BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25725_g3_i3 len=997 path=[7940:0-39 20456:40-119 8060:120-122
8063:123-299 20743:300-300 12943:301-540 8742:541-554 8756:555-642
20089:643-658 13297:659-724 13363:725-727 13366:728-765
21128:766-767 9671:768-794 9698:795-892 10644:893-938 10690:939-996]

Length=997
                                                                      Score     E

ref|XP_008221638.1|  PREDICTED: ran guanine nucleotide release fa...    337   2e-112   
ref|XP_007223470.1|  hypothetical protein PRUPE_ppa011657mg             336   4e-112   
gb|KDP41182.1|  hypothetical protein JCGZ_15589                         336   5e-112   
ref|XP_008389480.1|  PREDICTED: probable ran guanine nucleotide r...    330   5e-110   
ref|XP_004228383.1|  PREDICTED: probable ran guanine nucleotide r...    330   9e-110   
gb|KDO82896.1|  hypothetical protein CISIN_1g028780mg                   330   1e-109   
ref|XP_009804047.1|  PREDICTED: ran guanine nucleotide release fa...    329   3e-109   
emb|CDP00320.1|  unnamed protein product                                328   3e-109   
ref|XP_006438670.1|  hypothetical protein CICLE_v10032771mg             328   5e-109   
ref|XP_008361789.1|  PREDICTED: ran guanine nucleotide release fa...    327   1e-108   
ref|XP_011075491.1|  PREDICTED: ran guanine nucleotide release fa...    327   2e-108   
ref|XP_002524187.1|  Nuclear import protein mog1, putative              326   3e-108   Ricinus communis
gb|KHG04175.1|  putative ran guanine nucleotide release factor          325   8e-108   
ref|XP_009603835.1|  PREDICTED: ran guanine nucleotide release fa...    325   1e-107   
ref|XP_006366699.1|  PREDICTED: probable ran guanine nucleotide r...    324   2e-107   
ref|XP_008446339.1|  PREDICTED: probable ran guanine nucleotide r...    324   2e-107   
ref|XP_008339915.1|  PREDICTED: ran guanine nucleotide release fa...    323   5e-107   
ref|XP_004297310.1|  PREDICTED: probable ran guanine nucleotide r...    323   6e-107   
ref|XP_007046145.1|  Mog1/PsbP/DUF1795-like photosystem II reacti...    321   3e-106   
ref|XP_004228382.1|  PREDICTED: probable ran guanine nucleotide r...    320   9e-106   
ref|XP_003518721.1|  PREDICTED: ran guanine nucleotide release fa...    319   1e-105   
ref|NP_001241181.1|  uncharacterized protein LOC100786093               319   2e-105   
ref|XP_004135179.1|  PREDICTED: probable ran guanine nucleotide r...    319   2e-105   
ref|XP_010683207.1|  PREDICTED: probable ran guanine nucleotide r...    318   3e-105   
ref|XP_009360351.1|  PREDICTED: probable ran guanine nucleotide r...    317   7e-105   
gb|KDO82895.1|  hypothetical protein CISIN_1g028780mg                   317   2e-104   
ref|XP_010097929.1|  hypothetical protein L484_009363                   316   2e-104   
ref|XP_009804048.1|  PREDICTED: probable ran guanine nucleotide r...    316   3e-104   
gb|AES96655.2|  Ran guanine nucleotide release factor-like protein      315   6e-104   
ref|XP_010044730.1|  PREDICTED: probable ran guanine nucleotide r...    315   9e-104   
ref|XP_004490033.1|  PREDICTED: ran guanine nucleotide release fa...    314   1e-103   
gb|KEH19537.1|  Ran guanine nucleotide release factor-like protein      313   3e-103   
ref|XP_010652166.1|  PREDICTED: ran guanine nucleotide release fa...    312   1e-102   
ref|XP_006390983.1|  hypothetical protein EUTSA_v10019150mg             310   7e-102   
ref|XP_010258391.1|  PREDICTED: probable ran guanine nucleotide r...    310   9e-102   
ref|XP_007157638.1|  hypothetical protein PHAVU_002G086500g             309   1e-101   
ref|XP_003613697.1|  Ran guanine nucleotide release factor              316   2e-101   
ref|XP_009390729.1|  PREDICTED: probable ran guanine nucleotide r...    307   8e-101   
emb|CDY48395.1|  BnaA07g24140D                                          306   2e-100   
ref|XP_009104988.1|  PREDICTED: probable ran guanine nucleotide r...    306   3e-100   
emb|CDY04293.1|  BnaC06g25220D                                          303   2e-99    
ref|XP_010551533.1|  PREDICTED: ran guanine nucleotide release fa...    303   2e-99    
ref|NP_564972.1|  Mog1/PsbP/DUF1795-like photosystem II reaction ...    303   4e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887249.1|  predicted protein                                  302   7e-99    
emb|CDX95907.1|  BnaA07g28240D                                          302   7e-99    
ref|XP_009105522.1|  PREDICTED: probable ran guanine nucleotide r...    302   7e-99    
emb|CDY66733.1|  BnaC06g43570D                                          300   6e-98    
ref|XP_010512019.1|  PREDICTED: probable ran guanine nucleotide r...    299   2e-97    
ref|XP_010937086.1|  PREDICTED: ran guanine nucleotide release fa...    298   3e-97    
ref|XP_006302839.1|  hypothetical protein CARUB_v10020969mg             297   5e-97    
ref|XP_010470965.1|  PREDICTED: probable ran guanine nucleotide r...    297   1e-96    
