151/411 (37%), Positives = 213/411 (52%), Gaps = 61/411 (15%)
 Frame = -2

Query  1385  SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN------  1224
             +D L+QG  ++D   L SA   FKLGFFS + S      T +RYLGIW++  P+      
Sbjct  12    TDKLVQGQLLKDGMLLVSAFGNFKLGFFSPASS-----TTTERYLGIWHDTAPDTLGWYF  66

Query  1223  ----------EPVWVANRDSPLPDSSGSLIIDA-DGKLKISYVGG-MITVSNVSIMSGNN  1080
                       EP+W+ANR++P+ D SG L ID+ DG LKI + GG  I VS+V   S NN
Sbjct  67    RPFLPRYQTDEPIWIANRNTPILDQSGVLTIDSIDGNLKILHNGGNPIAVSSVEGAS-NN  125

Query  1079  VGATLLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLS  900
               ATLL SGNLV+RE+D +G+   VLWQSFDYPTD L+PGMKLG+NL+TGH W L SWL 
Sbjct  126   TSATLLQSGNLVLREMDTDGTIKRVLWQSFDYPTDTLLPGMKLGINLQTGHQWFLQSWLD  185

Query  899   DKVPGSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNE  720
                P  G+F LG++ N  N  ++  RR  +YWTSG+  NG+F  +      F +   SNE
Sbjct  186   YSSPAQGSFTLGIEPNATNQLIIRWRRETIYWTSGLLLNGNFNFSRSWNLSFSY--TSNE  243

Query  719   KEKYFSYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPY  540
             +EKYF YS          T  +   I+    + D              G +AS      +
Sbjct  244   QEKYFEYSLNEGV-----TSSVFLRIDPEGALSDSR------------GSFASCTYGGCW  286

Query  539   IGNYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICW  360
                 PRP+C K       +S    +   G+   ++ N+S             +DC + C+
Sbjct  287   -NQLPRPICRKGTGPENFQSKVGLISEHGFKFKESDNMSS------------TDCRANCF  333

Query  359   KNCSCTAYASSSTDGTG----CILYTNAAHDFQLDENGELYIYRL-LKEHK  222
              NCSC A+A+ +++ T     C +++      ++  N    I+ L +KE K
Sbjct  334   YNCSCIAFATGTSEYTDKQAYCEIWSEGTEFTEIASNNSREIFILAIKEEK  384



>emb|CBI18331.3| unnamed protein product [Vitis vinifera]
Length=657

 Score =   225 bits (574),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 154/393 (39%), Positives = 200/393 (51%), Gaps = 53/393 (13%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHL-TSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIP-NEP  1218
             A++DT+  G  ++  E L  SAK  F LGFFS+             YLGIWY     ++ 
Sbjct  58    AQTDTIKPGEELQFSEKLLVSAKGTFTLGFFSLESG---------SYLGIWYTTDDYHKK  108

Query  1217  VWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVR  1038
             VWVANRD  +  +  +L +DADGKL I++ GG   V N S  +  N  ATLLDSGN V+ 
Sbjct  109   VWVANRDKAISGTDANLTLDADGKLMITHSGGDPIVLN-SNQAARNSTATLLDSGNFVLE  167

Query  1037  EVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLD  858
             E + +GS    LW SFD PTD L+PGMKLG+NLKTG  W L SW+S++VP  G F   L+
Sbjct  168   EFNSDGSLKEKLWASFDNPTDTLLPGMKLGINLKTGRNWSLASWISEQVPAPGTFT--LE  225

Query  857   INGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE------FGFKLVSNEKEKYFSYS  696
              NG   QLV+ RRG  YW+SG  K+ SFE  P +         + F  VSN  E YFSYS
Sbjct  226   WNG--TQLVMKRRGGTYWSSGTLKDRSFEFIPWLMSSDTFNNIYSFNSVSNANEIYFSYS  283

Query  695   AKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPR-P  519
                    + W L   G +  +S    P F +                  D     Y   P
Sbjct  284   VPEGV-VSDWVLTSEGGLFDTS---RPVFVL------------------DDQCARYEEYP  321

Query  518   VCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTA  339
              C  +NP +CR   D F++          +I +       S L L DC ++CW +CSCTA
Sbjct  322   GCAVQNPPTCRSRKDGFMKQSVLISGSPSSIKE------KSSLGLRDCKALCWNDCSCTA  375

Query  338   YASSSTDGTGCILY-TNAAHDFQLDENG-ELYI  246
             Y S  T+GTGC  + T  A   + D N  ELY+
Sbjct  376   YNSLYTNGTGCRFWSTKFAQALKDDANQEELYV  408



>ref|XP_006426987.1| hypothetical protein CICLE_v10024887mg [Citrus clementina]
 gb|ESR40227.1| hypothetical protein CICLE_v10024887mg [Citrus clementina]
Length=560

 Score =   223 bits (568),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 150/406 (37%), Positives = 213/406 (52%), Gaps = 68/406 (17%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWY---------  1239
             +++D L++G +++D + L SA   F++GFFS       P  +E+RYLG+WY         
Sbjct  53    SQTDKLLRGQHLKDGDELVSAFGYFRMGFFS-------PDGSENRYLGVWYYRPTDPSVF  105

Query  1238  ---NKIPNEPVWVANRDSPLPDSSGSLIIDA-DGKLKISYVGGMITVSNVSIMSGNNVGA  1071
                N   N+PVWVANR++P+ D SGSL ID+ DG LKI + GG   V   S+ +  N  A
Sbjct  106   DYYNSERNKPVWVANRNNPILDKSGSLTIDSTDGNLKILHNGGNPIVI-TSVKADGNTSA  164

Query  1070  TLLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKV  891
             +LL +GNLV+ E++ +GS    LWQSFDYPTD L+PGMKLG+NL+TGH W L SW+SD  
Sbjct  165   SLLKTGNLVLYEMNSDGSERRELWQSFDYPTDTLLPGMKLGINLQTGHQWFLQSWISDFS  224

Query  890   PGSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEK  711
             P  G++ LG+D N   NQL+I  RG VYWTS +W  G F     ++  + F   S+E EK
Sbjct  225   PAQGSYTLGIDPN-VPNQLIIWWRGDVYWTSEIWPKGWFHSYSLVSDGYNFGYTSSEHEK  283

Query  710   YFSYSAKHNYRFTKW-TLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIG  534
             YF+YSA  N   T +  L L  +    +L                   YA  +   P   
Sbjct  284   YFNYSA--NETITSFPVLRLTANGLSGAL-------------------YADGIVKSP---  319

Query  533   NYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKN  354
                          SC K         G+   D     + +N      + LSDC   C++N
Sbjct  320   -------------SCSKDFSYIEYKYGFMNGDGFKFKESDN------MTLSDCKVKCFQN  360

Query  353   CSCTAYAS-SSTDGTGCILYTNAAHDFQLDENGELYIYRLLKEHKG  219
             CSC AYAS + ++ TGC ++++    F +    +  I  + +E KG
Sbjct  361   CSCVAYASINESNDTGCEIWSSGTK-FTVTSITDRRIIFMAREAKG  405



>ref|XP_010495280.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g67520 [Camelina sativa]
Length=412

 Score =   219 bits (558),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 152/372 (41%), Positives = 212/372 (57%), Gaps = 31/372 (8%)
 Frame = -2

Query  1388  ESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTED-RYLGIWYNKIPNEPVW  1212
             ++DTL  G  +RDWE LTSA  IF LGFF+  +S +  + +   RYLGIW  +    PVW
Sbjct  29    KTDTLEPGKQLRDWEQLTSASEIFTLGFFTPKESSTYELGSAGLRYLGIWSQRSLFNPVW  88

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIM----SGNNVGATLLDSGNLV  1044
             V N    + DSSGSL ID +G LKI+       + N  +     S  NV ATLLDSGN V
Sbjct  89    VGNPSESISDSSGSLSIDVNGVLKITQANAFPILVNQRLAGKLSSVGNVSATLLDSGNFV  148

Query  1043  VREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELG  864
             VRE+   G  G VL   FD+PT+ L+PGMK+G NL+T     +TSW+SD+VP  GAF LG
Sbjct  149   VREIGPGGVSGRVL--CFDHPTNTLLPGMKIGFNLRTKKEVSVTSWISDQVPLPGAFRLG  206

Query  863   LDINGCNNQLVISRRGKVYWTSGVW-KNGSFEKAPDMTK---EFGFKLVSNEKEKYFSYS  696
             LD +G  NQL++ R G++YW+SG+   NGS     ++++   ++ FK  S++  KYFSYS
Sbjct  207   LDPSGA-NQLLVWRHGEIYWSSGILTNNGSSHLTLELSRSYIDYEFKFDSDKYMKYFSYS  265

Query  695   AK--HNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPR  522
              K  ++   + W LD LG I  ++++             T+I    S+  C   + N   
Sbjct  266   IKKANSSVLSSWFLDTLGQITVTNVLSSNK-------STTYISE--SSEPCKKDLKNI-S  315

Query  521   PVCLKENPVSCRKSSDVFVQTRGYFRDDNR---NISDVENSGNGSRLALSDCHSICWKNC  351
              VC+ E P +CRK S+ F   RGY   + +   N   V++  +G    LSDCH  CW+NC
Sbjct  316   AVCITEKPTACRKGSEYFEPRRGYMMGNKKGYFNSYYVDSLSSG----LSDCHQNCWRNC  371

Query  350   SCTAYASSSTDG  315
             SC A+ + S+ G
Sbjct  372   SCIAFRAFSSYG  383



>emb|CAN74670.1| hypothetical protein VITISV_000269 [Vitis vinifera]
Length=751

 Score =   226 bits (577),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 154/401 (38%), Positives = 208/401 (52%), Gaps = 51/401 (13%)
 Frame = -2

Query  1421  MGFSSYVSVGAESDTLMQGANIRDWEHL-TSAKAIFKLGFFSISDSYSGPINTEDRYLGI  1245
             +G   Y+S  A++DT+  G  ++  E L  SAK  F LGFFS+             YLGI
Sbjct  21    LGVVPYIS-SAQTDTIKPGEELQFSEKLLVSAKGTFTLGFFSLESG---------SYLGI  70

Query  1244  WYN-KIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGAT  1068
             W+      E VWVANRD P+  +  +L + ADGKL I + GG   V N S  +  N  AT
Sbjct  71    WFTIDAQKEKVWVANRDKPISGTDANLTLHADGKLMIMHSGGDPIVLN-SNQAARNSTAT  129

Query  1067  LLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVP  888
             LLDSGN V+ E + + S    LW+SFD PTD L+PGMKLG+NLKTG  W L SW++++VP
Sbjct  130   LLDSGNFVLEEFNSDRSVKEKLWESFDNPTDTLLPGMKLGINLKTGQNWSLASWINEQVP  189

Query  887   GSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE-----FGFKLVSN  723
               G F   L+ NG   QLV+ RRG  YW+SG  KN SFE  P ++ +     + F  V+N
Sbjct  190   APGTFT--LEWNG--TQLVMKRRGGTYWSSGTLKNRSFEFIPWLSFDTCNNIYSFNSVAN  245

Query  722   EKEKYFSYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDP  543
             E E YFSY        ++W L+  G +  ++    P F    +              CD 
Sbjct  246   ENEIYFSYKVPDGV-VSEWALNSRGGLSDTN---RPLFVTDDV--------------CD-  286

Query  542   YIGNYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSIC  363
               G    P C  +NP +CR   D F++   +  +   +I +       S L  SDC +IC
Sbjct  287   --GFEEYPGCAVQNPPTCRTRKDGFMKQSVHISESPSSIKE------DSSLGPSDCQAIC  338

Query  362   WKNCSCTAYASSSTDGTGCILY-TNAAHDFQLDENGE-LYI  246
             W NCSCTA  +  T+GTGC  + T     +  D N E LY+
Sbjct  339   WNNCSCTACNTIYTNGTGCRFWSTKFTQAYAGDANREALYV  379



>ref|XP_010652593.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X2 [Vitis vinifera]
Length=789

 Score =   227 bits (578),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 153/388 (39%), Positives = 200/388 (52%), Gaps = 50/388 (13%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHL-TSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIP-NEP  1218
             A++DT+  G  ++  E L  SAK  F LGFFS+             YLGIWY     ++ 
Sbjct  30    AQTDTIKPGEELQFSEKLLVSAKGTFTLGFFSLESG---------SYLGIWYTTDDYHKK  80

Query  1217  VWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVR  1038
             VWVANRD  +  +  +L +DADGKL I++ GG   V N S  +  N  ATLLDSGN V+ 
Sbjct  81    VWVANRDKAISGTDANLTLDADGKLMITHSGGDPIVLN-SNQAARNSTATLLDSGNFVLE  139

Query  1037  EVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLD  858
             E + +GS    LW SFD PTD L+PGMKLG+NLKTG  W L SW+S++VP  G F   L+
Sbjct  140   EFNSDGSLKEKLWASFDNPTDTLLPGMKLGINLKTGRNWSLASWISEQVPAPGTFT--LE  197

Query  857   INGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE------FGFKLVSNEKEKYFSYS  696
              NG   QLV+ RRG  YW+SG  K+ SFE  P +         + F  VSN  E YFSYS
Sbjct  198   WNG--TQLVMKRRGGTYWSSGTLKDRSFEFIPWLMSSDTFNNIYSFNSVSNANEIYFSYS  255

Query  695   AKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPV  516
                    + W L   G       ++D +  +           +    +CD    +   P 
Sbjct  256   VPEGVG-SDWVLTSEGG------LFDTNRSV-----------FMQDDQCDR---DKEYPG  294

Query  515   CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAY  336
             C  +NP +CR   D FV+          +I +       S L L DC +ICW NCSCTAY
Sbjct  295   CAVQNPPTCRTRKDGFVKESVLISGSPSSIKE------NSSLGLGDCQAICWNNCSCTAY  348

Query  335   ASSSTDGTGCILY-TNAAHDFQLDENGE  255
              S  T+GTGC  + T  A  ++ D N E
Sbjct  349   NSIHTNGTGCRFWSTKFAQAYKDDGNQE  376



>emb|CAN61710.1| hypothetical protein VITISV_034501 [Vitis vinifera]
Length=494

 Score =   221 bits (563),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 145/386 (38%), Positives = 211/386 (55%), Gaps = 42/386 (11%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNK-IPNEPV  1215
             A +D++  G  ++  + L S++  F LGFF I D+ S        YLGIWY   + N+ V
Sbjct  25    AHTDSIKPGEGLQFSKLLVSSQGTFTLGFF-ILDTRS--------YLGIWYTSDVNNKKV  75

Query  1214  WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVRE  1035
             WVANRD+P+  ++ +L++D +G L I + GG   V N +  S N++ ATLLDSGN VV  
Sbjct  76    WVANRDNPISGTNANLMLDCNGTLMIIHSGGDPIVLNSNQASRNSI-ATLLDSGNFVVSA  134

Query  1034  VDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDI  855
             ++ +GS    LW+SFD PTD L+PGMKLG+NLKTG  W L SW++++VP +G F   L+ 
Sbjct  135   LNSDGSVKQTLWESFDDPTDTLLPGMKLGINLKTGQNWSLASWINEQVPDAGTFT--LEW  192

Query  854   NGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSYSAKHNYRF  675
             NG   QLV+ RRG +YW+SG+ K+ SFE        + F  V N+ E YFSYS +     
Sbjct  193   NG--TQLVMKRRGDIYWSSGILKDRSFEFIQTHHNIYYFISVCNDNEIYFSYSVQDG-AI  249

Query  674   TKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKENPV  495
             +KW L+  G            FF  Y  +      +     CDPY   YP   C  + P 
Sbjct  250   SKWVLNWRG-----------GFFDTYGTL------FVKEDMCDPY-DKYPG--CAVQEPP  289

Query  494   SCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSSTDG  315
             +CR     F++ +        ++ D++ S     L LSDC +IC  NCSCTA  +  T+G
Sbjct  290   TCRTRDFQFMK-QSVLNSGYPSLMDIDTS-----LGLSDCQAICRNNCSCTACNTVFTNG  343

Query  314   TGCILYTNAAHDFQLDENGELYIYRL  237
             +GC  + +     Q+ +  +  +Y L
Sbjct  344   SGCQFWKDKLPRAQVGDANQEELYVL  369



>emb|CAN61711.1| hypothetical protein VITISV_034502 [Vitis vinifera]
Length=906

 Score =   227 bits (578),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 155/402 (39%), Positives = 208/402 (52%), Gaps = 51/402 (13%)
 Frame = -2

Query  1424  HMGFSSYVSVGAESDTLMQGANIRDWEHL-TSAKAIFKLGFFSISDSYSGPINTEDRYLG  1248
              +G   Y+S  A+ DT+  G  ++  E L  SAK  F LGFFS+             YLG
Sbjct  105   QLGVVPYIS-SAQIDTIKPGEELQFSEKLLVSAKGTFTLGFFSLESG---------SYLG  154

Query  1247  IWYN-KIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGA  1071
             IW+      E VWVANRD P+  +  +L +DADGKL I + GG   V N S  +  N  A
Sbjct  155   IWFTIDAQKEKVWVANRDKPISGTDANLTLDADGKLMIMHSGGDPIVLN-SNQAARNSTA  213

Query  1070  TLLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKV  891
             TLLDSGN V+ E + + S    LW+SFD PTD L+PGMKLG+NLKTG  W L SW++++V
Sbjct  214   TLLDSGNFVLEEFNSDRSVKEKLWESFDNPTDTLLPGMKLGINLKTGQNWSLASWINEQV  273

Query  890   PGSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE-----FGFKLVS  726
             P  G F   L+ NG   Q V+ RRG  YW+SG  KN SFE  P ++ +     + F  V+
Sbjct  274   PAPGTFT--LEWNG--TQFVMKRRGGTYWSSGTLKNRSFEFIPWLSFDTCNNIYCFNSVA  329

Query  725   NEKEKYFSYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECD  546
             NE E YFSYS       ++W L+  G +  ++    P F    +              CD
Sbjct  330   NENEIYFSYSVPDGV-VSEWALNSRGGLSDTN---RPLFVTDDV--------------CD  371

Query  545   PYIGNYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSI  366
                G    P C  +NP +CR   D F++   +  +   +I +       S L  SDC +I
Sbjct  372   ---GLEEYPGCAVQNPPTCRTRKDGFMKQSVHISESPSSIKE------DSSLGPSDCQAI  422

Query  365   CWKNCSCTAYASSSTDGTGCILY-TNAAHDFQLDENGE-LYI  246
             CW NCSCTA  +  T+GTGC  + T     +  D N E LY+
Sbjct  423   CWNNCSCTACNTIYTNGTGCRFWGTKFTQAYAGDANQEALYV  464



>ref|XP_010652582.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 [Vitis vinifera]
Length=473

 Score =   220 bits (560),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 144/386 (37%), Positives = 210/386 (54%), Gaps = 42/386 (11%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWY-NKIPNEPV  1215
             A +D++  G  ++  + L SA+  F LGFF I D+ S        YLGIWY + + N+ V
Sbjct  38    AHTDSIKPGEGLQFSKLLVSAQGTFTLGFF-ILDTRS--------YLGIWYTSDVNNKKV  88

Query  1214  WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVRE  1035
             WVANRD+P+  ++ +L++D +G L I + GG   V N +  S N++ ATLLDSGN VV  
Sbjct  89    WVANRDNPISGTNANLMLDGNGTLMIIHSGGDPIVLNSNQASRNSI-ATLLDSGNFVVSA  147

Query  1034  VDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDI  855
             ++ +GS    LW+SFD PTD L+PGMKLG+NLKTG  W L SW++++VP  G F L  + 
Sbjct  148   LNSDGSVKQTLWESFDDPTDTLLPGMKLGINLKTGKNWSLASWINEQVPDPGTFTLEWN-  206

Query  854   NGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSYSAKHNYRF  675
                + QLV+ RRG +YW+SG+ K+ SFE        + F  V N+ E YFSYS +     
Sbjct  207   ---DTQLVMKRRGDIYWSSGILKDRSFEFIQTHHNIYYFISVCNDNEIYFSYSVQDG-AI  262

Query  674   TKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKENPV  495
             +KW L+  G            FF  Y  +      +     CD Y G YP   C  + P 
Sbjct  263   SKWVLNWRG-----------GFFDTYGTL------FVKEDMCDRY-GKYPG--CAVQEPP  302

Query  494   SCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSSTDG  315
             +CR     F++ +        ++ +++ S     L LSDC +IC  NCSCTA  +  T+G
Sbjct  303   TCRTRDFQFMK-QSVLNSGYPSLMNIDTS-----LGLSDCQAICRNNCSCTACNTVFTNG  356

Query  314   TGCILYTNAAHDFQLDENGELYIYRL  237
             TGC  + +     Q+ +  +  +Y L
Sbjct  357   TGCQFWRDELPRAQVGDANQEELYVL  382



>ref|XP_006426986.1| hypothetical protein CICLE_v10024887mg [Citrus clementina]
 gb|ESR40226.1| hypothetical protein CICLE_v10024887mg [Citrus clementina]
Length=621

 Score =   223 bits (568),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 150/406 (37%), Positives = 213/406 (52%), Gaps = 68/406 (17%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWY---------  1239
             +++D L++G +++D + L SA   F++GFFS       P  +E+RYLG+WY         
Sbjct  53    SQTDKLLRGQHLKDGDELVSAFGYFRMGFFS-------PDGSENRYLGVWYYRPTDPSVF  105

Query  1238  ---NKIPNEPVWVANRDSPLPDSSGSLIIDA-DGKLKISYVGGMITVSNVSIMSGNNVGA  1071
                N   N+PVWVANR++P+ D SGSL ID+ DG LKI + GG   V   S+ +  N  A
Sbjct  106   DYYNSERNKPVWVANRNNPILDKSGSLTIDSTDGNLKILHNGGNPIVI-TSVKADGNTSA  164

Query  1070  TLLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKV  891
             +LL +GNLV+ E++ +GS    LWQSFDYPTD L+PGMKLG+NL+TGH W L SW+SD  
Sbjct  165   SLLKTGNLVLYEMNSDGSERRELWQSFDYPTDTLLPGMKLGINLQTGHQWFLQSWISDFS  224

Query  890   PGSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEK  711
             P  G++ LG+D N   NQL+I  RG VYWTS +W  G F     ++  + F   S+E EK
Sbjct  225   PAQGSYTLGIDPN-VPNQLIIWWRGDVYWTSEIWPKGWFHSYSLVSDGYNFGYTSSEHEK  283

Query  710   YFSYSAKHNYRFTKW-TLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIG  534
             YF+YSA  N   T +  L L  +    +L                   YA  +   P   
Sbjct  284   YFNYSA--NETITSFPVLRLTANGLSGAL-------------------YADGIVKSP---  319

Query  533   NYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKN  354
                          SC K         G+   D     + +N      + LSDC   C++N
Sbjct  320   -------------SCSKDFSYIEYKYGFMNGDGFKFKESDN------MTLSDCKVKCFQN  360

Query  353   CSCTAYAS-SSTDGTGCILYTNAAHDFQLDENGELYIYRLLKEHKG  219
             CSC AYAS + ++ TGC ++++    F +    +  I  + +E KG
Sbjct  361   CSCVAYASINESNDTGCEIWSSGTK-FTVTSITDRRIIFMAREAKG  405



>ref|XP_010652594.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g67520 isoform X3 [Vitis vinifera]
Length=789

 Score =   226 bits (575),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 154/393 (39%), Positives = 200/393 (51%), Gaps = 53/393 (13%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHL-TSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIP-NEP  1218
             A++DT+  G  ++  E L  SAK  F LGFFS+             YLGIWY     ++ 
Sbjct  30    AQTDTIKPGEELQFSEKLLVSAKGTFTLGFFSLESG---------SYLGIWYTTDDYHKK  80

Query  1217  VWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVR  1038
             VWVANRD  +  +  +L +DADGKL I++ GG   V N S  +  N  ATLLDSGN V+ 
Sbjct  81    VWVANRDKAISGTDANLTLDADGKLMITHSGGDPIVLN-SNQAARNSTATLLDSGNFVLE  139

Query  1037  EVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLD  858
             E + +GS    LW SFD PTD L+PGMKLG+NLKTG  W L SW+S++VP  G F   L+
Sbjct  140   EFNSDGSLKEKLWASFDNPTDTLLPGMKLGINLKTGRNWSLASWISEQVPAPGTFT--LE  197

Query  857   INGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE------FGFKLVSNEKEKYFSYS  696
              NG   QLV+ RRG  YW+SG  K+ SFE  P +         + F  VSN  E YFSYS
Sbjct  198   WNG--TQLVMKRRGGTYWSSGTLKDRSFEFIPWLMSSDTFNNIYSFNSVSNANEIYFSYS  255

Query  695   AKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPR-P  519
                    + W L   G +  +S    P F +                  D     Y   P
Sbjct  256   VPEGV-VSDWVLTSEGGLFDTS---RPVFVL------------------DDQCARYEEYP  293

Query  518   VCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTA  339
              C  +NP +CR   D F++          +I +       S L L DC ++CW +CSCTA
Sbjct  294   GCAVQNPPTCRSRKDGFMKQSVLISGSPSSIKE------KSSLGLRDCKALCWNDCSCTA  347

Query  338   YASSSTDGTGCILY-TNAAHDFQLDENG-ELYI  246
             Y S  T+GTGC  + T  A   + D N  ELY+
Sbjct  348   YNSLYTNGTGCRFWSTKFAQALKDDANQEELYV  380



>ref|XP_006426988.1| hypothetical protein CICLE_v10024887mg [Citrus clementina]
 gb|ESR40228.1| hypothetical protein CICLE_v10024887mg [Citrus clementina]
Length=633

 Score =   223 bits (568),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 150/406 (37%), Positives = 213/406 (52%), Gaps = 68/406 (17%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWY---------  1239
             +++D L++G +++D + L SA   F++GFFS       P  +E+RYLG+WY         
Sbjct  53    SQTDKLLRGQHLKDGDELVSAFGYFRMGFFS-------PDGSENRYLGVWYYRPTDPSVF  105

Query  1238  ---NKIPNEPVWVANRDSPLPDSSGSLIIDA-DGKLKISYVGGMITVSNVSIMSGNNVGA  1071
                N   N+PVWVANR++P+ D SGSL ID+ DG LKI + GG   V   S+ +  N  A
Sbjct  106   DYYNSERNKPVWVANRNNPILDKSGSLTIDSTDGNLKILHNGGNPIVI-TSVKADGNTSA  164

Query  1070  TLLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKV  891
             +LL +GNLV+ E++ +GS    LWQSFDYPTD L+PGMKLG+NL+TGH W L SW+SD  
Sbjct  165   SLLKTGNLVLYEMNSDGSERRELWQSFDYPTDTLLPGMKLGINLQTGHQWFLQSWISDFS  224

Query  890   PGSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEK  711
             P  G++ LG+D N   NQL+I  RG VYWTS +W  G F     ++  + F   S+E EK
Sbjct  225   PAQGSYTLGIDPN-VPNQLIIWWRGDVYWTSEIWPKGWFHSYSLVSDGYNFGYTSSEHEK  283

Query  710   YFSYSAKHNYRFTKW-TLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIG  534
             YF+YSA  N   T +  L L  +    +L                   YA  +   P   
Sbjct  284   YFNYSA--NETITSFPVLRLTANGLSGAL-------------------YADGIVKSP---  319

Query  533   NYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKN  354
                          SC K         G+   D     + +N      + LSDC   C++N
Sbjct  320   -------------SCSKDFSYIEYKYGFMNGDGFKFKESDN------MTLSDCKVKCFQN  360

Query  353   CSCTAYAS-SSTDGTGCILYTNAAHDFQLDENGELYIYRLLKEHKG  219
             CSC AYAS + ++ TGC ++++    F +    +  I  + +E KG
Sbjct  361   CSCVAYASINESNDTGCEIWSSGTK-FTVTSITDRRIIFMAREAKG  405



>ref|XP_006465590.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g67520-like isoform X3 [Citrus sinensis]
Length=777

 Score =   225 bits (574),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 153/414 (37%), Positives = 214/414 (52%), Gaps = 67/414 (16%)
 Frame = -2

Query  1385  SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN------  1224
             +D L+QG  ++D   L SA   FKLGFFS + S      T +RYLGIW++  P+      
Sbjct  12    TDKLVQGQLLKDGMLLVSAFGNFKLGFFSPASS-----TTTERYLGIWHDTAPDTLGWYF  66

Query  1223  ----------EPVWVANRDSPLPDSSGSLIIDA-DGKLKISYVGG-MITVSNVSIMSGNN  1080
                       EP+W+ANR++P+ D SG L ID+ DG LKI + GG  I VS+V   S NN
Sbjct  67    RPFLPRYQTDEPIWIANRNTPILDQSGVLTIDSIDGNLKILHNGGNPIAVSSVEGAS-NN  125

Query  1079  VGATLLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLS  900
               ATLL SGNLV+RE+D +G+   VLWQSFDYPTD L+PGMKLG+NL+TGH W L SWL 
Sbjct  126   TSATLLQSGNLVLREMDTDGTIKRVLWQSFDYPTDTLLPGMKLGINLQTGHQWFLQSWLD  185

Query  899   DKVPGSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNE  720
                P  G+F LG++ N  N  ++  RR  +YWTSG+  NG+F  +      F +   SNE
Sbjct  186   YSSPAQGSFTLGIEPNATNQLIIRWRRETIYWTSGLLLNGNFNFSRSWNLSFSY--TSNE  243

Query  719   KEKYFSYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPY  540
             +EKYF YS          T  +   I+    + D              G +AS      Y
Sbjct  244   QEKYFEYSLNEGV-----TSSVFLRIDPEGALSDSR------------GSFASC----TY  282

Query  539   IG---NYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHS  369
              G     PRP+C K       +S    +   G+   ++ N+S             +DC +
Sbjct  283   GGCWNQLPRPICRKGTGPENFQSKVGLISEHGFKFKESDNMSS------------TDCRA  330

Query  368   ICWKNCSCTAYASSSTDGTG----CILYTNAAHDFQLDENGELYIYRL-LKEHK  222
              C+ NCSC A+A+ +++ T     C +++      ++  N    I+ L +KE K
Sbjct  331   NCFYNCSCIAFATGTSEYTDKQAYCEIWSEGTEFTEIASNNSREIFILAIKEEK  384



>ref|XP_010511696.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g67520 isoform X2 [Camelina sativa]
Length=670

 Score =   224 bits (570),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 140/377 (37%), Positives = 201/377 (53%), Gaps = 44/377 (12%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNK------I  1230
             +E+DTL QG  +++ + L SA  IFKL FF+         N+ + YLGIW+N       +
Sbjct  22    SETDTLHQGQYLKEGQELVSAFKIFKLKFFNFK-------NSRNLYLGIWFNDLYFDPDV  74

Query  1229  PNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGN  1050
              + PVW+ANR++P+ + SGSL +D+ GKL+I      + +   S  +  N    LLDSGN
Sbjct  75    RDRPVWIANRNNPISNHSGSLTVDSFGKLRILRGSSNMLLELSSTETTRNTTLKLLDSGN  134

Query  1049  LVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFE  870
             L ++E+D +GS   VLWQSFDYPTD L+PGMKLG ++KTG  W+LTSWL D +P SG+F 
Sbjct  135   LQLQEMDPDGSMKRVLWQSFDYPTDTLLPGMKLGFDVKTGKRWELTSWLGDTLPASGSFV  194

Query  869   LGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSYSAK  690
              G+D N   N L I  RGK+YW+SG+W  G F        +F F  VS +  +YF+YS  
Sbjct  195   FGMDAN-ITNVLTILWRGKMYWSSGLWYKGRFSVEELNECDFLFSFVSTKSGQYFTYS--  251

Query  689   HNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCL  510
                          G  +  +  + P+  I+         R     +  P   +   P CL
Sbjct  252   -------------GGDQNDAGTFFPTIMINQQGFL----RRTQIHQQQPTWQSSRNPNCL  294

Query  509   KENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSG-----NGSRLALSDCHSICWKNCSC  345
                 V    S + +      FR     +S   ++G      G RL+L DC +IC +N SC
Sbjct  295   AAGYVV---SDEPYSYGLTSFR---VTVSSSPSNGFVLNETGGRLSLVDCEAICVQNSSC  348

Query  344   TAYASSSTDGTGCILYT  294
               YAS++ DGTGC +++
Sbjct  349   LPYASANLDGTGCEIWS  365



>ref|XP_002268342.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g67520 isoform X1 [Vitis vinifera]
Length=795

 Score =   225 bits (574),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 154/393 (39%), Positives = 200/393 (51%), Gaps = 53/393 (13%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHL-TSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIP-NEP  1218
             A++DT+  G  ++  E L  SAK  F LGFFS+             YLGIWY     ++ 
Sbjct  30    AQTDTIKPGEELQFSEKLLVSAKGTFTLGFFSLESG---------SYLGIWYTTDDYHKK  80

Query  1217  VWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVR  1038
             VWVANRD  +  +  +L +DADGKL I++ GG   V N S  +  N  ATLLDSGN V+ 
Sbjct  81    VWVANRDKAISGTDANLTLDADGKLMITHSGGDPIVLN-SNQAARNSTATLLDSGNFVLE  139

Query  1037  EVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLD  858
             E + +GS    LW SFD PTD L+PGMKLG+NLKTG  W L SW+S++VP  G F   L+
Sbjct  140   EFNSDGSLKEKLWASFDNPTDTLLPGMKLGINLKTGRNWSLASWISEQVPAPGTFT--LE  197

Query  857   INGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE------FGFKLVSNEKEKYFSYS  696
              NG   QLV+ RRG  YW+SG  K+ SFE  P +         + F  VSN  E YFSYS
Sbjct  198   WNG--TQLVMKRRGGTYWSSGTLKDRSFEFIPWLMSSDTFNNIYSFNSVSNANEIYFSYS  255

Query  695   AKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPR-P  519
                    + W L   G +  +S    P F +                  D     Y   P
Sbjct  256   VPEGV-VSDWVLTSEGGLFDTS---RPVFVL------------------DDQCARYEEYP  293

Query  518   VCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTA  339
              C  +NP +CR   D F++          +I +       S L L DC ++CW +CSCTA
Sbjct  294   GCAVQNPPTCRSRKDGFMKQSVLISGSPSSIKE------KSSLGLRDCKALCWNDCSCTA  347

Query  338   YASSSTDGTGCILY-TNAAHDFQLDENG-ELYI  246
             Y S  T+GTGC  + T  A   + D N  ELY+
Sbjct  348   YNSLYTNGTGCRFWSTKFAQALKDDANQEELYV  380



>ref|XP_006465592.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101-like [Citrus sinensis]
Length=818

 Score =   225 bits (574),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 151/406 (37%), Positives = 214/406 (53%), Gaps = 68/406 (17%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWY---------  1239
             +++D L++G +++D + L SA   F++GFFS       P  +E+RYLG+WY         
Sbjct  25    SQTDKLLRGQHLKDGDELVSAFGYFRMGFFS-------PDGSENRYLGVWYYRPTDPSVF  77

Query  1238  ---NKIPNEPVWVANRDSPLPDSSGSLIIDA-DGKLKISYVGGMITVSNVSIMSGNNVGA  1071
                N   N+PVWVANR++P+ D SGSL ID+ DG LKI + GG   V   S+ +  N  A
Sbjct  78    DYYNSERNKPVWVANRNNPILDKSGSLTIDSTDGNLKILHNGGNPIVI-TSVKADGNTSA  136

Query  1070  TLLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKV  891
             +LL +GNLV+ E++ +GS    LWQSFDYPTD L+PGMKLG+NL+TGH W L SW+SD  
Sbjct  137   SLLKTGNLVLYEMNSDGSERRELWQSFDYPTDTLLPGMKLGINLQTGHQWFLQSWISDFS  196

Query  890   PGSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEK  711
             P  G++ LG+D N   NQL+I  RG VYWTS +W  G F     ++  + F   S+E EK
Sbjct  197   PAQGSYTLGIDPN-VPNQLIIWWRGDVYWTSEIWPKGWFHSYSLVSDGYNFGYTSSEHEK  255

Query  710   YFSYSAKHNYRFTKW-TLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIG  534
             YF+YSA  N   T +  L L  +    +L                   YA  +   P   
Sbjct  256   YFNYSA--NETITSFPVLRLTANGLSGAL-------------------YADGIVKSP---  291

Query  533   NYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKN  354
                          SCRK         G+   D     + +N      + LSDC   C++N
Sbjct  292   -------------SCRKDFSYIEYKYGFMNGDGFKFKESDN------MTLSDCKVKCFQN  332

Query  353   CSCTAYAS-SSTDGTGCILYTNAAHDFQLDENGELYIYRLLKEHKG  219
             CSC AYAS + ++ TGC ++++    F +    +  I  + +E KG
Sbjct  333   CSCVAYASINESNDTGCEIWSSGTK-FTVTSITDRRIIFMAREAKG  377



>ref|XP_006465588.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g67520-like isoform X1 [Citrus sinensis]
Length=826

 Score =   225 bits (574),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 153/414 (37%), Positives = 214/414 (52%), Gaps = 67/414 (16%)
 Frame = -2

Query  1385  SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN------  1224
             +D L+QG  ++D   L SA   FKLGFFS + S      T +RYLGIW++  P+      
Sbjct  12    TDKLVQGQLLKDGMLLVSAFGNFKLGFFSPASS-----TTTERYLGIWHDTAPDTLGWYF  66

Query  1223  ----------EPVWVANRDSPLPDSSGSLIIDA-DGKLKISYVGG-MITVSNVSIMSGNN  1080
                       EP+W+ANR++P+ D SG L ID+ DG LKI + GG  I VS+V   S NN
Sbjct  67    RPFLPRYQTDEPIWIANRNTPILDQSGVLTIDSIDGNLKILHNGGNPIAVSSVEGAS-NN  125

Query  1079  VGATLLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLS  900
               ATLL SGNLV+RE+D +G+   VLWQSFDYPTD L+PGMKLG+NL+TGH W L SWL 
Sbjct  126   TSATLLQSGNLVLREMDTDGTIKRVLWQSFDYPTDTLLPGMKLGINLQTGHQWFLQSWLD  185

Query  899   DKVPGSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNE  720
                P  G+F LG++ N  N  ++  RR  +YWTSG+  NG+F  +      F +   SNE
Sbjct  186   YSSPAQGSFTLGIEPNATNQLIIRWRRETIYWTSGLLLNGNFNFSRSWNLSFSY--TSNE  243

Query  719   KEKYFSYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPY  540
             +EKYF YS          T  +   I+    + D              G +AS      Y
Sbjct  244   QEKYFEYSLNEGV-----TSSVFLRIDPEGALSDSR------------GSFASC----TY  282

Query  539   IG---NYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHS  369
              G     PRP+C K       +S    +   G+   ++ N+S             +DC +
Sbjct  283   GGCWNQLPRPICRKGTGPENFQSKVGLISEHGFKFKESDNMSS------------TDCRA  330

Query  368   ICWKNCSCTAYASSSTDGTG----CILYTNAAHDFQLDENGELYIYRL-LKEHK  222
              C+ NCSC A+A+ +++ T     C +++      ++  N    I+ L +KE K
Sbjct  331   NCFYNCSCIAFATGTSEYTDKQAYCEIWSEGTEFTEIASNNSREIFILAIKEEK  384



>gb|AFO11038.1| S domain subfamily receptor-like kinase [Arabidopsis thaliana]
Length=852

 Score =   225 bits (574),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 144/392 (37%), Positives = 203/392 (52%), Gaps = 45/392 (11%)
 Frame = -2

Query  1388  ESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNK--------  1233
             E+DTL+QG  ++D + L S   IFK+ FF+         N+ + YLGIWYN         
Sbjct  23    ETDTLLQGQYLKDGQELVSTFNIFKVKFFNFE-------NSSNWYLGIWYNNFYLSGGNK  75

Query  1232  ----IPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATL  1065
                 I ++ VW+ANR++P+   SGSL +D+ G+L+I   G    +   S  +  N    L
Sbjct  76    KYGDIKDKAVWIANRNNPVLGRSGSLTVDSLGRLRI-LRGASSLLELSSTETTGNTTLKL  134

Query  1064  LDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPG  885
             LDSGNL ++E+D +GS   +LWQSFDYPTD L+PGMKLG N+K G  W+LTSWL D +P 
Sbjct  135   LDSGNLQLQEMDSDGSMMRILWQSFDYPTDTLLPGMKLGFNVKNGKRWELTSWLGDTLPA  194

Query  884   SGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYF  705
             SG+   G+D N   N+L I  RG +YW SG+W  G F         F F  +S E E YF
Sbjct  195   SGSLVFGMDAN-ITNRLTILWRGNMYWASGLWFKGGFSLEELNDYGFLFSFISTESEHYF  253

Query  704   SYSAKHNYR---FTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIG  534
              YS    Y    F    +D  G +    L  +   ++H  P          TL+ D    
Sbjct  254   MYSGDQKYAGTFFPAIMIDQQGILRIYRLDRE-RLYVHCSPF---------TLDEDSNFN  303

Query  533   NYPRPV--CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSG-----NGSRLALSDC  375
              Y R    CL    +   + ++ F   R +FR+    +S   ++G      G R + +DC
Sbjct  304   CYRRNSRDCLHAGCIVPERQNESFYGFR-FFRE---TVSAFSSNGFVLNETGGRFSSADC  359

Query  374   HSICWKNCSCTAYASSSTDGTGCILYTNAAHD  279
              +IC +N SC AYAS++ DGTGC ++     D
Sbjct  360   RAICMQNASCLAYASTNLDGTGCEIWNTYPTD  391



>ref|XP_010470661.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g67520 isoform X3 [Camelina sativa]
Length=668

 Score =   223 bits (568),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 140/377 (37%), Positives = 200/377 (53%), Gaps = 46/377 (12%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNK------I  1230
             +E+DTL QG  ++D + L SA  IFKL FF+ +       N+ + YLGIW+N       +
Sbjct  22    SETDTLHQGHYLKDGQELVSAFKIFKLKFFNFN-------NSRNLYLGIWFNDLYFDPDV  74

Query  1229  PNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGN  1050
              + PVW+ANR++P+ D SGSL +D+ G+L+I      + +   S  +  N    LLDSGN
Sbjct  75    RDRPVWIANRNNPISDHSGSLTVDSLGRLRILRGSSNMLLELSSTETTRNTTLKLLDSGN  134

Query  1049  LVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFE  870
             L ++E+D +GS   VLWQSFDYPTD L+PGMKLG ++KTG  W+LTSWL D +P SG+F 
Sbjct  135   LQLQEMDPDGSMKRVLWQSFDYPTDTLLPGMKLGFDVKTGKRWELTSWLGDTLPASGSFI  194

Query  869   LGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSY---  699
              G+D N   N L I  R  +YW+SG+W  G F        +F F  VS++  +YF+Y   
Sbjct  195   FGMDAN-ITNVLTILWRENMYWSSGLWYKGRFSVEELNECDFLFSFVSSKSGQYFTYLGG  253

Query  698   -SAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIG-RYASTLECDPYIGNYP  525
                     F    +D  G + ++ +         +   +TW   R  + L     + N P
Sbjct  254   DQNDAGTFFPTIMIDQQGFLSRAQI---------HQQQHTWQSSRNPNCLAAGYVVSNEP  304

Query  524   RPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSC  345
                      VS   SS+ FV                     G RL+L DC +IC +N SC
Sbjct  305   YGFTSFRVTVSS-SSSNGFVLNE-----------------TGGRLSLVDCKAICVQNSSC  346

Query  344   TAYASSSTDGTGCILYT  294
              AYAS++ DGTGC +++
Sbjct  347   LAYASANLDGTGCEIWS  363



>ref|XP_009628271.1| PREDICTED: LOW QUALITY PROTEIN: G-type lectin S-receptor-like 
serine/threonine-protein kinase CES101 [Nicotiana tomentosiformis]
Length=788

 Score =   224 bits (570),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 143/387 (37%), Positives = 202/387 (52%), Gaps = 59/387 (15%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIW----------  1242
             A+   + +  N+ D++ L S    FK+ FFS       P  + +RYLGI+          
Sbjct  22    ADLAEISKEQNLTDYQQLYSENRFFKMQFFS-------PGKSRNRYLGIFARPSLDMYSH  74

Query  1241  -YNKIPNEPVWVANRDSPLPDSSG--SLIIDADGKLKISYVGGMITVSNVSIMSGNNVGA  1071
                +   + VW+ANRD P+ D+S   SL+ID DG+L IS+    + + + +  +  N+ A
Sbjct  75    GIEEGDEKAVWIANRDDPITDTSATASLMIDRDGRLMISHSEENVILLSATPTAATNLTA  134

Query  1070  TLLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKV  891
              LLD+GN V+R+++ NGS    LWQSFD PTD L+PGMKLG+NL+TGH W LTSW +D+ 
Sbjct  135   ILLDNGNFVLRQLNSNGSVNRTLWQSFDSPTDTLLPGMKLGINLRTGHNWSLTSWATDQA  194

Query  890   PGSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEK  711
             P SG+F   LD NG  NQL+I   GKVYW SG   N  F  AP  +++F  K VSNE EK
Sbjct  195   PASGSFTFALDPNG-TNQLIILWMGKVYWKSGPLPNDHFGFAPKRSEDF--KYVSNEDEK  251

Query  710   YFSYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGN  531
             YF Y+A                           F ++ M   +  G      E +   GN
Sbjct  252   YFMYTA---------------------------FSLYEMYTISPSGSIQDGFERNKVFGN  284

Query  530   ----YPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSIC  363
                  P   C+K+    CR + + + + R  +   +    D EN      L+LSDC + C
Sbjct  285   CIDGIPDAGCVKQVLPQCRAAKNYWFELRQVYMFGDSFKYDEENYT----LSLSDCKAKC  340

Query  362   WKNCSCTAYAS-SSTDGTGCILYTNAA  285
               +CSC AYAS  S DGTGC ++ N++
Sbjct  341   ENDCSCVAYASVDSDDGTGCQIWGNSS  367



>ref|XP_002882973.1| CES101 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59232.1| CES101 [Arabidopsis lyrata subsp. lyrata]
Length=767

 Score =   223 bits (569),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 153/447 (34%), Positives = 222/447 (50%), Gaps = 78/447 (17%)
 Frame = -2

Query  1388  ESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNK--------  1233
             E+DTL+QG  ++D + L SA  IFKL FF++        N+ + YLGIWYN         
Sbjct  23    ETDTLLQGQYLKDGQELVSAFNIFKLKFFNLE-------NSSNWYLGIWYNNFYLSGNKK  75

Query  1232  ---IPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLL  1062
                I ++ VW+ANR++P+   SGSL +D+ G+L+I   G    +   S  +  N    LL
Sbjct  76    YGDIQDKAVWIANRNNPILGRSGSLTVDSLGRLRI-LRGASSLLEISSTETTGNTTLKLL  134

Query  1061  DSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGS  882
             DSGNL ++E+D +GS   +LWQSFDYPTD L+PGMKLG N+K G  W+LTSWL D +P S
Sbjct  135   DSGNLQLQEMDSDGSMRQILWQSFDYPTDTLLPGMKLGFNVKNGKRWELTSWLGDTLPAS  194

Query  881   GAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFG--FKLVSNEKEKY  708
             G+   G+D N   N+L I  RG +YW SG+W  G F  + ++  E+G  F  +S E E Y
Sbjct  195   GSLVFGMDAN-ITNRLTILWRGNMYWASGLWFKGGF--SLEVLNEYGFLFSFISTESEHY  251

Query  707   FSYSAKHNYR---FTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYI  537
             F YS  H +    F    +D  G +    L  +    +H   +Y    R+          
Sbjct  252   FMYSDDHKFAGTFFPAIMIDQQGILHIYRLDRER---LHTSLLYGLFARW----------  298

Query  536   GNYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWK  357
                           S R++   F  + G+  ++            G R + +DCH+IC +
Sbjct  299   -------------YSFRETVSAF-SSNGFILNE-----------TGGRFSSADCHAICMQ  333

Query  356   NCSCTAYASSSTDGTGCILYTNAAHDFQLDENGELYIYRLLKEHKG*ILVNVRYCCFTVI  177
             N SC AYAS++ DGTGC ++     D    ++    IY   +  KG    N+  CC   I
Sbjct  334   NSSCIAYASTNLDGTGCEIWNIDPTD---KKSSSQQIYVKPRARKG---GNLASCCGITI  387

Query  176   QVF-------CVFVNVPFVLEGCSLCN  117
               +       C+ +      + CSL N
Sbjct  388   PNYTCDLVKICIRITQMLPSQLCSLTN  414



>ref|XP_010470660.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g67520 isoform X2 [Camelina sativa]
Length=787

 Score =   223 bits (569),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 140/377 (37%), Positives = 200/377 (53%), Gaps = 46/377 (12%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNK------I  1230
             +E+DTL QG  ++D + L SA  IFKL FF+ +       N+ + YLGIW+N       +
Sbjct  22    SETDTLHQGHYLKDGQELVSAFKIFKLKFFNFN-------NSRNLYLGIWFNDLYFDPDV  74

Query  1229  PNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGN  1050
              + PVW+ANR++P+ D SGSL +D+ G+L+I      + +   S  +  N    LLDSGN
Sbjct  75    RDRPVWIANRNNPISDHSGSLTVDSLGRLRILRGSSNMLLELSSTETTRNTTLKLLDSGN  134

Query  1049  LVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFE  870
             L ++E+D +GS   VLWQSFDYPTD L+PGMKLG ++KTG  W+LTSWL D +P SG+F 
Sbjct  135   LQLQEMDPDGSMKRVLWQSFDYPTDTLLPGMKLGFDVKTGKRWELTSWLGDTLPASGSFI  194

Query  869   LGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSY---  699
              G+D N   N L I  R  +YW+SG+W  G F        +F F  VS++  +YF+Y   
Sbjct  195   FGMDAN-ITNVLTILWRENMYWSSGLWYKGRFSVEELNECDFLFSFVSSKSGQYFTYLGG  253

Query  698   -SAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIG-RYASTLECDPYIGNYP  525
                     F    +D  G + ++ +         +   +TW   R  + L     + N P
Sbjct  254   DQNDAGTFFPTIMIDQQGFLSRAQI---------HQQQHTWQSSRNPNCLAAGYVVSNEP  304

Query  524   RPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSC  345
                      VS   SS+ FV                     G RL+L DC +IC +N SC
Sbjct  305   YGFTSFRVTVSS-SSSNGFVLNE-----------------TGGRLSLVDCKAICVQNSSC  346

Query  344   TAYASSSTDGTGCILYT  294
              AYAS++ DGTGC +++
Sbjct  347   LAYASANLDGTGCEIWS  363



>ref|XP_006465589.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g67520-like isoform X2 [Citrus sinensis]
Length=813

 Score =   223 bits (568),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 150/408 (37%), Positives = 210/408 (51%), Gaps = 66/408 (16%)
 Frame = -2

Query  1385  SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN------  1224
             +D L+QG  ++D   L SA   FKLGFFS + S      T +RYLGIW++  P+      
Sbjct  12    TDKLVQGQLLKDGMLLVSAFGNFKLGFFSPASS-----TTTERYLGIWHDTAPDTLGWYF  66

Query  1223  ----------EPVWVANRDSPLPDSSGSLIIDA-DGKLKISYVGG-MITVSNVSIMSGNN  1080
                       EP+W+ANR++P+ D SG L ID+ DG LKI + GG  I VS+V   S NN
Sbjct  67    RPFLPRYQTDEPIWIANRNTPILDQSGVLTIDSIDGNLKILHNGGNPIAVSSVEGAS-NN  125

Query  1079  VGATLLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLS  900
               ATLL SGNLV+RE+D +G+   VLWQSFDYPTD L+PGMKLG+NL+TGH W L SWL 
Sbjct  126   TSATLLQSGNLVLREMDTDGTIKRVLWQSFDYPTDTLLPGMKLGINLQTGHQWFLQSWLD  185

Query  899   DKVPGSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNE  720
                P  G+F LG++ N  N  ++  RR  +YWTSG+  NG+F  +      F +   SNE
Sbjct  186   YSSPAQGSFTLGIEPNATNQLIIRWRRETIYWTSGLLLNGNFNFSRSWNLSFSY--TSNE  243

Query  719   KEKYFSYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPY  540
             +EKYF YS          T  +   I+    + D              G +AS      Y
Sbjct  244   QEKYFEYSLNEGV-----TSSVFLRIDPEGALSDSR------------GSFASC----TY  282

Query  539   IG---NYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHS  369
              G     PRP+C K       +S    +   G+   ++ N+S             +DC +
Sbjct  283   GGCWNQLPRPICRKGTGPENFQSKVGLISEHGFKFKESDNMSS------------TDCRA  330

Query  368   ICWKNCSCTAYASSSTDGTG----CILYTNAAHDFQLDENGELYIYRL  237
              C+ NCSC A+A+ +++ T     C +++      ++  N    I+ L
Sbjct  331   NCFYNCSCIAFATGTSEYTDKQAYCEIWSEGTEFTEIASNNSREIFIL  378



>ref|XP_010511695.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g67520 isoform X1 [Camelina sativa]
Length=827

 Score =   223 bits (569),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 140/377 (37%), Positives = 201/377 (53%), Gaps = 44/377 (12%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNK------I  1230
             +E+DTL QG  +++ + L SA  IFKL FF+         N+ + YLGIW+N       +
Sbjct  22    SETDTLHQGQYLKEGQELVSAFKIFKLKFFNFK-------NSRNLYLGIWFNDLYFDPDV  74

Query  1229  PNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGN  1050
              + PVW+ANR++P+ + SGSL +D+ GKL+I      + +   S  +  N    LLDSGN
Sbjct  75    RDRPVWIANRNNPISNHSGSLTVDSFGKLRILRGSSNMLLELSSTETTRNTTLKLLDSGN  134

Query  1049  LVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFE  870
             L ++E+D +GS   VLWQSFDYPTD L+PGMKLG ++KTG  W+LTSWL D +P SG+F 
Sbjct  135   LQLQEMDPDGSMKRVLWQSFDYPTDTLLPGMKLGFDVKTGKRWELTSWLGDTLPASGSFV  194

Query  869   LGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSYSAK  690
              G+D N   N L I  RGK+YW+SG+W  G F        +F F  VS +  +YF+YS  
Sbjct  195   FGMDAN-ITNVLTILWRGKMYWSSGLWYKGRFSVEELNECDFLFSFVSTKSGQYFTYS--  251

Query  689   HNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCL  510
                          G  +  +  + P+  I+         R     +  P   +   P CL
Sbjct  252   -------------GGDQNDAGTFFPTIMINQQGFL----RRTQIHQQQPTWQSSRNPNCL  294

Query  509   KENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSG-----NGSRLALSDCHSICWKNCSC  345
                 V    S + +      FR     +S   ++G      G RL+L DC +IC +N SC
Sbjct  295   AAGYVV---SDEPYSYGLTSFR---VTVSSSPSNGFVLNETGGRLSLVDCEAICVQNSSC  348

Query  344   TAYASSSTDGTGCILYT  294
               YAS++ DGTGC +++
Sbjct  349   LPYASANLDGTGCEIWS  365



>ref|XP_006366861.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101-like [Solanum tuberosum]
Length=809

 Score =   223 bits (568),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 139/388 (36%), Positives = 200/388 (52%), Gaps = 64/388 (16%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN----  1224
             A+ +T+ QG ++R  E L SA   F+L FFS+  +       + +Y+GI+YN   N    
Sbjct  18    AQKNTIFQGQHLRVGEKLESANKEFRLEFFSLDAN-------KTQYIGIFYNLPSNMTLF  70

Query  1223  ----EPVWVANRDSPLPDSSG-SLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLD  1059
                  PVWVANRD P+  +SG +L +D DGKLKI Y G    + +   ++  N  ATL D
Sbjct  71    PGDDRPVWVANRDIPIQYASGNTLTLDDDGKLKIFYGGDSFVMLSSYNVTTRNASATLFD  130

Query  1058  SGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSG  879
             +GN V+ E++ NGS    LWQSFDYPTD L+PGMKLG N+KTG +W LTSW+S  VP SG
Sbjct  131   NGNFVLVELNTNGSENKTLWQSFDYPTDTLLPGMKLGRNVKTGQIWSLTSWISKDVPASG  190

Query  878   AFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMT--KEFGFKLVSNEKEKYF  705
             +F +G+D N   +QL+I   G V+WTSG W N +F     ++  +      VS E EKY 
Sbjct  191   SFTIGIDTNDI-DQLIIWWMGSVFWTSGRWGNETFGNVSRVSHYEYVNLSFVSTEDEKYV  249

Query  704   SYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYP  525
             +YS       +++ +D  G I++                              P+   + 
Sbjct  250   TYSVSETRTLSRYVMDTFGFIKERG-------------------------AAGPFGVCFY  284

Query  524   RPV--CLKENPVSCRKSSDVFVQTR------GYFRDDNRNISDVENSGNGSRLALSDCHS  369
             +P   C+ +  + C   +D + + R        FR  N N+S            L DC  
Sbjct  285   KPSAGCVTQESIGCSIRNDSWFKRRPNSVSGNRFRFANNNMS------------LFDCKK  332

Query  368   ICWKNCSCTAYASSSTDGTGCILYTNAA  285
              C KNCSC A+AS +  GTGC +++N +
Sbjct  333   QCEKNCSCAAFASITATGTGCDIWSNVS  360



>ref|XP_010470659.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g67520 isoform X1 [Camelina sativa]
Length=825

 Score =   223 bits (568),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 140/377 (37%), Positives = 200/377 (53%), Gaps = 46/377 (12%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNK------I  1230
             +E+DTL QG  ++D + L SA  IFKL FF+ +       N+ + YLGIW+N       +
Sbjct  22    SETDTLHQGHYLKDGQELVSAFKIFKLKFFNFN-------NSRNLYLGIWFNDLYFDPDV  74

Query  1229  PNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGN  1050
              + PVW+ANR++P+ D SGSL +D+ G+L+I      + +   S  +  N    LLDSGN
Sbjct  75    RDRPVWIANRNNPISDHSGSLTVDSLGRLRILRGSSNMLLELSSTETTRNTTLKLLDSGN  134

Query  1049  LVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFE  870
             L ++E+D +GS   VLWQSFDYPTD L+PGMKLG ++KTG  W+LTSWL D +P SG+F 
Sbjct  135   LQLQEMDPDGSMKRVLWQSFDYPTDTLLPGMKLGFDVKTGKRWELTSWLGDTLPASGSFI  194

Query  869   LGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSY---  699
              G+D N   N L I  R  +YW+SG+W  G F        +F F  VS++  +YF+Y   
Sbjct  195   FGMDAN-ITNVLTILWRENMYWSSGLWYKGRFSVEELNECDFLFSFVSSKSGQYFTYLGG  253

Query  698   -SAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIG-RYASTLECDPYIGNYP  525
                     F    +D  G + ++ +         +   +TW   R  + L     + N P
Sbjct  254   DQNDAGTFFPTIMIDQQGFLSRAQI---------HQQQHTWQSSRNPNCLAAGYVVSNEP  304

Query  524   RPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSC  345
                      VS   SS+ FV                     G RL+L DC +IC +N SC
Sbjct  305   YGFTSFRVTVSS-SSSNGFVLNE-----------------TGGRLSLVDCKAICVQNSSC  346

Query  344   TAYASSSTDGTGCILYT  294
              AYAS++ DGTGC +++
Sbjct  347   LAYASANLDGTGCEIWS  363



>emb|CDY30129.1| BnaC05g37330D [Brassica napus]
Length=840

 Score =   223 bits (568),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 147/382 (38%), Positives = 198/382 (52%), Gaps = 56/382 (15%)
 Frame = -2

Query  1385  SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYN----------  1236
             +DTL+QG  ++  + L SA  IFKL FFS         N+ + YLGIWYN          
Sbjct  21    TDTLLQGQYLKHGQELVSAFNIFKLKFFSFE-------NSSNLYLGIWYNDLYLNGNKQY  73

Query  1235  -KIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLD  1059
               I +  VW+ANR++P+P  SGSL +D+ G+LKI        +   S  +  N    LLD
Sbjct  74    AHIQDRAVWIANRNNPIPGRSGSLTVDSLGRLKILRGASKSLLEITSTETTGNTTLKLLD  133

Query  1058  SGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSG  879
             +GNL ++E+D +GS   VLWQSFDYPTD  +PGMKLG N+KTG  W+LTSWL D +P SG
Sbjct  134   TGNLQLQEMDSDGSVRRVLWQSFDYPTDTFLPGMKLGFNVKTGKRWELTSWLGDTLPASG  193

Query  878   AFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSY  699
             +F  G+D N   N+L+I  RG +YW SG+W    F    +   EF F  VS E E YF +
Sbjct  194   SFVFGMDAN-ITNRLIILWRGNMYWASGLWFKDRFS-LEEFNSEFVFSYVSTESEHYFMF  251

Query  698   SAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRP  519
             S   +Y          G     ++  D    +H       I R    +  + Y G  PR 
Sbjct  252   SVDRHY----------GDTVFPTITIDQKGILH-------INRLDREVYNECY-GKDPR-  292

Query  518   VCLK------ENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSG-----NGSRLALSDCH  372
             +CL       + P   R  S        YFR+    +S    +G      G RL+ +DC 
Sbjct  293   MCLNAGCIVPDMPSGFRNCSPY---GYTYFRE---TVSAFSGNGFVLDETGGRLSSADCR  346

Query  371   SICWKNCSCTAYASSSTDGTGC  306
              +C +NCSC AYAS++ DGTGC
Sbjct  347   VMCLQNCSCLAYASTNRDGTGC  368



>gb|KDO37222.1| hypothetical protein CISIN_1g045212mg, partial [Citrus sinensis]
Length=368

