BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25735_g4_i1 len=935 path=[3127:0-513 17098:514-515 4580:516-558
17121:559-560 2045:561-599 2084:600-648 701:649-686 14368:687-934]

Length=935
                                                                      Score     E

ref|XP_006370167.1|  ubiquitin-conjugating enzyme family protein        316   2e-105   
ref|XP_007021721.1|  Ubiquitin-conjugating enzyme 36 isoform 1          317   5e-105   
ref|XP_010924615.1|  PREDICTED: ubiquitin-conjugating enzyme E2 36      315   7e-105   
ref|NP_001274306.1|  ubiquitin-conjugating enzyme E2 35-like            315   7e-105   
ref|NP_001267560.1|  ubiquitin-conjugating enzyme E2 35-like            315   7e-105   
gb|ABK24341.1|  unknown                                                 314   2e-104   Picea sitchensis
ref|NP_001275211.1|  ubiquitin-conjugating enzyme E2 36-like            313   2e-104   
ref|NP_001241639.1|  uncharacterized protein LOC100805631               313   3e-104   
ref|XP_010279114.1|  PREDICTED: ubiquitin-conjugating enzyme E2 36      313   3e-104   
ref|XP_006389951.1|  hypothetical protein EUTSA_v10019278mg             313   4e-104   
ref|XP_002316867.1|  ubiquitin-conjugating enzyme family protein        313   4e-104   Populus trichocarpa [western balsam poplar]
ref|XP_011006521.1|  PREDICTED: ubiquitin-conjugating enzyme E2 36      313   5e-104   
ref|XP_010417495.1|  PREDICTED: ubiquitin-conjugating enzyme E2 35      312   7e-104   
ref|XP_007149398.1|  hypothetical protein PHAVU_005G066900g             312   8e-104   
ref|XP_009388323.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    312   8e-104   
ref|NP_565192.1|  ubiquitin-conjugating enzyme E2 35                    312   8e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302954.1|  hypothetical protein CARUB_v10021093mg             312   1e-103   
ref|NP_564011.1|  ubiquitin-conjugating enzyme E2 36                    312   1e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004294139.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    312   1e-103   
ref|XP_008793012.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    311   1e-103   
ref|XP_009110436.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    311   1e-103   
ref|XP_008778384.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    311   2e-103   
ref|XP_011098228.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    311   2e-103   
ref|XP_008811252.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    311   2e-103   
ref|XP_007133200.1|  hypothetical protein PHAVU_011G160100g             311   3e-103   
ref|XP_009117738.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    310   3e-103   
ref|XP_006591825.1|  PREDICTED: uncharacterized protein LOC100306...    310   3e-103   
gb|ABK22122.1|  unknown                                                 310   3e-103   Picea sitchensis
ref|XP_008675216.1|  PREDICTED: ubiquitin-conjugating enzyme E2 36      310   4e-103   
ref|XP_006416763.1|  hypothetical protein EUTSA_v10008996mg             310   4e-103   
ref|NP_001235055.1|  uncharacterized protein LOC100500231               310   4e-103   
ref|XP_006360049.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    310   5e-103   
dbj|BAJ93925.1|  predicted protein                                      310   5e-103   
ref|XP_009106601.1|  PREDICTED: ubiquitin-conjugating enzyme E2 36      310   5e-103   
emb|CDY40025.1|  BnaC05g12900D                                          310   5e-103   
gb|KEH38618.1|  ubiquitin-conjugating enzyme                            310   5e-103   
gb|KHG03257.1|  Ubiquitin-conjugating enzyme E2 35 -like protein        310   5e-103   
ref|XP_003555344.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    310   6e-103   
emb|CDX96802.1|  BnaA08g23450D                                          310   7e-103   
ref|XP_010675423.1|  PREDICTED: ubiquitin-conjugating enzyme E2 35      310   7e-103   
ref|XP_002458301.1|  hypothetical protein SORBIDRAFT_03g030840          310   9e-103   Sorghum bicolor [broomcorn]
ref|XP_003567909.1|  PREDICTED: ubiquitin-conjugating enzyme E2 36      309   1e-102   
gb|ABI84266.1|  ubiquitin-conjugating enzyme 1 like protein             309   1e-102   Arachis hypogaea [goober]
emb|CDX88485.1|  BnaC06g39290D                                          309   2e-102   
ref|XP_009420050.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    311   2e-102   
ref|XP_010099384.1|  Ubiquitin-conjugating enzyme E2 35                 309   2e-102   
dbj|BAJ99711.1|  predicted protein                                      309   2e-102   
ref|XP_003569545.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    308   2e-102   
ref|XP_010537733.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    308   3e-102   
ref|XP_009128314.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    308   3e-102   
ref|NP_001043834.1|  Os01g0673600                                       308   3e-102   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010689886.1|  PREDICTED: ubiquitin-conjugating enzyme E2 36      308   3e-102   
ref|XP_006852412.1|  hypothetical protein AMTR_s00021p00045870          308   5e-102   
ref|NP_849902.2|  ubiquitin-conjugating enzyme E2 35                    307   6e-102   Arabidopsis thaliana [mouse-ear cress]
gb|EPS69473.1|  ubiquitin carrier protein                               307   6e-102   
ref|XP_004961237.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    310   9e-102   
ref|NP_001148361.1|  ubiquitin-conjugating enzyme E2 N                  307   1e-101   Zea mays [maize]
dbj|BAJ85100.1|  predicted protein                                      306   1e-101   
ref|NP_001140498.1|  putative ubiquitin-conjugating enzyme family       306   1e-101   Zea mays [maize]
ref|XP_008228914.1|  PREDICTED: ubiquitin-conjugating enzyme E2 36      306   1e-101   
ref|XP_007212191.1|  hypothetical protein PRUPE_ppa012814mg             306   2e-101   
ref|XP_006442523.1|  hypothetical protein CICLE_v10022662mg             306   2e-101   
ref|XP_006377751.1|  hypothetical protein POPTR_0011s11260g             306   3e-101   
ref|XP_008793011.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    305   5e-101   
ref|XP_001778399.1|  predicted protein                                  305   6e-101   
ref|XP_009354263.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    304   1e-100   
ref|XP_009397453.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    304   1e-100   
ref|XP_004303174.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    303   2e-100   
emb|CDY14587.1|  BnaC02g25260D                                          303   2e-100   
ref|XP_008362408.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    303   3e-100   
gb|AAD42941.1|AF091621_1  ubiquitin-conjugating enzyme E2               303   4e-100   Catharanthus roseus [chatas]
ref|NP_001185017.1|  ubiquitin-conjugating enzyme E2 36                 302   7e-100   
emb|CDY57941.1|  BnaA07g38410D                                          301   1e-99    
ref|XP_004969504.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    301   3e-99    
ref|XP_004956556.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    300   4e-99    
dbj|BAK05631.1|  predicted protein                                      300   4e-99    
gb|KEH38621.1|  ubiquitin-conjugating enzyme                            301   4e-99    
ref|XP_001764104.1|  predicted protein                                  300   8e-99    
ref|XP_006446781.1|  hypothetical protein CICLE_v10017059mg             297   6e-98    
gb|KHG21556.1|  Ubiquitin-conjugating enzyme E2 35 -like protein        297   1e-97    
emb|CDX79272.1|  BnaC06g20310D                                          297   1e-97    
ref|XP_004956557.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    296   3e-97    
ref|XP_004961236.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    298   5e-97    
gb|KHG29378.1|  Ubiquitin-conjugating enzyme E2 35 -like protein        294   1e-96    
gb|EPS71389.1|  hypothetical protein M569_03369                         293   7e-96    
ref|XP_007021722.1|  Ubiquitin-conjugating enzyme 36 isoform 2          293   3e-95    
emb|CDP15927.1|  unnamed protein product                                289   1e-94    
gb|KEH38619.1|  ubiquitin-conjugating enzyme                            286   2e-93    
emb|CDY26882.1|  BnaA02g19070D                                          285   3e-93    
ref|XP_004969501.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    286   4e-93    
gb|EEC71254.1|  hypothetical protein OsI_03230                          284   5e-93    Oryza sativa Indica Group [Indian rice]
gb|AFW83529.1|  putative ubiquitin-conjugating enzyme family            285   5e-93    
ref|XP_010277057.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    285   6e-93    
gb|AAC83026.1|  Similar to Ubiquitin-conjugating enzyme E2-17 KD ...    283   4e-92    Arabidopsis thaliana [mouse-ear cress]
gb|EMS46318.1|  Ubiquitin-conjugating enzyme E2 36                      283   7e-92    
gb|KDO63347.1|  hypothetical protein CISIN_1g031320mg                   277   5e-90    
gb|KDO63346.1|  hypothetical protein CISIN_1g031320mg                   276   6e-90    
ref|XP_002958782.1|  hypothetical protein VOLCADRAFT_84644              276   1e-89    
ref|XP_001690010.1|  predicted protein                                  276   1e-89    Chlamydomonas reinhardtii
ref|XP_006442521.1|  hypothetical protein CICLE_v10022662mg             275   2e-89    
ref|XP_006442519.1|  hypothetical protein CICLE_v10022662mg             274   8e-89    
ref|XP_002982217.1|  ubiquitin-conjugating enzyme 35, E2                274   1e-88    
ref|XP_008779001.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    271   5e-88    
ref|NP_001235245.1|  uncharacterized protein LOC100306707               270   2e-87    
ref|XP_005846325.1|  hypothetical protein CHLNCDRAFT_36102              270   3e-87    
ref|XP_007133201.1|  hypothetical protein PHAVU_011G160100g             270   3e-87    
ref|XP_002992245.1|  ubiquitin-conjugating enzyme 35, E2                270   4e-87    
ref|XP_008654942.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    267   2e-86    
ref|XP_004969502.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    269   3e-86    
ref|XP_002502504.1|  predicted protein                                  266   7e-86    Micromonas commoda
ref|XP_003056933.1|  predicted protein                                  262   3e-84    
gb|KFM24655.1|  Ubiquitin-conjugating enzyme E2 36                      261   6e-84    
emb|CDH58346.1|  ubiquitin conjugating enzyme                           261   9e-84    
ref|XP_004956558.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    260   1e-83    
gb|KDO63345.1|  hypothetical protein CISIN_1g031320mg                   261   1e-83    
ref|XP_003748080.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    259   3e-83    
ref|XP_010779820.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       259   4e-83    
ref|XP_004748607.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    259   4e-83    
ref|XP_007435778.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       259   4e-83    
pdb|2C2V|B  Chain B, Crystal Structure Of The Chip-Ubc13-Uev1a Co...    258   1e-82    
ref|NP_001012828.1|  ubiquitin-conjugating enzyme E2 N                  258   1e-82    Gallus gallus [bantam]
ref|XP_007545597.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       258   1e-82    
gb|KFM63508.1|  Ubiquitin-conjugating enzyme E2 N                       258   1e-82    
ref|NP_003339.1|  ubiquitin-conjugating enzyme E2 N                     258   2e-82    Homo sapiens [man]
pdb|3HCT|B  Chain B, Crystal Structure Of Traf6 In Complex With U...    258   2e-82    
ref|XP_006543032.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    259   2e-82    
ref|XP_001623427.1|  predicted protein                                  258   2e-82    Nematostella vectensis
gb|AAP36228.1|  Homo sapiens ubiquitin-conjugating enzyme E2N (UB...    257   3e-82    
ref|NP_998651.1|  ubiquitin-conjugating enzyme E2 N                     257   3e-82    Danio rerio [leopard danio]
ref|XP_006747857.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    257   3e-82    
ref|XP_004006306.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    257   3e-82    
ref|NP_989375.1|  ubiquitin-conjugating enzyme E2 N                     257   3e-82    Xenopus tropicalis [western clawed frog]
pdb|4ORH|B  Chain B, Crystal Structure Of Rnf8 Bound To The Ubc13...    257   3e-82    
pdb|4IP3|B  Chain B, Complex Structure Of Ospi And Ubc13                258   4e-82    
pdb|3VON|C  Chain C, Crystalstructure Of The Ubiquitin Protease         257   4e-82    
gb|KFH72712.1|  ubiquitin-conjugating enzyme E2 36                      257   4e-82    
gb|EGT53848.1|  CBN-UBC-13 protein                                      257   4e-82    
ref|XP_005797246.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    257   4e-82    
tpg|DAA34583.1|  TPA: ubiquitin protein ligase                          257   4e-82    
gb|ACH46291.1|  putative ubiquitin-conjugating enzyme E2N               256   5e-82    Taeniopygia guttata
ref|XP_004623156.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    256   5e-82    
ref|NP_446380.1|  ubiquitin-conjugating enzyme E2 N                     256   6e-82    Rattus norvegicus [brown rat]
gb|EDK98464.1|  mCG1038069                                              258   6e-82    
ref|XP_003440565.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    256   7e-82    
gb|EFX70655.1|  hypothetical protein DAPPUDRAFT_309332                  256   8e-82    
ref|NP_956636.1|  ubiquitin-conjugating enzyme E2Nb                     256   8e-82    Danio rerio [leopard danio]
ref|XP_002634988.1|  C. briggsae CBR-UBC-13 protein                     256   8e-82    Caenorhabditis briggsae
ref|XP_005802310.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    256   8e-82    
pdb|4NRI|B  Chain B, Crystal Structure Of A Human Mms2/ubc13 A122...    256   9e-82    
gb|ACM08830.1|  Ubiquitin-conjugating enzyme E2 N                       256   1e-81    Salmo salar
ref|XP_006007468.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       256   1e-81    
ref|XP_010888621.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       256   1e-81    
ref|NP_001080830.1|  ubiquitin-conjugating enzyme E2N                   256   1e-81    Xenopus laevis [clawed frog]
ref|XP_010862500.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    255   1e-81    
dbj|BAB24239.1|  unnamed protein product                                255   1e-81    Mus musculus [mouse]
ref|XP_002733137.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    255   1e-81    Saccoglossus kowalevskii
ref|NP_001271807.1|  ubiquitin-conjugating enzyme E2 N                  255   2e-81    
ref|XP_004548237.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    255   2e-81    
ref|XP_008313970.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       255   2e-81    
gb|AIT40204.1|  Ubiquitin protein ligase Ubc13                          255   2e-81    
ref|XP_010784120.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       255   2e-81    
ref|XP_004563518.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    255   2e-81    
emb|CDJ82209.1|  Ubiquitin-conjugating enzyme domain containing p...    254   3e-81    
pdb|4NRG|B  Chain B, Crystal Structure Of A Human Mms2/ubc13 D118...    255   3e-81    
ref|NP_500272.2|  Protein UBC-13                                        254   3e-81    Caenorhabditis elegans [roundworm]
ref|XP_004069764.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    254   3e-81    
gb|ABQ12946.1|  ubiquitin-conjugating enzyme E2N-like                   254   3e-81    Bos taurus [bovine]
ref|XP_003972864.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    254   4e-81    
pdb|4NR3|B  Chain B, Crystal Structure Of A Human Mms2/ubc13 L121...    254   4e-81    
ref|XP_008281153.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    254   4e-81    
gb|KHJ97097.1|  ubiquitin--protein ligase                               254   5e-81    
ref|XP_003096237.1|  CRE-UBC-13 protein                                 254   5e-81    
ref|XP_007092043.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    254   5e-81    
ref|XP_004663760.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    254   5e-81    
ref|XP_003445019.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    254   5e-81    
ref|XP_003433156.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    254   6e-81    
ref|XP_642773.2|  hypothetical protein DDB_G0277267                     254   7e-81    Dictyostelium discoideum AX4
gb|AJA90882.1|  ubiquitin-conjugating enzyme UBE2N                      254   7e-81    
gb|ADO27889.1|  ubiquitin-conjugating enzyme e2 n                       254   7e-81    
ref|XP_008843971.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    254   7e-81    
gb|ETS64227.1|  hypothetical protein PaG_01468                          253   7e-81    
gb|EYC34553.1|  hypothetical protein Y032_0001g467                      258   7e-81    
gb|EYC34551.1|  hypothetical protein Y032_0001g467                      258   7e-81    
ref|NP_001191642.1|  ubiquitin-conjugating enzyme E2N                   254   8e-81    
ref|XP_010735993.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       253   9e-81    
ref|XP_001897862.1|  ubiquitin conjugating enzyme protein 13            253   1e-80    Brugia malayi [agent of lymphatic filariasis]
ref|XP_010746165.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    253   1e-80    
emb|CCF50472.1|  probable ubiquitin-conjugating enzyme E2               253   1e-80    
ref|XP_010746164.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    253   1e-80    
ref|XP_004703811.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    253   1e-80    
ref|XP_004053723.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       253   1e-80    
ref|XP_009437632.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-co...    253   1e-80    
ref|NP_001154123.1|  ubiquitin-conjugating enzyme E2N                   253   2e-80    Oncorhynchus mykiss
ref|XP_002163965.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    253   2e-80    
ref|XP_002400703.1|  ubiquitin protein ligase, putative                 252   2e-80    Ixodes scapularis [blacklegged tick]
emb|CCA23248.1|  ubiquitinconjugating enzyme E2 putative                252   2e-80    
ref|XP_003139291.1|  ubiquitin conjugating enzyme protein 13            252   2e-80    
ref|XP_009011004.1|  hypothetical protein HELRODRAFT_185270             252   2e-80    
ref|XP_007876953.1|  hypothetical protein PFL1_01259                    252   3e-80    
emb|CCI44256.1|  unnamed protein product                                252   3e-80    
gb|ACO14311.1|  Ubiquitin-conjugating enzyme E2 N                       252   3e-80    Esox lucius
gb|EIE79235.1|  ubiquitin-conjugating enzyme E2 N                       252   3e-80    
ref|XP_003899705.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    252   4e-80    
gb|AAN16046.1|  ubiquitin-conjugating enzyme E2                         252   4e-80    Pavlova lutheri
ref|XP_005446379.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       253   4e-80    
ref|XP_002601727.1|  hypothetical protein BRAFLDRAFT_215251             251   4e-80    Branchiostoma floridae
dbj|GAC95856.1|  hypothetical protein PHSY_003433                       251   4e-80    
ref|XP_007885138.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       251   5e-80    
ref|XP_004404828.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    251   5e-80    
ref|XP_006442524.1|  hypothetical protein CICLE_v10022662mg             250   5e-80    
ref|XP_002998695.1|  ubiquitin-conjugating enzyme E2, putative          251   5e-80    
ref|XP_002128362.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    251   5e-80    Ciona intestinalis [sea vase]
ref|XP_001950288.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       251   5e-80    Acyrthosiphon pisum
dbj|GAM24195.1|  hypothetical protein SAMD00019534_073700               251   6e-80    
gb|EPB87495.1|  ubiquitin-conjugating enzyme E2 N                       251   7e-80    
ref|XP_007534789.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    251   7e-80    
ref|XP_004355325.1|  putative ubiquitin-conjugating enzyme E2           251   8e-80    
gb|EYC34552.1|  hypothetical protein Y032_0001g467                      256   8e-80    
ref|XP_005068072.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       251   8e-80    
ref|XP_008501818.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       251   8e-80    
ref|XP_008606915.1|  ubiquitin-conjugating enzyme E2 35                 251   9e-80    
gb|EFA75916.1|  putative ubiquitin-conjugating enzyme E2                251   9e-80    Polysphondylium pallidum PN500
ref|XP_007907199.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       251   1e-79    
ref|XP_003475937.2|  PREDICTED: ubiquitin-conjugating enzyme E2 N       255   1e-79    
ref|XP_003370281.1|  putative ubiquitin--protein ligase                 251   1e-79    
emb|CBQ68322.1|  probable ubiquitin-conjugating enzyme E2               250   1e-79    
ref|XP_009000800.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    250   1e-79    
ref|NP_849678.1|  ubiquitin-conjugating enzyme E2 36                    249   1e-79    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001134669.1|  ubiquitin-conjugating enzyme E2N                   250   2e-79    Salmo salar
gb|ERG85476.1|  ubiquitin-conjugating enzyme e2 n                       250   2e-79    
ref|XP_009867395.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       250   2e-79    
ref|XP_008871705.1|  ubiquitin-conjugating enzyme E2 N                  250   2e-79    
ref|XP_004647640.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    250   2e-79    
ref|XP_008908532.1|  ubiquitin-conjugating enzyme E2 N                  250   2e-79    
gb|KEP54506.1|  putative ubiquitin-conjugating enzyme E2                250   2e-79    
emb|CEJ04847.1|  Putative Ubiquitin-conjugating enzyme E2 N             250   2e-79    
ref|XP_009002292.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    250   2e-79    
dbj|GAM27414.1|  hypothetical protein SAMD00019534_105900               249   2e-79    
gb|EHJ76453.1|  ubiquitin conjugating enzyme E2                         249   2e-79    
ref|XP_011098229.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    248   2e-79    
ref|XP_009904317.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       250   3e-79    
gb|ACO10418.1|  Ubiquitin-conjugating enzyme E2 N                       249   4e-79    Caligus rogercresseyi
gb|KDE02787.1|  ubiquitin-conjugating enzyme E2 35                      249   4e-79    
emb|CCO30017.1|  ubiquitin-conjugating enzyme E2 N                      249   4e-79    
ref|XP_005879986.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    249   5e-79    
ref|NP_001040393.1|  ubiquitin conjugating enzyme E2                    249   5e-79    Bombyx mori [silk moth]
ref|XP_008487583.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       249   5e-79    
ref|XP_001897800.1|  Ubiquitin conjugating enzyme protein 13            249   5e-79    Brugia malayi [agent of lymphatic filariasis]
ref|XP_005242751.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       250   6e-79    
gb|ACO12818.1|  Ubiquitin-conjugating enzyme E2 N                       249   6e-79    Lepeophtheirus salmonis
ref|XP_006580942.1|  PREDICTED: uncharacterized protein LOC100500...    247   7e-79    
ref|XP_008793013.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    247   7e-79    
ref|XP_008226527.1|  PREDICTED: ubiquitin-conjugating enzyme E2 36      247   8e-79    
ref|XP_005177679.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    248   8e-79    
emb|CEG67091.1|  Putative Ubiquitin-conjugating enzyme E2 N             248   9e-79    
emb|CAG03424.1|  unnamed protein product                                248   1e-78    Tetraodon nigroviridis
gb|EFW44266.2|  ubiquitin-conjugating enzyme E2N                        248   1e-78    
gb|ESA03064.1|  hypothetical protein GLOINDRAFT_245832                  248   1e-78    
ref|XP_010376504.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    248   1e-78    
ref|XP_004855009.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    248   1e-78    
ref|XP_001995588.1|  GH17677                                            248   2e-78    Drosophila grimshawi
ref|XP_005480838.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       250   2e-78    
ref|XP_001848064.1|  ubiquitin-conjugating enzyme E2-17 kDa             248   2e-78    Culex quinquefasciatus
emb|CBN73785.1|  conserved unknown protein                              248   2e-78    
gb|ADD24379.1|  Ubiquitin-conjugating enzyme E2 N                       247   2e-78    Lepeophtheirus salmonis
ref|XP_009835207.1|  ubiquitin-conjugating enzyme E2 N                  247   2e-78    
ref|XP_008544110.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       247   2e-78    
ref|XP_006591826.1|  PREDICTED: uncharacterized protein LOC100306...    246   2e-78    
gb|KDR13781.1|  Ubiquitin-conjugating enzyme E2 N                       247   2e-78    
ref|XP_314098.2|  AGAP005197-PA                                         247   2e-78    Anopheles gambiae str. PEST
ref|XP_001649243.1|  ubiquitin conjugating enzyme, putative             247   3e-78    Aedes aegypti
ref|XP_004529640.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    247   3e-78    
ref|XP_008310204.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    247   3e-78    
ref|XP_009462264.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       247   3e-78    
gb|AGO46417.1|  ubiquitin conjugating enzyme                            247   3e-78    
ref|XP_008535902.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       248   3e-78    
ref|XP_001966839.1|  GF19231                                            247   3e-78    Drosophila ananassae
gb|KFB50838.1|  ubiquitin conjugating enzyme, putative                  247   4e-78    
gb|EHB17665.1|  Ubiquitin-conjugating enzyme E2 N                       247   4e-78    
ref|NP_511150.1|  bendless, isoform A                                   246   4e-78    
ref|XP_004888483.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    246   4e-78    
ref|XP_001994339.1|  GH22592                                            246   4e-78    
ref|XP_969360.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N          246   4e-78    
ref|XP_010210974.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       249   4e-78    
ref|XP_011056198.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       246   5e-78    
ref|XP_001606785.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       246   5e-78    
ref|XP_392901.2|  PREDICTED: ubiquitin-conjugating enzyme E2 N          246   5e-78    
ref|XP_002432584.1|  ubiquitin-conjugating enzyme E2-17 kDa, puta...    247   6e-78    
ref|XP_010187574.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       246   6e-78    
gb|EDL33433.1|  mCG1049276                                              246   6e-78    
ref|XP_007991737.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    246   6e-78    
gb|ETN65000.1|  ubiquitin-conjugating enzyme E2-17 kDa                  246   7e-78    
gb|ACO15432.1|  Ubiquitin-conjugating enzyme E2 N                       246   8e-78    
gb|EMG46302.1|  Ubiquitin carrier protein                               246   8e-78    
ref|XP_005679873.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       246   9e-78    
ref|XP_007527641.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    246   9e-78    
gb|ACO10809.1|  Ubiquitin-conjugating enzyme E2 N                       246   9e-78    
ref|XP_003471038.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    246   9e-78    
ref|XP_006154895.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    245   1e-77    
ref|XP_010381547.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    246   1e-77    
ref|XP_010803135.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    246   1e-77    
ref|XP_002111946.1|  conserved hypothetical protein                     246   1e-77    
ref|XP_009919188.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       245   1e-77    
ref|XP_007104214.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       245   1e-77    
ref|XP_002921829.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    245   1e-77    
ref|XP_004718170.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-co...    246   1e-77    
ref|XP_010130299.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       246   1e-77    
ref|XP_009064993.1|  hypothetical protein LOTGIDRAFT_236339             245   1e-77    
ref|XP_009693331.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       246   1e-77    
gb|EDL14771.1|  mCG48878                                                245   1e-77    
ref|XP_008142066.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       245   1e-77    
gb|ENN74247.1|  hypothetical protein YQE_09219                          245   1e-77    
dbj|GAA93847.1|  hypothetical protein E5Q_00493                         245   2e-77    
ref|XP_006154896.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    244   2e-77    
ref|XP_006112412.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       246   2e-77    
ref|XP_003783533.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    246   2e-77    
ref|XP_007668319.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       245   2e-77    
ref|XP_002010815.1|  GI21493                                            245   2e-77    
ref|XP_006999136.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-co...    245   2e-77    
ref|XP_009880955.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       245   2e-77    
ref|XP_003434588.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    244   2e-77    
ref|XP_002680813.1|  predicted protein                                  244   2e-77    
ref|XP_009002612.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    244   2e-77    
ref|XP_005508391.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       245   2e-77    
ref|XP_002054991.1|  GJ19035                                            244   2e-77    
ref|XP_010006364.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       245   2e-77    
ref|XP_001094543.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    244   2e-77    
gb|KFV71489.1|  Ubiquitin-conjugating enzyme E2 N                       244   3e-77    
ref|XP_004884213.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    245   3e-77    
ref|XP_005312709.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    244   3e-77    
ref|XP_008685974.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       246   3e-77    
ref|XP_004602889.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       245   3e-77    
ref|XP_006736438.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    246   3e-77    
ref|XP_006154894.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    244   3e-77    
ref|XP_006195898.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-co...    244   3e-77    
ref|XP_005374520.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    244   3e-77    
ref|XP_006456168.1|  hypothetical protein AGABI2DRAFT_195393            244   3e-77    
ref|XP_008634905.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       244   4e-77    
ref|XP_010201907.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       244   4e-77    
ref|XP_004748608.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    244   4e-77    
ref|XP_010152752.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-co...    244   4e-77    
ref|XP_007331589.1|  hypothetical protein AGABI1DRAFT_115008            244   4e-77    
ref|XP_010082084.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       244   4e-77    
gb|EHB03436.1|  Ubiquitin-conjugating enzyme E2 N                       244   5e-77    
ref|XP_008944185.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       244   5e-77    
emb|CCE33523.1|  probable ubiquitin-conjugating enzyme E2               244   5e-77    
ref|XP_009938453.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       244   5e-77    
ref|XP_005039975.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       245   5e-77    
ref|XP_005853639.1|  ubiquitin-conjugating enzyme E2 N                  244   5e-77    
ref|XP_003989194.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       244   5e-77    
ref|XP_010309067.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       243   5e-77    
ref|XP_008051354.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       243   6e-77    
ref|XP_007622588.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    244   6e-77    
ref|XP_006903742.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-co...    243   6e-77    
ref|XP_006871870.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       246   6e-77    
ref|XP_009319635.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       246   6e-77    
ref|XP_004855505.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    249   6e-77    
ref|XP_005012459.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       244   6e-77    
ref|XP_010365660.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    243   7e-77    
ref|XP_009964601.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       243   7e-77    
ref|XP_010124488.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       245   7e-77    
ref|XP_008932919.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       244   8e-77    
ref|XP_009558248.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       244   8e-77    
gb|ERE91444.1|  ubiquitin-conjugating enzyme E2 N-like protein          243   8e-77    
ref|XP_009948167.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       243   8e-77    
ref|XP_004083189.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    244   8e-77    
ref|XP_005705643.1|  ubiquitin-conjugating enzyme E2                    243   8e-77    
ref|XP_006514407.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    244   8e-77    
ref|XP_008040992.1|  ubiquitin-conjugating enzyme                       243   1e-76    
ref|XP_005606779.1|  PREDICTED: ubiquitin-conjugating enzyme E2 E3      248   1e-76    
gb|ELT96147.1|  hypothetical protein CAPTEDRAFT_21625                   243   1e-76    
ref|XP_008980113.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    243   1e-76    
gb|KDD75749.1|  ubiquitin-conjugating enzyme                            243   1e-76    
ref|XP_007166164.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       245   1e-76    
ref|XP_005072671.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    243   1e-76    
ref|XP_004908052.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    248   1e-76    
ref|XP_010385106.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    243   1e-76    
ref|XP_007365648.1|  ubiquitin-conjugating enzyme                       243   1e-76    
ref|XP_003967331.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    243   1e-76    
gb|EMS19762.1|  ubiquitin-conjugating enzyme E2 N                       243   2e-76    
ref|XP_007774369.1|  ubiquitin-conjugating enzyme                       242   2e-76    
gb|KDQ23081.1|  hypothetical protein PLEOSDRAFT_1068145                 242   2e-76    
ref|XP_005421708.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       243   2e-76    
ref|XP_009672896.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       244   2e-76    
gb|KFH47056.1|  Ubiquitin-conjugating enzyme E2-like protein            242   2e-76    
ref|XP_003506408.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    244   2e-76    
ref|XP_004837969.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    242   2e-76    
ref|XP_010710203.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       244   2e-76    
ref|XP_004631785.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    242   3e-76    
gb|EHB16394.1|  Ubiquitin-conjugating enzyme E2 N                       242   3e-76    
emb|CEF66110.1|  Ubiquitin-conjugating enzyme, E2 domain and Ubiq...    241   3e-76    
ref|XP_007403126.1|  hypothetical protein PHACADRAFT_266419             242   3e-76    
ref|XP_002850461.1|  ubiquitin-conjugating enzyme E2                    241   3e-76    
ref|XP_004332429.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-co...    242   3e-76    
ref|XP_002490939.1|  Ubiquitin-conjugating enzyme involved in the...    241   4e-76    
ref|XP_851403.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N-like     244   4e-76    
ref|XP_010627528.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       244   4e-76    
ref|XP_003026854.1|  hypothetical protein SCHCODRAFT_79547              241   4e-76    
ref|XP_007311250.1|  ubiquitin-conjugating enzyme                       241   5e-76    
ref|XP_007743607.1|  ubiquitin-conjugating enzyme E2 35                 241   6e-76    
gb|EHB18396.1|  Ubiquitin-conjugating enzyme E2 N                       241   6e-76    
emb|CCU97775.1|  unnamed protein product                                241   6e-76    
ref|XP_007355987.1|  ubiquitin-conjugating enzyme                       241   6e-76    
gb|KID75425.1|  ubiquitin-conjugating enzyme E2 13                      241   6e-76    
emb|CCM01267.1|  predicted protein                                      241   7e-76    
gb|EFX02799.1|  ubiquitin conjugating enzyme                            241   7e-76    
ref|XP_003177319.1|  ubiquitin-conjugating enzyme E2                    241   7e-76    
ref|XP_003435342.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       241   8e-76    
ref|XP_007755257.1|  ubiquitin-conjugating enzyme E2 35                 241   9e-76    
ref|XP_007848149.1|  ubiquitin-conjugating enzyme e2                    243   9e-76    
ref|XP_006691843.1|  putative ubiquitin carrier protein                 241   9e-76    
ref|XP_008602970.1|  ubiquitin-conjugating enzyme                       240   9e-76    
ref|XP_007726509.1|  ubiquitin-conjugating enzyme E2 35                 240   9e-76    
ref|XP_005877091.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       240   1e-75    
gb|KHJ32973.1|  putative ubiquitin conjugating enzyme                   240   1e-75    
gb|KEY68800.1|  hypothetical protein S7711_00668                        240   1e-75    
emb|CCA68374.1|  probable ubiquitin-conjugating enzyme E2               240   1e-75    
ref|XP_007817012.1|  ubiquitin-conjugating enzyme E2 13                 240   1e-75    
ref|XP_004644292.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    241   1e-75    
ref|XP_716832.1|  hypothetical protein CaO19.8548                       241   1e-75    
ref|XP_710134.1|  hypothetical protein CaO19.2225                       241   1e-75    
gb|KGQ09916.1|  Ubiquitin-conjugating enzyme E2 35                      240   1e-75    
ref|XP_009227920.1|  ubiquitin-conjugating enzyme E2 35                 240   1e-75    
ref|XP_001524698.1|  ubiquitin-conjugating enzyme E2 13                 240   1e-75    
gb|EKC32667.1|  Ubiquitin-conjugating enzyme E2 N                       240   2e-75    
ref|XP_009282776.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       244   2e-75    
ref|XP_002420362.1|  ubiquitin-conjugating enzyme, putative; ubiq...    240   2e-75    
ref|XP_008021687.1|  hypothetical protein SETTUDRAFT_166868             239   2e-75    
ref|XP_001883016.1|  predicted protein                                  239   2e-75    
ref|XP_004195004.1|  Piso0_005534                                       240   2e-75    
emb|CEJ86749.1|  Putative Ubiquitin-conjugating enzyme E2 13            239   2e-75    
gb|EST06884.1|  ubiquitin-conjugating enzyme                            239   2e-75    
gb|KDB15867.1|  ubiquitin-conjugating enzyme E2 13                      240   2e-75    
ref|XP_003639557.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    246   2e-75    
gb|KEF61204.1|  ubiquitin-conjugating enzyme E2 35                      239   2e-75    
gb|EHH21072.1|  hypothetical protein EGK_04055                          239   2e-75    
gb|KFY96432.1|  hypothetical protein V500_02444                         239   3e-75    
ref|XP_747835.1|  ubiquitin conjugating enzyme (UbcM)                   239   3e-75    
ref|XP_007736546.1|  ubiquitin-conjugating enzyme E2 N                  239   3e-75    
gb|ENH77777.1|  ubiquitin conjugating enzyme                            239   3e-75    
ref|XP_007587517.1|  putative ubiquitin conjugating enzyme protein      239   3e-75    
ref|XP_007869933.1|  ubiquitin-conjugating enzyme                       239   3e-75    
ref|XP_009157305.1|  ubiquitin-conjugating enzyme E2 35                 239   3e-75    
ref|XP_009656196.1|  ubiquitin-conjugating enzyme                       239   4e-75    
ref|XP_001257428.1|  ubiquitin conjugating enzyme (UbcM), putative      239   4e-75    
gb|KFM60983.1|  Ubiquitin-conjugating enzyme E2 N                       239   4e-75    
ref|XP_002143449.1|  ubiquitin conjugating enzyme (UbcM), putative      239   4e-75    
ref|XP_006777618.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    238   4e-75    
ref|XP_001395832.1|  ubiquitin-conjugating enzyme E2 N                  239   4e-75    
ref|XP_010409250.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       245   4e-75    
emb|CAG12069.1|  unnamed protein product                                239   4e-75    
gb|EMT17712.1|  Ubiquitin carrier protein E2 36                         250   4e-75    
ref|XP_007388133.1|  ubiquitin-conjugating enzyme                       239   4e-75    
gb|KHC59666.1|  ubiquitin-conjugating enzyme E2 13                      239   5e-75    
ref|XP_002836384.1|  hypothetical protein                               238   5e-75    
ref|XP_006446780.1|  hypothetical protein CICLE_v10017059mg             238   5e-75    
gb|KEZ39222.1|  Ubiquitin--protein ligase                               238   5e-75    
ref|XP_004196092.1|  Piso0_005534                                       239   5e-75    
ref|XP_007277983.1|  ubiquitin conjugating enzyme                       238   6e-75    
gb|KFY15654.1|  hypothetical protein V492_01851                         238   7e-75    
ref|XP_002550972.1|  ubiquitin-conjugating enzyme E2 13                 238   7e-75    
gb|KDQ55504.1|  hypothetical protein JAAARDRAFT_37517                   238   7e-75    
ref|XP_001209896.1|  ubiquitin-conjugating enzyme E2-17 kDa             238   7e-75    
emb|CCF37739.1|  ubiquitin-conjugating enzyme E2 35                     238   7e-75    
ref|XP_007595669.1|  ubiquitin-conjugating enzyme E2 35                 238   7e-75    
ref|XP_002544965.1|  ubiquitin-conjugating enzyme E2 N                  238   7e-75    
gb|AFR95672.2|  ubiquitin-conjugating enzyme E2 35                      238   8e-75    
ref|XP_964107.1|  ubiquitin-conjugating enzyme E2 13                    238   8e-75    
gb|EPS97145.1|  hypothetical protein FOMPIDRAFT_83057                   238   9e-75    
ref|XP_003069293.1|  Ubiquitin-conjugating enzyme E2, putative          238   9e-75    
ref|XP_005860279.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    238   9e-75    
ref|XP_007944336.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N       238   9e-75    
gb|EPS28438.1|  hypothetical protein PDE_03384                          238   9e-75    
ref|XP_003053164.1|  predicted protein                                  238   1e-74    
gb|KDN72382.1|  putative ubiquitin-conjugating enzyme                   238   1e-74    
gb|EPE05535.1|  ubiquitin-conjugating enzyme e2 13                      238   1e-74    
ref|XP_007294382.1|  ubiquitin-conjugating enzyme E2                    242   1e-74    
gb|ELR07552.1|  ubiquitin-conjugating enzyme E2 N                       238   1e-74    
ref|XP_004563517.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    238   1e-74    
ref|XP_009552747.1|  hypothetical protein HETIRDRAFT_446925             238   1e-74    
gb|EKG18090.1|  Ubiquitin-conjugating enzyme E2                         238   1e-74    
ref|XP_795646.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N-like     238   1e-74    
ref|XP_007534451.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    238   1e-74    
ref|XP_007006727.1|  hypothetical protein TREMEDRAFT_40481              238   1e-74    
gb|EFQ26788.1|  ubiquitin-conjugating enzyme                            238   1e-74    
gb|EPQ65044.1|  hypothetical protein BGT96224_A21102                    238   1e-74    
ref|XP_001935930.1|  ubiquitin-conjugating enzyme E2 N                  237   1e-74    
gb|EGU77718.1|  hypothetical protein FOXB_11740                         237   1e-74    
ref|XP_001823886.1|  ubiquitin-conjugating enzyme E2 N                  237   2e-74    
ref|XP_007261695.1|  ubiquitin-conjugating enzyme                       237   2e-74    
ref|XP_007781763.1|  ubiquitin-conjugating enzyme E2 13                 237   2e-74    
ref|XP_001481934.1|  hypothetical protein PGUG_05697                    237   2e-74    
ref|XP_006781203.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    239   2e-74    
ref|XP_001798158.1|  hypothetical protein SNOG_07831                    237   2e-74    
gb|KFY79805.1|  hypothetical protein V499_01238                         237   2e-74    
ref|XP_003352899.1|  hypothetical protein SMAC_05013                    237   2e-74    
emb|CEF76932.1|  unnamed protein product                                238   2e-74    
ref|XP_003758414.1|  PREDICTED: ubiquitin-conjugating enzyme E2 N...    238   2e-74    
ref|XP_001550431.1|  conserved hypothetical protein                     237   2e-74    
gb|ESZ92406.1|  ubiquitin-conjugating enzyme E2                         237   2e-74    