ref|XP_006827195.1|  hypothetical protein AMTR_s00010p00257970          296   2e-96    
gb|EYU28737.1|  hypothetical protein MIMGU_mgv1a014034mg                296   2e-96    
ref|XP_004290499.1|  PREDICTED: ran guanine nucleotide release fa...    295   5e-96    
ref|XP_011038454.1|  PREDICTED: probable ran guanine nucleotide r...    295   6e-96    
ref|XP_002319123.1|  hypothetical protein POPTR_0013s04750g             294   9e-96    Populus trichocarpa [western balsam poplar]
ref|XP_010421615.1|  PREDICTED: probable ran guanine nucleotide r...    293   4e-95    
ref|XP_010421613.1|  PREDICTED: probable ran guanine nucleotide r...    293   5e-95    
ref|XP_011036366.1|  PREDICTED: probable ran guanine nucleotide r...    285   3e-92    
ref|XP_008808045.1|  PREDICTED: probable ran guanine nucleotide r...    284   9e-92    
ref|XP_004975846.1|  PREDICTED: probable ran guanine nucleotide r...    283   3e-91    
ref|XP_003579899.1|  PREDICTED: probable ran guanine nucleotide r...    281   1e-90    
ref|NP_001131660.1|  uncharacterized protein LOC100193020               277   4e-89    Zea mays [maize]
ref|XP_003558963.1|  PREDICTED: probable ran guanine nucleotide r...    276   9e-89    
ref|NP_001052985.1|  Os04g0459600                                       276   1e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002447961.1|  hypothetical protein SORBIDRAFT_06g018890          275   3e-88    Sorghum bicolor [broomcorn]
ref|XP_002870395.1|  hypothetical protein ARALYDRAFT_355491             271   5e-87    
gb|ABK22676.1|  unknown                                                 271   1e-86    Picea sitchensis
gb|EEC77400.1|  hypothetical protein OsI_16161                          269   5e-86    Oryza sativa Indica Group [Indian rice]
ref|XP_006652371.1|  PREDICTED: probable ran guanine nucleotide r...    269   7e-86    
gb|KCW86831.1|  hypothetical protein EUGRSUZ_B03429                     268   8e-86    
ref|XP_007046147.1|  Mog1/PsbP/DUF1795-like photosystem II reacti...    268   2e-85    
gb|EMT31123.1|  hypothetical protein F775_00873                         265   4e-84    
gb|EMS54835.1|  hypothetical protein TRIUR3_14854                       264   7e-84    
gb|AAG52542.1|AC013289_9  hypothetical protein; 65754-64334             261   3e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011038452.1|  PREDICTED: probable ran guanine nucleotide r...    261   1e-82    
gb|ACF80176.1|  unknown                                                 260   2e-82    Zea mays [maize]
gb|KCW86833.1|  hypothetical protein EUGRSUZ_B03429                     256   3e-81    
gb|KDO82897.1|  hypothetical protein CISIN_1g028780mg                   250   3e-79    
gb|KEH27812.1|  Ran guanine nucleotide release factor-like protein      250   3e-79    
emb|CBI31975.3|  unnamed protein product                                251   1e-78    
ref|XP_006371112.1|  hypothetical protein POPTR_0019s04050g             246   4e-77    
ref|XP_011002024.1|  PREDICTED: probable ran guanine nucleotide r...    244   1e-76    
ref|XP_008808047.1|  PREDICTED: ran guanine nucleotide release fa...    231   2e-71    
ref|XP_010937089.1|  PREDICTED: ran guanine nucleotide release fa...    230   5e-71    
gb|EEE61122.1|  hypothetical protein OsJ_15049                          224   1e-68    Oryza sativa Japonica Group [Japonica rice]
gb|EPS73516.1|  hypothetical protein M569_01241                         219   3e-67    
ref|XP_001768602.1|  predicted protein                                  216   4e-65    
ref|XP_001781422.1|  predicted protein                                  213   3e-64    
ref|XP_010490369.1|  PREDICTED: ran guanine nucleotide release fa...    207   1e-62    
ref|XP_006302837.1|  hypothetical protein CARUB_v10020969mg             202   3e-60    
ref|XP_002972959.1|  hypothetical protein SELMODRAFT_97898              189   8e-55    
ref|XP_007046146.1|  Mog1/PsbP/DUF1795-like photosystem II reacti...    185   1e-54    
ref|XP_002993379.1|  hypothetical protein SELMODRAFT_236726             186   9e-54    
gb|KHN12221.1|  hypothetical protein glysoja_031569                     179   1e-51    
ref|XP_008385018.1|  PREDICTED: uncharacterized protein LOC103447601    171   2e-48    
ref|XP_008352298.1|  PREDICTED: uncharacterized protein LOC103415791    169   1e-47    
gb|EMT20367.1|  hypothetical protein F775_02256                         154   4e-42    
ref|XP_002504159.1|  predicted protein                                  126   5e-31    Micromonas commoda
emb|CCA21121.1|  conserved hypothetical protein                         124   2e-30    
emb|CCI43322.1|  unnamed protein product                                124   7e-30    
ref|XP_002906514.1|  conserved hypothetical protein                     119   1e-28    
gb|ETK80685.1|  hypothetical protein L915_13708                         119   2e-28    