 Score =   213 bits (543),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 143/387 (37%), Positives = 205/387 (53%), Gaps = 61/387 (16%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIP-----  1227
             +++DTL+ G  ++D + L SA   F++GFFS        +++EDRYLGIWY++       
Sbjct  25    SQTDTLLPGQLLKDGDELVSAFGNFRMGFFSY-------MSSEDRYLGIWYHRPTDPSDS  77

Query  1226  ---------NEPVWVANRDSPLPDSSGSLIIDA-DGKLKISYVGG-MITVSNVSIMSGNN  1080
                      N+PVWVANR++P+ D SGSL ID+ DG LKI   GG  I VS+V  M   N
Sbjct  78    HWSYGSPKINQPVWVANRNTPIADKSGSLTIDSRDGNLKILRKGGNSIVVSSVQAMG--N  135

Query  1079  VGATLLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLS  900
               A L ++GN V+ E + +GS    LWQSFDYPTD+L+PGMKLG+NL+TGH W L SW S
Sbjct  136   TSAALYETGNFVLYETNPSGSMERELWQSFDYPTDILLPGMKLGLNLQTGHGWFLRSWTS  195

Query  899   DKVPGSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNE  720
             +  P  G F L +D N  +NQL+I RRG+V WTSG++ +    +A D+  +F F    NE
Sbjct  196   EDSPAEGEFTLNIDPN-VSNQLIIQRRGEVLWTSGLFPHW---RALDLDSDFHFSYTLNE  251

Query  719   KEKYFSYSAKHNY-RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDP  543
             KE+YF+YS   N+  F    +D  G +  +                      A  + C  
Sbjct  252   KERYFNYSLNGNFTSFPTLQIDSRGSLTVTG---------------------ALPISCPG  290

Query  542   YIGNYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSIC  363
               G      C+   P     +   + + RG+   D       + S N SR    DC + C
Sbjct  291   SEGCVRLSSCIGYFPDDFELN---WARKRGFMSVDGFKF---KGSNNTSR---DDCATKC  341

Query  362   WKNCSCTAYA-SSSTDGTGCILYTNAA  285
               NCSC A+A ++  + T C +++  +
Sbjct  342   LSNCSCIAFAITNENNNTACEIWSRGS  368



>ref|XP_006426989.1| hypothetical protein CICLE_v10024887mg [Citrus clementina]
 gb|ESR40229.1| hypothetical protein CICLE_v10024887mg [Citrus clementina]
Length=846

 Score =   223 bits (567),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 150/406 (37%), Positives = 213/406 (52%), Gaps = 68/406 (17%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWY---------  1239
             +++D L++G +++D + L SA   F++GFFS       P  +E+RYLG+WY         
Sbjct  53    SQTDKLLRGQHLKDGDELVSAFGYFRMGFFS-------PDGSENRYLGVWYYRPTDPSVF  105

Query  1238  ---NKIPNEPVWVANRDSPLPDSSGSLIIDA-DGKLKISYVGGMITVSNVSIMSGNNVGA  1071
                N   N+PVWVANR++P+ D SGSL ID+ DG LKI + GG   V   S+ +  N  A
Sbjct  106   DYYNSERNKPVWVANRNNPILDKSGSLTIDSTDGNLKILHNGGNPIVI-TSVKADGNTSA  164

Query  1070  TLLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKV  891
             +LL +GNLV+ E++ +GS    LWQSFDYPTD L+PGMKLG+NL+TGH W L SW+SD  
Sbjct  165   SLLKTGNLVLYEMNSDGSERRELWQSFDYPTDTLLPGMKLGINLQTGHQWFLQSWISDFS  224

Query  890   PGSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEK  711
             P  G++ LG+D N   NQL+I  RG VYWTS +W  G F     ++  + F   S+E EK
Sbjct  225   PAQGSYTLGIDPN-VPNQLIIWWRGDVYWTSEIWPKGWFHSYSLVSDGYNFGYTSSEHEK  283

Query  710   YFSYSAKHNYRFTKW-TLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIG  534
             YF+YSA  N   T +  L L  +    +L                   YA  +   P   
Sbjct  284   YFNYSA--NETITSFPVLRLTANGLSGAL-------------------YADGIVKSP---  319

Query  533   NYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKN  354
                          SC K         G+   D     + +N      + LSDC   C++N
Sbjct  320   -------------SCSKDFSYIEYKYGFMNGDGFKFKESDN------MTLSDCKVKCFQN  360

Query  353   CSCTAYAS-SSTDGTGCILYTNAAHDFQLDENGELYIYRLLKEHKG  219
             CSC AYAS + ++ TGC ++++    F +    +  I  + +E KG
Sbjct  361   CSCVAYASINESNDTGCEIWSSGTK-FTVTSITDRRIIFMAREAKG  405



>ref|XP_010249749.1| PREDICTED: LOW QUALITY PROTEIN: G-type lectin S-receptor-like 
serine/threonine-protein kinase CES101 [Nelumbo nucifera]
Length=825

 Score =   222 bits (565),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 160/417 (38%), Positives = 220/417 (53%), Gaps = 52/417 (12%)
 Frame = -2

Query  1421  MGFSS-YVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGI  1245
             + F+S Y +  A SDTL QG  +RD   L S   +FKLG F+       P  +++RYLGI
Sbjct  24    LAFASLYAAATAASDTLRQGQVLRD--DLVSRSGMFKLGTFN-------PGASKNRYLGI  74

Query  1244  WYNKIPNEPV-WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITV--SNVSIMSGN--N  1080
             W     +  V WVANRD P+ DSSGSL++D  G L ++  GG   V  SN +  + N  N
Sbjct  75    WMEDAEDRKVVWVANRDKPIVDSSGSLMLDDRGNLNLTIGGGRFIVLNSNQTTTAANTSN  134

Query  1079  VGATLLDSGNLVVR---EVDGNGSFGG---VLWQSFDYPTDVLVPGMKLGVNLKTGHVWK  918
             + ATLLDSGN V+      + NGS G    VLWQSFDYPTD L+ GMKLG N KTG  W 
Sbjct  135   LTATLLDSGNFVLTGDVSFNANGSAGVKRVVLWQSFDYPTDTLLAGMKLGFNFKTGRNWS  194

Query  917   LTSWLSDKVPGSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEF--  744
             LTSW++D++P  GAF LGL+ +    QL+I RRG+VYW SG W      +  D+   F  
Sbjct  195   LTSWINDQIPAPGAFTLGLNPS-ATTQLLIWRRGEVYWNSGDWNFSG--RRFDIVLWFTT  251

Query  743   ---GFKLVSNEKEKYFSYS------AKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMP  591
                  + VSNE EKYF +S      +   +    W +D  G      LI +     H   
Sbjct  252   AVSNLRYVSNEDEKYFIFSPYQEKESDSRHVVNGWVMDSGG------LISNYGLAKHLNS  305

Query  590   MYTWIGRYASTLEC-DPYIGNYPRPVCLKENPV-SCRKSSDVFVQTRGYFRDDNRNISDV  417
             M   + R +  LEC +P    Y  P C+++  +  CR+  + F+  RG        I   
Sbjct  306   ME--LARTSLVLECLNPSNEPYWSPGCVEQKKLPECRRGDEEFLDRRGQIVGQPLQID--  361

Query  416   ENSGNGSRLALSDCHSICWKNCSCTAYASSSTDGTGCILYTNAAHDFQLDENGELYI  246
                 +   L ++DC + CW  C C AYA+++ + TGC L+ N   +F  D+ G+ Y+
Sbjct  362   ----SDPSLGITDCDAKCWSICDCVAYATANDNETGCQLW-NQDFEFFSDDYGKEYV  413



>dbj|BAB02668.1| receptor kinase 1 [Arabidopsis thaliana]
Length=805

 Score =   221 bits (563),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 153/407 (38%), Positives = 211/407 (52%), Gaps = 57/407 (14%)
 Frame = -2

Query  1415  FSSYVSVG---AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGI  1245
             F+ Y+ +G    ++DTL+QG  ++D + L SA  IFKL FF+         N+ + YLGI
Sbjct  11    FTFYLFLGQSCCQTDTLLQGQYLKDGQELVSAFNIFKLKFFNFE-------NSSNWYLGI  63

Query  1244  WYNK------------IPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNV  1101
             WYN             I ++ VW+ANR++P+   SGSL +D+ G+L+I   G    +   
Sbjct  64    WYNNFYLSGGNKKYGDIKDKAVWIANRNNPVLGRSGSLTVDSLGRLRI-LRGASSLLELS  122

Query  1100  SIMSGNNVGATLLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVW  921
             S  +  N    LLDSGNL ++E+D +GS    LWQSFDYPTD L+PGMKLG N+KTG  W
Sbjct  123   STETTGNTTLKLLDSGNLQLQEMDSDGSMKRTLWQSFDYPTDTLLPGMKLGFNVKTGKRW  182

Query  920   KLTSWLSDKVPGSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFG  741
             +LTSWL D +P SG+F  G+D N   N+L I   G VYW SG+W  G F      T  F 
Sbjct  183   ELTSWLGDTLPASGSFVFGMDDN-ITNRLTILWLGNVYWASGLWFKGGFSLEKLNTNGFI  241

Query  740   FKLVSNEKEKYFSYSAKHNY---RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGR  570
             F  VS E E YF YS   NY    F +  +D  G +++ +L       +H  P       
Sbjct  242   FSFVSTESEHYFMYSGDENYGGPLFPRIRIDQQGSLQKINLD-GVKKHVHCSP-----SV  295

Query  569   YASTLECDPYIGNYPRPVCLKENPVS--------------CRKSSDVFVQTR-GY-FRDD  438
             +   LE   Y  N+   V  +   V+               RK+ D+   +R GY FR+ 
Sbjct  296   FGEELEYGCYQQNFRNCVPARYKEVTGSWDCSPFGFGYTYTRKTYDLSYCSRFGYTFRE-  354

Query  437   NRNISDVENSGN-----GSRLALSDCHSICWKNCSCTAYASSSTDGT  312
                +S    +G      G RL+  DC+  C +NCSC AYAS++ DG 
Sbjct  355   --TVSPSAENGFVFNEIGRRLSSYDCYVKCLQNCSCVAYASTNGDGV  399



>ref|XP_008228523.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 [Prunus mume]
Length=783

 Score =   219 bits (559),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 141/370 (38%), Positives = 193/370 (52%), Gaps = 37/370 (10%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVW  1212
             +++DTL QG  ++D   L SA  IF+LGFF        P N+   YLGIWYN+   +  W
Sbjct  24    SQTDTLAQGQQLKDGMQLFSASGIFRLGFFK-------PGNSNTSYLGIWYNRNNEKAAW  76

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISY-VGGMITVSNVSIMSGNNVGATLLDSGNLVVRE  1035
             +ANR++P+ ++SG L ID  G LKI Y +G  I + +V      N  ATLLDSGN V+ E
Sbjct  77    IANRNNPILENSGVLTIDQYGNLKILYNIGDSIELYSVH-QEAINTSATLLDSGNFVLSE  135

Query  1034  VDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDI  855
             ++ +GS    LWQSFDYPT  L+P MKLG + KTG  W L SW +D +P  G+F LGLD 
Sbjct  136   LNPDGSIKQELWQSFDYPTGTLLPKMKLGFDRKTGLNWTLNSWRTDNLPAMGSFTLGLDP  195

Query  854   NGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTK--EFGFKLVSNEKEKYFSYSA-KHN  684
              G   Q+VI  RG +YWTSG W NG F    +     ++ F  +SN  E YFSYS  K  
Sbjct  196   TGL-KQMVIWWRGSIYWTSGPWNNGCFSFMYEFCNYYKYNFSYISNGNETYFSYSVDKGT  254

Query  683   YRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKE  504
               F +  L   G +    +  D  F               + + C     +  +  C+++
Sbjct  255   TIFPRLMLSAGGELRGFGM--DSMF---------------TGVSCTSSTNSSLKDGCVQQ  297

Query  503   NPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSS  324
                 CR   + F+   G          + +N      L L DC   C+K CSC AYAS++
Sbjct  298   KLPDCRSPGEKFLLKMGLMSRGGIKFHENQN------LTLIDCWDECFKLCSCIAYASAN  351

Query  323   TDGTGCILYT  294
              DGTGC ++T
Sbjct  352   -DGTGCEIWT  360



>ref|XP_007216127.1| hypothetical protein PRUPE_ppa018966mg [Prunus persica]
 gb|EMJ17326.1| hypothetical protein PRUPE_ppa018966mg [Prunus persica]
Length=738

 Score =   219 bits (557),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 139/359 (39%), Positives = 185/359 (52%), Gaps = 36/359 (10%)
 Frame = -2

Query  1358  IRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVWVANRDSPLPDS  1179
             +R W+    A  IF+LGFF        P N+   YLGIWYN+   +  W+ANR++P+ ++
Sbjct  1     MRKWQEREEASGIFRLGFFK-------PGNSNTSYLGIWYNRNNEKAAWIANRNNPILEN  53

Query  1178  SGSLIIDADGKLKISY-VGGMITVSNVSIMSGNNVGATLLDSGNLVVREVDGNGSFGGVL  1002
             SG L ID  G LKI Y +G  I + +V      N  ATLLDSGN V+ E++ +GS    L
Sbjct  54    SGVLTIDQYGNLKILYNIGDSIELYSVH-QEAVNTSATLLDSGNFVLSELNPDGSIKQEL  112

Query  1001  WQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDINGCNNQLVISR  822
             WQSFDYPT  L+P MKLG + KTG  W LTSW +D +P  G+F LGLD  G   Q+VI  
Sbjct  113   WQSFDYPTGTLLPKMKLGFDRKTGLNWTLTSWRTDNLPAIGSFTLGLDPTGL-KQMVIWW  171

Query  821   RGKVYWTSGVWKNGSFEKAPDMTK--EFGFKLVSNEKEKYFSYSA-KHNYRFTKWTLDLL  651
             RG +YWTSG W NG F    +     ++ F  +SN  E YFSYS  K    F +  L   
Sbjct  172   RGSIYWTSGPWNNGCFSFMYEFCNYYKYNFSYISNGNETYFSYSVDKGTTIFPRLMLSAE  231

Query  650   GHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKENPVSCRKSSDV  471
             G +    +  D  F               + + C     +  +  C++E    CR   + 
Sbjct  232   GELRGFGM--DSIF---------------TGVSCTSSTNSSLKDGCVQEKLPDCRSPGEK  274

Query  470   FVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSSTDGTGCILYT  294
             FV   G          + EN      L L DC   C+K CSC AYAS++ DGTGC ++T
Sbjct  275   FVLKMGLMSRGGIKFHENEN------LTLIDCWDECFKLCSCIAYASANDDGTGCEIWT  327



>ref|XP_010652590.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 [Vitis vinifera]
 ref|XP_010652591.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 [Vitis vinifera]
Length=735

 Score =   218 bits (556),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 145/386 (38%), Positives = 211/386 (55%), Gaps = 42/386 (11%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWY-NKIPNEPV  1215
             A +D++  G  ++  + L SA+  F LGFF I D+ S        YLGIWY + + N+ V
Sbjct  38    AHTDSIKPGEGLQFSKLLVSAQGTFTLGFF-ILDTRS--------YLGIWYTSDVNNKKV  88

Query  1214  WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVRE  1035
             WVANRD+P+  ++ +L++D +G L I + GG   V N +  S N++ ATLLDSGN VV  
Sbjct  89    WVANRDNPISGTNANLMLDGNGTLMIIHSGGDPIVLNSNQASRNSI-ATLLDSGNFVVSA  147

Query  1034  VDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDI  855
             ++ +GS    LW+SFD PTD L+PGMKLG+NLKTG  W L SW++++VP  G F   L+ 
Sbjct  148   LNSDGSVKQTLWESFDDPTDTLLPGMKLGINLKTGQNWSLASWINEQVPDPGTFT--LEW  205

Query  854   NGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSYSAKHNYRF  675
             NG   QLVI RRG +YW+SG+ K+ SFE        + F  V N+ E YFSYS +     
Sbjct  206   NG--TQLVIKRRGDIYWSSGILKDRSFEFIQTHHNIYYFISVCNDNEIYFSYSVQDG-AI  262

Query  674   TKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKENPV  495
             +KW L+  G            FF  Y  +      +     CDPY   YP   C  + P 
Sbjct  263   SKWVLNWRG-----------GFFDTYGTL------FVKEDMCDPY-DKYPG--CAVQEPP  302

Query  494   SCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSSTDG  315
             +CR +   F++ +        ++ +++ S     L LSDC +IC  NCSCTA  +  T+ 
Sbjct  303   TCRTTDFQFMK-QSVLNSGYPSLMNIDTS-----LGLSDCQAICRNNCSCTACNTVFTNE  356

Query  314   TGCILYTNAAHDFQLDENGELYIYRL  237
             TGC  + +     ++ +  +  +Y L
Sbjct  357   TGCQFWRDKLPRARVGDANQEELYVL  382



>emb|CDX97717.1| BnaA05g23620D [Brassica napus]
Length=900

 Score =   219 bits (559),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 139/376 (37%), Positives = 198/376 (53%), Gaps = 54/376 (14%)
 Frame = -2

Query  1385  SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYN----------  1236
             +DTL+QG  ++D + L SA  IFKL FFS         N+ + YLGIWYN          
Sbjct  25    TDTLLQGQYLKDGQELVSAFNIFKLKFFSFE-------NSSNLYLGIWYNDLYLNGNKQY  77

Query  1235  -KIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLD  1059
               I +  VW+ANR+SP+   SGSL +D+ G+LKI        +   S  +  N    LLD
Sbjct  78    AHIQDRAVWIANRNSPISGRSGSLTVDSLGRLKILGGASKSLLEITSTETTGNTTLKLLD  137

Query  1058  SGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSG  879
             +GNL ++E+D +GS   ++W+SFDYPTD  +PGMKLG N+KTG  W+LTSWL D +P SG
Sbjct  138   TGNLQLQEMDSDGSVRRIVWESFDYPTDTFLPGMKLGFNVKTGKRWELTSWLGDTLPASG  197

Query  878   AFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSY  699
             +F  G+D N   N+L+I  RG +YW SG+W    F      + EF F  VS E E YF  
Sbjct  198   SFVFGMDAN-ITNRLIILWRGNMYWASGLWFKDRFSLEEFNSYEFVFSYVSTESEHYFML  256

Query  698   SAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRP  519
             S   +Y  T +           ++  D    +H       + R  + + C          
Sbjct  257   SVDRHYSDTVF----------PTITIDQKGILH----INRLDREVTHVRC----------  292

Query  518   VCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSG-----NGSRLALSDCHSICWKN  354
              C+  + +S  ++      T  YFR+    +S   ++G      G RL+ +DC ++C +N
Sbjct  293   -CIVPDMLSGHRNCSPSGYT--YFRE---TVSAFSSNGFVLNETGGRLSSADCRAMCIQN  346

Query  353   CSCTAYASSSTDGTGC  306
             CSC AYAS++ DGTGC
Sbjct  347   CSCLAYASTNGDGTGC  362



>ref|XP_002267797.3| PREDICTED: S-locus-specific glycoprotein S6-like [Vitis vinifera]
Length=529

 Score =   214 bits (545),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 143/386 (37%), Positives = 209/386 (54%), Gaps = 42/386 (11%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNK-IPNEPV  1215
             A +D++  G  ++  + L S++  F LGFF I D+ S        YLGIWY   + N+ V
Sbjct  38    AHTDSIKPGEGLQFSKLLVSSQGTFTLGFF-ILDTRS--------YLGIWYTSDVNNKKV  88

Query  1214  WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVRE  1035
             WVANRD+P+  ++ +L++D +G L I + GG   V N +  S N++ ATLLDSGN VV  
Sbjct  89    WVANRDNPISGTNANLMLDGNGTLMIIHSGGDPIVLNSNQASRNSI-ATLLDSGNFVVSA  147

Query  1034  VDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDI  855
             ++ +GS    LW+SFD PTD L+PGMKLG+NLKTG  W L SW++++VP  G F   L+ 
Sbjct  148   LNSDGSVKQTLWESFDDPTDTLLPGMKLGINLKTGQNWSLASWINEQVPDPGTFT--LEW  205

Query  854   NGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSYSAKHNYRF  675
             NG   QLV+ RRG +YW+SG+ K+ SFE        + F  V N+ E YFSYS +     
Sbjct  206   NG--TQLVMKRRGDIYWSSGIPKDRSFEFIQTHHNIYYFISVCNDNEIYFSYSVQDGA-I  262

Query  674   TKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKENPV  495
             +KW L+  G            FF  +  +      +     CD Y   YP   C  + P 
Sbjct  263   SKWVLNSRG-----------GFFDTHGTL------FVKEDMCDRY-DKYPG--CAVQEPP  302

Query  494   SCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSSTDG  315
             +CR     F++ +        ++ +++ S     L LSDC +IC  NCSCTA  +  T+G
Sbjct  303   TCRTRDFQFMK-QSVLNSGYPSLMNIDTS-----LGLSDCQAICRNNCSCTACNTVFTNG  356

Query  314   TGCILYTNAAHDFQLDENGELYIYRL  237
             TGC  + +     Q+ +  +  +Y L
Sbjct  357   TGCQFWRDKLPRAQVGDANQEELYVL  382



>gb|AFO11039.1| S domain subfamily 1 receptor-like kinase [Arabidopsis thaliana]
Length=881

 Score =   219 bits (557),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 142/389 (37%), Positives = 198/389 (51%), Gaps = 53/389 (14%)
 Frame = -2

Query  1385  SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI--------  1230
             +DTL QG  ++D E L S   IFKL FF++ +S      +   YLGIWYN +        
Sbjct  24    TDTLQQGQYLKDGEELNSPFNIFKLKFFNLKNS------SNWWYLGIWYNSLYLHNSNNY  77

Query  1229  --PNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDS  1056
                +  VW+ANRD+P+   SGSL +D+ G+LKI      +   + +  +GN +   LLDS
Sbjct  78    DSEDRAVWIANRDNPISGRSGSLTVDSLGRLKILRGSSSLLDLSSTETTGNTI-LKLLDS  136

Query  1055  GNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGA  876
             GNL ++E+D  GS   +LWQSFDYPTD L+PGMKLG N++TG  W+LTSWL D  P SG+
Sbjct  137   GNLQLQEMDSGGSMKRILWQSFDYPTDTLLPGMKLGFNVETGKRWELTSWLGDTSPASGS  196

Query  875   FELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE-FGFKLVSNEKEKYFSY  699
             F  G+D N   N+L I  RG ++W SG+W  G F       K  FG   VS + E+YF Y
Sbjct  197   FVFGMDAN-VTNRLTILWRGNLFWASGLWFKGQFLMDEVYNKLGFGVSFVSTKSEQYFIY  255

Query  698   SAKHNY---RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNY  528
             S   NY    F +  +D  G ++ +                  +      + C P  G  
Sbjct  256   SGDQNYGGTLFPRIRIDQHGTLQTT----------------IDLNSVKRHVRCSPVFGGE  299

Query  527   PRPVCLKENPVSC--------RKSSDVFVQTRGYFRDDNRNISDVENSGNG-------SR  393
                 C  +N ++C         K+ +       +  DDN   +   + GNG        R
Sbjct  300   LDYGCYLKNSMNCVHKVYGDVDKNGNCPQHRNCWSFDDNFRDTVFPSLGNGFIISETDGR  359

Query  392   LALSDCHSICWKNCSCTAYASSSTDGTGC  306
             L+  DC+  C +NCSC AYAS+  DG+GC
Sbjct  360   LSSYDCYVKCLQNCSCLAYASTRADGSGC  388



>emb|CAN67086.1| hypothetical protein VITISV_031091 [Vitis vinifera]
Length=660

 Score =   216 bits (551),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 144/386 (37%), Positives = 210/386 (54%), Gaps = 42/386 (11%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWY-NKIPNEPV  1215
             A +D++  G  ++  + L SA+  F LGFF I D+ S        YLGIWY + + N+ V
Sbjct  25    AHTDSIKPGEGLQFSKLLVSAQGTFTLGFF-ILDTRS--------YLGIWYTSDVNNKKV  75

Query  1214  WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVRE  1035
             WVANRD+P+  ++ +L++D +G L I + GG   V N +  S N++ ATL DSGN VV  
Sbjct  76    WVANRDNPISGTNANLMLDGNGTLMIIHSGGDPIVLNSNQASRNSI-ATLFDSGNFVVSA  134

Query  1034  VDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDI  855
             ++ +GS    LW+SFD PTD L+PGMKLG+NLKTG  W L SW++++VP  G F   L+ 
Sbjct  135   LNSDGSVKQTLWESFDDPTDTLLPGMKLGINLKTGQNWSLASWINEQVPDPGTFT--LEW  192

Query  854   NGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSYSAKHNYRF  675
             NG   QLVI RRG +YW+SG+ K+ SFE        + F  V N+ E YFSYS +     
Sbjct  193   NG--TQLVIKRRGDIYWSSGILKDRSFEFIQTHHNIYYFISVCNDNEIYFSYSVQDG-AI  249

Query  674   TKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKENPV  495
             +KW L+  G            FF  Y  +      +     CDPY   YP   C  + P 
Sbjct  250   SKWVLNWRG-----------GFFDTYGTL------FVKEDMCDPY-DKYPG--CAVQEPP  289

Query  494   SCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSSTDG  315
             +CR +   F++ +        ++ +++ S     L LSDC +IC  NCSCTA  +  T+ 
Sbjct  290   TCRTTDFQFMK-QSVLNSGYPSLMNIDTS-----LGLSDCQAICRNNCSCTACNTVFTNE  343

Query  314   TGCILYTNAAHDFQLDENGELYIYRL  237
             TGC  + +     ++ +  +  +Y L
Sbjct  344   TGCQFWRDKLPRARVGDANQEELYVL  369



>ref|XP_010545710.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X3 [Tarenaya hassleriana]
Length=840

 Score =   218 bits (555),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 143/386 (37%), Positives = 201/386 (52%), Gaps = 66/386 (17%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVW  1212
             +E+DTL++G  ++D + L SA  IFKLGFFS   S            G W     +  VW
Sbjct  22    SETDTLLKGQFLKDEQELVSAFRIFKLGFFSPGKS------------GKW-----DRVVW  64

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
             +ANR+ P+ + SGSLIID+ GKLKI   G +  V   S  +  N    +LDSGNL ++E+
Sbjct  65    IANRNDPISNHSGSLIIDSLGKLKI-LRGAVDPVELSSTETTGNTTLKMLDSGNLQLQEM  123

Query  1031  DGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDIN  852
             D +GS   +LWQSFDYPTD L+PGMKLG N++TG +W+LTSWL   +P SG+F  G+D N
Sbjct  124   DSDGSVKRILWQSFDYPTDTLLPGMKLGFNVRTGKIWELTSWLEKDLPASGSFTFGMDPN  183

Query  851   GCNNQLVISRRGKVYWTSGVWKNGSFEKAPD-MTKEFGFKLVSNEKEKYFSYSAKHNY--  681
                N+L+   RG +YW SG+W  G F    +   + F F  VS E E+ F YSA H Y  
Sbjct  184   -VTNRLISLWRGNLYWASGLWFKGLFSLQGNWENRNFVFSFVSTESEESFLYSA-HLYGA  241

Query  680   -RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKE  504
               F +  +D  G ++  SL  +                  S ++C P+  +  +  C +E
Sbjct  242   TSFPRIMIDNQGVLQIISLHGE-----------------ESHVDCSPFAKDEAKYQCYRE  284

Query  503   NPV--SCRKSS------------------DVFVQTRGYFRDDNRNISDVENSGNGSRLAL  384
                  + RKS+                  + F +T   F      +S+      G R++ 
Sbjct  285   RQYNNTYRKSTVYQFGCSGQEFPECLGLCNFFTETEAPFSSKGFQLSE-----TGGRVSS  339

Query  383   SDCHSICWKNCSCTAYASSSTDGTGC  306
              DC++ C  NCSC AYAS + DGTGC
Sbjct  340   YDCYNACVHNCSCLAYASVNADGTGC  365



>ref|XP_010666132.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g67520 [Beta vulgaris subsp. vulgaris]
Length=840

 Score =   218 bits (555),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 151/409 (37%), Positives = 215/409 (53%), Gaps = 70/409 (17%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDS----YSGPINTEDRYLGIWYN  1236
             +S  A +DTL Q   + + E L SA  +F LGF +        Y  P NT+  Y+GIWY 
Sbjct  19    ISSYAVTDTLKQSYQLNNGEFLVSAGKVFTLGFINPEGKQTIGYFNPENTQISYIGIWYT  78

Query  1235  -KIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVG---AT  1068
               +   PVW+ANR+ P+   SG+L I+ +G LKI        ++++   SG  V    A 
Sbjct  79    YDVAKRPVWIANRNKPVSKISGALKIEKNGDLKILDK----DLTHMIFKSGGGVARRVAV  134

Query  1067  LLDSGNLVVREVDGNGSFGG-VLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKV  891
             L D+GN V+RE++ +GS G  +LWQSFDYPT+ L+ GM+LG NLK G  W LTSW+SD++
Sbjct  135   LTDTGNFVLREMNSDGSAGHEILWQSFDYPTETLLLGMRLGFNLKRGQNWSLTSWVSDEL  194

Query  890   PGSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEK  711
             P +GAF LG+D NG  +QL++ +RG++ W SGVWKNG F    D   +F +  VSN+ E 
Sbjct  195   PATGAFTLGVDPNG-TSQLIMWKRGEIQWRSGVWKNGKFPNLKDYLYKFDY--VSNDDET  251

Query  710   YFSYSAKHNY---RFTKWTLDLLGHI----------EQSSLIYDPSFFIHYMPMYTWIGR  570
             YF+ SA++ +    F  + +D  G +           QSSL                   
Sbjct  252   YFTLSAENTWWDNSFPMYQIDQKGEVLNFQRSTSKGSQSSL-------------------  292

Query  569   YASTLECDPYIGNYPRPVCLKENPVSCRKSSDVFVQTRGY-----FRDDNRNISDVENSG  405
               S ++C  +  NY +  C+++    CR  S  F  +RGY     F+ DN N        
Sbjct  293   -TSIVDCKRH-KNY-QAGCVEQKLPGCRIDS-WFDSSRGYALSEGFKYDNGN--------  340

Query  404   NGSRLALSDCHSICWKNCSCTAYASSSTDGTGCILYTNAAHDFQLDENG  258
                 L + DC   C+ NCSC AY     + TGC L++N     QL E+G
Sbjct  341   --QLLGMVDCEDKCFYNCSCVAYTFIYPNQTGCELWSNLT---QLREDG  384



>gb|KDO56866.1| hypothetical protein CISIN_1g046791mg [Citrus sinensis]
Length=1018

 Score =   219 bits (557),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 160/456 (35%), Positives = 227/456 (50%), Gaps = 95/456 (21%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIP-----  1227
             +++DTL+ G  ++D + L SA   F++GFFS        +++ DRYLGIWY++       
Sbjct  25    SQTDTLLLGQLLKDGDELVSAFGNFRMGFFSY-------MSSGDRYLGIWYHRPTDPSDS  77

Query  1226  ---------NEPVWVANRDSPLPDSSGSLIIDA-DGKLKISYVGG-MITVSNVSIMSGNN  1080
                      N+PVWVANR++P+ D SGSL ID+ DG LKI   GG  I VS+V  M   N
Sbjct  78    HWSYGSPKINQPVWVANRNTPITDKSGSLTIDSRDGNLKILRKGGNSIVVSSVQAMG--N  135

Query  1079  VGATLLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLS  900
               A L ++GN V+ E++ +GS    LWQSFDYPTD+L+PGMKLG+NL+TGH W L SW S
Sbjct  136   TSAALYETGNFVLYEMNPSGSMERELWQSFDYPTDILLPGMKLGLNLQTGHEWFLRSWTS  195

Query  899   DKVPGSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNE  720
             +  P  G F L +D N  +NQL+I RRG+V WT G++ +    +A D+  +F F   SNE
Sbjct  196   EDSPAEGEFTLNIDPN-VSNQLIIQRRGEVLWTCGLFPHW---RAVDLDSDFHFSYTSNE  251

Query  719   KEKYFSYSAKHNY-RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDP  543
             KE+YF+YS   N+  F    +D  G +  +  +                           
Sbjct  252   KERYFNYSLNGNFTSFPTLQIDSKGSLTVTGAL---------------------------  284

Query  542   YIGNYPRPVCLKENPVSCRKSSDV--FVQTRGYFRDD-------NRNISDVE-----NSG  405
                           P+SC  S         +GYF DD        R    V+      S 
Sbjct  285   --------------PISCPGSEGCVRLSSCKGYFLDDFELNWARKRGFMSVDGFKFKGSN  330

Query  404   NGSRLALSDCHSICWKNCSCTAYA-SSSTDGTGCILYTNAAHDFQLDENGELYIYRLLKE  228
             N SR    DC + C  NCSC A+A ++  + T C +++  +  F  D N     Y  + E
Sbjct  331   NMSR---DDCATKCLSNCSCIAFAITNKNNNTACEIWSRGSK-FIEDNNNTDARYISVWE  386

Query  227   HKG*ILVNVRYCCFTVIQVFCVFVNVPFVLEGCSLC  120
              KG   +  + C   +I    + V +P  +  CSLC
Sbjct  387   PKG---IEEKKCWLCLI--IPLAVALPVGILSCSLC  417


 Score = 78.2 bits (191),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 67/151 (44%), Gaps = 52/151 (34%)
 Frame = -2

Query  1385  SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNE-PVWV  1209
             SD L QG  +RD + L SA   F+L FFS       P +T   YLGIWY+K  +E  VW 
Sbjct  799   SDKLQQGQVLRDGDQLVSAFGRFRLAFFS-------PRSTTKHYLGIWYDKSEDELLVWD  851

Query  1208  ANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREVD  1029
             ANRD+P+ D SG L                                            V 
Sbjct  852   ANRDTPVLDKSGRL--------------------------------------------VK  867

Query  1028  GNGSFGGVLWQSFDYPTDVLVPGMKLGVNLK  936
              +G+   VLW SF+YP D L+ GMKLG+N K
Sbjct  868   TDGTIKRVLWLSFEYPADTLLHGMKLGINPK  898



>gb|KDO56868.1| hypothetical protein CISIN_1g043278mg [Citrus sinensis]
Length=752

 Score =   217 bits (552),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 146/397 (37%), Positives = 206/397 (52%), Gaps = 63/397 (16%)
 Frame = -2

Query  1340  LTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN----------------EPVWV  1209
             L SA   FKLGFFS + S      T +RYLGIW++  P+                EP+W+
Sbjct  3     LVSAFGNFKLGFFSPASS-----TTTERYLGIWHDTAPDTLGWYFRPFLPRYQTDEPIWI  57

Query  1208  ANRDSPLPDSSGSLIIDA-DGKLKISYVGG-MITVSNVSIMSGNNVGATLLDSGNLVVRE  1035
             ANR++P+ D SG L ID+ DG LKI + GG  I VS+V   S NN  ATLL SGNLV+RE
Sbjct  58    ANRNTPILDQSGVLTIDSIDGNLKILHNGGNPIAVSSVEGAS-NNTSATLLQSGNLVLRE  116

Query  1034  VDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDI  855
             +D +G+   VLWQSFDYPTD L+PGMKLG+NL+TGH W L SWL    P  G+F LG++ 
Sbjct  117   MDTDGTIKRVLWQSFDYPTDTLLPGMKLGINLQTGHQWFLQSWLDYSSPAQGSFTLGIEP  176

Query  854   NGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSYSAKHNYRF  675
             N  N  ++  RR  +YWTSG+  NG+F  +      F +   SNE+EKYF YS       
Sbjct  177   NATNQLIIRWRRETIYWTSGLLLNGNFNFSRSWNLSFSY--TSNEQEKYFEYSLNEGVTS  234

Query  674   TKW-TLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKENP  498
             + +  +D  G +  S   + P          T+ G +             PRP+C K   
Sbjct  235   SVFLRIDPEGALSDSRGSFAPC---------TYGGCW----------NQLPRPICRKGTG  275

Query  497   VSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSSTD  318
                 +S    +   G+   ++ N+S             +DC + C+ NCSC A+A+ +++
Sbjct  276   PENFQSKVGLISEHGFKFKESDNMSS------------TDCRANCFYNCSCIAFATGTSE  323

Query  317   GTG----CILYTNAAHDFQLDENGELYIYRL-LKEHK  222
              T     C +++      ++  N    I+ L +KE K
Sbjct  324   YTDKQAYCEIWSEGTEFTEIASNNSREIFILAIKEEK  360



>ref|XP_010545709.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X2 [Tarenaya hassleriana]
Length=846

 Score =   218 bits (554),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 141/386 (37%), Positives = 201/386 (52%), Gaps = 60/386 (16%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVW  1212
             +E+DTL++G  ++D + L SA  IFKLGFFS   S               +  + +  VW
Sbjct  22    SETDTLLKGQFLKDEQELVSAFRIFKLGFFSPGKSGKCT-----------FGDLRDRVVW  70

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
             +ANR+ P+ + SGSLIID+ GKLKI   G +  V   S  +  N    +LDSGNL ++E+
Sbjct  71    IANRNDPISNHSGSLIIDSLGKLKI-LRGAVDPVELSSTETTGNTTLKMLDSGNLQLQEM  129

Query  1031  DGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDIN  852
             D +GS   +LWQSFDYPTD L+PGMKLG N++TG +W+LTSWL   +P SG+F  G+D N
Sbjct  130   DSDGSVKRILWQSFDYPTDTLLPGMKLGFNVRTGKIWELTSWLEKDLPASGSFTFGMDPN  189

Query  851   GCNNQLVISRRGKVYWTSGVWKNGSFEKAPD-MTKEFGFKLVSNEKEKYFSYSAKHNY--  681
                N+L+   RG +YW SG+W  G F    +   + F F  VS E E+ F YSA H Y  
Sbjct  190   -VTNRLISLWRGNLYWASGLWFKGLFSLQGNWENRNFVFSFVSTESEESFLYSA-HLYGA  247

Query  680   -RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKE  504
               F +  +D  G ++  SL  +                  S ++C P+  +  +  C +E
Sbjct  248   TSFPRIMIDNQGVLQIISLHGE-----------------ESHVDCSPFAKDEAKYQCYRE  290

Query  503   NPV--SCRKSS------------------DVFVQTRGYFRDDNRNISDVENSGNGSRLAL  384
                  + RKS+                  + F +T   F      +S+      G R++ 
Sbjct  291   RQYNNTYRKSTVYQFGCSGQEFPECLGLCNFFTETEAPFSSKGFQLSE-----TGGRVSS  345

Query  383   SDCHSICWKNCSCTAYASSSTDGTGC  306
              DC++ C  NCSC AYAS + DGTGC
Sbjct  346   YDCYNACVHNCSCLAYASVNADGTGC  371



>emb|CDO98047.1| unnamed protein product [Coffea canephora]
Length=761

 Score =   216 bits (550),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 126/262 (48%), Positives = 166/262 (63%), Gaps = 17/262 (6%)
 Frame = -2

Query  1385  SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNE--PVW  1212
             +DT++QG  +RDW+ L SA    +L FFS       P ++  RYLGI+ N+ P++  PVW
Sbjct  30    NDTILQGEELRDWQQLVSASNFCRLQFFS-------PGSSRTRYLGIFLNQSPDDLRPVW  82

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGG-MITVSNVSIMSGNNVGATLLDSGNLVVRE  1035
             +ANRD+P+PD+SGSL I  DG+L I   GG  I +S+    +G NV  TLLD+GNLV+RE
Sbjct  83    IANRDNPIPDASGSLKIAPDGRLNIYSSGGSAIALSSAPSSAGGNVSVTLLDNGNLVLRE  142

Query  1034  VDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLS-DKVPGSGAFELGLD  858
             +  NGSF   LWQSFDYPT+ L+PGMK+G+NL+TGH W L S +S D+VP SG F LG+D
Sbjct  143   LYFNGSFKQTLWQSFDYPTNTLLPGMKIGINLRTGHRWSLVSPVSQDQVPASGPFILGID  202

Query  857   INGCNNQLVISRRGKVYWTSGVWKNGSFEKA-PDMTKEFGFKLVSNEKEKYFSYSAK-HN  684
              NG   QL+I  R KV W SG+W +G F  A PD      F  VS+  EK F Y++  HN
Sbjct  203   QNG-TGQLMIWWREKVVWNSGIWLDGHFACANPDY---INFTFVSDGDEKSFVYTSNTHN  258

Query  683   YRFTKWTLDLLGHIEQSSLIYD  618
                T + L+    I +  L  D
Sbjct  259   RSMTTYKLEPTCWITEEGLQVD  280



>ref|XP_006299249.1| hypothetical protein CARUB_v10015398mg [Capsella rubella]
 gb|EOA32147.1| hypothetical protein CARUB_v10015398mg [Capsella rubella]
Length=816

 Score =   216 bits (550),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 148/406 (36%), Positives = 205/406 (50%), Gaps = 48/406 (12%)
 Frame = -2

Query  1385  SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNK---------  1233
             +DTL+QG  ++D + L S  +IFKL FF+  +S S        YLGIWYN          
Sbjct  24    TDTLLQGQYLKDGKELNSPFSIFKLKFFNFKNSSSW-------YLGIWYNNFYLSGNKKY  76

Query  1232  ---IPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLL  1062
                I +  VW+ANR++P+   SGSL +D+ G+L I   G    +   S  +  N    LL
Sbjct  77    DGDIYDRAVWIANRNNPILGRSGSLTVDSLGRLSI-LRGASSLLELSSTETTGNTTLKLL  135

Query  1061  DSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGS  882
             DSGNL ++E+D +GS   +LWQSFDYPTD  +PGMKLG N+KTG  W+LTSWL D +P S
Sbjct  136   DSGNLQLQEMDSDGSMRRILWQSFDYPTDTFLPGMKLGFNVKTGKRWELTSWLGDTLPAS  195

Query  881   GAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFS  702
             G+   G+D N   N L IS RG +YW SG+W  G F       +E     +S E E YF 
Sbjct  196   GSLVFGMDAN-IPNLLTISWRGNMYWASGLWFKGRFS-----LEELPLTFISTETEHYFM  249

Query  701   YSAKH---NYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMY---TWIGRYASTLECDPY  540
             YS++       F    +D  G++  + L  D    +   P      W      T +C  Y
Sbjct  250   YSSEQYDAQTFFPAIMIDQQGNLHINRL--DKRLHVRCPPFTEESNWKCYRQDTRDC-LY  306

Query  539   IGNYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICW  360
              G      C+   P      S  F +T   F  +   +S+      G R + +DCH+IC 
Sbjct  307   AG------CIV--PYDPYGLSYSFRETISAFSSNGFVLSET-----GGRFSSADCHAICM  353

Query  359   KNCSCTAYASSSTDGTGCILYTNAAHDFQLDENGELYIYRLLKEHK  222
              N SC AYAS+  DGTGC ++ +   + +        IY  LKE++
Sbjct  354   LNSSCLAYASTKLDGTGCEIWNSDPTNKKSSSQSPRTIYIRLKENE  399



>ref|XP_002888604.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64863.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=785

 Score =   214 bits (545),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 142/374 (38%), Positives = 194/374 (52%), Gaps = 57/374 (15%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNK------I  1230
             +E+DTL QG  ++D + L SA  IFKL FF+         N+ + YLGIW+N       I
Sbjct  22    SETDTLHQGQFLKDGQELVSAFKIFKLKFFNFK-------NSRNWYLGIWFNNLYLNTDI  74

Query  1229  PNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGN  1050
              +  VW+ANR++P+ + SGSL +D+ G+L+I   G    +   S  +  N    LLDSGN
Sbjct  75    QDRAVWIANRNNPISERSGSLTVDSLGRLRI-LRGASTMLELSSTETRRNTTLKLLDSGN  133

Query  1049  LVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFE  870
             L ++E+D +GS   VLWQSFDYPTD L+PGMKLG ++KTG  W+LTSWL D +P SG+F 
Sbjct  134   LQLQEMDSDGSMKRVLWQSFDYPTDTLLPGMKLGFDVKTGKRWELTSWLGDTLPASGSFV  193

Query  869   LGLDINGCNNQLVISRRGKVYWTSGVWKNGSF--EKAPDMTKEFGFKLVSNEKEKYFSYS  696
              G+D N   N+L I  RG +YWTSG+W  G F  E+  D    F F    N+   +F   
Sbjct  194   FGMDAN-ITNRLTILWRGNMYWTSGLWYKGRFSEEELNDCGLLFSF----NDAITFFP--  246

Query  695   AKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPV  516
                                  +++ D    +H   ++        T   D Y  N     
Sbjct  247   ---------------------TIMIDQQGILHRAKIH-------QTRNYDSYWQNSRNQN  278

Query  515   CL----KENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCS  348
             CL    K N V+    S+ F   R      + N   V N  +G R  L DC++IC +N S
Sbjct  279   CLAAGYKGNNVADESYSNGFTSFRVTVSSSSSN-GFVLNETSG-RFRLVDCNAICVQNSS  336

Query  347   CTAYASSSTDGTGC  306
             C AYAS+  DGTGC
Sbjct  337   CLAYASTELDGTGC  350



>ref|XP_006426994.1| hypothetical protein CICLE_v10027600mg, partial [Citrus clementina]
 gb|ESR40234.1| hypothetical protein CICLE_v10027600mg, partial [Citrus clementina]
Length=761

 Score =   213 bits (541),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 149/393 (38%), Positives = 209/393 (53%), Gaps = 61/393 (16%)
 Frame = -2

Query  1385  SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIP-------  1227
             +DTL+ G  ++D + L SA   F++GFFS        +++EDRYLGIWY++         
Sbjct  1     TDTLLPGQLLKDGDELVSAFGNFRMGFFSY-------MSSEDRYLGIWYHRPTDPSDSHW  53

Query  1226  -------NEPVWVANRDSPLPDSSGSLIIDA-DGKLKISYVGG-MITVSNVSIMSGNNVG  1074
                    N+PVWVANR++P+ D SGSL ID+ DG LKI   GG  I VS+V  M   N  
Sbjct  54    SYGSPKINQPVWVANRNTPIADKSGSLTIDSRDGNLKILRKGGNSIVVSSVQAMG--NTS  111

Query  1073  ATLLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDK  894
             A L ++GN V+ E + +GS    LWQSFDYPTD+L+PGMKLG+NL+TGH W L SW S+ 
Sbjct  112   AALYETGNFVLYETNPSGSMERELWQSFDYPTDILLPGMKLGLNLQTGHGWFLRSWTSED  171

Query  893   VPGSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKE  714
              P  G F L +D N  +NQL+I RRG+V WTSG++ +    +A D+  +F F    NEKE
Sbjct  172   SPAEGEFTLNIDPN-VSNQLIIQRRGEVLWTSGLFPHW---RALDLDSDFHFSYTLNEKE  227

Query  713   KYFSYSAKHNY-RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYI  537
             +YF+YS   N+  F    +D  G     SL    +  I   P      R +S       I
Sbjct  228   RYFNYSLNGNFTSFPTLQIDSRG-----SLTVTGALPIS-CPGSEGCVRLSSC------I  275

Query  536   GNYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWK  357
             G +P    L             + + RG+   D       + S N SR    DC + C  
Sbjct  276   GYFPDDFELN------------WARKRGFMSVDGFKF---KGSNNTSR---DDCATKCLS  317

Query  356   NCSCTAYA-SSSTDGTGCILYTNAAHDFQLDEN  261
             NCSC A+A ++  + T C +++  +   + + N
Sbjct  318   NCSCIAFAITNENNNTACEIWSRGSKFIEDNNN  350



>ref|XP_010652616.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 [Vitis vinifera]
Length=706

 Score =   211 bits (537),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 144/395 (36%), Positives = 208/395 (53%), Gaps = 48/395 (12%)
 Frame = -2

Query  1400  SVGAESDTLMQGANIRDWEHL-TSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNK-IP  1227
             S  A +D++  G  +   E+L  SA+  F LGFFS+             YLGIWY   + 
Sbjct  26    SCSARTDSIKLGEGLPFSENLLVSAQGTFTLGFFSLDTG---------TYLGIWYTSDVN  76

Query  1226  NEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNL  1047
             N+ VWVANRD P+  ++ +L++D +G L I + GG   V N +  SGN++ ATLLDSGN 
Sbjct  77    NKKVWVANRDKPISGTNANLMLDGNGTLMIIHSGGDPIVMNSNQASGNSI-ATLLDSGNF  135

Query  1046  VVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFEL  867
             VV E++ +GS    LW+SFD PTD L+PGMKLG+NLKT   W L SW++++VP  G F  
Sbjct  136   VVAELNTDGSVKQTLWESFDDPTDTLLPGMKLGINLKTRQNWSLASWINEQVPAPGTFT-  194

Query  866   GLDINGCNNQLVISRRGKVYWTSGVWKNGSFE-----KAPDMTKEFGFKLVSNEKEKYFS  702
              L+ NG   QLV+ RRG +YW+SG+ K+  FE     +       + F  V N+ E YFS
Sbjct  195   -LEWNG--TQLVMKRRGDIYWSSGILKDLGFEFISSVRFATHHSIYYFISVCNDNEIYFS  251

Query  701   YSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPR  522
             YS +     +KW L+  G            FF  +  +      +     CD Y   YP 
Sbjct  252   YSVQDG-AISKWVLNSRG-----------GFFDTHGTL------FVKEDMCDRY-DKYPG  292

Query  521   PVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCT  342
               C  + P +CR     F++ +        ++ +++ S     L LSDC +IC  NCSCT
Sbjct  293   --CAVQEPPTCRTRDYQFMK-QSVLNSGYPSLMNIDTS-----LGLSDCQAICRNNCSCT  344

Query  341   AYASSSTDGTGCILYTNAAHDFQLDENGELYIYRL  237
             A  +  T+GTGC  + +     Q+ +  +  +Y L
Sbjct  345   ACNTVFTNGTGCQFWRDKLPRAQVGDANQEELYVL  379



>ref|XP_009804711.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X2 [Nicotiana sylvestris]
Length=685

 Score =   207 bits (528),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 129/380 (34%), Positives = 192/380 (51%), Gaps = 50/380 (13%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN----  1224
             +++DT+ QG N+R  E L SA   F+L FFS+  +       +  Y+GI+YN   N    
Sbjct  22    SQTDTIFQGQNLRVGEKLESANKEFRLEFFSLDAN-------KTHYIGIFYNLPSNMTLF  74

Query  1223  ----EPVWVANRDSPLPDSSGS-LIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLD  1059
                  PVWVANRD+P+P +SG+ L +D +GKLKI Y      + +    +  N  ATL D
Sbjct  75    SDDSRPVWVANRDNPIPYASGNNLTLDDEGKLKIIYGSDSSIILSSYNATARNASATLFD  134

Query  1058  SGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSG  879
             +GN V+ E++ NGS    LWQSF++PTD L+PGMK+G N  TG  W LTSW S+  P  G
Sbjct  135   NGNFVLVELNTNGSVNKTLWQSFEHPTDTLLPGMKIGRNRITGENWSLTSWRSEDEPALG  194

Query  878   AFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTK--EFGFKLVSNEKEKYF  705
             +F +G+D     +QL I   G+V+W SG W+NG+F     ++         VS + E+Y 
Sbjct  195   SFTIGID---STDQLTIWWEGRVHWMSGRWRNGAFSNVSRISHYDYVNLSFVSTDDERYV  251

Query  704   SYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYP  525
             +Y+       +K+T+D  G I++      P     Y                       P
Sbjct  252   TYTVSGTQTLSKYTIDSFGLIKERGAA-GPFGVCFYK----------------------P  288

Query  524   RPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSC  345
              P C+ E  + C        +   +F     ++S        + ++L DC   C KNCSC
Sbjct  289   SPGCVTEESIECP------TRNTSWFERMQSSVSGNRFRFENNDMSLFDCKRECEKNCSC  342

Query  344   TAYASSSTDGTGCILYTNAA  285
              A+AS +  GTGC +++N +
Sbjct  343   GAFASITVTGTGCEIWSNVS  362



>ref|XP_002267352.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 [Vitis vinifera]
Length=787

 Score =   208 bits (529),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 141/373 (38%), Positives = 194/373 (52%), Gaps = 52/373 (14%)
 Frame = -2

Query  1385  SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNK-IPNEPVWV  1209
             + T+  G N+ D E + SA  +F LGFFS       P  ++ RYLG+WY K      VWV
Sbjct  29    THTITSGQNLTDSERMVSANGVFTLGFFS-------PGKSKHRYLGMWYTKDEAQRVVWV  81

Query  1208  ANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVRE-V  1032
             ANR  P+ +SSG L I  DG+LKI   GG+  V N    + +N  ATLLDSGNLV+   +
Sbjct  82    ANRLIPITNSSGVLTIGDDGRLKIKQSGGLPIVLNTDQAAKHNATATLLDSGNLVLTHMI  141

Query  1031  DGNGSFG-GVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDI  855
             + NG+F    +WQSFD+P+D L+PGMKL VNLK G    LTSWLS +VP  GAF LGLD 
Sbjct  142   NDNGAFKRETVWQSFDHPSDTLLPGMKLAVNLKVGSNRSLTSWLSHEVPAPGAFTLGLDP  201

Query  854   ---NGCNNQLVISRRGKVYWTSGVWKNGS--FEKAPDMTKEFGFKLVSNEKEKYFSYSAK  690
                + C  Q+VI RRG V WTSG+W++ S  FE   +        +V ++ EKYF+Y+  
Sbjct  202   TVDDSC--QVVIWRRGIVLWTSGIWEDNSTHFEDWWNTYNVSFACVVVSKYEKYFNYTYA  259

Query  689   HNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCL  510
              +   ++  +     ++ +S                    +A TL             C 
Sbjct  260   DHSHLSRLVMGAWRQVKFNSF-----------------SEFAITL-------------CE  289

Query  509   KENPV----SCRKSSDVFVQTRGYFRDDNRNIS-DVENSGNGSRLALSDCHSICWKNCSC  345
               NP+       + S      R  FR  N+ +    E S +   L ++DC + C +NCSC
Sbjct  290   GRNPILSSGCVEEESKCGRHHRTAFRFKNKYMKRRAEYSDDDPNLGIADCDAKCKENCSC  349

Query  344   TAYASSSTDGTGC  306
              AYAS+  +GTGC
Sbjct  350   IAYASAHKNGTGC  362



>ref|XP_009804710.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X1 [Nicotiana sylvestris]
Length=804

 Score =   208 bits (529),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 129/380 (34%), Positives = 192/380 (51%), Gaps = 50/380 (13%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN----  1224
             +++DT+ QG N+R  E L SA   F+L FFS+  +       +  Y+GI+YN   N    
Sbjct  22    SQTDTIFQGQNLRVGEKLESANKEFRLEFFSLDAN-------KTHYIGIFYNLPSNMTLF  74

Query  1223  ----EPVWVANRDSPLPDSSGS-LIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLD  1059
                  PVWVANRD+P+P +SG+ L +D +GKLKI Y      + +    +  N  ATL D
Sbjct  75    SDDSRPVWVANRDNPIPYASGNNLTLDDEGKLKIIYGSDSSIILSSYNATARNASATLFD  134

Query  1058  SGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSG  879
             +GN V+ E++ NGS    LWQSF++PTD L+PGMK+G N  TG  W LTSW S+  P  G
Sbjct  135   NGNFVLVELNTNGSVNKTLWQSFEHPTDTLLPGMKIGRNRITGENWSLTSWRSEDEPALG  194

Query  878   AFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTK--EFGFKLVSNEKEKYF  705
             +F +G+D     +QL I   G+V+W SG W+NG+F     ++         VS + E+Y 
Sbjct  195   SFTIGID---STDQLTIWWEGRVHWMSGRWRNGAFSNVSRISHYDYVNLSFVSTDDERYV  251

Query  704   SYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYP  525
             +Y+       +K+T+D  G I++      P     Y                       P
Sbjct  252   TYTVSGTQTLSKYTIDSFGLIKERGAA-GPFGVCFYK----------------------P  288

Query  524   RPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSC  345
              P C+ E  + C        +   +F     ++S        + ++L DC   C KNCSC
Sbjct  289   SPGCVTEESIECP------TRNTSWFERMQSSVSGNRFRFENNDMSLFDCKRECEKNCSC  342

Query  344   TAYASSSTDGTGCILYTNAA  285
              A+AS +  GTGC +++N +
Sbjct  343   GAFASITVTGTGCEIWSNVS  362



>ref|XP_010503680.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 [Camelina sativa]
Length=877

 Score =   207 bits (527),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 145/397 (37%), Positives = 196/397 (49%), Gaps = 61/397 (15%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDR-YLGIWYNKI-----  1230
              E+DTL QG  ++D E L S   IFKL FF+         NT +  YLGI YN +     
Sbjct  22    CETDTLQQGQYLKDGEELNSPFNIFKLKFFNFK-------NTSNWWYLGISYNSLYLHNN  74

Query  1229  --------PNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVG  1074
                      + PVW+ANR++P+   SGSL +DA G+LKI   G    +   S  +  N  
Sbjct  75    NEYDSASHQDRPVWIANRNNPISGRSGSLTVDALGRLKI-LRGSESLLELSSTETTGNTT  133

Query  1073  ATLLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDK  894
               LLDSGNL ++E+D  GS   +LWQSFDYPTD ++PGMKLG N+KTG  W+LTSWL D 
Sbjct  134   LKLLDSGNLQLQEMDSGGSMKRILWQSFDYPTDTILPGMKLGFNVKTGKRWELTSWLGDT  193

Query  893   VPGSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKE  714
             +P SG+F  G+D N   N+L I   G ++W SG+W  G F     +   F    VS + E
Sbjct  194   LPASGSFVFGMDSN-VTNRLTILWHGNMFWASGLWFKGQFLVENKLG--FDVSFVSTKSE  250

Query  713   KYFSYSAKHN--YRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPY  540
             +YF Y    +    F +  +D  G ++  +L                 G     L C   
Sbjct  251   RYFMYLGDQSDGTLFPRIMIDQQGTLQTINL----------------KGVQQHVL-CSSV  293

Query  539   IGNYPRPVCLKENPVSCRKSSDVFVQTRGY---------FRDDNRNISDVENSGNG----  399
                     C ++N + CR      V   G          FRDD R+     + GNG    
Sbjct  294   FNYKLEYGCYQKNSMQCRYKFYGAVDKNGRCLEYGKCWSFRDDFRD-GVFTSLGNGFILS  352

Query  398   ---SRLALSDCHSICWKNCSCTAYASSSTDGTGCILY  297
                 +L+ +DC+  C +NCSC AYAS+  DGTGC L+
Sbjct  353   ETDGKLSSNDCYVKCLQNCSCLAYASTHADGTGCELW  389



>ref|NP_176919.2| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Arabidopsis thaliana]
 gb|AEE34658.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Arabidopsis thaliana]
Length=587

 Score =   203 bits (516),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/242 (45%), Positives = 147/242 (61%), Gaps = 15/242 (6%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI------  1230
             +E+DTL QG  ++D + L SA  IFKL FF+         N+E+ YLGIW+N +      
Sbjct  22    SETDTLHQGQFLKDGQELVSAFKIFKLKFFNFK-------NSENLYLGIWFNNLYLNTDS  74

Query  1229  PNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGN  1050
              + PVW+ANR++P+ D SGSL +D+ G+LKI   G    +   SI +  N    LLDSGN
Sbjct  75    QDRPVWIANRNNPISDRSGSLTVDSLGRLKI-LRGASTMLELSSIETTRNTTLQLLDSGN  133

Query  1049  LVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFE  870
             L ++E+D +GS   VLWQSFDYPTD L+PGMKLG + KT   W+LTSWL D +P SG+F 
Sbjct  134   LQLQEMDADGSMKRVLWQSFDYPTDTLLPGMKLGFDGKTRKRWELTSWLGDTLPASGSFV  193

Query  869   LGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSYSAK  690
              G+D N   N L I  RG +YW+SG+W  G F +       F F  VS +  +YF YS  
Sbjct  194   FGMDTN-ITNVLTILWRGNMYWSSGLWNKGRFSEEELNECGFLFSFVSTKSGQYFMYSGD  252

Query  689   HN  684
              +
Sbjct  253   QD  254



>ref|XP_010272743.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 [Nelumbo nucifera]
Length=304

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 135/371 (36%), Positives = 175/371 (47%), Gaps = 82/371 (22%)
 Frame = -2

Query  1421  MGFSSYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIW  1242
             MG S   +       + +G  ++DW+HL S   IF+LGFFS       P  + +RYLGI 
Sbjct  1     MGTSHDAAAATRDTIITEGEGVQDWDHLESEGGIFRLGFFS-------PGASRNRYLGIS  53

Query  1241  YNKIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLL  1062
             YNK  +  V                                       + + +NV  TLL
Sbjct  54    YNKARDATV---------------------------------------VWTADNVTTTLL  74

Query  1061  DSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGS  882
             DSGN V+REVD NG+   VLWQSFDYPTD L+PGMKLG N KTGH W LTSWL+ +   S
Sbjct  75    DSGNSVLREVDSNGTATRVLWQSFDYPTDTLLPGMKLGFNSKTGHNWTLTSWLTKEDLSS  134

Query  881   GAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE---FGFKLVSNEKEK  711
             G F LG D  G  NQL+  RR  VYW SGVW   SF+  P++T +   + F  V +E E+
Sbjct  135   GDFSLGGDPMG-TNQLLAWRRQDVYWKSGVWDGRSFKSVPELTSDNDTYNFSYVWSENER  193