>ref|XP_006370167.1| ubiquitin-conjugating enzyme family protein [Populus trichocarpa]
 ref|XP_010060692.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Eucalyptus grandis]
 ref|XP_010108244.1| Ubiquitin-conjugating enzyme E2 35 [Morus notabilis]
 gb|ABK93279.1| unknown [Populus trichocarpa]
 gb|ABK93666.1| unknown [Populus trichocarpa]
 gb|ABK94188.1| unknown [Populus trichocarpa]
 gb|ABK94347.1| unknown [Populus trichocarpa]
 gb|ERP66736.1| ubiquitin-conjugating enzyme family protein [Populus trichocarpa]
 gb|EXC18484.1| Ubiquitin-conjugating enzyme E2 35 [Morus notabilis]
Length=153

 Score =   316 bits (810),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/153 (100%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  153



>ref|XP_007021721.1| Ubiquitin-conjugating enzyme 36 isoform 1 [Theobroma cacao]
 gb|EOY13246.1| Ubiquitin-conjugating enzyme 36 isoform 1 [Theobroma cacao]
Length=204

 Score =   317 bits (813),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 153/154 (99%), Positives = 153/154 (99%), Gaps = 0/154 (0%)
 Frame = -3

Query  795  SMANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELF  616
            SMANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELF
Sbjct  51   SMANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELF  110

Query  615  LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP  436
            LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP
Sbjct  111  LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP  170

Query  435  DDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DDPLSENIAKHWKTNE EAVETAKEWTRLYASGA
Sbjct  171  DDPLSENIAKHWKTNEAEAVETAKEWTRLYASGA  204



>ref|XP_010924615.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Elaeis guineensis]
Length=153

 Score =   315 bits (807),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLS+NIAKHWKTNEVEAVETAKEWTRLYASGA
Sbjct  121  DPLSDNIAKHWKTNEVEAVETAKEWTRLYASGA  153



>ref|NP_001274306.1| ubiquitin-conjugating enzyme E2 35-like [Solanum lycopersicum]
 ref|XP_004489035.1| PREDICTED: ubiquitin-conjugating enzyme E2 35-like [Cicer arietinum]
 gb|AHA42248.1| Fen-interacting protein 3 [Solanum lycopersicum]
Length=153

 Score =   315 bits (807),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWK+NEVEAVETAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKSNEVEAVETAKEWTRLYASGA  153



>ref|NP_001267560.1| ubiquitin-conjugating enzyme E2 35-like [Cucumis sativus]
 ref|NP_001275770.1| ubiquitin-conjugating enzyme 13 [Citrus sinensis]
 ref|XP_002285421.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Vitis vinifera]
 ref|XP_002523377.1| Ubiquitin-conjugating enzyme E2 N, putative [Ricinus communis]
 ref|XP_004156510.1| PREDICTED: ubiquitin-conjugating enzyme E2 35-like [Cucumis sativus]
 ref|XP_006442522.1| hypothetical protein CICLE_v10022662mg [Citrus clementina]
 ref|XP_008451766.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Cucumis melo]
 ref|XP_009416513.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Musa acuminata 
subsp. malaccensis]
 ref|XP_010531930.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Tarenaya hassleriana]
 ref|XP_010539610.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Tarenaya hassleriana]
 ref|XP_010644126.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Vitis vinifera]
 ref|XP_011082757.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Sesamum indicum]
 gb|EEF38956.1| Ubiquitin-conjugating enzyme E2 N, putative [Ricinus communis]
 gb|ACV72277.1| ubiquitin-conjugating enzyme 13 [Citrus sinensis]
 gb|ADI76991.1| putative ubiquitin-conjugating enzyme [Cucumis sativus]
 gb|ADI76992.1| putative ubiquitin-conjugating enzyme [Cucumis sativus]
 emb|CBI20200.3| unnamed protein product [Vitis vinifera]
 gb|ADV04063.1| protein binding/ubiquitin-protein ligase 2 [Hevea brasiliensis]
 gb|AGQ57016.1| ubiquitin-conjugating enzyme E2N [Hevea brasiliensis]
 gb|ESR55762.1| hypothetical protein CICLE_v10022662mg [Citrus clementina]
 gb|KDO44641.1| hypothetical protein CISIN_1g031783mg [Citrus sinensis]
 gb|KDP32529.1| hypothetical protein JCGZ_14732 [Jatropha curcas]
 gb|KGN53563.1| hypothetical protein Csa_4G082400 [Cucumis sativus]
 gb|KHG24866.1| Ubiquitin-conjugating enzyme E2 35 -like protein [Gossypium arboreum]
Length=153

 Score =   315 bits (807),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWKTNE EAVETAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKTNEAEAVETAKEWTRLYASGA  153



>gb|ABK24341.1| unknown [Picea sitchensis]
 gb|ABK25864.1| unknown [Picea sitchensis]
 gb|ACN41228.1| unknown [Picea sitchensis]
Length=153

 Score =   314 bits (804),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MAN+NLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANANLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWKTNE EAVETAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKTNEAEAVETAKEWTRLYASGA  153



>ref|NP_001275211.1| ubiquitin-conjugating enzyme E2 36-like [Solanum tuberosum]
 gb|AFK36220.1| unknown [Lotus japonicus]
 gb|AFX66994.1| ubiquitin-conjugating enzyme E2 36 [Solanum tuberosum]
Length=153

 Score =   313 bits (803),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWK+NEVEAVETAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKSNEVEAVETAKEWTRLYASGA  153



>ref|NP_001241639.1| uncharacterized protein LOC100805631 [Glycine max]
 ref|XP_002887758.1| ubiquitin-conjugating enzyme 1 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_009598970.1| PREDICTED: ubiquitin-conjugating enzyme E2 35 [Nicotiana tomentosiformis]
 ref|XP_009761934.1| PREDICTED: ubiquitin-conjugating enzyme E2 35 [Nicotiana sylvestris]
 gb|AAZ20286.1| ubiquitin-conjugating enzyme 1 [Arachis hypogaea]
 gb|ACJ86036.1| unknown [Medicago truncatula]
 gb|ACU14785.1| unknown [Glycine max]
 gb|ACU20984.1| unknown [Glycine max]
 gb|EFH64017.1| ubiquitin-conjugating enzyme 1 [Arabidopsis lyrata subsp. lyrata]
 gb|AFC01194.1| ubiquitin-conjugating enzyme [Ammopiptanthus mongolicus]
 gb|AFK33708.1| unknown [Medicago truncatula]
 gb|AHA42249.1| Fen-interacting protein 3 [Nicotiana benthamiana]
 emb|CDP06001.1| unnamed protein product [Coffea canephora]
 gb|AIE54300.1| ubiquitin-conjugating enzyme E2 35-like protein [Nicotiana tabacum]
 gb|KHN36878.1| Ubiquitin-conjugating enzyme E2 35 [Glycine soja]
Length=153

 Score =   313 bits (803),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWK+NE EAVETAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKSNEAEAVETAKEWTRLYASGA  153



>ref|XP_010279114.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Nelumbo nucifera]
Length=153

 Score =   313 bits (802),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWKTNE EAVETAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKTNEAEAVETAKEWTRLYASGA  153



>ref|XP_006389951.1| hypothetical protein EUTSA_v10019278mg [Eutrema salsugineum]
 gb|ESQ27237.1| hypothetical protein EUTSA_v10019278mg [Eutrema salsugineum]
Length=153

 Score =   313 bits (802),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVM+LGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMVLGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWK+NE EAVETAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKSNEAEAVETAKEWTRLYASGA  153



>ref|XP_002316867.1| ubiquitin-conjugating enzyme family protein [Populus trichocarpa]
 ref|XP_010062810.1| PREDICTED: ubiquitin-conjugating enzyme E2 35 [Eucalyptus grandis]
 ref|XP_011029561.1| PREDICTED: ubiquitin-conjugating enzyme E2 35-like [Populus euphratica]
 gb|ABK93888.1| unknown [Populus trichocarpa]
 gb|ABK95650.1| unknown [Populus trichocarpa]
 gb|EEE97479.1| ubiquitin-conjugating enzyme family protein [Populus trichocarpa]
 gb|KCW69942.1| hypothetical protein EUGRSUZ_F03261 [Eucalyptus grandis]
Length=153

 Score =   313 bits (802),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MA+SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MASSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWKTNE EAVETAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKTNEAEAVETAKEWTRLYASGA  153



>ref|XP_011006521.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Populus euphratica]
Length=153

 Score =   313 bits (801),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWK NE EAVETAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKMNEAEAVETAKEWTRLYASGA  153



>ref|XP_010417495.1| PREDICTED: ubiquitin-conjugating enzyme E2 35 [Camelina sativa]
 ref|XP_010429746.1| PREDICTED: ubiquitin-conjugating enzyme E2 35 [Camelina sativa]
Length=153

 Score =   312 bits (800),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGP+QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPSQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWK+NE EAVETAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKSNEAEAVETAKEWTRLYASGA  153



>ref|XP_007149398.1| hypothetical protein PHAVU_005G066900g [Phaseolus vulgaris]
 gb|ESW21392.1| hypothetical protein PHAVU_005G066900g [Phaseolus vulgaris]
Length=153

 Score =   312 bits (800),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWKTNE EAVETAKEWTRLYA GA
Sbjct  121  DPLSENIAKHWKTNEAEAVETAKEWTRLYAIGA  153