gb|ETI40587.1|  hypothetical protein F443_14065                         119   2e-28    
ref|XP_008909556.1|  hypothetical protein PPTG_14765                    118   4e-28    
gb|ETP38504.1|  hypothetical protein F442_13908                         118   4e-28    
ref|XP_004366301.1|  Ran GTPase binding protein                         117   9e-28    
ref|XP_009515564.1|  hypothetical protein PHYSODRAFT_284230             115   8e-27    
gb|EXX71284.1|  Mog1p                                                   113   3e-26    
ref|XP_002522406.1|  pentatricopeptide repeat-containing protein,...    111   3e-26    Ricinus communis
gb|KDD73113.1|  hypothetical protein H632_c2524p1                       111   2e-25    
gb|KFH62880.1|  hypothetical protein MVEG_11404                         108   1e-24    
dbj|GAM27938.1|  hypothetical protein SAMD00019534_111140               108   2e-24    
ref|XP_005850724.1|  hypothetical protein CHLNCDRAFT_140842             105   1e-23    
ref|XP_003285372.1|  hypothetical protein DICPUDRAFT_29264              105   2e-23    
ref|XP_003060201.1|  predicted protein                                  104   1e-22    
ref|XP_004364703.1|  hypothetical protein CAOG_01835                    103   2e-22    
ref|XP_004995847.1|  hypothetical protein PTSG_03267                    102   3e-22    
gb|EFA74839.1|  Ran GTPase binding protein                              101   5e-22    Heterostelium album PN500
gb|EPZ35087.1|  Ran-interacting Mog1 protein domain-containing pr...    100   1e-21    
gb|KDO16628.1|  hypothetical protein SPRG_17826                       99.4    3e-21    
emb|CDX77290.1|  BnaC08g03350D                                        97.4    3e-21    
gb|KDO27359.1|  hypothetical protein SPRG_06947                       99.0    4e-21    
ref|XP_009827090.1|  hypothetical protein H257_04339                  98.6    5e-21    
ref|XP_008614781.1|  hypothetical protein SDRG_10563                  98.2    7e-21    
gb|KFM27018.1|  putative ran guanine nucleotide release factor        97.8    9e-21    
gb|EWM24485.1|  Mog1/PsbP/DUF1795, alpha/beta/alpha sandwich          99.0    1e-20    
gb|AAI55965.1|  Mog1 protein                                          96.7    2e-20    Xenopus laevis [clawed frog]
ref|XP_006627500.1|  PREDICTED: ran guanine nucleotide release fa...  97.1    2e-20    
gb|AAI50379.1|  Si:ch211-268m12.6 protein                             96.3    3e-20    Danio rerio [leopard danio]
ref|NP_001093465.1|  ran guanine nucleotide release factor            96.3    3e-20    Danio rerio [leopard danio]
ref|XP_008868883.1|  hypothetical protein H310_05827                  95.9    4e-20    
ref|XP_005649301.1|  Mog1p/PsbP-like protein                          96.3    4e-20    
ref|NP_001081994.1|  RAN guanine nucleotide release factor            95.5    6e-20    Xenopus laevis [clawed frog]
ref|XP_004919461.1|  PREDICTED: ran guanine nucleotide release fa...  94.7    1e-19    
gb|AAH86495.1|  rangnrf-prov protein                                  95.1    1e-19    Xenopus tropicalis [western clawed frog]
ref|XP_005715050.1|  unnamed protein product                          94.7    2e-19    
gb|ADO28291.1|  ran guanine nucleotide release factor                 94.0    2e-19    
ref|XP_008405579.1|  PREDICTED: ran guanine nucleotide release fa...  94.4    2e-19    
ref|XP_004067673.1|  PREDICTED: ran guanine nucleotide release fa...  94.0    2e-19    
ref|XP_010901293.1|  PREDICTED: ran guanine nucleotide release fa...  94.7    2e-19    
ref|XP_002948983.1|  hypothetical protein VOLCADRAFT_89409            93.6    3e-19    
ref|XP_008118596.1|  PREDICTED: ran guanine nucleotide release fa...  93.6    4e-19    
ref|XP_007550639.1|  PREDICTED: ran guanine nucleotide release fa...  93.2    4e-19    
ref|NP_001188207.1|  ran guanine nucleotide release factor            92.8    6e-19    
ref|XP_001743170.1|  hypothetical protein                             92.8    6e-19    Monosiga brevicollis MX1
ref|XP_009107587.1|  PREDICTED: uncharacterized protein LOC103833243  94.4    7e-19    
ref|XP_002941865.2|  PREDICTED: ran guanine nucleotide release fa...  94.4    9e-19    
ref|XP_004919459.1|  PREDICTED: ran guanine nucleotide release fa...  94.0    1e-18    
ref|XP_007434965.1|  PREDICTED: ran guanine nucleotide release fa...  91.7    1e-18    
ref|XP_003974013.1|  PREDICTED: ran guanine nucleotide release fa...  91.7    2e-18    
ref|XP_005795606.1|  PREDICTED: ran guanine nucleotide release fa...  91.7    2e-18    
emb|CDH56151.1|  ran guanine nucleotide release factor-like           90.9    3e-18    
emb|CDQ80495.1|  unnamed protein product                              91.7    3e-18    
ref|XP_008305349.1|  PREDICTED: ran guanine nucleotide release fa...  90.5    4e-18    
ref|XP_005999833.1|  PREDICTED: ran guanine nucleotide release fa...  89.7    8e-18    
ref|XP_003439948.1|  PREDICTED: ran guanine nucleotide release fa...  89.4    9e-18    