Query  710   YFSYSAKHNYRFTK-WTLDLLGHIEQSSLI------YDPSFFIHYMPMYTWIGRYASTLE  552
             YF+YS K N      W LD  G+I Q          YD   FI   P +           
Sbjct  194   YFTYSLKQNSSPPSFWVLDSEGNIRQYKFYNWNDDKYDS--FIIVCPTHL----------  241

Query  551   CDPYIGNYPRPV---CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALS  381
               PY  NY R     C+++    CR+  ++F   +GY        + ++ S       L 
Sbjct  242   --PY--NYSRENKKGCVEQKVPECRR-GELFYSKQGYMDGPGSFYTSLDTSSR-----LR  291

Query  380   DCHSICWKNCS  348
             DC  +CW NCS
Sbjct  292   DCADMCWSNCS  302



>gb|AAG52302.1|AC011020_9 putative receptor protein kinase [Arabidopsis thaliana]
 gb|AAC18783.1| Strong similarity to receptor kinase gb|M80238 from A. thaliana 
[Arabidopsis thaliana]
Length=833

 Score =   202 bits (515),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 110/242 (45%), Positives = 147/242 (61%), Gaps = 15/242 (6%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI------  1230
             +E+DTL QG  ++D + L SA  IFKL FF+         N+E+ YLGIW+N +      
Sbjct  22    SETDTLHQGQFLKDGQELVSAFKIFKLKFFNFK-------NSENLYLGIWFNNLYLNTDS  74

Query  1229  PNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGN  1050
              + PVW+ANR++P+ D SGSL +D+ G+LKI   G    +   SI +  N    LLDSGN
Sbjct  75    QDRPVWIANRNNPISDRSGSLTVDSLGRLKI-LRGASTMLELSSIETTRNTTLQLLDSGN  133

Query  1049  LVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFE  870
             L ++E+D +GS   VLWQSFDYPTD L+PGMKLG + KT   W+LTSWL D +P SG+F 
Sbjct  134   LQLQEMDADGSMKRVLWQSFDYPTDTLLPGMKLGFDGKTRKRWELTSWLGDTLPASGSFV  193

Query  869   LGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSYSAK  690
              G+D N   N L I  RG +YW+SG+W  G F +       F F  VS +  +YF YS  
Sbjct  194   FGMDTN-ITNVLTILWRGNMYWSSGLWNKGRFSEEELNECGFLFSFVSTKSGQYFMYSGD  252

Query  689   HN  684
              +
Sbjct  253   QD  254



>ref|XP_002298945.1| hypothetical protein POPTR_0001s43270g [Populus trichocarpa]
 gb|EEE83750.1| hypothetical protein POPTR_0001s43270g [Populus trichocarpa]
Length=741

 Score =   202 bits (514),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 140/395 (35%), Positives = 190/395 (48%), Gaps = 50/395 (13%)
 Frame = -2

Query  1385  SDTLMQGAN-IRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVWV  1209
             +DTL QG + +     L S   +F LGF  +     G   +  RYLGIWYN   + P W+
Sbjct  21    ADTLYQGGDSLNSSNTLVSKNGLFTLGFTRL-----GSAESNARYLGIWYNNDTSHPFWL  75

Query  1208  ANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREVD  1029
             ANRD P+ D+SG L ID  G +K++Y GG       S  S  N+ A L DSGN V+  +D
Sbjct  76    ANRDKPISDTSGVLAIDGSGNMKLAYSGGDPVEFYSSQSSTTNITAILEDSGNFVL--ID  133

Query  1028  GNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPG-SGAFELGLDIN  852
              N     VLWQSFD+PTD  +PGMKLG+N +TG  W L SWLSD VP  +GAF    D N
Sbjct  134   ENSGSQQVLWQSFDFPTDTFLPGMKLGINHRTGQSWSLMSWLSDLVPTPAGAFTFEWDTN  193

Query  851   GCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYF-------SYSA  693
             G   +LVI RR  +YWTSG  ++ +  + P + +   F  VSN  E YF        ++A
Sbjct  194   G--KELVIKRRDVIYWTSGPSRSNTSFEIPSLDQS--FITVSNADEDYFMFTVSANQFTA  249

Query  692   KHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVC  513
             +    F+ W L+  G I                   T+ G        D     +  P C
Sbjct  250   QGQRNFSMWQLEYDGSIADQR------------TRRTYGGTACKGNNTDGGCERWSGPAC  297

Query  512   LKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYA  333
              + N  S    S  FV T     DDN            S L++SDC  ICWK+C C   +
Sbjct  298   -RSNRNSFELRSGSFVNTVPRKYDDN------------SSLSISDCRDICWKDCQCVGVS  344

Query  332   S--SSTDGTGCILYTNAAHDFQLDENGELYIYRLL  234
             +  ++ + TGC  +  +   F  D +G    Y ++
Sbjct  345   TIGNNANNTGCTFFYGS---FTQDLSGNAIQYHII  376



>sp|O64793.3|Y1675_ARATH RecName: Full=G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g67520; Flags: Precursor [Arabidopsis thaliana]
Length=818

 Score =   202 bits (515),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 110/242 (45%), Positives = 147/242 (61%), Gaps = 15/242 (6%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI------  1230
             +E+DTL QG  ++D + L SA  IFKL FF+         N+E+ YLGIW+N +      
Sbjct  22    SETDTLHQGQFLKDGQELVSAFKIFKLKFFNFK-------NSENLYLGIWFNNLYLNTDS  74

Query  1229  PNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGN  1050
              + PVW+ANR++P+ D SGSL +D+ G+LKI   G    +   SI +  N    LLDSGN
Sbjct  75    QDRPVWIANRNNPISDRSGSLTVDSLGRLKI-LRGASTMLELSSIETTRNTTLQLLDSGN  133

Query  1049  LVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFE  870
             L ++E+D +GS   VLWQSFDYPTD L+PGMKLG + KT   W+LTSWL D +P SG+F 
Sbjct  134   LQLQEMDADGSMKRVLWQSFDYPTDTLLPGMKLGFDGKTRKRWELTSWLGDTLPASGSFV  193

Query  869   LGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSYSAK  690
              G+D N   N L I  RG +YW+SG+W  G F +       F F  VS +  +YF YS  
Sbjct  194   FGMDTN-ITNVLTILWRGNMYWSSGLWNKGRFSEEELNECGFLFSFVSTKSGQYFMYSGD  252

Query  689   HN  684
              +
Sbjct  253   QD  254



>ref|XP_007024153.1| Serine/threonine-protein kinase PBS1, putative [Theobroma cacao]
 gb|EOY26775.1| Serine/threonine-protein kinase PBS1, putative [Theobroma cacao]
Length=789

 Score =   202 bits (514),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 137/368 (37%), Positives = 189/368 (51%), Gaps = 40/368 (11%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVW  1212
             +++ T+ QG  ++ ++ L S   +FKLGF S+  + S        YLGIWY    +  +W
Sbjct  26    SQTATIGQGQQLKHYQQLVSNSGMFKLGFKSVHHNNS--------YLGIWYYGDDDNLLW  77

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
             VANRD+P+  +SG L ID  G L I        V   S+   +N  ATL DSGN V+ E+
Sbjct  78    VANRDTPISGTSGILEIDDHGNLIIVNEPADPFVL-YSVEEPSNTNATLEDSGNFVLHEL  136

Query  1031  DGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDIN  852
               +GS   VLWQSFD+PTD L+PGMKLG+N KTG  W LTSW SD  P SG+F LGLD  
Sbjct  137   SSDGSIKQVLWQSFDHPTDTLLPGMKLGINSKTGLNWSLTSWRSDMSPASGSFTLGLDPR  196

Query  851   GCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSYSAKHNYR-F  675
                +QLVI  RG+ YW SG +  GS   A  +   + F  +SNE E YF+Y+ K     F
Sbjct  197   D-TSQLVIWWRGETYWKSGSFLQGSSLVAL-VNGSYNFGFISNENETYFNYTVKKAVTIF  254

Query  674   TKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKENPV  495
              +  L+  G +  S                      A ++  +          CLK+N  
Sbjct  255   PRLKLNPEGELVSSR---------------------ADSVALEVSCTKNLSVGCLKQNIP  293

Query  494   SCRK-SSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSSTD  318
             +CR   + VF    G+  +     S  +N      L+  DC + C  +CSC AYAS + D
Sbjct  294   ACRSLGNKVFQHHTGFMSNTGFKFSQSDN------LSRIDCQAECLHDCSCVAYASKNDD  347

Query  317   GTGCILYT  294
             GTGC +++
Sbjct  348   GTGCEIWS  355



>ref|XP_008226124.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g67520 [Prunus mume]
Length=801

 Score =   202 bits (514),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 136/379 (36%), Positives = 195/379 (51%), Gaps = 33/379 (9%)
 Frame = -2

Query  1415  FSSYV-SVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWY  1239
             FSS + +  A  DTL  G  +     L S    F +GF  I D      N    YL + +
Sbjct  17    FSSLLWNFNAARDTLKPGDTLNSSSSLVSGMGKFTMGF-HIYDH-----NLNYSYLVVKW  70

Query  1238  NKIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGG--MITVSNVSIMSGNNVGATL  1065
                 N   W+ANR+ P+    G L +D +  LKI++  G  ++  S     + NN+ ATL
Sbjct  71    AASHNY-AWIANRNKPILYPLGILTLDQNNTLKITHKDGEPVVLYSASETSNANNIVATL  129

Query  1064  LDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPG  885
             LDSGN V++E+  +GS   VLWQSFD+P DVL+PGMKLG+N K+GHVW L+SW +     
Sbjct  130   LDSGNFVLQELSFDGSPNRVLWQSFDFPVDVLLPGMKLGLNHKSGHVWSLSSWFTPNSAV  189

Query  884   SGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFE-KAPDMTK-EFGFKLVSNEKEK  711
              GAF L  D     ++L I RRG VYW+SG ++NG F+   PD +K  + F +VSNE E 
Sbjct  190   PGAFTLDWDPEA--HELKIRRRGVVYWSSGAFRNGRFKFILPDESKLRYNFSIVSNEDED  247

Query  710   YFSYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGN  531
             YF+YSA      ++W L ++G +      +D +  I            A    C  Y  N
Sbjct  248   YFTYSAVDQSGISEWVLTIMGRLYD----FDETIDI------------AQADYC--YGSN  289

Query  530   YPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNC  351
                   + + P+ CR + D F + +GYF       +   ++ N S  ++SDC + CWKNC
Sbjct  290   TDGGCQMWDRPIDCRHAGDRFEEEKGYFNPTRSGPTATSDTSNTS-FSISDCKAACWKNC  348

Query  350   SCTAYASSSTDGTGCILYT  294
              C  +     + TGC  +T
Sbjct  349   DCLGFNYLFDNQTGCRFWT  367



>ref|XP_010927977.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Elaeis guineensis]
Length=786

 Score =   201 bits (511),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 139/417 (33%), Positives = 200/417 (48%), Gaps = 45/417 (11%)
 Frame = -2

Query  1415  FSSYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYN  1236
             FSS+ S     DTL+   ++ D + L S    F LGFFS       PI T +RY+GIWY 
Sbjct  21    FSSHFSPSIVGDTLIPARSLTDGQELISVGKKFVLGFFS-------PIKTNNRYVGIWYK  73

Query  1235  KIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDS  1056
               P+  VWVANR  P+ + +GSL I A+G L I+        S+ S+   N V A LLD 
Sbjct  74    ISPSTIVWVANRRQPISERNGSLSITANGTLIITDHNSKTIWSSGSLGLANPV-AQLLDD  132

Query  1055  GNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGA  876
             GN +V+E + +GSF    WQSFDYP+D L+PGMKLG NL +G    LTSW+S   P  G 
Sbjct  133   GNFIVKEANVSGSFA---WQSFDYPSDTLLPGMKLGWNLTSGLNRNLTSWISPTDPAPGP  189

Query  875   FELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFS  702
             + + +D++G + QL++       W  G W    F   PD+ +   F    V    E ++ 
Sbjct  190   YTMAVDLHG-DPQLILWEGSDWLWRGGPWNGKIFSGVPDILRYNIFILAFVMKNDEVFYM  248

Query  701   YSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYM-------PMYTWIGRYA-----ST  558
             Y+        + T++  G +++   I D   +  YM          T  G Y       +
Sbjct  249   YNTTSTSFIVRVTVNYTGVVQRLVWIDDSQMWSIYMSEPKDQCEHMTQCGAYGICNMDDS  308

Query  557   LECDPYIGNYPR-PV----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVEN  411
               C    G  PR P           C +   + CR  +D FV  +         + D   
Sbjct  309   PMCSCLQGFKPRSPTNWNLRDGKDGCARMTELDCRSGTDGFVTIK------EVKLPDTSR  362

Query  410   SGNGSRLALSDCHSICWKNCSCTAYASSSTDGTGCILYTNAAHDFQLDENG--ELYI  246
             S     + L +C + C +NCSCTAYAS+  +GTGCI++T    D ++   G  +LY+
Sbjct  363   STMDRSMGLDECRATCLRNCSCTAYASADVNGTGCIIWTTELTDIRVYSFGGQDLYV  419



>ref|XP_011016330.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 [Populus euphratica]
Length=795

 Score =   200 bits (509),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 137/384 (36%), Positives = 191/384 (50%), Gaps = 48/384 (13%)
 Frame = -2

Query  1385  SDTLMQGANIRDW-EHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVWV  1209
             +DTL QG +  D    L S   +F LGF  +     G   +   YLGIWY    + P+W+
Sbjct  27    ADTLYQGGDTLDSSRRLVSKNRLFTLGFVRL-----GSTESNASYLGIWYQNDTSHPIWI  81

Query  1208  ANRDSPLPDSSGSLIIDAD-GKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
             ANRD P+ D SG L ID D G +K++Y GG +     +  +   + ATL DSGN VV+  
Sbjct  82    ANRDKPIADDSGVLEIDGDSGTMKVAYSGGNLVDFYSTRSATTKLTATLEDSGNFVVK--  139

Query  1031  DGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDIN  852
             D N     +LWQSFD PTD  +PGMKLG+N KTG V  LTSW+SD VP SGAF    +  
Sbjct  140   DANSRSDQILWQSFDDPTDTFMPGMKLGINHKTGKVRSLTSWMSDLVPASGAFTFEWEPK  199

Query  851   GCNNQLVISRRGKVYWTSGVWK-NGSFEK-APDMTKEFGFKLVSNEKEKYFSYSAKHNYR  678
                 +LV+ RR ++YWTSG  + NGSFE   P+   ++ F +VSN  E YF ++   N  
Sbjct  200   --RQELVVKRRTEIYWTSGPLRSNGSFETFRPNPGLDYTFLIVSNIDEDYFMFTVARNKL  257

Query  677   ------FTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPV  516
                   F+KW L   G +E+ S                   + +    C+   GN     
Sbjct  258   TPPKTGFSKWLLQFGGGLEEQS-----------------NEQISGGNLCN---GNNIEMG  297

Query  515   CLK-ENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTA  339
             C+K ++  +CR      ++   +  +    + D     N + L++SDC  ICWK+C C  
Sbjct  298   CVKWDSEPTCRSRDRYELRACDFLVEGGHAVYD-----NNASLSISDCREICWKDCRCAG  352

Query  338   --YASSSTDGTGCIL-YTNAAHDF  276
                  S+ + TGC   Y N   D 
Sbjct  353   INIRGSNANNTGCTFWYGNFTRDL  376



>ref|XP_010927986.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Elaeis guineensis]
Length=821

 Score =   200 bits (509),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 139/407 (34%), Positives = 195/407 (48%), Gaps = 43/407 (11%)
 Frame = -2

Query  1415  FSSYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYN  1236
             FSS VS     D L     + D + L SA   F LGFFS       PI T +RY+GIWY 
Sbjct  21    FSSGVSPSIGGDILTPAQPLTDGQELISAGERFILGFFS-------PIKTNNRYIGIWYK  73

Query  1235  KIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDS  1056
               P   VWVANR  P+ D +GSL I A+G L I      I  S+ S    N V A LLD 
Sbjct  74    VSPPTVVWVANRQHPISDHNGSLSITANGTLIIINQNSKIIWSSGSSGLANPV-AQLLDD  132

Query  1055  GNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGA  876
             GN +V+E +     G + WQSFDYP+D L+PGMKLG NL +G    +TSW S   P SG 
Sbjct  133   GNFIVKEAN---ILGSLTWQSFDYPSDTLLPGMKLGWNLTSGLNRNITSWTSPSDPASGL  189

Query  875   FELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMT--KEFGFKLVSNEKEKYFS  702
             +   +D++G N QL++       W +G W   +    PD+   K F  + V N  E +  
Sbjct  190   YTGAMDLHG-NPQLILWEGSSQLWRTGSWNGKTLTGIPDILHYKIFLLEFVINNDEVFCM  248

Query  701   YSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMP-------MYTWIGRYA-----ST  558
             Y   +     + T++  G  ++S  + D   +I Y+          +  G Y       +
Sbjct  249   YHTTNTSLIARLTVNYTGICQRSVWLDDSKMWISYLSEPKDPCDYMSQCGVYGVCNMDDS  308

Query  557   LECDPYIGNYPR-PV----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVEN  411
               C    G  PR P           C++   + CR  +D FV  +      N  + D   
Sbjct  309   PMCSCLKGFKPRSPTNWDLRDWRDGCMRMTELDCRNGTDGFVTMK------NIKLPDTSR  362

Query  410   SGNGSRLALSDCHSICWKNCSCTAYASSSTDGTGCILYTNAAHDFQL  270
             S     + L++C ++C +NCSCTAYAS+  +GTGCI++T    D ++
Sbjct  363   STVDRSMELNECRAMCLRNCSCTAYASADINGTGCIIWTTELIDIRV  409



>ref|XP_008793685.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Phoenix dactylifera]
Length=776

 Score =   200 bits (508),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 141/389 (36%), Positives = 201/389 (52%), Gaps = 43/389 (11%)
 Frame = -2

Query  1385  SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPV-WV  1209
             +DTL  G +I+D   L SA   F+LGFFS       P ++ +RY+GIWY K+  + V WV
Sbjct  27    ADTLFPGQSIKDGGKLVSASQTFELGFFS-------PGSSRNRYVGIWYYKLSTKTVVWV  79

Query  1208  ANRDSPLPDSSGSLIIDADGKLKI-SYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
             ANR+SP+ D+SG L ID +G L I   +G  IT+++ S  +   V A L D+GNLV++E 
Sbjct  80    ANRESPVFDASGYLTIDGEGNLIILDGIGRSITIASNSGRTNLTVAA-LTDAGNLVLKEW  138

Query  1031  DGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDIN  852
              G G  G VLWQSFD+PTD L+PGMK+G+  K   +  LTSW S + P  G F +G+D N
Sbjct  139   SG-GREGRVLWQSFDHPTDTLIPGMKMGLVGKENRI--LTSWRSSEDPAEGDFSVGIDPN  195

Query  851   GCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEF--GFKLVSNEKEKYFSYSAKHNYR  678
             G   Q +I RR  VYW SGVW   +F   P+MT+++  GF    N     +SYS   + +
Sbjct  196   G-TRQFIIWRRRDVYWKSGVWNGMNFSSIPEMTRDYYIGFSYSPNWNGSSYSYSLNDSSK  254

Query  677   FTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIG------NYPRPV  516
               +  +D+ G I Q + +     ++ +     W G    + E     G      NY  P 
Sbjct  255   PVRTVMDVSGKIGQLAWVETSQEWVQF-----WAGPTNYSCEIPTSCGVNGLCNNYTTPA  309

Query  515   C---LKENPVS------------CRKSSDVFVQTRGYFRDDNRNISDVENSGNGS-RLAL  384
             C       P S            C +   +       F +  R    +  S  G   + +
Sbjct  310   CSCPYGFEPTSHVAWNSGDWSGGCVRREKLECGNGNGFTEMKRIKLPIFFSDTGVLSMDI  369

Query  383   SDCHSICWKNCSCTAYASSSTDGTGCILY  297
              DC + C  NC+CTAYAS+  +GTGC+L+
Sbjct  370   DDCKAKCLLNCTCTAYASAHGNGTGCLLW  398



>ref|XP_009619490.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 [Nicotiana tomentosiformis]
Length=810

 Score =   200 bits (508),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 130/388 (34%), Positives = 200/388 (52%), Gaps = 67/388 (17%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN----  1224
             +++DT+ +G ++R  E L SA   F++ FFS+  +       +  Y+GI+YN   N    
Sbjct  22    SQTDTIFRGQSLRVGEKLESANKEFRVEFFSLDAN-------KTHYIGIFYNLPSNMTLF  74

Query  1223  ----EPVWVANRDSPLPDSSGS-LIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLD  1059
                  PVWVANRD+P+P +SG+ L +D +GKLKI+       +S+ +  +  N  ATL D
Sbjct  75    SDDSRPVWVANRDNPIPYASGNNLTLDDEGKLKINDGTDSFILSSYN-GTARNASATLFD  133

Query  1058  SGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSG  879
             +GN V+ E++ NGS    LWQSF++PTD L+PGMK+G N  TG  W LTSW S+  P SG
Sbjct  134   NGNFVLVELETNGSVKKTLWQSFEHPTDTLLPGMKIGRNRITGENWSLTSWRSEDEPASG  193

Query  878   AFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTK--EFGFKLVSNEKEKYF  705
             +F +G+D     +QL I   G+VYW SG W NG+F     ++         VS + E+Y 
Sbjct  194   SFTIGID---STDQLTIWWEGRVYWMSGRWSNGTFSNVSRISHYDYVNMSFVSTDDERYM  250

Query  704   SYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYP  525
             +Y+       +++T+D  G I++                              P+   + 
Sbjct  251   TYTVSGTRTLSRYTIDSFGLIKERG-------------------------AAGPFGVCFY  285

Query  524   RPV--CLKENPVSCR-KSSDVFVQ-----TRGYFRDDNRNISDVENSGNGSRLALSDCHS  369
             +P   C+ E  + C  +++ +F +     T   FR +N N+S            L DC  
Sbjct  286   KPSAGCVSEESIECPVRNASLFERMQNSVTGNRFRFENNNMS------------LFDCKR  333

Query  368   ICWKNCSCTAYASSSTDGTGCILYTNAA  285
              C KNCSC A+AS +  GTGC +++N +
Sbjct  334   ECEKNCSCGAFASITATGTGCEIWSNVS  361



>ref|XP_011011051.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 [Populus euphratica]
Length=795

 Score =   199 bits (507),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 137/384 (36%), Positives = 190/384 (49%), Gaps = 48/384 (13%)
 Frame = -2

Query  1385  SDTLMQGANIRDW-EHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVWV  1209
             +DTL QG +  D    L S   +F LGF  +     G   +   YLGIWY    + P+W+
Sbjct  27    ADTLYQGGDTLDSSRRLVSKNRLFTLGFVRL-----GSTESNASYLGIWYQNDTSHPIWI  81

Query  1208  ANRDSPLPDSSGSLIIDAD-GKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
             ANRD P+ D SG L ID D G +K++Y GG +     +      + ATL DSGN VV+  
Sbjct  82    ANRDKPIADDSGVLEIDGDSGTMKVAYSGGNLVDFYSTRSPTTKLTATLEDSGNFVVK--  139

Query  1031  DGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDIN  852
             D N     +LWQSFD PTD  +PGMKLG+N KTG V  LTSW+SD VP SGAF    +  
Sbjct  140   DANSRSDQILWQSFDDPTDTFMPGMKLGINHKTGKVRSLTSWMSDLVPASGAFTFEWEPK  199

Query  851   GCNNQLVISRRGKVYWTSGVWK-NGSFEK-APDMTKEFGFKLVSNEKEKYFSYSAKHNYR  678
                 +LV+ RR ++YWTSG  + NGSFE   P+   ++ F +VSN  E YF ++   N  
Sbjct  200   --RQELVVKRRTEIYWTSGPLRSNGSFETFRPNPGLDYTFLIVSNIDEDYFMFTVARNKL  257

Query  677   ------FTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPV  516
                   F+KW L   G +E+ S                   + +    C+   GN     
Sbjct  258   TPPKTGFSKWLLQFGGGLEEQS-----------------NEQISGGNLCN---GNNIEMG  297

Query  515   CLK-ENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTA  339
             C+K ++  +CR      ++   +  +    + D     N + L++SDC  ICWK+C C  
Sbjct  298   CVKWDSEPTCRSRDRYELRACDFLVEGGHAVYD-----NNASLSISDCREICWKDCRCAG  352

Query  338   --YASSSTDGTGCIL-YTNAAHDF  276
                  S+ + TGC   Y N   D 
Sbjct  353   INIRGSNANNTGCTFWYGNFTRDL  376



>ref|XP_006352934.1| PREDICTED: LOW QUALITY PROTEIN: G-type lectin S-receptor-like 
serine/threonine-protein kinase At1g67520-like [Solanum tuberosum]
Length=1491

 Score =   202 bits (513),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 148/414 (36%), Positives = 203/414 (49%), Gaps = 55/414 (13%)
 Frame = -2

Query  1424  HMGFSSYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGI  1245
             H G  +  SV A + ++  G  +   + L S    FKLGFFSIS        T + YLGI
Sbjct  19    HTGIITLPSVAAIT-SMKPGDELNHTQVLDSEDGTFKLGFFSIS-------QTNNSYLGI  70

Query  1244  WYNKIP-NEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGAT  1068
             WY   P ++ +W+AN ++PL ++SG L ID  G LKI+  G  +      +++G+ + A 
Sbjct  71    WYAGDPQDKKLWIANPNTPLLNNSGLLTIDTTGTLKITSGGKTVVNITPPLLTGSLI-AR  129

Query  1067  LLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVP  888
             L DSGNLV+++   N +    LWQSFD+PTD L PGMKLG NL T   W LTSWLS  +P
Sbjct  130   LQDSGNLVLQDETENRT----LWQSFDHPTDTLFPGMKLGYNLTTKQNWTLTSWLSSYIP  185

Query  887   GSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTK--------EFGFKL  732
              SGAF L L       QLVI RRG+VYWTSG W+N SF   P +T         ++   L
Sbjct  186   ASGAFTLSLXSIQDAFQLVIRRRGEVYWTSGAWRNQSF---PFLTALHDSSNRYQYNLNL  242

Query  731   VSNEKEKYFSYSAKHNYRFTKWTLDLLGHI---EQSSLIYDPSFFIHYMPMYTWIGRYAS  561
             VS +   +F + A     F    L   G I    + S IY                    
Sbjct  243   VSEKDGVFFQFDAPDG-SFPSLVLTFNGAILGGGEDSRIY--------------------  281

Query  560   TLECDPYIGNYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALS  381
              L  +   G      C+      CRK  D F     YF       S   N  + + ++L 
Sbjct  282   ALYNEFCYGYESHDGCVSNQLPECRKDGDKFELKSAYFTTG----SATSNYDDNANISLG  337

Query  380   DCHSICWKNCSCTAYASSSTDGTGCILYTNAAHDFQLDENGELYIYRLLKEHKG  219
             DC   CW++CSC  + +SS +G GCI++ N   +F++DE+G      +L   KG
Sbjct  338   DCMKNCWEHCSCVGFITSS-NGIGCIIW-NGNGEFRVDESGSAVQQYVLVSSKG  389


 Score =   185 bits (469),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 125/344 (36%), Positives = 178/344 (52%), Gaps = 38/344 (11%)
 Frame = -2

Query  1223  EPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLV  1044
             + +W+AN ++P+ +SSG L +D+ G LKI+  G  +      +++G+ + A L DSGNLV
Sbjct  778   KKLWIANPNTPILNSSGLLTLDSAGTLKITSGGKTVVNITTPLLTGSLI-ARLQDSGNLV  836

Query  1043  VREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWL-SDKVPGSGAFEL  867
             V++   N +    LWQSFD+PT  L+PGMKLG NL T   W LTSWL S  +P SGAF L
Sbjct  837   VQDETRNRT----LWQSFDHPTSCLLPGMKLGYNLTTRQNWTLTSWLVSSTIPASGAFTL  892

Query  866   GLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDM-----TKEFGFKLVSNEKEKYFS  702
              L+      QLV+ RRG+VYWTSG W N  F   P       T ++   LVS     +F 
Sbjct  893   SLEAIQDAFQLVVRRRGEVYWTSGAWNNQGFPFLPSFRDSATTYQYNLNLVSGTDGMFFQ  952

Query  701   YSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPR  522
             + A              G      L  D +       +YT   ++     C  Y G+   
Sbjct  953   FEATK------------GSFPSLELFSDGAIAAGDGSIYTRYNKF-----CYGYGGD---  992

Query  521   PVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCT  342
               C+      CRK+SD F Q RG F D +   +   N  N S ++L DC   CW++CSC 
Sbjct  993   DGCVSSQLPECRKNSDKFEQKRGDFIDLSGTTTS--NYDNAS-ISLGDCMQKCWEHCSCV  1049

Query  341   AYASSSTDGTGCILYTNAAHDFQLDENG---ELYIYRLLKEHKG  219
              + S +++GTGC ++ N   DF++DE+G   + Y+    K  KG
Sbjct  1050  GFTSLNSNGTGCRIW-NGKRDFRVDESGNAVQRYVLISPKSSKG  1092



>ref|XP_011012335.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X2 [Populus euphratica]
Length=787

 Score =   198 bits (503),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 139/410 (34%), Positives = 197/410 (48%), Gaps = 51/410 (12%)
 Frame = -2

Query  1415  FSSYVSVGAESDTLMQGAN-IRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWY  1239
             F    S    +DTL QG + +     L S   +F LGF  +     G   +   YLGIWY
Sbjct  15    FCFCASHALAADTLYQGDDSLSSSNTLVSKNGLFTLGFTGL-----GFAESNASYLGIWY  69

Query  1238  NKIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLD  1059
             N   + P W+ANR  P+ D+SG L ID  G +K++  GG +   N S  S +N+ A L D
Sbjct  70    NNDTSTPFWLANRGKPIADNSGVLAIDGSGNMKLTCSGGDLVDFNSSRSSASNITAILED  129

Query  1058  SGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPG-S  882
             SGN V++  D N     VLWQSFD+PTD  +PGMKLG+N +TG  W L SWL D VP  +
Sbjct  130   SGNFVLK--DENSGSQQVLWQSFDFPTDTFLPGMKLGINHRTGRTWSLMSWLGDLVPTPT  187

Query  881   GAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTK---EFGFKLVSNEKEK  711
             GAF    D NG   +LVI RR  +YWT+G  ++ +  + P +     +F F  +SN  E 
Sbjct  188   GAFTFEWDTNG--KELVIKRRDVIYWTTGPLRSNTSFEIPFLDAAVLDFSFINISNADED  245

Query  710   YFSYSAKHNY-------RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLE  552
              F ++   N         F+ W L   G IE  S                  GR      
Sbjct  246   CFMFTVSANQFTPQGQRNFSMWQLRFDGGIEDLS-----------------TGRVYGRSS  288

Query  551   CDPYIGNYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCH  372
             C    GN     C + +  +CR++ + F   RGYF +   +  D  +S     L++SDC 
Sbjct  289   CK---GNNKDGGCERWSGPACRRNRNSFELRRGYFVNTVPSKDDYNSS-----LSISDCM  340

Query  371   SICWKNCSCTAYAS--SSTDGTGCILYTNAAHDFQLDENGELYIYRLLKE  228
              ICWK+C C    +  ++ + TGC  +  +   F  D +G    Y ++ +
Sbjct  341   DICWKDCDCVGVTTRGNNANNTGCTFFYGS---FTQDLSGNAIQYHIIVQ  387



>ref|XP_011012334.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X1 [Populus euphratica]
Length=789

 Score =   198 bits (503),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 139/410 (34%), Positives = 197/410 (48%), Gaps = 51/410 (12%)
 Frame = -2

Query  1415  FSSYVSVGAESDTLMQGAN-IRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWY  1239
             F    S    +DTL QG + +     L S   +F LGF  +     G   +   YLGIWY
Sbjct  15    FCFCASHALAADTLYQGDDSLSSSNTLVSKNGLFTLGFTGL-----GFAESNASYLGIWY  69

Query  1238  NKIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLD  1059
             N   + P W+ANR  P+ D+SG L ID  G +K++  GG +   N S  S +N+ A L D
Sbjct  70    NNDTSTPFWLANRGKPIADNSGVLAIDGSGNMKLTCSGGDLVDFNSSRSSASNITAILED  129

Query  1058  SGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPG-S  882
             SGN V++  D N     VLWQSFD+PTD  +PGMKLG+N +TG  W L SWL D VP  +
Sbjct  130   SGNFVLK--DENSGSQQVLWQSFDFPTDTFLPGMKLGINHRTGRTWSLMSWLGDLVPTPT  187

Query  881   GAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTK---EFGFKLVSNEKEK  711
             GAF    D NG   +LVI RR  +YWT+G  ++ +  + P +     +F F  +SN  E 
Sbjct  188   GAFTFEWDTNG--KELVIKRRDVIYWTTGPLRSNTSFEIPFLDAAVLDFSFINISNADED  245

Query  710   YFSYSAKHNY-------RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLE  552
              F ++   N         F+ W L   G IE  S                  GR      
Sbjct  246   CFMFTVSANQFTPQGQRNFSMWQLRFDGGIEDLS-----------------TGRVYGRSS  288

Query  551   CDPYIGNYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCH  372
             C    GN     C + +  +CR++ + F   RGYF +   +  D  +S     L++SDC 
Sbjct  289   CK---GNNKDGGCERWSGPACRRNRNSFELRRGYFVNTVPSKDDYNSS-----LSISDCM  340

Query  371   SICWKNCSCTAYAS--SSTDGTGCILYTNAAHDFQLDENGELYIYRLLKE  228
              ICWK+C C    +  ++ + TGC  +  +   F  D +G    Y ++ +
Sbjct  341   DICWKDCDCVGVTTRGNNANNTGCTFFYGS---FTQDLSGNAIQYHIIVQ  387



>ref|XP_011012337.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X3 [Populus euphratica]
Length=787

 Score =   198 bits (503),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 139/410 (34%), Positives = 197/410 (48%), Gaps = 51/410 (12%)
 Frame = -2

Query  1415  FSSYVSVGAESDTLMQGAN-IRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWY  1239
             F    S    +DTL QG + +     L S   +F LGF  +     G   +   YLGIWY
Sbjct  15    FCFCASHALAADTLYQGDDSLSSSNTLVSKNGLFTLGFTGL-----GFAESNASYLGIWY  69

Query  1238  NKIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLD  1059
             N   + P W+ANR  P+ D+SG L ID  G +K++  GG +   N S  S +N+ A L D
Sbjct  70    NNDTSTPFWLANRGKPIADNSGVLAIDGSGNMKLTCSGGDLVDFNSSRSSASNITAILED  129

Query  1058  SGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPG-S  882
             SGN V++  D N     VLWQSFD+PTD  +PGMKLG+N +TG  W L SWL D VP  +
Sbjct  130   SGNFVLK--DENSGSQQVLWQSFDFPTDTFLPGMKLGINHRTGRTWSLMSWLGDLVPTPT  187

Query  881   GAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTK---EFGFKLVSNEKEK  711
             GAF    D NG   +LVI RR  +YWT+G  ++ +  + P +     +F F  +SN  E 
Sbjct  188   GAFTFEWDTNG--KELVIKRRDVIYWTTGPLRSNTSFEIPFLDAAVLDFSFINISNADED  245

Query  710   YFSYSAKHNY-------RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLE  552
              F ++   N         F+ W L   G IE  S                  GR      
Sbjct  246   CFMFTVSANQFTPQGQRNFSMWQLRFDGGIEDLS-----------------TGRVYGRSS  288

Query  551   CDPYIGNYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCH  372
             C    GN     C + +  +CR++ + F   RGYF +   +  D  +S     L++SDC 
Sbjct  289   CK---GNNKDGGCERWSGPACRRNRNSFELRRGYFVNTVPSKDDYNSS-----LSISDCM  340

Query  371   SICWKNCSCTAYAS--SSTDGTGCILYTNAAHDFQLDENGELYIYRLLKE  228
              ICWK+C C    +  ++ + TGC  +  +   F  D +G    Y ++ +
Sbjct  341   DICWKDCDCVGVTTRGNNANNTGCTFFYGS---FTQDLSGNAIQYHIIVQ  387



>ref|XP_011012338.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X4 [Populus euphratica]
Length=787

 Score =   197 bits (502),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 139/410 (34%), Positives = 197/410 (48%), Gaps = 51/410 (12%)
 Frame = -2

Query  1415  FSSYVSVGAESDTLMQGAN-IRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWY  1239
             F    S    +DTL QG + +     L S   +F LGF  +     G   +   YLGIWY
Sbjct  15    FCFCASHALAADTLYQGDDSLSSSNTLVSKNGLFTLGFTGL-----GFAESNASYLGIWY  69

Query  1238  NKIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLD  1059
             N   + P W+ANR  P+ D+SG L ID  G +K++  GG +   N S  S +N+ A L D
Sbjct  70    NNDTSTPFWLANRGKPIADNSGVLAIDGSGNMKLTCSGGDLVDFNSSRSSASNITAILED  129

Query  1058  SGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPG-S  882
             SGN V++  D N     VLWQSFD+PTD  +PGMKLG+N +TG  W L SWL D VP  +
Sbjct  130   SGNFVLK--DENSGSQQVLWQSFDFPTDTFLPGMKLGINHRTGRTWSLMSWLGDLVPTPT  187

Query  881   GAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTK---EFGFKLVSNEKEK  711
             GAF    D NG   +LVI RR  +YWT+G  ++ +  + P +     +F F  +SN  E 
Sbjct  188   GAFTFEWDTNG--KELVIKRRDVIYWTTGPLRSNTSFEIPFLDAAVLDFSFINISNADED  245

Query  710   YFSYSAKHNY-------RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLE  552
              F ++   N         F+ W L   G IE  S                  GR      
Sbjct  246   CFMFTVSANQFTPQGQRNFSMWQLRFDGGIEDLS-----------------TGRVYGRSS  288

Query  551   CDPYIGNYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCH  372
             C    GN     C + +  +CR++ + F   RGYF +   +  D  +S     L++SDC 
Sbjct  289   CK---GNNKDGGCERWSGPACRRNRNSFELRRGYFVNTVPSKDDYNSS-----LSISDCM  340

Query  371   SICWKNCSCTAYAS--SSTDGTGCILYTNAAHDFQLDENGELYIYRLLKE  228
              ICWK+C C    +  ++ + TGC  +  +   F  D +G    Y ++ +
Sbjct  341   DICWKDCDCVGVTTRGNNANNTGCTFFYGS---FTQDLSGNAIQYHIIVQ  387



>ref|XP_002298942.2| hypothetical protein POPTR_0001s43260g, partial [Populus trichocarpa]
 gb|EEE83747.2| hypothetical protein POPTR_0001s43260g, partial [Populus trichocarpa]
Length=754

 Score =   196 bits (499),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 138/400 (35%), Positives = 192/400 (48%), Gaps = 51/400 (13%)
 Frame = -2

Query  1385  SDTLMQGAN-IRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVWV  1209
             +DTL QG + +     L S   +F LGF  +     G   +   YLGIWYN   + P W+
Sbjct  21    ADTLYQGGDSLNSSSTLVSKNGLFTLGFTRL-----GSAESNASYLGIWYNNDTSHPFWL  75

Query  1208  ANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREVD  1029
             ANRD P+ D+SG L ID  G +K+ Y GG       S  S  N+ A L DSGN V++  D
Sbjct  76    ANRDKPISDTSGVLAIDGSGNMKLIYSGGDPVEFYSSQSSATNITAILEDSGNFVLK--D  133

Query  1028  GNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPG-SGAFELGLDIN  852
              N     VLWQSFD+PTD  +PGMKLG+N +TG  W L SWLSD  P  +GAF    D N
Sbjct  134   ENSGSQQVLWQSFDFPTDTFLPGMKLGINHRTGQTWSLMSWLSDLAPTPAGAFTFEWDTN  193

Query  851   GCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTK---EFGFKLVSNEKEKYFSYSAKHNY  681
             G   +LVI RR  +YWT+G  ++ +  + P +     +F F   SN  E YF ++   N 
Sbjct  194   G--KELVIKRRDVIYWTTGPLRSNTSFEIPFLDAAVLDFSFINDSNADEDYFMFTVSANQ  251

Query  680   -------RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPR  522
                     F+ W L+  G I  ++                   R      C    GN   
Sbjct  252   FTPQGQRNFSMWQLEYDGSIVDNT-----------------TSRTYGGSTCK---GNNTD  291

Query  521   PVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCT  342
               C + +  +CR + + F   RGYF     N   ++   N S L++SDC  ICWK+C C 
Sbjct  292   GGCERWSGPACRSNRNSFELRRGYF----VNTVPIKVDDNSS-LSISDCMDICWKDCQCV  346

Query  341   AYAS--SSTDGTGCILYTNAAHDFQLDENGELYIYRLLKE  228
                +  ++ + TGC  Y  +   F  D +G    Y ++ +
Sbjct  347   GVTTRGNNANNTGCTFYYGS---FTQDLSGNAIQYHIIVQ  383



>ref|XP_002300490.2| hypothetical protein POPTR_0001s43180g [Populus trichocarpa]
 gb|EEE85295.2| hypothetical protein POPTR_0001s43180g [Populus trichocarpa]
Length=720

 Score =   196 bits (498),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 138/398 (35%), Positives = 191/398 (48%), Gaps = 51/398 (13%)
 Frame = -2

Query  1385  SDTLMQGAN-IRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVWV  1209
             +DTL QG + +     L S   +F LGF  +     G   +   YLGIWYN   + P W+
Sbjct  21    ADTLYQGGDSLNSSSTLVSKNGLFTLGFTRL-----GSAESNASYLGIWYNNDTSHPFWL  75

Query  1208  ANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREVD  1029
             ANRD P+ D+SG L ID  G +K+ Y GG       S  S  N+ A L DSGN V++  D
Sbjct  76    ANRDKPISDTSGVLAIDGSGNMKLIYSGGDPVEFYSSQSSATNITAILEDSGNFVLK--D  133

Query  1028  GNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPG-SGAFELGLDIN  852
              N     VLWQSFD+PTD  +PGMKLG+N +TG  W L SWLSD  P  +GAF    D N
Sbjct  134   ENSGSQQVLWQSFDFPTDTFLPGMKLGINHRTGQTWSLMSWLSDLAPTPAGAFTFEWDTN  193

Query  851   GCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTK---EFGFKLVSNEKEKYFSYSAKHNY  681
             G   +LVI RR  +YWT+G  ++ +  + P +     +F F   SN  E YF ++   N 
Sbjct  194   G--KELVIKRRDVIYWTTGPLRSNTSFEIPFLDAAVLDFSFINDSNADEDYFMFTVSANQ  251

Query  680   -------RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPR  522
                     F+ W L+  G I  ++                   R      C    GN   
Sbjct  252   FTPQGQRNFSMWQLEYDGSIVDNT-----------------TSRTYGGSTCK---GNNTD  291

Query  521   PVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCT  342
               C + +  +CR + + F   RGYF     N   ++   N S L++SDC  ICWK+C C 
Sbjct  292   GGCERWSGPACRSNRNSFELRRGYF----VNTVPIKVDDNSS-LSISDCMDICWKDCQCV  346

Query  341   AYAS--SSTDGTGCILYTNAAHDFQLDENGELYIYRLL  234
                +  ++ + TGC  Y  +   F  D +G    Y ++
Sbjct  347   GVPTVGNNANDTGCTFYYGS---FTQDLSGNAIQYHII  381



>ref|XP_006370489.1| hypothetical protein POPTR_0001s43180g [Populus trichocarpa]
 gb|ERP67058.1| hypothetical protein POPTR_0001s43180g [Populus trichocarpa]
Length=741

 Score =   196 bits (498),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 138/398 (35%), Positives = 191/398 (48%), Gaps = 51/398 (13%)
 Frame = -2

Query  1385  SDTLMQGAN-IRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVWV  1209
             +DTL QG + +     L S   +F LGF  +     G   +   YLGIWYN   + P W+
Sbjct  21    ADTLYQGGDSLNSSSTLVSKNGLFTLGFTRL-----GSAESNASYLGIWYNNDTSHPFWL  75

Query  1208  ANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREVD  1029
             ANRD P+ D+SG L ID  G +K+ Y GG       S  S  N+ A L DSGN V++  D
Sbjct  76    ANRDKPISDTSGVLAIDGSGNMKLIYSGGDPVEFYSSQSSATNITAILEDSGNFVLK--D  133

Query  1028  GNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPG-SGAFELGLDIN  852
              N     VLWQSFD+PTD  +PGMKLG+N +TG  W L SWLSD  P  +GAF    D N
Sbjct  134   ENSGSQQVLWQSFDFPTDTFLPGMKLGINHRTGQTWSLMSWLSDLAPTPAGAFTFEWDTN  193

Query  851   GCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTK---EFGFKLVSNEKEKYFSYSAKHNY  681
             G   +LVI RR  +YWT+G  ++ +  + P +     +F F   SN  E YF ++   N 
Sbjct  194   G--KELVIKRRDVIYWTTGPLRSNTSFEIPFLDAAVLDFSFINDSNADEDYFMFTVSANQ  251

Query  680   -------RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPR  522
                     F+ W L+  G I  ++                   R      C    GN   
Sbjct  252   FTPQGQRNFSMWQLEYDGSIVDNT-----------------TSRTYGGSTCK---GNNTD  291

Query  521   PVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCT  342
               C + +  +CR + + F   RGYF     N   ++   N S L++SDC  ICWK+C C 
Sbjct  292   GGCERWSGPACRSNRNSFELRRGYF----VNTVPIKVDDNSS-LSISDCMDICWKDCQCV  346

Query  341   AYAS--SSTDGTGCILYTNAAHDFQLDENGELYIYRLL  234
                +  ++ + TGC  Y  +   F  D +G    Y ++
Sbjct  347   GVPTVGNNANDTGCTFYYGS---FTQDLSGNAIQYHII  381



>ref|XP_010489860.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 [Camelina sativa]
Length=811

 Score =   196 bits (498),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 132/369 (36%), Positives = 179/369 (49%), Gaps = 52/369 (14%)
 Frame = -2

Query  1334  SAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNK-----------IPNEPVWVANRDSPL  1188
             +A  IFKL F       S   N+   YLGIWYN            I    VW+ANR++P+
Sbjct  11    AAFNIFKLQF-------SNFKNSGKWYLGIWYNSFYLNGKENYADIQGGAVWIANRNNPI  63

Query  1187  PDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREVDGNGSFGG  1008
                SGSL +D+ G+L+I   G    +   S  +  N    LLDSGNL ++E+D +GS   
Sbjct  64    LGGSGSLTVDSLGRLRI-LRGAASLLELSSTETTGNTTLKLLDSGNLQLQEMDSDGSMRR  122

Query  1007  VLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDINGCNNQLVI  828
             +LWQSFDYPT+ L+PGMKLG N+KTG  W+LTSWL D +P SG+F  G+D N   N+L I
Sbjct  123   ILWQSFDYPTNTLLPGMKLGFNVKTGKRWELTSWLGDALPASGSFVFGMDAN-ITNRLTI  181

Query  827   SRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSYSAKHNYRFTKWTLDLLG  648
               RG +YW SG+W  G F         F F   S+E E YF YS    Y     T     
Sbjct  182   LWRGSMYWASGLWFKGGFSLEELNHHGFLFSFTSSESEHYFMYSGHQRY---DGTFPPAI  238

Query  647   HIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYI----GNYPRPVCLKENPVSCRKS  480
              I+Q  +++   F            R    + C P+      NY    C + +   C  +
Sbjct  239   EIDQQGMLHIHRF-----------QRERLHVHCYPFTLDEASNYD---CYRRDSTDCLHA  284

Query  479   SDVFVQTR------GYFRDDNRNISDVENSG-----NGSRLALSDCHSICWKNCSCTAYA  333
               +    R      G        +S   + G      G + + +DC +IC +N SC AYA
Sbjct  285   GCIVPDERHESSYYGLGYSFKETVSAFSSKGFLPNETGGKFSSADCRAICLQNSSCLAYA  344

Query  332   SSSTDGTGC  306
             S++ DGTGC
Sbjct  345   STNLDGTGC  353



>ref|XP_002298946.2| hypothetical protein POPTR_0001s43280g [Populus trichocarpa]
 gb|EEE83751.2| hypothetical protein POPTR_0001s43280g [Populus trichocarpa]
Length=756

 Score =   196 bits (498),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 135/384 (35%), Positives = 189/384 (49%), Gaps = 48/384 (13%)
 Frame = -2

Query  1385  SDTLMQGAN-IRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVWV  1209
             +DTL QG + +     L S   +F LGF  +     G       YLGIWY      P+W+
Sbjct  27    ADTLYQGGDALNSSSTLVSKNRLFTLGFVRL-----GSTEYNASYLGIWYQNDTIHPIWI  81

Query  1208  ANRDSPLPDSSGSLIIDAD-GKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
             ANRD P+ D SG L ID D G + ++Y GG + +   +      + ATL DSGN V++  
Sbjct  82    ANRDKPIADDSGVLEIDGDSGTMTVAYSGGNLVIFYSTQSPTTKLTATLEDSGNFVLK--  139

Query  1031  DGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDIN  852
             D N     +LWQSFD PTD  +PGMKLG+N KTG V  LTSW+SD VP SGAF    +  
Sbjct  140   DANSRSDQILWQSFDDPTDTFMPGMKLGINHKTGKVRSLTSWMSDSVPASGAFTFEWEPK  199

Query  851   GCNNQLVISRRGKVYWTSGVWK-NGSFEK-APDMTKEFGFKLVSNEKEKYFSYSAKHNYR  678
                 +LVI RR ++YWTSG  + NGSFE   P+   ++ F +VSN  E YF ++   N  
Sbjct  200   --RQELVIKRRTEIYWTSGPLRSNGSFETFRPNPGLDYTFLIVSNIDEDYFMFTVARNKL  257

Query  677   ------FTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPV  516
                   F+KW L   G +E+ S                   + +    C+   GN     
Sbjct  258   TPPETGFSKWLLQFGGGLEEQS-----------------NEQISGGNLCN---GNNIEMG  297

Query  515   CLK-ENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTA  339
             C+K ++  +CR      ++   +  +    + D     N + L++SDC  ICWK+C+C  
Sbjct  298   CVKWDSEPTCRSRDRYELRACDFLVEGGHAVYD-----NNASLSISDCREICWKDCTCAG  352

Query  338   --YASSSTDGTGCIL-YTNAAHDF  276
                  S+ + TGC   Y N   D 
Sbjct  353   INIRGSNANNTGCTFWYGNFTADL  376



>ref|XP_010928155.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Elaeis guineensis]
Length=453

 Score =   191 bits (486),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 144/416 (35%), Positives = 204/416 (49%), Gaps = 65/416 (16%)
 Frame = -2

Query  1385  SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEP-VWV  1209
             +DTL+   +I D + L SA   F+LGFFS       P N+ +RYLGIWY++IP +  VW 
Sbjct  27    TDTLLPTQSISDGQTLVSANNTFELGFFS-------PNNSSNRYLGIWYHQIPQQTIVWT  79

Query  1208  ANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSG-NNVGATLLDSGNLVVREV  1032
             ANRDSP+ D+SG L    DG L I  V G  + + V+  SG NN    +LDSGNLV+R+ 
Sbjct  80    ANRDSPIADTSGLLKFSDDGDLMI--VDGRGSSTTVASGSGTNNTALAILDSGNLVLRDA  137

Query  1031  DGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWK-LTSWLSDKVPGSGAFELGLDI  855
             +   +   + WQSFD PTD  +PGMKLG   + G + + LTSW SD  P  G F LG+D 
Sbjct  138   N---NLSRIFWQSFDSPTDTFLPGMKLG---RWGGISRLLTSWRSDDDPARGDFSLGVDP  191

Query  854   NGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFSYSAKHNY  681
             NG + Q+ I ++   YWTSGVW    F   P+MT++  + F+ V+N  E YF+Y  K + 
Sbjct  192   NG-STQIFIWQKETTYWTSGVWNGRIFSLVPEMTQDYIYSFEFVTNGDESYFTYHVKTDS  250

Query  680   RFTKWTLDLLGHIEQSSLI--YDPSFFIHYMP-----MYTWIGRYA-----STLECDPYI  537
               ++  +D  G I+Q++ +  Y         P     +    G +      S   C    
Sbjct  251   ILSRLVMDSSGKIQQTTWMDKYQEWILFWAQPKPQCDVRNLCGAFGVCNENSLASCQCLE  310

Query  536   GNYPRPV-----------CLKENPVSCRK---SSDVFV-QTRGYFRDDNRNISDVENSGN  402
             G  P  +           CL++  + C K     D F+ +    F  D  N+   E    
Sbjct  311   GFEPASLPEWNNGYWSHGCLRKTSLQCNKIGGEKDAFLNKAHMRFPLDAVNLDIGEP---  367

Query  401   GSRLALSDCHSICWKNCSCTAYASSSTDGTGCILY----TNAAHDFQLDENGELYI  246
                    +C   C  NCSC AY  S     GC L+     N   ++   E+G LY+
Sbjct  368   ------EECKMACLNNCSCNAYTFSE----GCNLWYGDLKNLQENYVGTESGTLYL  413



>emb|CDP11734.1| unnamed protein product [Coffea canephora]
Length=802

 Score =   196 bits (497),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 150/396 (38%), Positives = 200/396 (51%), Gaps = 48/396 (12%)
 Frame = -2

Query  1379  TLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI-PNEPVWVAN  1203
             T+  G  +     L S    F LGFF+I +           YLGIWY     +  VWVAN
Sbjct  29    TIRPGDRLNSTSQLVSEGGNFTLGFFTIKEKNFS-------YLGIWYTADDQSRKVWVAN  81

Query  1202  RDSP-LPDSSG--SLIIDADGKLKISYVGGMITVSNVSIMSGN-NVGATLLDSGNLVVRE  1035
              D+P + + +G  SL ID +G LKI  V G  TV NVS   G  N  A L DSGN V+ +
Sbjct  82    PDAPVIMNDAGAVSLTIDNEGILKI--VSGDNTVLNVSDEVGTGNTTAALQDSGNFVLMD  139

Query  1034  VDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDI  855
              + +     +LWQSFD+PT+ L+PGMKLGVN  TG  W LTSWLSD+VP SGAF L L+ 
Sbjct  140   AEADNR---ILWQSFDHPTNRLLPGMKLGVNFTTGQSWTLTSWLSDEVPASGAFRLSLER  196

Query  854   NGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSYSAKHNYRF  675
                + QLVI  RG+ YWTSG W + +F+    +T                SY+  HN   
Sbjct  197   IQDSGQLVIRLRGEDYWTSGPWNDQTFQFLQTLTA---------------SYNMFHNNLT  241

Query  674   TKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPY----IGNYPRPVCLK  507
                T+D +    QS      S  +  +     I   A++L   PY     G      C+ 
Sbjct  242   FTSTIDSIYFTFQS---IGSSLSMLELTPDGEILDDATSLFVSPYEKFCYGYESDNGCVT  298

Query  506   ENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASS  327
                 SCR + D F     YF D + N        N S L+LS+C   CW +C+C A+AS+
Sbjct  299   SALPSCRGNKDKFELKSAYFVDGDSNYD------NNSSLSLSNCMKRCWNDCNCDAFAST  352

Query  326   STDGTGCILYTNAAHDFQLDENGE-LYIYRLLKEHK  222
             S +GTGCI +T     +Q+DE+G+ +  Y L+K  K
Sbjct  353   S-NGTGCITWT-GGKQYQIDESGQTVQKYVLVKAKK  386



>ref|XP_011012340.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X6 [Populus euphratica]
Length=785

 Score =   195 bits (496),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 137/400 (34%), Positives = 193/400 (48%), Gaps = 51/400 (13%)
 Frame = -2

Query  1385  SDTLMQGAN-IRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVWV  1209
             +DTL QG + +     L S   +F LGF  +     G   +   YLGI YN   + P W+
Sbjct  21    ADTLYQGGDSLNSSSTLVSKNGLFTLGFTRL-----GSAESNASYLGISYNNDTSHPFWL  75

Query  1208  ANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREVD  1029
             ANR  P+ D+SG L ID  G +K++Y GG       S  S  N+ A L DSGN V++  D
Sbjct  76    ANRGKPIADNSGVLAIDGSGNMKLTYSGGDPVEFYSSQSSATNITAILEDSGNFVLK--D  133

Query  1028  GNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPG-SGAFELGLDIN  852
              N     VLWQSFD+PTD  +PGMKLG+N +TG  W L SWLSD VP  +GAF    D N
Sbjct  134   ENSGSQQVLWQSFDFPTDTFLPGMKLGINHRTGRTWSLMSWLSDLVPTPAGAFTFEWDTN  193

Query  851   GCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTK---EFGFKLVSNEKEKYFSYSAKHNY  681
             G   +LVI RR  +YWT+G  ++ +  + P +     +F F  +SN  E  F ++   N 
Sbjct  194   G--KKLVIKRRDVIYWTTGPLRSNTSFEIPFLDAAVLDFSFINISNADEDCFMFTVSANQ  251

Query  680   -------RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPR  522
                     F+ W L   G IE  S                  GR      C    GN   
Sbjct  252   FTPQGQRNFSMWQLRFDGGIEDLS-----------------TGRVYGRSSCK---GNNKD  291

Query  521   PVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCT  342
               C + +  +CR++ + F   RGYF +   +  D  +S     L++SDC  ICWK+C C 
Sbjct  292   GGCERWSGPACRRNRNSFELRRGYFVNTVPSKDDYNSS-----LSISDCMDICWKDCDCV  346

Query  341   AYAS--SSTDGTGCILYTNAAHDFQLDENGELYIYRLLKE  228
                +  ++ + TGC  +  +   F  D +G    Y ++ +
Sbjct  347   GVTTRGNNANNTGCTFFYGS---FTQDLSGNAIQYHIIVQ  383



>ref|XP_011012341.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X7 [Populus euphratica]
Length=783

 Score =   195 bits (496),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 137/400 (34%), Positives = 193/400 (48%), Gaps = 51/400 (13%)
 Frame = -2

Query  1385  SDTLMQGAN-IRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVWV  1209
             +DTL QG + +     L S   +F LGF  +     G   +   YLGI YN   + P W+
Sbjct  21    ADTLYQGGDSLNSSSTLVSKNGLFTLGFTRL-----GSAESNASYLGISYNNDTSHPFWL  75

Query  1208  ANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREVD  1029
             ANR  P+ D+SG L ID  G +K++Y GG       S  S  N+ A L DSGN V++  D
Sbjct  76    ANRGKPIADNSGVLAIDGSGNMKLTYSGGDPVEFYSSQSSATNITAILEDSGNFVLK--D  133

Query  1028  GNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPG-SGAFELGLDIN  852
              N     VLWQSFD+PTD  +PGMKLG+N +TG  W L SWLSD VP  +GAF    D N
Sbjct  134   ENSGSQQVLWQSFDFPTDTFLPGMKLGINHRTGRTWSLMSWLSDLVPTPAGAFTFEWDTN  193

Query  851   GCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTK---EFGFKLVSNEKEKYFSYSAKHNY  681
             G   +LVI RR  +YWT+G  ++ +  + P +     +F F  +SN  E  F ++   N 
Sbjct  194   G--KKLVIKRRDVIYWTTGPLRSNTSFEIPFLDAAVLDFSFINISNADEDCFMFTVSANQ  251

Query  680   -------RFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPR  522
                     F+ W L   G IE  S                  GR      C    GN   
Sbjct  252   FTPQGQRNFSMWQLRFDGGIEDLS-----------------TGRVYGRSSCK---GNNKD  291

Query  521   PVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCT  342
               C + +  +CR++ + F   RGYF +   +  D  +S     L++SDC  ICWK+C C 
Sbjct  292   GGCERWSGPACRRNRNSFELRRGYFVNTVPSKDDYNSS-----LSISDCMDICWKDCDCV  346

Query  341   AYAS--SSTDGTGCILYTNAAHDFQLDENGELYIYRLLKE  228
                +  ++ + TGC  +  +   F  D +G    Y ++ +
Sbjct  347   GVTTRGNNANNTGCTFFYGS---FTQDLSGNAIQYHIIVQ  383



>gb|KDO56864.1| hypothetical protein CISIN_1g039858mg [Citrus sinensis]
Length=351

 Score =   188 bits (477),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 138/381 (36%), Positives = 196/381 (51%), Gaps = 59/381 (15%)
 Frame = -2

Query  1340  LTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEP--------VWVANRDSPLP  1185
             + SA   F+LGFF+       P +T   YL I Y K P+E         VW+ANR++P+ 
Sbjct  1     MVSANQRFRLGFFN-------PPSTTTHYLAISYVK-PHELGDDETDKLVWIANRNTPIF  52

Query  1184  DSSGSLIIDA-DGKLKISYVGG-MITVSNVSIMSGNNVGATLLDSGNLVVREVDGNGSFG  1011
             D+SGSL ID+ DG LKI + GG  I VS++   +GNN  A L DSGNLV++E + +GS  
Sbjct  53    DTSGSLTIDSNDGNLKILHNGGDPIAVSSIP-GAGNNTIAILQDSGNLVLQEANHDGSTR  111

Query  1010  GVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDINGCNNQLV  831
              VLWQSFDYPTD  +PGMKLG+NL+    W L SW++++ P  G+F LG+D N   N L 
Sbjct  112   RVLWQSFDYPTDTFLPGMKLGINLEADKKWFLQSWITEESPAQGSFTLGVDPN-FTNHLS  170

Query  830   ISRRGKVYWTSGVWKNGSFEKAPDMT-KEFGFKLVSNEKEKYFSYSAKHNYRFTKWTLDL  654
             I  RG+ +   G+W+NG F+ + D T  +F F   SN++EKYF+YS K N          
Sbjct  171   IWWRGEFHSNIGLWRNGIFDSSGDSTISDFIFSYTSNKQEKYFTYSVKGNV---------  221