>ref|XP_009388323.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like [Musa acuminata 
subsp. malaccensis]
Length=153

 Score =   312 bits (799),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGP+QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPSQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLS+NIAKHWKTNE EAVETAKEWTRLYASGA
Sbjct  121  DPLSDNIAKHWKTNEAEAVETAKEWTRLYASGA  153



>ref|NP_565192.1| ubiquitin-conjugating enzyme E2 35 [Arabidopsis thaliana]
 sp|Q94A97.1|UBC35_ARATH RecName: Full=Ubiquitin-conjugating enzyme E2 35; AltName: Full=Ubiquitin 
carrier protein 35 [Arabidopsis thaliana]
 gb|AAK83603.1| At1g78870/F9K20_8 [Arabidopsis thaliana]
 gb|AAM63067.1| E2, ubiquitin-conjugating enzyme, putative [Arabidopsis thaliana]
 gb|AAN18113.1| At1g78870/F9K20_8 [Arabidopsis thaliana]
 gb|AAY44874.1| ubiquitinating enzyme [Arabidopsis thaliana]
 gb|AEE36165.1| ubiquitin-conjugating enzyme E2 35 [Arabidopsis thaliana]
Length=153

 Score =   312 bits (799),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWK+NE EAV+TAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKSNEAEAVDTAKEWTRLYASGA  153



>ref|XP_006302954.1| hypothetical protein CARUB_v10021093mg [Capsella rubella]
 gb|EOA35852.1| hypothetical protein CARUB_v10021093mg [Capsella rubella]
Length=153

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVM+LGP+QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMVLGPSQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWK+NE EAVETAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKSNEAEAVETAKEWTRLYASGA  153



>ref|NP_564011.1| ubiquitin-conjugating enzyme E2 36 [Arabidopsis thaliana]
 ref|NP_001274716.1| ubiquitin-conjugating enzyme E2 36-like [Solanum lycopersicum]
 ref|XP_002280480.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Vitis vinifera]
 ref|XP_002892926.1| hypothetical protein ARALYDRAFT_889082 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006303394.1| hypothetical protein CARUB_v10010547mg [Capsella rubella]
 ref|XP_009149125.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Brassica rapa]
 ref|XP_009604805.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Nicotiana tomentosiformis]
 ref|XP_009794170.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Nicotiana sylvestris]
 ref|XP_010498020.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Camelina sativa]
 ref|XP_010459243.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Camelina sativa]
 ref|XP_010476824.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Camelina sativa]
 sp|Q9FZ48.1|UBC36_ARATH RecName: Full=Ubiquitin-conjugating enzyme E2 36; AltName: Full=Ubiquitin 
carrier protein 36 [Arabidopsis thaliana]
 gb|AAF99844.1|AC051629_11 Putative ubiquitin-conjugating enzyme E2 [Arabidopsis thaliana]
 gb|AAK96500.1| At1g16890/F17F16.16 [Arabidopsis thaliana]
 gb|AAL31253.1| At1g16890/F17F16.16 [Arabidopsis thaliana]
 gb|AAM63831.1| E2, ubiquitin-conjugating enzyme, putative [Arabidopsis thaliana]
 gb|AAY44875.1| ubiquitinating enzyme [Arabidopsis thaliana]
 gb|EFH69185.1| hypothetical protein ARALYDRAFT_889082 [Arabidopsis lyrata subsp. 
lyrata]
 emb|CBI21980.3| unnamed protein product [Vitis vinifera]
 gb|AEE29516.1| ubiquitin-conjugating enzyme E2 36 [Arabidopsis thaliana]
 gb|EOA36292.1| hypothetical protein CARUB_v10010547mg [Capsella rubella]
 gb|AHA42250.1| Ubc13-type ubiquitin-conjugating enzyme 2 [Solanum lycopersicum]
 gb|AHA42251.1| Ubc13-type ubiquitin-conjugating enzyme 2 [Nicotiana benthamiana]
 gb|EYU26328.1| hypothetical protein MIMGU_mgv1a015555mg [Erythranthe guttata]
 gb|AIE54302.1| ubiquitin-conjugating enzyme E2 36-like protein [Nicotiana tabacum]
 gb|KFK43889.1| hypothetical protein AALP_AA1G187100 [Arabis alpina]
 emb|CDY35126.1| BnaA06g11360D [Brassica napus]
 emb|CDX81788.1| BnaC08g38130D [Brassica napus]
Length=153

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWK+NE EAVETAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKSNEAEAVETAKEWTRLYASGA  153



>ref|XP_004294139.1| PREDICTED: ubiquitin-conjugating enzyme E2 35-like [Fragaria 
vesca subsp. vesca]
 ref|XP_007213848.1| hypothetical protein PRUPE_ppa012813mg [Prunus persica]
 ref|XP_008359332.1| PREDICTED: ubiquitin-conjugating enzyme E2 35 [Malus domestica]
 ref|XP_009340078.1| PREDICTED: ubiquitin-conjugating enzyme E2 35 [Pyrus x bretschneideri]
 gb|EMJ15047.1| hypothetical protein PRUPE_ppa012813mg [Prunus persica]
Length=153

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASG  337
            DPLSENIAKHWK+NE EAVETAKEWTRLYASG
Sbjct  121  DPLSENIAKHWKSNEAEAVETAKEWTRLYASG  152



>ref|XP_008793012.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 isoform X2 [Phoenix 
dactylifera]
Length=153

 Score =   311 bits (798),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLS+NIAKHWK NE EAVETAKEWTRLYASGA
Sbjct  121  DPLSDNIAKHWKANEAEAVETAKEWTRLYASGA  153



>ref|XP_009110436.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like [Brassica 
rapa]
Length=153

 Score =   311 bits (798),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVM+LGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMVLGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWK+NE EAVETAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKSNEAEAVETAKEWTRLYASGA  153



>ref|XP_008778384.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like isoform X1 
[Phoenix dactylifera]
Length=153

 Score =   311 bits (798),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEP PGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPVPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLS+N+AKHWKTNE EAVETAKEWTRLYASGA
Sbjct  121  DPLSDNVAKHWKTNEAEAVETAKEWTRLYASGA  153



>ref|XP_011098228.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 isoform X1 [Sesamum 
indicum]
Length=153

 Score =   311 bits (798),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWK NE EAVETAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKANEAEAVETAKEWTRLYASGA  153



>ref|XP_008811252.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like [Phoenix dactylifera]
 ref|XP_010919966.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like [Elaeis guineensis]
Length=153

 Score =   311 bits (796),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGP QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPEQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLS+NIAKHWKTNE EAVETAKEWTRLYASGA
Sbjct  121  DPLSDNIAKHWKTNEAEAVETAKEWTRLYASGA  153



>ref|XP_007133200.1| hypothetical protein PHAVU_011G160100g [Phaseolus vulgaris]
 gb|ESW05194.1| hypothetical protein PHAVU_011G160100g [Phaseolus vulgaris]
Length=153

 Score =   311 bits (796),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWK++EVEAVETAKEWTRLYAS A
Sbjct  121  DPLSENIAKHWKSSEVEAVETAKEWTRLYASDA  153



>ref|XP_009117738.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like [Brassica 
rapa]
 gb|AFK36542.1| unknown [Lotus japonicus]
 emb|CDY54372.1| BnaAnng13030D [Brassica napus]
 emb|CDX83936.1| BnaC08g17090D [Brassica napus]
Length=153

 Score =   310 bits (795),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVMILGP+QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPSQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWK+NE EAVETAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKSNEAEAVETAKEWTRLYASGA  153



>ref|XP_006591825.1| PREDICTED: uncharacterized protein LOC100306707 isoform X1 [Glycine 
max]
Length=153

 Score =   310 bits (795),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPAL IRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALGIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWK+NE EAVETAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKSNEAEAVETAKEWTRLYASGA  153



>gb|ABK22122.1| unknown [Picea sitchensis]
Length=153

 Score =   310 bits (795),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            M+NSNLPRRIIKETQRLLSEPAPGISASPSE+N+RYFNVMILGP+QSPYEGGVFKLELFL
Sbjct  1    MSNSNLPRRIIKETQRLLSEPAPGISASPSEENLRYFNVMILGPSQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  153



>ref|XP_008675216.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Zea mays]
 tpg|DAA58173.1| TPA: putative ubiquitin-conjugating enzyme family [Zea mays]
Length=153

 Score =   310 bits (795),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVMILGP QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPAQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLS+NIAKHWK+NEVEAVETAKEWTRLYASGA
Sbjct  121  DPLSDNIAKHWKSNEVEAVETAKEWTRLYASGA  153



>ref|XP_006416763.1| hypothetical protein EUTSA_v10008996mg [Eutrema salsugineum]
 gb|ESQ35116.1| hypothetical protein EUTSA_v10008996mg [Eutrema salsugineum]
Length=153

 Score =   310 bits (795),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWK+NE EAV+TAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKSNEAEAVDTAKEWTRLYASGA  153



>ref|NP_001235055.1| uncharacterized protein LOC100500231 [Glycine max]
 gb|ACU15235.1| unknown [Glycine max]
 gb|KHN23936.1| Ubiquitin-conjugating enzyme E2 36 [Glycine soja]
Length=153

 Score =   310 bits (795),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWK+NE EAVETAKEWT+LYASGA
Sbjct  121  DPLSENIAKHWKSNEAEAVETAKEWTQLYASGA  153



>ref|XP_006360049.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like [Solanum tuberosum]
Length=153

 Score =   310 bits (794),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWK+NE EAVETAKEW RLYASGA
Sbjct  121  DPLSENIAKHWKSNEAEAVETAKEWARLYASGA  153



>dbj|BAJ93925.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08001.1| predicted protein [Hordeum vulgare subsp. vulgare]
 emb|CDM82079.1| unnamed protein product [Triticum aestivum]
 emb|CDJ26358.1| unnamed protein product [Triticum aestivum]
Length=153

 Score =   310 bits (794),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVMILGP QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPAQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWK+NE EAVETAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKSNEAEAVETAKEWTRLYASGA  153



>ref|XP_009106601.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Brassica rapa]
 emb|CDX87428.1| BnaA07g34450D [Brassica napus]
Length=153

 Score =   310 bits (794),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVM+LGP+QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMVLGPSQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWK+NE EAVETAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKSNEAEAVETAKEWTRLYASGA  153



>emb|CDY40025.1| BnaC05g12900D [Brassica napus]
Length=153

 Score =   310 bits (794),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWK++E EAVETAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKSDEAEAVETAKEWTRLYASGA  153



>gb|KEH38618.1| ubiquitin-conjugating enzyme [Medicago truncatula]
Length=153

 Score =   310 bits (794),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLP+RIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPQRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKW+PALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWNPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWK+NE EAVETAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKSNEAEAVETAKEWTRLYASGA  153



>gb|KHG03257.1| Ubiquitin-conjugating enzyme E2 35 -like protein [Gossypium arboreum]
Length=153

 Score =   310 bits (794),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MAN+NLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANTNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPM APKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMTAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWK NE EAVETAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKMNEAEAVETAKEWTRLYASGA  153



>ref|XP_003555344.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like isoform 1 
[Glycine max]
 ref|XP_009334050.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Pyrus x bretschneideri]
 ref|XP_009342280.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Pyrus x bretschneideri]
 gb|KHN22621.1| Ubiquitin-conjugating enzyme E2 36 [Glycine soja]
Length=153

 Score =   310 bits (794),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 149/152 (98%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASG  337
            DPLSENIAKHWK+NE EAVETAKEWTRLYASG
Sbjct  121  DPLSENIAKHWKSNEAEAVETAKEWTRLYASG  152



>emb|CDX96802.1| BnaA08g23450D [Brassica napus]
Length=153

 Score =   310 bits (793),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVM+LGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMVLGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMA PKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAVPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWK+NE EAVETAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKSNEAEAVETAKEWTRLYASGA  153



>ref|XP_010675423.1| PREDICTED: ubiquitin-conjugating enzyme E2 35 [Beta vulgaris 
subsp. vulgaris]
Length=153

 Score =   310 bits (793),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGP+QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPSQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWK +E EAVETAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKMDEAEAVETAKEWTRLYASGA  153



>ref|XP_002458301.1| hypothetical protein SORBIDRAFT_03g030840 [Sorghum bicolor]
 ref|XP_008655404.1| PREDICTED: putative ubiquitin-conjugating enzyme family isoform 
X1 [Zea mays]
 gb|ACG24609.1| ubiquitin-conjugating enzyme E2 N [Zea mays]
 gb|EES03421.1| hypothetical protein SORBIDRAFT_03g030840 [Sorghum bicolor]
 gb|AFW83530.1| putative ubiquitin-conjugating enzyme family [Zea mays]
Length=153

 Score =   310 bits (793),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVMILGP QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPAQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLS+NIAKHWK NEVEAVETAKEWTRLYASGA
Sbjct  121  DPLSDNIAKHWKANEVEAVETAKEWTRLYASGA  153



>ref|XP_003567909.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Brachypodium distachyon]
Length=153

 Score =   309 bits (792),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 147/153 (96%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVM+LGP QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMVLGPAQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSEN+AKHWK+NE EAVETAKEWTRLYASGA
Sbjct  121  DPLSENVAKHWKSNEAEAVETAKEWTRLYASGA  153



>gb|ABI84266.1| ubiquitin-conjugating enzyme 1 like protein [Arachis hypogaea]
Length=153

 Score =   309 bits (792),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKET RLL+EPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKL+LFL
Sbjct  1    MANSNLPRRIIKETHRLLTEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLKLFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWK+NE EAVETAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKSNEAEAVETAKEWTRLYASGA  153



>emb|CDX88485.1| BnaC06g39290D [Brassica napus]
Length=153

 Score =   309 bits (791),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/153 (96%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVM+LGP+QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMVLGPSQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPM+APKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMSAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWK+NE EAVETAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKSNEAEAVETAKEWTRLYASGA  153



>ref|XP_009420050.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like [Musa acuminata 
subsp. malaccensis]
Length=213

 Score =   311 bits (797),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/154 (96%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = -3

Query  795  SMANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELF  616
             MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGP+QSPYEGGVFKLELF
Sbjct  60   GMANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPSQSPYEGGVFKLELF  119

Query  615  LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP  436
            LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP
Sbjct  120  LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP  179

Query  435  DDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DDPLS+NIA+HWKTNE EAVETAKEWTRLYA+GA
Sbjct  180  DDPLSDNIARHWKTNEAEAVETAKEWTRLYATGA  213



>ref|XP_010099384.1| Ubiquitin-conjugating enzyme E2 35 [Morus notabilis]
 gb|EXB78109.1| Ubiquitin-conjugating enzyme E2 35 [Morus notabilis]
Length=153

 Score =   309 bits (791),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/152 (98%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGP+QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPSQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMA PKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASG  337
            DPLSENIAKHWKTNE EAVETAKEWTRLYASG
Sbjct  121  DPLSENIAKHWKTNEAEAVETAKEWTRLYASG  152



>dbj|BAJ99711.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=153

 Score =   309 bits (791),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/153 (95%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVM+LGP QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMVLGPAQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSEN+AKHWK+NE EAVETAKEWTR+YASGA
Sbjct  121  DPLSENVAKHWKSNEAEAVETAKEWTRMYASGA  153



>ref|XP_003569545.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like [Brachypodium 
distachyon]
Length=153

 Score =   308 bits (790),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVMILGP QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPAQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLS+NIAKHWK+NE EAVETAKEWTRLYASGA
Sbjct  121  DPLSDNIAKHWKSNEAEAVETAKEWTRLYASGA  153



>ref|XP_010537733.1| PREDICTED: ubiquitin-conjugating enzyme E2 35-like [Tarenaya 
hassleriana]
Length=153

 Score =   308 bits (790),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGP+QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPSQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWKT+E EAVETAK+WTRLYAS A
Sbjct  121  DPLSENIAKHWKTDEAEAVETAKKWTRLYASAA  153



>ref|XP_009128314.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like [Brassica 
rapa]
Length=153

 Score =   308 bits (789),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 147/152 (97%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVM+LGP+QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMVLGPSQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASG  337
            DPLSENIAKHWK+NE EAVETAKEWTRLYASG
Sbjct  121  DPLSENIAKHWKSNEAEAVETAKEWTRLYASG  152



>ref|NP_001043834.1| Os01g0673600 [Oryza sativa Japonica Group]
 ref|XP_004969503.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like isoform X3 
[Setaria italica]
 ref|XP_006644506.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like [Oryza brachyantha]
 dbj|BAB84382.1| putative ubiquitin-conjugating enzyme E2 [Oryza sativa Japonica 
Group]
 dbj|BAC01179.1| putative ubiquitin-conjugating enzyme E2 [Oryza sativa Japonica 
Group]
 dbj|BAF05748.1| Os01g0673600 [Oryza sativa Japonica Group]
 dbj|BAH00779.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55162.1| hypothetical protein OsJ_02975 [Oryza sativa Japonica Group]
 gb|AEK99337.1| ubiquitin conjugated enzyme [Oryza sativa Japonica Group]
Length=153

 Score =   308 bits (789),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVMILGP QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPAQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLS+NIAKHWK NE EAVETAKEWTRLYASGA
Sbjct  121  DPLSDNIAKHWKANEAEAVETAKEWTRLYASGA  153



>ref|XP_010689886.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Beta vulgaris 
subsp. vulgaris]
Length=153

 Score =   308 bits (789),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVMILGP+QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPSQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMA PKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWK+NEVEAVETAKEWTRLYA+GA
Sbjct  121  DPLSENIAKHWKSNEVEAVETAKEWTRLYATGA  153



>ref|XP_006852412.1| hypothetical protein AMTR_s00021p00045870 [Amborella trichopoda]
 gb|ERN13879.1| hypothetical protein AMTR_s00021p00045870 [Amborella trichopoda]
Length=153

 Score =   308 bits (788),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 147/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MAN+NLPRRIIKETQRLLS+PAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANTNLPRRIIKETQRLLSDPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASG  337
            DPLS+NIAKHWK NE EAVETAKEWTRLYASG
Sbjct  121  DPLSDNIAKHWKANEAEAVETAKEWTRLYASG  152



>ref|NP_849902.2| ubiquitin-conjugating enzyme E2 35 [Arabidopsis thaliana]
 gb|AEE36164.1| ubiquitin-conjugating enzyme E2 35 [Arabidopsis thaliana]
Length=154

 Score =   307 bits (787),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 150/154 (97%), Positives = 152/154 (99%), Gaps = 1/154 (1%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEG-GVFKLELF  616
            MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEG GVFKLELF
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGRGVFKLELF  60

Query  615  LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP  436
            LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP
Sbjct  61   LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP  120

Query  435  DDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DDPLSENIAKHWK+NE EAV+TAKEWTRLYASGA
Sbjct  121  DDPLSENIAKHWKSNEAEAVDTAKEWTRLYASGA  154



>gb|EPS69473.1| ubiquitin carrier protein [Genlisea aurea]
Length=153

 Score =   307 bits (787),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASP EDNMRYFNVMILGP+QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPFEDNMRYFNVMILGPSQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PE+YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEDYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWK NE EAVETAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKANEAEAVETAKEWTRLYASGA  153



>ref|XP_004961237.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like isoform X2 
[Setaria italica]
Length=224

 Score =   310 bits (793),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 149/156 (96%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -3

Query  801  LISMANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLE  622
            L +MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVMILGP QSPYEGGVFKLE
Sbjct  69   LGAMANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPAQSPYEGGVFKLE  128

Query  621  LFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAP  442
            LFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAP
Sbjct  129  LFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAP  188

Query  441  NPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            NPDDPLS+NIAKHWK+NE EAVETAKEWTRLYASGA
Sbjct  189  NPDDPLSDNIAKHWKSNEAEAVETAKEWTRLYASGA  224



>ref|NP_001148361.1| ubiquitin-conjugating enzyme E2 N [Zea mays]
 gb|ACG31105.1| ubiquitin-conjugating enzyme E2 N [Zea mays]
 gb|ACR37894.1| unknown [Zea mays]
 gb|AFW81107.1| putative ubiquitin-conjugating enzyme family [Zea mays]
Length=153

 Score =   307 bits (786),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/153 (96%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVMILGP QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPAQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLS+NIAKHWK+NE EAVETAKEWTRLY SGA
Sbjct  121  DPLSDNIAKHWKSNEAEAVETAKEWTRLYTSGA  153



>dbj|BAJ85100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=153

 Score =   306 bits (785),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/153 (95%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVM+LGP QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMVLGPAQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRT LLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTALLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSEN+AKHWK+NE EAVETAKEWTR+YASGA
Sbjct  121  DPLSENVAKHWKSNEAEAVETAKEWTRMYASGA  153



>ref|NP_001140498.1| putative ubiquitin-conjugating enzyme family [Zea mays]
 gb|ACF83944.1| unknown [Zea mays]
 gb|AFW79140.1| putative ubiquitin-conjugating enzyme family [Zea mays]
Length=154

 Score =   306 bits (785),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/153 (96%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVMILGP QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPAQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLS+NIAKHWK+NE EA ETAKEWTRLYASGA
Sbjct  121  DPLSDNIAKHWKSNEAEAFETAKEWTRLYASGA  153



>ref|XP_008228914.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Prunus mume]
Length=153

 Score =   306 bits (785),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVMILGP QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPAQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMA PKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASG  337
            DPLSENIAKHWKTNE EAVETAKEWTRLYASG
Sbjct  121  DPLSENIAKHWKTNEAEAVETAKEWTRLYASG  152



>ref|XP_007212191.1| hypothetical protein PRUPE_ppa012814mg [Prunus persica]
 gb|EMJ13390.1| hypothetical protein PRUPE_ppa012814mg [Prunus persica]
Length=153

 Score =   306 bits (784),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/152 (97%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVMILGP QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPAQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMA PKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLS+QALLSAPNPD
Sbjct  61   PEEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSVQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASG  337
            DPLSENIAKHWKTNE EAVETAKEWTRLYASG
Sbjct  121  DPLSENIAKHWKTNEAEAVETAKEWTRLYASG  152



>ref|XP_006442523.1| hypothetical protein CICLE_v10022662mg [Citrus clementina]
 gb|ESR55763.1| hypothetical protein CICLE_v10022662mg [Citrus clementina]
Length=151

 Score =   306 bits (783),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 2/153 (1%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEP  GISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEP--GISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  58

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  59   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  118

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWKTNE EAVETAKEWTRLYASGA
Sbjct  119  DPLSENIAKHWKTNEAEAVETAKEWTRLYASGA  151



>ref|XP_006377751.1| hypothetical protein POPTR_0011s11260g [Populus trichocarpa]
 gb|ERP55548.1| hypothetical protein POPTR_0011s11260g [Populus trichocarpa]
Length=161

 Score =   306 bits (784),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 151/161 (94%), Positives = 152/161 (94%), Gaps = 8/161 (5%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MA+SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MASSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVET--------AKEWTRLYASGA  334
            DPLSENIAKHWKTNE EAVET        AKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKTNEAEAVETVLIFLNSAAKEWTRLYASGA  161



>ref|XP_008793011.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 isoform X1 [Phoenix 
dactylifera]
Length=158

 Score =   305 bits (781),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 151/158 (96%), Gaps = 5/158 (3%)
 Frame = -3

Query  792  MANSNLPRRIIK-----ETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFK  628
            MANSNLPRRIIK     ETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFK
Sbjct  1    MANSNLPRRIIKVNPPSETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFK  60

Query  627  LELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLS  448
            LELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLS
Sbjct  61   LELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLS  120

Query  447  APNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            APNPDDPLS+NIAKHWK NE EAVETAKEWTRLYASGA
Sbjct  121  APNPDDPLSDNIAKHWKANEAEAVETAKEWTRLYASGA  158



>ref|XP_001778399.1| predicted protein [Physcomitrella patens]
 gb|EDQ56757.1| predicted protein [Physcomitrella patens]
Length=157

 Score =   305 bits (781),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = -3

Query  795  SMANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELF  616
            + AN+NLPRRIIKETQRLLSEPAPGISASPSE+N+RYFNVMILGP+QSPYEGGVFKLELF
Sbjct  4    ATANTNLPRRIIKETQRLLSEPAPGISASPSEENLRYFNVMILGPSQSPYEGGVFKLELF  63

Query  615  LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP  436
            LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP
Sbjct  64   LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP  123

Query  435  DDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DDPL+ENIAKHWKTNE EAVETA+EWTRLYASGA
Sbjct  124  DDPLAENIAKHWKTNEQEAVETAREWTRLYASGA  157



>ref|XP_009354263.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like [Pyrus x bretschneideri]
Length=153

 Score =   304 bits (779),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/152 (97%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASP+E+NMRYFNVMILGP QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPAEENMRYFNVMILGPAQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMA PKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASG  337
            DPLSENIAKHWKTNE EAVETAKEWTRLYASG
Sbjct  121  DPLSENIAKHWKTNEEEAVETAKEWTRLYASG  152