emb|CDS02651.1|  hypothetical protein LRAMOSA00056                    88.6    1e-17    
ref|XP_005732275.1|  PREDICTED: ran guanine nucleotide release fa...  88.6    2e-17    
ref|XP_004557275.1|  PREDICTED: ran guanine nucleotide release fa...  88.6    2e-17    
ref|XP_005923290.1|  PREDICTED: ran guanine nucleotide release fa...  88.6    2e-17    
ref|XP_005732276.1|  PREDICTED: ran guanine nucleotide release fa...  88.6    2e-17    
ref|XP_005923289.1|  PREDICTED: ran guanine nucleotide release fa...  88.6    2e-17    
ref|XP_004557276.1|  PREDICTED: ran guanine nucleotide release fa...  88.2    2e-17    
ref|XP_006790194.1|  PREDICTED: ran guanine nucleotide release fa...  88.2    2e-17    
ref|XP_500317.1|  YALI0A21098p                                        84.7    3e-16    Yarrowia lipolytica CLIB122
ref|XP_008275660.1|  PREDICTED: ran guanine nucleotide release fa...  85.1    3e-16    
ref|XP_001700745.1|  ran-binding protein Mog1                         84.3    5e-16    Chlamydomonas reinhardtii
ref|XP_007434966.1|  PREDICTED: ran guanine nucleotide release fa...  83.6    5e-16    
ref|XP_637974.1|  Ran GTPase binding protein                          84.0    8e-16    Dictyostelium discoideum AX4
gb|ACX55053.1|  Mog1 protein                                          82.0    3e-15    Euglena gracilis
ref|XP_003880103.1|  putative mog1 protein                            81.6    3e-15    
ref|XP_008022833.1|  hypothetical protein SETTUDRAFT_127511           81.6    4e-15    
gb|EJK64591.1|  hypothetical protein THAOC_14659                      82.4    5e-15    
gb|EPY36533.1|  Ran-binding protein                                   81.6    6e-15    
gb|ESW98610.1|  hypothetical protein HPODL_05254                      80.9    7e-15    
gb|EME39846.1|  hypothetical protein DOTSEDRAFT_74672                 80.5    1e-14    
ref|XP_010729399.1|  PREDICTED: ran guanine nucleotide release fa...  80.5    2e-14    
gb|ELW63572.1|  Ran guanine nucleotide release factor                 79.3    2e-14    
emb|CEG82666.1|  hypothetical protein RMATCC62417_16709               80.1    2e-14    
ref|NP_001032537.1|  ran guanine nucleotide release factor            79.7    2e-14    Bos taurus [bovine]
ref|XP_002370023.1|  mog1 protein, putative                           79.3    3e-14    Toxoplasma gondii ME49
ref|XP_006819515.1|  PREDICTED: ran guanine nucleotide release fa...  79.3    3e-14    
gb|EPR58474.1|  Ran-interacting Mog1 protein                          79.3    3e-14    
gb|EGU85381.1|  hypothetical protein FOXB_04092                       79.3    3e-14    
gb|EXK44900.1|  hypothetical protein FOMG_03548                       79.3    3e-14    
ref|XP_007321305.1|  hypothetical protein SERLADRAFT_473971           79.0    4e-14    
ref|XP_005959833.1|  PREDICTED: ran guanine nucleotide release fa...  79.0    4e-14    
emb|CEI96871.1|  hypothetical protein RMCBS344292_11019               78.6    5e-14    
ref|XP_006151803.1|  PREDICTED: ran guanine nucleotide release fa...  79.0    5e-14    
ref|XP_001802458.1|  hypothetical protein SNOG_12232                  78.6    5e-14    Parastagonospora nodorum SN15
ref|XP_001933700.1|  conserved hypothetical protein                   78.6    6e-14    Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_006151804.1|  PREDICTED: ran guanine nucleotide release fa...  78.2    6e-14    
ref|XP_005894886.1|  PREDICTED: ran guanine nucleotide release fa...  78.6    7e-14    
gb|EKC39311.1|  Ran guanine nucleotide release factor                 78.2    8e-14    
ref|XP_007881326.1|  hypothetical protein PFL1_05600                  78.2    8e-14    
gb|KFA65339.1|  hypothetical protein S40285_07157                     78.2    8e-14    
gb|KEY64752.1|  hypothetical protein S7711_05402                      78.2    9e-14    
gb|KFA53000.1|  hypothetical protein S40293_05907                     78.2    9e-14    
gb|KFG61141.1|  Ran-interacting Mog1 protein                          77.8    1e-13    
ref|XP_007550640.1|  PREDICTED: ran guanine nucleotide release fa...  77.4    1e-13    
ref|XP_388124.1|  hypothetical protein FG07948.1                      77.8    1e-13    Fusarium graminearum PH-1
ref|XP_004594816.1|  PREDICTED: ran guanine nucleotide release fa...  77.8    1e-13    
gb|ESS30069.1|  Ran-interacting Mog1 protein                          77.4    1e-13    
ref|XP_008886228.1|  Ran-interacting Mog1 protein                     77.4    1e-13    
ref|NP_001272372.1|  ran guanine nucleotide release factor isoform 4  77.4    1e-13    
gb|ESL11297.1|  Ran-binding protein                                   77.8    2e-13    
ref|XP_010766915.1|  PREDICTED: ran guanine nucleotide release fa...  77.4    2e-13    
ref|XP_004012731.1|  PREDICTED: ran guanine nucleotide release fa...  77.0    2e-13    
ref|XP_006062972.1|  PREDICTED: ran guanine nucleotide release fa...  76.6    3e-13    