Query  653   LGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKENPVSCRKSSD  474
                          + F     M    G  A+    +  I  YP           CR +S 
Sbjct  222   -------------TLFPRLRIMAD--GILATHNGKERLIEGYP----------VCRNASS  256

Query  473   VFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYAS-SSTDGTGCILY  297
              F        D + +    + S N   + ++DC   C KNCSC A+AS +  + TGC ++
Sbjct  257   DFKTITALSGDISNDGFTFKESDN---MTINDCQLACQKNCSCIAFASPNENNKTGCQIW  313

Query  296   TNAAHDFQLDENGELYIYRLL  234
             +   +         ++ YRL+
Sbjct  314   SEGTNFTDAVFANPVFTYRLI  334



>ref|XP_006388896.1| hypothetical protein POPTR_0080s002201g, partial [Populus trichocarpa]
 gb|ERP47810.1| hypothetical protein POPTR_0080s002201g, partial [Populus trichocarpa]
Length=484

 Score =   191 bits (486),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 130/365 (36%), Positives = 179/365 (49%), Gaps = 46/365 (13%)
 Frame = -2

Query  1388  ESDTLMQGAN-IRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVW  1212
             E+DTL QG + +     L S   +F LGF  +     G   +   YLGIWYN   + P W
Sbjct  20    EADTLYQGGDSLNSSSTLVSKNGLFTLGFTRV-----GSAESNASYLGIWYNNDTSHPFW  74

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
             +ANR  P+ D+SG L ID  G +K++Y GG       S  S  N+ A L DSGN V++  
Sbjct  75    LANRGKPIADNSGVLAIDGSGNMKLTYSGGDPVEFYSSQSSTTNITAILEDSGNFVLK--  132

Query  1031  DGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPG-SGAFELGLDI  855
             D N     VLWQSFD+PTD  +PGMKLG+N +TG  W L SWLSD VP  +GAF    D 
Sbjct  133   DENSGSQQVLWQSFDFPTDTFLPGMKLGINNRTGQTWYLKSWLSDLVPTPAGAFTFEWDT  192

Query  854   NGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTK---EFGFKLVSNEKEKYF-------  705
              G   +LVI RR  +YWT+G  ++ S  + P +     +F +   SN  E YF       
Sbjct  193   YG--KELVIKRRDVIYWTTGPLRSNSSFEIPFLDAAVLDFSYINDSNADEDYFMFKVSAN  250

Query  704   SYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYP  525
              Y+++    F+ W L   G I               + + T     +      P  GN  
Sbjct  251   EYASQGQRNFSMWQLGYDGTI---------------LDLTT-----SQAFGGPPCKGNNA  290

Query  524   RPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSC  345
                C++ +  +CR +S+ F    GYF +   +  D     + S L++SDC  ICWK+C C
Sbjct  291   DAGCVRWSGPTCRSNSNSFELRSGYFVNTVPSKDD-----DNSSLSISDCRDICWKDCRC  345

Query  344   TAYAS  330
                 S
Sbjct  346   VGVPS  350



>ref|XP_011013017.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Populus euphratica]
Length=500

 Score =   191 bits (486),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 142/405 (35%), Positives = 205/405 (51%), Gaps = 34/405 (8%)
 Frame = -2

Query  1382  DTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIP-NEPVWVA  1206
             D +    +I+D + + SA   FK+GFFS       P ++++RYLGIWYNK+     VWVA
Sbjct  28    DIINTTQSIKDGDSMASADGSFKMGFFS-------PGSSKNRYLGIWYNKVSVMTVVWVA  80

Query  1205  NRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREVDG  1026
             NR++PL +SSG L I  +G L++    G I  S  S  S  N  A LLDSGNLVV+E DG
Sbjct  81    NRETPLTNSSGVLKITGEGILELLNQNGSIIWSTNSSGSARNPVAQLLDSGNLVVKE-DG  139

Query  1025  NGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDINGC  846
             +      LWQSFDYP D L+PGMK+G +L TG    L+SW S   P  G F    D +G 
Sbjct  140   DDDLENSLWQSFDYPCDTLLPGMKMGRDLITGFDRYLSSWKSPDDPSRGNFTFRNDPSGH  199

Query  845   NNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFSYSAKHNYRFT  672
               Q +++    V + SG W    F   P++     + F+ V N+KE Y+ Y   +N   +
Sbjct  200   PEQ-ILTENSIVRYRSGPWNGLRFSGVPELRPNTLYKFEFVFNDKEIYYRYQLLNNSILS  258

Query  671   KWTLDLLGHIEQSSLIYDPSFFIHYMPMY-TWIGRYA---STLECDPYIGNYPRPVCLKE  504
             +  L   G++++ +       +  Y+ ++  +  RYA   +   CD  I + P   CLK 
Sbjct  259   RLVLTENGNLQRFTWTDQTDVWAFYLALFDDYCSRYALCGAYGSCD--ITSSPVCGCLKG  316

Query  503   NPVSCRKSSDVFVQTRGYFRDDNRNIS-------------DVENSGNGSRLALSDCHSIC  363
                   K  D+   + G  R    N S             D+  S     + L +C S+C
Sbjct  317   FLPKVPKDWDMVDWSDGCARRTALNCSGDGFQKYSGVKLPDIRKSWLNKNMNLEECKSMC  376

Query  362   WKNCSCTAYASSSTD--GTGCILYTNAAHDF-QLDENGELYIYRL  237
              KNCSCTAYA+      G+GC+L+ +   D  QL+ENG+    R+
Sbjct  377   MKNCSCTAYANLDIREGGSGCLLWFSELIDMRQLNENGQDIYIRM  421



>ref|XP_007021210.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY12735.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
Length=812

 Score =   194 bits (494),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 140/404 (35%), Positives = 207/404 (51%), Gaps = 35/404 (9%)
 Frame = -2

Query  1382  DTLMQGANIRD--WEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIP-NEPVW  1212
             +T+  G +I+D   + L SA  IF+LGFFS       P N+  RYLGIWY  IP    VW
Sbjct  22    NTITPGHSIKDSKADALISANGIFQLGFFS-------PGNSIKRYLGIWYKDIPIRTVVW  74

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
             VANR++P+  +SG L I + G L+++     I  S+ +     N  A LL++GNLVVR+ 
Sbjct  75    VANRETPISGTSGVLSITSQGILQLTNGTDSIFWSSNTSRPPLNPVAQLLEAGNLVVRDG  134

Query  1031  DGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDIN  852
             D N     +LWQSFD+P+D L+PGMKLG N  TG    L+SW S   P  G F L +D  
Sbjct  135   DENRE-ENILWQSFDHPSDTLLPGMKLGKNFITGKETFLSSWKSADDPAPGDFSLWIDSR  193

Query  851   GCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFSYSAKHNYR  678
             G   QLVI +  K  +  G W    F  AP + K   + F+ + NEKE +++Y   +N  
Sbjct  194   G-YPQLVIMKGPKFLYRDGSWNGIQFTGAPQLKKNDIYSFEFIFNEKEVHYTYELYNNSV  252

Query  677   FTKWTLDLLGHIEQSSLIYDP--------SFFIHYMPMYTWIGRYAS-------TLEC-D  546
              ++  ++  G +++   + DP        S    Y  +Y   G Y S         EC +
Sbjct  253   VSRLAVNQSGLLQRYVWV-DPTKTWIVYLSLMTDYCDIYALCGAYGSCNIQGSPVCECLE  311

Query  545   PYIGNYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSI  366
              ++   P+   L +    C + +++     G+ +     + D  +S     ++L +C  +
Sbjct  312   GFVPKSPKNWGLLDWADGCVRRTELNCSQDGFRKLSGMKLPDTSSSWFNGTMSLKECREM  371

Query  365   CWKNCSCTAYASSSTD--GTGCILYTNAAHDFQLDENG--ELYI  246
             C KNCSCTAYA+S     GTGC+L+ N   D ++   G  ELYI
Sbjct  372   CLKNCSCTAYANSDIKGSGTGCLLWFNELMDVRVFNEGGQELYI  415



>ref|XP_010652609.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 [Vitis vinifera]
Length=291

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 117/270 (43%), Positives = 154/270 (57%), Gaps = 23/270 (9%)
 Frame = -2

Query  1421  MGFSSYVSVGAESDTLMQGANIRDWEHL-TSAKAIFKLGFFSISDSYSGPINTEDRYLGI  1245
             +G   Y+S  A +DT+  G  ++  E L  SAK  F LGFFS+             YLGI
Sbjct  24    LGVLPYIS-SAPTDTIKPGEELQFSEKLLVSAKGTFTLGFFSLESG---------SYLGI  73

Query  1244  WYN-KIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGAT  1068
             W+      E VWVANRD P+  +  +L +DADGKL I + GG   V N S  +  N  AT
Sbjct  74    WFTIDAQKEKVWVANRDKPISGTDANLTLDADGKLMIMHSGGDPIVLN-SNQAARNSTAT  132

Query  1067  LLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVP  888
             LLDSGN V+ E + + S    LW+SFD PTD L+PGMKLG+NLKTG  W L SW++++VP
Sbjct  133   LLDSGNFVLEEFNSDRSVKEKLWESFDNPTDTLLPGMKLGINLKTGQNWSLASWINEQVP  192

Query  887   GSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE-----FGFKLVSN  723
               G F   L+ NG   QLV+ RRG  YW+SG  KN SFE  P ++ +     + F  V+N
Sbjct  193   APGTFT--LEWNG--TQLVMKRRGGTYWSSGTLKNRSFEFIPWLSFDTCNNIYSFNSVAN  248

Query  722   EKEKYFSYSAKHNYRFTKWTLDLLGHIEQS  633
             E E YFSYS       ++W L+  G +  +
Sbjct  249   ENEIYFSYSVPDGV-VSEWALNSRGGLSDT  277



>emb|CAN74543.1| hypothetical protein VITISV_029622 [Vitis vinifera]
Length=744

 Score =   194 bits (492),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 136/351 (39%), Positives = 182/351 (52%), Gaps = 38/351 (11%)
 Frame = -2

Query  1340  LTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPV-WVANRDSPLPDSSGSLI  1164
             + SA  +F LGFFS       P  ++ RYLG+WY K   + V WVANR  P+ +SSG L 
Sbjct  1     MVSANGVFTLGFFS-------PGKSKHRYLGMWYTKDEAQRVVWVANRLIPITNSSGVLT  53

Query  1163  IDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVRE-VDGNGSFG-GVLWQSF  990
             I  DG+LKI   GG+  V N    + +N  ATLLDSGNLV+   ++ NG+F    +WQSF
Sbjct  54    IGDDGRLKIKQSGGLPIVLNTDQAAKHNATATLLDSGNLVLTHMINDNGAFKRETVWQSF  113

Query  989   DYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDINGCNN-QLVISRRGK  813
             D+P+D L+PGMKLGVNLK G    LTSWLS +VP  GAF LGLD    ++ Q+VI RRG 
Sbjct  114   DHPSDTLLPGMKLGVNLKVGSNRSLTSWLSHEVPAPGAFTLGLDPTVNDSCQVVIWRRGI  173

Query  812   VYWTSGVWKNGS--FEKAPDMTKEFGFKLVSNEKEKYFSYSAKHNYRFTKWTLDLLGHIE  639
             V W SG+W++ S  FE   + T    F    ++ EKYF Y+   +   ++    ++G   
Sbjct  174   VLWRSGIWEDKSTHFEDWWN-TYNVSFTCAVSKYEKYFMYTYADHSHLSRL---VMGSWR  229

Query  638   QSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKENPVSCRKSSDVFVQT  459
             Q      P F I              TL C+          C++E     R     F   
Sbjct  230   QVKFNSFPEFEI--------------TL-CEGNRNPILSSGCVEEESKCGRHHRTAFRFM  274

Query  458   RGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSSTDGTGC  306
               Y +         E S +   L  + C + C +NCSC AYAS+  +GTGC
Sbjct  275   NKYMK------RRAEYSDDDPNLGKAGCDAKCKENCSCIAYASAHNNGTGC  319



>emb|CBI20449.3| unnamed protein product [Vitis vinifera]
Length=475

 Score =   189 bits (481),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 149/423 (35%), Positives = 210/423 (50%), Gaps = 51/423 (12%)
 Frame = -2

Query  1409  SYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI  1230
             S + +    DT+    +IRD E +TSA   F+LGFFS       P ++++RYLGIWY K+
Sbjct  16    SLLRISTAVDTINVNQHIRDGETITSAGGTFQLGFFS-------PGDSKNRYLGIWYKKV  68

Query  1229  -PNEPVWVANRDSPLPDSSGSLIIDADGKLKI-SYVGGMITVSNVSIMSGNNVGATLLDS  1056
              P   VWVANR+SPL DSSG L +   G L + S   G++  SN S  S  +  A LL+S
Sbjct  69    APQTVVWVANRESPLTDSSGVLKVTQQGTLVVVSGTNGILWNSNSS-RSAQDPNAQLLES  127

Query  1055  GNLVVREVDGNGS-FGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSG  879
             GNLV+R  +GN S     LWQSFDYP D L+PGMK G N  TG    L+SW S   P  G
Sbjct  128   GNLVMR--NGNDSDPENFLWQSFDYPCDTLLPGMKFGWNRVTGLDRYLSSWKSADDPSKG  185

Query  878   AFELGLDINGCNNQLVISRRG-KVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKY  708
              F  G+D++G     +  R G  V + +G W    F   P +T    F F  VSNEKE Y
Sbjct  186   NFTYGIDLSGFPQPFL--RNGLTVKFRAGPWNGVRFGGIPQLTNNSLFTFDYVSNEKEIY  243

Query  707   FSYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPM-------YTWIGRYA-----  564
             F Y   ++  F +  L   G+  + +     + +  Y          Y   G Y      
Sbjct  244   FIYYLVNSSVFVRRVLTPDGYSRRFTWTDKKNEWTLYSTAQRDDCDNYAICGVYGICKID  303

Query  563   STLECDPYIGNYPR-----------PVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDV  417
              + +C+   G  P+             C++  P+ C+K  D FV+  G        + D 
Sbjct  304   ESPKCECMKGFRPKFQSNWDMADWSKGCVRSTPLDCQK-GDGFVKYSGV------KLPDT  356

Query  416   ENSGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDFQ-LDENGELYI  246
              NS     + L +C S+C +NCSCTAYA+S     G+GC+L+ +   D +   +NG+ + 
Sbjct  357   RNSWFDESMNLKECASLCLRNCSCTAYANSDIRGGGSGCLLWFDDLIDIRDFTQNGQEFY  416

Query  245   YRL  237
              R+
Sbjct  417   ARM  419



>ref|XP_008778592.1| PREDICTED: S-locus-specific glycoprotein S13-like, partial [Phoenix 
dactylifera]
Length=503

 Score =   190 bits (482),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 134/404 (33%), Positives = 197/404 (49%), Gaps = 36/404 (9%)
 Frame = -2

Query  1382  DTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVWVAN  1203
             D L    ++RD + L SA   F LGFFS       P+NT +RY+GIWY   P   VWVAN
Sbjct  32    DILTPNQHLRDDQILISAGERFALGFFS-------PVNTNNRYVGIWYRVSPRTIVWVAN  84

Query  1202  RDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREVDGN  1023
             R  P+ + +GSL I A+G L I+        S+ S    + V A LLD GN +V+E  G+
Sbjct  85    RQHPISERNGSLSITANGTLIITDQNSKPIWSSGSSGLVSPV-AQLLDDGNFIVKEAKGD  143

Query  1022  GSF--GGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDING  849
              +   G ++WQSFDYPTD L+PGMKLG NL +G    L SW S   P  G + + LD+ G
Sbjct  144   NNIVPGRLVWQSFDYPTDTLLPGMKLGWNLTSGLNRSLASWASPSDPAPGPYTMFLDLRG  203

Query  848   CNNQLVISRRGKVYWTSGVWKNGSFEKAPDMT--KEFGFKLVSNEKEKYFSYSAKHNYRF  675
              + Q ++    K  + +G W   SF   PD+   K      V    E +F Y+       
Sbjct  204   -DPQGILLEDSKQLFRTGPWNGQSFSGIPDIIRYKVIIVDFVIKNDEVFFMYNTTSTSII  262

Query  674   TKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYP--RPVC----  513
              + T++  G +++   + D   +  YM     I  Y S  +C  Y    P   PVC    
Sbjct  263   ARHTVNYTGQVQRLIWLNDSQMWSVYMSKPKDICDYVS--QCGAYGVCNPDDSPVCSCLQ  320

Query  512   -----------LKENPVSCRKSSDVFVQ--TRGYFRDDNRNISDVENSGNGSRLALSDCH  372
                        L+E    C + +++  +  T G+       + D   S     + L +C 
Sbjct  321   GFKPRSPENWDLREGKDGCVRMTELDCRNGTDGFVTIAETKLPDTSRSTVDRSMGLDECR  380

Query  371   SICWKNCSCTAYASSSTDGTGCILYTNAAHDFQLDENG--ELYI  246
             + C +NCSCTAYAS++ +G+GCI++T    D ++   G  +LY+
Sbjct  381   ATCLRNCSCTAYASANINGSGCIIWTTELTDIRVFTFGGQDLYV  424



>ref|XP_002298944.2| hypothetical protein POPTR_0001s42890g [Populus trichocarpa]
 gb|EEE83749.2| hypothetical protein POPTR_0001s42890g [Populus trichocarpa]
Length=767

 Score =   193 bits (490),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 133/369 (36%), Positives = 181/369 (49%), Gaps = 47/369 (13%)
 Frame = -2

Query  1385  SDTLMQGAN-IRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVWV  1209
               TL QG + +     L S   +F LGF  +     G   +   YLGIWYN   + P W+
Sbjct  35    QQTLYQGGHSLNSSNTLVSKNGLFTLGFTRL-----GSAESNATYLGIWYNNDRSHPFWL  89

Query  1208  ANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREVD  1029
             ANRD P+ D+SG L ID  G +K++Y  G       S  S  N+ A L DSGN V+  +D
Sbjct  90    ANRDKPIADNSGVLAIDGSGNMKLTYSRGDPVEFYSSQSSTTNITAILEDSGNFVL--ID  147

Query  1028  GNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPG-SGAFELGLDIN  852
              N S   VLWQSFD+PTD ++PGMKLG+N +TG  W L SWLSD VP  +GAF L  D N
Sbjct  148   ENSSSQQVLWQSFDFPTDTVLPGMKLGINHRTGQTWSLVSWLSDIVPTPAGAFTLEWDTN  207

Query  851   GCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYF-------SYSA  693
             G   +LVI RR  +YWTSG++ + +  + P + +   FK+VSN  E Y         ++A
Sbjct  208   G--KELVIKRRDVIYWTSGLFTSNTSFEIPSLDQS--FKIVSNAGEDYLMFNVSPKQFTA  263

Query  692   KHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPV-  516
             +    F+ W L   G I   S                  GR      C    GN      
Sbjct  264   QGQRNFSMWQLKYDGSIADQS-----------------TGRTYGGTAC---TGNNTDIDG  303

Query  515   -CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTA  339
              C + +  +CR + + F  T G F +      D     + S L++SDC  ICWK+C C  
Sbjct  304   GCERWSGPACRSNRNSFELTSGSFVNKVPRKYD-----DNSSLSISDCKDICWKDCQCVG  358

Query  338   YASSSTDGT  312
              ++   + T
Sbjct  359   VSTIGNNAT  367



>ref|XP_008226187.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 [Prunus mume]
Length=422

 Score =   187 bits (475),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 143/383 (37%), Positives = 192/383 (50%), Gaps = 37/383 (10%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVW  1212
             A SDTL  G  +     L SA   F L F  +  +  G   +   YLGI  NK      W
Sbjct  25    AASDTLKPGDTLNSSSSLVSASGKFILRF--VVQNIDG---SNTSYLGILRNKPGANKAW  79

Query  1211  VANRDSPLP-DSSGSLIIDADGKLKISYVGG-MITVSNVSIMSGNNVGATLLDSGNLVVR  1038
             + NR++P+P  SS  LI+D +  LKI+Y GG  I +S+    S   V ATLLDSGN V++
Sbjct  80    IGNRNTPIPYPSSPLLILDLNNALKITYPGGDPIVISSAPQTSV--VVATLLDSGNFVLQ  137

Query  1037  EVDG-NGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGL  861
             EV+  N S  GVLWQSFDYPTD  +PGMKLGV+ + GH W L SW +   P  G   L  
Sbjct  138   EVNSVNKSTSGVLWQSFDYPTDTFLPGMKLGVDHRNGHNWSLLSWATSYNPAPGPLSLDW  197

Query  860   DINGCNNQLVISRRGKVYWTSGVWKNGSFEKA-PDMTKE-FGFKLVSNEKEKYFSYSAKH  687
             D NG  +QL I + G VYW+SG++ +G FE   PD++K+ + F +VSNE E Y +Y+A  
Sbjct  198   DPNG--HQLRIKQAGVVYWSSGIFGDGRFEFIFPDVSKQRYNFSVVSNENEDYLTYTAVG  255

Query  686   NYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLK  507
             +              E   ++Y       Y             L CD Y  N       +
Sbjct  256   D----------PSDPEPEWVLYSRGTLFEYGTQVA----ITKALNCDGY--NTDGGCVRR  299

Query  506   ENPVSCR-KSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAY--  336
             + P SC  K  D F Q  GYF+ +N   S+   S N    + SDC   CW+NC C  +  
Sbjct  300   DRPSSCTAKFGDEFEQKNGYFKINNS--SNTSRSPNWFNASSSDCKVTCWQNCDCLGFDL  357

Query  335   --ASSSTDGTGCILYTNAAHDFQ  273
               A+ S   TGC  ++  +  F+
Sbjct  358   PLANQSQTSTGCEFWSVDSQFFE  380



>ref|XP_010927558.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X4 [Elaeis guineensis]
Length=665

 Score =   191 bits (485),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 133/407 (33%), Positives = 189/407 (46%), Gaps = 43/407 (11%)
 Frame = -2

Query  1415  FSSYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYN  1236
              +S +S     DTL     + D + L S    F LGFFS       PI T +RY+GIWY 
Sbjct  15    LTSRISPSIVGDTLTPAQPLADGQELISTGKRFALGFFS-------PIKTNNRYVGIWYK  67

Query  1235  KIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDS  1056
               P   VWVANR  P+   +GSL I A+G L I+        S+ S    N V A LLD 
Sbjct  68    VSPPTVVWVANRQHPISKCNGSLSITANGTLIITDQNSKTIWSSGSSGLANPV-AQLLDD  126

Query  1055  GNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGA  876
             GN +V+E +   SF    WQS DYP+D L+PGMKLG NLK+G    +TSW S   P  G 
Sbjct  127   GNFIVKEANAPVSFA---WQSSDYPSDTLLPGMKLGWNLKSGLNRNVTSWTSPSDPAPGP  183

Query  875   FELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMT--KEFGFKLVSNEKEKYFS  702
             + +G+D++G N Q+++       W  G W        PD+   K F    V    E ++ 
Sbjct  184   YTMGVDLHG-NPQIILWEGSSQLWRVGPWNGKILTGIPDILHYKIFILDFVIKNDEVFYM  242

Query  701   YSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMP-------MYTWIGRYA-----ST  558
             Y+       T+ T++  G +++   + D   +  YM          +  G Y       +
Sbjct  243   YNTTSTSFITRLTVNYTGFVQRLVWLDDSKMWSSYMSEPKDQCDYVSQCGAYGVCNTNDS  302

Query  557   LECDPYIGNYPR-PV----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVEN  411
               C    G  PR P           C +   + CR  +D FV  +      N  + D   
Sbjct  303   PMCSCLQGFKPRSPTNWDLRDWRDGCKRMTKLDCRNGTDGFVMMK------NVKLPDTSR  356

Query  410   SGNGSRLALSDCHSICWKNCSCTAYASSSTDGTGCILYTNAAHDFQL  270
             S    R+ L++C + C +NCSC AYAS+  +GTGCI++T    D ++
Sbjct  357   STVDRRMGLNECRATCLRNCSCMAYASADINGTGCIIWTTELTDIRV  403



>ref|XP_006452073.1| hypothetical protein CICLE_v10007451mg [Citrus clementina]
 gb|ESR65313.1| hypothetical protein CICLE_v10007451mg [Citrus clementina]
Length=629

 Score =   190 bits (483),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 142/425 (33%), Positives = 214/425 (50%), Gaps = 53/425 (12%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN  1224
             +S     DT+  G +I+D E L SAKA F+LGFFS       P N+  RYLGIWY KI  
Sbjct  39    ISAARTLDTISLGQSIKDGETLVSAKASFELGFFS-------PGNSNIRYLGIWYKKIAE  91

Query  1223  EPV-WVANRDSPLPDSSGSLIIDADGK---LKISYVGGMITVSNVSIMSGNNVGATLLDS  1056
               V WVANRD+PL D SG L I+ +     + ++     +  SN SI +   V A L++S
Sbjct  92    GTVTWVANRDAPLSDRSGVLRINGERNGILVLLNSTNDTVWSSNSSISAQKPVAA-LMES  150

Query  1055  GNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGA  876
             GNLVV++   N     +LWQSFDYP D L+PGMKLG+NL TG    L+SW S   P  G 
Sbjct  151   GNLVVKDGKDNNP-DNILWQSFDYPCDTLLPGMKLGINLGTGLNRFLSSWKSTDDPARGD  209

Query  875   FELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFS  702
             F  GLD  G   QLV+ +   + + +G+W    +   P +     + F+ VSNEKE +++
Sbjct  210   FTYGLDPRGI-PQLVLRKNSIITFRAGLWNGLHWTGVPQLQPNPVYTFEYVSNEKEAFYT  268

Query  701   YSAKHNYRFTKWTLDLLGHIEQSSLIYDP---SFFIHYMPM-------YTWIGRYAS---  561
             Y+  ++   ++  ++  G +++ + +      + F  +  +       Y   G YAS   
Sbjct  269   YNLSNSSVPSRMVINPAGTVQRYTWMERTKTWTLFSRFSGVTLDQCDSYALCGAYASCNI  328

Query  560   ---TLECDPYIGNYPRPV-----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNIS  423
                + EC+   G  P              C++  P+ C K  D F++ +         + 
Sbjct  329   NSNSPECECLQGFVPNSQREWDMQYKSGGCVRRTPLDC-KHGDGFLEHKAV------KLP  381

Query  422   DVENSGNGSRLALSDCHSICWKNCSCTAYASSST--DGTGCILYTNAAHDF-QLDENGEL  252
             D   S     + L +C  +C KNCSCTAYA++     G+GC+L+ +   D  +L E+G+ 
Sbjct  382   DTRFSWVDKNITLWECKELCSKNCSCTAYANADVRGRGSGCLLWFHDLIDIKELPESGQD  441

Query  251   YIYRL  237
                R+
Sbjct  442   LFIRM  446



>ref|XP_011002473.1| PREDICTED: uncharacterized protein LOC105109448 [Populus euphratica]
Length=1666

 Score =   194 bits (494),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 144/406 (35%), Positives = 206/406 (51%), Gaps = 41/406 (10%)
 Frame = -2

Query  1382  DTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIP-NEPVWVA  1206
             D +    +IRD + + SA   FK+GFFS       P ++++RYLGIWYNK+     VWVA
Sbjct  869   DIINTTQSIRDGDSMASADGSFKMGFFS-------PGSSKNRYLGIWYNKVSVMTVVWVA  921

Query  1205  NRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREVDG  1026
             NR++PL +SSG L I  +G L++    G I  S  S  S  N  A LLDSGNLVV+E DG
Sbjct  922   NRETPLTNSSGVLKITGEGILELLNQNGSIIWSTNSSGSARNPVAQLLDSGNLVVKE-DG  980

Query  1025  NGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDINGC  846
             +      LWQSFDYP D L+PGMK+G +L TG    L+SW S   P  G F    D +G 
Sbjct  981   DDDLENSLWQSFDYPCDTLLPGMKMGRDLITGFDRYLSSWKSPDDPSRGNFTFRNDPSGH  1040

Query  845   NNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFSYSAKHNYRFT  672
               Q +++    V + SG W    F   P++     + F+ V N+KE Y+ Y   +N   +
Sbjct  1041  PEQ-ILTENSIVRYRSGPWNGLRFSGVPELRPNTLYKFEFVFNDKEIYYRYQLLNNSILS  1099

Query  671   KWTLDLLGHIEQSSLI-------YDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVC  513
             +  L   G++++ +         +  + F  Y   Y   G Y S   CD  I + P   C
Sbjct  1100  RLVLTENGNLQRFTWTDQTDVWAFYLALFDDYCSRYALCGAYGS---CD--ITSSPVCGC  1154

Query  512   LK----ENPVS---------CRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCH  372
             LK    E P           C + + +     G+ +     + D+  S     + L +C 
Sbjct  1155  LKGFLPEVPKDWDMMDWSDGCARRTALNCSGDGFQKYSGVKLPDIRKSWLNKNMNLEECK  1214

Query  371   SICWKNCSCTAYASSSTD--GTGCILYTNAAHDF-QLDENGE-LYI  246
             S+C KNCSCTAYA+      G+GC+L+ +   D  QL+ENG+ +YI
Sbjct  1215  SMCMKNCSCTAYANLDIREGGSGCLLWFSELIDMRQLNENGQDIYI  1260


 Score =   147 bits (371),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 132/414 (32%), Positives = 200/414 (48%), Gaps = 54/414 (13%)
 Frame = -2

Query  1385  SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNE-PVWV  1209
             +DT+     +R+ + + SA   ++LGFFS       P  +++RYLGIWY+KI  +  VWV
Sbjct  23    TDTINTTQFVREGDTIVSAGGTYELGFFS-------PGKSKNRYLGIWYSKISVQTAVWV  75

Query  1208  ANRDSPLPDSSGSLI-IDADGKLKI-SYVGGMITVSNVSIMSGNNVGATLLDSGNLVVRE  1035
             ANR++PL DSSG ++ +   G L + +  G +I  SN+S  + N V A LLDSGNLVV+E
Sbjct  76    ANRETPLNDSSGVILRLTNQGILVLLNRSGSLIWSSNISTPAKNPV-AQLLDSGNLVVKE  134

Query  1034  VDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDI  855
              +G+ +    LWQSF++P D  +P MK G N  TG  W +TSW S   P  G     L  
Sbjct  135   -EGDDNLENSLWQSFEHPGDTFMPDMKQGRNRITGMDWYMTSWKSPDDPSRGNITYILVP  193

Query  854   NGCNNQLVISRRGKVYWTSGVWK----NGSFEKAPDMTKEFGFKLVSNEKEKYFSYSAKH  687
              G    LV+    +V + SG W     +G+    P+    FGF  V N+KE ++ Y   +
Sbjct  194   YGYPEILVM-EDSRVKYRSGPWNGMRSSGTPHLKPNPVYTFGF--VFNDKEIFYRYHLLN  250

Query  686   NYRFTKWTLDLLGHI--------EQSSLIYDPSFFIHYMPMYTWIG-----RYASTLECD  546
               +  +      G I         QS L+Y  +        Y+  G       +++  CD
Sbjct  251   RSKLWRVVASQNGDITNFVWVDKTQSWLLYGTA-NTDNCERYSLCGANGICSISNSPVCD  309

Query  545   PYIGNYPRPV-----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNG  399
                G  P+             C+++ P++C  S D F +  G        + + + S   
Sbjct  310   CLNGFVPKIQKDWDAMDWSSGCVRKIPLNC--SGDEFRKLSG------AKLPETKTSWFN  361

Query  398   SRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDFQLDENGELYIY  243
               + L +C S C KNCSCTAY++      G+GC+L+     D ++    E  IY
Sbjct  362   KSMNLEECKSTCLKNCSCTAYSNLDIRDGGSGCLLWFGDLIDSRIFIENEQDIY  415



>ref|XP_010927549.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X3 [Elaeis guineensis]
Length=782

 Score =   191 bits (485),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 133/407 (33%), Positives = 189/407 (46%), Gaps = 43/407 (11%)
 Frame = -2

Query  1415  FSSYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYN  1236
              +S +S     DTL     + D + L S    F LGFFS       PI T +RY+GIWY 
Sbjct  15    LTSRISPSIVGDTLTPAQPLADGQELISTGKRFALGFFS-------PIKTNNRYVGIWYK  67

Query  1235  KIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDS  1056
               P   VWVANR  P+   +GSL I A+G L I+        S+ S    N V A LLD 
Sbjct  68    VSPPTVVWVANRQHPISKCNGSLSITANGTLIITDQNSKTIWSSGSSGLANPV-AQLLDD  126

Query  1055  GNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGA  876
             GN +V+E +   SF    WQS DYP+D L+PGMKLG NLK+G    +TSW S   P  G 
Sbjct  127   GNFIVKEANAPVSFA---WQSSDYPSDTLLPGMKLGWNLKSGLNRNVTSWTSPSDPAPGP  183

Query  875   FELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMT--KEFGFKLVSNEKEKYFS  702
             + +G+D++G N Q+++       W  G W        PD+   K F    V    E ++ 
Sbjct  184   YTMGVDLHG-NPQIILWEGSSQLWRVGPWNGKILTGIPDILHYKIFILDFVIKNDEVFYM  242

Query  701   YSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMP-------MYTWIGRYA-----ST  558
             Y+       T+ T++  G +++   + D   +  YM          +  G Y       +
Sbjct  243   YNTTSTSFITRLTVNYTGFVQRLVWLDDSKMWSSYMSEPKDQCDYVSQCGAYGVCNTNDS  302

Query  557   LECDPYIGNYPR-PV----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVEN  411
               C    G  PR P           C +   + CR  +D FV  +      N  + D   
Sbjct  303   PMCSCLQGFKPRSPTNWDLRDWRDGCKRMTKLDCRNGTDGFVMMK------NVKLPDTSR  356

Query  410   SGNGSRLALSDCHSICWKNCSCTAYASSSTDGTGCILYTNAAHDFQL  270
             S    R+ L++C + C +NCSC AYAS+  +GTGCI++T    D ++
Sbjct  357   STVDRRMGLNECRATCLRNCSCMAYASADINGTGCIIWTTELTDIRV  403



>ref|XP_010927539.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X2 [Elaeis guineensis]
Length=792

 Score =   191 bits (485),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 133/407 (33%), Positives = 189/407 (46%), Gaps = 43/407 (11%)
 Frame = -2

Query  1415  FSSYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYN  1236
              +S +S     DTL     + D + L S    F LGFFS       PI T +RY+GIWY 
Sbjct  15    LTSRISPSIVGDTLTPAQPLADGQELISTGKRFALGFFS-------PIKTNNRYVGIWYK  67

Query  1235  KIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDS  1056
               P   VWVANR  P+   +GSL I A+G L I+        S+ S    N V A LLD 
Sbjct  68    VSPPTVVWVANRQHPISKCNGSLSITANGTLIITDQNSKTIWSSGSSGLANPV-AQLLDD  126

Query  1055  GNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGA  876
             GN +V+E +   SF    WQS DYP+D L+PGMKLG NLK+G    +TSW S   P  G 
Sbjct  127   GNFIVKEANAPVSFA---WQSSDYPSDTLLPGMKLGWNLKSGLNRNVTSWTSPSDPAPGP  183

Query  875   FELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMT--KEFGFKLVSNEKEKYFS  702
             + +G+D++G N Q+++       W  G W        PD+   K F    V    E ++ 
Sbjct  184   YTMGVDLHG-NPQIILWEGSSQLWRVGPWNGKILTGIPDILHYKIFILDFVIKNDEVFYM  242

Query  701   YSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMP-------MYTWIGRYA-----ST  558
             Y+       T+ T++  G +++   + D   +  YM          +  G Y       +
Sbjct  243   YNTTSTSFITRLTVNYTGFVQRLVWLDDSKMWSSYMSEPKDQCDYVSQCGAYGVCNTNDS  302

Query  557   LECDPYIGNYPR-PV----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVEN  411
               C    G  PR P           C +   + CR  +D FV  +      N  + D   
Sbjct  303   PMCSCLQGFKPRSPTNWDLRDWRDGCKRMTKLDCRNGTDGFVMMK------NVKLPDTSR  356

Query  410   SGNGSRLALSDCHSICWKNCSCTAYASSSTDGTGCILYTNAAHDFQL  270
             S    R+ L++C + C +NCSC AYAS+  +GTGCI++T    D ++
Sbjct  357   STVDRRMGLNECRATCLRNCSCMAYASADINGTGCIIWTTELTDIRV  403



>ref|XP_010927531.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Elaeis guineensis]
Length=823

 Score =   191 bits (485),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 133/407 (33%), Positives = 189/407 (46%), Gaps = 43/407 (11%)
 Frame = -2

Query  1415  FSSYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYN  1236
              +S +S     DTL     + D + L S    F LGFFS       PI T +RY+GIWY 
Sbjct  15    LTSRISPSIVGDTLTPAQPLADGQELISTGKRFALGFFS-------PIKTNNRYVGIWYK  67

Query  1235  KIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDS  1056
               P   VWVANR  P+   +GSL I A+G L I+        S+ S    N V A LLD 
Sbjct  68    VSPPTVVWVANRQHPISKCNGSLSITANGTLIITDQNSKTIWSSGSSGLANPV-AQLLDD  126

Query  1055  GNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGA  876
             GN +V+E +   SF    WQS DYP+D L+PGMKLG NLK+G    +TSW S   P  G 
Sbjct  127   GNFIVKEANAPVSFA---WQSSDYPSDTLLPGMKLGWNLKSGLNRNVTSWTSPSDPAPGP  183

Query  875   FELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMT--KEFGFKLVSNEKEKYFS  702
             + +G+D++G N Q+++       W  G W        PD+   K F    V    E ++ 
Sbjct  184   YTMGVDLHG-NPQIILWEGSSQLWRVGPWNGKILTGIPDILHYKIFILDFVIKNDEVFYM  242

Query  701   YSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMP-------MYTWIGRYA-----ST  558
             Y+       T+ T++  G +++   + D   +  YM          +  G Y       +
Sbjct  243   YNTTSTSFITRLTVNYTGFVQRLVWLDDSKMWSSYMSEPKDQCDYVSQCGAYGVCNTNDS  302

Query  557   LECDPYIGNYPR-PV----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVEN  411
               C    G  PR P           C +   + CR  +D FV  +      N  + D   
Sbjct  303   PMCSCLQGFKPRSPTNWDLRDWRDGCKRMTKLDCRNGTDGFVMMK------NVKLPDTSR  356

Query  410   SGNGSRLALSDCHSICWKNCSCTAYASSSTDGTGCILYTNAAHDFQL  270
             S    R+ L++C + C +NCSC AYAS+  +GTGCI++T    D ++
Sbjct  357   STVDRRMGLNECRATCLRNCSCMAYASADINGTGCIIWTTELTDIRV  403



>gb|KDO74345.1| hypothetical protein CISIN_1g003254mg [Citrus sinensis]
Length=555

 Score =   188 bits (478),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 139/425 (33%), Positives = 210/425 (49%), Gaps = 53/425 (12%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN  1224
             +S     DT+  G +I+D E L SAK  F+LGFFS       P N++ RYLGIWY KI  
Sbjct  39    ISAARTLDTISLGQSIKDGETLVSAKESFELGFFS-------PGNSKSRYLGIWYKKIAE  91

Query  1223  EPV-WVANRDSPLPDSSGSLIIDADGK---LKISYVGGMITVSNVSIMSGNNVGATLLDS  1056
               V WVANRD+PL D SG L I+ +     + ++     +  SN SI +   V A L++S
Sbjct  92    GTVTWVANRDAPLSDRSGVLRINGERNGILVLLNSTNDTVWSSNSSISAQKPVAA-LMES  150

Query  1055  GNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGA  876
             GNLVV++   N     +LWQSFDYP D L+PGMKLG+NL TG    L+SW S   P  G 
Sbjct  151   GNLVVKDGKDNNP-DNILWQSFDYPCDTLLPGMKLGINLGTGLNRFLSSWKSTDDPARGD  209

Query  875   FELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFS  702
             F  GLD  G   QLV+ +   + + +G W    +   P +     + F+ VSNEKE +++
Sbjct  210   FTYGLDPRGI-PQLVLRKNSIITFRAGSWNGLHWTGVPQLQLNPVYTFEYVSNEKEAFYT  268

Query  701   YSAKHNYRFTKWTLDLLGHIEQSSLIYDP---SFFIHYMPM-------YTWIGRYAS---  561
             Y+  ++   ++  ++  G +++ + +      + F  +  +       Y   G YAS   
Sbjct  269   YNLSNSSVPSRMVINPAGTVQRYTWMERTKTWTLFSRFSGVTLDQCDSYALCGAYASCNI  328

Query  560   ---TLECDPYIGNYPRPV-----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNIS  423
                + EC+   G  P              C++  P+ C+          G+       + 
Sbjct  329   NSNSPECECLQGFVPNSQREWDMQYKSGGCVRRTPLDCKHGD-------GFLEHKAVKLP  381

Query  422   DVENSGNGSRLALSDCHSICWKNCSCTAYASSST--DGTGCILYTNAAHDF-QLDENGEL  252
             D   S     + L +C  +C KNCSCTAYA++     G+GC+L+ +   D  +L E+G+ 
Sbjct  382   DTRFSWVDKNITLWECKELCSKNCSCTAYANADVRGRGSGCLLWFHDLIDIKELPESGQD  441

Query  251   YIYRL  237
                R+
Sbjct  442   LFIRM  446



>ref|XP_006370396.1| hypothetical protein POPTR_0001s42220g [Populus trichocarpa]
 gb|ERP66965.1| hypothetical protein POPTR_0001s42220g [Populus trichocarpa]
Length=776

 Score =   190 bits (483),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 141/411 (34%), Positives = 204/411 (50%), Gaps = 34/411 (8%)
 Frame = -2

Query  1382  DTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIP-NEPVWVA  1206
             D +    +IRD   + SA   FK+GFFS       P ++++RYLGIWYNK+     VWVA
Sbjct  28    DIINTTQSIRDGGSMVSADGSFKMGFFS-------PGSSKNRYLGIWYNKVSVMTVVWVA  80

Query  1205  NRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREVDG  1026
             NR+ PL +SSG L I  +G L++    G I  S  S  S  N  A LLDSGNLVV+E DG
Sbjct  81    NREIPLTNSSGVLKITGEGILELLNQNGSIIWSTNSSRSARNPVAQLLDSGNLVVKE-DG  139

Query  1025  NGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDINGC  846
             +      LWQSFDYP D L+PGMK+G +L TG    L+SW S   P  G F    D +G 
Sbjct  140   DDDLENSLWQSFDYPCDTLLPGMKMGRDLITGFDRYLSSWKSPDDPSRGNFTFRNDPSGH  199

Query  845   NNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFSYSAKHNYRFT  672
               Q +++    V + SG W    F   P +     + F+ V N+KE Y+ Y   +N   +
Sbjct  200   PEQ-ILTENSIVRYRSGPWNGLRFSGVPQLRPNTLYKFEFVFNDKEIYYRYQLLNNSILS  258

Query  671   KWTLDLLGHIEQSSLIYDPSFFIHYMPMY-TWIGRYA---STLECDPYIGNYPRPVCLK-  507
             +  L   G+ ++ +       +  Y+ ++  +  RYA   +   CD  I + P   CLK 
Sbjct  259   RLVLTQNGNFQRFTWTDQTDVWAFYLALFDDYCSRYALCGAYGTCD--ITSSPVCGCLKG  316

Query  506   ---ENPV---------SCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSIC  363
                + P           C + + +     G+ +     + D+  S     + L +C S+C
Sbjct  317   FLPKVPKVWDMMDWSDGCARRTALNCSGDGFQKYSGVKLPDIRKSWLNKNMNLEECKSMC  376

Query  362   WKNCSCTAYASSSTD--GTGCILYTNAAHDF-QLDENGELYIYRLLKEHKG  219
              KNCSCTAYA+      G+GC+L+ +   D  QL+ENG+    R+     G
Sbjct  377   MKNCSCTAYANLDIREGGSGCLLWFSELIDMRQLNENGQDIYIRMAASELG  427



>ref|XP_009605162.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X3 [Nicotiana tomentosiformis]
Length=661

 Score =   189 bits (481),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 135/388 (35%), Positives = 190/388 (49%), Gaps = 43/388 (11%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIP-  1227
             +S  A   ++  G  +   + L S    FKLGFFSI         T   YLGIWY   P 
Sbjct  45    LSSVAAITSMKPGDELNHSQVLDSEGGKFKLGFFSIP-------QTNKNYLGIWYAGDPQ  97

Query  1226  NEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNL  1047
             ++ +W+AN ++P+ ++SG L ID+ G LKI+  G  +      +++G+ + A L DSGN 
Sbjct  98    DKKLWIANPNTPILNNSGLLTIDSTGILKITSGGKTVVNIAPPLLTGSLI-ARLQDSGNF  156

Query  1046  VVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFEL  867
             V+++   N +    LWQSFD+PTD L+PGMKLG NL T   W LTSWLS  +P SGAF L
Sbjct  157   VLQDETRNST----LWQSFDHPTDCLLPGMKLGYNLTTKQNWTLTSWLSSYIPASGAFTL  212

Query  866   GLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEF-----GFKLVSNEKEKYFS  702
              L+      QLVI RRG VYWTSG W+N  F     +   F        LVS +   +F 
Sbjct  213   SLESIQDAFQLVIRRRGGVYWTSGSWRNQGFPFLTALNDSFNRYQYNLSLVSEKDGVFFQ  272

Query  701   YSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPR  522
             + A     F        G I                 +Y     +    E D        
Sbjct  273   FDAPEG-SFPSLEFSSNGAIIGGG---------EDGRIYALYNEFCYGYESD--------  314

Query  521   PVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCT  342
               C+      CRK  D F Q  G F D + N     N  + + ++L DC   CW++CSC 
Sbjct  315   DGCVSTQLPECRKDGDKFEQKSGDFIDRSYN-----NYYDNASISLGDCMQKCWEDCSCV  369

Query  341   AYASSSTDGTGCILYTNAAHDFQLDENG  258
              + +SS + TGC++++    +FQ+DE+G
Sbjct  370   GFTTSSAE-TGCVIWSGNG-EFQVDESG  395



>ref|XP_006452072.1| hypothetical protein CICLE_v10007451mg [Citrus clementina]
 gb|ESR65312.1| hypothetical protein CICLE_v10007451mg [Citrus clementina]
Length=836

 Score =   191 bits (484),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 142/425 (33%), Positives = 214/425 (50%), Gaps = 53/425 (12%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN  1224
             +S     DT+  G +I+D E L SAKA F+LGFFS       P N+  RYLGIWY KI  
Sbjct  39    ISAARTLDTISLGQSIKDGETLVSAKASFELGFFS-------PGNSNIRYLGIWYKKIAE  91

Query  1223  EPV-WVANRDSPLPDSSGSLIIDADGK---LKISYVGGMITVSNVSIMSGNNVGATLLDS  1056
               V WVANRD+PL D SG L I+ +     + ++     +  SN SI +   V A L++S
Sbjct  92    GTVTWVANRDAPLSDRSGVLRINGERNGILVLLNSTNDTVWSSNSSISAQKPVAA-LMES  150

Query  1055  GNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGA  876
             GNLVV++   N     +LWQSFDYP D L+PGMKLG+NL TG    L+SW S   P  G 
Sbjct  151   GNLVVKDGKDNNP-DNILWQSFDYPCDTLLPGMKLGINLGTGLNRFLSSWKSTDDPARGD  209

Query  875   FELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFS  702
             F  GLD  G   QLV+ +   + + +G+W    +   P +     + F+ VSNEKE +++
Sbjct  210   FTYGLDPRGI-PQLVLRKNSIITFRAGLWNGLHWTGVPQLQPNPVYTFEYVSNEKEAFYT  268

Query  701   YSAKHNYRFTKWTLDLLGHIEQSSLIYDP---SFFIHYMPM-------YTWIGRYAS---  561
             Y+  ++   ++  ++  G +++ + +      + F  +  +       Y   G YAS   
Sbjct  269   YNLSNSSVPSRMVINPAGTVQRYTWMERTKTWTLFSRFSGVTLDQCDSYALCGAYASCNI  328

Query  560   ---TLECDPYIGNYPRPV-----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNIS  423
                + EC+   G  P              C++  P+ C K  D F++ +         + 
Sbjct  329   NSNSPECECLQGFVPNSQREWDMQYKSGGCVRRTPLDC-KHGDGFLEHKAV------KLP  381

Query  422   DVENSGNGSRLALSDCHSICWKNCSCTAYASSST--DGTGCILYTNAAHDF-QLDENGEL  252
             D   S     + L +C  +C KNCSCTAYA++     G+GC+L+ +   D  +L E+G+ 
Sbjct  382   DTRFSWVDKNITLWECKELCSKNCSCTAYANADVRGRGSGCLLWFHDLIDIKELPESGQD  441

Query  251   YIYRL  237
                R+
Sbjct  442   LFIRM  446



>ref|XP_006475244.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like [Citrus sinensis]
Length=841

 Score =   191 bits (484),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 142/425 (33%), Positives = 214/425 (50%), Gaps = 53/425 (12%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN  1224
             +S     DT+  G +I+D E L SAKA F+LGFFS       P N+  RYLGIWY KI  
Sbjct  44    ISAARTLDTISLGQSIKDGETLVSAKASFELGFFS-------PGNSNIRYLGIWYKKIAE  96

Query  1223  EPV-WVANRDSPLPDSSGSLIIDADGK---LKISYVGGMITVSNVSIMSGNNVGATLLDS  1056
               V WVANRD+PL D SG L I+ +     + ++     +  SN SI +   V A L++S
Sbjct  97    GTVTWVANRDAPLSDRSGVLRINGERNGILVLLNSTNDTVWSSNSSISAQKPVAA-LMES  155

Query  1055  GNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGA  876
             GNLVV++   N     +LWQSFDYP D L+PGMKLG+NL TG    L+SW S   P  G 
Sbjct  156   GNLVVKDGKDNNP-DNILWQSFDYPCDTLLPGMKLGINLGTGLNRFLSSWKSTDDPARGD  214

Query  875   FELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFS  702
             F  GLD  G   QLV+ +   + + +G+W    +   P +     + F+ VSNEKE +++
Sbjct  215   FTYGLDPRGI-PQLVLRKNSIITFRAGLWNGLHWTGVPQLQPNPVYTFEYVSNEKEAFYT  273

Query  701   YSAKHNYRFTKWTLDLLGHIEQSSLIYDP---SFFIHYMPM-------YTWIGRYAS---  561
             Y+  ++   ++  ++  G +++ + +      + F  +  +       Y   G YAS   
Sbjct  274   YNLSNSSVPSRMVINPAGTVQRYTWMERTKTWTLFSRFSGVTLDQCDSYALCGAYASCNI  333

Query  560   ---TLECDPYIGNYPRPV-----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNIS  423
                + EC+   G  P              C++  P+ C K  D F++ +         + 
Sbjct  334   NSNSPECECLQGFVPNSQREWDMQYKSGGCVRRTPLDC-KHGDGFLEHKAV------KLP  386

Query  422   DVENSGNGSRLALSDCHSICWKNCSCTAYASSST--DGTGCILYTNAAHDF-QLDENGEL  252
             D   S     + L +C  +C KNCSCTAYA++     G+GC+L+ +   D  +L E+G+ 
Sbjct  387   DTRFSWVDKNITLWECKELCSKNCSCTAYANADVRGRGSGCLLWFHDLIDIKELPESGQD  446

Query  251   YIYRL  237
                R+
Sbjct  447   LFIRM  451



>ref|XP_011011049.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 [Populus euphratica]
 ref|XP_011011050.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 [Populus euphratica]
Length=781

 Score =   190 bits (482),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 142/410 (35%), Positives = 195/410 (48%), Gaps = 52/410 (13%)
 Frame = -2

Query  1415  FSSYVSVGAESDTLMQGAN-IRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWY  1239
             F    S    +DTL QG + +     L S   +F LGF  +     G   +   YLGIWY
Sbjct  15    FCFCASHALAADTLYQGDDSLSSSNTLVSKNGLFTLGFTGL-----GFAESNASYLGIWY  69

Query  1238  NKIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLD  1059
             N   + P W+ANR  P+ D+SG L ID  G +K++  GG +   N S  S +N+ A L D
Sbjct  70    NNDTSNPFWLANRGKPIADNSGVLAIDGSGNMKLTCSGGDLVDFNSSRSSASNITAILED  129

Query  1058  SGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPG-S  882
             SGN V++  D N     VLWQSFD+PTD  +PGMKLG+N +TG  W L SWLSD VP  +
Sbjct  130   SGNFVLK--DENSGSQQVLWQSFDFPTDTFLPGMKLGINHRTGRTWSLMSWLSDLVPTPT  187

Query  881   GAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDM---TKEFGFKLVSNEKEK  711
             GAF    D NG   +LVI RRG  YWTSG   + +  K  D+   T +F F   SN  E 
Sbjct  188   GAFTFEWDTNG--KELVIKRRGVFYWTSGPLTSNTSFKNFDLNIGTLDFSFINDSNADED  245

Query  710   YFSYSAKHNYR-------FTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLE  552
             YF ++   N         F+ W L   G     S++   +   H  P+            
Sbjct  246   YFMFNVSANQHASQDQRNFSMWQLRFDG-----SIVDLTTHQTHGGPV------------  288

Query  551   CDPYIGNYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCH  372
             C    GN     C + +  +C  +S+ F    G F      ++ V      S L++SDC 
Sbjct  289   CK---GNNIDAGCERWSGRACGSNSNSFELRSGSF------VNPVFRRDYNSSLSISDCM  339

Query  371   SICWKNCSCTAYASS--STDGTGCILYTNAAHDFQLDENGELYIYRLLKE  228
              ICW +C C    ++  S + TGC+ Y  +   F  D  G    Y ++ +
Sbjct  340   DICWNDCKCFGVPTTDNSANNTGCLFYYTS---FTPDPTGGAIQYHIIVQ  386



>ref|XP_009605161.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X2 [Nicotiana tomentosiformis]
Length=793

 Score =   190 bits (482),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 134/390 (34%), Positives = 198/390 (51%), Gaps = 55/390 (14%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIP-NEPV  1215
             A   ++  G  +   + L S    FKLGFFSI         T   YLGIWY   P ++ +
Sbjct  49    AAITSMKPGDELNHSQVLDSEGGKFKLGFFSIP-------QTNKNYLGIWYAGDPQDKKL  101

Query  1214  WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVRE  1035
             W+AN ++P+ ++SG L ID+ G LKI+  G  +      +++G+ + A L DSGN V+++
Sbjct  102   WIANPNTPILNNSGLLTIDSTGILKITSGGKTVVNIAPPLLTGSLI-ARLQDSGNFVLQD  160

Query  1034  VDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDI  855
                N +    LWQSFD+PTD L+PGMKLG NL T   W LTSWLS  +P SGAF L L+ 
Sbjct  161   ETRNST----LWQSFDHPTDCLLPGMKLGYNLTTKQNWTLTSWLSSYIPASGAFTLSLES  216

Query  854   NGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTK--------EFGFKLVSNEKEKYFSY  699
                  QLVI RRG VYWTSG W+N  F   P +T         ++   LVS +   +F +
Sbjct  217   IQDAFQLVIRRRGGVYWTSGSWRNQGF---PFLTALNDSFNRYQYNLSLVSEKDGVFFQF  273

Query  698   SAKH-NYRFTKWTLD--LLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNY  528
              A   ++   +++ +  ++G  E   +             Y     +    E D      
Sbjct  274   DAPEGSFPSLEFSSNGAIIGGGEDGRI-------------YALYNEFCYGYESDDG----  316

Query  527   PRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCS  348
                 C+      CRK  D F Q  G F D + N     N  + + ++L DC   CW++CS
Sbjct  317   ----CVSTQLPECRKDGDKFEQKSGDFIDRSYN-----NYYDNASISLGDCMQKCWEDCS  367

Query  347   CTAYASSSTDGTGCILYTNAAHDFQLDENG  258
             C  + +SS + TGC++++    +FQ+DE+G
Sbjct  368   CVGFTTSSAE-TGCVIWSGNG-EFQVDESG  395



>ref|XP_009605160.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g67520 isoform X1 [Nicotiana tomentosiformis]
Length=814

 Score =   190 bits (482),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 135/387 (35%), Positives = 191/387 (49%), Gaps = 49/387 (13%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIP-NEPV  1215
             A   ++  G  +   + L S    FKLGFFSI         T   YLGIWY   P ++ +
Sbjct  49    AAITSMKPGDELNHSQVLDSEGGKFKLGFFSIP-------QTNKNYLGIWYAGDPQDKKL  101

Query  1214  WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVRE  1035
             W+AN ++P+ ++SG L ID+ G LKI+  G  +      +++G+ + A L DSGN V+++
Sbjct  102   WIANPNTPILNNSGLLTIDSTGILKITSGGKTVVNIAPPLLTGSLI-ARLQDSGNFVLQD  160

Query  1034  VDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDI  855
                N +    LWQSFD+PTD L+PGMKLG NL T   W LTSWLS  +P SGAF L L+ 
Sbjct  161   ETRNST----LWQSFDHPTDCLLPGMKLGYNLTTKQNWTLTSWLSSYIPASGAFTLSLES  216

Query  854   NGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTK--------EFGFKLVSNEKEKYFSY  699
                  QLVI RRG VYWTSG W+N  F   P +T         ++   LVS +   +F +
Sbjct  217   IQDAFQLVIRRRGGVYWTSGSWRNQGF---PFLTALNDSFNRYQYNLSLVSEKDGVFFQF  273

Query  698   SAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRP  519
              A     F        G I                 +Y     +    E D         
Sbjct  274   DAPEG-SFPSLEFSSNGAIIGGG---------EDGRIYALYNEFCYGYESDDG-------  316

Query  518   VCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTA  339
              C+      CRK  D F Q  G F D + N     N  + + ++L DC   CW++CSC  
Sbjct  317   -CVSTQLPECRKDGDKFEQKSGDFIDRSYN-----NYYDNASISLGDCMQKCWEDCSCVG  370

Query  338   YASSSTDGTGCILYTNAAHDFQLDENG  258
             + +SS + TGC++++    +FQ+DE+G
Sbjct  371   FTTSSAE-TGCVIWSGNG-EFQVDESG  395



>ref|XP_010644298.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Vitis vinifera]
Length=814

 Score =   189 bits (481),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 146/422 (35%), Positives = 204/422 (48%), Gaps = 50/422 (12%)
 Frame = -2

Query  1409  SYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI  1230
             S + + A  DT+     IRD E +TS    F+LGFFS       P N+++RYLGIWY K+
Sbjct  16    SLLRISAAVDTITVNQPIRDGETITSTGGTFELGFFS-------PGNSKNRYLGIWYKKV  68

Query  1229  -PNEPVWVANRDSPLPDSSGSLIIDADGKLKI-SYVGGMITVSNVSIMSGNNVGATLLDS  1056
              P   VWVANR+SPL DSSG L +   G L + +   G++  SN S  S  +  A LL+S
Sbjct  69    APRTVVWVANRESPLTDSSGVLKVTQQGILVVVNGTNGILWNSNSS-RSAQDPNAQLLES  127

Query  1055  GNLVVREVDGNGS-FGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSG  879
             GNLV+R  +GN S     LWQS DYP D L+PGMK G N  TG    L+SW S   P  G
Sbjct  128   GNLVMR--NGNDSDPENFLWQSSDYPGDTLLPGMKFGWNRVTGLDRYLSSWTSADDPSKG  185

Query  878   AFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYF  705
              F  G+D++G   QL++     V + +G W    F   P + +     F  VSNEKE YF
Sbjct  186   NFTYGIDLSGF-PQLLLRNGLDVEFRAGPWNGVGFSGLPQVIENSVTKFHFVSNEKEIYF  244

Query  704   SYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPM-------YTWIGRY-----AS  561
             SYS   +    +  L   G+  +S+     + +  Y          Y   G Y     A 
Sbjct  245   SYSLVDSSVMMRLVLTPDGYSRRSTWTDKKNEWTLYTTAQRDHCDNYALCGGYGICKTAQ  304

Query  560   TLECDPYIGNYPR-----------PVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVE  414
             +  CD   G  P+             C++  P+ C        QT G+ +     + D  
Sbjct  305   SQTCDCMKGFRPKFQINWDMADWSSGCVRSTPLDC--------QTDGFVKLSGVKLPDTR  356

Query  413   NSGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDFQ-LDENGELYIY  243
             NS     + L +C S+C +NCSCTAY +      G+GC+L+     D +   +NG+ +  
Sbjct  357   NSSFNESMNLKECASLCLRNCSCTAYGNLDIRGGGSGCLLWFGELIDIRDFTQNGQEFYV  416

Query  242   RL  237
             R+
Sbjct  417   RM  418



>gb|KDO74343.1| hypothetical protein CISIN_1g003254mg [Citrus sinensis]
 gb|KDO74344.1| hypothetical protein CISIN_1g003254mg [Citrus sinensis]
Length=629

 Score =   188 bits (478),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 141/425 (33%), Positives = 213/425 (50%), Gaps = 53/425 (12%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN  1224
             +S     DT+  G +I+D E L SAK  F+LGFFS       P N++ RYLGIWY KI  
Sbjct  39    ISAARTLDTISLGQSIKDGETLVSAKESFELGFFS-------PGNSKSRYLGIWYKKIAE  91