>ref|XP_009397453.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like [Musa acuminata 
subsp. malaccensis]
Length=153

 Score =   304 bits (778),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/153 (95%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MA+SNLP RIIKETQRLLSEPAPGISASPSE+NMRYFNVMILGP QSPYEGGVFKLELFL
Sbjct  1    MASSNLPPRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPAQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWKTNE EAVETA+EWTRLYA+GA
Sbjct  121  DPLSENIAKHWKTNEAEAVETAREWTRLYATGA  153



>ref|XP_004303174.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like [Fragaria 
vesca subsp. vesca]
Length=153

 Score =   303 bits (777),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVMILGP QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPAQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMA PKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASG  337
            DPLSENIAKHWK+NE EAVETAKEWTRLY SG
Sbjct  121  DPLSENIAKHWKSNETEAVETAKEWTRLYGSG  152



>emb|CDY14587.1| BnaC02g25260D [Brassica napus]
Length=154

 Score =   303 bits (777),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/153 (96%), Positives = 151/153 (99%), Gaps = 1/153 (1%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEG-GVFKLELF  616
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVM+LGP+QSPYEG GVFKLELF
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMVLGPSQSPYEGRGVFKLELF  60

Query  615  LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP  436
            LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP
Sbjct  61   LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP  120

Query  435  DDPLSENIAKHWKTNEVEAVETAKEWTRLYASG  337
            DDPLSENIAKHWK+NE EAVETAKEWTRLYASG
Sbjct  121  DDPLSENIAKHWKSNEAEAVETAKEWTRLYASG  153



>ref|XP_008362408.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like [Malus domestica]
Length=153

 Score =   303 bits (776),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASP+E+NMRYFNVMILGP QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPAEENMRYFNVMILGPAQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMA PKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASG  337
            DPLSENIAKHWKTNE EAVETAKEWTRLYA+G
Sbjct  121  DPLSENIAKHWKTNEEEAVETAKEWTRLYANG  152



>gb|AAD42941.1|AF091621_1 ubiquitin-conjugating enzyme E2 [Catharanthus roseus]
Length=153

 Score =   303 bits (775),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 146/153 (95%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLP+RIIKETQRLLSEPAPGISASPSEDNMR FNVMILGP QSPYEGGVFKLELFL
Sbjct  1    MANSNLPKRIIKETQRLLSEPAPGISASPSEDNMRDFNVMILGPAQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMA PKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWK+NE EAVETAKEWTRLYA+GA
Sbjct  121  DPLSENIAKHWKSNEAEAVETAKEWTRLYATGA  153



>ref|NP_001185017.1| ubiquitin-conjugating enzyme E2 36 [Arabidopsis thaliana]
 gb|AEE29517.1| ubiquitin-conjugating enzyme E2 36 [Arabidopsis thaliana]
Length=162

 Score =   302 bits (774),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 152/162 (94%), Gaps = 9/162 (6%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEP---------APGISASPSEDNMRYFNVMILGPTQSPYEG  640
            MANSNLPRRIIKETQRLLSEP         +PGISASPSE+NMRYFNVMILGPTQSPYEG
Sbjct  1    MANSNLPRRIIKETQRLLSEPGNFITSFDPSPGISASPSEENMRYFNVMILGPTQSPYEG  60

Query  639  GVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQ  460
            GVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQ
Sbjct  61   GVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQ  120

Query  459  ALLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            ALLSAPNPDDPLSENIAKHWK+NE EAVETAKEWTRLYASGA
Sbjct  121  ALLSAPNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYASGA  162



>emb|CDY57941.1| BnaA07g38410D [Brassica napus]
Length=155

 Score =   301 bits (772),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 150/155 (97%), Gaps = 2/155 (1%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVM+LGP+QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMVLGPSQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVR--FLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPN  439
            PEEYPM+APK    FLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPN
Sbjct  61   PEEYPMSAPKASCLFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPN  120

Query  438  PDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            PDDPLSENIAKHWK+NE EAVETAKEWTRLYASGA
Sbjct  121  PDDPLSENIAKHWKSNEAEAVETAKEWTRLYASGA  155



>ref|XP_004969504.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like isoform X4 
[Setaria italica]
Length=158

 Score =   301 bits (770),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 150/158 (95%), Gaps = 5/158 (3%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEP-----APGISASPSEDNMRYFNVMILGPTQSPYEGGVFK  628
            MANSNLPRRIIKETQRLLSEP     +PGISASPSE+NMRYFNVMILGP QSPYEGGVFK
Sbjct  1    MANSNLPRRIIKETQRLLSEPGAGAFSPGISASPSEENMRYFNVMILGPAQSPYEGGVFK  60

Query  627  LELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLS  448
            LELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLS
Sbjct  61   LELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLS  120

Query  447  APNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            APNPDDPLS+NIAKHWK NE EAVETAKEWTRLYASGA
Sbjct  121  APNPDDPLSDNIAKHWKANEAEAVETAKEWTRLYASGA  158



>ref|XP_004956556.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like isoform X1 
[Setaria italica]
Length=153

 Score =   300 bits (769),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MA+SNLPRRIIKETQRLLSEPAPGISASP+E+NMRYFNVMILGP+QSPYEGGVFKLELFL
Sbjct  1    MAHSNLPRRIIKETQRLLSEPAPGISASPTEENMRYFNVMILGPSQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMA PKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASG  337
            DPL++N+AKHWK+NE EAVETAKEWTRLYASG
Sbjct  121  DPLADNVAKHWKSNETEAVETAKEWTRLYASG  152



>dbj|BAK05631.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01323.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT08271.1| Ubiquitin carrier protein E2 36 [Aegilops tauschii]
Length=153

 Score =   300 bits (768),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 143/153 (93%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMA PKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPL++N+AKHWK NE EAVETAKEWTR+YA+ A
Sbjct  121  DPLADNVAKHWKANETEAVETAKEWTRVYANDA  153



>gb|KEH38621.1| ubiquitin-conjugating enzyme [Medicago truncatula]
Length=167

 Score =   301 bits (770),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 149/167 (89%), Positives = 152/167 (91%), Gaps = 14/167 (8%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEG---------  640
            MANSNLP+RIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEG         
Sbjct  1    MANSNLPQRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGSDDTNNLVL  60

Query  639  -----GVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTV  475
                 GVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKW+PALQIRTV
Sbjct  61   HLEMWGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWNPALQIRTV  120

Query  474  LLSIQALLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            LLSIQALLSAPNPDDPLSENIAKHWK+NE EAVETAKEWTRLYASGA
Sbjct  121  LLSIQALLSAPNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYASGA  167



>ref|XP_001764104.1| predicted protein [Physcomitrella patens]
 gb|EDQ70945.1| predicted protein [Physcomitrella patens]
Length=157

 Score =   300 bits (767),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 142/153 (93%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -3

Query  795  SMANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELF  616
            + AN+NLPRRIIKETQRLLSEPAPGISASPSE+N+RYFNVMILGP+QSPYEGGVFKLELF
Sbjct  4    AAANANLPRRIIKETQRLLSEPAPGISASPSEENLRYFNVMILGPSQSPYEGGVFKLELF  63

Query  615  LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP  436
            LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP
Sbjct  64   LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP  123

Query  435  DDPLSENIAKHWKTNEVEAVETAKEWTRLYASG  337
            DDPL+ENIAKHWK+NE EAVETA+EWTR YASG
Sbjct  124  DDPLAENIAKHWKSNEQEAVETAREWTRSYASG  156



>ref|XP_006446781.1| hypothetical protein CICLE_v10017059mg [Citrus clementina]
 ref|XP_006469026.1| PREDICTED: ubiquitin-conjugating enzyme E2 35-like [Citrus sinensis]
 gb|ESR60021.1| hypothetical protein CICLE_v10017059mg [Citrus clementina]
 gb|KDO63344.1| hypothetical protein CISIN_1g031320mg [Citrus sinensis]
Length=153

 Score =   297 bits (761),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 140/153 (92%), Positives = 148/153 (97%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MA+ NLPRRI+KETQRLLSEPAPGISASP+EDNMRYFNVMILGP+QSPYEGGVFKLELFL
Sbjct  1    MASGNLPRRIVKETQRLLSEPAPGISASPAEDNMRYFNVMILGPSQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PE+YPM+APKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEDYPMSAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLS+NIAKHWK +E EAVETAKEWTRLYAS  
Sbjct  121  DPLSDNIAKHWKADETEAVETAKEWTRLYASDG  153



>gb|KHG21556.1| Ubiquitin-conjugating enzyme E2 35 -like protein [Gossypium arboreum]
Length=170

 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 151/170 (89%), Gaps = 17/170 (10%)
 Frame = -3

Query  792  MANSNLPRRIIK-ETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELF  616
            MANSNLPRRIIK ETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELF
Sbjct  1    MANSNLPRRIIKQETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELF  60

Query  615  LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLS----------  466
            LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLL           
Sbjct  61   LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLRYCKWKRKLNV  120

Query  465  ------IQALLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
                  IQALLSAPNPDDPLSENIAKHWK+NE EAVETAKEWTRLYASGA
Sbjct  121  SIAVAYIQALLSAPNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYASGA  170



>emb|CDX79272.1| BnaC06g20310D [Brassica napus]
Length=170

 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 152/170 (89%), Gaps = 17/170 (10%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANS+LPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVM+LGP+QSPYEGGVFKLELFL
Sbjct  1    MANSSLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMVLGPSQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPK-----------------VRFLTKIYHPNIDKLGRICLDILKDKWSPALQI  484
            PEEYPM+APK                 VRFLTKIYHPNIDKLGRICLDIL+DKWSPALQI
Sbjct  61   PEEYPMSAPKASCFVHLGSFDDFDLEQVRFLTKIYHPNIDKLGRICLDILQDKWSPALQI  120

Query  483  RTVLLSIQALLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            RTVLLSIQALLSAPNPDDPLSENIAKHWK+NE EAVETAKEWTRLYASGA
Sbjct  121  RTVLLSIQALLSAPNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYASGA  170



>ref|XP_004956557.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like isoform X2 
[Setaria italica]
Length=154

 Score =   296 bits (757),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 142/153 (93%), Positives = 150/153 (98%), Gaps = 1/153 (1%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEG-GVFKLELF  616
            MA+SNLPRRIIKETQRLLSEPAPGISASP+E+NMRYFNVMILGP+QSPYEG GVFKLELF
Sbjct  1    MAHSNLPRRIIKETQRLLSEPAPGISASPTEENMRYFNVMILGPSQSPYEGRGVFKLELF  60

Query  615  LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP  436
            LPEEYPMA PKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP
Sbjct  61   LPEEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP  120

Query  435  DDPLSENIAKHWKTNEVEAVETAKEWTRLYASG  337
            DDPL++N+AKHWK+NE EAVETAKEWTRLYASG
Sbjct  121  DDPLADNVAKHWKSNETEAVETAKEWTRLYASG  153



>ref|XP_004961236.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like isoform X1 
[Setaria italica]
Length=242

 Score =   298 bits (763),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 153/174 (88%), Gaps = 18/174 (10%)
 Frame = -3

Query  801  LISMANSNLPRRIIKETQRLLSEP------------------APGISASPSEDNMRYFNV  676
            L +MANSNLPRRIIKETQRLLSEP                  APGISASPSE+NMRYFNV
Sbjct  69   LGAMANSNLPRRIIKETQRLLSEPGAWLFAFDPAFVLLLMRAAPGISASPSEENMRYFNV  128

Query  675  MILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSP  496
            MILGP QSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSP
Sbjct  129  MILGPAQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSP  188

Query  495  ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            ALQIRTVLLSIQALLSAPNPDDPLS+NIAKHWK+NE EAVETAKEWTRLYASGA
Sbjct  189  ALQIRTVLLSIQALLSAPNPDDPLSDNIAKHWKSNEAEAVETAKEWTRLYASGA  242



>gb|KHG29378.1| Ubiquitin-conjugating enzyme E2 35 -like protein [Gossypium arboreum]
Length=157

 Score =   294 bits (753),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 148/157 (94%), Gaps = 4/157 (3%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSEDNM+YFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMQYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLG----RICLDILKDKWSPALQIRTVLLSIQALLSA  445
            PEEYPMAAPKVRFLTKIYHPNIDK+     +  LDILKDKWS ALQIRTVLLSIQALLSA
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKVSSTSWKNSLDILKDKWSSALQIRTVLLSIQALLSA  120

Query  444  PNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            PNPDDPLSENIAKHWKTNE EAVETAKEWTRLYASGA
Sbjct  121  PNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYASGA  157



>gb|EPS71389.1| hypothetical protein M569_03369, partial [Genlisea aurea]
Length=179

 Score =   293 bits (750),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 151/179 (84%), Gaps = 27/179 (15%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDK---------------------------LGRICLDIL  514
            PEEYPMAAPKVRFLTKIYHPNIDK                           LGRICLDIL
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKVWDILNDVYITHFLSPLYVCRIHFPFQLGRICLDIL  120

Query  513  KDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASG  337
            KDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWK+NE EAVETA++WTR+YASG
Sbjct  121  KDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKSNEAEAVETARDWTRIYASG  179



>ref|XP_007021722.1| Ubiquitin-conjugating enzyme 36 isoform 2 [Theobroma cacao]
 gb|EOY13247.1| Ubiquitin-conjugating enzyme 36 isoform 2 [Theobroma cacao]
Length=219

 Score =   293 bits (749),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 153/174 (88%), Gaps = 10/174 (6%)
 Frame = -3

Query  795  SMANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELF  616
            SMANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELF
Sbjct  51   SMANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELF  110

Query  615  LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP  436
            LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP
Sbjct  111  LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP  170

Query  435  DDPLSENIAKHWKTNEVEAVETAKE-----WTRLYASGA*TLPTKHFEITKCAM  289
            DDPLSENIAKHWKTNE EAVET  +     W  +  +GA   P    EIT  AM
Sbjct  171  DDPLSENIAKHWKTNEAEAVETGMDPFICKWCMM--TGANDCP---LEITFYAM  219



>emb|CDP15927.1| unnamed protein product [Coffea canephora]
Length=162

 Score =   289 bits (740),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 148/162 (91%), Gaps = 9/162 (6%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEP+PGISASPSEDNMR+FNVMILGP QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPSPGISASPSEDNMRHFNVMILGPAQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDK---------LGRICLDILKDKWSPALQIRTVLLSIQ  460
            PE+YPMA PKVRFLTKIYHPNIDK         LGRICLDILKDKWSPALQIRTVLLSIQ
Sbjct  61   PEDYPMAPPKVRFLTKIYHPNIDKASGICSEFLLGRICLDILKDKWSPALQIRTVLLSIQ  120

Query  459  ALLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            ALLSAPNPDDPL++NIAKHWK+NE EAVETAKEWT  YA+GA
Sbjct  121  ALLSAPNPDDPLADNIAKHWKSNESEAVETAKEWTSAYATGA  162



>gb|KEH38619.1| ubiquitin-conjugating enzyme [Medicago truncatula]
Length=148

 Score =   286 bits (731),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/142 (96%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLP+RIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPQRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKW+PALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWNPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETA  367
            DPLSENIAKHWK+NE EAVET 
Sbjct  121  DPLSENIAKHWKSNEAEAVETG  142



>emb|CDY26882.1| BnaA02g19070D [Brassica napus]
Length=145

 Score =   285 bits (729),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 143/152 (94%), Gaps = 8/152 (5%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVM+LG        GVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMVLG--------GVFKLELFL  52

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  53   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  112

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASG  337
            DPLSENIAKHWK+NE EAVETAKEWTRLYASG
Sbjct  113  DPLSENIAKHWKSNEAEAVETAKEWTRLYASG  144



>ref|XP_004969501.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like isoform X1 
[Setaria italica]
Length=190

 Score =   286 bits (733),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVMILGP QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPAQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAK  364
            DPLS+NIAKHWK NE EAVET K
Sbjct  121  DPLSDNIAKHWKANEAEAVETGK  143



>gb|EEC71254.1| hypothetical protein OsI_03230 [Oryza sativa Indica Group]
Length=142

 Score =   284 bits (727),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 136/141 (96%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = -3

Query  756  ETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVR  577
            ETQRLLSEPAPGISASPSE+NMRYFNVMILGP QSPYEGGVFKLELFLPEEYPMAAPKVR
Sbjct  2    ETQRLLSEPAPGISASPSEENMRYFNVMILGPAQSPYEGGVFKLELFLPEEYPMAAPKVR  61

Query  576  FLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWK  397
            FLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLS+NIAKHWK
Sbjct  62   FLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSDNIAKHWK  121

Query  396  TNEVEAVETAKEWTRLYASGA  334
             NE EAVETAKEWTRLYASGA
Sbjct  122  ANEAEAVETAKEWTRLYASGA  142



>gb|AFW83529.1| putative ubiquitin-conjugating enzyme family [Zea mays]
Length=155

 Score =   285 bits (728),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/142 (96%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVMILGP QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPAQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETA  367
            DPLS+NIAKHWK NEVEAVET 
Sbjct  121  DPLSDNIAKHWKANEVEAVETG  142



>ref|XP_010277057.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like [Nelumbo nucifera]
Length=153

 Score =   285 bits (728),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 140/153 (92%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKV +       +I +LGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVWYSYNSGSSDICQLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWKTNE EAVETAKEWTRLYASGA
Sbjct  121  DPLSENIAKHWKTNEAEAVETAKEWTRLYASGA  153



>gb|AAC83026.1| Similar to Ubiquitin-conjugating enzyme E2-17 KD gb|D83004 from 
Homo sapiens. ESTs gb|T88233, gb|Z24464, gb|N37265, gb|H36151, 
gb|Z34711, gb|AA040983, and gb|T22122 come from this gene 
[Arabidopsis thaliana]
Length=163

 Score =   283 bits (723),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 1/143 (1%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLL-SIQALLSAPNP  436
            PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLL SIQALLSAPNP
Sbjct  61   PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLRSIQALLSAPNP  120

Query  435  DDPLSENIAKHWKTNEVEAVETA  367
            DDPLSENIAKHWK+NE EAV+T 
Sbjct  121  DDPLSENIAKHWKSNEAEAVDTG  143



>gb|EMS46318.1| Ubiquitin-conjugating enzyme E2 36 [Triticum urartu]
Length=175

 Score =   283 bits (723),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMA PKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYAS  340
            DPL++N+AKHWK NE EAVET  +     A+
Sbjct  121  DPLADNVAKHWKANETEAVETGDDLVAFLAA  151



>gb|KDO63347.1| hypothetical protein CISIN_1g031320mg [Citrus sinensis]
Length=145

 Score =   277 bits (708),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MA+ NLPRRI+KETQRLLSEPAPGISASP+EDNMRYFNVMILGP+QSPYEGGVFKLELFL
Sbjct  1    MASGNLPRRIVKETQRLLSEPAPGISASPAEDNMRYFNVMILGPSQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PE+YPM+APKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEDYPMSAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEW  358
            DPLS+NIAKHWK +E EAVET   +
Sbjct  121  DPLSDNIAKHWKADETEAVETGNSY  145



>gb|KDO63346.1| hypothetical protein CISIN_1g031320mg [Citrus sinensis]
Length=149

 Score =   276 bits (707),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MA+ NLPRRI+KETQRLLSEPAPGISASP+EDNMRYFNVMILGP+QSPYEGGVFKLELFL
Sbjct  1    MASGNLPRRIVKETQRLLSEPAPGISASPAEDNMRYFNVMILGPSQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PE+YPM+APKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEDYPMSAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKE  361
            DPLS+NIAKHWK +E EAVET  +
Sbjct  121  DPLSDNIAKHWKADETEAVETGMD  144



>ref|XP_002958782.1| hypothetical protein VOLCADRAFT_84644 [Volvox carteri f. nagariensis]
 gb|EFJ40172.1| hypothetical protein VOLCADRAFT_84644 [Volvox carteri f. nagariensis]
Length=158

 Score =   276 bits (707),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = -3

Query  777  LPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYP  598
            LPRRIIKETQ+LLSEPAPGISASPSE+N+RYFNVMILGP QSPYEGGVFKLELFLPE+YP
Sbjct  12   LPRRIIKETQKLLSEPAPGISASPSEENLRYFNVMILGPQQSPYEGGVFKLELFLPEDYP  71

Query  597  MAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSE  418
            MA PKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL++
Sbjct  72   MAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLAD  131

Query  417  NIAKHWKTNEVEAVETAKEWTRLYASG  337
            N+AKHWK NE EA+ TA++WT +YA G
Sbjct  132  NVAKHWKENEKEAIATARQWTSMYAQG  158



>ref|XP_001690010.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP09748.1| predicted protein [Chlamydomonas reinhardtii]
Length=158

 Score =   276 bits (706),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 141/149 (95%), Gaps = 0/149 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQ+LLSEPAPGISASPSE+N+RYFNVMILGP QSPYEGGVFKLELFLPE+
Sbjct  10   AQLPRRIIKETQKLLSEPAPGISASPSEENLRYFNVMILGPQQSPYEGGVFKLELFLPED  69

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMA PKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  70   YPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  129

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYASG  337
            +E++AKHWK NE EA+ TA++WT ++A G
Sbjct  130  AEHVAKHWKENEKEAIATARQWTAMHAQG  158



>ref|XP_006442521.1| hypothetical protein CICLE_v10022662mg [Citrus clementina]
 gb|ESR55761.1| hypothetical protein CICLE_v10022662mg [Citrus clementina]
 gb|KDO44640.1| hypothetical protein CISIN_1g031783mg [Citrus sinensis]
Length=139

 Score =   275 bits (703),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/153 (90%), Positives = 138/153 (90%), Gaps = 14/153 (9%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPK              LGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPK--------------LGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  106

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLSENIAKHWKTNE EAVETAKEWTRLYASGA
Sbjct  107  DPLSENIAKHWKTNEAEAVETAKEWTRLYASGA  139



>ref|XP_006442519.1| hypothetical protein CICLE_v10022662mg [Citrus clementina]
 gb|ESR55759.1| hypothetical protein CICLE_v10022662mg [Citrus clementina]
 gb|KDO44642.1| hypothetical protein CISIN_1g031783mg [Citrus sinensis]
Length=143

 Score =   274 bits (700),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 131/132 (99%), Positives = 131/132 (99%), Gaps = 0/132 (0%)
 Frame = -3

Query  729  APGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPN  550
            APGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPN
Sbjct  12   APGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPN  71

Query  549  IDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEVEAVET  370
            IDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNE EAVET
Sbjct  72   IDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVET  131

Query  369  AKEWTRLYASGA  334
            AKEWTRLYASGA
Sbjct  132  AKEWTRLYASGA  143



>ref|XP_002982217.1| ubiquitin-conjugating enzyme 35, E2 [Selaginella moellendorffii]
 gb|EFJ16885.1| ubiquitin-conjugating enzyme 35, E2 [Selaginella moellendorffii]
Length=157

 Score =   274 bits (700),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -3

Query  795  SMANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELF  616
            ++ANSNLPRRIIKETQRLL+EPA GISASP+EDN+RYF+VMILGP QSPYEG +  LELF
Sbjct  4    AIANSNLPRRIIKETQRLLTEPAEGISASPAEDNLRYFSVMILGPAQSPYEGKISLLELF  63

Query  615  LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP  436
            LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP
Sbjct  64   LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP  123

Query  435  DDPLSENIAKHWKTNEVEAVETAKEWTRLYAS  340
            +DPL ENIAKHWKT++  A+ TA+EWT+LYA+
Sbjct  124  EDPLDENIAKHWKTDQGGAIATAREWTQLYAT  155



>ref|XP_008779001.1| PREDICTED: ubiquitin-conjugating enzyme E2 35-like isoform X2 
[Phoenix dactylifera]
Length=139

 Score =   271 bits (694),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 137/153 (90%), Gaps = 14/153 (9%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEP PGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPVPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPK              LGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPK--------------LGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  106

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLS+N+AKHWKTNE EAVETAKEWTRLYASGA
Sbjct  107  DPLSDNVAKHWKTNEAEAVETAKEWTRLYASGA  139



>ref|NP_001235245.1| uncharacterized protein LOC100306707 [Glycine max]
 gb|ACU15012.1| unknown [Glycine max]
Length=133

 Score =   270 bits (689),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/132 (98%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = -3

Query  729  APGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPN  550
            APGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPN
Sbjct  2    APGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPN  61

Query  549  IDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEVEAVET  370
            IDKLGRICLDILKDKWSPAL IRTVLLSIQALLSAPNPDDPLSENIAKHWK+NE EAVET
Sbjct  62   IDKLGRICLDILKDKWSPALGIRTVLLSIQALLSAPNPDDPLSENIAKHWKSNEAEAVET  121