ref|XP_005349867.1|  PREDICTED: ran guanine nucleotide release fa...  76.3    4e-13    
ref|XP_006973545.1|  PREDICTED: ran guanine nucleotide release fa...  76.3    4e-13    
ref|XP_002719058.1|  PREDICTED: ran guanine nucleotide release fa...  76.3    4e-13    Oryctolagus cuniculus [domestic rabbit]
gb|EMD97534.1|  hypothetical protein COCHEDRAFT_1190382               75.9    5e-13    
emb|CBJ29147.1|  conserved unknown protein                            77.8    5e-13    
ref|XP_005959834.1|  PREDICTED: ran guanine nucleotide release fa...  75.9    5e-13    
ref|NP_067304.1|  ran guanine nucleotide release factor isoform 2     75.9    5e-13    Mus musculus [mouse]
ref|XP_004594817.1|  PREDICTED: ran guanine nucleotide release fa...  75.9    5e-13    
ref|XP_007931678.1|  hypothetical protein MYCFIDRAFT_87248            75.9    5e-13    
ref|XP_847168.1|  Ran-binding protein                                 75.9    7e-13    Trypanosoma brucei brucei TREU927
gb|EJU05527.1|  Mog1p/PsbP-like protein                               75.5    7e-13    
ref|XP_005693612.1|  PREDICTED: ran guanine nucleotide release fa...  75.5    7e-13    
ref|XP_008268967.1|  PREDICTED: ran guanine nucleotide release fa...  75.5    8e-13    
gb|KFY47891.1|  hypothetical protein V496_10399                       75.5    8e-13    
ref|XP_005220404.1|  PREDICTED: ran guanine nucleotide release fa...  75.1    9e-13    
ref|XP_009050017.1|  hypothetical protein LOTGIDRAFT_213480           75.1    1e-12    
emb|CDI74610.1|  mog1 protein, putative                               75.1    1e-12    
ref|XP_003466271.1|  PREDICTED: ran guanine nucleotide release fa...  75.1    1e-12    
dbj|BAB26824.1|  unnamed protein product                              74.7    1e-12    Mus musculus [mouse]
ref|NP_001099260.1|  ran guanine nucleotide release factor            74.7    1e-12    Rattus norvegicus [brown rat]
ref|NP_001171272.1|  ran guanine nucleotide release factor isoform B  73.9    1e-12    Homo sapiens [man]
ref|XP_004266912.1|  PREDICTED: ran guanine nucleotide release fa...  74.7    1e-12    
gb|ELR08333.1|  hypothetical protein GMDG_03128                       74.7    2e-12    
ref|XP_007295313.1|  ran-interacting Mog1 protein                     74.3    2e-12    
gb|KFY85744.1|  hypothetical protein V500_08149                       74.3    2e-12    
ref|XP_003929270.1|  PREDICTED: ran guanine nucleotide release fa...  74.3    2e-12    
emb|CDJ68253.1|  mog1 protein, putative                               74.3    2e-12    
ref|XP_002921197.1|  PREDICTED: ran guanine nucleotide release fa...  73.9    2e-12    
ref|XP_001504868.1|  PREDICTED: ran guanine nucleotide release fa...  73.9    2e-12    Equus caballus [domestic horse]
ref|XP_005657094.1|  PREDICTED: RAN guanine nucleotide release fa...  73.9    3e-12    
emb|CCC49672.1|  putative Ran-binding protein                         74.3    3e-12    
gb|EPT05899.1|  hypothetical protein FOMPIDRAFT_1154477               73.6    3e-12    
ref|XP_006738276.1|  PREDICTED: ran guanine nucleotide release fa...  73.9    3e-12    
ref|XP_004329214.1|  PREDICTED: ran guanine nucleotide release fa...  73.9    3e-12    
ref|XP_849976.2|  PREDICTED: ran guanine nucleotide release facto...  73.9    3e-12    Canis lupus familiaris [dogs]
ref|NP_001272371.1|  ran guanine nucleotide release factor isoform 3  73.6    3e-12    
ref|XP_006062973.1|  PREDICTED: ran guanine nucleotide release fa...  73.6    3e-12    
ref|XP_002142144.1|  nuclear import protein mog1                      73.6    3e-12    Cryptosporidium muris RN66
gb|EPB86349.1|  hypothetical protein HMPREF1544_06888                 73.6    3e-12    
gb|KHO01136.1|  Ran-interacting protein Mog1                          73.9    3e-12    
ref|XP_001587801.1|  hypothetical protein SS1G_11041                  73.6    4e-12    Sclerotinia sclerotiorum 1980 UF-70
gb|ETE69601.1|  Ran guanine nucleotide release factor                 73.2    4e-12    
gb|KFG82420.1|  hypothetical protein MANI_015480                      73.6    4e-12    
gb|KFY05570.1|  hypothetical protein V492_08441                       73.6    4e-12    
ref|XP_010338144.1|  PREDICTED: ran guanine nucleotide release fa...  73.2    4e-12    
gb|KFX88053.1|  hypothetical protein O988_09175                       73.6    4e-12    
ref|NP_057576.2|  ran guanine nucleotide release factor isoform A     73.2    5e-12    Homo sapiens [man]
gb|EGW00516.1|  Ran guanine nucleotide release factor                 72.4    5e-12    
ref|XP_003497220.1|  PREDICTED: ran guanine nucleotide release fa...  73.2    5e-12    
ref|XP_007457886.1|  PREDICTED: ran guanine nucleotide release fa...  73.2    5e-12    
ref|NP_001230299.1|  RAN guanine nucleotide release factor isoform 2  72.4    5e-12    
gb|KID92567.1|  Ran-interacting protein Mog1                          73.2    5e-12    
ref|XP_008853971.1|  PREDICTED: ran guanine nucleotide release fa...  73.2    6e-12    