Query  1223  EPV-WVANRDSPLPDSSGSLIIDADGK---LKISYVGGMITVSNVSIMSGNNVGATLLDS  1056
               V WVANRD+PL D SG L I+ +     + ++     +  SN SI +   V A L++S
Sbjct  92    GTVTWVANRDAPLSDRSGVLRINGERNGILVLLNSTNDTVWSSNSSISAQKPVAA-LMES  150

Query  1055  GNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGA  876
             GNLVV++   N     +LWQSFDYP D L+PGMKLG+NL TG    L+SW S   P  G 
Sbjct  151   GNLVVKDGKDNNP-DNILWQSFDYPCDTLLPGMKLGINLGTGLNRFLSSWKSTDDPARGD  209

Query  875   FELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFS  702
             F  GLD  G   QLV+ +   + + +G W    +   P +     + F+ VSNEKE +++
Sbjct  210   FTYGLDPRGI-PQLVLRKNSIITFRAGSWNGLHWTGVPQLQLNPVYTFEYVSNEKEAFYT  268

Query  701   YSAKHNYRFTKWTLDLLGHIEQSSLIYDP---SFFIHYMPM-------YTWIGRYAS---  561
             Y+  ++   ++  ++  G +++ + +      + F  +  +       Y   G YAS   
Sbjct  269   YNLSNSSVPSRMVINPAGTVQRYTWMERTKTWTLFSRFSGVTLDQCDSYALCGAYASCNI  328

Query  560   ---TLECDPYIGNYPRPV-----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNIS  423
                + EC+   G  P              C++  P+ C K  D F++ +         + 
Sbjct  329   NSNSPECECLQGFVPNSQREWDMQYKSGGCVRRTPLDC-KHGDGFLEHKAV------KLP  381

Query  422   DVENSGNGSRLALSDCHSICWKNCSCTAYASSST--DGTGCILYTNAAHDF-QLDENGEL  252
             D   S     + L +C  +C KNCSCTAYA++     G+GC+L+ +   D  +L E+G+ 
Sbjct  382   DTRFSWVDKNITLWECKELCSKNCSCTAYANADVRGRGSGCLLWFHDLIDIKELPESGQD  441

Query  251   YIYRL  237
                R+
Sbjct  442   LFIRM  446



>gb|KGN45304.1| hypothetical protein Csa_7G433330 [Cucumis sativus]
Length=540

 Score =   187 bits (474),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 138/406 (34%), Positives = 198/406 (49%), Gaps = 45/406 (11%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVW  1212
             A+SD + QG  I     L S  A F LGF+S       P    + Y+ IWY+     PVW
Sbjct  23    AQSDVMAQGQEITPGSTLISTMANFSLGFYS-------PSLLNNSYIAIWYHSDSQNPVW  75

Query  1211  VANRDSPLPDSSGS--LIIDADGKLKISYVGGM----ITVSNVSIMSGNNVGATLLDSGN  1050
             +ANR+   P   G+  L ID++G LKI    G            +    N  A LLD+GN
Sbjct  76    IANRNFAFPRDFGTPCLTIDSNGSLKIVPKEGKGRNGYNFYLFEVEEPTNSSAILLDNGN  135

Query  1049  LVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFE  870
              V+  ++ +GS    LWQSFD+PTD L+PGMKLG+N KTG +W +TS   D    SG+F 
Sbjct  136   FVLCVLNLDGSIKRQLWQSFDHPTDTLLPGMKLGINHKTGSIWSITSRRGDYSVLSGSFT  195

Query  869   LGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMT----KEFGFKLVSNEKEKYFS  702
             L ++ N   NQL+I  RG V+WTSG WK+G FE + +++    +EF F   SNE E +F+
Sbjct  196   LTVNPNN-TNQLLILHRGSVFWTSGNWKDGRFEFSEELSNINNQEFVFSRFSNENETFFN  254

Query  701   YSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGR-YASTLECDPYIGN--  531
             YS  + ++       L+          +   F+        +GR + S +EC PY  N  
Sbjct  255   YSISNLFQLPNHNKGLI----------EVQTFLRLGNDGKLVGRNWDSKVEC-PYFENEL  303

Query  530   -YPRPVC-------LKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDC  375
               P+ V        ++     CR     +  T   F +  RN      S N   L + DC
Sbjct  304   FEPKHVSEVGCVGKMQHKVPECRNPPKQY-STSQRFGNMERNGLRFRESEN---LTIYDC  359

Query  374   HSICWKNCSCTAYASSSTDGTGCILYTNAAHDFQLDENGELYIYRL  237
                C  +C C A++S++ +GTGC ++ N    F   E G+  I+ L
Sbjct  360   EKNCISSCDCIAFSSTNEEGTGCEMW-NVGATFIPVEGGKRIIWSL  404



>gb|KDO74342.1| hypothetical protein CISIN_1g003254mg [Citrus sinensis]
Length=684

 Score =   189 bits (479),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 141/425 (33%), Positives = 213/425 (50%), Gaps = 53/425 (12%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN  1224
             +S     DT+  G +I+D E L SAK  F+LGFFS       P N++ RYLGIWY KI  
Sbjct  39    ISAARTLDTISLGQSIKDGETLVSAKESFELGFFS-------PGNSKSRYLGIWYKKIAE  91

Query  1223  EPV-WVANRDSPLPDSSGSLIIDADGK---LKISYVGGMITVSNVSIMSGNNVGATLLDS  1056
               V WVANRD+PL D SG L I+ +     + ++     +  SN SI +   V A L++S
Sbjct  92    GTVTWVANRDAPLSDRSGVLRINGERNGILVLLNSTNDTVWSSNSSISAQKPVAA-LMES  150

Query  1055  GNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGA  876
             GNLVV++   N     +LWQSFDYP D L+PGMKLG+NL TG    L+SW S   P  G 
Sbjct  151   GNLVVKDGKDNNP-DNILWQSFDYPCDTLLPGMKLGINLGTGLNRFLSSWKSTDDPARGD  209

Query  875   FELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFS  702
             F  GLD  G   QLV+ +   + + +G W    +   P +     + F+ VSNEKE +++
Sbjct  210   FTYGLDPRGI-PQLVLRKNSIITFRAGSWNGLHWTGVPQLQLNPVYTFEYVSNEKEAFYT  268

Query  701   YSAKHNYRFTKWTLDLLGHIEQSSLIYDP---SFFIHYMPM-------YTWIGRYAS---  561
             Y+  ++   ++  ++  G +++ + +      + F  +  +       Y   G YAS   
Sbjct  269   YNLSNSSVPSRMVINPAGTVQRYTWMERTKTWTLFSRFSGVTLDQCDSYALCGAYASCNI  328

Query  560   ---TLECDPYIGNYPRPV-----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNIS  423
                + EC+   G  P              C++  P+ C K  D F++ +         + 
Sbjct  329   NSNSPECECLQGFVPNSQREWDMQYKSGGCVRRTPLDC-KHGDGFLEHKAV------KLP  381

Query  422   DVENSGNGSRLALSDCHSICWKNCSCTAYASSST--DGTGCILYTNAAHDF-QLDENGEL  252
             D   S     + L +C  +C KNCSCTAYA++     G+GC+L+ +   D  +L E+G+ 
Sbjct  382   DTRFSWVDKNITLWECKELCSKNCSCTAYANADVRGRGSGCLLWFHDLIDIKELPESGQD  441

Query  251   YIYRL  237
                R+
Sbjct  442   LFIRM  446



>ref|XP_010927579.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X2 [Elaeis guineensis]
Length=591

 Score =   187 bits (475),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 134/413 (32%), Positives = 195/413 (47%), Gaps = 37/413 (9%)
 Frame = -2

Query  1415  FSSYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYN  1236
              +S VS     DTL     + D + L SA   F LGFFS       PI T + Y+GIWY 
Sbjct  15    LASRVSPSIAGDTLTPTQPLADGQELISAGERFILGFFS-------PIKTNNCYIGIWYK  67

Query  1235  KIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDS  1056
               P   VWVANR  P+ + +GSL I  +G L I+        S+ S    N V A LLD 
Sbjct  68    VSPPTVVWVANRQHPISERNGSLSITVNGTLIITDQNSKTIWSSGSSGLANPV-AQLLDD  126

Query  1055  GNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGA  876
             GN +V+E +  GSF    WQS DYP+D L+PGMKLG NLK+G    +TSW S   P  G 
Sbjct  127   GNFIVKEANIPGSFA---WQSSDYPSDTLLPGMKLGWNLKSGLNRNVTSWTSPSDPAPGP  183

Query  875   FELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMT--KEFGFKLVSNEKEKYFS  702
             + +G+D++G N Q+++       W  G W   +    PD+   K F    V    E ++ 
Sbjct  184   YTMGVDLHG-NPQIILWEGSSQLWRVGPWNGKTLAGIPDILRYKIFILDFVIKNDEVFYM  242

Query  701   YSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPY--IGNY  528
             Y+       T+ T++  G +++   + D   +  YM        Y S  +C  Y      
Sbjct  243   YNTTSTSFITRLTVNYTGFVQRLVWLDDSKMWSSYMSEPKDQCDYVS--QCGAYGVCNTD  300

Query  527   PRPVC---------------LKENPVSCRKSSDVFVQ--TRGYFRDDNRNISDVENSGNG  399
               P+C               L+E    C +   +  Q  T G+    +  + D   S   
Sbjct  301   DSPICSCLQGFKPRSPTNWDLREGKDGCTRRMGLDCQNGTDGFVIVKDVKLPDTSRSMVD  360

Query  398   SRLALSDCHSICWKNCSCTAYASSSTDGTGCILYTNAAHDFQLDENG--ELYI  246
               + L +C + C +NCSCTAYAS++ +G+GCI++T    D ++   G  +LY+
Sbjct  361   RSMGLDECRATCLRNCSCTAYASANINGSGCIIWTTELTDIRVYSFGGQDLYV  413



>gb|KDO74338.1| hypothetical protein CISIN_1g003832mg [Citrus sinensis]
Length=577

 Score =   187 bits (474),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 148/457 (32%), Positives = 216/457 (47%), Gaps = 71/457 (16%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI-P  1227
             +   A +D +    +IRD E L S    F+LGFFS       P  +  RYLGIWY ++ P
Sbjct  12    LGASAANDNITPSQSIRDGETLVSVNGTFELGFFS-------PGTSAKRYLGIWYKRVSP  64

Query  1226  NEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNL  1047
                 WVANR++PL D SG L + + G + +     +   SN SI   N V   L+DSGNL
Sbjct  65    RTVAWVANRETPLTDQSGLLNVTSKGIVLLDGRDRIFWSSNTSITMKNPV-VQLMDSGNL  123

Query  1046  VVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFEL  867
             V+   DGN  +  +LWQSFD+P D L+PGMKLG N KTG    L+SW S   P  G F L
Sbjct  124   VL--TDGN--YNSLLWQSFDHPCDTLLPGMKLGRNFKTGMDRHLSSWKSINDPAPGEFSL  179

Query  866   GLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEF---GFKLVSNEKEKYFSYS  696
              +D +G   QLV+ +   + + +G W    F   P + +      +K V NE E Y+   
Sbjct  180   WIDTHGF-PQLVLRKGSVLQYRAGSWNGLGFTGTPPLKENVPLCDYKFVINENEVYYECD  238

Query  695   AKHNYRFTKWTLDLLGHIEQSSLIY--------DPSFFIHYMP-----MYTWIGRYA---  564
             AK       W       + QS L+         D  F  +Y P     +Y+  G  A   
Sbjct  239   AKGPAVSRLW-------VNQSGLVLRSIWSSQQDVWFLAYYAPLDRCDLYSVCGANARCT  291

Query  563   --STLECDPYIGNYPRPV------CLKENPVSCRKSSDV--FVQTRGYFRDDNRNISDVE  414
               S+  CD   G  P+        C++E  + CR   +   +V+ +         + D  
Sbjct  292   TNSSRRCDCLEGFVPKSPNNWSEGCVRERELKCRNGDEFPKYVKLK---------LPDTS  342

Query  413   NSGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDFQLDENG--ELYI  246
             +S   + + L +C  +C KNCSCTAYA+S  +  G+GC+L+     D +   +G  +LYI
Sbjct  343   SSWFNASMNLKECSELCSKNCSCTAYANSDVERGGSGCLLWFGDLMDMKEYNDGGQDLYI  402

Query  245   -------YRLLKEHKG*ILVNV-RYCCFTVIQVFCVF  159
                      + K+  G I+ +V     F V  +FC++
Sbjct  403   RIASERGRSVTKKQVGIIIASVLLMAMFIVASLFCIW  439



>ref|XP_010325596.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g67520 [Solanum lycopersicum]
Length=1493

 Score =   192 bits (487),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 142/392 (36%), Positives = 199/392 (51%), Gaps = 57/392 (15%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN-EPV  1215
             A   ++  G  +   + L S    FKLGFFSIS        T + YLGIWY   P  + +
Sbjct  29    AAITSMKPGDELNHSQVLDSEGGKFKLGFFSIS-------QTNNYYLGIWYAGDPQGKKL  81

Query  1214  WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVRE  1035
             W+AN ++PL ++SG L ID  G LKI+  G  +      +++G+ + A L DSGNLV+++
Sbjct  82    WIANPNTPLLNNSGLLTIDTTGTLKITSEGKTVVNITPPLLTGSLI-ARLQDSGNLVLQD  140

Query  1034  VDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDI  855
                N +    LWQSFD+PTD L+PGMK+G NL T   W LTSWLS  +P SGAF L L+ 
Sbjct  141   ETRNRN----LWQSFDHPTDTLLPGMKIGYNLTTKQNWTLTSWLSSSIPASGAFTLSLES  196

Query  854   NGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTK--------EFGFKLVSNEKEKYFSY  699
                  QL+I RRG+VYWTSG W NG F   P +T         ++   LVS +   YF +
Sbjct  197   IEDAFQLLIRRRGEVYWTSGAWNNGIF---PFLTALNDSSNRYQYNLNLVSEKDGVYFQF  253

Query  698   SAKHNYRFTKWTLDLLGHI---EQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNY  528
              A  +  F    L+  G I   ++ S +Y                     L  +   G  
Sbjct  254   DAP-DRSFPSLVLNFNGAIFGGDEDSRVY--------------------ALYNEFCYGYE  292

Query  527   PRPVCLKENPVSCRKSSDVFVQTRGYFRD-DNRNISDVENSGNGSRLALSDCHSICWKNC  351
              +  C+      CRK  D F Q  G F D  N NI D       +  +L DC   CW++C
Sbjct  293   SQDGCVSNQLPECRKDGDKFEQKSGDFIDRSNSNIYD------NASTSLGDCMKRCWEHC  346

Query  350   SCTAYASSSTDGTGCILYTNAAHDFQLDENGE  255
             SC  + +++   TGCI++ N   +FQ+DE+G+
Sbjct  347   SCVGFTTTTNG-TGCIIW-NGNGEFQVDESGD  376


 Score =   177 bits (450),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 120/345 (35%), Positives = 177/345 (51%), Gaps = 40/345 (12%)
 Frame = -2

Query  1223  EPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLV  1044
             + +W+AN ++P+ ++SG L +D+ G L+I+  G  +      +++G+ + A L DSGN V
Sbjct  780   KKLWIANPNTPILNNSGLLTLDSTGALRITSGGKTVVNIATPLLTGSLI-ARLQDSGNFV  838

Query  1043  VREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWL-SDKVPGSGAFEL  867
             V++   N +    LWQSFD+PT  L+PGMKLG NL T   W LTSWL S  +P SGAF L
Sbjct  839   VQDETRNRT----LWQSFDHPTSCLLPGMKLGYNLTTRQNWTLTSWLVSSTIPASGAFTL  894

Query  866   GLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDM-----TKEFGFKLVSNEKEKYFS  702
              L+      QLV+SRRG++YWTSG W +  F   P       T ++   LVS     +F 
Sbjct  895   SLEAIQDAFQLVVSRRGEIYWTSGAWNDQGFPYLPSFRDSATTYQYNLNLVSGTDGMFFQ  954

Query  701   YSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPR  522
             + A              G      L  D +       +YT   ++     C  Y G+   
Sbjct  955   FEATK------------GSFPSLELSSDGAIAAGDGSIYTRYNKF-----CYGYGGD---  994

Query  521   PVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENS-GNGSRLALSDCHSICWKNCSC  345
               C+      CRK SD F Q RG F D    +S    S  + + ++L DC   CW++CSC
Sbjct  995   DGCVSSQLPECRKDSDKFEQKRGDFID----LSGTSTSYYDNASISLGDCMQKCWEHCSC  1050

Query  344   TAYASSSTDGTGCILYTNAAHDFQLDENG---ELYIYRLLKEHKG  219
               + S +++GTGC ++ N   DF++DE+G   + Y+    K  KG
Sbjct  1051  VGFTSLNSNGTGCRIW-NGKRDFRVDESGNAVQRYVLVSPKSSKG  1094



>ref|XP_011012339.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X5 [Populus euphratica]
Length=786

 Score =   188 bits (478),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 141/410 (34%), Positives = 194/410 (47%), Gaps = 52/410 (13%)
 Frame = -2

Query  1415  FSSYVSVGAESDTLMQGAN-IRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWY  1239
             F    S    +DTL QG + +     L S   +F LGF  +     G   +   YLGIWY
Sbjct  15    FCFCASHALAADTLYQGDDSLSSSNTLVSKNGLFTLGFTGL-----GFAESNASYLGIWY  69

Query  1238  NKIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLD  1059
             N   + P W+ANR  P+ D+SG L ID  G +K++  GG +   N S  S +N+ A L D
Sbjct  70    NNDTSTPFWLANRGKPIADNSGVLAIDGSGNMKLTCSGGDLVDFNSSRSSASNITAILED  129

Query  1058  SGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPG-S  882
             SGN V++  D N     VLWQSFD+PTD  +PGMKLG+N +TG  W L SWL D VP  +
Sbjct  130   SGNFVLK--DENSGSQQVLWQSFDFPTDTFLPGMKLGINHRTGRTWSLMSWLGDLVPTPT  187

Query  881   GAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDM---TKEFGFKLVSNEKEK  711
             GAF    D NG   +LVI RRG  YWTSG   + +  K  D+   T +F F   SN  E 
Sbjct  188   GAFTFEWDTNG--KELVIKRRGVFYWTSGPLTSNTSFKNFDLNIGTLDFSFINDSNADED  245

Query  710   YFSYSAKHNYR-------FTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLE  552
             YF ++   N         F+ W L   G     S++   +   H  P+            
Sbjct  246   YFMFNVSANQHASQDQRNFSMWQLRFDG-----SIVDLTTHQTHGGPV------------  288

Query  551   CDPYIGNYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCH  372
             C    GN     C + +  +C  +S+ F    G F      ++ V      S L++SDC 
Sbjct  289   CK---GNNIDAGCERWSGRACGSNSNSFELRSGSF------VNPVFRRDYNSSLSISDCM  339

Query  371   SICWKNCSCTAYASS--STDGTGCILYTNAAHDFQLDENGELYIYRLLKE  228
              ICW +C C    ++  S + TGC+ Y  +   F  D  G    Y ++ +
Sbjct  340   DICWNDCKCFGVPTTDNSANNTGCLFYYTS---FTPDPTGGAIQYHIIVQ  386



>gb|KDO74341.1| hypothetical protein CISIN_1g003254mg [Citrus sinensis]
Length=738

 Score =   188 bits (478),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 141/425 (33%), Positives = 213/425 (50%), Gaps = 53/425 (12%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN  1224
             +S     DT+  G +I+D E L SAK  F+LGFFS       P N++ RYLGIWY KI  
Sbjct  39    ISAARTLDTISLGQSIKDGETLVSAKESFELGFFS-------PGNSKSRYLGIWYKKIAE  91

Query  1223  EPV-WVANRDSPLPDSSGSLIIDADGK---LKISYVGGMITVSNVSIMSGNNVGATLLDS  1056
               V WVANRD+PL D SG L I+ +     + ++     +  SN SI +   V A L++S
Sbjct  92    GTVTWVANRDAPLSDRSGVLRINGERNGILVLLNSTNDTVWSSNSSISAQKPVAA-LMES  150

Query  1055  GNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGA  876
             GNLVV++   N     +LWQSFDYP D L+PGMKLG+NL TG    L+SW S   P  G 
Sbjct  151   GNLVVKDGKDNNP-DNILWQSFDYPCDTLLPGMKLGINLGTGLNRFLSSWKSTDDPARGD  209

Query  875   FELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFS  702
             F  GLD  G   QLV+ +   + + +G W    +   P +     + F+ VSNEKE +++
Sbjct  210   FTYGLDPRGI-PQLVLRKNSIITFRAGSWNGLHWTGVPQLQLNPVYTFEYVSNEKEAFYT  268

Query  701   YSAKHNYRFTKWTLDLLGHIEQSSLIYDP---SFFIHYMPM-------YTWIGRYAS---  561
             Y+  ++   ++  ++  G +++ + +      + F  +  +       Y   G YAS   
Sbjct  269   YNLSNSSVPSRMVINPAGTVQRYTWMERTKTWTLFSRFSGVTLDQCDSYALCGAYASCNI  328

Query  560   ---TLECDPYIGNYPRPV-----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNIS  423
                + EC+   G  P              C++  P+ C K  D F++ +         + 
Sbjct  329   NSNSPECECLQGFVPNSQREWDMQYKSGGCVRRTPLDC-KHGDGFLEHKAV------KLP  381

Query  422   DVENSGNGSRLALSDCHSICWKNCSCTAYASSST--DGTGCILYTNAAHDF-QLDENGEL  252
             D   S     + L +C  +C KNCSCTAYA++     G+GC+L+ +   D  +L E+G+ 
Sbjct  382   DTRFSWVDKNITLWECKELCSKNCSCTAYANADVRGRGSGCLLWFHDLIDIKELPESGQD  441

Query  251   YIYRL  237
                R+
Sbjct  442   LFIRM  446



>ref|XP_006300803.1| hypothetical protein CARUB_v10019886mg [Capsella rubella]
 gb|EOA33701.1| hypothetical protein CARUB_v10019886mg [Capsella rubella]
Length=696

 Score =   188 bits (477),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 111/270 (41%), Positives = 155/270 (57%), Gaps = 30/270 (11%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNK----IPN  1224
             +E+DTL QG  ++D + L SA  IFKL FF++ DS        + YLGIW+N     + +
Sbjct  23    SETDTLHQGQYLKDGQELVSAFKIFKLKFFNMEDS-------RNWYLGIWFNDLYLDVRD  75

Query  1223  EPVWVANRDSPLPDSSGSLIIDADGKLKISY-VGGMITVSNVSIMSGNNVGATLLDSGNL  1047
              PVW+ANR++P+ + SGSL +D+ G+L+I      M+ +S  S  +  N    LLDSGNL
Sbjct  76    RPVWIANRNNPISERSGSLTVDSLGRLRILRGSSNMLELS--STEATRNTTLKLLDSGNL  133

Query  1046  VVREVD-GNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFE  870
              ++E+D  N S   VLWQSFDYPTD L+PGMKLG + KTG  W+LTSWL D +P SG+F 
Sbjct  134   QLQEMDDSNRSVKRVLWQSFDYPTDTLLPGMKLGFDAKTGKRWELTSWLGDTLPSSGSFV  193

Query  869   LGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSYSAK  690
              G+D N  N   ++ R    YW+SG+W NG F         F F  VS +  +YF+Y   
Sbjct  194   FGMDANITNILTILWRGNSTYWSSGLWFNGRFSVEGLNECGFLFSYVSTKNGQYFTY---  250

Query  689   HNYRFTKWTLDLLGHIEQSSLIYDPSFFIH  600
                         LGH +  +  + P+  I+
Sbjct  251   ------------LGHDQNDAETFFPTIMIN  268



>ref|XP_010928178.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330 [Elaeis guineensis]
Length=798

 Score =   188 bits (478),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 139/398 (35%), Positives = 201/398 (51%), Gaps = 54/398 (14%)
 Frame = -2

Query  1385  SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPV-WV  1209
             ++TL+   ++RD + L SA  IF+LGFFS       P ++ +RYLGIWY  +  E V WV
Sbjct  19    TNTLLPTQSLRDGQTLVSAAKIFELGFFS-------PGSSTNRYLGIWYLNLAGENVIWV  71

Query  1208  ANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVG---ATLLDSGNLVVR  1038
             ANR+SP+ D+SG L+ D DG L I    G  ++    + SG+  G   AT+LDSGNLV+R
Sbjct  72    ANRNSPIVDTSGVLLFDEDGDLTILDGRGSASI----LASGSKTGSMAATILDSGNLVLR  127

Query  1037  EVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLD  858
             +++ +     +LWQSFDYPTD  +PGMKLG+  +   +  LTSW S   P SG + +G D
Sbjct  128   DINDSSR---ILWQSFDYPTDTFLPGMKLGLEGRQNRL--LTSWKSANDPASGDYSMGFD  182

Query  857   INGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFSYSAKHN  684
              NG  +Q +I ++G VYWTSG W    F   P+M  E  F +  VSN  EKYF+YS  ++
Sbjct  183   PNG-TSQFLIWQKGNVYWTSGTWNGEIFSLNPEMVTEGIFDWTFVSNMHEKYFTYSLLND  241

Query  683   YRFTKWTLDLLGHIEQSSLIYDPSFFIHYMP-----MYTWIGRYASTLECDPYIGNYPRP  519
                 ++ LD  G I+  +     S  +   P     +    G Y    E  P     P  
Sbjct  242   TMIFRYVLDSSGKIQLLTYSGGKSILLWSQPTSQCRVNDLCGAYGVCNENTP-----PPC  296

Query  518   VCLKE-NPVS------------CRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLAL--  384
              CLK   P S            C + + +  ++ G   D+   + ++     G    +  
Sbjct  297   RCLKGFEPGSLIDWNEGVTGGGCIRKTGLQCESGGE-PDEFLKMPNMRLPTFGQNCQIWE  355

Query  383   -SDCHSICWKNCSCTAYASSSTDGTGCILYTNAAHDFQ  273
               +C S C +NC+CTAY  S      C L+     + Q
Sbjct  356   AEECRSACLQNCNCTAYVFS----VNCTLWYGNLENLQ  389



>gb|KDO74339.1| hypothetical protein CISIN_1g003832mg [Citrus sinensis]
Length=579

 Score =   186 bits (473),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 148/457 (32%), Positives = 216/457 (47%), Gaps = 71/457 (16%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI-P  1227
             +   A +D +    +IRD E L S    F+LGFFS       P  +  RYLGIWY ++ P
Sbjct  12    LGASAANDNITPSQSIRDGETLVSVNGTFELGFFS-------PGTSAKRYLGIWYKRVSP  64

Query  1226  NEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNL  1047
                 WVANR++PL D SG L + + G + +     +   SN SI   N V   L+DSGNL
Sbjct  65    RTVAWVANRETPLTDQSGLLNVTSKGIVLLDGRDRIFWSSNTSITMKNPV-VQLMDSGNL  123

Query  1046  VVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFEL  867
             V+   DGN  +  +LWQSFD+P D L+PGMKLG N KTG    L+SW S   P  G F L
Sbjct  124   VL--TDGN--YNSLLWQSFDHPCDTLLPGMKLGRNFKTGMDRHLSSWKSINDPAPGEFSL  179

Query  866   GLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEF---GFKLVSNEKEKYFSYS  696
              +D +G   QLV+ +   + + +G W    F   P + +      +K V NE E Y+   
Sbjct  180   WIDTHGF-PQLVLRKGSVLQYRAGSWNGLGFTGTPPLKENVPLCDYKFVINENEVYYECD  238

Query  695   AKHNYRFTKWTLDLLGHIEQSSLIY--------DPSFFIHYMP-----MYTWIGRYA---  564
             AK       W       + QS L+         D  F  +Y P     +Y+  G  A   
Sbjct  239   AKGPAVSRLW-------VNQSGLVLRSIWSSQQDVWFLAYYAPLDRCDLYSVCGANARCT  291

Query  563   --STLECDPYIGNYPRPV------CLKENPVSCRKSSDV--FVQTRGYFRDDNRNISDVE  414
               S+  CD   G  P+        C++E  + CR   +   +V+ +         + D  
Sbjct  292   TNSSRRCDCLEGFVPKSPNNWSEGCVRERELKCRNGDEFPKYVKLK---------LPDTS  342

Query  413   NSGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDFQLDENG--ELYI  246
             +S   + + L +C  +C KNCSCTAYA+S  +  G+GC+L+     D +   +G  +LYI
Sbjct  343   SSWFNASMNLKECSELCSKNCSCTAYANSDVERGGSGCLLWFGDLMDMKEYNDGGQDLYI  402

Query  245   -------YRLLKEHKG*ILVNV-RYCCFTVIQVFCVF  159
                      + K+  G I+ +V     F V  +FC++
Sbjct  403   RIASERGRSVTKKQVGIIIASVLLMAMFIVASLFCIW  439



>ref|XP_009135846.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X2 [Brassica rapa]
Length=979

 Score =   190 bits (482),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 109/241 (45%), Positives = 142/241 (59%), Gaps = 14/241 (6%)
 Frame = -2

Query  1388  ESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNK-----IPN  1224
             ++DTL+QG +++D + L SA  IFKL FF+         N+ + YLG+WYN      I +
Sbjct  67    QTDTLLQGESLKDGQELVSAFNIFKLKFFNFK-------NSSNLYLGVWYNNLYLNDIQD  119

Query  1223  EPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLV  1044
              PVW+ANRD+P+P   GSL ID+ G+LKI      + ++  S  S  N    LLDSGNL 
Sbjct  120   RPVWIANRDNPIPRRPGSLTIDSLGRLKILRGASSLLLNLSSTESTGNTTLKLLDSGNLQ  179

Query  1043  VREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELG  864
             + E+ G G    VLWQSFDYPTD L+PGMKLG N+KT   W+L S LSD +P SG+F  G
Sbjct  180   LTEM-GPGGSTRVLWQSFDYPTDTLLPGMKLGFNVKTKKRWELRSGLSDTLPASGSFVFG  238

Query  863   LDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSYSAKHN  684
             +D N  +N L I  RG+ YW SG+W  G F        E  F   S E E+YF +S    
Sbjct  239   MDAN-ISNLLTILWRGERYWASGLWFKGRFSLEAFNNYESVFSFNSTESERYFVFSVDRR  297

Query  683   Y  681
             Y
Sbjct  298   Y  298


 Score = 57.0 bits (136),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  401  GSRLALSDCHSICWKNCSCTAYASSSTDGTGCILYTN  291
            G RL+ +DCH IC +NCSC AYAS++ DGTGC ++T+
Sbjct  445  GGRLSSADCHVICLQNCSCVAYASTNVDGTGCEIWTD  481



>ref|XP_009135847.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X3 [Brassica rapa]
Length=947

 Score =   189 bits (481),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 109/241 (45%), Positives = 142/241 (59%), Gaps = 14/241 (6%)
 Frame = -2

Query  1388  ESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNK-----IPN  1224
             ++DTL+QG +++D + L SA  IFKL FF+         N+ + YLG+WYN      I +
Sbjct  20    QTDTLLQGESLKDGQELVSAFNIFKLKFFNFK-------NSSNLYLGVWYNNLYLNDIQD  72

Query  1223  EPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLV  1044
              PVW+ANRD+P+P   GSL ID+ G+LKI      + ++  S  S  N    LLDSGNL 
Sbjct  73    RPVWIANRDNPIPRRPGSLTIDSLGRLKILRGASSLLLNLSSTESTGNTTLKLLDSGNLQ  132

Query  1043  VREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELG  864
             + E+ G G    VLWQSFDYPTD L+PGMKLG N+KT   W+L S LSD +P SG+F  G
Sbjct  133   LTEM-GPGGSTRVLWQSFDYPTDTLLPGMKLGFNVKTKKRWELRSGLSDTLPASGSFVFG  191

Query  863   LDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSYSAKHN  684
             +D N  +N L I  RG+ YW SG+W  G F        E  F   S E E+YF +S    
Sbjct  192   MDAN-ISNLLTILWRGERYWASGLWFKGRFSLEAFNNYESVFSFNSTESERYFVFSVDRR  250

Query  683   Y  681
             Y
Sbjct  251   Y  251


 Score = 57.0 bits (136),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  401  GSRLALSDCHSICWKNCSCTAYASSSTDGTGCILYTN  291
            G RL+ +DCH IC +NCSC AYAS++ DGTGC ++T+
Sbjct  398  GGRLSSADCHVICLQNCSCVAYASTNVDGTGCEIWTD  434



>gb|KDO74337.1| hypothetical protein CISIN_1g003832mg [Citrus sinensis]
Length=634

 Score =   187 bits (474),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 148/457 (32%), Positives = 216/457 (47%), Gaps = 71/457 (16%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI-P  1227
             +   A +D +    +IRD E L S    F+LGFFS       P  +  RYLGIWY ++ P
Sbjct  12    LGASAANDNITPSQSIRDGETLVSVNGTFELGFFS-------PGTSAKRYLGIWYKRVSP  64

Query  1226  NEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNL  1047
                 WVANR++PL D SG L + + G + +     +   SN SI   N V   L+DSGNL
Sbjct  65    RTVAWVANRETPLTDQSGLLNVTSKGIVLLDGRDRIFWSSNTSITMKNPV-VQLMDSGNL  123

Query  1046  VVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFEL  867
             V+   DGN  +  +LWQSFD+P D L+PGMKLG N KTG    L+SW S   P  G F L
Sbjct  124   VL--TDGN--YNSLLWQSFDHPCDTLLPGMKLGRNFKTGMDRHLSSWKSINDPAPGEFSL  179

Query  866   GLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEF---GFKLVSNEKEKYFSYS  696
              +D +G   QLV+ +   + + +G W    F   P + +      +K V NE E Y+   
Sbjct  180   WIDTHGF-PQLVLRKGSVLQYRAGSWNGLGFTGTPPLKENVPLCDYKFVINENEVYYECD  238

Query  695   AKHNYRFTKWTLDLLGHIEQSSLIY--------DPSFFIHYMP-----MYTWIGRYA---  564
             AK       W       + QS L+         D  F  +Y P     +Y+  G  A   
Sbjct  239   AKGPAVSRLW-------VNQSGLVLRSIWSSQQDVWFLAYYAPLDRCDLYSVCGANARCT  291

Query  563   --STLECDPYIGNYPRPV------CLKENPVSCRKSSDV--FVQTRGYFRDDNRNISDVE  414
               S+  CD   G  P+        C++E  + CR   +   +V+ +         + D  
Sbjct  292   TNSSRRCDCLEGFVPKSPNNWSEGCVRERELKCRNGDEFPKYVKLK---------LPDTS  342

Query  413   NSGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDFQLDENG--ELYI  246
             +S   + + L +C  +C KNCSCTAYA+S  +  G+GC+L+     D +   +G  +LYI
Sbjct  343   SSWFNASMNLKECSELCSKNCSCTAYANSDVERGGSGCLLWFGDLMDMKEYNDGGQDLYI  402

Query  245   -------YRLLKEHKG*ILVNV-RYCCFTVIQVFCVF  159
                      + K+  G I+ +V     F V  +FC++
Sbjct  403   RIASERGRSVTKKQVGIIIASVLLMAMFIVASLFCIW  439



>ref|XP_009135845.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X1 [Brassica rapa]
Length=994

 Score =   189 bits (481),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 109/241 (45%), Positives = 142/241 (59%), Gaps = 14/241 (6%)
 Frame = -2

Query  1388  ESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNK-----IPN  1224
             ++DTL+QG +++D + L SA  IFKL FF+         N+ + YLG+WYN      I +
Sbjct  67    QTDTLLQGESLKDGQELVSAFNIFKLKFFNFK-------NSSNLYLGVWYNNLYLNDIQD  119

Query  1223  EPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLV  1044
              PVW+ANRD+P+P   GSL ID+ G+LKI      + ++  S  S  N    LLDSGNL 
Sbjct  120   RPVWIANRDNPIPRRPGSLTIDSLGRLKILRGASSLLLNLSSTESTGNTTLKLLDSGNLQ  179

Query  1043  VREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELG  864
             + E+ G G    VLWQSFDYPTD L+PGMKLG N+KT   W+L S LSD +P SG+F  G
Sbjct  180   LTEM-GPGGSTRVLWQSFDYPTDTLLPGMKLGFNVKTKKRWELRSGLSDTLPASGSFVFG  238

Query  863   LDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSYSAKHN  684
             +D N  +N L I  RG+ YW SG+W  G F        E  F   S E E+YF +S    
Sbjct  239   MDAN-ISNLLTILWRGERYWASGLWFKGRFSLEAFNNYESVFSFNSTESERYFVFSVDRR  297

Query  683   Y  681
             Y
Sbjct  298   Y  298


 Score = 57.0 bits (136),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  401  GSRLALSDCHSICWKNCSCTAYASSSTDGTGCILYTN  291
            G RL+ +DCH IC +NCSC AYAS++ DGTGC ++T+
Sbjct  445  GGRLSSADCHVICLQNCSCVAYASTNVDGTGCEIWTD  481



>ref|XP_009406495.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Musa acuminata subsp. malaccensis]
Length=834

 Score =   188 bits (477),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 137/419 (33%), Positives = 202/419 (48%), Gaps = 69/419 (16%)
 Frame = -2

Query  1385  SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI-PNEPVWV  1209
             +DTL  G +IRD + L SA   F+LGFFS       P N+ +RYLGIWY K+ P   +WV
Sbjct  30    ADTLSAGQSIRDGQTLISAAQTFELGFFS-------PPNSSNRYLGIWYQKLSPRTIIWV  82

Query  1208  ANRDSPLPDSSGSLIIDADGKLKI-SYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
              NR+ P+P+ SG L IDA G L I   +G  I +++ +  S N   ATLLDSGNLV+++ 
Sbjct  83    GNRERPIPNISGFLTIDAQGTLMILDKIGTSIMIAS-NTGSTNLTSATLLDSGNLVLKQW  141

Query  1031  DGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDIN  852
             + +      LWQSFD+PTD  +PGMKLG++ K   +  LTSW S   PG G F  G+D N
Sbjct  142   NSSQD-AQPLWQSFDHPTDTFLPGMKLGLDGKRNRL--LTSWRSSDDPGPGDFSAGIDPN  198

Query  851   GCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTK-EFGFKLVSNEKEKYFSYSAKHNYRF  675
             G   Q  +  +G+V W SG+W   SF     MT  ++      +  + Y+ Y+   +   
Sbjct  199   G-TKQFFMWYKGEVQWQSGLWNGTSFGLVNRMTSGQYNITYTPHWIDGYYYYTFGDSSLI  257

Query  674   TKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWI------------------------GRY  567
             T+  +++ G  +Q         FI       W+                        G +
Sbjct  258   TRGVMEVSGQFKQ---------FIWLESEEEWVVLWVQPKELPCEIRATCGANGICSGSH  308

Query  566   ASTLECDPYIGNYPRPV-----------CLKENPVS-CRKSSDVFVQTRGYFRDDNRNIS  423
              ++  C    G  P              C++  P + C +  DVF      F   N  + 
Sbjct  309   DNSTTCRCMYGFVPASYQRWRSNDWSEGCMRRTPTTECER--DVF------FGLTNVKLP  360

Query  422   DVENSGNGSRLALSDCHSICWKNCSCTAYASSSTDGTGCILYTNAAHDFQLDENGELYI  246
                +    S ++L DC S C ++CSCTAYA++  +GTGC+ ++      Q D   +LY+
Sbjct  361   IFSSREGDSSVSLEDCESSCGRDCSCTAYAAAYANGTGCLFWSGGLLGLQ-DGTQDLYV  418



>gb|KDO74340.1| hypothetical protein CISIN_1g003254mg [Citrus sinensis]
Length=836

 Score =   188 bits (477),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 141/425 (33%), Positives = 213/425 (50%), Gaps = 53/425 (12%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN  1224
             +S     DT+  G +I+D E L SAK  F+LGFFS       P N++ RYLGIWY KI  
Sbjct  39    ISAARTLDTISLGQSIKDGETLVSAKESFELGFFS-------PGNSKSRYLGIWYKKIAE  91

Query  1223  EPV-WVANRDSPLPDSSGSLIIDADGK---LKISYVGGMITVSNVSIMSGNNVGATLLDS  1056
               V WVANRD+PL D SG L I+ +     + ++     +  SN SI +   V A L++S
Sbjct  92    GTVTWVANRDAPLSDRSGVLRINGERNGILVLLNSTNDTVWSSNSSISAQKPVAA-LMES  150

Query  1055  GNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGA  876
             GNLVV++   N     +LWQSFDYP D L+PGMKLG+NL TG    L+SW S   P  G 
Sbjct  151   GNLVVKDGKDNNP-DNILWQSFDYPCDTLLPGMKLGINLGTGLNRFLSSWKSTDDPARGD  209

Query  875   FELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFS  702
             F  GLD  G   QLV+ +   + + +G W    +   P +     + F+ VSNEKE +++
Sbjct  210   FTYGLDPRGI-PQLVLRKNSIITFRAGSWNGLHWTGVPQLQLNPVYTFEYVSNEKEAFYT  268

Query  701   YSAKHNYRFTKWTLDLLGHIEQSSLIYDP---SFFIHYMPM-------YTWIGRYAS---  561
             Y+  ++   ++  ++  G +++ + +      + F  +  +       Y   G YAS   
Sbjct  269   YNLSNSSVPSRMVINPAGTVQRYTWMERTKTWTLFSRFSGVTLDQCDSYALCGAYASCNI  328

Query  560   ---TLECDPYIGNYPRPV-----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNIS  423
                + EC+   G  P              C++  P+ C K  D F++ +         + 
Sbjct  329   NSNSPECECLQGFVPNSQREWDMQYKSGGCVRRTPLDC-KHGDGFLEHKAV------KLP  381

Query  422   DVENSGNGSRLALSDCHSICWKNCSCTAYASSST--DGTGCILYTNAAHDF-QLDENGEL  252
             D   S     + L +C  +C KNCSCTAYA++     G+GC+L+ +   D  +L E+G+ 
Sbjct  382   DTRFSWVDKNITLWECKELCSKNCSCTAYANADVRGRGSGCLLWFHDLIDIKELPESGQD  441

Query  251   YIYRL  237
                R+
Sbjct  442   LFIRM  446



>gb|KDO74335.1| hypothetical protein CISIN_1g003832mg [Citrus sinensis]
 gb|KDO74336.1| hypothetical protein CISIN_1g003832mg [Citrus sinensis]
Length=640

 Score =   187 bits (474),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 148/457 (32%), Positives = 216/457 (47%), Gaps = 71/457 (16%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI-P  1227
             +   A +D +    +IRD E L S    F+LGFFS       P  +  RYLGIWY ++ P
Sbjct  12    LGASAANDNITPSQSIRDGETLVSVNGTFELGFFS-------PGTSAKRYLGIWYKRVSP  64

Query  1226  NEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNL  1047
                 WVANR++PL D SG L + + G + +     +   SN SI   N V   L+DSGNL
Sbjct  65    RTVAWVANRETPLTDQSGLLNVTSKGIVLLDGRDRIFWSSNTSITMKNPV-VQLMDSGNL  123

Query  1046  VVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFEL  867
             V+   DGN  +  +LWQSFD+P D L+PGMKLG N KTG    L+SW S   P  G F L
Sbjct  124   VL--TDGN--YNSLLWQSFDHPCDTLLPGMKLGRNFKTGMDRHLSSWKSINDPAPGEFSL  179

Query  866   GLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEF---GFKLVSNEKEKYFSYS  696
              +D +G   QLV+ +   + + +G W    F   P + +      +K V NE E Y+   
Sbjct  180   WIDTHGF-PQLVLRKGSVLQYRAGSWNGLGFTGTPPLKENVPLCDYKFVINENEVYYECD  238

Query  695   AKHNYRFTKWTLDLLGHIEQSSLIY--------DPSFFIHYMP-----MYTWIGRYA---  564
             AK       W       + QS L+         D  F  +Y P     +Y+  G  A   
Sbjct  239   AKGPAVSRLW-------VNQSGLVLRSIWSSQQDVWFLAYYAPLDRCDLYSVCGANARCT  291

Query  563   --STLECDPYIGNYPRPV------CLKENPVSCRKSSDV--FVQTRGYFRDDNRNISDVE  414
               S+  CD   G  P+        C++E  + CR   +   +V+ +         + D  
Sbjct  292   TNSSRRCDCLEGFVPKSPNNWSEGCVRERELKCRNGDEFPKYVKLK---------LPDTS  342

Query  413   NSGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDFQLDENG--ELYI  246
             +S   + + L +C  +C KNCSCTAYA+S  +  G+GC+L+     D +   +G  +LYI
Sbjct  343   SSWFNASMNLKECSELCSKNCSCTAYANSDVERGGSGCLLWFGDLMDMKEYNDGGQDLYI  402

Query  245   -------YRLLKEHKG*ILVNV-RYCCFTVIQVFCVF  159
                      + K+  G I+ +V     F V  +FC++
Sbjct  403   RIASERGRSVTKKQVGIIIASVLLMAMFIVASLFCIW  439



>ref|XP_009417412.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-7 
[Musa acuminata subsp. malaccensis]
Length=1630

 Score =   191 bits (485),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 143/435 (33%), Positives = 209/435 (48%), Gaps = 64/435 (15%)
 Frame = -2

Query  1412  SSYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNK  1233
             +S +     +DTL+   ++RD + L SA   F+ GFFS       P ++ +RY+GIWY+K
Sbjct  19    ASRIVFSIAADTLLPSQSLRDGQTLVSANKTFEFGFFS-------PGSSTNRYVGIWYHK  71

Query  1232  IPNE-PVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDS  1056
             +  + PVWVANRD+ + D SG L+ D +    I   G   +    S +  NN  AT+LDS
Sbjct  72    VQKQTPVWVANRDNAIADKSGVLMFDDNNGDLILLDGRGSSSVLASGLGTNNREATILDS  131

Query  1055  GNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGA  876
             GNLV+R  D       V WQSFD+PTD  +PGMKLG+N +   +  LTSW S   P  G 
Sbjct  132   GNLVLRSSDNTSM---VSWQSFDHPTDTFLPGMKLGLNRRQNRL--LTSWKSKDDPALGD  186

Query  875   FELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFS  702
             F LGLD  G   + +I ++G  YW+SG W    F   P+MT +  F ++ V ++ E YF+
Sbjct  187   FSLGLDPTG-KPKFLIWKKGTPYWSSGDWDGKMFRAVPEMTPDYIFNYEFVHDQHELYFT  245

Query  701   YSAKHNYRFTKWTLDLLGHIEQSS-LIYDPSFFIHYMPMYTWIGRY--------------  567
             YS K +   ++  + + G I+Q + L  + S+ + +   +T    Y              
Sbjct  246   YSMKDDSIISRLIIGISGQIQQMTWLEIETSWILFWSQPHTQCNVYDLCGAFGVCNEAIQ  305

Query  566   ASTLECDPYIGNYPRPV-----------CLKENPVSCR--KSSDVFVQTRGYFRDDNRNI  426
                 EC P  G  P  +           CL++  + C   +  D FV       + N   
Sbjct  306   PKACECLP--GFQPASLQDWFEGSTGGGCLRKTSLQCESGEKPDKFVVMPHMKFNANATK  363

Query  425   SDVENSGNGSRLALSDCHSICWKNCSCTAYASSSTDGTGCILYTNAAHDFQLDENGE---  255
              DV ++         DC S C K+C+CTAYA S     GC L+     + Q  + GE   
Sbjct  364   LDVSDA--------KDCESACHKHCNCTAYAFSG----GCSLWQGDLVNLQQVDGGENIT  411

Query  254   ---LYIYRLLKEHKG  219
                LYI     E +G
Sbjct  412   IGTLYIRVADSESQG  426


 Score =   154 bits (390),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 124/407 (30%), Positives = 191/407 (47%), Gaps = 47/407 (12%)
 Frame = -2

Query  1388  ESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEP-VW  1212
             + DTL     + D + LTSA  IF+LGFF        P N+ + YLGIWY +IP++P VW
Sbjct  852   KGDTLTSSTPLSDNQTLTSAGGIFELGFFR-------PGNSSEWYLGIWYKEIPDQPIVW  904

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIM-SGNNVGAT-----LLDSGN  1050
             VANRD+PL  S   L + ADG L       ++   + +I+ S N   AT     L DSGN
Sbjct  905   VANRDTPLNGSVRILNLTADGNL-------LLLNKDANILWSTNTSNATYPLLQLSDSGN  957

Query  1049  LVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFE  870
             L++      G    +LWQSFD+P+D  + GMK+G++        L SW S   P  G + 
Sbjct  958   LILT----GGIPKSILWQSFDHPSDTFLAGMKIGLDFSAKLDRHLISWKSSSDPSPGNYS  1013

Query  869   LGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDM--TKEFGFKLVSNEKEKYFSYS  696
              G+D +G     +     + + T G W    +   PDM       F  V N+ E Y+++ 
Sbjct  1014  YGMDPHGVPEVYIWEGSSRTFRT-GPWNGKGWSGRPDMWTNGVLRFHFVMNQHEVYYTFE  1072

Query  695   AKHNYRFTKWTLDLLGHIEQ-----SSLIYDPSFFIHYMP--MYTWIGR-------YAST  558
             + +     +  LD  G +++     +S  +D  + +   P   Y   G        Y+  
Sbjct  1073  SLNKSVHCRAVLDASGVLQRLVWSTASNRWDLFWLVPEDPCDQYATCGANGMCTTIYSPR  1132

Query  557   LEC-DPYIGNYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALS  381
              +C   +    P+   L+EN   C + + +   T G+F   N  + D  N+   S   L+
Sbjct  1133  CQCLQGFTPKSPKDWDLRENSDGCVRRTGLNCSTDGFFPLQNVKLPDTSNASTESNKTLN  1192

Query  380   DCHSICWKNCSCTAYASSSTDGTGCILYTNAAHDFQLDENG--ELYI  246
             +C  +C KNCSC AYA +    + CI + +   D ++   G  +LYI
Sbjct  1193  ECQDLCLKNCSCLAYALNGE--SMCITWLSDLVDIRMFIEGGDDLYI  1237



>emb|CAH67725.1| H0613A10.8 [Oryza sativa Indica Group]
 emb|CAH67663.1| H0315F07.1 [Oryza sativa Indica Group]
Length=834

 Score =   188 bits (477),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 141/430 (33%), Positives = 209/430 (49%), Gaps = 37/430 (9%)
 Frame = -2

Query  1412  SSYVSVGAE-SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYN  1236
             S   + GAE  DTL +G NI D E L SA   F LGFFS + S S   +T  RYLGIW++
Sbjct  18    SGRTTTGAELGDTLGKGRNITDGERLVSAGGSFTLGFFSPASSSS--SSTSRRYLGIWFS  75

Query  1235  KIPNEPVWVANRDSPLPDSSGSLII-DADGKLKISYVGGMITVSNVSIMSGNNVGATLLD  1059
                +   WVANRD PL D+SG L+I DA   L +   G ++  SN +   G ++ A LL+
Sbjct  76    VSDDVVCWVANRDRPLTDTSGVLVITDAGSLLLLDGSGHVVWSSNTTTGGGASMAAQLLE  135

Query  1058  SGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSG  879
             SGNLVV +    G+   V+WQSFD+P D L+PGMK+G NL TG  W L+SW S   P  G
Sbjct  136   SGNLVVSDRGNGGAGAVVVWQSFDHPCDTLLPGMKIGKNLWTGAEWYLSSWRSSGDPSPG  195

Query  878   AFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDM---TKEFGFKLVSNEKEKY  708
              +    D  G    ++    G+VY T G W    F   P+M   +  F ++L  +  E  
Sbjct  196   NYRYRTDTKGVPENVLWDGDGEVYRT-GPWNGLWFSGIPEMGTYSDMFSYQLTVSPGEIT  254

Query  707   FSYSAKHNYRFTKWTLDLLGHIEQSSLIYDPS------FFIHYMPMYTWIGRYASTLECD  546
             F YSA     F++  +  +G +++  L+++PS      FF     +    G+  +   CD
Sbjct  255   FGYSANAGAPFSRLVVTGVGEVQR--LVWEPSSRAWKNFFQGPRDLCDDYGKCGAFGLCD  312

Query  545   P-------------YIGNYPRP-VCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENS  408
                           +    P P   +++    CR+ + +   T G+       + D  N+
Sbjct  313   AGAASTSFCSCVEGFTPASPSPWKKMRDTSAGCRRDAALGCATDGFLAVRGVKLPDAHNA  372

Query  407   GNGSRLALSDCHSICWKNCSCTAYASSSTD-------GTGCILYTNAAHDFQLDENGELY  249
                 R+ + +C + C  NCSC AYA +  +       G+GCI++ +   D +  + G+  
Sbjct  373   TVDKRVTVEECRARCLANCSCVAYAPADIEGGGGGGAGSGCIIWADDLVDLRYVDGGQDL  432

Query  248   IYRLLKEHKG  219
               RL K   G
Sbjct  433   YVRLAKSELG  442



>ref|XP_010644396.1| PREDICTED: uncharacterized protein LOC100260657 [Vitis vinifera]
Length=1656

 Score =   191 bits (484),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 142/422 (34%), Positives = 208/422 (49%), Gaps = 49/422 (12%)
 Frame = -2

Query  1409  SYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI  1230
             S + +    DT+    +IRD E +TSA   F+LGFFS       P N+++RYLGIWY K+
Sbjct  854   SLIRISIAVDTITVNQHIRDGETITSAGGTFELGFFS-------PGNSKNRYLGIWYKKV  906

Query  1229  -PNEPVWVANRDSPLPDSSGSLIIDADGKLK-ISYVGGMITVSNVSIMSGNNVGATLLDS  1056
              P   VWVANR+SPL DSSG L +   G L  ++   G++  SN S  S  +  A LL+S
Sbjct  907   APRTVVWVANRESPLTDSSGVLKVTQQGILVLVNDTNGILWNSNSS-HSALDPNAQLLES  965

Query  1055  GNLVVREVDGNGS-FGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSG  879
             GNLV+R  +GN S     LWQSFDYP D L+PGMKLG N  TG  W L+SW S   P  G
Sbjct  966   GNLVMR--NGNDSDPENFLWQSFDYPGDTLLPGMKLGRNRVTGLDWYLSSWKSADDPSKG  1023

Query  878   AFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYF  705
              F   +D+NG   QLV+     + + +G W    +   P +T    + F  VSNEKE Y 
Sbjct  1024  NFTCEIDLNGF-PQLVLRNGFVINFRAGPWNGVRYSGIPQLTNNSVYTFNFVSNEKEVYI  1082

Query  704   SYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPM-------YTWIGRYA-----S  561
              Y+  H+    +  L+  G + +       + +  Y          Y + G Y       
Sbjct  1083  FYNTVHSSVILRHVLNPDGSLRKLKWTDKNTGWTLYSTAQRDDCDNYAFCGAYGICKIDQ  1142

Query  560   TLECDPYIGNYPRPV-----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVE  414
             + +C+   G  P+             C+   P+ C+K         G+ +  +  + D +
Sbjct  1143  SPKCECMKGFRPKFQSKWDEADWSHGCVPNTPLDCQKGD-------GFAKFSDVKLPDTQ  1195

Query  413   NSGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDF-QLDENGELYIY  243
              S     + L +C S+C + C+CTAYA+S     G+GC+L+     D  +  +NG+ +  
Sbjct  1196  TSWFNVSMNLKECASLCLRKCTCTAYANSDIRGGGSGCLLWLGDLIDIREFTQNGQEFYV  1255

Query  242   RL  237
             R+
Sbjct  1256  RM  1257


 Score =   188 bits (477),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 143/421 (34%), Positives = 209/421 (50%), Gaps = 47/421 (11%)
 Frame = -2

Query  1409  SYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI  1230
             S + +    DT++   NI D E +TSA   F+LGFFS       P N+++RYLGIWY K+
Sbjct  40    SLLRISVAVDTIIVNQNITDGETITSAGGSFELGFFS-------PGNSKNRYLGIWYKKV  92

Query  1229  PN-EPVWVANRDSPLPDSSGSLIIDADGKLK-ISYVGGMITVSNVSIMSGNNVGATLLDS  1056
                  VWVANR+SPL DSSG L +   G L  ++   G++  SN S  +  +  A LL+S
Sbjct  93    ATGTVVWVANRESPLTDSSGVLKVTEQGILVLVNGTNGILWNSNSSRFA-EDPNAQLLES  151

Query  1055  GNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGA  876
             GNLV+R  + + S     WQSFDYP D L+PGMK G N  TG    L+SW SD  P  G 
Sbjct  152   GNLVMRSGNDSDS-ENFFWQSFDYPCDTLLPGMKFGRNRVTGLDRYLSSWKSDDDPSKGN  210

Query  875   FELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFS  702
             F  G+D++G   QL++     V + +G W    +   P +T    + F  VSNEKE YF 
Sbjct  211   FTYGIDLSGF-PQLLLRNGLAVEFRAGPWNGVRYSGIPQLTNNSVYTFNFVSNEKEIYFI  269

Query  701   YSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPM-------YTWIGRYA-----ST  558
             YS  ++    +  L   G+  + +     + +  Y          Y   G Y       +
Sbjct  270   YSLVNSSVIMRLVLTPDGYSRRFTWTDQKNEWTLYSTTQKDDCDNYAICGVYGICKIDES  329

Query  557   LECDPYIGNYPR-----------PVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVEN  411
              +C+   G  P+             C++  P+ C+K  D FV+  G        + D  N
Sbjct  330   PKCECMKGFRPKFQSNWDMADWSKGCVRSTPLDCQK-GDGFVKYSGV------KLPDTRN  382

Query  410   SGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDFQ-LDENGELYIYR  240
             S     + L +C S+C +NCSCTAYA+S     G+GC+L+ +   D +   +NG+ +  R
Sbjct  383   SWFDESMNLKECASLCLRNCSCTAYANSDIRGGGSGCLLWFDDLIDIRDFTQNGQEFYAR  442

Query  239   L  237
             +
Sbjct  443   M  443



>ref|XP_010644274.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-7 
[Vitis vinifera]
Length=1573

 Score =   191 bits (484),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 135/400 (34%), Positives = 193/400 (48%), Gaps = 48/400 (12%)
 Frame = -2

Query  1409  SYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI  1230
             ++ +V  ++DT+    ++ D   L S    F+LGFFS  DS S       RYLGIWY K 
Sbjct  812   AFSTVRKKTDTITPNQSLVDGMTLVSTAQSFELGFFSPGDSNS-------RYLGIWYKKF  864

Query  1229  PNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGN  1050
             PN  VWVANR+ P+ D  G L ID+DG L +         S++S     N  A LL+SGN
Sbjct  865   PNTIVWVANREKPITDRYGVLSIDSDGYLILLDQTKRTIWSSISSRLPKNPVAQLLESGN  924

Query  1049  LVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFE  870
              V+R+     S    LWQSFD+P D  +PGMK+G NLKTG  W +TSW +   P  G F 
Sbjct  925   FVLRDASDVNS-ENYLWQSFDFPCDTTLPGMKMGWNLKTGQDWYVTSWRNASDPSPGDFT  983

Query  869   LGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE-FGFKLVSNEKEKYFSYSA  693
               +D  G   Q+V+ +  +  + +G W    F     MT + F    V NE E Y+ Y  
Sbjct  984   YRIDKVGL-PQIVLRKGSEKKYRTGTWNGLRFSGTAVMTNQAFKTSFVYNEDEAYYLYEL  1042

Query  692   KHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTW---------------IGRYAST  558
             K N   T+ TL+ LG I +  L    +    +  MYT                  R  +T
Sbjct  1043  KDNLSITRLTLNELGSINRFVLSESST---EWAIMYTVQNDLCDNYGHCGANGFCRIGNT  1099

Query  557   LECDPYIGNYPRPV-----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVEN  411
               C+   G  P+             C++  P+ C+K  + F++ +G        + D+ +
Sbjct  1100  PICECLDGFVPKSQNEWEFLNWTSGCIRSTPLDCQK-GEGFIEVKGV------KLPDLLD  1152

Query  410   SGNGSRLALSDCHSICWKNCSCTAYASS--STDGTGCILY  297
                  R  L +C + C KNCSCTAYA+S  S  G+GC+++
Sbjct  1153  FWVNKRTTLRECRAECLKNCSCTAYANSNISKGGSGCLMW  1192


 Score =   182 bits (462),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 128/403 (32%), Positives = 198/403 (49%), Gaps = 48/403 (12%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN  1224
             +SV A  DT+  G  +R  + + SA   F+LGFFS       P N+   ++GIWY KI  
Sbjct  31    ISVDAAPDTIFSGQMLRQTDTIISAGGNFELGFFS-------PGNSPSYFVGIWYKKISE  83

Query  1223  EPV-WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNL  1047
             + V WVANRD  +  SS SL I+ DG L I  + G +T    +I  G NV ATLLDSGNL
Sbjct  84    QTVVWVANRDYTITGSSPSLTINDDGNLVI--LDGRVTYMVANISLGQNVSATLLDSGNL  141

Query  1046  VVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFEL  867
             ++R  + N     +LWQSFDYP++  +PGMK+G N KTG VW  TSW + + PG G   L
Sbjct  142   ILRNGNSN-----ILWQSFDYPSNHFLPGMKIGYNRKTGEVWSFTSWKNAEDPGLGPVSL  196

Query  866   GLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFSYSA  693
              +D     +Q VI    ++ W+SGVW   +F   P+M  +  F +    +  E YF+YS 
Sbjct  197   KMDPE--THQFVIMWNSQMVWSSGVWNGHAFSSVPEMRLDYIFNYSYFEDMSEAYFTYSL  254

Query  692   KHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHY-MPM------YTWIGRYAS-----TLEC  549
               N   ++  +D+ G+I+Q + +    + + +  P       Y++ G ++S     T  C
Sbjct  255   YDNSIISRLLIDVSGNIKQLTWLDRSGWNLFWSQPQNFECDYYSYCGSFSSCNNQTTPIC  314