Query  369  AKEWTRLYASGA  334
            AKEWTRLYASGA
Sbjct  122  AKEWTRLYASGA  133



>ref|XP_005846325.1| hypothetical protein CHLNCDRAFT_36102 [Chlorella variabilis]
 gb|EFN54223.1| hypothetical protein CHLNCDRAFT_36102 [Chlorella variabilis]
Length=153

 Score =   270 bits (690),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            M  S LPRRIIKETQRLLSEP  GISA+PSEDN+RYFNV+ILGP  SPY+GG+FKLELFL
Sbjct  1    METSQLPRRIIKETQRLLSEPVAGISAAPSEDNLRYFNVIILGPDSSPYQGGMFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PE+YPMAAPKVRFLTKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQAL+SAPNPD
Sbjct  61   PEDYPMAAPKVRFLTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALMSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYA  343
            DPL EN+A+HWKTNEV+A+ TA++WT  +A
Sbjct  121  DPLDENVARHWKTNEVDAMNTARQWTAAHA  150



>ref|XP_007133201.1| hypothetical protein PHAVU_011G160100g, partial [Phaseolus vulgaris]
 gb|ESW05195.1| hypothetical protein PHAVU_011G160100g, partial [Phaseolus vulgaris]
Length=164

 Score =   270 bits (691),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/132 (98%), Positives = 131/132 (99%), Gaps = 0/132 (0%)
 Frame = -3

Query  729  APGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPN  550
            APGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPN
Sbjct  33   APGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPN  92

Query  549  IDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEVEAVET  370
            IDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWK++EVEAVET
Sbjct  93   IDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKSSEVEAVET  152

Query  369  AKEWTRLYASGA  334
            AKEWTRLYAS A
Sbjct  153  AKEWTRLYASDA  164



>ref|XP_002992245.1| ubiquitin-conjugating enzyme 35, E2 [Selaginella moellendorffii]
 gb|EFJ06742.1| ubiquitin-conjugating enzyme 35, E2 [Selaginella moellendorffii]
Length=175

 Score =   270 bits (691),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 145/170 (85%), Gaps = 18/170 (11%)
 Frame = -3

Query  795  SMANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEG--------  640
            ++ANSNLPRRIIKETQRLL+EPA GISASP+EDN+RYF+VMILGP QSPYEG        
Sbjct  4    AIANSNLPRRIIKETQRLLTEPAEGISASPAEDNLRYFSVMILGPAQSPYEGKISFLLCS  63

Query  639  ----------GVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPAL  490
                      G F+LELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPAL
Sbjct  64   SSELLCFFSGGAFRLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPAL  123

Query  489  QIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYAS  340
            QIRTVLLSIQALLSAPNP+DPL ENIAKHWKT++  A+ TA+EWT+LYA+
Sbjct  124  QIRTVLLSIQALLSAPNPEDPLDENIAKHWKTDQGGAIATAREWTQLYAT  173



>ref|XP_008654942.1| PREDICTED: ubiquitin-conjugating enzyme E2 N isoform X1 [Zea 
mays]
Length=139

 Score =   267 bits (683),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 136/153 (89%), Gaps = 14/153 (9%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVMILGP QSPYEGGVFKLELFL
Sbjct  1    MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPAQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAP              KLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAP--------------KLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  106

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPLS+NIAKHWK+NE EAVETAKEWTRLY SGA
Sbjct  107  DPLSDNIAKHWKSNEAEAVETAKEWTRLYTSGA  139



>ref|XP_004969502.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like isoform X2 
[Setaria italica]
Length=188

 Score =   269 bits (687),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -3

Query  744  LLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTK  565
            L    APGISASPSE+NMRYFNVMILGP QSPYEGGVFKLELFLPEEYPMAAPKVRFLTK
Sbjct  52   LFVRAAPGISASPSEENMRYFNVMILGPAQSPYEGGVFKLELFLPEEYPMAAPKVRFLTK  111

Query  564  IYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEV  385
            IYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLS+NIAKHWK NE 
Sbjct  112  IYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSDNIAKHWKANEA  171

Query  384  EAVETAKEWTRLYASGA  334
            EAVETAKEWTRLYASGA
Sbjct  172  EAVETAKEWTRLYASGA  188



>ref|XP_002502504.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63762.1| predicted protein [Micromonas sp. RCC299]
Length=155

 Score =   266 bits (681),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  798  ISMANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLEL  619
            ++ A+S LPRRIIKETQRLLSEPAPGISA P EDN+R+F+VMI GP  SPYEGGVF+LEL
Sbjct  1    MASASSALPRRIIKETQRLLSEPAPGISAQPQEDNLRHFSVMIRGPQDSPYEGGVFELEL  60

Query  618  FLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPN  439
            FLPEEYPMAAPKVRFLTKIYHPNID LGRICLDILKDKWSPALQIRTVLLSIQALLSAPN
Sbjct  61   FLPEEYPMAAPKVRFLTKIYHPNIDTLGRICLDILKDKWSPALQIRTVLLSIQALLSAPN  120

Query  438  PDDPLSENIAKHWKTNEVEAVETAKEWTRLYA  343
            PDDPLSE IAK WK +E EA++TAKEWT+ +A
Sbjct  121  PDDPLSEKIAKAWKVDEAEALKTAKEWTQRFA  152



>ref|XP_003056933.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58578.1| predicted protein [Micromonas pusilla CCMP1545]
Length=156

 Score =   262 bits (670),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  798  ISMANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLEL  619
            ++ A+S LPRRIIKETQRLLSEPAPGISA P EDN+R+F+VMI GP  SPYEGGVF+LEL
Sbjct  1    MASASSALPRRIIKETQRLLSEPAPGISAQPQEDNLRHFSVMIRGPRDSPYEGGVFELEL  60

Query  618  FLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPN  439
            FLPEEYPMAAPKVRFLTKIYHPNID LGRICLDILKDKWSPALQIRTVLLSIQALLSAPN
Sbjct  61   FLPEEYPMAAPKVRFLTKIYHPNIDNLGRICLDILKDKWSPALQIRTVLLSIQALLSAPN  120

Query  438  PDDPLSENIAKHWKTNEVEAVETAKEWTRLYA  343
            PDDPLSE +A  WK +EV A++TAKEWT+ +A
Sbjct  121  PDDPLSEKVANAWKVDEVTALKTAKEWTQKFA  152



>gb|KFM24655.1| Ubiquitin-conjugating enzyme E2 36 [Auxenochlorella protothecoides]
Length=156

 Score =   261 bits (668),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  777  LPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYP  598
            LPRRIIKE+QRLL+EP PGISA+PSE+N+RYFNV+I GP  SPY+GGVFKLELFLPE+YP
Sbjct  10   LPRRIIKESQRLLTEPVPGISAAPSEENLRYFNVVIFGPDSSPYQGGVFKLELFLPEDYP  69

Query  597  MAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSE  418
            MAAPKVRFLTKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQAL+SAPNPDDPL E
Sbjct  70   MAAPKVRFLTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALMSAPNPDDPLDE  129

Query  417  NIAKHWKTNEVEAVETAKEWTRLYA  343
             +A+HWK NEVEA++TA+ WT  YA
Sbjct  130  AVARHWKGNEVEAMDTARAWTAQYA  154



>emb|CDH58346.1| ubiquitin conjugating enzyme [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDS09053.1| Putative Ubiquitin-conjugating enzyme E2 N [Absidia idahoensis 
var. thermophila]
Length=149

 Score =   261 bits (666),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -3

Query  777  LPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYP  598
            LP+RIIKET+RLL+EPAPGISA+P EDN+RYF+V+I GPTQSP+EGGVF+LELFLPE+YP
Sbjct  3    LPKRIIKETERLLAEPAPGISATPHEDNLRYFDVVIAGPTQSPFEGGVFRLELFLPEDYP  62

Query  597  MAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSE  418
            MA PKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL+ 
Sbjct  63   MAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLAN  122

Query  417  NIAKHWKTNEVEAVETAKEWTRLYAS  340
            ++A+HWK N+  A+ TA+EWTR+YA 
Sbjct  123  DVAQHWKENDEAAIATAREWTRMYAQ  148



>ref|XP_004956558.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like isoform X3 
[Setaria italica]
Length=139

 Score =   260 bits (665),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 136/152 (89%), Gaps = 14/152 (9%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MA+SNLPRRIIKETQRLLSEPAPGISASP+E+NMRYFNVMILGP+QSPYEGGVFKLELFL
Sbjct  1    MAHSNLPRRIIKETQRLLSEPAPGISASPTEENMRYFNVMILGPSQSPYEGGVFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMA PK              LGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAPPK--------------LGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  106

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASG  337
            DPL++N+AKHWK+NE EAVETAKEWTRLYASG
Sbjct  107  DPLADNVAKHWKSNETEAVETAKEWTRLYASG  138



>gb|KDO63345.1| hypothetical protein CISIN_1g031320mg [Citrus sinensis]
Length=161

 Score =   261 bits (667),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -3

Query  729  APGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPN  550
            APGISASP+EDNMRYFNVMILGP+QSPYEGGVFKLELFLPE+YPM+APKVRFLTKIYHPN
Sbjct  30   APGISASPAEDNMRYFNVMILGPSQSPYEGGVFKLELFLPEDYPMSAPKVRFLTKIYHPN  89

Query  549  IDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEVEAVET  370
            IDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLS+NIAKHWK +E EAVET
Sbjct  90   IDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSDNIAKHWKADETEAVET  149

Query  369  AKEWTRLYASGA  334
            AKEWTRLYAS  
Sbjct  150  AKEWTRLYASDG  161



>ref|XP_003748080.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Metaseiulus 
occidentalis]
Length=152

 Score =   259 bits (663),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRL+ EP PGISA P E+N RYF+V++ GP +SP+EGGVFKLELFLPEE
Sbjct  3    AGLPRRIIKETQRLMLEPVPGISAVPDEENARYFHVVVAGPEESPFEGGVFKLELFLPEE  62

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPM+APKVRF+TKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  63   YPMSAPKVRFMTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  122

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WK NEVEA+ TA+EWTRLYA
Sbjct  123  ANDVAEQWKVNEVEAIRTAREWTRLYA  149



>ref|XP_010779820.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Notothenia coriiceps]
Length=154

 Score =   259 bits (663),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRI+KETQRL++EP PGI A P E N RYF+V+I GP  SP+EGGVFKLELFLPEE
Sbjct  2    AGLPRRILKETQRLIAEPVPGIRAEPDEGNARYFHVVICGPQDSPFEGGVFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYAS  340
            + ++A+ WK+NEVEA+ETAK WTRLYA 
Sbjct  122  ANDVAEKWKSNEVEAIETAKSWTRLYAG  149



>ref|XP_004748607.1| PREDICTED: ubiquitin-conjugating enzyme E2 N isoform X1 [Mustela 
putorius furo]
Length=152

 Score =   259 bits (662),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SPYEGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPYEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  122  ANDVAEQWKTNEAQAIETARAWTRLYA  148



>ref|XP_007435778.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Python bivittatus]
Length=152

 Score =   259 bits (662),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNEV+A+ETA+ WTRLYA
Sbjct  122  ANDVAEQWKTNEVQAIETARAWTRLYA  148



>pdb|2C2V|B Chain B, Crystal Structure Of The Chip-Ubc13-Uev1a Complex
 pdb|2C2V|E Chain E, Crystal Structure Of The Chip-Ubc13-Uev1a Complex
 pdb|2C2V|H Chain H, Crystal Structure Of The Chip-Ubc13-Uev1a Complex
 pdb|2C2V|K Chain K, Crystal Structure Of The Chip-Ubc13-Uev1a Complex
Length=154

 Score =   258 bits (660),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -3

Query  789  ANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLP  610
             ++ LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLP
Sbjct  2    GSAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLP  61

Query  609  EEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD  430
            EEYPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD
Sbjct  62   EEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD  121

Query  429  PLSENIAKHWKTNEVEAVETAKEWTRLYA  343
            PL+ ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  122  PLANDVAEQWKTNEAQAIETARAWTRLYA  150



>ref|NP_001012828.1| ubiquitin-conjugating enzyme E2 N [Gallus gallus]
 emb|CAH65129.1| hypothetical protein RCJMB04_3o20 [Gallus gallus]
Length=152

 Score =   258 bits (659),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAGPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  122  ANDVAEQWKTNEAQAIETARAWTRLYA  148



>ref|XP_007545597.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Poecilia formosa]
 ref|XP_008294225.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Stegastes partitus]
 ref|XP_008409686.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Poecilia reticulata]
Length=154

 Score =   258 bits (659),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDEGNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYAS  340
            + ++A+ WK+NE EA+ETAK WTRLYA 
Sbjct  122  ANDVAEKWKSNEAEAIETAKTWTRLYAG  149



>gb|KFM63508.1| Ubiquitin-conjugating enzyme E2 N, partial [Stegodyphus mimosarum]
Length=151

 Score =   258 bits (659),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  777  LPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYP  598
            LPRRIIKETQRL++EP PGISA P E N RYF+V++ GP +SP+EGGVFKLELFLPEEYP
Sbjct  4    LPRRIIKETQRLITEPVPGISAIPDESNARYFHVVVAGPEESPFEGGVFKLELFLPEEYP  63

Query  597  MAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSE  418
            M+APKVRF+TKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL+ 
Sbjct  64   MSAPKVRFMTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLAN  123

Query  417  NIAKHWKTNEVEAVETAKEWTRLYA  343
            ++A+ WK NE EA++TA+EWTRLYA
Sbjct  124  DVAEQWKVNEAEAIKTAREWTRLYA  148



>ref|NP_003339.1| ubiquitin-conjugating enzyme E2 N [Homo sapiens]
 ref|NP_542127.1| ubiquitin-conjugating enzyme E2 N [Mus musculus]
 ref|NP_001069726.1| ubiquitin-conjugating enzyme E2 N [Bos taurus]
 ref|NP_001127530.1| ubiquitin-conjugating enzyme E2 N [Pongo abelii]
 ref|NP_001156530.1| ubiquitin-conjugating enzyme E2 N [Ovis aries]
 ref|NP_001180523.1| ubiquitin-conjugating enzyme E2 N [Macaca mulatta]
 ref|NP_001232271.1| putative ubiquitin-conjugating enzyme E2N [Taeniopygia guttata]
 ref|NP_001239060.1| ubiquitin-conjugating enzyme E2 N [Canis lupus familiaris]
 ref|XP_001139171.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Pan troglodytes]
 ref|XP_002711246.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Oryctolagus cuniculus]
 ref|XP_002714242.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Oryctolagus cuniculus]
 ref|XP_002751731.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Callithrix jacchus]
 ref|XP_002752947.1| PREDICTED: ubiquitin-conjugating enzyme E2 N isoform X1 [Callithrix 
jacchus]
 ref|XP_003221087.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Anolis carolinensis]
 ref|XP_003259712.1| PREDICTED: ubiquitin-conjugating enzyme E2 N isoform 1 [Nomascus 
leucogenys]
 ref|XP_003405307.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Loxodonta africana]
 ref|XP_003771070.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Sarcophilus 
harrisii]
 ref|XP_003907001.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Papio anubis]
 ref|XP_004384260.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Trichechus manatus 
latirostris]
 ref|XP_004397528.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Odobenus rosmarus 
divergens]
 ref|XP_004400339.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Odobenus rosmarus 
divergens]
 ref|XP_004418010.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Ceratotherium simum 
simum]
 ref|XP_004446801.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Dasypus novemcinctus]
 ref|XP_004583158.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Ochotona princeps]
 ref|XP_004650235.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Jaculus jaculus]
 ref|XP_004675870.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Condylura cristata]
 ref|XP_004748651.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Mustela putorius 
furo]
 ref|XP_004884214.1| PREDICTED: ubiquitin-conjugating enzyme E2 N isoform X2 [Heterocephalus 
glaber]
 ref|XP_004845025.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Heterocephalus 
glaber]
 ref|XP_005143171.1| PREDICTED: ubiquitin-conjugating enzyme E2 N isoform X1 [Melopsittacus 
undulatus]
 ref|XP_005312708.1| PREDICTED: ubiquitin-conjugating enzyme E2 N isoform X1 [Chrysemys 
picta bellii]
 ref|XP_005361598.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Microtus ochrogaster]
 ref|XP_005374519.1| PREDICTED: ubiquitin-conjugating enzyme E2 N isoform X1 [Chinchilla 
lanigera]
 ref|XP_005519483.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Pseudopodoces humilis]
 ref|XP_005606554.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Equus caballus]
 ref|XP_005664319.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Sus scrofa]
 ref|XP_005688259.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Capra hircus]
 ref|XP_005889130.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Bos mutus]
 ref|XP_005980369.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Pantholops hodgsonii]
 ref|XP_006027121.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Alligator sinensis]
 ref|XP_006084088.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Myotis lucifugus]
 ref|XP_006269348.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Alligator mississippiensis]
 ref|XP_006735522.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Leptonychotes weddellii]
 ref|XP_006923891.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Pteropus alecto]
 ref|XP_007069296.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Chelonia mydas]
 ref|XP_006070283.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Bubalus bubalis]
 ref|XP_007468264.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Lipotes vexillifer]
 ref|XP_007503274.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Monodelphis domestica]
 ref|XP_007523268.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Erinaceus europaeus]
 ref|XP_008002437.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Chlorocebus sabaeus]
 ref|XP_008513542.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Equus przewalskii]
 ref|XP_008588120.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Galeopterus variegatus]
 ref|XP_008822026.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Nannospalax galili]
 ref|XP_010382235.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Rhinopithecus roxellana]
 ref|XP_010560169.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Haliaeetus leucocephalus]
 ref|XP_010838002.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Bison bison bison]
 sp|P61088.1|UBE2N_HUMAN RecName: Full=Ubiquitin-conjugating enzyme E2 N; AltName: Full=Bendless-like 
ubiquitin-conjugating enzyme; AltName: Full=Ubc13; 
AltName: Full=UbcH13; AltName: Full=Ubiquitin carrier 
protein N; AltName: Full=Ubiquitin-protein ligase N [Homo sapiens]
 sp|P61089.1|UBE2N_MOUSE RecName: Full=Ubiquitin-conjugating enzyme E2 N; AltName: Full=Bendless-like 
ubiquitin-conjugating enzyme; AltName: Full=Ubc13; 
AltName: Full=Ubiquitin carrier protein N; AltName: Full=Ubiquitin-protein 
ligase N [Mus musculus]
 sp|Q5R7J6.1|UBE2N_PONAB RecName: Full=Ubiquitin-conjugating enzyme E2 N; AltName: Full=Ubiquitin 
carrier protein N; AltName: Full=Ubiquitin-protein 
ligase N [Pongo abelii]
 sp|Q0P5K3.1|UBE2N_BOVIN RecName: Full=Ubiquitin-conjugating enzyme E2 N; AltName: Full=Ubiquitin 
carrier protein N; AltName: Full=Ubiquitin-protein 
ligase N [Bos taurus]
 pdb|1J7D|B Chain B, Crystal Structure Of Hmms2-Hubc13
 pdb|4DHI|D Chain D, Structure Of C. Elegans Otub1 Bound To Human Ubc13
 pdb|4DHJ|C Chain C, The Structure Of A Ceotub1 Ubiquitin Aldehyde Ubc13~ub 
Complex
 pdb|4DHJ|K Chain K, The Structure Of A Ceotub1 Ubiquitin Aldehyde Ubc13~ub 
Complex
 pdb|4DHJ|G Chain G, The Structure Of A Ceotub1 Ubiquitin Aldehyde Ubc13~ub 
Complex
 pdb|4DHJ|N Chain N, The Structure Of A Ceotub1 Ubiquitin Aldehyde Ubc13~ub 
Complex
 pdb|4DHZ|F Chain F, The Structure Of HCEOTUB1-Ubiquitin Aldehyde-Ubc13~ub
 dbj|BAA11675.1| ubiquitin-conjugating enzyme E2 UbcH-ben [Homo sapiens]
 gb|AAH00396.1| Ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast) [Homo 
sapiens]
 dbj|BAB23941.1| unnamed protein product [Mus musculus]
 gb|AAH03365.1| Ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast) [Homo 
sapiens]
 gb|AAK74128.1| E2 ubiquitin conjugating enzyme UBC13 [Mus musculus]
 emb|CAA71001.1| bendless-like ubiquitin conjugating enzyme [Mus musculus]
 gb|AAP35519.1| ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast) [Homo 
sapiens]
 gb|AAH67069.1| Ubiquitin-conjugating enzyme E2N [Mus musculus]
 gb|AAH34898.3| Ubiquitin-conjugating enzyme E2N [Mus musculus]
 emb|CAH92264.1| hypothetical protein [Pongo abelii]
 gb|AAX41704.1| ubiquitin-conjugating enzyme E2N [synthetic construct]
 gb|AAX41705.1| ubiquitin-conjugating enzyme E2N [synthetic construct]
 gb|AAI08705.1| Ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast) [Homo 
sapiens]
 gb|AAI19932.1| Ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast) [Bos 
taurus]
 gb|EAW97480.1| ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast), isoform 
CRA_a [Homo sapiens]
 gb|EAW97481.1| ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast), isoform 
CRA_a [Homo sapiens]
 gb|EAW97482.1| ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast), isoform 
CRA_a [Homo sapiens]
 gb|ABM87762.1| ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast) [synthetic 
construct]
 gb|AAI32631.1| Ubiquitin-conjugating enzyme E2N [Mus musculus]
 gb|EDL21609.1| mCG4297 [Mus musculus]
 gb|ABW03914.1| ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast) [synthetic 
construct]
 gb|ABW03917.1| ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast) [synthetic 
construct]
 gb|AAI38212.1| Ubiquitin-conjugating enzyme E2N [Mus musculus]
 gb|ACH46292.1| putative ubiquitin-conjugating enzyme E2N [Taeniopygia guttata]
 gb|ACH46293.1| putative ubiquitin-conjugating enzyme E2N [Taeniopygia guttata]
 dbj|BAG73849.1| ubiquitin-conjugating enzyme E2N [synthetic construct]
 gb|ACI46046.1| epididymis secretory protein Li 71 [Homo sapiens]
 gb|ACR56694.1| ubiquitin-conjugating enzyme [Ovis aries]
 tpg|DAA30062.1| TPA: ubiquitin-conjugating enzyme E2 N [Bos taurus]
 gb|ELK02565.1| Ubiquitin-conjugating enzyme E2 N [Pteropus alecto]
 gb|ELR61212.1| Ubiquitin-conjugating enzyme E2 N [Bos mutus]
Length=152

 Score =   258 bits (658),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  122  ANDVAEQWKTNEAQAIETARAWTRLYA  148



>pdb|3HCT|B Chain B, Crystal Structure Of Traf6 In Complex With Ubc13 In 
The P1 Space Group
 pdb|3HCU|B Chain B, Crystal Structure Of Traf6 In Complex With Ubc13 In 
The C2 Space Group
 pdb|3HCU|D Chain D, Crystal Structure Of Traf6 In Complex With Ubc13 In 
The C2 Space Group
 pdb|3W31|B Chain B, Structual Basis For The Recognition Of Ubc13 By The 
Shigella Flexneri Effector Ospi
Length=155

 Score =   258 bits (658),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  5    AGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  64

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  65   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  124

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  125  ANDVAEQWKTNEAQAIETARAWTRLYA  151



>ref|XP_006543032.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Mus musculus]
Length=203

 Score =   259 bits (663),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  122  ANDVAEQWKTNEAQAIETARAWTRLYA  148



>ref|XP_001623427.1| predicted protein [Nematostella vectensis]
 ref|XP_001632658.1| predicted protein [Nematostella vectensis]
 gb|EDO31327.1| predicted protein [Nematostella vectensis]
 gb|EDO40595.1| predicted protein [Nematostella vectensis]
Length=153

 Score =   258 bits (658),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            M++  LPRRIIKETQRL++EP  GI A P E N RYF+V + GP  SPYEGG FKLELFL
Sbjct  1    MSSVGLPRRIIKETQRLVAEPVAGIQAVPDESNARYFHVTVNGPKDSPYEGGTFKLELFL  60

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRF+TKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  61   PEEYPMAAPKVRFMTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  120

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            DPL+ ++A+ WK NEV+A+ETAK WTRLYA+ +
Sbjct  121  DPLANDVAEQWKVNEVQAIETAKAWTRLYANAS  153



>gb|AAP36228.1| Homo sapiens ubiquitin-conjugating enzyme E2N (UBC13 homolog, 
yeast) [synthetic construct]
 gb|AAX43336.1| ubiquitin-conjugating enzyme E2N [synthetic construct]
Length=153

 Score =   257 bits (657),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  122  ANDVAEQWKTNEAQAIETARAWTRLYA  148



>ref|NP_998651.1| ubiquitin-conjugating enzyme E2 N [Danio rerio]
 ref|NP_001187530.1| ubiquitin-conjugating enzyme e2 n [Ictalurus punctatus]
 ref|XP_006633237.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Lepisosteus 
oculatus]
 ref|XP_007250615.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Astyanax mexicanus]
 gb|AAH44461.1| Ubiquitin-conjugating enzyme E2N [Danio rerio]
 emb|CAK04885.1| ubiquitin-conjugating enzyme E2N [Danio rerio]
 gb|AAI64904.1| Ube2n protein [Danio rerio]
 gb|ADO28774.1| ubiquitin-conjugating enzyme e2 n [Ictalurus punctatus]
Length=154