ref|XP_002747976.1|  PREDICTED: ran guanine nucleotide release fa...  72.4    6e-12    Callithrix jacchus [common marmoset]
ref|XP_005348461.1|  PREDICTED: ran guanine nucleotide release fa...  72.8    6e-12    
ref|XP_001546586.1|  hypothetical protein BC1G_14935                  73.2    6e-12    Botrytis cinerea B05.10
gb|EDL18064.1|  mCG133827                                             72.8    6e-12    
ref|XP_005139371.1|  PREDICTED: LOW QUALITY PROTEIN: RAN guanine ...  72.8    6e-12    
ref|XP_008059325.1|  PREDICTED: ran guanine nucleotide release fa...  72.8    6e-12    
ref|NP_001230298.1|  RAN guanine nucleotide release factor isoform 1  72.8    7e-12    
gb|AAF36156.1|AF151070_1  HSPC236                                     72.8    7e-12    Homo sapiens [man]
ref|XP_005332908.1|  PREDICTED: ran guanine nucleotide release fa...  72.8    7e-12    
ref|XP_010360735.1|  PREDICTED: ran guanine nucleotide release fa...  72.8    7e-12    
gb|KFY75752.1|  hypothetical protein V499_04308                       72.8    8e-12    
ref|XP_007820741.1|  hypothetical protein MAA_04454                   72.8    8e-12    
ref|XP_004058600.1|  PREDICTED: ran guanine nucleotide release fa...  72.4    8e-12    
ref|XP_001833618.2|  hypothetical protein CC1G_03835                  72.4    8e-12    Coprinopsis cinerea okayama7#130
emb|CDJ43028.1|  mog1 protein, putative                               72.4    8e-12    
ref|XP_007808026.1|  Ran-interacting protein Mog1                     72.8    8e-12    
ref|XP_005582903.1|  PREDICTED: ran guanine nucleotide release fa...  72.4    8e-12    
ref|XP_003274696.1|  PREDICTED: ran guanine nucleotide release fa...  72.4    8e-12    
ref|XP_004398516.1|  PREDICTED: ran guanine nucleotide release fa...  72.4    8e-12    
dbj|GAA96677.1|  hypothetical protein E5Q_03348                       72.4    9e-12    
ref|NP_001181499.1|  ran guanine nucleotide release factor            72.4    9e-12    
ref|XP_003912357.1|  PREDICTED: ran guanine nucleotide release fa...  72.4    1e-11    
gb|KFH45748.1|  ran guanine nucleotide release factor-like protein    72.4    1e-11    
ref|XP_005693613.1|  PREDICTED: ran guanine nucleotide release fa...  72.0    1e-11    
ref|XP_003315648.1|  PREDICTED: ran guanine nucleotide release fa...  72.4    1e-11    
ref|XP_008036845.1|  Mog1p/PsbP-like protein                          72.0    1e-11    
gb|KEQ80129.1|  ran-interacting Mog1 protein                          72.4    1e-11    
ref|XP_004433146.1|  PREDICTED: ran guanine nucleotide release fa...  72.0    1e-11    
ref|XP_007166410.1|  PREDICTED: ran guanine nucleotide release fa...  72.0    1e-11    
ref|XP_005597819.1|  PREDICTED: ran guanine nucleotide release fa...  72.0    1e-11    
ref|XP_003040748.1|  predicted protein                                72.0    1e-11    
gb|KFZ22678.1|  hypothetical protein V502_02848                       72.0    1e-11    
gb|KFY22433.1|  hypothetical protein V493_06592                       72.0    1e-11    
ref|XP_007457885.1|  PREDICTED: ran guanine nucleotide release fa...  72.0    1e-11    
ref|XP_005399473.1|  PREDICTED: ran guanine nucleotide release fa...  72.0    1e-11    
ref|XP_007522534.1|  PREDICTED: ran guanine nucleotide release fa...  72.0    1e-11    
ref|XP_004604895.1|  PREDICTED: ran guanine nucleotide release fa...  72.0    1e-11    
ref|XP_006176994.1|  PREDICTED: ran guanine nucleotide release fa...  71.6    1e-11    
gb|KEQ67132.1|  Mog1p/PsbP-like protein                               72.0    1e-11    
ref|XP_006176993.1|  PREDICTED: ran guanine nucleotide release fa...  71.6    2e-11    
ref|XP_008853972.1|  PREDICTED: ran guanine nucleotide release fa...  71.2    2e-11    
ref|XP_009542358.1|  hypothetical protein HETIRDRAFT_457360           71.2    2e-11    
ref|XP_003818114.1|  PREDICTED: ran guanine nucleotide release fa...  71.6    2e-11    
gb|EKG08647.1|  phosphatidylinositol 3-kinase, putative               71.6    2e-11    
ref|XP_006102664.1|  PREDICTED: ran guanine nucleotide release fa...  71.2    2e-11    
ref|XP_004663210.1|  PREDICTED: ran guanine nucleotide release fa...  70.9    2e-11    
ref|XP_008530634.1|  PREDICTED: ran guanine nucleotide release fa...  71.2    2e-11    
ref|XP_010613247.1|  PREDICTED: ran guanine nucleotide release fa...  71.2    3e-11    
gb|KID78407.1|  Ran-interacting protein Mog1                          71.2    3e-11    
ref|XP_011120102.1|  hypothetical protein AOL_s00054g484              71.6    3e-11    
ref|XP_010613246.1|  PREDICTED: ran guanine nucleotide release fa...  70.9    3e-11    
gb|KEQ93513.1|  hypothetical protein AUEXF2481DRAFT_31090             70.9    3e-11    
gb|EKF26843.1|  hypothetical protein MOQ_009453                       71.2    3e-11    
ref|XP_004760264.1|  PREDICTED: ran guanine nucleotide release fa...  70.9    4e-11    
ref|XP_004462477.1|  PREDICTED: ran guanine nucleotide release fa...  70.5    4e-11    