Query  548   DPYIGNYP-----------RPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGN  402
                 G  P           R  C+++  + C   + V  +   + +    N+   ++   
Sbjct  315   QCLYGFRPNSAGDWMMNQFRDGCVRKTSLQCDDLTSVNSEKDKFLK--MANVKFPQSPQI  372

Query  401   GSRLALSDCHSICWKNCSCTAYASSSTDGTGCILYTNAAHDFQ  273
                 ++  C   C   CSC AYA + +    C+++     + Q
Sbjct  373   LETQSIETCKMTCLNKCSCNAYAHNGS----CLMWDQILLNLQ  411



>ref|XP_008226191.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 [Prunus mume]
Length=1549

 Score =   191 bits (484),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 139/393 (35%), Positives = 192/393 (49%), Gaps = 41/393 (10%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVW  1212
             A  DTL  G  +     L SAK  F LGF       S         L +W +  PN  +W
Sbjct  6     AARDTLKPGDTLNSTSFLCSAKGKFCLGFIVYDQLNSSQ-------LTVW-STTPNSQLW  57

Query  1211  VANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
             +A+RD  +   +G L +D +  LKI   GG       +    +NV ATLL+SGN +++EV
Sbjct  58    IASRDMHVLYPTGVLTLDKNKTLKIMDQGGTRLELCSAPKRTSNVVATLLESGNFILQEV  117

Query  1031  DG-NGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDI  855
             +  +GS   V WQSFDYPTD L+PGMKLGVN + GHVW L SW ++  P +G F L  D 
Sbjct  118   NSVDGSTTQVFWQSFDYPTDTLMPGMKLGVNHRNGHVWSLASWSTEYNPETGPFTLEWDP  177

Query  854   NGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSYSAKHNYRF  675
              GC  +L I RRG VYWTSG + +  F++   +   +   +VSNE E YF+Y A +    
Sbjct  178   KGC--ELKIKRRGVVYWTSGAFTSKRFKQ---IMMRYNVSIVSNESEDYFTYIALNQSSP  232

Query  674   TKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLK--EN  501
             ++W L   G       +YD   F                   D   G      C +  E 
Sbjct  233   SQWLLTSTGR------LYDFGGF--------------DIARADNCYGYNTDGGCQRWAEK  272

Query  500   PVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYA-SSS  324
             P +CR   D F    G+FR  + N + + +S   + L++SDC   CWKNC C  +     
Sbjct  273   P-TCRHVGDTFELKNGFFRLTSSNSTFLNDS--DTSLSISDCKDSCWKNCECLGFNFLFD  329

Query  323   TDGTGCILYTNAAHDFQLDENGELYI-YRLLKE  228
              D TGC  +T    +F  D NG+  + + LLK+
Sbjct  330   IDQTGCKFWTGMNWEFIQDFNGDSTLSFYLLKK  362


 Score =   147 bits (370),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 114/193 (59%), Gaps = 6/193 (3%)
 Frame = -2

Query  1214  WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVRE  1035
             WVA+RD P+   +G L +D +  LKI   GG       +    +NV ATLLDSGN +++E
Sbjct  742   WVASRDKPILYPTGVLTLDKNKTLKIMDQGGTRLELCSAPKRTSNVVATLLDSGNFILQE  801

Query  1034  VDG-NGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLD  858
             V+  +GS   V WQSFDYPTD L+PGMKLGVN + GHVW L SW +      G F L  D
Sbjct  802   VNSVDGSTTQVFWQSFDYPTDTLMPGMKLGVNHRNGHVWSLVSWSTQYNLEPGPFTLEWD  861

Query  857   INGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSYSAKHNYR  678
               G   +L I RRG VYWTSG + +  F+  P M + +   +VSNE E YF+Y+A +   
Sbjct  862   PKG--RELKIKRRGVVYWTSGAFTSKRFK--PIMMR-YNVSIVSNENEDYFTYTALNQSS  916

Query  677   FTKWTLDLLGHIE  639
              ++W L   GH+ 
Sbjct  917   PSEWLLTSTGHLH  929


 Score = 86.3 bits (212),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 65/113 (58%), Gaps = 5/113 (4%)
 Frame = -2

Query  977   DVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDINGCNNQLVISRRGKVYWTS  798
             D L+PGMKLGVN + GHVW L SW +      G F L  D  G   +L I RRG VYWTS
Sbjct  952   DTLMPGMKLGVNHRNGHVWSLVSWSTQYNLEPGPFTLEWDPKG--RELKIKRRGVVYWTS  1009

Query  797   GVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSYSAKHNYRFTKWTLDLLGHIE  639
             G + +  F+  P M + +   +VSNE E YF+Y+A +    ++W L   GH+ 
Sbjct  1010  GAFTSKRFK--PIMMR-YNVSIVSNENEDYFTYTALNQSSPSEWLLTSTGHLH  1059



>gb|KDO74334.1| hypothetical protein CISIN_1g003832mg [Citrus sinensis]
Length=698

 Score =   187 bits (474),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 146/457 (32%), Positives = 216/457 (47%), Gaps = 71/457 (16%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI-P  1227
             +   A +D +    +IRD E L S    F+LGFFS       P  +  RYLGIWY ++ P
Sbjct  12    LGASAANDNITPSQSIRDGETLVSVNGTFELGFFS-------PGTSAKRYLGIWYKRVSP  64

Query  1226  NEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNL  1047
                 WVANR++PL D SG L + + G + +     +   SN SI   N V   L+DSGNL
Sbjct  65    RTVAWVANRETPLTDQSGLLNVTSKGIVLLDGRDRIFWSSNTSITMKNPV-VQLMDSGNL  123

Query  1046  VVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFEL  867
             V+ +    G++  +LWQSFD+P D L+PGMKLG N KTG    L+SW S   P  G F L
Sbjct  124   VLTD----GNYNSLLWQSFDHPCDTLLPGMKLGRNFKTGMDRHLSSWKSINDPAPGEFSL  179

Query  866   GLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEF---GFKLVSNEKEKYFSYS  696
              +D +G   QLV+ +   + + +G W    F   P + +      +K V NE E Y+   
Sbjct  180   WIDTHGF-PQLVLRKGSVLQYRAGSWNGLGFTGTPPLKENVPLCDYKFVINENEVYYECD  238

Query  695   AKHNYRFTKWTLDLLGHIEQSSLIY--------DPSFFIHYMP-----MYTWIGRYA---  564
             AK       W       + QS L+         D  F  +Y P     +Y+  G  A   
Sbjct  239   AKGPAVSRLW-------VNQSGLVLRSIWSSQQDVWFLAYYAPLDRCDLYSVCGANARCT  291

Query  563   --STLECDPYIGNYPRPV------CLKENPVSCRKSSDV--FVQTRGYFRDDNRNISDVE  414
               S+  CD   G  P+        C++E  + CR   +   +V+ +         + D  
Sbjct  292   TNSSRRCDCLEGFVPKSPNNWSEGCVRERELKCRNGDEFPKYVKLK---------LPDTS  342

Query  413   NSGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDFQLDENG--ELYI  246
             +S   + + L +C  +C KNCSCTAYA+S  +  G+GC+L+     D +   +G  +LYI
Sbjct  343   SSWFNASMNLKECSELCSKNCSCTAYANSDVERGGSGCLLWFGDLMDMKEYNDGGQDLYI  402

Query  245   -------YRLLKEHKG*ILVNV-RYCCFTVIQVFCVF  159
                      + K+  G I+ +V     F V  +FC++
Sbjct  403   RIASERGRSVTKKQVGIIIASVLLMAMFIVASLFCIW  439



>ref|XP_010927571.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X1 [Elaeis guineensis]
Length=815

 Score =   187 bits (475),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 134/413 (32%), Positives = 195/413 (47%), Gaps = 37/413 (9%)
 Frame = -2

Query  1415  FSSYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYN  1236
              +S VS     DTL     + D + L SA   F LGFFS       PI T + Y+GIWY 
Sbjct  15    LASRVSPSIAGDTLTPTQPLADGQELISAGERFILGFFS-------PIKTNNCYIGIWYK  67

Query  1235  KIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDS  1056
               P   VWVANR  P+ + +GSL I  +G L I+        S+ S    N V A LLD 
Sbjct  68    VSPPTVVWVANRQHPISERNGSLSITVNGTLIITDQNSKTIWSSGSSGLANPV-AQLLDD  126

Query  1055  GNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGA  876
             GN +V+E +  GSF    WQS DYP+D L+PGMKLG NLK+G    +TSW S   P  G 
Sbjct  127   GNFIVKEANIPGSFA---WQSSDYPSDTLLPGMKLGWNLKSGLNRNVTSWTSPSDPAPGP  183

Query  875   FELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMT--KEFGFKLVSNEKEKYFS  702
             + +G+D++G N Q+++       W  G W   +    PD+   K F    V    E ++ 
Sbjct  184   YTMGVDLHG-NPQIILWEGSSQLWRVGPWNGKTLAGIPDILRYKIFILDFVIKNDEVFYM  242

Query  701   YSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPY--IGNY  528
             Y+       T+ T++  G +++   + D   +  YM        Y S  +C  Y      
Sbjct  243   YNTTSTSFITRLTVNYTGFVQRLVWLDDSKMWSSYMSEPKDQCDYVS--QCGAYGVCNTD  300

Query  527   PRPVC---------------LKENPVSCRKSSDVFVQ--TRGYFRDDNRNISDVENSGNG  399
               P+C               L+E    C +   +  Q  T G+    +  + D   S   
Sbjct  301   DSPICSCLQGFKPRSPTNWDLREGKDGCTRRMGLDCQNGTDGFVIVKDVKLPDTSRSMVD  360

Query  398   SRLALSDCHSICWKNCSCTAYASSSTDGTGCILYTNAAHDFQLDENG--ELYI  246
               + L +C + C +NCSCTAYAS++ +G+GCI++T    D ++   G  +LY+
Sbjct  361   RSMGLDECRATCLRNCSCTAYASANINGSGCIIWTTELTDIRVYSFGGQDLYV  413



>gb|KDO74333.1| hypothetical protein CISIN_1g003832mg [Citrus sinensis]
Length=792

 Score =   187 bits (474),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 148/457 (32%), Positives = 216/457 (47%), Gaps = 71/457 (16%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI-P  1227
             +   A +D +    +IRD E L S    F+LGFFS       P  +  RYLGIWY ++ P
Sbjct  12    LGASAANDNITPSQSIRDGETLVSVNGTFELGFFS-------PGTSAKRYLGIWYKRVSP  64

Query  1226  NEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNL  1047
                 WVANR++PL D SG L + + G + +     +   SN SI   N V   L+DSGNL
Sbjct  65    RTVAWVANRETPLTDQSGLLNVTSKGIVLLDGRDRIFWSSNTSITMKNPV-VQLMDSGNL  123

Query  1046  VVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFEL  867
             V+   DGN  +  +LWQSFD+P D L+PGMKLG N KTG    L+SW S   P  G F L
Sbjct  124   VL--TDGN--YNSLLWQSFDHPCDTLLPGMKLGRNFKTGMDRHLSSWKSINDPAPGEFSL  179

Query  866   GLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEF---GFKLVSNEKEKYFSYS  696
              +D +G   QLV+ +   + + +G W    F   P + +      +K V NE E Y+   
Sbjct  180   WIDTHGF-PQLVLRKGSVLQYRAGSWNGLGFTGTPPLKENVPLCDYKFVINENEVYYECD  238

Query  695   AKHNYRFTKWTLDLLGHIEQSSLIY--------DPSFFIHYMP-----MYTWIGRYA---  564
             AK       W       + QS L+         D  F  +Y P     +Y+  G  A   
Sbjct  239   AKGPAVSRLW-------VNQSGLVLRSIWSSQQDVWFLAYYAPLDRCDLYSVCGANARCT  291

Query  563   --STLECDPYIGNYPRPV------CLKENPVSCRKSSDV--FVQTRGYFRDDNRNISDVE  414
               S+  CD   G  P+        C++E  + CR   +   +V+ +         + D  
Sbjct  292   TNSSRRCDCLEGFVPKSPNNWSEGCVRERELKCRNGDEFPKYVKLK---------LPDTS  342

Query  413   NSGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDFQLDENG--ELYI  246
             +S   + + L +C  +C KNCSCTAYA+S  +  G+GC+L+     D +   +G  +LYI
Sbjct  343   SSWFNASMNLKECSELCSKNCSCTAYANSDVERGGSGCLLWFGDLMDMKEYNDGGQDLYI  402

Query  245   -------YRLLKEHKG*ILVNV-RYCCFTVIQVFCVF  159
                      + K+  G I+ +V     F V  +FC++
Sbjct  403   RIASERGRSVTKKQVGIIIASVLLMAMFIVASLFCIW  439



>ref|XP_006475243.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1-like [Citrus sinensis]
Length=801

 Score =   187 bits (474),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 148/457 (32%), Positives = 216/457 (47%), Gaps = 71/457 (16%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI-P  1227
             +   A +D +    +IRD E L S    F+LGFFS       P  +  RYLGIWY ++ P
Sbjct  21    LGASAANDNITPSQSIRDGETLVSVNGTFELGFFS-------PGTSAKRYLGIWYKRVSP  73

Query  1226  NEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNL  1047
                 WVANR++PL D SG L + + G + +     +   SN SI   N V   L+DSGNL
Sbjct  74    RTVAWVANRETPLTDQSGLLNVTSKGIVLLDGRDRIFWSSNTSITMKNPV-VQLMDSGNL  132

Query  1046  VVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFEL  867
             V+   DGN  +  +LWQSFD+P D L+PGMKLG N KTG    L+SW S   P  G F L
Sbjct  133   VL--TDGN--YNSLLWQSFDHPCDTLLPGMKLGRNFKTGMDRHLSSWKSINDPAPGEFSL  188

Query  866   GLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEF---GFKLVSNEKEKYFSYS  696
              +D +G   QLV+ +   + + +G W    F   P + +      +K V NE E Y+   
Sbjct  189   WIDTHGF-PQLVLRKGSVLQYRAGSWNGLGFTGTPPLKENVPLCDYKFVINENEVYYECD  247

Query  695   AKHNYRFTKWTLDLLGHIEQSSLIY--------DPSFFIHYMP-----MYTWIGRYA---  564
             AK       W       + QS L+         D  F  +Y P     +Y+  G  A   
Sbjct  248   AKGPAVSRLW-------VNQSGLVLRSIWSSQQDVWFLAYYAPLDRCDLYSVCGANARCT  300

Query  563   --STLECDPYIGNYPRPV------CLKENPVSCRKSSDV--FVQTRGYFRDDNRNISDVE  414
               S+  CD   G  P+        C++E  + CR   +   +V+ +         + D  
Sbjct  301   TNSSRRCDCLEGFVPKSPNNWSEGCVRERELKCRNGDEFPKYVKLK---------LPDTS  351

Query  413   NSGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDFQLDENG--ELYI  246
             +S   + + L +C  +C KNCSCTAYA+S  +  G+GC+L+     D +   +G  +LYI
Sbjct  352   SSWFNASMNLKECSELCSKNCSCTAYANSDVERGGSGCLLWFGDLMDMKEYNDGGQDLYI  411

Query  245   -------YRLLKEHKG*ILVNV-RYCCFTVIQVFCVF  159
                      + K+  G I+ +V     F V  +FC++
Sbjct  412   RIASERGRSVTKKQVGIIIASVLLMAMFIVASLFCIW  448



>gb|KDO74326.1| hypothetical protein CISIN_1g003846mg [Citrus sinensis]
Length=791

 Score =   187 bits (474),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 140/386 (36%), Positives = 191/386 (49%), Gaps = 41/386 (11%)
 Frame = -2

Query  1421  MGFSSYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIW  1242
             M FS  V   +++D+L  G  I   E L S+   F+LGFF        P  + + Y+GIW
Sbjct  16    MQFSLVVDAVSDTDSLSVGQVITRSETLVSSGKFFELGFFR-------PGQSRNYYVGIW  68

Query  1241  YNKIPNEPV-WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVS-NVSIMSGNNVGAT  1068
             Y  IP   V WVANRD PL  SS  L I ++G L I    G IT   + ++ S  N  AT
Sbjct  69    YKNIPERTVVWVANRDQPLTSSSPVLTISSEGNLVIE--DGRITYRVSENVSSSQNTTAT  126

Query  1067  LLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVP  888
             LLDSGN V+R         G+LWQSFDYP+   +PGMKLG + KTG VW LTSW S   P
Sbjct  127   LLDSGNFVLRNEKL-----GLLWQSFDYPSHTFLPGMKLGYSRKTGKVWSLTSWKSRDDP  181

Query  887   GSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKE  714
               G  EL ++  G +N   + +R ++ WTSGVW    F   P+MT    F + L ++E E
Sbjct  182   SVGDAELKME-PGKSNAFSLMKRSQIVWTSGVWDGYIFSLVPEMTLNYIFNYSLYTDENE  240

Query  713   KYFSYSAKHNYRFTKWTLDLLGHIEQSS-LIYDPSFFIHYMPMYTWIGRYASTLECDPY-  540
              YF YS K +   ++  LD+ G +EQ S L    ++FI       W     S + C P+ 
Sbjct  241   TYFIYSIKDSI-ISRCILDVSGQVEQMSWLGARQAWFIF------WSQPRTSCVACGPFS  293

Query  539   IGNYPRPVCL---------KENPVSCRKSSDVFVQTRGYFRDDN-RNISDVENSGNGSRL  390
             I N     C           +N   C + + +        R+D    + +V+       L
Sbjct  294   ICNTATGSCQCLQGFFIGSDKNLSECVRRTALQCGDNSADREDRFLRMHNVKLPSPDKVL  353

Query  389   AL---SDCHSICWKNCSCTAYASSST  321
              L    +C S C  NC+CTAYA +S+
Sbjct  354   KLPGIEECKSACLNNCACTAYAYNSS  379



>ref|XP_011002474.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Populus euphratica]
Length=735

 Score =   186 bits (473),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 138/419 (33%), Positives = 205/419 (49%), Gaps = 33/419 (8%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN  1224
             +++ +  DT+    +IRD E + SA   FKLGFF        P ++++RYLGIWYNKI N
Sbjct  20    MTISSAVDTMNTTESIRDSEAMVSADGSFKLGFFI-------PGSSKNRYLGIWYNKISN  72

Query  1223  E-PVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNL  1047
                VWVANR+  L DSSG L ++  G L +    G I  S  S  S  N  A LLDSGNL
Sbjct  73    RNVVWVANREILLTDSSGVLRLNHRGILVLLNHNGNIIWSTNSSRSVRNPVAQLLDSGNL  132

Query  1046  VVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFEL  867
             +V++ +G+GS   +LWQSFDYP D L+PGMKLG N  TG    L+SW +   P  G F  
Sbjct  133   IVKD-EGDGSMENLLWQSFDYPCDTLLPGMKLGRNTTTGLDRFLSSWKTPDDPSRGVFTY  191

Query  866   GLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFSYSA  693
             GL   G   +++ +   ++Y  SG W    F   P M     + +  V  EKE Y+SY  
Sbjct  192   GLKAAGYPEKVLRANSLQMY-RSGPWNGIRFSGCPQMQPNPVYTYAFVFTEKEMYYSYQL  250

Query  692   KHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPM-------YTWIGRYASTLECDP---  543
                   ++  L   G+I++ +       ++ Y+         Y   G Y S    D    
Sbjct  251   PDRSILSRVILTQNGNIQRFTWSSSAHIWVFYLTAQVDDCNRYVLCGVYGSCHINDSPMC  310

Query  542   -----YIGNYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSD  378
                  +I   P+   +      C + + +   T G+ +     + +  NS     + L +
Sbjct  311   GCLRGFIPKVPKDWQMMNWSGGCERRTPLNCSTDGFRKYSGVKLPETANSWFSKSMNLEE  370

Query  377   CHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDF-QLDENGELYIYRLLK---EHKG  219
             C ++C KNCSC AY +      G+GC+L+ +   D  +L+ENG+    R+     +H+G
Sbjct  371   CRNMCTKNCSCIAYTNLDIREGGSGCLLWFSDLIDIRRLNENGQDIYVRMAASELDHEG  429



>gb|EYU23280.1| hypothetical protein MIMGU_mgv1a000166mg [Erythranthe guttata]
Length=1512

 Score =   189 bits (481),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 146/405 (36%), Positives = 193/405 (48%), Gaps = 63/405 (16%)
 Frame = -2

Query  1382  DTLMQGAN-IRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVWVA  1206
             DTL  G +       L SAK IF LGF++       P NT + YL IWY      PVW+ 
Sbjct  28    DTLKPGGDEFNSSSQLVSAKKIFTLGFYT-------PENTNNSYLAIWYTDGLYSPVWIG  80

Query  1205  NRDSPLPDSSGSLI-IDADGK-LKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
             NR++P P +S  ++ I   G+ L I++ GG  +    S  SG N+ ATLLD+GN VV  V
Sbjct  81    NRENPFPKNSNPILAIGTTGENLVITHGGGGESFELYSGQSGKNISATLLDTGNFVVISV  140

Query  1031  DGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLD-I  855
              G      VLWQSFDYP D L+PGMKLG+N KTG  W L+SW     P +GAF L  D I
Sbjct  141   SGE-----VLWQSFDYPADTLLPGMKLGINHKTGRNWTLSSWFGQNNPATGAFTLEWDPI  195

Query  854   NGCNNQLVISRRGKVYWTSGVWKN--------GSFE--------KAPD-MTKEFGFKLVS  726
             +G   +L++ RRG VYWTSG  K+        G F           PD     + F  VS
Sbjct  196   SG---RLLVRRRGVVYWTSGEMKDYYYNGQGLGDFRVKEFENINPKPDPFNLNYNFTNVS  252

Query  725   NEKEKYFSYS--------AKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGR  570
             +E E+YF+YS         +     + W L   G+I  +    D  F       Y +  R
Sbjct  253   SENEEYFTYSLIQVPNWTPEKRKVISGWMLSYQGNIYDN----DRPFIADANLCYGYNTR  308

Query  569   YASTLECDPYIGNYPRPVCLKENPVSCRKSSDVFVQTRGYFRD-DNRNISDVENSGNGSR  393
              +S      Y G      C       CR   + FV   G FR  D +++  V +S   S 
Sbjct  309   GSSF-----YTG------CELWAQPECRNDRETFVLKSGDFRPVDGKSVPSVYDS--NSS  355

Query  392   LALSDCHSICWKNCSCTAYASSSTDGTGCILYTNAAHDFQLDENG  258
             L LSDC  ICW +C C AY  +     GC+ +     +F+   +G
Sbjct  356   LTLSDCREICWNDCECVAYIDADR-SDGCVYWRGKNLEFEQSLDG  399


 Score =   172 bits (436),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 135/394 (34%), Positives = 193/394 (49%), Gaps = 51/394 (13%)
 Frame = -2

Query  1343  HLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVWVANRDSPLPDSSGSLI  1164
              L SA  IF LGF++       P +T + YL IWY    +  VW+ANR++P+P +S  ++
Sbjct  792   QLVSANKIFTLGFYT-------PEDTNNTYLAIWYTNASDYRVWIANRENPIPKNSNPVL  844

Query  1163  I---DADGKLKISYVGGM-ITVSNVSIMSGNNVGATLLDSGNLVVREVDGNGSFGGVLWQ  996
                     KL I++ GG   +    S  SG N+ ATLLD+GN VV  V G      VLWQ
Sbjct  845   TIPATTGEKLIITHGGGGGESFELYSGQSGKNISATLLDTGNFVVSSVSGE-----VLWQ  899

Query  995   SFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLD-INGCNNQLVISRR  819
             SFD+PTD L+PGMKLG + KTG    L+SW     P +GAF L  D I+G    L++ RR
Sbjct  900   SFDFPTDTLLPGMKLGFDRKTGRYRTLSSWFGRSNPATGAFTLEWDPISG---MLLVRRR  956

Query  818   GKVYWTSGVWKNGSFEK--------------APDMTK-EFGFKLVSNEKEKYFSYSAKHN  684
             G VYWTSG  K+  ++                PD +   + F  VS + E+YF+YS   +
Sbjct  957   GVVYWTSGEMKDFQYDGQEGGDSRVKKFENIVPDSSNFNYNFTNVSYDGEEYFTYSLIKD  1016

Query  683   YRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGR-YA-STLECDPYIGNYPRPVCL  510
                 +WT +    I    L +D        P++  +   Y  +T   D Y G       L
Sbjct  1017  ----RWTPNSRKVISGWRLGFDGRIDDTGRPVFVDVSLCYGYNTRGSDVYAG-----CRL  1067

Query  509   KENPVSCRKSSDVFVQTRG-YFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYA  333
              + P+ CR + + FV   G +FR +   ++ V  S + S L  SDC  ICW +C C A+ 
Sbjct  1068  WQQPM-CRNNRETFVDRAGNFFRANGTFVAFV--SDDNSSLTQSDCREICWNDCECAAFL  1124

Query  332   SSSTDGTGCILYTNAAHDFQLDENGELYIYRLLK  231
              +   G GC  +     +F    NG   +  +L+
Sbjct  1125  DAPLSG-GCWYWKGKDLNFTQSLNGRTTVQYVLQ  1157



>gb|EEC78088.1| hypothetical protein OsI_17567 [Oryza sativa Indica Group]
Length=823

 Score =   187 bits (474),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 141/430 (33%), Positives = 208/430 (48%), Gaps = 37/430 (9%)
 Frame = -2

Query  1412  SSYVSVGAE-SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYN  1236
             S   + GAE  DTL +G NI D E L SA   F LGFFS + S S   +T  RYLGIW++
Sbjct  7     SGRTTTGAELGDTLGKGRNITDGERLVSAGGSFTLGFFSPASSSS--SSTSRRYLGIWFS  64

Query  1235  KIPNEPVWVANRDSPLPDSSGSLII-DADGKLKISYVGGMITVSNVSIMSGNNVGATLLD  1059
                +   WVANRD PL D+SG L+I DA   L +   G ++  SN +   G ++ A LL+
Sbjct  65    VSDDVVCWVANRDRPLTDTSGVLVITDAGSLLLLDGSGHVVWSSNTTTGGGASMAAQLLE  124

Query  1058  SGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSG  879
             SGNLVV +    G+   V+WQSFD+P D L+PGMK+G NL TG  W L+SW S   P  G
Sbjct  125   SGNLVVSDRGNGGAGAVVVWQSFDHPCDTLLPGMKIGKNLWTGAEWYLSSWRSSGDPSPG  184

Query  878   AFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDM---TKEFGFKLVSNEKEKY  708
              +    D  G    ++    G+VY T G W    F   P+M   +  F ++L  +  E  
Sbjct  185   NYRYRTDTKGVPENVLWDGDGEVYRT-GPWNGLWFSGIPEMGTYSDMFSYQLTVSPGEIT  243

Query  707   FSYSAKHNYRFTKWTLDLLGHIEQSSLIYDPS------FFIHYMPMYTWIGRYASTLECD  546
             F YSA     F++  +  +G +++  L+++PS      FF     +    G+  +   CD
Sbjct  244   FGYSANAGAPFSRLVVTGVGEVQR--LVWEPSSRAWKNFFQGPRDLCDDYGKCGAFGLCD  301

Query  545   P-------------YIGNYPRP-VCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENS  408
                           +    P P   +++    CR+ + +   T G+       + D  N+
Sbjct  302   AGAASTSFCSCVEGFTPASPSPWKKMRDTSAGCRRDAALGCATDGFLAVRGVKLPDAHNA  361

Query  407   GNGSRLALSDCHSICWKNCSCTAYASS-------STDGTGCILYTNAAHDFQLDENGELY  249
                 R+ + +C + C  NCSC AYA +          G+GCI++ +   D +  + G+  
Sbjct  362   TVDKRVTVEECRARCLANCSCVAYAPADIGGGGGGGAGSGCIIWADDLVDLRYVDGGQDL  421

Query  248   IYRLLKEHKG  219
               RL K   G
Sbjct  422   YVRLAKSELG  431



>ref|XP_008794829.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At2g19130 [Phoenix dactylifera]
Length=826

 Score =   186 bits (471),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 133/407 (33%), Positives = 197/407 (48%), Gaps = 51/407 (13%)
 Frame = -2

Query  1385  SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNE-PVWV  1209
             +DT+   ++I   + LTS    F LGFFS       P ++   Y+GIWY K+  + PVWV
Sbjct  34    ADTISANSSISGEQQLTSKGGNFVLGFFS-------PSSSSKYYIGIWYKKVSQQTPVWV  86

Query  1208  ANRDSPLPDSSGS-LIIDADGKLKI-SYVGGMITVSNVSIMSGNNVGATLLDSGNLVVRE  1035
             ANR++P+ D + S L + ADG L + +     I  +N SI + + V A L D+GNLV+  
Sbjct  87    ANRETPVSDKTKSELRLSADGNLVLLNLSKAQIWSTNASISAKSTV-AVLRDTGNLVL--  143

Query  1034  VDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDI  855
              DG+ S   +LWQS D+PTD  +PG KLG+N  T    +L SW S   P  G F L LD 
Sbjct  144   ADGSNS-SRILWQSIDHPTDTWLPGGKLGLNKVTKQNQRLISWRSSADPAPGIFSLELDP  202

Query  854   NGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFSYSAKHNY  681
             NG +   +   +   YWTSG W    F K P+MT    + FK V++  E YF+YS K   
Sbjct  203   NGSSQYFIQWNKSVQYWTSGTWNGNIFSKVPEMTANYIYDFKYVTDSDESYFTYSVKDPS  262

Query  680   RFTKWTLDLLGHIEQSSLIYDPSFFIHY-------MPMYTWIGRYASTLECDPYIGNYPR  522
               +++ +D  G I+Q + + +   +I +         +Y+  G + S   C    G + +
Sbjct  263   IISRFIMDTSGQIKQLTWVEESQEWILFWSQPRAQCEVYSLCGPFGS---CSESSGTFCK  319

Query  521   PV-------------------CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNG  399
              V                   C++  P+ C  +S   V+   ++  D   + D  N+ N 
Sbjct  320   CVKGFVARNQTEWDLLDRTGGCVRTTPLQCSSNSSTNVEKDKFYPMDGMKLPD--NAQNL  377

Query  398   SRLALSDCHSICWKNCSCTAYASSSTDGTGCILYTNAAHDFQLDENG  258
                +  DC S C  NCSCTAY  S     GC ++     + Q   NG
Sbjct  378   DAGSAEDCESACLNNCSCTAYTFSG----GCSVWHGDLINLQEQYNG  420



>gb|KCW69727.1| hypothetical protein EUGRSUZ_F031111, partial [Eucalyptus grandis]
Length=468

 Score =   181 bits (460),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 145/416 (35%), Positives = 199/416 (48%), Gaps = 49/416 (12%)
 Frame = -2

Query  1382  DTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEP-VWVA  1206
             DT+    +IRD E+L SA   F+LGFFS  D          RYLGIWY KI     VWVA
Sbjct  25    DTITTDQSIRDGENLLSAGGTFELGFFSAGDP-------PKRYLGIWYKKITTRTIVWVA  77

Query  1205  NRDSPLPDSSGSLIIDADGKLKI-SYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREVD  1029
             NR +PL D+SG+L +   G L +    G  I +SN  I   N V A LLDSGNLVVR+ +
Sbjct  78    NRVAPLADASGTLRVTTHGSLVLLDGNGSDIWLSNAPIPVRNPV-AQLLDSGNLVVRDAE  136

Query  1028  GNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDING  849
             G+      LWQSFDYPTD LV GMKLG N ++G    LTSW S   P  G F   LD NG
Sbjct  137   GSDP-KNFLWQSFDYPTDTLVAGMKLGRNRRSGFNRHLTSWKSIDDPSPGNFTFQLDPNG  195

Query  848   CNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFSYSAKHNYRF  675
                +L + +   + + +G W    +   P +     +G++ V NE+E YF Y   +    
Sbjct  196   YPQEL-LKQGSDIKFRTGPWNGLRWSGTPFLNPNPYYGYEFVLNEEEMYFRYELLNRSVT  254

Query  674   TKWTLDLLGHIEQSSLIYDPSFFIHYMPM-------YTWIGRYAS-----TLECDPYIGN  531
             ++  L   G +++ + I     ++ YM         Y   G Y S     +  C    G 
Sbjct  255   SRLILTTNGILQRFAWIDRTQGWMLYMASPTDQCDNYASCGAYGSCRVDTSPVCRCLKGF  314

Query  530   YPRPV-----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLAL  384
              PR             C++ NP+ C K  D+FV+           + D  +S     + L
Sbjct  315   VPRFSQEWDMLEWSNGCVRRNPLDCEK--DIFVKYSWL------KLPDTRSSWFNESMNL  366

Query  383   SDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDFQLDEN--GELYIYRLLKE  228
              +C  +C KNCSC AY+S      G+GC+L+     D +   N   +LYI   + E
Sbjct  367   RECKVVCMKNCSCIAYSSLDIRNGGSGCLLWFGELIDIRGYSNYGQDLYIRMAVSE  422



>ref|XP_006370493.1| hypothetical protein POPTR_0001s43220g, partial [Populus trichocarpa]
 gb|ERP67062.1| hypothetical protein POPTR_0001s43220g, partial [Populus trichocarpa]
Length=273

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 108/243 (44%), Positives = 137/243 (56%), Gaps = 14/243 (6%)
 Frame = -2

Query  1388  ESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVWV  1209
             E+DTL QG ++     L S   +F LGF  +     G   ++  YLGIWYN   + P W+
Sbjct  20    EADTLYQGDSLNSSSTLVSKNRLFTLGFKRV-----GSAESDATYLGIWYNDDTSHPFWL  74

Query  1208  ANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREVD  1029
             ANRD P+ D+SG L ID  G +K++Y GG +     S  S +N+ A L DSGN V++  D
Sbjct  75    ANRDKPIADNSGVLAIDGSGNMKLTYSGGDLVEFYSSQSSASNITAILEDSGNFVLK--D  132

Query  1028  GNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPG-SGAFELGLDIN  852
              N     VLWQSFD PTD  +PGMKLG+N +TG  W L SWLSD VP  +GAF    D  
Sbjct  133   ENSGSQQVLWQSFDIPTDTFLPGMKLGINHRTGQTWSLKSWLSDLVPTPAGAFTFEWDTK  192

Query  851   GCNNQLVISRRGKVYWTSGVWK-NGSFEKAP--DMTKEFGFKLVSNEKEKYFSYSAKHNY  681
             G    LVI RR  +YWTSG  + N SFE         +F F  VSN  E YF ++   N 
Sbjct  193   G--KGLVIKRRDVIYWTSGPLRSNTSFENFALGGAVLDFSFINVSNADEDYFMFTVSAN-  249

Query  680   RFT  672
             +FT
Sbjct  250   QFT  252



>ref|XP_010644397.1| PREDICTED: uncharacterized protein LOC100262430 [Vitis vinifera]
Length=1658

 Score =   188 bits (478),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 148/421 (35%), Positives = 206/421 (49%), Gaps = 47/421 (11%)
 Frame = -2

Query  1409  SYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI  1230
             S + +    DT+    +IRD E +TSA   F+LGFFS       P N+E+RYLGIWY K 
Sbjct  851   SLLRISTAVDTITVNQHIRDGETITSAGGTFELGFFS-------PGNSENRYLGIWYKKA  903

Query  1229  PNEPV-WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSG  1053
               +PV WVANR+SPL DSSG L +   G L +      I  ++ S  S  N  A LL+SG
Sbjct  904   STKPVVWVANRESPLTDSSGVLRVTHQGILVVVNGINRILWNSNSSRSAQNPNAQLLESG  963

Query  1052  NLVVREVDGNGS-FGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGA  876
             NLV++  +GN S     LWQSFDYP D L+PGMKLG N  TG  W L+SW S   P  G 
Sbjct  964   NLVMK--NGNDSDPENFLWQSFDYPCDTLLPGMKLGRNTVTGLDWYLSSWKSADDPSKGN  1021

Query  875   FELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFS  702
             F  G+D +G   QLV+     V + +G W        P +TK   + +  V+N KE Y  
Sbjct  1022  FTYGIDPSGL-PQLVLRNGLAVKFRAGPWNGIRLSGLPQLTKNPVYTYDYVANGKEIYII  1080

Query  701   YSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPM-------YTWIGRYA-----ST  558
             Y    +    +  L   G  ++ +   + + +  Y          Y   G Y       +
Sbjct  1081  YYLVKSSIIMRLVLTPEGKAQRFTWADEKNEWTLYSTAQKDDCDSYALCGAYGICKIDQS  1140

Query  557   LECDPYIGNYPR-----------PVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVEN  411
               C+   G  P+             C++  P+ CRK  D FV+  G    D RN S V  
Sbjct  1141  PNCECMKGFRPKFQSKWDTADWSDGCVRSTPLDCRK-GDGFVKYSGVKLPDTRN-SWVHE  1198

Query  410   SGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDFQ-LDENGELYIYR  240
             S N     L +C  +C +NCSC+AYA+S     G+GC+L+ +   D +   +NG+ +  R
Sbjct  1199  SMN-----LKECAWMCLRNCSCSAYANSDIRGGGSGCLLWFDDLIDIRDFTQNGQDFYVR  1253

Query  239   L  237
             +
Sbjct  1254  M  1254


 Score =   171 bits (433),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 137/425 (32%), Positives = 197/425 (46%), Gaps = 47/425 (11%)
 Frame = -2

Query  1409  SYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI  1230
             S + V    DTL     I D E +TSA   F+LGFFS       P ++ +RY+GIWY K+
Sbjct  12    SILRVSIAVDTLTVNQIITDGETITSAGGSFELGFFS-------PDSSRNRYVGIWYKKV  64

Query  1229  PNEPV-WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSG  1053
                 V WVANR  PL  SSG L +   G L I         S+ S     N  A LLDSG
Sbjct  65    ATRTVVWVANRQIPLTASSGILKVTDRGTLVILNGTNTTIWSSNSSRPAQNPNAQLLDSG  124

Query  1052  NLVVREVDGNGSFG-GVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGA  876
             NLV++  +GN S     LWQSFDYP + L+PGMK G N  TG    L+SW +   P  G 
Sbjct  125   NLVMK--NGNDSDSENFLWQSFDYPCNTLLPGMKFGRNRVTGLDRYLSSWKTTDDPSIGN  182

Query  875   FELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFS  702
             F   LD  G + QL++     V + SG W    F   P +     + +  + N+KE Y++
Sbjct  183   FTYRLDPGG-SPQLLVRNGSTVTFRSGPWNGLRFSGFPQLRPNSVYSYAFIFNDKETYYT  241

Query  701   YSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPM-------YTWIGRYA-----ST  558
             +   ++   T+  L   G+ ++ + I   S +I Y          Y   G Y       +
Sbjct  242   FELVNSSVITRLVLSPEGYAQRFTWIDRTSDWILYSSAQTDDCDSYALCGVYGICEINRS  301

Query  557   LECDPYIGNYPR-----------PVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVEN  411
              +C+   G  P+             C++  P+ C+KS+       G+ +     + D  N
Sbjct  302   PKCECMKGFEPKFQSNWDMADWSDGCVRSTPMVCQKSN-------GFLKYSGVKLPDTRN  354

Query  410   SGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDF-QLDENGELYIYR  240
             S     + L +C S+C  NCSCTAY +S     G+GC+L+     D  +  ENG+ +  R
Sbjct  355   SWFNESMNLKECASLCLGNCSCTAYTNSDIRGGGSGCLLWFGDLIDIREYTENGQDFYIR  414

Query  239   LLKEH  225
             + K  
Sbjct  415   MAKSE  419



>ref|XP_004151787.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g67520-like [Cucumis sativus]
 ref|XP_004168249.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g67520-like [Cucumis sativus]
Length=413

 Score =   180 bits (456),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 141/400 (35%), Positives = 195/400 (49%), Gaps = 78/400 (20%)
 Frame = -2

Query  1421  MGFSSYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIW  1242
             M   S+      ++ L QG ++     L S+ A F LGF++       P ++   YLGI 
Sbjct  1     MAEFSHAQTTLTNNVLTQGQHLSIGSQLISSTATFVLGFYN-------PPSSNSTYLGIS  53

Query  1241  YNKIPNEPVWVANRDSPLPDSSGS--LIIDADGKLKIS--------YVGGMITVSNVSIM  1092
             YN    +P+W+ANR+SP P++S S  L ID +G LKI         + GG  T S     
Sbjct  54    YNTNDQKPIWIANRNSPFPNNSASISLTIDVNGSLKIQSGNYFFSLFNGGQPTTS-----  108

Query  1091  SGNNVGATLLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLT  912
                   A L D GN V+RE++ +GS   ++WQSFD+PTD L+P MK+G+N KT   W LT
Sbjct  109   -----SAILQDDGNFVLREMNRDGSVKQIVWQSFDHPTDTLLPRMKIGINHKTNSTWSLT  163

Query  911   SWLSDKVPGSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFE-KAPDMTKEFGFK  735
             SW SD+ P  GAF LG++ N    +LV+  +  + W SG WK+GSFE  A  ++K   F 
Sbjct  164   SWRSDESPKPGAFRLGMNPNNT-YELVMFIQDDLLWRSGNWKDGSFEFLASYISKGINFN  222

Query  734   LVSNEKEKYFSY--SAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYAS  561
              VSNE E YF Y     H Y   + + D  G  E          FI  +P +        
Sbjct  223   RVSNENETYFIYYIPGLHRYSVYENSYDYEGSRE----------FI--LPQW--------  262

Query  560   TLECDPYI----GNYPRPVCL---KENPVSC-RKSSDVFVQTR-----GY---------F  447
             TLE D  +      Y   VCL    E   SC R+  +   + R     GY         +
Sbjct  263   TLENDGVLIFNNQQYFPLVCLNSRNEMDSSCVRRKQEQLPECRNELSYGYGPGFSVINGY  322

Query  446   RDDNRNISD--VENSGNGSRLALSDCHSICWKNCSCTAYA  333
             + +  N S+   E SGN + L   +CHSIC  +C C A+A
Sbjct  323   KGERINGSNYYYEQSGNLTTL---ECHSICMNDCDCIAFA  359



>ref|XP_010324437.1| PREDICTED: uncharacterized protein LOC101244973 [Solanum lycopersicum]
Length=1632

 Score =   188 bits (477),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 143/413 (35%), Positives = 204/413 (49%), Gaps = 49/413 (12%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI-PNEPV  1215
             A  DT+    +IRD   + SA  +++LGFFS       P N+++RY+GIWY KI P   V
Sbjct  28    AALDTITTNKSIRDGNTIVSAGGVYELGFFS-------PGNSKNRYVGIWYKKISPTTVV  80

Query  1214  WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGN------NVGATLLDSG  1053
             WVANRD PL D+SG L ++ +G L       ++  SNVSI S N      N  A LLD+ 
Sbjct  81    WVANRDIPLNDTSGVLTLNPNGILV------LVDKSNVSIWSSNSSRLLKNPKARLLDTA  134

Query  1052  NLVVREVDGNGSFGGV--LWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSG  879
             NLVV   DGN    G+   WQSFDYP + L+PGMK+G++L TG    +TSW S   P  G
Sbjct  135   NLVVS--DGNDRDQGINFAWQSFDYPGNTLLPGMKVGIDLVTGMDRYVTSWKSTDDPTPG  192

Query  878   AFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYF  705
              +   +D +G   QL +SR   V ++SG W   +F  +P       + F+ V N+KE YF
Sbjct  193   DYVDRVDSHG-YPQLFLSRNSSVVFSSGPWTGAAFSSSPSNKPSLYYTFEFVINQKEIYF  251

Query  704   SYSAKHNYRFTKWTLDLLGHIEQSSLI-YDPSFFIHYMPMYTWIGRYASTLECDPY----  540
              Y  K +   T+  L+  G I+    I +  S+F++         R+A    C PY    
Sbjct  252   KYELKSDSLPTRVVLNPDGVIQHLIWIEHTQSWFLYLTAQLDNCDRFAL---CGPYSSCN  308

Query  539   IGNYPRPVCLK--------ENPVS----CRKSSDVFVQTRGYFRDDNRNISDVENSGNGS  396
             I N P   CLK        E+       C + + +     G+ +     + D  NS    
Sbjct  309   INNSPPCDCLKGFEPRYPQESAADWSSGCVRRTSLNCTHDGFLKFTRIKMPDSRNSWYNE  368

Query  395   RLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDFQLDENGELYIY  243
             R+ L DC  +C  +C+CTAY+       G+GC+L+     D +     E  +Y
Sbjct  369   RMNLEDCEKMCLADCNCTAYSDLDVRNGGSGCLLWFGELIDIREFSQNEQNLY  421


 Score =   181 bits (459),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 134/411 (33%), Positives = 202/411 (49%), Gaps = 45/411 (11%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN-EPV  1215
             A  DT+    +IRD + + SA  +++LGFFS       P N+++ Y+GIWY KI N   V
Sbjct  849   AALDTITTDKSIRDGDTIVSAGGVYELGFFS-------PGNSKNHYVGIWYKKISNGTVV  901

Query  1214  WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGN------NVGATLLDSG  1053
             WVANR  PL D+SG L ++ +G L       ++  SNVSI S N      N  A LLDSG
Sbjct  902   WVANRSIPLNDTSGVLTLNPNGILV------LVDKSNVSIWSSNSSRLLKNPKARLLDSG  955

Query  1052  NLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAF  873
             NLVV + +  G      WQSFDYP + L+PGM+LG +  TG  W LTSW S   P  G +
Sbjct  956   NLVVSDGNDRGLENNFAWQSFDYPGNTLLPGMRLGKDFVTGMNWHLTSWKSTDDPTPGDY  1015

Query  872   ELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFSY  699
                +D +G   QL + +   + ++SG W   +F  +P+      + F+ V N++E Y++Y
Sbjct  1016  VDRVDSHG-YPQLFVWKNSSIVFSSGPWNGIAFSGSPNNKPNTYYSFEFVINQQEIYYTY  1074

Query  698   SAKHNYRFTKWTLDLLGHIEQSSLI-YDPSFFIHYMPMYTWIGRYASTLECDPY----IG  534
             + K++   T+  L+  G +E  + I    S+F++    +    R+     C PY    I 
Sbjct  1075  TIKNDSIPTRVVLNPSGVLEHLTWIERSQSWFLYLTAQFDNCDRFGL---CGPYSSCNIN  1131

Query  533   NYPRPVCLK------------ENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRL  390
             N P   CLK            E    C + + +     G+ +     + D  NS     +
Sbjct  1132  NSPPCDCLKGFEPRYPQDSATEWSSGCIRRTSLDCTHDGFLKFSGIKMPDSRNSWYNDSM  1191

Query  389   ALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDFQLDENGELYIY  243
              L DC  +C  +C+CTAY+       G+GC+L+     D +     E  +Y
Sbjct  1192  NLEDCEKMCLADCNCTAYSDLDVRNGGSGCLLWFGELIDIRGFSQNEQNLY  1242



>ref|XP_006370486.1| hypothetical protein POPTR_0001s43160g [Populus trichocarpa]
 gb|ERP67055.1| hypothetical protein POPTR_0001s43160g [Populus trichocarpa]
Length=736

 Score =   184 bits (468),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 143/416 (34%), Positives = 190/416 (46%), Gaps = 75/416 (18%)
 Frame = -2

Query  1385  SDTLMQGAN-IRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVWV  1209
             +DTL QG + +     L S   +F LGF  +     G   +   YLGIWYN   + P W+
Sbjct  21    ADTLYQGDDSLSSPNTLVSKNGLFTLGFTGL-----GSAESNASYLGIWYNNDTSHPFWL  75

Query  1208  ANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREVD  1029
             ANR  P+ D+SG L ID  G +K++Y GG       S  S  N+ A L DSGN V++  D
Sbjct  76    ANRGKPIADNSGVLAIDGSGNMKLTYSGGDPVEFYSSQSSTTNITAILEDSGNFVLK--D  133

Query  1028  GNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPG-SGAFELGLDIN  852
              N     VLWQSFD PTD  +PGMKLG+N +TG  W L SWLSD VP  +GAF    D N
Sbjct  134   ENSGSQQVLWQSFDSPTDTFLPGMKLGINHRTGQNWSLLSWLSDLVPTPAGAFTFEWDTN  193

Query  851   GCNNQLVISRRGKVYWTSGVWK-NGSFEKA-PDMTKEFGFKLV--SNEKEKYF-------  705
             G   +LVI RRG  YWTSG  + N SFE    +  KE  F  +  SN  E YF       
Sbjct  194   G--KKLVIKRRGVFYWTSGPLRSNTSFENFYLNSGKEVDFSFINDSNADEDYFMFKVSAN  251

Query  704   SYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYP  525
              Y+++    F+ W L   G I                            L      G   
Sbjct  252   EYASRDQRNFSMWQLRSDGSIVD--------------------------LTTSQAFGG--  283

Query  524   RPVCLKENPV------SCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSIC  363
              P+C   N        +CR + + F    G F     N +      + S L +SDC  IC
Sbjct  284   -PICKGNNADAGCERWTCRSNRNSFELRSGSF-----NYTVPRKYDDNSGLGISDCKDIC  337

Query  362   WKNCSCTAYA--SSSTDGTGCILY----------TNAAHDFQLDE-NGELYIYRLL  234
             WK+C C      +++ + TGC+ +           N  H   +D+ + E Y++ LL
Sbjct  338   WKDCQCVGVTPMANNVNNTGCVFWYGSFTQSLTGNNFQHYIIVDQGSSEKYLFELL  393



>gb|KDP38980.1| hypothetical protein JCGZ_00737 [Jatropha curcas]
Length=827

 Score =   184 bits (468),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 142/420 (34%), Positives = 205/420 (49%), Gaps = 53/420 (13%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINT-EDRYLGIWYNKIP  1227
              ++   +DTL    +IRD + L SA   F+LGFFS       P+ T +++YLGIWYN +P
Sbjct  18    TAISTVADTLNITRSIRDDDGLVSAGGSFRLGFFS-------PLGTSKNKYLGIWYNNLP  70

Query  1226  NEPV-WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGN  1050
              + V WVANR+ P+ DSSG L I   G L ++   G I  S+ S  +  N  A LLDSGN
Sbjct  71    GQTVVWVANREIPITDSSGVLRISDQGMLVLTVGNGSIIWSSNSTRASRNPIAQLLDSGN  130

Query  1049  LVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFE  870
             LVV+  +G+ +    LWQSFDYPTD  +PGMKLG N + G    LT W +   P  G F 
Sbjct  131   LVVKN-EGDDNPENYLWQSFDYPTDTFLPGMKLGWNREKGLGRYLTPWKTSDNPARGNFS  189

Query  869   LGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFSYS  696
              G+D  G   QLV+ +  K+ + +G W    F  AP +     + F  V NEKE Y+ Y 
Sbjct  190   CGVDAAGY-PQLVVRKNSKLVFRAGSWNGLRFSGAPGLKPNSIYTFGFVLNEKELYYHYE  248

Query  695   AKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLE---CDPY-----  540
              +++   ++  ++ +  + Q         F+       W  R  ST++   CD Y     
Sbjct  249   LRNSSLLSRSMINNVNGLFQR--------FLWNEQTREW--RLYSTVQMDNCDQYALCGS  298

Query  539   -----IGNYPRPVCLK--ENPV-----------SCRKSSDVFVQTRGYFRDDNRNISDVE  414
                  I N P   CL+  E  V            C +   +     G+ R     + D +
Sbjct  299   YGSCNINNSPTCSCLEGFEPKVPKEWDTVDWSSGCVRKIPLNCAGDGFRRYSAVKLPDTQ  358

Query  413   NSGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCIL-YTNAAHDFQLDENGE-LYI  246
              S     + L +C ++C KNCSC AY +      G+GC++ Y +      LDENG+ +YI
Sbjct  359   KSWYNKSMNLEECRTMCLKNCSCIAYTNLDIRGGGSGCLIWYDDLLDTRHLDENGQDIYI  418



>ref|XP_006370395.1| hypothetical protein POPTR_0001s42210g [Populus trichocarpa]
 gb|ERP66964.1| hypothetical protein POPTR_0001s42210g [Populus trichocarpa]
Length=828

 Score =   184 bits (468),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 139/413 (34%), Positives = 204/413 (49%), Gaps = 41/413 (10%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN  1224
             +++ +  DT+    +IRD E + SA   FKLGFFS       P ++++RYLGIWYNKI  
Sbjct  20    MTISSAVDTMNTTESIRDSEVMVSADGSFKLGFFS-------PGSSQNRYLGIWYNKISG  72

Query  1223  EPV-WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNL  1047
               V WVANR+ PL  SSG L +   G L +    G I  S  S  S  N  A LLDSGNL
Sbjct  73    RTVVWVANREIPLTVSSGVLRVTHRGVLVLLNHNGNIIWSTNSSRSVRNPVAQLLDSGNL  132

Query  1046  VVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFEL  867
             +V++ +G+GS   +LWQSFDYP D L+PGMKLG N  TG    L+SW +   P  G F  
Sbjct  133   IVKD-EGDGSMENLLWQSFDYPCDTLLPGMKLGRNTMTGLDRYLSSWKTPDHPSRGVFTY  191

Query  866   GLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFSYSA  693
             GL   G   +++ +   ++Y  SG W    F   P M     + +  V  EKE Y+SY  
Sbjct  192   GLKAAGYPEKVLRANSLQMY-RSGPWNGIRFSGCPQMQPNPVYTYGFVFTEKEMYYSYQL  250

Query  692   KHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPM-------YTWIGRYASTLECDPYIG  534
                   ++  L   G+I++ +       ++ Y+         Y   G Y S      +I 
Sbjct  251   LDRSILSRVILTQNGNIQRFTWSSSAHSWVFYLTAQVDDCNRYALCGVYGSC-----HIN  305

Query  533   NYPRPVCLK----ENPVS---------CRKSSDVFVQTRGYFRDDNRNISDVENSGNGSR  393
             + P   CL+    + P           C + + +   T G+ +     + +  NS     
Sbjct  306   DSPMCGCLRGFIPKVPKDWQMMNWLGGCERRTPLNCSTDGFRKYSGVKLPETANSWFSKS  365

Query  392   LALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDF-QLDENGE-LYI  246
             + L +C ++C KNCSC AY +      G+GC+L+ +   D  +L+ENG+ +YI
Sbjct  366   MNLEECKNMCTKNCSCIAYTNLDIREGGSGCLLWFSDLIDIRRLNENGQDIYI  418



>ref|XP_006388898.1| hypothetical protein POPTR_0080s00240g [Populus trichocarpa]
 gb|ERP47812.1| hypothetical protein POPTR_0080s00240g [Populus trichocarpa]
Length=772

 Score =   184 bits (466),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 138/378 (37%), Positives = 185/378 (49%), Gaps = 45/378 (12%)
 Frame = -2

Query  1385  SDTLMQGAN-IRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVWV  1209
             +DTL QG + +     L S   +F LGF  +     G   +   YLGIWYN   + P W+
Sbjct  21    ADTLYQGDDSLSSPNTLVSKNGLFTLGFTGL-----GSAESNASYLGIWYNNDTSHPFWL  75

Query  1208  ANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREVD  1029
             ANR  P+ D+SG L ID  G +K++Y GG +     S  S  N+ A L DSGN V++  D
Sbjct  76    ANRGKPIADNSGVLAIDGSGNIKLTYSGGDLVEFYSSQSSTTNITAILEDSGNFVLK--D  133

Query  1028  GNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKT-GHVWKLTSWLSDKVPG-SGAFELGLDI  855
              N S    LWQSFD PTD  +PGMKLG+N +T G  W L SWLSD VP  +GAF L  D 
Sbjct  134   ENSSSQQFLWQSFDSPTDTFLPGMKLGINHRTGGQNWSLLSWLSDLVPTPAGAFTLEWDT  193

Query  854   NGCNNQLVISRRGKVYWTSGVWK-NGSFEKA-PDMTK-EFGFKLVSNEKEKYF-------  705
             NG   +LVI RRG  YWTSG  + N SFE    ++ K +F F   SN  E YF       
Sbjct  194   NG--KKLVIKRRGVFYWTSGPLRSNTSFENFYLNLGKVDFSFINDSNADEDYFMFKVSAN  251

Query  704   SYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYP  525
              Y+++    F+ W L   G I            +       + G +   + C    GN  
Sbjct  252   EYASQDQRNFSMWQLRFDGSI------------VDLTTSRAFGGAFGGPV-CK---GNNA  295

Query  524   RPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSC  345
                C + +  +CR + + F    G F +      D  +S     L++SDC  ICWKNC+C
Sbjct  296   DAGCKRWSGPTCRSNRNSFELRSGDFFETVPRKLDYNSS-----LSISDCKDICWKNCTC  350

Query  344   TAYASSSTD--GTGCILY  297
                     +   TGC+ +
Sbjct  351   VGVTPMVNNVCNTGCVFW  368



>ref|XP_008779293.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Phoenix dactylifera]
Length=850

 Score =   184 bits (468),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 126/390 (32%), Positives = 197/390 (51%), Gaps = 35/390 (9%)
 Frame = -2

Query  1340  LTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVWVANRDSPLPDSSGSLII  1161
             L SA   F LGFFS       P+NT +RY+GIWY   P+  VWVANR  P+ + + SL I
Sbjct  66    LISAGERFALGFFS-------PVNTNNRYVGIWYKVSPHTIVWVANRQHPISERNSSLSI  118

Query  1160  DADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREVDGNGS--FGGVLWQSFD  987
              A+G L I+        S+ S    + V A LLD GN +V+E +G+G+   G   WQS D
Sbjct  119   TANGTLIITDQNSKTIWSSGSSGLASPV-AQLLDDGNFIVKEANGDGNIDLGSFAWQSSD  177

Query  986   YPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDINGCNNQLVISRRGKVY  807
             YPTD L+PGMK G NL +G    LTSW +   P  G++ + LD++G + Q+++    K  
Sbjct  178   YPTDTLLPGMKFGWNLTSGLKHNLTSWANPSDPALGSYTMVLDLHG-DPQMILLEDSKQL  236

Query  806   WTSGVWKNGSFEKAPDMTKEFGFKLVSN----EKEKYFSYSAKHNYRFTKWTLDLLGHIE  639
               +G W   SF   PD+    G   V++      E ++ Y+   +   T+ T+D  GH++
Sbjct  237   VRAGPWNGQSFSGDPDIRAMDGNGFVADFVIKSDEVFYMYNTSTSI-ITRLTVDYTGHVQ  295

Query  638   QSSLIYDPSFFIHYMPMYT----WIGRYASTLECDP-----------YIGNYPRPVCLKE  504
             +   + D   +  Y+        ++ +  +   C+P           +    PR   L+E
Sbjct  296   RLVWLNDSQMWSVYLSRPKDRCDYVSQCGAYGVCNPDDSRVCSCLHGFKPRSPRNWDLRE  355

Query  503   NPVSCRKSSDVFVQ--TRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYAS  330
                 C + +++  +  T G+   +   + D   S     + L +C +IC +NCSCTAYAS
Sbjct  356   GKDGCVRMTELDCRNGTDGFVTIEEAKLPDTSRSTVDRSMRLDECRAICLRNCSCTAYAS  415

Query  329   SSTDGTGCILYTNAAHDFQLDENG--ELYI  246
             ++  GTGCI++T    D ++   G  +LY+
Sbjct  416   ANIKGTGCIIWTTELTDIRVFTFGGQDLYV  445



>ref|XP_010240986.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 isoform X1 [Nelumbo nucifera]
Length=838

 Score =   184 bits (467),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 137/404 (34%), Positives = 199/404 (49%), Gaps = 46/404 (11%)
 Frame = -2

Query  1385  SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIP-NEPVWV  1209
             +DT+  G +I     + SA   ++LGFFS       P +++  Y+GIWY KI     VWV
Sbjct  23    TDTIKPGESISGQRTIFSAGGEYELGFFS-------PGSSKGYYVGIWYRKISVRTIVWV  75

Query  1208  ANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVG---ATLLDSGNLVVR  1038
             ANR+ P   SS  L I+ +G L +      ITV+++SI S  N     ATLLDSGNL+++
Sbjct  76    ANREYPPFSSSSYLTINNEGNLVVVDGRMSITVTSISISSPVNTSTATATLLDSGNLILK  135

Query  1037  EVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLD  858
             + + +     +LWQSFDYP+  L+PGM+LG N+KTGH W LTSW     PG G + + LD
Sbjct  136   DENSH-----ILWQSFDYPSHTLLPGMRLGHNVKTGHKWSLTSWRGTTDPGPGDYSVELD  190

Query  857   INGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFSYSAKHN  684
                   Q  I R  + YWTSG W    F   P+M     + F  VSNE E Y +YS    
Sbjct  191   PENW-RQFSIFRGSQRYWTSGTWDGLMFSMMPEMRLNYIYNFSFVSNENETYLTYSLYVG  249

Query  683   YRFTKWTLDLLGHIEQSSLIYDPS----FFIHYMP---MYTWIGRYAS-------TLEC-  549
                ++  +DL G I Q S + D      F+    P   + +  G + S       T +C 
Sbjct  250   SIISRLVMDLNGQIRQFSWLEDTQQWNLFWSQPRPQCDVKSLCGPFGSCNEQAMATCQCL  309

Query  548   ---------DPYIGNYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGS  396
                      D  +  Y    C++++P+ C  S+   ++   + + DN  +   EN+ + +
Sbjct  310   QGFKPVSSEDRNLRTYNSGGCVRQSPLRCETSNPEMLEEDRFLQMDNV-VRFPENNQSSA  368