 Score =   257 bits (657),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDEGNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYAS  340
            + ++A+ WKTNE +A+ETA+ WTRLYA 
Sbjct  122  ANDVAEQWKTNEAQAIETARTWTRLYAG  149



>ref|XP_006747857.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Leptonychotes 
weddellii]
Length=152

 Score =   257 bits (657),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AALPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  122  ANDVAEQWKTNEAQAIETARAWTRLYA  148



>ref|XP_004006306.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Ovis aries]
Length=152

 Score =   257 bits (656),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPIPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  122  ANDVAEQWKTNEAQAIETARAWTRLYA  148



>ref|NP_989375.1| ubiquitin-conjugating enzyme E2 N [Xenopus (Silurana) tropicalis]
 gb|AAH64184.1| ubiquitin-conjugating enzyme E2N (UBC13 homolog) [Xenopus (Silurana) 
tropicalis]
 emb|CAJ82488.1| ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast) [Xenopus 
(Silurana) tropicalis]
Length=152

 Score =   257 bits (656),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E+N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDENNARYFHVLIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE +A+ETA+ WTRL+A
Sbjct  122  ANDVAEQWKTNEAQAIETARAWTRLHA  148



>pdb|4ORH|B Chain B, Crystal Structure Of Rnf8 Bound To The Ubc13/mms2 Heterodimer
 pdb|4ORH|F Chain F, Crystal Structure Of Rnf8 Bound To The Ubc13/mms2 Heterodimer
 pdb|4ORH|J Chain J, Crystal Structure Of Rnf8 Bound To The Ubc13/mms2 Heterodimer
Length=160

 Score =   257 bits (657),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  10   AGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  69

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  70   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  129

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  130  ANDVAEQWKTNEAQAIETARAWTRLYA  156



>pdb|4IP3|B Chain B, Complex Structure Of Ospi And Ubc13
Length=172

 Score =   258 bits (658),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  22   AGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  81

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  82   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  141

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  142  ANDVAEQWKTNEAQAIETARAWTRLYA  168



>pdb|3VON|C Chain C, Crystalstructure Of The Ubiquitin Protease
 pdb|3VON|E Chain E, Crystalstructure Of The Ubiquitin Protease
 pdb|3VON|G Chain G, Crystalstructure Of The Ubiquitin Protease
 pdb|3VON|J Chain J, Crystalstructure Of The Ubiquitin Protease
 pdb|3VON|L Chain L, Crystalstructure Of The Ubiquitin Protease
 pdb|3VON|N Chain N, Crystalstructure Of The Ubiquitin Protease
 pdb|3VON|Q Chain Q, Crystalstructure Of The Ubiquitin Protease
 pdb|3VON|S Chain S, Crystalstructure Of The Ubiquitin Protease
 pdb|3VON|U Chain U, Crystalstructure Of The Ubiquitin Protease
 pdb|3VON|X Chain X, Crystalstructure Of The Ubiquitin Protease
 pdb|3VON|Z Chain Z, Crystalstructure Of The Ubiquitin Protease
 pdb|3VON|BB Chain b, Crystalstructure Of The Ubiquitin Protease
 pdb|3VON|EE Chain e, Crystalstructure Of The Ubiquitin Protease
 pdb|3VON|GG Chain g, Crystalstructure Of The Ubiquitin Protease
 pdb|3VON|II Chain i, Crystalstructure Of The Ubiquitin Protease
 pdb|3VON|LL Chain l, Crystalstructure Of The Ubiquitin Protease
 pdb|3VON|NN Chain n, Crystalstructure Of The Ubiquitin Protease
 pdb|3VON|PP Chain p, Crystalstructure Of The Ubiquitin Protease
Length=148

 Score =   257 bits (656),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -3

Query  780  NLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEY  601
             LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEEY
Sbjct  1    GLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEY  60

Query  600  PMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLS  421
            PMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL+
Sbjct  61   PMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLA  120

Query  420  ENIAKHWKTNEVEAVETAKEWTRLYA  343
             ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  121  NDVAEQWKTNEAQAIETARAWTRLYA  146



>gb|KFH72712.1| ubiquitin-conjugating enzyme E2 36 [Mortierella verticillata 
NRRL 6337]
Length=149

 Score =   257 bits (656),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  777  LPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYP  598
            LP+RIIKET+RLL++PAPGISA+P EDN+RYF+V+I GP QSP+EGGVFKLELFLPE+YP
Sbjct  3    LPKRIIKETERLLADPAPGISATPHEDNLRYFDVIIAGPNQSPFEGGVFKLELFLPEDYP  62

Query  597  MAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSE  418
            MA PKVRF+TKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLS+QALLS+PNPDDPL+ 
Sbjct  63   MAPPKVRFMTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSVQALLSSPNPDDPLAN  122

Query  417  NIAKHWKTNEVEAVETAKEWTRLYASG  337
            ++A+HWK NE  A++TA++WTR YA+ 
Sbjct  123  DVAQHWKENENNAIQTAQDWTRKYATA  149



>gb|EGT53848.1| CBN-UBC-13 protein [Caenorhabditis brenneri]
Length=154

 Score =   257 bits (656),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            S LPRRIIKETQRLL++P PGISA+P E N RYF+VMI GP  SP+ GGVFKLELFLPEE
Sbjct  3    SQLPRRIIKETQRLLADPVPGISANPDESNARYFHVMIAGPDDSPFAGGVFKLELFLPEE  62

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP+DPL
Sbjct  63   YPMAAPKVRFMTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPEDPL  122

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE EA++TAK+WT+ YA
Sbjct  123  ATDVAEQWKTNEAEAIKTAKQWTQSYA  149



>ref|XP_005797246.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Xiphophorus 
maculatus]
 ref|XP_007540417.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Poecilia formosa]
 ref|XP_008399154.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Poecilia reticulata]
Length=153

 Score =   257 bits (656),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRL++EP PGI+A+P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLMAEPVPGITATPDEGNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYAS  340
            + ++A+ WK NE  A+ETA+ WTRLYAS
Sbjct  122  ANDVAEQWKKNESHAIETARTWTRLYAS  149



>tpg|DAA34583.1| TPA_exp: ubiquitin protein ligase [Amblyomma variegatum]
Length=151

 Score =   257 bits (656),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            S LPRRIIKETQRL++EP PGISA P E N RYF+V++ GP  SP+EGGVFKLELFLPEE
Sbjct  2    SALPRRIIKETQRLMAEPVPGISAVPDESNARYFHVIVSGPEGSPFEGGVFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPM APKVRF+TKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMLAPKVRFMTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WK NE EA++TA+EWTRLYA
Sbjct  122  ANDVAEQWKVNEAEAIKTAREWTRLYA  148



>gb|ACH46291.1| putative ubiquitin-conjugating enzyme E2N [Taeniopygia guttata]
Length=152

 Score =   256 bits (655),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRII+ETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIRETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  122  ANDVAEQWKTNEAQAIETARAWTRLYA  148



>ref|XP_004623156.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Octodon degus]
Length=152

 Score =   256 bits (655),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLVEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  122  ANDVAEQWKTNEAQAIETARAWTRLYA  148



>ref|NP_446380.1| ubiquitin-conjugating enzyme E2 N [Rattus norvegicus]
 ref|XP_004269591.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Orcinus orca]
 sp|Q9EQX9.1|UBE2N_RAT RecName: Full=Ubiquitin-conjugating enzyme E2 N; AltName: Full=Bendless-like 
ubiquitin-conjugating enzyme; AltName: Full=Ubiquitin 
carrier protein N; AltName: Full=Ubiquitin-protein 
ligase N [Rattus norvegicus]
 dbj|BAB20414.1| bendless protein [Rattus norvegicus]
 gb|AAH90072.1| Ubiquitin-conjugating enzyme E2N [Rattus norvegicus]
 gb|EDM16856.1| ubiquitin-conjugating enzyme E2N [Rattus norvegicus]
Length=152

 Score =   256 bits (655),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WK+NE +A+ETA+ WTRLYA
Sbjct  122  ANDVAEQWKSNEAQAIETARAWTRLYA  148



>gb|EDK98464.1| mCG1038069 [Mus musculus]
Length=206

 Score =   258 bits (660),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  122  ANDVAEQWKTNEAQAIETARAWTRLYA  148



>ref|XP_003440565.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Oreochromis 
niloticus]
 ref|XP_006789600.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Neolamprologus 
brichardi]
Length=154

 Score =   256 bits (654),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG F+LELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDEANARYFHVVIAGPQDSPFEGGTFRLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYAS  340
            + ++A+ WKT+E EA+ETAK WTRLYA 
Sbjct  122  ANDVAEKWKTSEAEAIETAKTWTRLYAG  149



>gb|EFX70655.1| hypothetical protein DAPPUDRAFT_309332 [Daphnia pulex]
Length=152

 Score =   256 bits (654),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRL++EP PGISA P E N RYF+V++ GP  SP+EGGVFKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLMAEPVPGISAVPDEQNARYFHVVVAGPEGSPFEGGVFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPM+APKVRF+TKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMSAPKVRFMTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYASG  337
            + ++A+ WK NEVEA+  A+EWTR YA G
Sbjct  122  ANDVAELWKVNEVEAIRNAREWTRTYAMG  150



>ref|NP_956636.1| ubiquitin-conjugating enzyme E2Nb [Danio rerio]
 gb|AAH53141.1| Ubiquitin-conjugating enzyme E2N-like [Danio rerio]
Length=154

 Score =   256 bits (654),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDEGNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYAS  340
            + ++A+ WK+NE +A+ETA+ WTRLYA 
Sbjct  122  ANDVAEQWKSNEAQAIETARTWTRLYAG  149



>ref|XP_002634988.1| C. briggsae CBR-UBC-13 protein [Caenorhabditis briggsae]
 emb|CAP32312.1| Protein CBR-UBC-13 [Caenorhabditis briggsae]
Length=151

 Score =   256 bits (654),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            S LPRRIIKETQRLL++P PGISA+P E N RYF+VMI GP  SP+ GGVFKLELFLPEE
Sbjct  3    SQLPRRIIKETQRLLADPVPGISANPDESNARYFHVMIAGPDDSPFAGGVFKLELFLPEE  62

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP+DPL
Sbjct  63   YPMAAPKVRFMTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPEDPL  122

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYASG  337
            + ++A+ WKTNE EA++TAK+WT  YA  
Sbjct  123  ATDVAEQWKTNEAEAIKTAKQWTLSYAQA  151



>ref|XP_005802310.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Xiphophorus 
maculatus]
Length=154

 Score =   256 bits (654),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDEGNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYAS  340
            + ++A+ WK++E EA+ETAK WTRLYA 
Sbjct  122  ANDVAEKWKSSEAEAIETAKTWTRLYAG  149



>pdb|4NRI|B Chain B, Crystal Structure Of A Human Mms2/ubc13 A122g Mutant
Length=156

 Score =   256 bits (654),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -3

Query  780  NLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEY  601
             LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEEY
Sbjct  9    GLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEY  68

Query  600  PMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLS  421
            PMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL 
Sbjct  69   PMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLG  128

Query  420  ENIAKHWKTNEVEAVETAKEWTRLYA  343
             ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  129  NDVAEQWKTNEAQAIETARAWTRLYA  154



>gb|ACM08830.1| Ubiquitin-conjugating enzyme E2 N [Salmo salar]
 gb|ACM09511.1| Ubiquitin-conjugating enzyme E2 N [Salmo salar]
 emb|CDQ75340.1| unnamed protein product [Oncorhynchus mykiss]
 emb|CDQ70833.1| unnamed protein product [Oncorhynchus mykiss]
Length=154

 Score =   256 bits (653),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDEANARYFHVVISGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            + ++A+ WK+NE +A+ETA+ WTRLYA  +
Sbjct  122  ANDVAEQWKSNEAQAIETARTWTRLYAGNS  151



>ref|XP_006007468.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Latimeria chalumnae]
Length=156

 Score =   256 bits (653),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRL++EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLMAEPVPGIKAEPDEGNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WK+NE +A+ETAK WTRLYA
Sbjct  122  ANDVAEQWKSNEGQAIETAKSWTRLYA  148



>ref|XP_010888621.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Esox lucius]
Length=154

 Score =   256 bits (653),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRL++EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLMAEPVPGIKAEPDEGNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYAS  340
            + ++A+ WK+NE +A+ETA+ WTRLYA 
Sbjct  122  ANDVAEQWKSNEAQAIETARTWTRLYAQ  149



>ref|NP_001080830.1| ubiquitin-conjugating enzyme E2N [Xenopus laevis]
 gb|AAH53797.1| Ube2n-prov protein [Xenopus laevis]
Length=152

 Score =   256 bits (653),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E+N R+F+V I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDENNARFFHVAIAGPQDSPFEGGSFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  122  ANDVAEQWKTNEAQAIETARAWTRLYA  148



>ref|XP_010862500.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Esox lucius]
Length=154

 Score =   255 bits (652),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDEANARYFHVVISGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYAS  340
            + ++A+ WK+NE +A+ETA+ WTRLYA 
Sbjct  122  ANDVAEQWKSNEAQAIETARTWTRLYAG  149



>dbj|BAB24239.1| unnamed protein product [Mus musculus]
Length=152

 Score =   255 bits (652),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLS PNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSDPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  122  ANDVAEQWKTNEAQAIETARAWTRLYA  148



>ref|XP_002733137.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Saccoglossus 
kowalevskii]
Length=149

 Score =   255 bits (652),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRI+KETQRL+ EP PGISA P E+N RYF+V++ GP +SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIVKETQRLMQEPVPGISAVPDENNARYFHVVVAGPEESPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPM+APKVRF+TKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMSAPKVRFMTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WK NE +A+ETA+ WTRLYA
Sbjct  122  ANDVAEQWKVNEAQAIETARAWTRLYA  148



>ref|NP_001271807.1| ubiquitin-conjugating enzyme E2 N [Macaca fascicularis]
 sp|Q4R4I1.1|UBE2N_MACFA RecName: Full=Ubiquitin-conjugating enzyme E2 N; AltName: Full=Ubiquitin 
carrier protein N; AltName: Full=Ubiquitin-protein 
ligase N [Macaca fascicularis]
 dbj|BAE01994.1| unnamed protein product [Macaca fascicularis]
Length=152

 Score =   255 bits (652),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DK GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKSGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  122  ANDVAEQWKTNEAQAIETARAWTRLYA  148



>ref|XP_004548237.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Maylandia 
zebra]
 ref|XP_005725341.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Pundamilia 
nyererei]
 ref|XP_005930474.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Haplochromis 
burtoni]
Length=153

 Score =   255 bits (651),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRI+KETQRL++EP PGI+A+P E N RYF+V I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIVKETQRLMAEPVPGITATPDEGNARYFHVFIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            + ++A+ WK NE +A+ETA+ WTRLYA  +
Sbjct  122  ANDVAEQWKKNESQAIETARTWTRLYAGNS  151



>ref|XP_008313970.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Cynoglossus semilaevis]
Length=153

 Score =   255 bits (651),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRL++EP PGI+A+P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLMAEPVPGITATPDEGNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILK+KWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKEKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYAS  340
            + ++A+ WK NE  A+ETA+ WTRLYAS
Sbjct  122  ANDVAEQWKKNESHAIETARTWTRLYAS  149



>gb|AIT40204.1| Ubiquitin protein ligase Ubc13 [Rhipicephalus microplus]
Length=151

 Score =   255 bits (651),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            S LPRRIIKETQRL++EP PGISA P E N RYF+V++ GP  SP+EGGVFKLELFLPEE
Sbjct  2    SGLPRRIIKETQRLMAEPVPGISAIPDEQNARYFHVVVAGPEGSPFEGGVFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPM APKVRF+TKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMLAPKVRFMTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WK NE EA+ TA+EWTR YA
Sbjct  122  ANDVAEQWKVNEAEAIRTAREWTRQYA  148



>ref|XP_010784120.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Notothenia coriiceps]
Length=153

 Score =   255 bits (651),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRL++EP PGI+A+P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLMAEPVPGITATPDEGNARYFHVIIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYAS  340
            + ++A+ WK NE  A+ETA+ WTRLYA 
Sbjct  122  ANDVAEQWKKNESNAIETARSWTRLYAG  149



>ref|XP_004563518.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like isoform X2 
[Maylandia zebra]
 ref|XP_005737670.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Pundamilia 
nyererei]
 ref|XP_005943751.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Haplochromis 
burtoni]
Length=154

 Score =   255 bits (651),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG F+LELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDEANARYFHVVIAGPQDSPFEGGTFRLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYAS  340
            + ++A+ WK++E EA+ETAK WTRLYA 
Sbjct  122  ANDVAEKWKSSEAEAIETAKTWTRLYAG  149



>emb|CDJ82209.1| Ubiquitin-conjugating enzyme domain containing protein [Haemonchus 
contortus]
 gb|ETN79891.1| ubiquitin--protein ligase [Necator americanus]
 gb|EYC34550.1| hypothetical protein Y032_0001g467 [Ancylostoma ceylanicum]
Length=151

 Score =   254 bits (650),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -3

Query  777  LPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYP  598
            LPRRIIKETQRL+++P PGISASP ++N RYF+VMI GP  SP+ GGVFKLELFLPEEYP
Sbjct  5    LPRRIIKETQRLMADPVPGISASPDDNNARYFHVMIAGPQDSPFAGGVFKLELFLPEEYP  64

Query  597  MAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSE  418
            MAAPKVRF+TKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP+DPL+ 
Sbjct  65   MAAPKVRFMTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPEDPLAT  124

Query  417  NIAKHWKTNEVEAVETAKEWTRLYA  343
            ++A+ WKTNE EA+ TAKEWT  YA
Sbjct  125  DVAEQWKTNETEAIRTAKEWTLQYA  149



>pdb|4NRG|B Chain B, Crystal Structure Of A Human Mms2/ubc13 D118g Mutant
Length=160

 Score =   255 bits (651),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  10   AGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  69

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP DPL
Sbjct  70   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPGDPL  129

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  130  ANDVAEQWKTNEAQAIETARAWTRLYA  156



>ref|NP_500272.2| Protein UBC-13 [Caenorhabditis elegans]
 emb|CCD83521.1| Protein UBC-13 [Caenorhabditis elegans]
Length=151

 Score =   254 bits (650),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
              LPRRIIKETQRLL++P PGISA+P E N RYF+VMI GP  SP+ GGVFKLELFLPEE
Sbjct  3    GQLPRRIIKETQRLLADPVPGISANPDESNARYFHVMIAGPDDSPFAGGVFKLELFLPEE  62

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP+DPL
Sbjct  63   YPMAAPKVRFMTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPEDPL  122

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYASG  337
            + ++A+ WKTNE EA++TAK+WT  YA  
Sbjct  123  ATDVAEQWKTNEAEAIKTAKQWTMNYAQA  151



>ref|XP_004069764.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Oryzias latipes]
Length=154

 Score =   254 bits (650),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYAS  340
            + ++A+ WK+NE EA++ AK WTRLYA 
Sbjct  122  ANDVAEKWKSNEAEAIDIAKTWTRLYAG  149



>gb|ABQ12946.1| ubiquitin-conjugating enzyme E2N-like [Bos taurus]
Length=152

 Score =   254 bits (650),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LP RIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPCRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  122  ANDVAEQWKTNEAQAIETARAWTRLYA  148



>ref|XP_003972864.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Takifugu rubripes]
Length=153

 Score =   254 bits (650),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRL++EP PGI+A+P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLMAEPVPGITATPDERNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYAS  340
            + ++A+ WK NE  A+ETA+ WTRLYA 
Sbjct  122  ANDVAEQWKKNESAAIETARAWTRLYAG  149



>pdb|4NR3|B Chain B, Crystal Structure Of A Human Mms2/ubc13 L121g Mutant
Length=157

 Score =   254 bits (650),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  9    AGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  68

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDP 
Sbjct  69   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPG  128

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  129  ANDVAEQWKTNEAQAIETARAWTRLYA  155



>ref|XP_008281153.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Stegastes 
partitus]
Length=152

 Score =   254 bits (649),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRI+KETQRL++EP PGI+A+P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIVKETQRLMAEPVPGITATPDEGNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WK NE  A+ETA+ WTRLYA
Sbjct  122  ANDVAEQWKKNESHAIETARTWTRLYA  148



>gb|KHJ97097.1| ubiquitin--protein ligase [Oesophagostomum dentatum]
Length=151

 Score =   254 bits (649),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -3

Query  777  LPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYP  598
            LPRRIIKETQRL+++P PGISASP ++N RYF+VMI GP  SP+ GGVFKLELFLPEEYP
Sbjct  5    LPRRIIKETQRLMADPVPGISASPDDNNARYFHVMIAGPQDSPFAGGVFKLELFLPEEYP  64

Query  597  MAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSE  418
            MAAPKVRF+TKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP+DPL+ 
Sbjct  65   MAAPKVRFMTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPEDPLAT  124

Query  417  NIAKHWKTNEVEAVETAKEWTRLYA  343
            ++A+ WKTNE EA+ TAKEWT  YA
Sbjct  125  DVAEQWKTNESEAIRTAKEWTLQYA  149



>ref|XP_003096237.1| CRE-UBC-13 protein [Caenorhabditis remanei]
 gb|EFO87367.1| CRE-UBC-13 protein [Caenorhabditis remanei]
Length=151

 Score =   254 bits (649),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
              LPRRIIKETQRLL++P PGISA+P E N RYF+VMI GP  SP+ GGVFKLELFLPEE
Sbjct  3    GQLPRRIIKETQRLLADPVPGISANPDESNARYFHVMIAGPDDSPFAGGVFKLELFLPEE  62

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP+DPL
Sbjct  63   YPMAAPKVRFMTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPEDPL  122

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE EA++TAK+WT  YA
Sbjct  123  ATDVAEQWKTNEAEAIKTAKQWTLSYA  149



>ref|XP_007092043.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Panthera tigris 
altaica]
Length=152

 Score =   254 bits (649),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLL IQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLLIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ W+TNE +A+ETA+ WTRLYA
Sbjct  122  ANDVAEQWRTNEAQAIETARAWTRLYA  148



>ref|XP_004663760.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Jaculus jaculus]
Length=152

 Score =   254 bits (649),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP P I A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPDIKAEPDESNARYFHVVIGGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  122  ANDVAEQWKTNEAQAIETARAWTRLYA  148



>ref|XP_003445019.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Oreochromis 
niloticus]
Length=153

 Score =   254 bits (649),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRI+KETQRL++EP PGI+A+P E N RYF+V I GP  SP+EGG F+LELFLPEE
Sbjct  2    AGLPRRIVKETQRLMAEPVPGITATPDEGNARYFHVFIAGPQDSPFEGGTFRLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            + ++A+ WK NE +A+ETA+ WTRLYA  +
Sbjct  122  ANDVAEQWKKNESQAIETARTWTRLYAGNS  151



>ref|XP_003433156.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Canis lupus 
familiaris]
Length=152

 Score =   254 bits (648),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQGSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQI TVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQICTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  122  ANDVAEQWKTNETQAIETARAWTRLYA  148



>ref|XP_642773.2| hypothetical protein DDB_G0277267 [Dictyostelium discoideum AX4]
 sp|Q86K32.2|UBE2N_DICDI RecName: Full=Probable ubiquitin-conjugating enzyme E2 N; AltName: 
Full=Ubiquitin carrier protein N; AltName: Full=Ubiquitin-protein 
ligase N [Dictyostelium discoideum]
 gb|EAL68819.2| hypothetical protein DDB_G0277267 [Dictyostelium discoideum AX4]
Length=154

 Score =   254 bits (648),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LP+RIIKETQRL++EPAPGISA+P+ DN RYF V I GP  SP+EGGVF LELFL ++
Sbjct  2    ATLPKRIIKETQRLMTEPAPGISATPATDNFRYFKVAISGPLDSPFEGGVFNLELFLTDD  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPM+APKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMSAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYASG  337
            + ++A+HWKTNE EA+  A+EWTRLYA  
Sbjct  122  ANDVAEHWKTNEKEAMARAREWTRLYAEA  150



>gb|AJA90882.1| ubiquitin-conjugating enzyme UBE2N [Lethenteron camtschaticum]
Length=152

 Score =   254 bits (648),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    TGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPADSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMA PKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAPPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WK NE +A+ETA+ WTRLYA
Sbjct  122  ANDVAEQWKVNEAQAIETARAWTRLYA  148



>gb|ADO27889.1| ubiquitin-conjugating enzyme e2 n [Ictalurus furcatus]
Length=154

 Score =   254 bits (648),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPR IIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRGIIKETQRLLAEPVPGIKAEPDEGNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYAS  340
              ++A+ WKTNE +A+ETA+ WTRLYA 
Sbjct  122  VNDVAEQWKTNEAQAIETARTWTRLYAG  149