ref|XP_004712991.1|  PREDICTED: ran guanine nucleotide release fa...  70.5    4e-11    
ref|XP_004887176.1|  PREDICTED: ran guanine nucleotide release fa...  70.5    4e-11    
ref|XP_003848651.1|  hypothetical protein MYCGRDRAFT_49805            70.5    4e-11    
ref|XP_004887175.1|  PREDICTED: ran guanine nucleotide release fa...  70.5    4e-11    
ref|XP_006922430.1|  PREDICTED: ran guanine nucleotide release fa...  70.5    4e-11    
ref|XP_007714934.1|  hypothetical protein COCCADRAFT_39052            70.5    4e-11    
emb|CDS32961.1|  ran guanine nucleotide release factor                70.5    5e-11    
gb|EQB58236.1|  ran-interacting Mog1 protein                          70.9    5e-11    
ref|XP_008579937.1|  PREDICTED: ran guanine nucleotide release fa...  70.5    5e-11    
ref|XP_007285849.1|  ran-interacting mog1 protein                     70.5    5e-11    
gb|KDE06641.1|  hypothetical protein MVLG_02994                       70.1    6e-11    
emb|CCW67509.1|  unnamed protein product                              71.6    6e-11    
ref|XP_004684668.1|  PREDICTED: ran guanine nucleotide release fa...  70.1    6e-11    
ref|XP_009249552.1|  PREDICTED: LOW QUALITY PROTEIN: ran guanine ...  70.1    6e-11    
gb|KEQ77330.1|  Mog1p/PsbP-like protein                               70.1    7e-11    
gb|ESZ96769.1|  putative ran guanine nucleotide release factor        70.1    7e-11    
ref|XP_666820.1|  HSPC236                                             69.7    7e-11    
gb|EMF09144.1|  Mog1p/PsbP-like protein                               70.1    8e-11    
ref|XP_004638511.1|  PREDICTED: ran guanine nucleotide release fa...  69.7    8e-11    
emb|CDR96214.1|  hypothetical protein BBBOND_0301190                  69.7    1e-10    
ref|XP_005349868.1|  PREDICTED: ran guanine nucleotide release fa...  69.3    1e-10    
ref|XP_007483186.1|  PREDICTED: ran guanine nucleotide release fa...  69.3    1e-10    
gb|KDN62858.1|  putative ran-interacting Mog1 protein                 69.3    1e-10    
ref|XP_007126685.1|  PREDICTED: ran guanine nucleotide release fa...  69.3    1e-10    
ref|XP_005256675.1|  PREDICTED: ran guanine nucleotide release fa...  68.2    1e-10    
ref|XP_815005.1|  Ran-binding protein                                 69.7    1e-10    
gb|EFQ30500.1|  ran-interacting Mog1 protein                          69.3    1e-10    
ref|XP_009187901.1|  PREDICTED: ran guanine nucleotide release fa...  67.8    1e-10    
ref|XP_008008471.1|  PREDICTED: ran guanine nucleotide release fa...  67.8    1e-10    
gb|EPQ66325.1|  hypothetical protein BGT96224_1817                    69.3    1e-10    
ref|XP_007691736.1|  hypothetical protein COCMIDRAFT_105336           68.9    1e-10    
gb|KEZ45481.1|  hypothetical protein SAPIO_CDS1798                    68.9    2e-10    
ref|NP_001171273.1|  ran guanine nucleotide release factor isoform C  68.6    2e-10    
ref|XP_004760265.1|  PREDICTED: ran guanine nucleotide release fa...  68.9    2e-10    
gb|EPY86769.1|  phosphoribosylformylglycinamidine synthase            72.0    2e-10    
ref|XP_007695627.1|  hypothetical protein COCSADRAFT_33787            68.6    2e-10    
ref|XP_005878853.1|  PREDICTED: ran guanine nucleotide release fa...  68.6    2e-10    
ref|XP_003416961.1|  PREDICTED: ran guanine nucleotide release fa...  68.6    2e-10    
emb|CCG82215.1|  Putative tRNA 2'-phosphotransferase                  71.2    2e-10    
gb|ABY87951.1|  hypothetical protein                                  68.6    2e-10    
ref|XP_004398517.1|  PREDICTED: ran guanine nucleotide release fa...  68.2    2e-10    
ref|XP_006964832.1|  predicted protein                                68.9    2e-10    
ref|XP_008151696.1|  PREDICTED: ran guanine nucleotide release fa...  68.6    2e-10    
emb|CCF36841.1|  ran-interacting Mog1 protein                         68.6    2e-10    
gb|EPY20635.1|  Ran-binding protein                                   68.6    2e-10    
gb|KGQ02595.1|  putative ran guanine nucleotide release factor        68.9    2e-10    
ref|XP_007950422.1|  PREDICTED: ran guanine nucleotide release fa...  67.4    3e-10    
emb|CCA69848.1|  hypothetical protein PIIN_03788                      67.8    3e-10    
ref|XP_006692259.1|  hypothetical protein CTHT_0017570                68.6    3e-10    
ref|XP_008087300.1|  Mog1p/PsbP-like protein                          68.2    3e-10    
ref|XP_008603528.1|  ran-interacting Mog1 protein                     67.8    4e-10    
ref|XP_744186.1|  hypothetical protein                                67.4    5e-10    
ref|XP_007599073.1|  ran-interacting Mog1 protein                     67.8    5e-10    
ref|XP_001364184.1|  PREDICTED: ran guanine nucleotide release fa...  67.4    5e-10    
gb|EUN21695.1|  hypothetical protein COCVIDRAFT_113349                67.4    5e-10    
ref|XP_003875782.1|  putative Ran-binding protein                     67.8    5e-10    