Query  395   RLALSDCHSICWKNCSCTAYASSSTDGTGCILYTNAAHDFQLDE  264
               +   C S C  NCSC AY   S  G   + Y N ++  QL E
Sbjct  369   VGSADKCRSFCLNNCSCNAYTYIS--GLCFVWYGNLSNLQQLPE  410



>ref|XP_010487446.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 [Camelina sativa]
Length=880

 Score =   184 bits (468),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 140/395 (35%), Positives = 190/395 (48%), Gaps = 57/395 (14%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI------  1230
              E+DTL QG  ++  E L S   IFKL FF+  +S      +   YLGI YN +      
Sbjct  22    CETDTLQQGQYLKVGEELNSPFNIFKLKFFNFKNS------SNWWYLGISYNSLYLHNNN  75

Query  1229  -------PNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGA  1071
                     + PVW+ANR++P+   SGSL +D  G+L+I   G    +   S  +  N   
Sbjct  76    EYDSASHQDRPVWIANRNNPISGRSGSLKVDPLGRLRI-LRGASSLLELSSTETTANTTL  134

Query  1070  TLLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKV  891
             TLLDSGNL ++E+D  GS   +LWQSFDYPTD L+PGMKLG N+KTG  W+LTSWL D +
Sbjct  135   TLLDSGNLQLQEMDSGGSMRRILWQSFDYPTDTLLPGMKLGFNVKTGKRWELTSWLGDTL  194

Query  890   PGSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEK  711
             P SG+F  G+D     N+L I   G ++W SG+W  G F     +   F    VS + E+
Sbjct  195   PASGSFVFGMDAK-VTNRLTILWHGNMFWASGIWFKGQFLVENRLG--FDVSFVSTKSER  251

Query  710   YFSYSAKHN--YRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYI  537
             YF Y    +    F +  +D  G +   +L                + R         Y 
Sbjct  252   YFMYLGDQSDGTLFPRIMIDKQGTLRTINL--------------KGVQRNVLCSSVSDYK  297

Query  536   GNYPRPVCLKENPVSCRKSSDVFVQTRGYFRD-------DNRNISDVENS-GNG------  399
               Y    C ++  + CR      +   G   +        N  I  V  S GNG      
Sbjct  298   LEYG---CYQKKSMKCRYKRYGDLDKNGRCLEYGKCWSFSNYFIDGVFTSLGNGFILSET  354

Query  398   -SRLALSDCHSICWKNCSCTAYASSSTDGTGCILY  297
               RL+  DC+  C +NCSC AYAS+  DGTGC L+
Sbjct  355   DGRLSSYDCNVKCHQNCSCLAYASTHADGTGCELW  389



>ref|XP_010327263.1| PREDICTED: uncharacterized protein LOC101244232 [Solanum lycopersicum]
Length=1630

 Score =   187 bits (474),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 134/402 (33%), Positives = 201/402 (50%), Gaps = 47/402 (12%)
 Frame = -2

Query  1415  FSSYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYN  1236
             +  + S+    DT+    +I+D + + S+  +++LGFF        P N+ +RY+GIWY 
Sbjct  835   YFKFFSIVLALDTITIDKSIKDGDTIVSSGGVYELGFFR-------PGNSTNRYVGIWYK  887

Query  1235  KIPN-EPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGN------NV  1077
             KI     VWVANR++PL DSSG L+I+ DG L       ++  +NV+I S N      N 
Sbjct  888   KISTGTVVWVANRNNPLSDSSGVLMINPDGILV------LVDSTNVTIWSANSSTILKNP  941

Query  1076  GATLLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSD  897
              A LLDSGNLV+RE + N       WQSFDYP D L+PGMKLG NL TG  W ++SW S 
Sbjct  942   IARLLDSGNLVIREENENRP-EFFAWQSFDYPGDTLLPGMKLGRNLVTGMDWYMSSWKSP  1000

Query  896   KVPGSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSN  723
               PG G F   +D+ G   QL + +   + ++SG W   +F  +P +     F F  V N
Sbjct  1001  DDPGIGEFVDRMDVQG-YPQLFVWKGSSIAFSSGPWNGLAFSGSPSLQPNTYFTFGFVLN  1059

Query  722   EKEKYFSYSAKHNYRFTKWTLDLLGHIEQSSLI-YDPSFFIHYMPMYTWIGRYASTLECD  546
             ++E Y+ Y  K+    T+  L   G I   + I    S+F++    +    R+A    C 
Sbjct  1060  QEEVYYRYDLKNGSMLTRVVLTPGGLINHYTWIDRTQSWFLYLTAQFDNCDRFAL---CG  1116

Query  545   PY----IGNYPRPVCLK----ENPVS---------CRKSSDVFVQTRGYFRDDNRNISDV  417
             PY    I N P   CL+    + P           C + + +  Q  G+ +     + D 
Sbjct  1117  PYARCVINNSPPCDCLRGFVPKYPQEWDAADWSSGCVRRTPLACQQDGFRKFTGIKVPDT  1176

Query  416   ENSGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILY  297
               S     + L +C  +C  +C+CTAY++      G+GC+L+
Sbjct  1177  RKSWFNESIGLEECRKLCLADCNCTAYSNMDVRDGGSGCLLW  1218


 Score =   160 bits (405),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 134/420 (32%), Positives = 197/420 (47%), Gaps = 51/420 (12%)
 Frame = -2

Query  1406  YVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIP  1227
             +  V ++SDTL     ++D E + S+   F+LGFFS   + S    + +RY+GIWY KI 
Sbjct  15    FQKVESQSDTLTTSQILKDGETIISSDGTFELGFFSAGKNSS----SRNRYIGIWYKKIS  70

Query  1226  N-EPVWVANRDSPLPDSSGSLIIDADGKLKI--SYVGGMITVSNVSIMSGNNVGATLLDS  1056
                P+WVANR  P+   SG L I   G L +  +     I  +N S +S  N  A LLD+
Sbjct  71    ALTPIWVANRQIPVKGISGILKIVEPGYLVLINNVTNDTIWSTNFSSISVKNPVAKLLDT  130

Query  1055  GNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGA  876
             GN V++  D N     +LWQSFDYP+D L+  MKLG +L TG    L SW SD  P  G 
Sbjct  131   GNFVIK--DANDDL--LLWQSFDYPSDTLLASMKLGRDLVTGLERYLRSWKSDDDPAPGD  186

Query  875   FELGLDINGCNNQLVISRRG-KVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYF  705
             +    D  G    L+  RRG  V + +G W    +  AP+M       F LV N++E Y+
Sbjct  187   YTYHCDPTGYPQDLM--RRGPNVVYRAGPWNGLRWSGAPNMVNNSVTSFGLVMNDQEIYY  244

Query  704   SYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMP-------MYTWIGRYAS-TLEC  549
              Y   +    T   L   G+  +   I     +++Y          Y   G Y + T+  
Sbjct  245   KYELVNKSLLTTLVLTPNGNAMRMIWIEKREGWVNYHSADADHCDTYKLCGAYGTCTMFS  304

Query  548   DP-------YIGNYP--------RPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVE  414
             DP       ++  +P           C++ +P++C  S D F++  G        + D  
Sbjct  305   DPVCRCLDKFVPKHPDDWNRADWSSGCVRNHPLNC--SEDGFIKYTGV------KLPDTR  356

Query  413   NSGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDF-QLDENGE-LYI  246
              S     + L +C  +C +NCSC  Y S      G+GC+L+     D  QL E+G+ +YI
Sbjct  357   YSWFNETMTLDECKLVCLRNCSCMGYTSLDIRNGGSGCLLWIGELVDLRQLSESGQDIYI  416



>ref|XP_010928020.1| PREDICTED: S-locus-specific glycoprotein S13-like [Elaeis guineensis]
Length=464

 Score =   180 bits (456),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 129/408 (32%), Positives = 196/408 (48%), Gaps = 45/408 (11%)
 Frame = -2

Query  1415  FSSYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYN  1236
              SS+ S     DTL     + D   L SA   F LGFFS       P+N   RY+GIWY 
Sbjct  16    LSSHFSPSIGGDTLTPAQPLADGHELISAGERFVLGFFS-------PVNINSRYVGIWYK  68

Query  1235  KIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDS  1056
               P+  VWVANR  P+ + +GSL ID +G L I+        S+ S    N V A LLD 
Sbjct  69    VSPSTVVWVANRQHPISERNGSLSIDTNGTLIITDHNSKPIWSSGSSGLTNPV-AQLLDD  127

Query  1055  GNLVVREVDGNGSFG-GVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSG  879
             GN +++E +G+G+      WQSFDYPTD L+PGMKLG N+ +G    LTSW+S   P  G
Sbjct  128   GNFIIKEANGDGNVPRSFAWQSFDYPTDTLLPGMKLGWNITSGFNRNLTSWISPSDPTPG  187

Query  878   AFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSY  699
             ++ + LD++G + Q+++ +       +G W   +F   PD + +F    V N +E ++  
Sbjct  188   SYSMVLDVHG-DPQVIVWKGSDKQGRTGPWNGQTFSGMPDFSPDFVLDFVMNNEEVFYMN  246

Query  698   SAKHNYRFTKWTLDLLGHIEQSSLIYD------PSFFIH---YMPMYTWIGRYA-----S  561
             +  +     +  L   G + +  L++D       +F +       M++  G Y      +
Sbjct  247   NTTNTSIIGRLLLYYTGVVVR--LVWDDATQMWSTFALEPKDTCDMWSQCGSYGVCNYDN  304

Query  560   TLECDPYIGNYPRPV--------CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSG  405
             +  C    G   R          C +   + C+  +D FV  +         + D   S 
Sbjct  305   SPICSCLQGFKLRSSRNSDFRDGCTRMTELDCQNGTDGFVTVK------EVKLPDTSRST  358

Query  404   NGSRLALSDCHSICWKNCSCTAYASSSTDGTGCILYTN-----AAHDF  276
                 + L +C + C +NCSCTAYAS+  +GTGC+++T      +AH F
Sbjct  359   VDRSIRLHECRNSCLRNCSCTAYASADINGTGCVIWTTELTDISAHSF  406



>ref|XP_004308259.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120-like [Fragaria vesca subsp. vesca]
Length=1532

 Score =   186 bits (473),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 130/350 (37%), Positives = 179/350 (51%), Gaps = 34/350 (10%)
 Frame = -2

Query  1331  AKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVWVANRDSPLPDSSGSLIIDAD  1152
             A   F L F    D+ S        YL   YN   ++  WVANR +P+    G L +D +
Sbjct  42    ANGKFTLSFHRYDDAASLS------YLVSKYNA-SHDYAWVANRYTPVLYPFGILTLDRN  94

Query  1151  GKLKISYVGGMITVSNVSIMSGNNVG---ATLLDSGNLVVREVDGNGSFGGVLWQSFDYP  981
               LKI+   G   V   S  SG  +G   ATL+D GN V++E+  +GS   VLWQSFDYP
Sbjct  95    NTLKITQKDGDPVVL-YSADSGTIIGDVVATLMDDGNFVLQELSSDGSAKRVLWQSFDYP  153

Query  980   TDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDINGCNNQLVISRRGKVYWT  801
              DVL+PGMKLGVN  TGH W L+ WL++K    G F L  D +G   +L I RRG VYW+
Sbjct  154   GDVLLPGMKLGVNRSTGHNWSLSCWLTEKSAVPGPFTLDWDPDG--KELQIRRRGVVYWS  211

Query  800   SGVWKNGSFEKAPDMTKEFGFKLVSNEKEKYFSYSAKHNYRFTKWTLDLLGHIEQSSLIY  621
             SGV+++GS E      K + F +VSNE E YFSYSA       +W L  +G       +Y
Sbjct  212   SGVFRDGSLENIKQ--KRYKFSIVSNENEDYFSYSAVDRNARPEWLLTTIGR------LY  263

Query  620   DPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKENPVSCRKSSDVFVQTRGYFRD  441
             D    +      +  G Y++   C  +           + P  CR+  DVF Q  GYF  
Sbjct  264   DFDGSMDIAKADSCYG-YSTDGGCQIW-----------DQPTECRRFGDVFEQENGYFNP  311

Query  440   DNRNISDV-ENSGNGSRLALSDCHSICWKNCSCTAYASSSTDGTGCILYT  294
                + + V   S + + L++SDC + CW +C+C  +   + + TGC  +T
Sbjct  312   TGSSGASVTSTSDSNTSLSISDCKAACWADCNCRGFIFLNANQTGCRYWT  361


 Score =   186 bits (473),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 116/320 (36%), Positives = 166/320 (52%), Gaps = 26/320 (8%)
 Frame = -2

Query  1256  YLGIWYNKIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGG--MITVSNVSIMSGN  1083
             YL I YN   N   WV NR++P+    G L +D +  LKI++  G  ++  S  S     
Sbjct  800   YLVIKYNASHNY-AWVGNRETPILYPFGVLTLDRNNTLKITHRDGDAVVLYSAESGTVSG  858

Query  1082  NVGATLLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWL  903
             +V ATL D GN V++E+  +GS   VLWQSFDYP DVL+PGMKLGVN   GH W L+ WL
Sbjct  859   DVVATLTDDGNFVLQELSSDGSVKRVLWQSFDYPGDVLLPGMKLGVNRSNGHNWSLSCWL  918

Query  902   SDKVPGSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSN  723
             +++    G F L  D +G   QL I RRG VYW+SGV+++G+FE      K + F +VS 
Sbjct  919   TERSAVPGPFTLDWDPDG--KQLKIKRRGVVYWSSGVFRDGNFENIKH--KRYNFSIVSK  974

Query  722   EKEKYFSYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDP  543
             E E YFSYSA      ++W L  +G ++    + D                 A   +C  
Sbjct  975   ENENYFSYSAVDEDAISEWLLTTIGRLKDFDGLLD----------------IAKADDCYG  1018

Query  542   YIGNYPRPVCLKENPVSCRKSSDVFVQTRGYFRD-DNRNISDVENSGNGSRLALSDCHSI  366
             Y  N      + + P  C +  ++F Q  GYF   D+        +   + L++SDC + 
Sbjct  1019  Y--NTEEGCQIWDQPTKCGRFGNIFEQENGYFNPADSSGSPTTSTTDPNTSLSISDCKAA  1076

Query  365   CWKNCSCTAYASSSTDGTGC  306
             CW +C+C  +   + + TGC
Sbjct  1077  CWADCNCCGFIFLNANQTGC  1096



>gb|KCW74885.1| hypothetical protein EUGRSUZ_E03623 [Eucalyptus grandis]
Length=588

 Score =   181 bits (460),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 151/469 (32%), Positives = 230/469 (49%), Gaps = 55/469 (12%)
 Frame = -2

Query  1382  DTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEP-VWVA  1206
             D L     IRD + L SA   F+LGFFS       P N+  R+L IWY+ IP +  VWVA
Sbjct  26    DVLSSSETIRDGDTLVSAGEKFQLGFFS-------PGNSSYRFLAIWYHNIPEKTTVWVA  78

Query  1205  NRDSPLPDSSGSLIIDADGKLK-ISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREVD  1029
             N D+P+ DSSG L I ++GKL  +     ++  SN    +  +V A LLDSGNLV+++  
Sbjct  79    NGDNPVNDSSGVLRIGSEGKLVLVDQAERVLWSSNNMNATSQSVVAKLLDSGNLVLKDDS  138

Query  1028  GNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDING  849
              N S G  LWQSFD+P++ L+ GMKLG +L+ G    +TSW S + P +G F  G+D+ G
Sbjct  139   ENVS-GNYLWQSFDHPSNTLLVGMKLGWDLRMGLDRHMTSWKSAEDPSTGDFTFGVDLGG  197

Query  848   CNNQLVISRRGKV-YWTSGVWKNGSFEKAPDMTKEFGF--KLVSNEKEKYFSYSAKHNYR  678
                QLVI R+G+V Y+ SG W    F + P M     F  K V+N +E YF+++  +   
Sbjct  198   IIPQLVI-RKGRVKYFRSGPWNGIQFGRMP-MVPNLIFIPKFVNNSQEVYFTFNHFNEST  255

Query  677   FTKWTLDLLGHIEQSSLIYDPS--FFIHYMPMYTWIGRY-----------ASTLECDPYI  537
              T+  L+  G+  Q  L  + +  + + YM  Y     Y           +++  C   I
Sbjct  256   ITRLVLNASGN-HQRYLWSEKTQEWTMIYMLPYDACDVYGKCGSNSMCTISNSPICSCMI  314

Query  536   GNYPRPV-----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRL  390
             G  P+             C+ +NP +C K         G+ R     + D+      + +
Sbjct  315   GYQPKSQAEWDTLVWSSGCVSKNPFNCSKG-------EGFKRLKGVKMPDLLQFTMNTSM  367

Query  389   ALSDCHSICWKNCSCTAYAS--SSTDGTGCILYTNAAHDFQL---DENGELYIYRLLKEH  225
             +L +C   C+KNCSC AYA+  ++  G+GC+L+     D ++     N +LYI     + 
Sbjct  368   SLKECELECFKNCSCRAYANIDATGGGSGCLLWFGDLLDVRILSRSANQDLYIRVSASDL  427

Query  224   KG*ILVNVRYCCFTVIQVFCVFVNVPFVLEGCSLCNHVYYHYEIKMDIQ  78
                  VN +   +  + +   FV +  VL  C +     +   I  D+Q
Sbjct  428   DS---VNSKGKEWVAVAISMAFVVLSVVLYFCIVWKRKKHAQGITFDLQ  473



>ref|XP_006362970.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like [Solanum tuberosum]
Length=803

 Score =   183 bits (464),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 133/402 (33%), Positives = 201/402 (50%), Gaps = 47/402 (12%)
 Frame = -2

Query  1415  FSSYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYN  1236
             + +++S+    DT+     I+D + + S+  +++LGFF        P N+ +RY+GIWY 
Sbjct  10    YFNFLSIVLALDTITIDQPIKDGDTIVSSGGVYELGFFR-------PGNSTNRYVGIWYK  62

Query  1235  KIPN-EPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGN------NV  1077
             KI     VWVANR++PL DSSG L+I+ DG L       ++  +NV+I S N      N 
Sbjct  63    KISTGTVVWVANRNNPLSDSSGVLMINPDGILV------LVNSTNVTIWSTNSSTILKNP  116

Query  1076  GATLLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSD  897
              A LLDSGNLV+RE + N       WQSFDYP D L+PGMKLG NL TG  W  +SW S 
Sbjct  117   IARLLDSGNLVIREENENRP-EFFTWQSFDYPGDTLLPGMKLGRNLVTGLDWYSSSWKSP  175

Query  896   KVPGSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSN  723
               P  G F   +D+ G   QL + +   + ++SG W   +F  +P +     F F  V N
Sbjct  176   DDPAIGEFVERMDVQG-YPQLFVWKGSSITFSSGPWNGLAFSSSPSLQPNTYFTFGFVLN  234

Query  722   EKEKYFSYSAKHNYRFTKWTLDLLGHIEQSSLI-YDPSFFIHYMPMYTWIGRYASTLECD  546
             ++E Y+ Y  K+    T+  L   G I   + I    S+F++    +    R+A    C 
Sbjct  235   QEEVYYKYDLKNGSLLTRVVLTPGGLINHYTWIDRTQSWFLYLTAQFDNCDRFAL---CG  291

Query  545   PY----IGNYPRPVCLK----ENPVS---------CRKSSDVFVQTRGYFRDDNRNISDV  417
             PY    I N P   CL+    + P           C + + +  Q  G+ +     + D 
Sbjct  292   PYARCVINNSPPCDCLRGFEPKYPQEWDAADWSSGCVRRTPLACQQDGFRKFTGIKVPDT  351

Query  416   ENSGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILY  297
             + S     + L +C  +C  +C+CTAY++      G+GC+L+
Sbjct  352   QKSWFNESIGLEECGKLCLADCNCTAYSNMDVRDGGSGCLLW  393



>ref|XP_007021203.1| S-locus lectin protein kinase family protein, putative isoform 
2, partial [Theobroma cacao]
 gb|EOY12728.1| S-locus lectin protein kinase family protein, putative isoform 
2, partial [Theobroma cacao]
Length=667

 Score =   182 bits (462),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 145/483 (30%), Positives = 216/483 (45%), Gaps = 73/483 (15%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN  1224
             +   A +D +    +IRD E L S    F+LGFFS       P N+  RYLGIWY   P 
Sbjct  23    LGASAAADNITPNQSIRDNETLVSGDGSFELGFFS-------PGNSTKRYLGIWYKVSPE  75

Query  1223  EPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLV  1044
               VWVANR++PL +  G L +   G + I      I  S+  I +  N    LLDSGNLV
Sbjct  76    TVVWVANREAPLANHFGVLNVTNQGTIIILDKKPSIIWSSSGIRTAENPVVQLLDSGNLV  135

Query  1043  VREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELG  864
             V++ + +GS    LWQSFDYP D L+P MKLG N  TG  W LTSW S   P  G F   
Sbjct  136   VKDGNDSGS-ENFLWQSFDYPCDTLLPAMKLGKNFVTGRNWSLTSWKSPNDPARGQFSAL  194

Query  863   LDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE-----FGFKLVSNEKEKYFSY  699
             +D  G   QLV+     + +  G W    F   PD+ +      F F+   N+ E Y+  
Sbjct  195   IDPQGF-PQLVVRNGSVILYRGGSWNGKRFTGTPDLEQVESSNLFKFEFELNKNEVYYK-  252

Query  698   SAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTL-ECDPY------  540
                ++   ++  ++  G +E+         F+       W G Y++   ECD Y      
Sbjct  253   GEPYSSLLSRLVVNQSGFLER---------FVRTKQSNLWAGIYSAPRDECDYYAVCGVY  303

Query  539   ----IGNYPRPVCL---------------------KENPVSCRKSSDVFVQTRGYFRDDN  435
                  GN P   CL                     +  P  CR  S VF +  G      
Sbjct  304   AICITGNSPLCACLDDFEPKSPMDWNNSKWSGGCVRRTPFDCR--SSVFTKRPGL-----  356

Query  434   RNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDFQLDEN  261
               + D  +S   + ++L++C   C +NCSC  YA+S     G+GC+L+ +  +D ++  +
Sbjct  357   -KLPDTSHSFFNTSMSLAECQEECLRNCSCMGYANSDIRQGGSGCLLWFDDLNDMRVFTS  415

Query  260   G--ELYIYRLLKEHKG*ILVNVRYCCFTVIQVFCVFVNVPFVLEGCSLCNHVYYHYEIKM  87
             G  +LYI R+     G ++++        + V    + +P +L G  L   +++    K+
Sbjct  416   GGQDLYI-RMANSTSGPLVLSKNSSEKKKVAV----IVIPVILVGVILGGLIFWMMWKKL  470

Query  86    DIQ  78
               Q
Sbjct  471   RKQ  473



>ref|XP_008366279.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Malus domestica]
Length=827

 Score =   183 bits (464),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 140/429 (33%), Positives = 213/429 (50%), Gaps = 66/429 (15%)
 Frame = -2

Query  1400  SVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI-PN  1224
             S+ A  D +    ++RD E L S+   F+LGFFS       P N+ +RY+GIWYN I P 
Sbjct  18    SISAAKDIITPTVSLRDGESLVSSGGTFELGFFS-------PGNSXNRYVGIWYNGISPQ  70

Query  1223  EPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVG-------ATL  1065
               VWVANR++PL D SG+L I   G L       + +  N S+ S N          A L
Sbjct  71    IVVWVANRETPLTDXSGALNITXGGVLV------LFSDKNXSLWSSNXTSRXLRSPVAQL  124

Query  1064  LDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPG  885
             L+SGNLVV++ + + S G ++WQSFDYP + L+PGMKLG NL TG    L+SW + + P 
Sbjct  125   LESGNLVVKDGNXDNSEGNLVWQSFDYPGNXLLPGMKLGWNLXTGXNRXLSSWKAAEDPS  184

Query  884   SGAFELGLDINGCNNQLVISRRGKV-YWTSGVWKNGSFEKAPDMTKEFGFKL--VSNEKE  714
              G F   +D +G   QLV+ R+G+V ++  G W    F  +P+++    FK+  VSN+ E
Sbjct  185   PGXFSYSIDHSGY-PQLVL-RKGRVPHYRLGSWNGLGFTGSPELSPNEAFKIEFVSNDSE  242

Query  713   KYFSYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSF---FIHYMP-----MYTWIGRYA--  564
              Y+ +    +   ++  L+L G + Q  L  D +     I+  P      Y   G +A  
Sbjct  243   AYYKFDLMRDSMHSRLVLNLSGGL-QRFLWIDKTHSGNMIYSAPADXCDTYDLCGAFAFC  301

Query  563   ---STLECDPYIGNYPRPV------------CLKENPVSCRKSSDV--FVQTRGYFRDDN  435
                S   C    G  P+              CL+++P++C    +   F++ +       
Sbjct  302   KLDSVPLCSCLQGFVPKSPXDYWTMKNTSSGCLRKSPLNCTNQDEFQKFIRVK-------  354

Query  434   RNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDF-QLDE  264
               + D  +S   + ++L +C  +C  NCSCTAYA+      GTGC+L+     D  + D 
Sbjct  355   --LPDTSSSRINNTMSLEECKKMCLTNCSCTAYANLDVRGGGTGCLLWFGXLIDIKZFDS  412

Query  263   NGELYIYRL  237
              G+    R+
Sbjct  413   VGQDLFVRM  421



>ref|XP_011097953.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Sesamum indicum]
Length=812

 Score =   183 bits (464),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 137/427 (32%), Positives = 200/427 (47%), Gaps = 48/427 (11%)
 Frame = -2

Query  1409  SYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI  1230
             S +   A ++++    ++RD E + S    F+LGFFS       P N+++RYLGIWY  I
Sbjct  16    SMLKTSALTESIAASQSLRDGETMVSNGGSFELGFFS-------PGNSKNRYLGIWYKNI  68

Query  1229  P-NEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSG  1053
             P    VWVANR +P+ D SGSL+I++ G L +S     +  S  S     +  A LLDSG
Sbjct  69    PVRTIVWVANRKNPIKDMSGSLMINSTGSLLLSDGTNTVVWSTYSTRIPQSPVAQLLDSG  128

Query  1052  NLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAF  873
             NLVVR++  +G     LWQSFDYP+D L+PGMKLG NL+T    +L+SW S   P  G  
Sbjct  129   NLVVRDIK-DGDADSYLWQSFDYPSDTLLPGMKLGWNLRTHLNRRLSSWKSSDDPSPGEL  187

Query  872   ELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFSY  699
               G++++    Q V+ +  + Y+  G W    F  AP++     F FK VSN+ E Y+ Y
Sbjct  188   SNGIELDA-YPQGVMRKGSRKYFRGGPWNGLRFSGAPELKSNPLFDFKFVSNQDEVYYQY  246

Query  698   SAKHNYRFTKWTLDLLGHIEQSSLIYDP--------SFFIHYMPMYTWIGRYASTLECDP  543
                +    T+  L+      Q  +  +P        S    Y   Y   G     +  D 
Sbjct  247   RLLNTSVITRLVLNETTSTRQRYVWAEPDMSWKLYASVPRDYCDTYGLCGANGICIISDS  306

Query  542   --------YIGNYPRP--------VCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVEN  411
                     +  N+P+          C+   P+ CR+         G+ +     + D   
Sbjct  307   PVCKCLEGFKPNFPQSWDAMDWSRGCIHNEPLDCRRK-------HGFIKFSGLKLPDTTY  359

Query  410   SGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDFQLDENG--ELYIY  243
             S     + L +C   C KNCSCTAY +S     G GC L+     D +    G  +LYI 
Sbjct  360   SWVNESMNLWECREECLKNCSCTAYTNSDIRGGGNGCALWFGDLVDIKQVSGGGQDLYI-  418

Query  242   RLLKEHK  222
             R+   H+
Sbjct  419   RMPTPHR  425



>gb|KCW74883.1| hypothetical protein EUGRSUZ_E03623 [Eucalyptus grandis]
Length=614

 Score =   181 bits (460),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 152/476 (32%), Positives = 232/476 (49%), Gaps = 55/476 (12%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN  1224
             + V    D L     IRD + L SA   F+LGFFS       P N+  R+L IWY+ IP 
Sbjct  19    LEVCKSVDVLSSSETIRDGDTLVSAGEKFQLGFFS-------PGNSSYRFLAIWYHNIPE  71

Query  1223  EP-VWVANRDSPLPDSSGSLIIDADGKLK-ISYVGGMITVSNVSIMSGNNVGATLLDSGN  1050
             +  VWVAN D+P+ DSSG L I ++GKL  +     ++  SN    +  +V A LLDSGN
Sbjct  72    KTTVWVANGDNPVNDSSGVLRIGSEGKLVLVDQAERVLWSSNNMNATSQSVVAKLLDSGN  131

Query  1049  LVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFE  870
             LV+++   N S G  LWQSFD+P++ L+ GMKLG +L+ G    +TSW S + P +G F 
Sbjct  132   LVLKDDSENVS-GNYLWQSFDHPSNTLLVGMKLGWDLRMGLDRHMTSWKSAEDPSTGDFT  190

Query  869   LGLDINGCNNQLVISRRGKV-YWTSGVWKNGSFEKAPDMTKEFGF--KLVSNEKEKYFSY  699
              G+D+ G   QLVI R+G+V Y+ SG W    F + P M     F  K V+N +E YF++
Sbjct  191   FGVDLGGIIPQLVI-RKGRVKYFRSGPWNGIQFGRMP-MVPNLIFIPKFVNNSQEVYFTF  248

Query  698   SAKHNYRFTKWTLDLLGHIEQSSLIYDPS--FFIHYMPMYTWIGRY-----------AST  558
             +  +    T+  L+  G+  Q  L  + +  + + YM  Y     Y           +++
Sbjct  249   NHFNESTITRLVLNASGN-HQRYLWSEKTQEWTMIYMLPYDACDVYGKCGSNSMCTISNS  307

Query  557   LECDPYIGNYPRPV-----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVEN  411
               C   IG  P+             C+ +NP +C K         G+ R     + D+  
Sbjct  308   PICSCMIGYQPKSQAEWDTLVWSSGCVSKNPFNCSKG-------EGFKRLKGVKMPDLLQ  360

Query  410   SGNGSRLALSDCHSICWKNCSCTAYAS--SSTDGTGCILYTNAAHDFQL---DENGELYI  246
                 + ++L +C   C+KNCSC AYA+  ++  G+GC+L+     D ++     N +LYI
Sbjct  361   FTMNTSMSLKECELECFKNCSCRAYANIDATGGGSGCLLWFGDLLDVRILSRSANQDLYI  420

Query  245   YRLLKEHKG*ILVNVRYCCFTVIQVFCVFVNVPFVLEGCSLCNHVYYHYEIKMDIQ  78
                  +      VN +   +  + +   FV +  VL  C +     +   I  D+Q
Sbjct  421   RVSASDLDS---VNSKGKEWVAVAISMAFVVLSVVLYFCIVWKRKKHAQGITFDLQ  473



>ref|XP_010644283.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Vitis vinifera]
 ref|XP_010644284.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Vitis vinifera]
 ref|XP_010644285.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Vitis vinifera]
Length=541

 Score =   180 bits (457),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 143/418 (34%), Positives = 201/418 (48%), Gaps = 50/418 (12%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN  1224
             + V    DT+     IRD E +TS    F+LGFFS       P+++ +RY+GIWY K+  
Sbjct  17    LRVSNAGDTITVDLVIRDGETITSVGGSFELGFFS-------PVDSNNRYVGIWYKKVST  69

Query  1223  EPV-WVANRDSPLPDSSGSLIIDADGKLKI-SYVGGMITVSNVSIMSGNNVGATLLDSGN  1050
               V WVANR+ PL DSSG L +   G L + +   G+I  SN S     N    LL+SGN
Sbjct  70    RTVVWVANREFPLTDSSGVLKVTDQGTLVVLNGTNGIIWSSNSS-QPAINPNVQLLESGN  128

Query  1049  LVVREVDGNGS-FGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAF  873
             LVV+  +GN S     LWQSFDYP D ++PGMK G N  TG    L+SW S   P  G F
Sbjct  129   LVVK--NGNDSDPEKFLWQSFDYPCDTVLPGMKFGRNTVTGLDRYLSSWKSTDDPSKGNF  186

Query  872   ELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFSY  699
                LD +G   QL++     V + SG W    F   P++     + +  V NEKE Y++Y
Sbjct  187   TYRLDPSGF-PQLILRSGSAVTFCSGPWNGLRFSGCPEIRSNPVYKYSFVLNEKEIYYTY  245

Query  698   SAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPM-------YTWIGRYAS-----TL  555
                +N   T+  L   G++++ + I     +I Y          Y   G Y S     + 
Sbjct  246   DLLNNSVITRLVLSPNGYVQRFTWIDRTRGWILYSSAHKDDCDSYALCGAYGSCNINHSP  305

Query  554   ECDPYIGNYPRPV-----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENS  408
             +C    G  P+             C++  P+ C K         G+ +     + D + S
Sbjct  306   KCTCMKGFVPKFPNEWNMVDWSNGCVRSTPLDCHKG-------EGFVKYSGVKLPDTQYS  358

Query  407   GNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDF-QLDENG-ELYI  246
                  ++L +C SIC  NCSCTAYA+S     G+GC+L+     D  +  ENG ELY+
Sbjct  359   WFNENMSLKECASICLGNCSCTAYANSDIRNGGSGCLLWFGDLIDIREFAENGQELYV  416



>ref|XP_006452078.1| hypothetical protein CICLE_v10010587mg [Citrus clementina]
 gb|ESR65318.1| hypothetical protein CICLE_v10010587mg [Citrus clementina]
Length=808

 Score =   182 bits (463),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 137/422 (32%), Positives = 207/422 (49%), Gaps = 53/422 (13%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN  1224
             +   +  DTL  G +IRD E L SA   F+LGFFS       P  ++ RYLGIWY KI N
Sbjct  12    IRTTSTQDTLRLGQSIRDGETLVSANESFELGFFS-------PGKSKSRYLGIWYKKIAN  64

Query  1223  EPV-WVANRDSPLPDSSGSLIIDADGK---LKISYVGGMITVSNVSIMSGNNVGATLLDS  1056
               V WVANR++PLPD SG L I + G    +  +   G++  SN S  + N V A LL+S
Sbjct  65    GTVTWVANRNAPLPDRSGVLSISSQGNGTLILQNSTNGIVWSSNASRTAQNPV-AVLLES  123

Query  1055  GNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGA  876
             GNLVV+  + N S    LWQSFDYPT VL+PGMKLGVNL TG    ++SW S   P    
Sbjct  124   GNLVVKSGNDNDS-DNFLWQSFDYPTHVLLPGMKLGVNLVTGLNRFISSWKSADDPAQDD  182

Query  875   FELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFS  702
             +   +D  G   Q ++ +   + +  G W    +   P +     + F+ VSNEKE ++ 
Sbjct  183   YMYEIDPRGV-PQAMLLKGSTIRYRPGSWNGLHWTGMPQLQPNPVYTFEYVSNEKEVFYR  241

Query  701   YSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPM---------YTWIGRYA-----  564
             ++   +   +   +  LG  ++ + +     +  ++           Y   G YA     
Sbjct  242   FTLIKSSVPSMMVVSPLGESQRYTWMEQTQKWAPFLSFSGLIDQCDNYALCGTYAICKMN  301

Query  563   -STLECDPYIGNYPRPV-----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNISD  420
              ++ EC+   G  P+             C++   + C +         G+ + ++  + D
Sbjct  302   SNSAECECLEGFEPKSPRDWKLLDKTDGCVRRTKLDCERGD-------GFLKRESVKLPD  354

Query  419   VENSGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDFQ-LDENGE-L  252
                S     ++L +C  +C KNCSCTAYA++     G+GC+L+ +   D + L E G+ L
Sbjct  355   TRFSRVDKNISLFECKELCSKNCSCTAYANADVRGGGSGCLLWFHELTDMKILSEGGQDL  414

Query  251   YI  246
             YI
Sbjct  415   YI  416



>gb|KHN17919.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Glycine soja]
Length=740

 Score =   182 bits (461),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 132/390 (34%), Positives = 185/390 (47%), Gaps = 61/390 (16%)
 Frame = -2

Query  1388  ESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVWV  1209
               DTL+QG  +     L S   ++ L FF + D   G       YLG+  NK  +  VWV
Sbjct  20    REDTLLQGHQLGSTNRLISPSGLYTLRFFQLDD---GSDANSKFYLGVSANKF-HYYVWV  75

Query  1208  ANRDSPLPDSSGSLIIDADGKLKI-SYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
             ANRD+P+ D  G L ID    LKI S    M+  S  +  +  +V ATLLD+GN V+ E+
Sbjct  76    ANRDNPIHDDPGVLTIDEFSNLKILSSTTTMMLYSVEAENTNKSVRATLLDTGNFVLHEL  135

Query  1031  DGNG-SFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDI  855
             + +G S   VLWQSFDYPTD ++PGMKLG +  TGH W +T+  S +   SG+F L LD 
Sbjct  136   NPDGISVKRVLWQSFDYPTDTILPGMKLGYDKNTGHTWSITARRSYRTLWSGSFSLSLDP  195

Query  854   NGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMT---KEFGFKLVSNEKEKYFSYSAKHN  684
                 NQLV   R  + W+SG W+NGSF      +   + F F   SNE   YF Y++   
Sbjct  196   K--TNQLVSRWREAIIWSSGEWRNGSFSNLNSSSLYKENFNFTFFSNESVTYFEYASVSG  253

Query  683   YRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKE  504
             Y    +T++ LG +  S   Y                   S ++ +        P C   
Sbjct  254   Y----FTMEPLGRLNASGAAY-------------------SCVDIEIV------PGCTMP  284

Query  503   NPVSCRKSSDVFV---------QTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNC  351
              P  CR+  D+++           RG+  D+  N            L +SDC   C KNC
Sbjct  285   RPPKCREDDDLYLPNWNSLGAMSRRGFIFDEREN------------LTISDCWMKCLKNC  332

Query  350   SCTAYASSSTDGTGCILYTNAAHDFQLDEN  261
             SC AY  +  D TGC +++     + ++ N
Sbjct  333   SCVAYTYAKEDATGCEIWSRDDTSYFVETN  362



>ref|XP_006591790.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101-like [Glycine max]
Length=777

 Score =   182 bits (462),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 132/390 (34%), Positives = 185/390 (47%), Gaps = 61/390 (16%)
 Frame = -2

Query  1388  ESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVWV  1209
               DTL+QG  +     L S   ++ L FF + D   G       YLG+  NK  +  VWV
Sbjct  20    REDTLLQGHQLGSTNRLISPSGLYTLRFFQLDD---GSDANSKFYLGVSANKF-HYYVWV  75

Query  1208  ANRDSPLPDSSGSLIIDADGKLKI-SYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREV  1032
             ANRD+P+ D  G L ID    LKI S    M+  S  +  +  +V ATLLD+GN V+ E+
Sbjct  76    ANRDNPIHDDPGVLTIDEFSNLKILSSTTTMMLYSVEAENTNKSVRATLLDTGNFVLHEL  135

Query  1031  DGNG-SFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDI  855
             + +G S   VLWQSFDYPTD ++PGMKLG +  TGH W +T+  S +   SG+F L LD 
Sbjct  136   NPDGISVKRVLWQSFDYPTDTILPGMKLGYDKNTGHTWSITARRSYRTLWSGSFSLSLDP  195

Query  854   NGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMT---KEFGFKLVSNEKEKYFSYSAKHN  684
                 NQLV   R  + W+SG W+NGSF      +   + F F   SNE   YF Y++   
Sbjct  196   K--TNQLVSRWREAIIWSSGEWRNGSFSNLNSSSLYKENFNFTFFSNESVTYFEYASVSG  253

Query  683   YRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKE  504
             Y    +T++ LG +  S   Y                   S ++ +        P C   
Sbjct  254   Y----FTMEPLGRLNASGAAY-------------------SCVDIEIV------PGCTMP  284

Query  503   NPVSCRKSSDVFV---------QTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNC  351
              P  CR+  D+++           RG+  D+  N            L +SDC   C KNC
Sbjct  285   RPPKCREDDDLYLPNWNSLGAMSRRGFIFDEREN------------LTISDCWMKCLKNC  332

Query  350   SCTAYASSSTDGTGCILYTNAAHDFQLDEN  261
             SC AY  +  D TGC +++     + ++ N
Sbjct  333   SCVAYTYAKEDATGCEIWSRDDTSYFVETN  362



>ref|XP_006451681.1| hypothetical protein CICLE_v10010284mg, partial [Citrus clementina]
 gb|ESR64921.1| hypothetical protein CICLE_v10010284mg, partial [Citrus clementina]
Length=411

 Score =   177 bits (449),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 137/398 (34%), Positives = 197/398 (49%), Gaps = 43/398 (11%)
 Frame = -2

Query  1415  FSSYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDS-YSGPINTEDRYLGIWY  1239
             F   V +   +DT+    +IRD E L S+   F+LGFFS  +S YS       +YLGIWY
Sbjct  4     FFLIVKLSLAADTITPARSIRDGEKLVSSSQTFELGFFSPGNSRYS-------KYLGIWY  56

Query  1238  NKIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYV-GGMITVSNVSIMSGNNVGATLL  1062
              K P   VWVANR+SP+ D S  L + ++G L +  V  G+I  SN+S    N V A L 
Sbjct  57    KKSPETIVWVANRNSPILDPSAVLTVSSNGNLVLLNVTKGIIWSSNISRKVENPV-AQLQ  115

Query  1061  DSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGS  882
             D+GNLV+ +V    +    LWQSFDYP+D L+PGMK+G NLKTG  W LTSW S   P  
Sbjct  116   DTGNLVLVDVIRKNTSESYLWQSFDYPSDTLLPGMKVGWNLKTGVEWYLTSWRSADDPSP  175

Query  881   GAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTK-EFGFKLVSNEKEKYF  705
             G F   LDI+    ++ I      Y+ +G W   +F  AP  T   +  +L  N+ E YF
Sbjct  176   GNFTSRLDIHVL-PEICIYNGSVKYFCTGPWSGVAFVAAPSYTNFLYNQELAHNQDEIYF  234

Query  704   SYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPY-----  540
             SY + ++       L+  G +++  LI++            W   Y++   C  Y     
Sbjct  235   SYESYNSPSIMMLKLNPSGTVQR--LIWNER-------NAAWDVVYSAPNVCGVYGKCGA  285

Query  539   -----IGNYPRPVCLK-------EN---PVSCRKSSDVFVQTRGYF-RDDNRNISDVENS  408
                  +   P   CLK       +N   P  C +S   + ++   F + D     D+   
Sbjct  286   NSICILDKGPNCECLKGFKLKSQDNQTWPGKCERSHSSYCKSGDQFIKLDGIKAPDLLQV  345

Query  407   GNGSRLALSDCHSICWKNCSCTAYASSS-TDGTGCILY  297
                  + L  C + C KNC+C AYA S+ T+G+GC+++
Sbjct  346   SVNDNMNLKQCEAECLKNCTCRAYAYSNLTEGSGCLMW  383



>gb|KDO74352.1| hypothetical protein CISIN_1g038934mg, partial [Citrus sinensis]
Length=751

 Score =   182 bits (461),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 137/416 (33%), Positives = 205/416 (49%), Gaps = 53/416 (13%)
 Frame = -2

Query  1385  SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPV-WV  1209
              DTL  G +IRD E L SA   F+LGFFS       P  ++ RYLGIWY KI N  V WV
Sbjct  5     QDTLRLGQSIRDGETLVSANESFELGFFS-------PGKSKSRYLGIWYKKIANGTVTWV  57

Query  1208  ANRDSPLPDSSGSLIIDADGK---LKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVR  1038
             ANR++PLPD SG L I + G    +  +   G++  SN S  + N V A LL+SGNLVV+
Sbjct  58    ANRNAPLPDRSGVLSISSQGNGTLILQNSTNGIVWSSNASRTAQNPV-AVLLESGNLVVK  116

Query  1037  EVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLD  858
               + N S    LWQSFDYPT VL+PGMKLGVNL TG    ++SW S   P    +   +D
Sbjct  117   SGNDNDS-DNFLWQSFDYPTHVLLPGMKLGVNLVTGLNRFISSWKSADDPAQDDYMYEID  175

Query  857   INGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFSYSAKHN  684
               G   Q ++ +   + +  G W    +   P +     + F+ VSNEKE ++ ++   +
Sbjct  176   PRGV-PQAMLLKGSTIRYRPGSWNGLHWTGMPQLQPNPVYTFEYVSNEKEVFYRFTLIKS  234

Query  683   YRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPM---------YTWIGRYA------STLEC  549
                +   +  LG  ++ + +     +  ++           Y   G YA      ++ EC
Sbjct  235   SVPSMMVVSPLGESQRYTWMEQTQKWAPFLSFSGLIDQCDNYALCGTYAICKMNSNSAEC  294

Query  548   DPYIGNYPRPV-----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGN  402
             +   G  P+             C++   + C +         G+ + ++  + D   S  
Sbjct  295   ECLEGFEPKSPRDWKLLDKTDGCVRRTKLDCERGD-------GFLKRESVKLPDTRFSRV  347

Query  401   GSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDFQ-LDENGE-LYI  246
                ++L +C  +C KNCSCTAYA++     G+GC+L+ +   D + L E G+ LYI
Sbjct  348   DKNISLFECKELCSKNCSCTAYANADVRGGGSGCLLWFHELTDMKILSEGGQDLYI  403



>gb|KCW74886.1| hypothetical protein EUGRSUZ_E03623 [Eucalyptus grandis]
Length=661

 Score =   181 bits (459),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 152/476 (32%), Positives = 232/476 (49%), Gaps = 55/476 (12%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN  1224
             + V    D L     IRD + L SA   F+LGFFS       P N+  R+L IWY+ IP 
Sbjct  19    LEVCKSVDVLSSSETIRDGDTLVSAGEKFQLGFFS-------PGNSSYRFLAIWYHNIPE  71

Query  1223  EP-VWVANRDSPLPDSSGSLIIDADGKLK-ISYVGGMITVSNVSIMSGNNVGATLLDSGN  1050
             +  VWVAN D+P+ DSSG L I ++GKL  +     ++  SN    +  +V A LLDSGN
Sbjct  72    KTTVWVANGDNPVNDSSGVLRIGSEGKLVLVDQAERVLWSSNNMNATSQSVVAKLLDSGN  131

Query  1049  LVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFE  870
             LV+++   N S G  LWQSFD+P++ L+ GMKLG +L+ G    +TSW S + P +G F 
Sbjct  132   LVLKDDSENVS-GNYLWQSFDHPSNTLLVGMKLGWDLRMGLDRHMTSWKSAEDPSTGDFT  190

Query  869   LGLDINGCNNQLVISRRGKV-YWTSGVWKNGSFEKAPDMTKEFGF--KLVSNEKEKYFSY  699
              G+D+ G   QLVI R+G+V Y+ SG W    F + P M     F  K V+N +E YF++
Sbjct  191   FGVDLGGIIPQLVI-RKGRVKYFRSGPWNGIQFGRMP-MVPNLIFIPKFVNNSQEVYFTF  248

Query  698   SAKHNYRFTKWTLDLLGHIEQSSLIYDPS--FFIHYMPMYTWIGRY-----------AST  558
             +  +    T+  L+  G+  Q  L  + +  + + YM  Y     Y           +++
Sbjct  249   NHFNESTITRLVLNASGN-HQRYLWSEKTQEWTMIYMLPYDACDVYGKCGSNSMCTISNS  307

Query  557   LECDPYIGNYPRPV-----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVEN  411
               C   IG  P+             C+ +NP +C K         G+ R     + D+  
Sbjct  308   PICSCMIGYQPKSQAEWDTLVWSSGCVSKNPFNCSKG-------EGFKRLKGVKMPDLLQ  360

Query  410   SGNGSRLALSDCHSICWKNCSCTAYAS--SSTDGTGCILYTNAAHDFQL---DENGELYI  246
                 + ++L +C   C+KNCSC AYA+  ++  G+GC+L+     D ++     N +LYI
Sbjct  361   FTMNTSMSLKECELECFKNCSCRAYANIDATGGGSGCLLWFGDLLDVRILSRSANQDLYI  420

Query  245   YRLLKEHKG*ILVNVRYCCFTVIQVFCVFVNVPFVLEGCSLCNHVYYHYEIKMDIQ  78
                  +      VN +   +  + +   FV +  VL  C +     +   I  D+Q
Sbjct  421   RVSASDLDS---VNSKGKEWVAVAISMAFVVLSVVLYFCIVWKRKKHAQGITFDLQ  473



>emb|CAN61538.1| hypothetical protein VITISV_030742 [Vitis vinifera]
Length=819

 Score =   182 bits (461),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 143/419 (34%), Positives = 207/419 (49%), Gaps = 49/419 (12%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN  1224
             +S+G ++ T+ Q   I D E +TSA   F+LGFFS       P N++ RYLGI Y K  N
Sbjct  20    ISIGVDTITVNQL--ITDAETITSAGGSFELGFFS-------PANSKHRYLGIRYKKELN  70

Query  1223  EPV-WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNL  1047
               V WVANR++PL DSSG L + + G L +         S+ S     N  A LLDSGNL
Sbjct  71    RAVVWVANRENPLNDSSGVLKVTSQGILVVLDGANKTLWSSTSSRPAQNPNAQLLDSGNL  130

Query  1046  VVREVDGN-GSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFE  870
             V++  +GN G+    LWQSFDYP + L+PGMKLG N  TG    L+SW S   P  G F 
Sbjct  131   VMK--NGNDGNPENFLWQSFDYPCNTLLPGMKLGWNRVTGLDRYLSSWKSADDPSIGTFT  188

Query  869   LGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFSYS  696
              G+D +G + Q+ +     V + SG W    F   P  T    + +  V NEKE YF Y 
Sbjct  189   YGIDPSG-SPQIFVRNVSVVTFRSGPWNGIRFSGYPHFTPNPVYTYDFVLNEKEIYFIYY  247

Query  695   AKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPM-------YTWIG-----RYASTLE  552
               ++   T+  L   G+ ++ + I +   ++ Y  +       Y   G     +   + +
Sbjct  248   LVNSSLLTRLVLTPDGYAQRFTWIDEKGQWVKYSSVQNDDCDNYALCGANGICKIDQSPK  307

Query  551   CDPYIGNYPR-----------PVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSG  405
             C+   G  PR             C++  P+ C+K  D FV+  G        + D   S 
Sbjct  308   CECMKGFRPRFQSNWDMADWSDGCVRSTPLDCQK-GDRFVKFSGV------KLPDTRTSW  360

Query  404   NGSRLALSDCHSICWKNCSCTAYASS--STDGTGCILYTNAAHDF-QLDENGELYIYRL  237
                 + L +C S+C +NCSCTAY +S  S +G+GC+L+     D  +  ENG+ +  R+
Sbjct  361   FNESMNLKECASLCLRNCSCTAYVNSNISGEGSGCLLWFGNLTDIREFAENGQEFYVRM  419



>ref|XP_004308260.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101-like [Fragaria vesca subsp. vesca]
Length=356

 Score =   176 bits (445),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 118/324 (36%), Positives = 164/324 (51%), Gaps = 39/324 (12%)
 Frame = -2

Query  1256  YLGIWYNKIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYVGG--MITVSNVSIMSGN  1083
             YL I Y +  N   W+ANR+  +   SG L ++ +  L I+      ++  S  S     
Sbjct  14    YLAIKYKESHNY-AWIANREDLVEYPSGVLTLETNNTLHITRGDDDPVLLYSPDSETING  72

Query  1082  NVGATLLDSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWL  903
             +V A L D GN VV+EV    S   VLWQSFDYP DVL+PGMKLGVN   G  W L+SWL
Sbjct  73    DVVAVLNDDGNFVVQEV----SSKRVLWQSFDYPGDVLLPGMKLGVNRGKGQDWSLSSWL  128

Query  902   SDKVPGSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEFGFKLVSN  723
             S+K    G F LG D     +QL+I RRG VYWTSGV ++G FE      K++ +K VSN
Sbjct  129   SEKAAVPGPFTLGWD----GSQLIIKRRGMVYWTSGVLRDGKFENIKQ--KKYSYKTVSN  182

Query  722   EKEKYFSYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDP  543
             E E  F+Y A       +W L  +G ++ S                          + D 
Sbjct  183   ENEFSFTYLAADQKATPQWLLTTMGRLQDSDR--------------------GDIAKADS  222

Query  542   YIGNYPRPVCLK-ENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSI  366
             + G   +  C   + P  C ++ DVF Q  GYF +D  + +D  N+     L+LSDC + 
Sbjct  223   FYGYNNKEGCRTWDQPTDCNRTGDVFQQYNGYF-NDGGSRTDYPNAS----LSLSDCKAN  277

Query  365   CWKNCSCTAYASSSTDGTGCILYT  294
             CW +C C  ++   T+ TGC +++
Sbjct  278   CWADCQCKGFSFFYTNQTGCKIWS  301



>ref|XP_010644290.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Vitis vinifera]
Length=819

 Score =   182 bits (461),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 143/419 (34%), Positives = 207/419 (49%), Gaps = 49/419 (12%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN  1224
             +S+G ++ T+ Q   I D E +TSA   F+LGFFS       P N++ RYLGI Y K  N
Sbjct  20    ISIGVDTITVNQL--ITDAETITSAGGSFELGFFS-------PANSKHRYLGIRYKKELN  70

Query  1223  EPV-WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNL  1047
               V WVANR++PL DSSG L + + G L +         S+ S     N  A LLDSGNL
Sbjct  71    RAVVWVANRENPLNDSSGVLKVTSQGILVVLDGANKTLWSSTSSRPAQNPNAQLLDSGNL  130

Query  1046  VVREVDGN-GSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFE  870
             V++  +GN G+    LWQSFDYP + L+PGMKLG N  TG    L+SW S   P  G F 
Sbjct  131   VMK--NGNDGNPENFLWQSFDYPCNTLLPGMKLGWNRVTGLDRYLSSWKSADDPSIGTFT  188

Query  869   LGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFSYS  696
              G+D +G + Q+ +     V + SG W    F   P  T    + +  V NEKE YF Y 
Sbjct  189   YGIDPSG-SPQIFVRNVSVVTFRSGPWNGIRFSGYPHFTPNPVYTYDFVLNEKEIYFIYY  247

Query  695   AKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPM-------YTWIG-----RYASTLE  552
               ++   T+  L   G+ ++ + I +   ++ Y  +       Y   G     +   + +
Sbjct  248   LVNSSLLTRLVLTPDGYAQRFTWIDEKGQWVKYSSVQNDDCDNYALCGANGICKIDQSPK  307

Query  551   CDPYIGNYPR-----------PVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSG  405
             C+   G  PR             C++  P+ C+K  D FV+  G        + D   S 
Sbjct  308   CECMKGFRPRFQSNWDMADWSDGCVRSTPLDCQK-GDRFVKFSGV------KLPDTRTSW  360

Query  404   NGSRLALSDCHSICWKNCSCTAYASS--STDGTGCILYTNAAHDF-QLDENGELYIYRL  237
                 + L +C S+C +NCSCTAY +S  S +G+GC+L+     D  +  ENG+ +  R+
Sbjct  361   FNESMNLKECASLCLRNCSCTAYVNSNISGEGSGCLLWFGNLTDIREFAENGQEFYVRM  419



>ref|NP_001053997.2| Os04g0633900 [Oryza sativa Japonica Group]
 dbj|BAF15911.2| Os04g0633900 [Oryza sativa Japonica Group]
Length=767

 Score =   181 bits (460),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 141/430 (33%), Positives = 208/430 (48%), Gaps = 37/430 (9%)
 Frame = -2

Query  1412  SSYVSVGAE-SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYN  1236
             S   + GAE  DTL +G NI D E L SA   F LGFFS + S S   +T  RYLGIW++
Sbjct  18    SGRTTTGAELGDTLGKGRNITDGERLVSAGGSFTLGFFSPASSSS--SSTSRRYLGIWFS  75

Query  1235  KIPNEPVWVANRDSPLPDSSGSLII-DADGKLKISYVGGMITVSNVSIMSGNNVGATLLD  1059
                +   WVANRD PL D+SG L+I DA   L +   G ++  SN +   G ++ A LL+
Sbjct  76    VSDDVVCWVANRDRPLTDTSGVLVITDAGSLLLLDGSGHVVWSSNTTTGGGASMAAQLLE  135

Query  1058  SGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSG  879
             SGNLVV +    G+   V+WQSFD+P D L+PGMK+G NL TG  W L+SW S   P  G
Sbjct  136   SGNLVVSDRGNGGAGAVVVWQSFDHPCDTLLPGMKIGKNLWTGAEWYLSSWRSSGDPSPG  195

Query  878   AFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDM---TKEFGFKLVSNEKEKY  708
              +    D  G    ++    G+VY T G W    F   P+M   +  F ++L  +  E  
Sbjct  196   NYRYRTDTKGVPENVLWDGDGEVYRT-GPWNGLWFSGIPEMGTYSDMFSYQLTVSPGEIT  254

Query  707   FSYSAKHNYRFTKWTLDLLGHIEQSSLIYDPS------FFIHYMPMYTWIGRYASTLECD  546
             F YSA     F++  +  +G +++  L+++PS      FF     +    G+  +   CD
Sbjct  255   FGYSANAGAPFSRLVVTGVGEVQR--LVWEPSSRAWKNFFQGPRDLCDDYGKCGAFGLCD  312

Query  545   P-------------YIGNYPRP-VCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENS  408
                           +    P P   +++    CR+ + +   T G+       + D  N+
Sbjct  313   AGAASTSFCSCVEGFTPASPSPWKKMRDTSAGCRRDAALGCATDGFLTVRGVKLPDAHNA  372

Query  407   GNGSRLALSDCHSICWKNCSCTAYASS-------STDGTGCILYTNAAHDFQLDENGELY  249
                 R+ + +C + C  NCSC AYA +          G+GCI++ +   D +  + G+  
Sbjct  373   TVDKRVTVEECWARCLANCSCVAYAPADIGGGGGCGAGSGCIIWADDLVDLRYVDGGQDL  432

Query  248   IYRLLKEHKG  219
               RL K   G
Sbjct  433   YVRLAKSELG  442



>ref|XP_010647533.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Vitis vinifera]
Length=824

 Score =   182 bits (461),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 144/418 (34%), Positives = 202/418 (48%), Gaps = 50/418 (12%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN  1224
             + V    DT+     IRD E +TS    F+LGFFS       P+++ +RY+GIWY K+  
Sbjct  17    LRVSNAGDTITVDLVIRDGETITSVGGSFELGFFS-------PVDSNNRYVGIWYKKVST  69

Query  1223  EPV-WVANRDSPLPDSSGSLIIDADGKLKI-SYVGGMITVSNVSIMSGNNVGATLLDSGN  1050
               V WVANR+ PL DSSG L +   G L + +   G+I  SN S     N  A LL+SGN
Sbjct  70    RTVVWVANREFPLTDSSGVLKVTDQGTLVVLNGTNGIIWSSNSS-QPAINPNAQLLESGN  128

Query  1049  LVVREVDGNGS-FGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAF  873
             LVV+  +GN S     LWQSFDYP D ++PGMK G N  TG    L+SW S   P  G F
Sbjct  129   LVVK--NGNDSDPEKFLWQSFDYPCDTVLPGMKFGRNTVTGLDRYLSSWKSTDDPSKGNF  186

Query  872   ELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFSY  699
                LD +G   QL++     V + SG W    F   P++     + +  V NEKE Y++Y
Sbjct  187   TYRLDPSGF-PQLILRSGSAVTFCSGPWNGLRFSGCPEIRSNPVYKYSFVLNEKEIYYTY  245

Query  698   SAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPM-------YTWIGRYAS-----TL  555
                +N   T+  L   G++++ + I     +I Y          Y   G Y S     + 
Sbjct  246   DLLNNSVITRLVLSPNGYVQRFTWIDRTRGWILYSSAHKDDCDSYALCGAYGSCNINHSP  305

Query  554   ECDPYIGNYPRPV-----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENS  408
             +C    G  P+             C++  P+ C K         G+ +     + D + S
Sbjct  306   KCTCMKGFVPKFPNEWNMVDWSNGCVRSTPLDCHKG-------EGFVKYSGVKLPDTQYS  358

Query  407   GNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDF-QLDENG-ELYI  246
                  ++L +C SIC  NCSCTAYA+S     G+GC+L+     D  +  ENG ELY+
Sbjct  359   WFNENMSLKECASICLGNCSCTAYANSDIRNGGSGCLLWFGDLIDIREFAENGQELYV  416



>gb|KHG07104.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
SD1-1 [Gossypium arboreum]
Length=814

 Score =   182 bits (461),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 136/419 (32%), Positives = 202/419 (48%), Gaps = 54/419 (13%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN  1224
             ++  A +D +  G +IRD E L S+   F+LGFFS       P+N+  RYLGIWY   P 
Sbjct  23    LAASAATDNITPGRSIRDGEALVSSDETFELGFFS------SPVNSTTRYLGIWYKVSPE  76

Query  1223  EPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLV  1044
               VW+ANR++PL D  G L +  +G + +      I  S+    +  N    LLDSGNLV
Sbjct  77    TVVWIANREAPLLDHFGVLNVTKEGSIILQDKKTGIIWSSNRTRTAENPVLQLLDSGNLV  136

Query  1043  VREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELG  864
             V++ + +GS   +LWQSFDYP D L+PGMKLG +  TG  W L+SW     P  G F   
Sbjct  137   VKDGNDSGS-ANLLWQSFDYPCDTLLPGMKLGKSFITGMNWSLSSWKGLNDPAPGRFSAL  195