>ref|XP_008843971.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Nannospalax 
galili]
Length=152

 Score =   254 bits (648),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQ LL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQHLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKW PALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWFPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYAS  340
            + ++A+ WKTNE +A+ETA+ WTRLYA+
Sbjct  122  ANDVAEQWKTNEAQAIETARAWTRLYAT  149



>gb|ETS64227.1| hypothetical protein PaG_01468 [Pseudozyma aphidis DSM 70725]
 dbj|GAK65991.1| ubiquitin-conjugating enzyme [Pseudozyma antarctica]
Length=148

 Score =   253 bits (647),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -3

Query  780  NLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEY  601
            +LP+RIIKET+RL+++PAPGISA+P EDN+RYF+V+I GPTQSP+EGGVF+LELFLPEEY
Sbjct  2    SLPKRIIKETERLIADPAPGISATPHEDNLRYFDVVISGPTQSPFEGGVFRLELFLPEEY  61

Query  600  PMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLS  421
            PM+APKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLS+QALLSAPNPDDPL+
Sbjct  62   PMSAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSVQALLSAPNPDDPLA  121

Query  420  ENIAKHWKTNEVEAVETAKEWTRLYA  343
             ++A+H+K +E  A+E +++WT LYA
Sbjct  122  NDVAEHYKKDEKGAIEVSRQWTALYA  147



>gb|EYC34553.1| hypothetical protein Y032_0001g467 [Ancylostoma ceylanicum]
Length=290

 Score =   258 bits (660),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -3

Query  777  LPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYP  598
            LPRRIIKETQRL+++P PGISASP ++N RYF+VMI GP  SP+ GGVFKLELFLPEEYP
Sbjct  5    LPRRIIKETQRLMADPVPGISASPDDNNARYFHVMIAGPQDSPFAGGVFKLELFLPEEYP  64

Query  597  MAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSE  418
            MAAPKVRF+TKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP+DPL+ 
Sbjct  65   MAAPKVRFMTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPEDPLAT  124

Query  417  NIAKHWKTNEVEAVETAKEWTRLYA  343
            ++A+ WKTNE EA+ TAKEWT  YA
Sbjct  125  DVAEQWKTNETEAIRTAKEWTLQYA  149



>gb|EYC34551.1| hypothetical protein Y032_0001g467 [Ancylostoma ceylanicum]
Length=290

 Score =   258 bits (660),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 135/150 (90%), Gaps = 1/150 (1%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MA + LPRRIIKETQRL+++P PGISASP ++N RYF+VMI GP  SP+ GGVFKLELFL
Sbjct  1    MAGA-LPRRIIKETQRLMADPVPGISASPDDNNARYFHVMIAGPQDSPFAGGVFKLELFL  59

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRF+TKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP+
Sbjct  60   PEEYPMAAPKVRFMTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPE  119

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYA  343
            DPL+ ++A+ WKTNE EA+ TAKEWT  YA
Sbjct  120  DPLATDVAEQWKTNETEAIRTAKEWTLQYA  149



>ref|NP_001191642.1| ubiquitin-conjugating enzyme E2N [Aplysia californica]
 gb|ACU83595.1| ubiquitin-conjugating enzyme E2N [Aplysia californica]
Length=155

 Score =   254 bits (648),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRL++EP  GI+A P E N RY +V++ GP+QSPYEGG+FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLMAEPVAGITAIPDESNARYXHVVVAGPSQSPYEGGLFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPM+APKVRF+TKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMSAPKVRFMTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
              N+A+HWKTNE  A++ A++WT+LYA
Sbjct  122  ENNVAEHWKTNEKSAIDQARQWTQLYA  148



>ref|XP_010735993.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Larimichthys crocea]
Length=154

 Score =   253 bits (647),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDEGNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYAS  340
            + ++A+ WK +E EA+E AK WTRLYA 
Sbjct  122  ANDVAEKWKASEAEAIEIAKTWTRLYAG  149



>ref|XP_001897862.1| ubiquitin conjugating enzyme protein 13 [Brugia malayi]
 gb|EJW88618.1| ubiquitin carrier protein [Wuchereria bancrofti]
 emb|CDP94084.1| Protein Bm6825, isoform c [Brugia malayi]
Length=152

 Score =   253 bits (646),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            S LPRRI KETQRL+++P PGISA P E N RYF+V+I GP  SP+ GGVFKLELFLPEE
Sbjct  3    SALPRRITKETQRLMNDPVPGISAVPDESNARYFHVIIAGPEGSPFAGGVFKLELFLPEE  62

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  63   YPMAAPKVRFMTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  122

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYASG  337
            + ++A+ WK NE +A+ TA+EWTR YA+G
Sbjct  123  ATDVAEQWKNNESDAIRTAQEWTRTYATG  151



>ref|XP_010746165.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like isoform X2 
[Larimichthys crocea]
Length=153

 Score =   253 bits (646),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRI+KETQRL++EP PGI+A+P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIVKETQRLMAEPVPGITATPDEGNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYAS  340
            + ++A+ WK +E  A+ETA+ WTRLYA 
Sbjct  122  ANDVAEQWKKSESSAIETARAWTRLYAG  149



>emb|CCF50472.1| probable ubiquitin-conjugating enzyme E2 [Ustilago hordei]
Length=148

 Score =   253 bits (645),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -3

Query  780  NLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEY  601
            +LP+RIIKET+RL+++PAPGISA+P EDN+RYF+V+I GPTQSP+EGGVF+LELFLPEEY
Sbjct  2    SLPKRIIKETERLIADPAPGISATPHEDNLRYFDVVISGPTQSPFEGGVFRLELFLPEEY  61

Query  600  PMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLS  421
            PM+APKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLS+QALLSAPNPDDPL+
Sbjct  62   PMSAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSVQALLSAPNPDDPLA  121

Query  420  ENIAKHWKTNEVEAVETAKEWTRLYA  343
             ++A+H+K +E  A+E  ++WT LYA
Sbjct  122  NDVAEHYKKDEKGAIEVGRQWTALYA  147



>ref|XP_010746164.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like isoform X1 
[Larimichthys crocea]
Length=157

 Score =   253 bits (646),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRI+KETQRL++EP PGI+A+P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIVKETQRLMAEPVPGITATPDEGNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WK +E  A+ETA+ WTRLYA
Sbjct  122  ANDVAEQWKKSESSAIETARAWTRLYA  148



>ref|XP_004703811.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Echinops telfairi]
Length=152

 Score =   253 bits (646),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQ LL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQHLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQI T+LLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIHTILLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  122  ANDVAEQWKTNEAQAIETARAWTRLYA  148



>ref|XP_004053723.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Gorilla gorilla 
gorilla]
Length=150

 Score =   253 bits (645),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -3

Query  777  LPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYP  598
            LPR ++KETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEEYP
Sbjct  2    LPRLVVKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYP  61

Query  597  MAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSE  418
            MAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL+ 
Sbjct  62   MAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLAN  121

Query  417  NIAKHWKTNEVEAVETAKEWTRLYA  343
            ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  122  DVAEQWKTNEAQAIETARAWTRLYA  146



>ref|XP_009437632.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin-conjugating enzyme 
E2 N-like [Pan troglodytes]
Length=152

 Score =   253 bits (646),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I G   +P+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIGGXRDAPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  122  ANDVAEQWKTNEAQAIETARAWTRLYA  148



>ref|NP_001154123.1| ubiquitin-conjugating enzyme E2N [Oncorhynchus mykiss]
 gb|ACO07945.1| Ubiquitin-conjugating enzyme E2 N [Oncorhynchus mykiss]
Length=154

 Score =   253 bits (645),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDEANARYFHVVISGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            + ++A+ WK+NE +A+ETA+ WTRL A  +
Sbjct  122  ANDVAEQWKSNEAQAIETARTWTRLCAGNS  151



>ref|XP_002163965.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like isoform 2 [Hydra 
vulgaris]
Length=154

 Score =   253 bits (645),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            S LPRRI KET RLL+EP  GI+A P E N RYF+V I GP +SP+EGG+FKLELFLPEE
Sbjct  3    SGLPRRITKETNRLLTEPVKGITAVPDEQNARYFHVTIAGPGESPFEGGIFKLELFLPEE  62

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRFLTKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  63   YPMAAPKVRFLTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  122

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYASG  337
            + ++A+ WK NE +A+ETA+ WTRLYAS 
Sbjct  123  ANDVAEKWKVNEEQAIETARAWTRLYASA  151



>ref|XP_002400703.1| ubiquitin protein ligase, putative [Ixodes scapularis]
 gb|EEC07129.1| ubiquitin protein ligase, putative [Ixodes scapularis]
Length=151

 Score =   252 bits (644),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  777  LPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYP  598
            LPRRIIKETQRL++EP PGISA P E N RYF+V++ GP  SP+EGGVFKLELFLPEEYP
Sbjct  4    LPRRIIKETQRLMAEPVPGISAIPDESNARYFHVVVAGPEGSPFEGGVFKLELFLPEEYP  63

Query  597  MAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSE  418
            M+APKVRF+TKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPN DD L+ 
Sbjct  64   MSAPKVRFMTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNSDDLLAN  123

Query  417  NIAKHWKTNEVEAVETAKEWTRLYASGA  334
            ++A+ WK NE EA+ TA+EWTRLYA  A
Sbjct  124  DVAEQWKVNEAEAIRTAREWTRLYAQNA  151



>emb|CCA23248.1| ubiquitinconjugating enzyme E2 putative [Albugo laibachii Nc14]
Length=152

 Score =   252 bits (644),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  798  ISMANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLEL  619
            +S   SNLPRRI+KETQRLL+EP PGISA+P EDN+RYF V+I GP  SPYE G+FKLEL
Sbjct  1    MSAGASNLPRRIVKETQRLLAEPVPGISATPYEDNLRYFQVVIAGPQTSPYENGIFKLEL  60

Query  618  FLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPN  439
            FLP +YPM+ PKVRFLT+IYHPNIDKLGRICLDILKDKWSPALQIRTVLLS+QALLSAPN
Sbjct  61   FLPADYPMSPPKVRFLTRIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSVQALLSAPN  120

Query  438  PDDPLSENIAKHWKTNEVEAVETAKEWTRLYA  343
            PDDPL+ ++A+HWK++E  AV TA +WTR +A
Sbjct  121  PDDPLANDVAEHWKSDEAGAVRTAADWTRRFA  152



>ref|XP_003139291.1| ubiquitin conjugating enzyme protein 13 [Loa loa]
 gb|EFO24778.1| ubiquitin-conjugating enzyme E2 N [Loa loa]
Length=152

 Score =   252 bits (644),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 135/152 (89%), Gaps = 1/152 (1%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MAN+ LPRRI KETQRL+++P PGISA P + N RYF+V+I GP  SP+ GGVFKLELFL
Sbjct  1    MANA-LPRRITKETQRLMNDPVPGISAVPDDSNARYFHVIIAGPEGSPFAGGVFKLELFL  59

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRF+TKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct  60   PEEYPMAAPKVRFMTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  119

Query  432  DPLSENIAKHWKTNEVEAVETAKEWTRLYASG  337
            DPL+ ++A+ WK NE +A+ TA+EWTR YA+G
Sbjct  120  DPLATDVAEQWKNNESDAIRTAEEWTRTYATG  151



>ref|XP_009011004.1| hypothetical protein HELRODRAFT_185270 [Helobdella robusta]
 gb|ESO10735.1| hypothetical protein HELRODRAFT_185270 [Helobdella robusta]
Length=152

 Score =   252 bits (644),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = -3

Query  789  ANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLP  610
            A   LPRRI+KETQRL +EP PGI A+P E+N RYF+V+++GP  SPYEGGVFKLELFLP
Sbjct  3    APGGLPRRILKETQRLKAEPVPGIEATPDENNARYFHVIVVGPKDSPYEGGVFKLELFLP  62

Query  609  EEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD  430
            EEYPM+APKVRF+T+IYHPNIDKLGRICLDILK+KWSPALQIRTVLLSIQALLSAPNPDD
Sbjct  63   EEYPMSAPKVRFMTRIYHPNIDKLGRICLDILKEKWSPALQIRTVLLSIQALLSAPNPDD  122

Query  429  PLSENIAKHWKTNEVEAVETAKEWTRLYA  343
            PL+ ++A+ WK NE +A+ETA++WTR YA
Sbjct  123  PLANDVAEQWKVNEAQAIETARQWTRRYA  151



>ref|XP_007876953.1| hypothetical protein PFL1_01259 [Pseudozyma flocculosa PF-1]
 gb|EPQ31070.1| hypothetical protein PFL1_01259 [Pseudozyma flocculosa PF-1]
Length=148

 Score =   252 bits (644),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -3

Query  780  NLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEY  601
            +LP+RIIKET+RL+++PAPGISA+P EDN+RYF+V+I GP+QSP+EGGVF+LELFLPEEY
Sbjct  2    SLPKRIIKETERLIADPAPGISATPHEDNLRYFDVVISGPSQSPFEGGVFRLELFLPEEY  61

Query  600  PMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLS  421
            PM+APKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL+
Sbjct  62   PMSAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLA  121

Query  420  ENIAKHWKTNEVEAVETAKEWTRLYA  343
             ++A+H+KT+E  A+E +++WT  YA
Sbjct  122  NDVAEHYKTDEKGAIEVSRQWTAQYA  147



>emb|CCI44256.1| unnamed protein product [Albugo candida]
Length=152

 Score =   252 bits (643),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  798  ISMANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLEL  619
            +S   SNLPRRI+KETQRLL+EP PGISA+P EDN+RYF V+I GP  SPYE G+FKLEL
Sbjct  1    MSTGASNLPRRIVKETQRLLAEPVPGISATPYEDNLRYFQVVIAGPQTSPYENGIFKLEL  60

Query  618  FLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPN  439
            FLP +YPM+ PKVRFLT++YHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPN
Sbjct  61   FLPADYPMSPPKVRFLTRLYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPN  120

Query  438  PDDPLSENIAKHWKTNEVEAVETAKEWTRLYA  343
            PDDPL+ ++A+HWK++E  AV TA +WTR +A
Sbjct  121  PDDPLANDVAEHWKSDEAGAVRTAADWTRRFA  152



>gb|ACO14311.1| Ubiquitin-conjugating enzyme E2 N [Esox lucius]
Length=154

 Score =   252 bits (643),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDEANARYFHVVISGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKW PALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWPPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYAS  340
            + ++A+ WK+NE +A+ETA+ WTRLYA 
Sbjct  122  ANDVAEQWKSNEAQAIETARIWTRLYAG  149



>gb|EIE79235.1| ubiquitin-conjugating enzyme E2 N [Rhizopus delemar RA 99-880]
Length=149

 Score =   252 bits (643),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  777  LPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYP  598
            LP+RIIKET+RLL++PAPGISA+P E+N+RYF+V+I GP+QSP+EGGVF LELFLPE+YP
Sbjct  3    LPKRIIKETERLLADPAPGISATPHEENLRYFDVIIAGPSQSPFEGGVFHLELFLPEDYP  62

Query  597  MAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSE  418
            M  PKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL+ 
Sbjct  63   MGPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLAN  122

Query  417  NIAKHWKTNEVEAVETAKEWTRLYA  343
            ++A HWK NE +A+E A++WT +YA
Sbjct  123  DVASHWKENERDAIEQARQWTAMYA  147



>ref|XP_003899705.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Papio anubis]
Length=152

 Score =   252 bits (643),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQ LL+EP PGI A P E N  YF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQCLLAEPVPGIKAEPDESNAHYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TK+YHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKVYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  122  ANDVAEQWKTNEAQAIETARAWTRLYA  148



>gb|AAN16046.1| ubiquitin-conjugating enzyme E2 [Pavlova lutheri]
Length=153

 Score =   252 bits (643),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
              LPRRI KETQRLLSEP  GISASP +DN+RYFNV++ GP  SP+EGG+F+LELFLPEE
Sbjct  2    GELPRRIQKETQRLLSEPVAGISASPYQDNLRYFNVVLAGPATSPFEGGIFRLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMA PKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQ+RTVLLSIQALLSAPNP+DPL
Sbjct  62   YPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQVRTVLLSIQALLSAPNPEDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYASGA  334
               +A HWK+NE  A+E AK WT+ YA+G+
Sbjct  122  DAGVADHWKSNEAAAIEEAKRWTQQYATGS  151



>ref|XP_005446379.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Falco cherrug]
Length=185

 Score =   253 bits (646),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 141/167 (84%), Gaps = 4/167 (2%)
 Frame = -3

Query  843  KVSGVNSPTERTFQLISMANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILG  664
            ++  ++S T+R+      ++  LP ++++ETQRLL+EP PGI A P E N RYF+V+I G
Sbjct  19   RIGKLSSQTKRSLS----SSYILPHKLVRETQRLLAEPVPGIKAEPDESNARYFHVVIAG  74

Query  663  PTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQI  484
            P  SP+EGG FKLELFLPEEYPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQI
Sbjct  75   PQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQI  134

Query  483  RTVLLSIQALLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYA  343
            RTVLLSIQALLSAPNPDDPL+ ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  135  RTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYA  181



>ref|XP_002601727.1| hypothetical protein BRAFLDRAFT_215251 [Branchiostoma floridae]
 gb|EEN57739.1| hypothetical protein BRAFLDRAFT_215251 [Branchiostoma floridae]
Length=151

 Score =   251 bits (642),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            ++LPRRIIKETQRL  EP PGISA P E N RYF+V ++GP++SP+EGG FKLELFLPE+
Sbjct  2    ASLPRRIIKETQRLTHEPVPGISAIPDEQNARYFHVDVMGPSESPFEGGTFKLELFLPED  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMA PKVRF+TKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAPPKVRFMTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WK NE  A+ETAK WTRLYA
Sbjct  122  ANDVAEQWKVNESHAIETAKAWTRLYA  148



>dbj|GAC95856.1| hypothetical protein PHSY_003433 [Pseudozyma hubeiensis SY62]
Length=148

 Score =   251 bits (642),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -3

Query  780  NLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEY  601
            +LP+RIIKET+RL+++PAPGISA+P EDN+RYF+V+I GP QSP+EGGVF+LELFLPEEY
Sbjct  2    SLPKRIIKETERLIADPAPGISATPHEDNLRYFDVVISGPAQSPFEGGVFRLELFLPEEY  61

Query  600  PMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLS  421
            PM+APKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLS+QALLSAPNPDDPL+
Sbjct  62   PMSAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSVQALLSAPNPDDPLA  121

Query  420  ENIAKHWKTNEVEAVETAKEWTRLYA  343
             ++A+H+K +E  A+E +++WT LYA
Sbjct  122  NDVAEHYKKDEKGAIEVSRQWTALYA  147



>ref|XP_007885138.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Callorhinchus milii]
Length=152

 Score =   251 bits (642),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRI+KETQRLL+EP PGI A P + N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRILKETQRLLAEPVPGIRAEPDDGNARYFHVVIAGPQDSPFEGGNFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFVTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYAS  340
            + ++A+ WK +E +A+ETA+ WTRLYAS
Sbjct  122  ANDVAEQWKVSEAQAIETARAWTRLYAS  149



>ref|XP_004404828.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Odobenus rosmarus 
divergens]
Length=152

 Score =   251 bits (642),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+E G FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFERGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLL IQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLLIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  122  ANDVAEQWKTNEAQAIETARAWTRLYA  148



>ref|XP_006442524.1| hypothetical protein CICLE_v10022662mg [Citrus clementina]
 gb|ESR55764.1| hypothetical protein CICLE_v10022662mg [Citrus clementina]
Length=120

 Score =   250 bits (639),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/120 (99%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -3

Query  693  MRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDIL  514
            MRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDIL
Sbjct  1    MRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDIL  60

Query  513  KDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            KDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNE EAVETAKEWTRLYASGA
Sbjct  61   KDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYASGA  120



>ref|XP_002998695.1| ubiquitin-conjugating enzyme E2, putative [Phytophthora infestans 
T30-4]
 gb|AAN31476.1| ubiquitin-conjugating enzyme [Phytophthora infestans]
 gb|EEY70048.1| ubiquitin-conjugating enzyme E2, putative [Phytophthora infestans 
T30-4]
Length=149

 Score =   251 bits (642),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            S LPRRI+KETQRLL+EP  GISA+P EDN+RYF V+I GP  SPYE G+FKLELFLP +
Sbjct  3    SALPRRIVKETQRLLAEPVAGISATPYEDNLRYFQVVIAGPQTSPYENGIFKLELFLPAD  62

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMA PKVRFLT+IYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  63   YPMAPPKVRFLTRIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  122

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A HWKT+EV AV+ A EWTR YA
Sbjct  123  ANDVADHWKTDEVGAVQMAAEWTRRYA  149



>ref|XP_002128362.1| PREDICTED: ubiquitin-conjugating enzyme E2 35-like isoform X2 
[Ciona intestinalis]
Length=158

 Score =   251 bits (642),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -3

Query  780  NLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEY  601
            NLPRRI+KETQRLLSEP PGI+A+P EDN+RYF V++ GP  SP+EGG FKLELFLPEEY
Sbjct  10   NLPRRIVKETQRLLSEPVPGITAAPVEDNLRYFKVLMKGPKDSPFEGGNFKLELFLPEEY  69

Query  600  PMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLS  421
            PMAAPKVRF+TKIYHPN+DK+GRICLDILKDKWSPALQ+RTVLLSIQALLSAPNPDDPL+
Sbjct  70   PMAAPKVRFITKIYHPNVDKIGRICLDILKDKWSPALQMRTVLLSIQALLSAPNPDDPLN  129

Query  420  ENIAKHWKTNEVEAVETAKEWTRLYA  343
              +A  WK NE EA+  AKEWTR++A
Sbjct  130  NEVANLWKENEAEAISRAKEWTRIHA  155



>ref|XP_001950288.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Acyrthosiphon pisum]
 ref|XP_003247074.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Acyrthosiphon pisum]
Length=151

 Score =   251 bits (642),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            S LPRRI+KETQRL+ EP PGISA P E N RYF+V + GP  SP+EGG+FKLELFLPE+
Sbjct  2    SVLPRRILKETQRLMQEPVPGISAKPDEGNARYFHVKVTGPEDSPFEGGLFKLELFLPED  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPM+APKVRF+TKIYHPNID+LGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMSAPKVRFITKIYHPNIDRLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYAS  340
            + ++A+ WK NE+EA+  AKEWTR+YAS
Sbjct  122  ANDVAELWKVNEIEAIRNAKEWTRMYAS  149



>dbj|GAM24195.1| hypothetical protein SAMD00019534_073700 [Acytostelium subglobosum 
LB1]
Length=149

 Score =   251 bits (641),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
             +L RRIIKE+QRL++EPAPGISA+P  DN+RYFNV+I GP  SP++GGVF LELFL ++
Sbjct  2    DSLTRRIIKESQRLVTEPAPGISATPHTDNLRYFNVIISGPEGSPFQGGVFHLELFLTDD  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPM+APKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMSAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+HWK+NE +A+E A+EWTR+YA
Sbjct  122  ANDVAEHWKSNEKDAIERAREWTRIYA  148



>gb|EPB87495.1| ubiquitin-conjugating enzyme E2 N [Mucor circinelloides f. circinelloides 
1006PhL]
Length=149

 Score =   251 bits (641),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -3

Query  780  NLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEY  601
            +LP+RIIKET+RLL++PAPGISA+P +DN+RYF+V+I GPTQSP+EGG+F LELFLPE+Y
Sbjct  2    SLPKRIIKETERLLADPAPGISATPHDDNLRYFDVIIAGPTQSPFEGGIFHLELFLPEDY  61

Query  600  PMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLS  421
            PM  PKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL+
Sbjct  62   PMGPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLA  121

Query  420  ENIAKHWKTNEVEAVETAKEWTRLYA  343
             ++A HWK +E  A+E A++WT +YA
Sbjct  122  NDVASHWKEDEKGAIEQARQWTTMYA  147



>ref|XP_007534789.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Erinaceus 
europaeus]
Length=152

 Score =   251 bits (641),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  S +EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSLFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD+PL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDNPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE +A+ETA  WTRLYA
Sbjct  122  ANDVAEQWKTNEAQAIETATAWTRLYA  148



>ref|XP_004355325.1| putative ubiquitin-conjugating enzyme E2 [Dictyostelium fasciculatum]
 gb|EGG16851.1| putative ubiquitin-conjugating enzyme E2 [Dictyostelium fasciculatum]
Length=150

 Score =   251 bits (641),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -3

Query  777  LPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYP  598
            L +RI+KETQRL+SEP PGISASP  DN+RYFNV I GP +SP+EGGVF LELFL ++YP
Sbjct  3    LSKRIVKETQRLMSEPVPGISASPLNDNLRYFNVAISGPVESPFEGGVFHLELFLTDDYP  62

Query  597  MAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSE  418
            MAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL+ 
Sbjct  63   MAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLAN  122

Query  417  NIAKHWKTNEVEAVETAKEWTRLYAS  340
            ++A+HWK+NE +A+ TA++WT+ YA+
Sbjct  123  DVAEHWKSNEKDAIATARDWTKRYAN  148



>gb|EYC34552.1| hypothetical protein Y032_0001g467 [Ancylostoma ceylanicum]
Length=286

 Score =   256 bits (653),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 133/146 (91%), Gaps = 1/146 (1%)
 Frame = -3

Query  792  MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL  613
            MA + LPRRIIKETQRL+++P PGISASP ++N RYF+VMI GP  SP+ GGVFKLELFL
Sbjct  1    MAGA-LPRRIIKETQRLMADPVPGISASPDDNNARYFHVMIAGPQDSPFAGGVFKLELFL  59

Query  612  PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD  433
            PEEYPMAAPKVRF+TKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP+
Sbjct  60   PEEYPMAAPKVRFMTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPE  119

Query  432  DPLSENIAKHWKTNEVEAVETAKEWT  355
            DPL+ ++A+ WKTNE EA+ TAKEWT
Sbjct  120  DPLATDVAEQWKTNETEAIRTAKEWT  145



>ref|XP_005068072.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Mesocricetus auratus]
Length=152

 Score =   251 bits (641),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N  YF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDESNTHYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            Y MAAPKV F+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YQMAAPKVHFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  122  ANDVAEQWKTNEAQAIETARAWTRLYA  148



>ref|XP_008501818.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Calypte anna]
Length=166

 Score =   251 bits (642),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  801  LISMANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLE  622
            ++++A +   R ++KETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLE
Sbjct  10   ILTIAENVAARGVVKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLE  69

Query  621  LFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAP  442
            LFLPEEYPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAP
Sbjct  70   LFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAP  129

Query  441  NPDDPLSENIAKHWKTNEVEAVETAKEWTRLYA  343
            NPDDPL+ ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  130  NPDDPLANDVAEQWKTNEAQAIETARAWTRLYA  162



>ref|XP_008606915.1| ubiquitin-conjugating enzyme E2 35 [Saprolegnia diclina VS20]
 gb|EQC39643.1| ubiquitin-conjugating enzyme E2 35 [Saprolegnia diclina VS20]
Length=151

 Score =   251 bits (640),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 134/151 (89%), Gaps = 1/151 (1%)
 Frame = -3

Query  792  MANS-NLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELF  616
            M+N+ NLPRRI+KETQRLL+EP PGISA+P EDN+RYF V+I GP  SPYE G+FKLELF
Sbjct  1    MSNAANLPRRIVKETQRLLAEPVPGISATPYEDNLRYFQVVIAGPQSSPYENGIFKLELF  60

Query  615  LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP  436
            LP +YPMA PKVRFLT+IYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP
Sbjct  61   LPADYPMAPPKVRFLTRIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP  120

Query  435  DDPLSENIAKHWKTNEVEAVETAKEWTRLYA  343
            DDPL+ ++A HWKT+E  A+ TA EWTR +A
Sbjct  121  DDPLANDVADHWKTDEPGALRTAMEWTRRFA  151



>gb|EFA75916.1| putative ubiquitin-conjugating enzyme E2 [Polysphondylium pallidum 
PN500]
Length=157

 Score =   251 bits (641),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 140/156 (90%), Gaps = 8/156 (5%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEG--------GVFK  628
            ++LP+RIIKET+RL+ EPAPGISA+P+E+N+RYFNV+I GP  SP++G        GVF 
Sbjct  2    NSLPKRIIKETERLVKEPAPGISATPNEENLRYFNVVITGPVDSPFQGNVSHHKSGGVFN  61

Query  627  LELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLS  448
            LELFL ++YPM+APKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLS
Sbjct  62   LELFLTDDYPMSAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLS  121

Query  447  APNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYAS  340
            APNPDDPL+ ++A+HWK+NE +A++TAKEWTRLYA+
Sbjct  122  APNPDDPLANDVAEHWKSNEKDAIQTAKEWTRLYAA  157



>ref|XP_007907199.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Callorhinchus milii]
Length=149

 Score =   251 bits (640),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LP+RI KET RL+ EP PGI A P E+N RYF+V+I GP  SP+EGG+FKLELFLPEE
Sbjct  2    AGLPKRISKETVRLMQEPVPGIQARPDENNARYFHVVIAGPQDSPFEGGIFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYAS  340
            + ++A+ WK+NE +A+ETAK+WTRL+A+
Sbjct  122  ANDVAEQWKSNEAKAIETAKQWTRLHAT  149



>ref|XP_003475937.2| PREDICTED: ubiquitin-conjugating enzyme E2 N [Cavia porcellus]
Length=283

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -3

Query  780  NLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEY  601
              PRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEEY
Sbjct  134  GCPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEY  193

Query  600  PMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLS  421
            PMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL+
Sbjct  194  PMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLA  253

Query  420  ENIAKHWKTNEVEAVETAKEWTRLYA  343
             ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  254  NDVAEQWKTNEAQAIETARAWTRLYA  279



>ref|XP_003370281.1| putative ubiquitin--protein ligase [Trichinella spiralis]
 gb|EFV50270.1| putative ubiquitin--protein ligase [Trichinella spiralis]
Length=179

 Score =   251 bits (642),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  798  ISMANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLEL  619
            +S   + LPRRIIKETQRL+ EP PGISA P E N RYF+V++ GP  SP+EGG+FKLEL
Sbjct  24   MSGFGTELPRRIIKETQRLMQEPVPGISAVPDEHNARYFHVVVAGPQSSPFEGGMFKLEL  83

Query  618  FLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPN  439
            FLPEEYPMAAPKVRF+TKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLS+PN
Sbjct  84   FLPEEYPMAAPKVRFMTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSSPN  143

Query  438  PDDPLSENIAKHWKTNEVEAVETAKEWTRLYA  343
            PDDPL+ ++A+ WK+NE EA+  A+EWTR YA
Sbjct  144  PDDPLATDVAELWKSNESEAIRIAREWTRTYA  175



>emb|CBQ68322.1| probable ubiquitin-conjugating enzyme E2 [Sporisorium reilianum 
SRZ2]
Length=148

 Score =   250 bits (639),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -3

Query  780  NLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEY  601
            +LP+RIIKET+RL+++PAPGISA+P EDN+RYF+V+I GP QSP+EGGVF+LELFLPEEY
Sbjct  2    SLPKRIIKETERLIADPAPGISATPHEDNLRYFDVVISGPAQSPFEGGVFRLELFLPEEY  61

Query  600  PMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLS  421
            PM+APKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLS+QALLSAPNPDDPL+
Sbjct  62   PMSAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSVQALLSAPNPDDPLA  121

Query  420  ENIAKHWKTNEVEAVETAKEWTRLYA  343
             ++A+H+K +E  A++ +++WT LYA
Sbjct  122  NDVAEHYKKDEKGAIQVSRQWTALYA  147



>ref|XP_009000800.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Callithrix 
jacchus]
Length=152

 Score =   250 bits (639),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LP RIIKETQ LL+EP  GI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPCRIIKETQHLLAEPVTGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRFLTKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFLTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  122  ANDVAEQWKTNEAQAIETARAWTRLYA  148



>ref|NP_849678.1| ubiquitin-conjugating enzyme E2 36 [Arabidopsis thaliana]
 gb|AEE29515.1| ubiquitin-conjugating enzyme E2 36 [Arabidopsis thaliana]
Length=120

 Score =   249 bits (636),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/120 (98%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -3

Query  693  MRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDIL  514
            MRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDIL
Sbjct  1    MRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDIL  60

Query  513  KDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            KDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWK+NE EAVETAKEWTRLYASGA
Sbjct  61   KDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYASGA  120



>ref|NP_001134669.1| ubiquitin-conjugating enzyme E2N [Salmo salar]
 gb|ACI68429.1| Ubiquitin-conjugating enzyme E2 N [Salmo salar]
Length=154

 Score =   250 bits (639),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRL++EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLMAEPVPGIKAEPDEGNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YP AAPKVRF+TKI HPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPTAAPKVRFMTKICHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYAS  340
            + ++A+ WK+NE +A+ETA+ WTRLYA 
Sbjct  122  ANDVAEQWKSNEAQAIETARTWTRLYAQ  149



>gb|ERG85476.1| ubiquitin-conjugating enzyme e2 n [Ascaris suum]
 gb|KHN77979.1| Ubiquitin-conjugating enzyme E2 N [Toxocara canis]
Length=152

 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  777  LPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYP  598
            LPRRI KETQRL+++P PGISA P ++N RYF+V+I GP  SP+ GGVFKLELFLPEEYP
Sbjct  5    LPRRITKETQRLMADPVPGISAIPDDNNARYFHVIIAGPEGSPFAGGVFKLELFLPEEYP  64

Query  597  MAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSE  418
            MAAPKVRF+TKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL+ 
Sbjct  65   MAAPKVRFMTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLAT  124

Query  417  NIAKHWKTNEVEAVETAKEWTRLYASG  337
            ++A+ WK NE +A+ TA+EWTR++A+G
Sbjct  125  DVAEQWKNNESDAIRTAQEWTRVHANG  151



>ref|XP_009867395.1| PREDICTED: ubiquitin-conjugating enzyme E2 N, partial [Apaloderma 
vittatum]
Length=148

 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  774  PRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPM  595
            P++I++ETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEEYPM
Sbjct  1    PKKILEETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPM  60

Query  594  AAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSEN  415
            AAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL+ +
Sbjct  61   AAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLAND  120

Query  414  IAKHWKTNEVEAVETAKEWTRLYA  343
            +A+ WKTNE +A+ETA+ WTRLYA
Sbjct  121  VAEQWKTNEAQAIETARAWTRLYA  144



>ref|XP_008871705.1| ubiquitin-conjugating enzyme E2 N [Aphanomyces invadans]
 gb|ETV99929.1| ubiquitin-conjugating enzyme E2 N [Aphanomyces invadans]
Length=151

 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 133/151 (88%), Gaps = 1/151 (1%)
 Frame = -3

Query  792  MAN-SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELF  616
            M+N S LPRRI+KETQRLL+EP PGISA+P EDN+RYF V+I GP  SPYE G+FKLELF
Sbjct  1    MSNPSQLPRRIVKETQRLLAEPVPGISATPYEDNLRYFQVVIAGPQSSPYEHGIFKLELF  60

Query  615  LPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP  436
            LP +YPMA PKVRFLT+IYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP
Sbjct  61   LPADYPMAPPKVRFLTRIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP  120

Query  435  DDPLSENIAKHWKTNEVEAVETAKEWTRLYA  343
            DDPL+ ++A HWKT+E  A+ TA EWTR +A
Sbjct  121  DDPLANDVADHWKTDEPAALRTATEWTRRFA  151



>ref|XP_004647640.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Octodon degus]
Length=152

 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQR L+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRFLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++ + W+TNE +A+ETA+ WT LYA
Sbjct  122  ANDVVEQWETNEAQAIETARAWTGLYA  148



>ref|XP_008908532.1| ubiquitin-conjugating enzyme E2 N [Phytophthora parasitica INRA-310]
 ref|XP_009535024.1| hypothetical protein PHYSODRAFT_355843 [Phytophthora sojae]
 gb|EGZ10163.1| hypothetical protein PHYSODRAFT_355843 [Phytophthora sojae]
 gb|ETI42696.1| ubiquitin-conjugating enzyme E2 N [Phytophthora parasitica P1569]
 gb|ETK82723.1| ubiquitin-conjugating enzyme E2 N [Phytophthora parasitica]
 gb|ETL36101.1| ubiquitin-conjugating enzyme E2 N [Phytophthora parasitica]
 gb|ETL89338.1| ubiquitin-conjugating enzyme E2 N [Phytophthora parasitica]
 gb|ETM42606.1| ubiquitin-conjugating enzyme E2 N [Phytophthora parasitica]
 gb|ETN06030.1| ubiquitin-conjugating enzyme E2 N [Phytophthora parasitica INRA-310]
 gb|ETO71321.1| ubiquitin-conjugating enzyme E2 N [Phytophthora parasitica P1976]
 gb|ETP12434.1| ubiquitin-conjugating enzyme E2 N [Phytophthora parasitica CJ01A1]
 gb|ETP40553.1| ubiquitin-conjugating enzyme E2 N [Phytophthora parasitica P10297]
Length=149

 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            S LPRRI+KETQRLL+EP  GISA+P EDN+RYF V+I GP  SPYE G+FKLELFLP +
Sbjct  3    SALPRRIVKETQRLLAEPVAGISATPYEDNLRYFQVVIAGPQSSPYENGIFKLELFLPAD  62

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMA PKVRFLT+IYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  63   YPMAPPKVRFLTRIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  122

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A HWKT+E  AV+ A EWTR YA
Sbjct  123  ANDVADHWKTDEAGAVQMAAEWTRRYA  149



>gb|KEP54506.1| putative ubiquitin-conjugating enzyme E2 [Rhizoctonia solani 
123E]
Length=148

 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  780  NLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEY  601
            +LP+RIIKET+RL ++PAPGISASP EDN+RYF+V I GP  SP+EGGVFKLELFLPEEY
Sbjct  2    SLPKRIIKETERLAADPAPGISASPHEDNLRYFDVTIAGPGGSPFEGGVFKLELFLPEEY  61

Query  600  PMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLS  421
            PM  PKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL+
Sbjct  62   PMNPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLA  121

Query  420  ENIAKHWKTNEVEAVETAKEWTRLYAS  340
             ++AKH+K NE +A+  +KEWT  YA+
Sbjct  122  TDVAKHYKENETDAIRVSKEWTEKYAA  148



>emb|CEJ04847.1| Putative Ubiquitin-conjugating enzyme E2 N [Rhizopus microsporus]
Length=149

 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  777  LPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYP  598
            LP+RI+KET+RLL++PAPGISA+P E+N+RYF+V+I GP+QSP+EGGVF+LELFLPE+YP
Sbjct  3    LPKRIVKETERLLADPAPGISATPHEENLRYFDVVIAGPSQSPFEGGVFRLELFLPEDYP  62

Query  597  MAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSE  418
            M  PKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL+ 
Sbjct  63   MGPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLAN  122

Query  417  NIAKHWKTNEVEAVETAKEWTRLYA  343
            ++A HWK +E  A+E A++WT +YA
Sbjct  123  DVASHWKEDEKGAIEQARQWTAMYA  147



>ref|XP_009002292.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Callithrix 
jacchus]
Length=152

 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKV F+TKIY PN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVCFMTKIYQPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++ + WKTNE +A+ETA+ WTRLYA
Sbjct  122  ANDVVEQWKTNEAQAIETARAWTRLYA  148



>dbj|GAM27414.1| hypothetical protein SAMD00019534_105900 [Acytostelium subglobosum 
LB1]
Length=150

 Score =   249 bits (637),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  777  LPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYP  598
            L +RIIKETQ+L+SEPAPGISA+P+ DN+RYFNV+I GP  SP++GG+F LELFL ++YP
Sbjct  4    LSKRIIKETQKLMSEPAPGISATPNSDNLRYFNVVITGPADSPFQGGIFHLELFLTDDYP  63

Query  597  MAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSE  418
            M+APKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL+ 
Sbjct  64   MSAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLAN  123

Query  417  NIAKHWKTNEVEAVETAKEWTRLYA  343
            ++A HWK+NE +A++ A+EWT +YA
Sbjct  124  DVADHWKSNEKDAIQKAREWTNVYA  148



>gb|EHJ76453.1| ubiquitin conjugating enzyme E2 [Danaus plexippus]
Length=151

 Score =   249 bits (637),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -3

Query  777  LPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYP  598
            LPRRIIKETQRL+ EP PGISA PSE+N RYF+V++ GP  SP+EGG+FKLELFLPE+YP
Sbjct  4    LPRRIIKETQRLMQEPVPGISAVPSENNARYFHVIVTGPEDSPFEGGLFKLELFLPEDYP  63

Query  597  MAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSE  418
            M+APKVRF+TKIYHPNID+LGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL+ 
Sbjct  64   MSAPKVRFITKIYHPNIDRLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLAN  123

Query  417  NIAKHWKTNEVEAVETAKEWTRLYA  343
            ++A+ WK NE EA+  AKEWTR YA
Sbjct  124  DVAELWKVNESEAIRNAKEWTRRYA  148



>ref|XP_011098229.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 isoform X2 [Sesamum 
indicum]
Length=120

 Score =   248 bits (634),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/120 (98%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -3

Query  693  MRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDIL  514
            MRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDIL
Sbjct  1    MRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDIL  60

Query  513  KDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            KDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWK NE EAVETAKEWTRLYASGA
Sbjct  61   KDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKANEAEAVETAKEWTRLYASGA  120



>ref|XP_009904317.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Picoides pubescens]
Length=179

 Score =   250 bits (639),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -3

Query  777  LPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYP  598
            LP  +++ETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEEYP
Sbjct  31   LPHFVVEETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYP  90

Query  597  MAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSE  418
            MAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL+ 
Sbjct  91   MAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLAN  150

Query  417  NIAKHWKTNEVEAVETAKEWTRLYA  343
            ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  151  DVAEQWKTNEAQAIETARAWTRLYA  175



>gb|ACO10418.1| Ubiquitin-conjugating enzyme E2 N [Caligus rogercresseyi]
 gb|ACO11367.1| Ubiquitin-conjugating enzyme E2 N [Caligus rogercresseyi]
 gb|ACO12462.1| Ubiquitin-conjugating enzyme E2 N [Lepeophtheirus salmonis]
 gb|ADD37954.1| Ubiquitin-conjugating enzyme E2 N [Lepeophtheirus salmonis]
Length=151

 Score =   249 bits (636),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRI+KETQRL+ EP PGISA P E N RYF+V++ GP +SP+EGGVFKLELFLPE+
Sbjct  2    AGLPRRIVKETQRLMKEPVPGISAIPDEGNARYFHVVVAGPEESPFEGGVFKLELFLPED  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPM+APKVRF+TKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMSAPKVRFITKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WK NEVEA+  A++WTR YA
Sbjct  122  ANDVAELWKENEVEAIRNARDWTRKYA  148



>gb|KDE02787.1| ubiquitin-conjugating enzyme E2 35 [Microbotryum violaceum p1A1 
Lamole]
Length=155

 Score =   249 bits (636),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  789  ANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLP  610
            AN+ LP+RIIKETQRL+++  PGISA P +DN+RYF+V++ GP  SP+EGGVFKLELFLP
Sbjct  3    ANAALPKRIIKETQRLIADSPPGISAVPHDDNLRYFDVLVSGPEGSPFEGGVFKLELFLP  62

Query  609  EEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD  430
            EEYPMA PKVRFLTK+YHPNIDKLGRICLDILKDKWSPALQIRTVLLS+QALLSAPNPDD
Sbjct  63   EEYPMAPPKVRFLTKLYHPNIDKLGRICLDILKDKWSPALQIRTVLLSVQALLSAPNPDD  122

Query  429  PLSENIAKHWKTNEVEAVETAKEWTRLYASGA  334
            PL+ ++A HWK NE +A+  ++EWT+ YAS +
Sbjct  123  PLANDVAAHWKENEKDAMRVSREWTQKYASAS  154



>emb|CCO30017.1| ubiquitin-conjugating enzyme E2 N [Rhizoctonia solani AG-1 IB]
Length=148

 Score =   249 bits (635),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -3

Query  780  NLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEY  601
            +LP+RIIKET+RL ++PAPGISASP EDN+RYF+V I GP  SP+EGGVFKLELFLPEEY
Sbjct  2    SLPKRIIKETERLAADPAPGISASPHEDNLRYFDVTIAGPGGSPFEGGVFKLELFLPEEY  61

Query  600  PMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLS  421
            PM  PKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL+
Sbjct  62   PMNPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLA  121

Query  420  ENIAKHWKTNEVEAVETAKEWTRLYA  343
             ++AKH+K NE +A+  +KEWT  YA
Sbjct  122  TDVAKHYKDNETDAIRVSKEWTEKYA  147



>ref|XP_005879986.1| PREDICTED: ubiquitin-conjugating enzyme E2 N-like [Myotis brandtii]
Length=154

 Score =   249 bits (636),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 130/149 (87%), Gaps = 2/149 (1%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRIIKETQRLL+EP PGI A P E N RYF V+I GP   P+EGG FKLELFLPEE
Sbjct  2    AGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFYVVIAGPQDFPFEGGTFKLELFLPEE  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPMAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWT--RLYA  343
            + ++A+ WKTNE +A+ETA+ WT  RLYA
Sbjct  122  ANDVAEQWKTNEAQAIETARAWTRARLYA  150



>ref|NP_001040393.1| ubiquitin conjugating enzyme E2 [Bombyx mori]
 gb|ABF51305.1| ubiquitin conjugating enzyme E2 [Bombyx mori]
Length=151

 Score =   249 bits (635),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -3

Query  777  LPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYP  598
            LPRRIIKETQRL+ EP PGISA PSE N RYF+V++ GP  SP+EGG+FKLELFLPE+YP
Sbjct  4    LPRRIIKETQRLMQEPVPGISAVPSETNARYFHVIVTGPEDSPFEGGLFKLELFLPEDYP  63

Query  597  MAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSE  418
            M+APKVRF+TKIYHPNID+LGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL+ 
Sbjct  64   MSAPKVRFITKIYHPNIDRLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLAN  123

Query  417  NIAKHWKTNEVEAVETAKEWTRLYA  343
            ++A+ WK NE EA+  AKEWTR YA
Sbjct  124  DVAELWKVNESEAIRNAKEWTRRYA  148



>ref|XP_008487583.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Diaphorina citri]
Length=151

 Score =   249 bits (635),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            S LPRRIIKETQRL+ EP PGISA P E N RYF+V++ GP  SP+EGG+FKLELFLPE+
Sbjct  2    SALPRRIIKETQRLMQEPVPGISAVPDESNARYFHVIVTGPEDSPFEGGLFKLELFLPED  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPM+APKVRF+TKIYHPNID+LGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct  62   YPMSAPKVRFITKIYHPNIDRLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WK NE EA+  AKEWTR YA
Sbjct  122  ANDVAELWKVNEAEAIRNAKEWTRKYA  148



>ref|XP_001897800.1| Ubiquitin conjugating enzyme protein 13 [Brugia malayi]
 ref|XP_003144292.1| ubiquitin conjugating enzyme protein 13 [Loa loa]
 gb|EFO19777.1| ubiquitin-conjugating enzyme E2 N [Loa loa]
 gb|EJW86458.1| ubiquitin carrier protein [Wuchereria bancrofti]
 emb|CDP92930.1| Protein Bm9167 [Brugia malayi]
Length=152

 Score =   249 bits (635),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  777  LPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYP  598
            LPRRI KETQRL+++P PGISA P ++N RYF+V+I GP  SP+ GGVFKLELFLPEEYP
Sbjct  5    LPRRIAKETQRLIADPVPGISAVPDDNNARYFHVIIAGPEGSPFAGGVFKLELFLPEEYP  64

Query  597  MAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSE  418
            MAAPKVRF+TKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL+ 
Sbjct  65   MAAPKVRFMTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLAT  124

Query  417  NIAKHWKTNEVEAVETAKEWTRLYASG  337
            ++A+ WK+NE +A+  A+EWTR++A+G
Sbjct  125  DVAEQWKSNESDAIRIAQEWTRIHANG  151



>ref|XP_005242751.1| PREDICTED: ubiquitin-conjugating enzyme E2 N [Falco peregrinus]
Length=195

 Score =   250 bits (639),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -3

Query  777  LPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYP  598
            LP ++++ETQRLL+EP PGI A P E N RYF+V+I GP  SP+EGG FKLELFLPEEYP
Sbjct  47   LPHKLVRETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYP  106

Query  597  MAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSE  418
            MAAPKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL+ 
Sbjct  107  MAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLAN  166

Query  417  NIAKHWKTNEVEAVETAKEWTRLYA  343
            ++A+ WKTNE +A+ETA+ WTRLYA
Sbjct  167  DVAEQWKTNEAQAIETARAWTRLYA  191



>gb|ACO12818.1| Ubiquitin-conjugating enzyme E2 N [Lepeophtheirus salmonis]
Length=151

 Score =   249 bits (635),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  783  SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE  604
            + LPRRI+KETQRL+ EP PGISA P E N RYF+V++ GP +SP+EGGVFKLELFLPE+
Sbjct  2    AGLPRRIVKETQRLMKEPVPGISAIPDEGNARYFHVVVAGPEESPFEGGVFKLELFLPED  61

Query  603  YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL  424
            YPM+APKVRF+TKIYHPNIDKLGRICLDILKDKWSPALQIRT+LLSIQALLSAPNPDDPL
Sbjct  62   YPMSAPKVRFITKIYHPNIDKLGRICLDILKDKWSPALQIRTILLSIQALLSAPNPDDPL  121

Query  423  SENIAKHWKTNEVEAVETAKEWTRLYA  343
            + ++A+ WK NEVEA+  A++WTR YA
Sbjct  122  ANDVAELWKENEVEAIRNARDWTRKYA  148



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1985022489692