Query  863   LDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTK-------EFGFKLVSNE----K  717
             ++  G   QLV+     +++  G W    F   PD+ +       +F F+L  NE     
Sbjct  196   IEPEGF-PQLVVRNGSAIFYRGGSWNGERFTGTPDLKQVESSNLFKFTFELNKNEVYYRG  254

Query  716   EKYFSYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPM-----YTWIGRYA--ST  558
             E Y S  ++     + +   L+   +  S I      I++ P+     Y   G YA  ST
Sbjct  255   EPYPSLISRLVVNQSGFLRRLVRTKQSQSWIE-----IYFAPLDECDHYAVCGPYASCST  309

Query  557   LECDPYIGNYPR-PV----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVEN  411
               C    G  P+ P           C+++  ++C+ S  VF +  G        + D  N
Sbjct  310   NNCACLDGFEPKYPTEWDHSKWSGGCVRKTELACQNS--VFTKYNGL------KLPDTSN  361

Query  410   SGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDFQLDENG--ELYI  246
             S   + ++L +C   C KNCSC AYA+S     G GC+L+     D ++  +G  +LY+
Sbjct  362   SSFDASMSLKECQEKCSKNCSCIAYANSDIRNGGNGCLLWFGDLIDMRIYPDGGQDLYV  420



>ref|XP_004166621.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101-like, partial [Cucumis sativus]
Length=727

 Score =   181 bits (459),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 135/401 (34%), Positives = 194/401 (48%), Gaps = 45/401 (11%)
 Frame = -2

Query  1376  LMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVWVANRD  1197
             + QG  I     L S  A F LGF+S       P    + Y+ IWY+     PVW+ANR+
Sbjct  1     MAQGQEITPGSTLISTMANFSLGFYS-------PSLLNNSYIAIWYHSDSQNPVWIANRN  53

Query  1196  SPLPDSSGS--LIIDADGKLKISYVGGM----ITVSNVSIMSGNNVGATLLDSGNLVVRE  1035
                P   G+  L ID++G LKI    G            +    N  A LLD+GN V+  
Sbjct  54    FAFPRDFGTPCLTIDSNGSLKIVPKEGKGRNGYNFYLFEVEEPTNSSAILLDNGNFVLCV  113

Query  1034  VDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDI  855
             ++ +GS    LWQSFD+PTD L+PGMKLG+N KTG +W +TS   D    SG+F L ++ 
Sbjct  114   LNLDGSIKRQLWQSFDHPTDTLLPGMKLGINHKTGSIWSITSRRGDYSVLSGSFTLTVNP  173

Query  854   NGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMT----KEFGFKLVSNEKEKYFSYSAKH  687
             N   NQL+I  RG V+WTSG WK+G FE + +++    +EF F   SNE E +F+YS  +
Sbjct  174   NN-TNQLLILHRGSVFWTSGNWKDGRFEFSEELSNINNQEFVFSRFSNENETFFNYSISN  232

Query  686   NYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGR-YASTLECDPYIGN---YPRP  519
              ++       L+          +   F+        +GR + S +EC PY  N    P+ 
Sbjct  233   LFQLPNHNKGLI----------EVQTFLRLGNDGKLVGRNWDSKVEC-PYFENELFEPKH  281

Query  518   VC-------LKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICW  360
             V        ++     CR     +  T   F +  RN      S N   L + DC   C 
Sbjct  282   VSEVGCVGKMQHKVPECRNPPKQY-STSQRFGNMERNGLRFRESEN---LTIYDCEKNCI  337

Query  359   KNCSCTAYASSSTDGTGCILYTNAAHDFQLDENGELYIYRL  237
              +C C A++S++ +GTGC ++ N    F   E G+  I+ L
Sbjct  338   SSCDCIAFSSTNEEGTGCEMW-NVGATFIPVEGGKRIIWSL  377



>ref|XP_006452077.1| hypothetical protein CICLE_v10007816mg [Citrus clementina]
 gb|ESR65317.1| hypothetical protein CICLE_v10007816mg [Citrus clementina]
Length=589

 Score =   180 bits (456),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 131/415 (32%), Positives = 200/415 (48%), Gaps = 52/415 (13%)
 Frame = -2

Query  1409  SYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI  1230
             S +   +  DT+  G +IRD E L SA   F+LGFFS       P  ++ RYLGIWY KI
Sbjct  19    SNIRTASTRDTIGLGQSIRDGETLVSANESFELGFFS-------PGKSKSRYLGIWYKKI  71

Query  1229  PNEPV-WVANRDSPLPDSSGSLIIDADGK---LKISYVGGMITVSNVSIMSGNNVGATLL  1062
              N  V WVANRD+PLPD SG L I + G    + ++   G++   N +  + N V A LL
Sbjct  72    ANGTVTWVANRDAPLPDRSGVLSISSQGNGTLILLNSTNGIVWSFNAARTAQNPV-ALLL  130

Query  1061  DSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGS  882
             +SGNLVV+  + N S    LWQSFDYPT VL+PGMKLGVNL TG    ++SW S   P  
Sbjct  131   ESGNLVVKSGNDNDS-DNFLWQSFDYPTHVLLPGMKLGVNLVTGLKRFMSSWKSADDPAQ  189

Query  881   GAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKY  708
               +   +D  G   Q V  +  K+ + +G W    +   P +     + F+ VSNE E +
Sbjct  190   DNYIYEVDPRGV-PQAVFRKGSKIKFRAGPWNGLHWTGTPQLQPNPVYTFEYVSNENEVF  248

Query  707   FSYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPM----------YTWIGRYA--  564
             + ++   +   T   ++  G  ++ + +     +  +MP           Y   G YA  
Sbjct  249   YRFNLIKSSVLTMMVINPQGEPQRLTWMEQTQKWAPFMPFSGLILDQCDNYALCGAYAIC  308

Query  563   ----STLECDPYIGNYPRPV-----------CLKENPVSCRKSSDVFVQTRGYFRDDNRN  429
                 ++  C+   G  P+             C++   + C           G+ + ++  
Sbjct  309   NMNSNSARCECLEGFVPKSPSEWDLLDTSDGCIRRTQLDCEHGD-------GFLKRESVK  361

Query  428   ISDVENSGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDFQL  270
             + D   S     +++  C  +C KNCSCTAYA++     G+GC+L+ +   D ++
Sbjct  362   LPDTSFSRVDKNISILACKELCSKNCSCTAYANADVRGGGSGCLLWFHDLIDMKV  416



>ref|XP_010064867.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Eucalyptus grandis]
Length=849

 Score =   182 bits (461),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 145/416 (35%), Positives = 199/416 (48%), Gaps = 49/416 (12%)
 Frame = -2

Query  1382  DTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEP-VWVA  1206
             DT+    +IRD E+L SA   F+LGFFS  D          RYLGIWY KI     VWVA
Sbjct  118   DTITTDQSIRDGENLLSAGGTFELGFFSAGDP-------PKRYLGIWYKKITTRTIVWVA  170

Query  1205  NRDSPLPDSSGSLIIDADGKLKI-SYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREVD  1029
             NR +PL D+SG+L +   G L +    G  I +SN  I   N V A LLDSGNLVVR+ +
Sbjct  171   NRVAPLADASGTLRVTTHGSLVLLDGNGSDIWLSNAPIPVRNPV-AQLLDSGNLVVRDAE  229

Query  1028  GNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDING  849
             G+      LWQSFDYPTD LV GMKLG N ++G    LTSW S   P  G F   LD NG
Sbjct  230   GSDP-KNFLWQSFDYPTDTLVAGMKLGRNRRSGFNRHLTSWKSIDDPSPGNFTFQLDPNG  288

Query  848   CNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFSYSAKHNYRF  675
                +L + +   + + +G W    +   P +     +G++ V NE+E YF Y   +    
Sbjct  289   YPQEL-LKQGSDIKFRTGPWNGLRWSGTPFLNPNPYYGYEFVLNEEEMYFRYELLNRSVT  347

Query  674   TKWTLDLLGHIEQSSLIYDPSFFIHYMPM-------YTWIGRYAS-----TLECDPYIGN  531
             ++  L   G +++ + I     ++ YM         Y   G Y S     +  C    G 
Sbjct  348   SRLILTTNGILQRFAWIDRTQGWMLYMASPTDQCDNYASCGAYGSCRVDTSPVCRCLKGF  407

Query  530   YPRPV-----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLAL  384
              PR             C++ NP+ C K  D+FV+           + D  +S     + L
Sbjct  408   VPRFSQEWDMLEWSNGCVRRNPLDCEK--DIFVKYSWL------KLPDTRSSWFNESMNL  459

Query  383   SDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDFQLDEN--GELYIYRLLKE  228
              +C  +C KNCSC AY+S      G+GC+L+     D +   N   +LYI   + E
Sbjct  460   RECKVVCMKNCSCIAYSSLDIRNGGSGCLLWFGELIDIRGYSNYGQDLYIRMAVSE  515



>ref|XP_007163418.1| hypothetical protein PHAVU_001G233100g [Phaseolus vulgaris]
 gb|ESW35412.1| hypothetical protein PHAVU_001G233100g [Phaseolus vulgaris]
Length=745

 Score =   181 bits (459),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 126/374 (34%), Positives = 182/374 (49%), Gaps = 41/374 (11%)
 Frame = -2

Query  1388  ESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVWV  1209
               +TL+QG  +     L S   ++ L FF +     G       YLGI  N I +  VW+
Sbjct  29    RENTLVQGHPLAATNRLISPSGLYTLHFFQLD---GGSEANTKFYLGISDNNI-SYYVWL  84

Query  1208  ANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREVD  1029
             ANRD+P+ D  G L ID  G LKI      + + +V   S  +V A+LLD+GN V+ E++
Sbjct  85    ANRDNPIHDDPGVLTIDEYGNLKIVSSSTTMILYSVEAESNKSVRASLLDTGNFVLHELN  144

Query  1028  GNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDING  849
              +GS   VLWQSFDYPTD ++  MK+G +  +GH W LT+  S +   SG+F L LD   
Sbjct  145   SDGSVKRVLWQSFDYPTDTILSRMKIGYDKHSGHRWSLTARRSYRTLWSGSFSLSLDPK-  203

Query  848   CNNQLVISRRGKVYWTSGVWKNGSF--EKAPDMTKE-FGFKLVSNEKEKYFSYSAKHNYR  678
               NQL+   RG + W+SG W+NGSF    +  + +E F F   SNE   Y+ Y++   + 
Sbjct  204   -TNQLITRWRGAIIWSSGEWRNGSFCNLNSSSLERENFNFTFFSNESLTYYEYASVSGFL  262

Query  677   FTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPYIGNYPRPVCLKENP  498
                  +  LG I  S + Y  +                         G+     C    P
Sbjct  263   I----MGPLGIINASGVPYSCT-------------------------GSEIVHGCAMPQP  293

Query  497   VSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSSTD  318
               CRK SD+++ +   F + +R     + + N   L +SDC   C KNCSC AY  +  D
Sbjct  294   PKCRKDSDLYLPSWNSFGEMSRKGYIFDETEN---LTISDCWMRCLKNCSCEAYTYAFKD  350

Query  317   GTGCILYTNAAHDF  276
              TGC +++    DF
Sbjct  351   ATGCEIWSRDTSDF  364



>gb|KCW74884.1| hypothetical protein EUGRSUZ_E03623 [Eucalyptus grandis]
Length=813

 Score =   181 bits (460),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 152/476 (32%), Positives = 232/476 (49%), Gaps = 55/476 (12%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN  1224
             + V    D L     IRD + L SA   F+LGFFS       P N+  R+L IWY+ IP 
Sbjct  19    LEVCKSVDVLSSSETIRDGDTLVSAGEKFQLGFFS-------PGNSSYRFLAIWYHNIPE  71

Query  1223  EP-VWVANRDSPLPDSSGSLIIDADGKLK-ISYVGGMITVSNVSIMSGNNVGATLLDSGN  1050
             +  VWVAN D+P+ DSSG L I ++GKL  +     ++  SN    +  +V A LLDSGN
Sbjct  72    KTTVWVANGDNPVNDSSGVLRIGSEGKLVLVDQAERVLWSSNNMNATSQSVVAKLLDSGN  131

Query  1049  LVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFE  870
             LV+++   N S G  LWQSFD+P++ L+ GMKLG +L+ G    +TSW S + P +G F 
Sbjct  132   LVLKDDSENVS-GNYLWQSFDHPSNTLLVGMKLGWDLRMGLDRHMTSWKSAEDPSTGDFT  190

Query  869   LGLDINGCNNQLVISRRGKV-YWTSGVWKNGSFEKAPDMTKEFGF--KLVSNEKEKYFSY  699
              G+D+ G   QLVI R+G+V Y+ SG W    F + P M     F  K V+N +E YF++
Sbjct  191   FGVDLGGIIPQLVI-RKGRVKYFRSGPWNGIQFGRMP-MVPNLIFIPKFVNNSQEVYFTF  248

Query  698   SAKHNYRFTKWTLDLLGHIEQSSLIYDPS--FFIHYMPMYTWIGRY-----------AST  558
             +  +    T+  L+  G+  Q  L  + +  + + YM  Y     Y           +++
Sbjct  249   NHFNESTITRLVLNASGN-HQRYLWSEKTQEWTMIYMLPYDACDVYGKCGSNSMCTISNS  307

Query  557   LECDPYIGNYPRPV-----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVEN  411
               C   IG  P+             C+ +NP +C K         G+ R     + D+  
Sbjct  308   PICSCMIGYQPKSQAEWDTLVWSSGCVSKNPFNCSKG-------EGFKRLKGVKMPDLLQ  360

Query  410   SGNGSRLALSDCHSICWKNCSCTAYAS--SSTDGTGCILYTNAAHDFQL---DENGELYI  246
                 + ++L +C   C+KNCSC AYA+  ++  G+GC+L+     D ++     N +LYI
Sbjct  361   FTMNTSMSLKECELECFKNCSCRAYANIDATGGGSGCLLWFGDLLDVRILSRSANQDLYI  420

Query  245   YRLLKEHKG*ILVNVRYCCFTVIQVFCVFVNVPFVLEGCSLCNHVYYHYEIKMDIQ  78
                  +      VN +   +  + +   FV +  VL  C +     +   I  D+Q
Sbjct  421   RVSASDLDS---VNSKGKEWVAVAISMAFVVLSVVLYFCIVWKRKKHAQGITFDLQ  473



>ref|XP_007021202.1| S-locus lectin protein kinase family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY12727.1| S-locus lectin protein kinase family protein, putative isoform 
1 [Theobroma cacao]
Length=825

 Score =   181 bits (460),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 145/483 (30%), Positives = 216/483 (45%), Gaps = 73/483 (15%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN  1224
             +   A +D +    +IRD E L S    F+LGFFS       P N+  RYLGIWY   P 
Sbjct  23    LGASAAADNITPNQSIRDNETLVSGDGSFELGFFS-------PGNSTKRYLGIWYKVSPE  75

Query  1223  EPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLV  1044
               VWVANR++PL +  G L +   G + I      I  S+  I +  N    LLDSGNLV
Sbjct  76    TVVWVANREAPLANHFGVLNVTNQGTIIILDKKPSIIWSSSGIRTAENPVVQLLDSGNLV  135

Query  1043  VREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELG  864
             V++ + +GS    LWQSFDYP D L+P MKLG N  TG  W LTSW S   P  G F   
Sbjct  136   VKDGNDSGS-ENFLWQSFDYPCDTLLPAMKLGKNFVTGRNWSLTSWKSPNDPARGQFSAL  194

Query  863   LDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE-----FGFKLVSNEKEKYFSY  699
             +D  G   QLV+     + +  G W    F   PD+ +      F F+   N+ E Y+  
Sbjct  195   IDPQGF-PQLVVRNGSVILYRGGSWNGKRFTGTPDLEQVESSNLFKFEFELNKNEVYYK-  252

Query  698   SAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTL-ECDPY------  540
                ++   ++  ++  G +E+         F+       W G Y++   ECD Y      
Sbjct  253   GEPYSSLLSRLVVNQSGFLER---------FVRTKQSNLWAGIYSAPRDECDYYAVCGVY  303

Query  539   ----IGNYPRPVCL---------------------KENPVSCRKSSDVFVQTRGYFRDDN  435
                  GN P   CL                     +  P  CR  S VF +  G      
Sbjct  304   AICITGNSPLCACLDDFEPKSPMDWNNSKWSGGCVRRTPFDCR--SSVFTKRPGL-----  356

Query  434   RNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDFQLDEN  261
               + D  +S   + ++L++C   C +NCSC  YA+S     G+GC+L+ +  +D ++  +
Sbjct  357   -KLPDTSHSFFNTSMSLAECQEECLRNCSCMGYANSDIRQGGSGCLLWFDDLNDMRVFTS  415

Query  260   G--ELYIYRLLKEHKG*ILVNVRYCCFTVIQVFCVFVNVPFVLEGCSLCNHVYYHYEIKM  87
             G  +LYI R+     G ++++        + V    + +P +L G  L   +++    K+
Sbjct  416   GGQDLYI-RMANSTSGPLVLSKNSSEKKKVAV----IVIPVILVGVILGGLIFWMMWKKL  470

Query  86    DIQ  78
               Q
Sbjct  471   RKQ  473



>ref|XP_004136078.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101-like, partial [Cucumis sativus]
Length=743

 Score =   181 bits (458),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 135/401 (34%), Positives = 194/401 (48%), Gaps = 45/401 (11%)
 Frame = -2

Query  1376  LMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPVWVANRD  1197
             + QG  I     L S  A F LGF+S       P    + Y+ IWY+     PVW+ANR+
Sbjct  1     MAQGQEITPGSTLISTMANFSLGFYS-------PSLLNNSYIAIWYHSDSQNPVWIANRN  53

Query  1196  SPLPDSSGS--LIIDADGKLKISYVGGM----ITVSNVSIMSGNNVGATLLDSGNLVVRE  1035
                P   G+  L ID++G LKI    G            +    N  A LLD+GN V+  
Sbjct  54    FAFPRDFGTPCLTIDSNGSLKIVPKEGKGRNGYNFYLFEVEEPTNSSAILLDNGNFVLCV  113

Query  1034  VDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDI  855
             ++ +GS    LWQSFD+PTD L+PGMKLG+N KTG +W +TS   D    SG+F L ++ 
Sbjct  114   LNLDGSIKRQLWQSFDHPTDTLLPGMKLGINHKTGSIWSITSRRGDYSVLSGSFTLTVNP  173

Query  854   NGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMT----KEFGFKLVSNEKEKYFSYSAKH  687
             N   NQL+I  RG V+WTSG WK+G FE + +++    +EF F   SNE E +F+YS  +
Sbjct  174   NN-TNQLLILHRGSVFWTSGNWKDGRFEFSEELSNINNQEFVFSRFSNENETFFNYSISN  232

Query  686   NYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGR-YASTLECDPYIGN---YPRP  519
              ++       L+          +   F+        +GR + S +EC PY  N    P+ 
Sbjct  233   LFQLPNHNKGLI----------EVQTFLRLGNDGKLVGRNWDSKVEC-PYFENELFEPKH  281

Query  518   VC-------LKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDCHSICW  360
             V        ++     CR     +  T   F +  RN      S N   L + DC   C 
Sbjct  282   VSEVGCVGKMQHKVPECRNPPKQY-STSQRFGNMERNGLRFRESEN---LTIYDCEKNCI  337

Query  359   KNCSCTAYASSSTDGTGCILYTNAAHDFQLDENGELYIYRL  237
              +C C A++S++ +GTGC ++ N    F   E G+  I+ L
Sbjct  338   SSCDCIAFSSTNEEGTGCEMW-NVGATFIPVEGGKRIIWSL  377



>emb|CAE02990.2| OSJNBa0043L09.9 [Oryza sativa Japonica Group]
Length=834

 Score =   181 bits (460),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 141/430 (33%), Positives = 208/430 (48%), Gaps = 37/430 (9%)
 Frame = -2

Query  1412  SSYVSVGAE-SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYN  1236
             S   + GAE  DTL +G NI D E L SA   F LGFFS + S S   +T  RYLGIW++
Sbjct  18    SGRTTTGAELGDTLGKGRNITDGERLVSAGGSFTLGFFSPASSSS--SSTSRRYLGIWFS  75

Query  1235  KIPNEPVWVANRDSPLPDSSGSLII-DADGKLKISYVGGMITVSNVSIMSGNNVGATLLD  1059
                +   WVANRD PL D+SG L+I DA   L +   G ++  SN +   G ++ A LL+
Sbjct  76    VSDDVVCWVANRDRPLTDTSGVLVITDAGSLLLLDGSGHVVWSSNTTTGGGASMAAQLLE  135

Query  1058  SGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSG  879
             SGNLVV +    G+   V+WQSFD+P D L+PGMK+G NL TG  W L+SW S   P  G
Sbjct  136   SGNLVVSDRGNGGAGAVVVWQSFDHPCDTLLPGMKIGKNLWTGAEWYLSSWRSSGDPSPG  195

Query  878   AFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDM---TKEFGFKLVSNEKEKY  708
              +    D  G    ++    G+VY T G W    F   P+M   +  F ++L  +  E  
Sbjct  196   NYRYRTDTKGVPENVLWDGDGEVYRT-GPWNGLWFSGIPEMGTYSDMFSYQLTVSPGEIT  254

Query  707   FSYSAKHNYRFTKWTLDLLGHIEQSSLIYDPS------FFIHYMPMYTWIGRYASTLECD  546
             F YSA     F++  +  +G +++  L+++PS      FF     +    G+  +   CD
Sbjct  255   FGYSANAGAPFSRLVVTGVGEVQR--LVWEPSSRAWKNFFQGPRDLCDDYGKCGAFGLCD  312

Query  545   P-------------YIGNYPRP-VCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENS  408
                           +    P P   +++    CR+ + +   T G+       + D  N+
Sbjct  313   AGAASTSFCSCVEGFTPASPSPWKKMRDTSAGCRRDAALGCATDGFLTVRGVKLPDAHNA  372

Query  407   GNGSRLALSDCHSICWKNCSCTAYASS-------STDGTGCILYTNAAHDFQLDENGELY  249
                 R+ + +C + C  NCSC AYA +          G+GCI++ +   D +  + G+  
Sbjct  373   TVDKRVTVEECWARCLANCSCVAYAPADIGGGGGCGAGSGCIIWADDLVDLRYVDGGQDL  432

Query  248   IYRLLKEHKG  219
               RL K   G
Sbjct  433   YVRLAKSELG  442



>ref|XP_010062922.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Eucalyptus grandis]
Length=782

 Score =   181 bits (458),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 152/464 (33%), Positives = 218/464 (47%), Gaps = 50/464 (11%)
 Frame = -2

Query  1412  SSYVSVGAES-DTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYN  1236
             S YV+  +E+ D++    +I+D   L SA   F+LGFFS             RYLGIWY 
Sbjct  17    SPYVAQVSEALDSITANQSIQDGGSLVSAGGTFELGFFSTG-------LPSRRYLGIWYK  69

Query  1235  KIPNEPV-WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLD  1059
             K+    V WVANR +PL DS G+L +   G L +    G    S+ S     N  A LLD
Sbjct  70    KVATMTVVWVANRVTPLADSVGTLKVTGSGSLVLLNANGSEIWSSNSSTDARNPVAQLLD  129

Query  1058  SGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSG  879
             SGNLVV++VDG GS G +LWQSFDYPTD L+ GMK+G N  TG    LTSW S   P  G
Sbjct  130   SGNLVVKDVDGTGS-GFLLWQSFDYPTDTLLAGMKMGRNRTTGFERYLTSWKSIDDPSPG  188

Query  878   AFELGLDINGCNNQLVISRRGKVY-WTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKY  708
              F   +D NG    L+  R+G V  + SG W    +   P++     + ++ V ++ E Y
Sbjct  189   NFTYKIDPNGFPQSLL--RQGSVVKFRSGPWNGVRYSGMPNLDPNPYYSYEFVLDDDEIY  246

Query  707   FSYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPM-------YTWIGRYAS----  561
             + +    +   ++  L   G +++ + I     +  Y+ +       Y   G Y+S    
Sbjct  247   YHFELLDSSFISRLVLSSNGIVQRFTWIDRTQGWTLYLTVPIDNCDTYALCGAYSSCKID  306

Query  560   -TLECDPYIGNYPRPV-----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDV  417
              +  C    G  PR             C+++ P+ C K  D+FV+  G        + D 
Sbjct  307   ESPVCRCLTGFTPRYSQEWDILDWSHGCVRKTPLDCGK--DIFVKYPGV------KLPDT  358

Query  416   ENSGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDF-QLDENGE-LY  249
              NS     + L +C  IC KNCSC AY++      GTGC+ +     D  +L++NG+ LY
Sbjct  359   GNSWFNKTMDLQECKEICKKNCSCMAYSTLDIRGGGTGCLQWFGELIDIRELNQNGQDLY  418

Query  248   IYRLLKEHKG*ILVNVRYCCFTVIQVFCVFVNVPFVLEGCSLCN  117
             I     E         +   F  + V    V++  VL  C L N
Sbjct  419   IRMAASESDLLQSKQTKQKLFISLAVSFGVVSLCLVLTFCILQN  462



>emb|CAH67720.1| H0613A10.3 [Oryza sativa Indica Group]
Length=531

 Score =   178 bits (452),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 142/432 (33%), Positives = 205/432 (47%), Gaps = 59/432 (14%)
 Frame = -2

Query  1406  YVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIP  1227
             Y + G  SDTL  G N+ D + L SA   F LGFFS       P     RYL IW+++  
Sbjct  33    YRAAGVASDTLSNGRNLTDGDTLVSANGSFTLGFFS-------PGLPSRRYLAIWFSE-S  84

Query  1226  NEPVWVANRDSPLPDSSGSLIIDADGKLKI-SYVGGMITVSNVSIMSGNNVGATLLDSGN  1050
              + VWVANRDSPL D++G ++ID  G L +     G    S+ +  S  +V   LL+SGN
Sbjct  85    ADAVWVANRDSPLNDTAGVVVIDGTGGLVLLDGAAGQAAWSSNTTGSSPSVAVQLLESGN  144

Query  1049  LVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFE  870
             LVVR+    GS G VLWQSFD+P++ L+ GM+LG N +TG  W LTSW +   P +G   
Sbjct  145   LVVRD---QGS-GDVLWQSFDHPSNTLIAGMRLGRNPRTGAEWSLTSWRAPDYPATGGCR  200

Query  869   LGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDM---TKEFGFKLVSNEKE-KYFS  702
               +D  G  + +     GK Y T G W    F   P+M   +  F  ++V    E  Y  
Sbjct  201   RVMDTRGLADCVSWCGAGKKYRT-GPWNGLWFSGVPEMASYSSMFANQVVVKPDEIAYVF  259

Query  701   YSAKHNYRFTKWTLDLLGHIEQSSLIYDPSF----FIHYMPM-----YTWIGRY------  567
              +A     F++  L   G I++  L++DPS          P      Y   G +      
Sbjct  260   TAATAAAPFSRLVLSEAGVIQR--LVWDPSSKGWNTFAQAPRDVCDDYAKCGAFGLCNVN  317

Query  566   -ASTLECDPYIG---NYPRPVCLKENPVSCRK----------SSDVFVQTRGYFRDDNRN  429
              ASTL C    G    +P    ++E    CR+          ++D FV  RG        
Sbjct  318   TASTLFCSCMAGFSPMFPSQWSMRETSGGCRRNAPLECGNGSTTDGFVPVRGV------K  371

Query  428   ISDVENSGNGSRLALSDCHSICWKNCSCTAYASS----STDGTGCILYTNAAHDFQLDEN  261
             + D +N+   +   L +C + C+ NCSC AYA++    +  G+GC+++T    D +  + 
Sbjct  372   LPDTDNATVDTGATLDECRARCFANCSCVAYAAADIRGAGGGSGCVMWTGDVIDVRYVDK  431

Query  260   GELYIYRLLKEH  225
             G+    RL K  
Sbjct  432   GQDLYLRLAKPE  443



>gb|KDP38970.1| hypothetical protein JCGZ_00727 [Jatropha curcas]
Length=783

 Score =   181 bits (458),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 142/410 (35%), Positives = 198/410 (48%), Gaps = 66/410 (16%)
 Frame = -2

Query  1358  IRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDR-YLGIWYNKIPNEPV-WVANRDSPLP  1185
             ++D + L SA   F+LGFFS       P N+  R YLGIWY +IP   V WVANR +P  
Sbjct  1     MKDGDTLISADGTFELGFFS-------PDNSSSRIYLGIWYRRIPIRTVIWVANRATPFL  53

Query  1184  DSSGSLIIDADGKLKI-SYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREVDGNGSF-G  1011
              +SG L ++ +G + + +   G +  SN S  + N V A LLDSGNLVV+  DGNGS   
Sbjct  54    STSGVLQVNEEGSIIVLNSTNGTVWSSNSSRSTQNPV-AKLLDSGNLVVK--DGNGSNPE  110

Query  1010  GVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDINGCNNQLV  831
              +LWQSFD+P D L+P MKLG NL T     LTSW S   P  G F   + + G   QL 
Sbjct  111   NILWQSFDFPYDTLLPDMKLGWNLDTRMNRFLTSWKSIDDPSMGDFSCLIKLGGV-PQLF  169

Query  830   ISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFSYSAKHNYRFTKWTLD  657
             I +   V+  SG W    F  +P +     F F  VSNE E Y+SY  K++   ++  L 
Sbjct  170   IMKGDTVHTRSGSWNGLQFTGSPQLKPNPLFNFMYVSNEHEIYYSYELKNSSIVSRLILS  229

Query  656   LLGHIEQSSLIYDPSFFIHYMPMYTWIGRYAS--------TLECDPY----------IGN  531
               G + +                Y WI R  S        T +CD Y          I N
Sbjct  230   EQGGLNR----------------YVWIDRTQSWTLFFGVPTDQCDTYQLCGPYASCNINN  273

Query  530   YPRPVCLK----ENPVS---------CRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRL  390
             YP   CL+    ++P           C + + +   + G+ +     + D  +S     +
Sbjct  274   YPVCACLEGFVPKSPTDWKASDWSDGCVRRTQLDCHSDGFQKHAEMKLPDTSSSWVDKSI  333

Query  389   ALSDCHSICWKNCSCTAYASSSTDGTGCILYTNAAHDF-QLDENGE-LYI  246
              L +C  +C +NCSC AYA+S   G+GC+L+ +   D  +  E G+ LYI
Sbjct  334   GLMECEELCRRNCSCLAYANSDIRGSGCLLWFDNLIDMREFTEGGQDLYI  383



>gb|KDO62849.1| hypothetical protein CISIN_1g012654mg [Citrus sinensis]
Length=459

 Score =   177 bits (448),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 137/398 (34%), Positives = 197/398 (49%), Gaps = 43/398 (11%)
 Frame = -2

Query  1415  FSSYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDS-YSGPINTEDRYLGIWY  1239
             F   V +   +DT+    +IRD E L S+   F+LGFFS  +S YS       +YLGIWY
Sbjct  15    FFLIVKLSLAADTITPARSIRDGEKLVSSSQTFELGFFSPGNSRYS-------KYLGIWY  67

Query  1238  NKIPNEPVWVANRDSPLPDSSGSLIIDADGKLKISYV-GGMITVSNVSIMSGNNVGATLL  1062
              K P   VWVANR+SP+ D S  L + ++G L +  V  G+I  SN+S    N V A L 
Sbjct  68    KKSPETIVWVANRNSPILDPSAVLTVSSNGNLVLLNVTKGIIWSSNISRKVENPV-AQLQ  126

Query  1061  DSGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGS  882
             D+GNLV+ +V    +    LWQSFDYP+D L+PGMK+G NLKTG  W LTSW S   P  
Sbjct  127   DTGNLVLVDVIRKNTSESYLWQSFDYPSDTLLPGMKVGWNLKTGVEWYLTSWRSADDPSP  186

Query  881   GAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTK-EFGFKLVSNEKEKYF  705
             G F   LDI+    ++ I      Y+ +G W   +F  AP  T   +  +L  N+ E YF
Sbjct  187   GNFTSRLDIHVL-PEICIYNGSVKYFCTGPWSGVAFVAAPSYTNFLYNQELAHNQDEIYF  245

Query  704   SYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPMYTWIGRYASTLECDPY-----  540
             SY + ++       L+  G +++  LI++            W   Y++   C  Y     
Sbjct  246   SYESYNSPSIMMLKLNPSGTVQR--LIWNER-------NAAWDVVYSAPNVCGVYGKCGA  296

Query  539   -----IGNYPRPVCLK-------EN---PVSCRKSSDVFVQTRGYF-RDDNRNISDVENS  408
                  +   P   CLK       +N   P  C +S   + ++   F + D     D+   
Sbjct  297   NSICILDKGPNCECLKGFKLKSQDNQTWPGKCERSHSSYCKSGDQFIKLDGIKAPDLLQV  356

Query  407   GNGSRLALSDCHSICWKNCSCTAYASSS-TDGTGCILY  297
                  + L  C + C KNC+C AYA S+ T+G+GC+++
Sbjct  357   SVNDNMNLKQCEAECLKNCTCRAYAYSNLTEGSGCLMW  394



>ref|XP_010064917.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Eucalyptus grandis]
 gb|KCW70071.1| hypothetical protein EUGRSUZ_F03374 [Eucalyptus grandis]
Length=837

 Score =   181 bits (458),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 143/420 (34%), Positives = 206/420 (49%), Gaps = 48/420 (11%)
 Frame = -2

Query  1415  FSSYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYN  1236
             FS    +    DT+    +IRD E+L SA   F+LGFFS  D          RYLGIWY 
Sbjct  14    FSCNALLSNALDTIATDQSIRDGENLLSAGGTFELGFFSAGDP-------RKRYLGIWYK  66

Query  1235  KIPNEPVWVANRDSPLPDSSGSLIIDADGKLKI-SYVGGMITVSNVSIMSGNNVGATLLD  1059
             KI    VWVANR +PL D+SG+L +   G L +    G  I +SN  I   N V A LLD
Sbjct  67    KIATTIVWVANRVAPLADASGTLRVTTHGSLVLLDGNGSDIWLSNAPIPVRNPV-AQLLD  125

Query  1058  SGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSG  879
             SGNLVVR+ +G+      LW+SFDYPTD LV GMKLG N ++G    LTSW S   P  G
Sbjct  126   SGNLVVRDAEGSDP-NTFLWESFDYPTDTLVAGMKLGRNRRSGFNRHLTSWKSINDPSPG  184

Query  878   AFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYF  705
              F   LD NG   +L + +   + +++G W    +   P++     + ++ V NE+E Y+
Sbjct  185   NFTFQLDPNGYPQEL-LKQGSDIKFSTGPWNGLRWSGIPNLNPNPYYRYEFVLNEEEMYY  243

Query  704   SYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYM--PM-----YTWIGRYAS-----  561
              Y   +++  ++  L   G +++ + I     +  Y+  P+     Y   G Y S     
Sbjct  244   RYELLNSWVISRMILMPNGMLQRFTWIDRTQGWTLYISCPIDQCDNYASCGAYGSCRVDT  303

Query  560   TLECDPYIGNYPRPV-----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVE  414
             +  C    G  PR             C++ N + C K  D+FV+   Y R     + D  
Sbjct  304   SPVCRCLKGFVPRFSQEWDILDWSNGCVRRNALDCEK--DIFVK---YSR---LKLPDTR  355

Query  413   NSGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDFQL--DENGELYI  246
             +S     + L +C  +C KNCSC AY++      G+GC+L+ +   D +   D   +LYI
Sbjct  356   SSWFNESMNLQECEVVCMKNCSCMAYSNLDIRDGGSGCLLWFDKLIDIREYSDYGQDLYI  415



>gb|KDO38116.1| hypothetical protein CISIN_1g0448792mg, partial [Citrus sinensis]
Length=549

 Score =   178 bits (452),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 136/414 (33%), Positives = 196/414 (47%), Gaps = 58/414 (14%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI-PNEPV  1215
             A +D +    +IRD E L S    F+LGFFS       P     RYLGIWY ++ P    
Sbjct  3     AANDNITPSQSIRDGETLVSVNGTFELGFFS-------PGTPAKRYLGIWYKRVSPRTVA  55

Query  1214  WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVRE  1035
             WVANR++PL D SG   + + G + +     +   SN S    N V   L+DSGNLV+++
Sbjct  56    WVANRETPLTDHSGWFNVTSKGIVLVDGRDRIFWSSNTSKTMKNPV-VQLMDSGNLVLKD  114

Query  1034  VDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDI  855
              + N S   +LWQSFD+P D L+PGMKLG N KTG    L+SW S   P  G F LG+D 
Sbjct  115   GNNN-SLENLLWQSFDHPCDTLIPGMKLGRNFKTGMDRHLSSWKSIDDPAPGEFSLGIDS  173

Query  854   NGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKEF---GFKLVSNEKEKYFSYSAKHN  684
             +G   QLV+ +   + + +G W    F   P + +      +K V NE E Y+   AK  
Sbjct  174   HGF-PQLVLRKGSVLQYRAGSWNGLGFTGTPPLKENVRLCDYKFVINENEVYYECDAKGP  232

Query  683   YRFTKWTLDLLGHIEQSSLIYDPS--------FFIHYMP-----MYTWIG---RYASTLE  552
                  W       + QS LI            F  +Y P     +Y+  G   R  +   
Sbjct  233   VVSRLW-------VNQSGLILRSIWSSQQNVWFLAYYAPVDRCDLYSVCGANARCTTNSR  285

Query  551   CDPYIGNYPRPV------CLKENPVSCRKSSDV--FVQTRGYFRDDNRNISDVENSGNGS  396
             C    G  P+        C++E  + CR   +   +V+ +         + D  +S   +
Sbjct  286   CACLEGFVPKSPNNWSEGCVRERELKCRNGDEFPKYVKLK---------LPDTSSSWFNA  336

Query  395   RLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDFQLDENG--ELYI  246
              + L +C  +C KNCSCTAYA+S  +  G+GC+L+     D +   +G  +LYI
Sbjct  337   SMNLKECSELCSKNCSCTAYANSDVERGGSGCLLWFGDLMDMKEYNDGGQDLYI  390



>ref|XP_010062920.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Eucalyptus grandis]
Length=820

 Score =   180 bits (457),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 152/464 (33%), Positives = 218/464 (47%), Gaps = 50/464 (11%)
 Frame = -2

Query  1412  SSYVSVGAES-DTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYN  1236
             S YV+  +E+ D++    +I+D   L SA   F+LGFFS             RYLGIWY 
Sbjct  17    SPYVAQVSEALDSITANQSIQDGGSLVSAGGTFELGFFSTG-------LPSRRYLGIWYK  69

Query  1235  KIPNEPV-WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLD  1059
             K+    V WVANR +PL DS G+L +   G L +    G    S+ S     N  A LLD
Sbjct  70    KVATMTVVWVANRVTPLADSVGTLKVTGSGSLVLLNANGSEIWSSNSSTDARNPVAQLLD  129

Query  1058  SGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSG  879
             SGNLVV++VDG GS G +LWQSFDYPTD L+ GMK+G N  TG    LTSW S   P  G
Sbjct  130   SGNLVVKDVDGTGS-GFLLWQSFDYPTDTLLAGMKMGRNRTTGFERYLTSWKSIDDPSPG  188

Query  878   AFELGLDINGCNNQLVISRRGKVY-WTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKY  708
              F   +D NG    L+  R+G V  + SG W    +   P++     + ++ V ++ E Y
Sbjct  189   NFTYKIDPNGFPQSLL--RQGSVVKFRSGPWNGVRYSGMPNLDPNPYYSYEFVLDDDEIY  246

Query  707   FSYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPM-------YTWIGRYAS----  561
             + +    +   ++  L   G +++ + I     +  Y+ +       Y   G Y+S    
Sbjct  247   YHFELLDSSFISRLVLSSNGIVQRFTWIDRTQGWTLYLTVPIDNCDTYALCGAYSSCKID  306

Query  560   -TLECDPYIGNYPRPV-----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDV  417
              +  C    G  PR             C+++ P+ C K  D+FV+  G        + D 
Sbjct  307   ESPVCRCLTGFTPRYSQEWDILDWSHGCVRKTPLDCGK--DIFVKYPGV------KLPDT  358

Query  416   ENSGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDF-QLDENGE-LY  249
              NS     + L +C  IC KNCSC AY++      GTGC+ +     D  +L++NG+ LY
Sbjct  359   GNSWFNKTMDLQECKEICKKNCSCMAYSTLDIRGGGTGCLQWFGELIDIRELNQNGQDLY  418

Query  248   IYRLLKEHKG*ILVNVRYCCFTVIQVFCVFVNVPFVLEGCSLCN  117
             I     E         +   F  + V    V++  VL  C L N
Sbjct  419   IRMAASESDLLQSKQTKQKLFISLAVSFGVVSLCLVLTFCILQN  462



>ref|XP_003526159.2| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like [Glycine max]
Length=815

 Score =   180 bits (457),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 134/424 (32%), Positives = 200/424 (47%), Gaps = 58/424 (14%)
 Frame = -2

Query  1403  VSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPN  1224
             + +   +D++    ++ D E L S    F+LGFFS       P N++ RYLGIWY  +PN
Sbjct  17    LRISVANDSINVSKSMTDGESLVSKGGKFELGFFS-------PGNSQKRYLGIWYKNVPN  69

Query  1223  EPV-WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNL  1047
             + V WVANR+ P+ DSSG L ++  G L ++    ++  +N S     N  A LLDSGNL
Sbjct  70    QTVVWVANREDPINDSSGILTLNTTGNLVLTQNKSLVWYTNNSHKQAPNPVAVLLDSGNL  129

Query  1046  VVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFEL  867
             V+R  +G  +    LWQSFDYP+D  +PGMKLG NL+TGH WKLT+W S   P  G    
Sbjct  130   VIRN-EGETNPEAYLWQSFDYPSDTFLPGMKLGWNLRTGHEWKLTAWKSPDDPSPGDVYR  188

Query  866   GLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFSYSA  693
                +       V+ +  K+Y   G W    F    D+       F  VSN+ E Y++YS 
Sbjct  189   VFKLYNYPELYVMKKTKKLY-RFGPWNGLYFSGMSDLQNNTVHSFYYVSNKDEIYYAYSL  247

Query  692   KHNYRFTKWTLDLLGHIEQSSLIY-------------DPSFFIHYMPMYTWIGRYASTLE  552
              ++    +   D     + +S +Y               SF   +   Y+  G Y + + 
Sbjct  248   ANDSVIVRSVTD-----QTTSTVYRYKWVVGEQNWRLSRSFPTEFCDTYSVCGAYGNCVS  302

Query  551   ------CDPYIGNYPRPV-----------CLKENPVSC-RKSSDVFVQTRGYFRDDNRNI  426
                   C+   G  P              C++  P+ C  K SD FV+ +G        +
Sbjct  303   STQPQACNCLKGFSPNSPQAWKSSYWSGGCVRNKPLICEEKLSDGFVKFKGL------KV  356

Query  425   SDVENSGNGSRLALSDCHSICWKNCSCTAYASSST--DGTGCILYTNAAHDF-QLDENGE  255
              D  ++     + L +C   C  NCSC A+A+S    +G+GC+++     D  QL  +G+
Sbjct  357   PDTTHTWLNESIGLEECRVKCLSNCSCMAFANSDIRGEGSGCVMWFGDLIDMKQLQTDGQ  416

Query  254   -LYI  246
              LYI
Sbjct  417   DLYI  420



>ref|XP_009591715.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Nicotiana tomentosiformis]
Length=454

 Score =   176 bits (446),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 128/415 (31%), Positives = 201/415 (48%), Gaps = 35/415 (8%)
 Frame = -2

Query  1391  AESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI-PNEPV  1215
             A  DT+ +   IRD + + SA  +++LGFFS       P N+++RY+GIWY K+ P   V
Sbjct  20    AALDTITRDKPIRDGDTIVSAGGVYELGFFS-------PGNSKNRYVGIWYKKLLPTTAV  72

Query  1214  WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVRE  1035
             WVANR+ PL D+SG L +  +G L +         S+ S  S  N  A +LDSGNLVV +
Sbjct  73    WVANRNIPLNDTSGMLTLKPNGTLVLVNSSNASIWSSNSSRSLKNPKARILDSGNLVVSD  132

Query  1034  VDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDI  855
              +   +   ++WQSFDYP + L+PGMKLG NL TG  W ++SW S   P  G +   LD 
Sbjct  133   RNDRDAEINLVWQSFDYPGNTLLPGMKLGRNLVTGMDWYISSWKSTDDPAPGEYVDFLDS  192

Query  854   NGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFSYSAKHNY  681
             +G   QLV+ +   + +  G W   +F  +P+      + F+ V N++E Y+ Y  K+  
Sbjct  193   HG-YPQLVVLKNSSIVYNVGPWNGIAFSGSPNSKPNIYYTFEFVINQQEIYYKYEIKNAS  251

Query  680   RFTKWTLDLLGHIEQSSLI-YDPSFFIHYMPMYTWIGRYASTLECDPY----IGNYPRPV  516
               T+  +D  G +E  + I    S+F++    +    R+A    C PY    I N P   
Sbjct  252   LPTRVVIDADGVVEHLTWIERSQSWFLYLTAQFGNCDRFAL---CGPYASCNINNSPPCD  308

Query  515   CLK-------------ENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRLALSDC  375
             CL+             +    C + + +      + +     + D  +S     + L  C
Sbjct  309   CLRGFEPRYPNQWYAADWSSGCIRRTSLACNQDDFLKLTGIKMPDSRHSWYNQSMDLEGC  368

Query  374   HSICWKNCSCTAYASSSTD--GTGCILYTNAAHDF-QLDENGELYIYRLLKEHKG  219
               +C  +C+CTAY++      G+GC+L+     D  +L  N +    R+     G
Sbjct  369   KKLCLADCNCTAYSNLDVRNGGSGCLLWFGELIDIRELSHNEQDLFVRVAASELG  423



>ref|XP_010324436.1| PREDICTED: uncharacterized protein LOC101244686 [Solanum lycopersicum]
Length=1611

 Score =   183 bits (464),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 138/416 (33%), Positives = 209/416 (50%), Gaps = 46/416 (11%)
 Frame = -2

Query  1397  VGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEP  1218
             + AESDT+    +IRD + + SA  I++LGFFS     SG  N ++RY+GIWY KI  + 
Sbjct  830   ISAESDTITTDRSIRDGDTIVSAGGIYELGFFS-----SG--NAKNRYVGIWYKKISTQT  882

Query  1217  V-WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGN------NVGATLLD  1059
             V WVANRD PL D+SG LI+  +G L       ++  SN SI S N      +  A +LD
Sbjct  883   VVWVANRDIPLNDTSGVLILKPNGILV------LVDNSNTSIWSSNSSRPLKDPKARILD  936

Query  1058  SGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSG  879
             SGNLVV + +         WQSFDYP +  +PGMKLG NL TG  W ++SW S   P  G
Sbjct  937   SGNLVVNDGNERDLEINFAWQSFDYPGNTFIPGMKLGRNLVTGMDWYMSSWKSIDDPSPG  996

Query  878   AFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDM--TKEFGFKLVSNEKEKYF  705
              +   LD +G   QL + +   +  +SG+WK  +F  + +      +  + + N++E Y+
Sbjct  997   EYINRLDSHGY-PQLFVWKNSTIVSSSGIWKGNAFTVSANSRPNTHYTSEFIINQQEIYY  1055

Query  704   SYSAKHNYRFTKWTLDLLGHIEQSSLIY-DPSFFIHYMPMYTWIGRYASTLECDPY----  540
              +  K+    ++  L+  G IE  + I    S+F++    +   GR+A    C PY    
Sbjct  1056  QFKLKNESLPSRMVLNPEGLIEHLTWIESSQSWFLYSTVQFDSCGRFAL---CGPYSSCN  1112

Query  539   IGNYPRPVCLKE-NP-----------VSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGS  396
             I N P   CL+  NP             C +S+ +     G+ +     + D  NS    
Sbjct  1113  INNSPPCDCLQGFNPRVPQQSAADWSSGCVRSTSLDCNKDGFLKFTGIKMPDSRNSWFNK  1172

Query  395   RLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDF-QLDENGELYIYRL  237
              + L +C  +C  NC+CTAY++      G+GC+L+     D  +L +N +    R+
Sbjct  1173  SINLEECEKLCLANCNCTAYSNLDVRNGGSGCLLWFGDLIDIRELSQNEQNLFVRV  1228


 Score =   170 bits (431),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 135/417 (32%), Positives = 199/417 (48%), Gaps = 61/417 (15%)
 Frame = -2

Query  1415  FSSYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYN  1236
             F   + +    DT+     IRD + + SA  +F+LGFFS       P N+++RY+GIW+ 
Sbjct  13    FLPVLLISTALDTITTEKPIRDGDTIISAGGVFELGFFS-------PGNSKNRYVGIWFK  65

Query  1235  KIPNEPV-WVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGN------NV  1077
             KI    V WVANR+ PL D+SG L ++ +G L       ++  SN SI S N      N 
Sbjct  66    KIATRTVVWVANRNFPLNDNSGVLSLNPNGILV------LLRNSNASIWSSNSSRLLTNP  119

Query  1076  GATLLDSGNLVVREVDGNGSFGGV--LWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWL  903
              A LLDSGNLVV   DGN S   V   WQSFDYP D L+PGMKLG NL TG  W + SW 
Sbjct  120   KAWLLDSGNLVV--TDGNDSDPEVNFAWQSFDYPGDTLLPGMKLGRNLVTGMDWYIESWK  177

Query  902   SDKVPGSGAFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLV  729
             S   P  G +   LD +G   Q  + +   + +++G W   +F  +P       + F+ V
Sbjct  178   SSDDPAPGEYIERLDSHGY-PQFFVWQNSSIVYSTGPWNGITFSSSPKNQPAIYYAFEFV  236

Query  728   SNEKEKYFSYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPM-------YTWIGR  570
               +KE YF Y    +   T+  ++  G +E  + I     +I Y+         +   G 
Sbjct  237   IKQKEIYFKYELNESLP-TRVVINQAGMVEHLTWIERNQRWIVYVSTQSDNCDRFALCGP  295

Query  569   YAS-----TLECDPYIGNYPR-PV----------CLKENPVSCRKSSDVFVQTRGYFRDD  438
             YAS     +  CD   G  PR P           C+++  +SC +         G+ +  
Sbjct  296   YASCNINNSPPCDCLQGFEPRYPEQWYAVDWSNGCIRKTSLSCNQD--------GFLKFT  347

Query  437   NRNISDVENSGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDFQ  273
             N  + D  +S     + L +C  +C  +C+CTAY++      G+GC+L+     D +
Sbjct  348   NIKMPDSRHSWYNVSMNLEECKKMCLADCNCTAYSNLDIRNGGSGCLLWFGELIDIR  404



>emb|CBI20455.3| unnamed protein product [Vitis vinifera]
Length=454

 Score =   176 bits (446),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 141/422 (33%), Positives = 200/422 (47%), Gaps = 67/422 (16%)
 Frame = -2

Query  1382  DTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEPV-WVA  1206
             DT++    I D E +TSA   F+LGFF+       P N+++RYLGIWY K   +PV WVA
Sbjct  4     DTIIVNQPITDGETITSAGGSFELGFFN-------PGNSKNRYLGIWYKKASKKPVVWVA  56

Query  1205  NRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREVDG  1026
             NR+SPL DSSG L +   G L +      I  ++ S  S  +  A LLDSGNL++R  +G
Sbjct  57    NRESPLTDSSGVLKVTQPGILVLVNGTNGILWNSTSSRSAQDPNAQLLDSGNLIMR--NG  114

Query  1025  NGS-FGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDING  849
             N S     LWQSFDYP D L+PGMK G N  TG    L+SW S   P  G F  G+D++G
Sbjct  115   NDSDPENSLWQSFDYPCDTLLPGMKFGWNRVTGLDRHLSSWRSADDPSKGNFTYGIDLSG  174

Query  848   CNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFSYSAKHNYRF  675
                QL++     V +  G W    F   P +T    + ++ VSNEKE YF Y        
Sbjct  175   F-PQLLLKNGLAVAFRPGPWNGIRFSGIPQLTINPVYSYEFVSNEKEIYFMY--------  225

Query  674   TKWTLDLLGHIEQSSLIYDPSFFIH-YMPMYTWIGR--------YASTLECDPY------  540
                      H+  SS++         Y   +TW  +         A   +CD Y      
Sbjct  226   ---------HLVNSSVVMRNVLTPDGYSRRFTWTDQKNEWSLYSTAQRDDCDTYAICGVN  276

Query  539   ----IGNYPRPVCLK-------------ENPVSCRKSSDVFVQT-RGYFRDDNRNISDVE  414
                 I   P+  C+K             +    C +S+ +  Q   G+ +     + D +
Sbjct  277   GICKINESPKCECMKGFRPKIQSNWDMADWSNGCIRSTRLDCQKGDGFEKYSGVKLPDTQ  336

Query  413   NSGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDFQ-LDENGELYIY  243
             +S     + L +C S+C  NCSCTAYA+S     G+GC+L+     D +   +NG+ +  
Sbjct  337   SSWFNESMNLKECASLCLSNCSCTAYANSDIRGAGSGCLLWFGGLIDIRDFTQNGQEFYV  396

Query  242   RL  237
             R+
Sbjct  397   RM  398



>ref|XP_007021205.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY12730.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
Length=786

 Score =   179 bits (455),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 130/413 (31%), Positives = 203/413 (49%), Gaps = 46/413 (11%)
 Frame = -2

Query  1385  SDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI-PNEPVWV  1209
              D ++ G +I+D E L SA   F+LGFFS       P ++++RY+GIWY KI P   VWV
Sbjct  20    QDIIIPGQSIKDGETLRSAGGSFELGFFS-------PGSSKNRYVGIWYKKISPGTVVWV  72

Query  1208  ANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSGNLVVREVD  1029
             ANR++P+ D SG L I + G L +      +  S+ +  +  +  A LLDSGNLVV+E +
Sbjct  73    ANRETPISDRSGVLNITSQGILTLLNSSNSLVWSSNTSKTAESPVAQLLDSGNLVVKERN  132

Query  1028  GNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGAFELGLDING  849
              N +   VLW+SFDYP D L+ GMKLG N  TG    ++SW S + P  G + L ++  G
Sbjct  133   DN-NLENVLWESFDYPCDNLLSGMKLGRNFVTGFERYISSWKSTEDPAPGQYSLRIEPRG  191

Query  848   CNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYFSYSAKHNYRF  675
                QLV+ +  ++ + +G W    F   P + +   + +  V N  E Y+ Y  +++   
Sbjct  192   -YPQLVLKKGSEILFRAGSWNGLYFSGKPGLEQNPVYSYDFVLNNIEVYYKYEHRNSSFV  250

Query  674   TKWTLDLLGHIEQ---SSLIYDPSFF----IHYMPMYTWIGRYAS-----TLECDPYIGN  531
             ++++L+ LG I++   +    D   F         +Y + G YA+     +  C    G 
Sbjct  251   SRYSLNPLGVIQRFMWNERKNDWEIFSTAQADQCAIYAFCGAYATCTTNKSPPCTCLEGF  310

Query  530   YPRPV-------------CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNGSRL  390
              PR               C++  P  C           G+ +     + D  +S     +
Sbjct  311   VPRSTKSGDLNSVDWSDGCVRRTPSVCDGKD-------GFLKHTGLKLPDTSHSWADKSI  363

Query  389   ALSDCHSICWKNCSCTAYASSST-DGTGCILYTNAAHDF-QLDENGELYIYRL  237
             +L +C  IC +NCSCTAYA+     GTGC+++ N   D  +  E G+    RL
Sbjct  364   SLQECEKICLRNCSCTAYANLDILKGTGCLIWFNDLIDMTEFTEVGQDLHIRL  416



>ref|XP_006382400.1| hypothetical protein POPTR_0005s01780g [Populus trichocarpa]
 gb|ERP60197.1| hypothetical protein POPTR_0005s01780g [Populus trichocarpa]
Length=937

 Score =   181 bits (458),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 131/417 (31%), Positives = 197/417 (47%), Gaps = 58/417 (14%)
 Frame = -2

Query  1382  DTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKIPNEP-VWVA  1206
             DTL+ G ++   + L S   IF+LGFF  + S+S        YLGIWY    N+  VWVA
Sbjct  30    DTLLVGQSLSANQTLISQNGIFELGFFKPAASFS-------IYLGIWYKNFANKTIVWVA  82

Query  1205  NRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNV-----------SIMSGNNVGATLLD  1059
             NR+SP  + + S       KL++   G ++ + N            S+ + +   A +LD
Sbjct  83    NRESPSNNPASS-------KLELLSDGNLVLLKNFTETVWSTALASSVPNTSKAEAVILD  135

Query  1058  SGNLVVREVDGNGSFGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSG  879
              GN VVR  DG+     + WQSFDYPTD  +PG KLG+N  TG V +L SW + + P  G
Sbjct  136   DGNFVVR--DGSNP-SAIYWQSFDYPTDTWLPGGKLGINKHTGQVQRLISWKNPEDPAPG  192

Query  878   AFELGLDINGCNNQLVISRRGKVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYF  705
              F +G+D NG +   +   R   YW+SG W    F   P+M     F +  VSNE E YF
Sbjct  193   MFSIGIDPNGSSQFFIEWNRSHRYWSSGDWNGERFTLVPEMRLNYIFNYSYVSNENESYF  252

Query  704   SYSAKHNYRFTKWTLDLLGHIEQSSLIYDPS--FFIHYMPMYTW----------IGRYAS  561
             +YS  +    ++  +D+ G I+Q S + D    F     P Y            +    S
Sbjct  253   TYSLYNTSILSRTVIDVSGQIKQFSSLGDFRDWFLFWSQPKYQADVYGLCGAFGVFHVNS  312

Query  560   TLEC------DPYIGNYPRPVCLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVENSGNG  399
             +  C       P++ N     CL+ +P+ C+   ++ V   G+ +  N  +    NS   
Sbjct  313   STPCGCLRGFRPFVANDWSSGCLRMSPLHCQHRKNIAVSNDGFLKMSNLTLPG--NSKAY  370

Query  398   SRLALSDCHSICWKNCSCTAYASSSTDGTGCILYTNAAHDFQLDE------NGELYI  246
              +++   C   C +NCSC A+A +  +G  C+L+  A  + Q  E        E+YI
Sbjct  371   QKVSYERCRLDCIENCSCMAHAYNDNNGE-CLLWDGALINLQRAEVAGGRTEAEIYI  426



>ref|XP_010644308.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X3 [Vitis vinifera]
Length=769

 Score =   179 bits (454),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 145/428 (34%), Positives = 203/428 (47%), Gaps = 49/428 (11%)
 Frame = -2

Query  1409  SYVSVGAESDTLMQGANIRDWEHLTSAKAIFKLGFFSISDSYSGPINTEDRYLGIWYNKI  1230
             S + +    DT++   NI D E +TSA   F+LGFFS       P N+++RYLGIWY K+
Sbjct  16    SLLRISVAVDTIIVNQNITDGETITSAGGSFELGFFS-------PGNSKNRYLGIWYKKV  68

Query  1229  PN-EPVWVANRDSPLPDSSGSLIIDADGKLKISYVGGMITVSNVSIMSGNNVGATLLDSG  1053
                  VWVANR+SPL DSSG L +   G L +      I  ++ S  S  +  A LL+SG
Sbjct  69    ATGTVVWVANRESPLTDSSGVLKVTEQGILVLVNDTNGILWNSSSSRSAQDPNAQLLESG  128

Query  1052  NLVVREVDGNGS-FGGVLWQSFDYPTDVLVPGMKLGVNLKTGHVWKLTSWLSDKVPGSGA  876
             NLV+R  +GN S     LWQSFDYP D L+PGMK G N  TG    L+SW S   P  G 
Sbjct  129   NLVMR--NGNDSDPENFLWQSFDYPCDTLLPGMKFGWNRVTGLDRYLSSWKSTDDPSKGN  186

Query  875   FELGLDINGCNNQLVISRRG-KVYWTSGVWKNGSFEKAPDMTKE--FGFKLVSNEKEKYF  705
             F  G+D++G     +  R G  V + +G W    F   P +T    F    VSNEKE Y 
Sbjct  187   FTYGIDLSGFPQPFL--RNGLAVKFRAGPWNGVRFGGIPQLTNNSLFTSDYVSNEKEIYS  244

Query  704   SYSAKHNYRFTKWTLDLLGHIEQSSLIYDPSFFIHYMPM-------YTWIGRYA-----S  561
              Y   ++  F +  L   G+  + +     + +  Y          Y   G Y       
Sbjct  245   IYYLVNSSVFVRRVLTPDGYSRRFTWTDKKNEWTLYATAQSDDCDNYAICGVYGICKIDE  304

Query  560   TLECDPYIGNYPRPV-----------CLKENPVSCRKSSDVFVQTRGYFRDDNRNISDVE  414
             + +C+   G  P+             C++  P+ C+K  D FV+  G        + D  
Sbjct  305   SPKCECMKGFRPKFQSNWDMADWSNGCIRSTPLDCQK-GDGFVKYSGV------KLPDTR  357

Query  413   NSGNGSRLALSDCHSICWKNCSCTAYASSSTD--GTGCILYTNAAHDFQ-LDENGELYIY  243
             NS     + L +C S+C +NCSCTAYA+S     G+GC+L+     D +    NG+ +  
Sbjct  358   NSWFNESMNLKECASLCLRNCSCTAYANSDIRGGGSGCLLWFGDLIDIRDFTHNGQEFYV  417

Query  242   RLLKEHKG  219
             R+     G
Sbjct  418   RMAASELG  425



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4018413329892