gb|EWC48250.1|  hypothetical protein DRE_02354                        67.8    6e-10    
gb|ESA12041.1|  hypothetical protein GLOINDRAFT_27586                 65.1    6e-10    
ref|XP_004760266.1|  PREDICTED: ran guanine nucleotide release fa...  67.4    6e-10    
gb|AAR11854.1|  mog1-like protein                                     67.0    6e-10    
ref|XP_007875247.1|  hypothetical protein PNEG_03184                  67.8    6e-10    
emb|CDK26517.1|  unnamed protein product                              67.4    6e-10    
ref|XP_003768771.1|  PREDICTED: ran guanine nucleotide release fa...  67.4    6e-10    
ref|XP_009221807.1|  hypothetical protein GGTG_05736                  67.4    7e-10    
ref|XP_004462478.1|  PREDICTED: ran guanine nucleotide release fa...  65.9    7e-10    
ref|XP_002842026.1|  hypothetical protein                             67.4    8e-10    
dbj|GAC95203.1|  potential Ran guanine nucleotide release factor      66.6    8e-10    
ref|XP_003686276.1|  hypothetical protein TPHA_0F03620                67.0    9e-10    
ref|XP_006863470.1|  PREDICTED: ran guanine nucleotide release fa...  66.6    1e-09    
ref|XP_007764000.1|  Mog1p PsbP-like protein                          66.2    1e-09    
ref|XP_002156068.1|  PREDICTED: ran guanine nucleotide release fa...  66.2    1e-09    
ref|XP_010594905.1|  PREDICTED: ran guanine nucleotide release fa...  66.6    1e-09    
ref|XP_003996246.2|  PREDICTED: ran guanine nucleotide release fa...  67.0    1e-09    
gb|EMS25455.1|  Ran-binding protein Mog1p                             66.6    1e-09    
emb|CCD77422.1|  putative ran-binding protein                         66.6    1e-09    
ref|XP_007672843.1|  hypothetical protein BAUCODRAFT_64329            66.6    1e-09    
emb|CCF51884.1|  uncharacterized protein UHOR_04961                   66.6    1e-09    
gb|EPE02733.1|  ran-interacting mog1 protein                          66.6    1e-09    
ref|NP_588500.1|  Ran GTPase binding protein Mog1                     66.2    2e-09    
emb|CDJ49382.1|  mog1 protein, putative                               65.9    2e-09    
ref|XP_007389118.1|  Mog1p/PsbP-like protein                          65.9    2e-09    
gb|KDQ33535.1|  hypothetical protein PLEOSDRAFT_1073760               65.9    2e-09    
ref|XP_003665136.1|  hypothetical protein MYCTH_2315892               65.9    2e-09    
ref|XP_006666407.1|  Mog1/PsbP/DUF1795, alpha/beta/alpha sandwich     65.9    2e-09    
ref|XP_008622514.1|  hypothetical protein YYE_00608                   65.5    2e-09    
gb|EHK23221.1|  hypothetical protein TRIVIDRAFT_36828                 65.9    2e-09    
ref|XP_007832679.1|  hypothetical protein PFICI_05907                 65.9    2e-09    
gb|EGU12351.1|  hypothetical protein RTG_01373                        65.9    2e-09    
ref|XP_007913239.1|  putative ran-interacting mog1 protein            65.9    2e-09    
ref|XP_007847640.1|  ran guanine nucleotide release factor            65.5    3e-09    
ref|XP_628032.1|  possible RAN guanine nucleotide release factor      65.5    3e-09    
gb|EST05064.1|  hypothetical protein PSEUBRA_SCAF7g04588              65.5    3e-09    
emb|CDS16084.1|  ran guanine nucleotide release factor                65.5    3e-09    
ref|XP_002682346.1|  predicted protein                                65.1    4e-09    
emb|CCU77299.1|  hypothetical protein BGHDH14_bgh01380                65.1    4e-09    
emb|CCE34203.1|  related to MOG1-required for nuclear-protein import  65.1    4e-09    
ref|XP_002493088.1|  hypothetical protein                             65.1    4e-09    
gb|EQK97850.1|  Ran-interacting protein Mog1                          65.1    4e-09    
ref|XP_001904659.1|  hypothetical protein                             65.1    5e-09    
emb|CCO26131.1|  Ran guanine nucleotide release factor Short=RanGNRF  64.3    5e-09    
emb|CCM02891.1|  predicted protein                                    64.3    6e-09    
ref|XP_007863063.1|  Mog1p/PsbP-like protein                          64.3    6e-09    
ref|XP_003804096.1|  PREDICTED: LOW QUALITY PROTEIN: ran guanine ...  63.9    6e-09    
ref|XP_001878568.1|  predicted protein                                64.3    6e-09    
emb|CDJ03613.1|  ran guanine nucleotide release factor                64.7    6e-09    
gb|ETO26247.1|  ran-binding protein                                   65.9    7e-09    
ref|XP_007301350.1|  Mog1p/PsbP-like protein                          63.9    7e-09    
gb|AAF29129.1|AF161514_1  HSPC165                                     64.3    7e-09    
gb|EUB63450.1|  Ran guanine nucleotide release factor                 64.7    7e-09    
gb|KHJ34918.1|  putative ran-interacting mog1 protein                 64.3    8e-09    
gb|EHL02534.1|  putative ran guanine nucleotide release factor        64.7    9e-09    
dbj|GAA53908.1|  Ran guanine nucleotide release factor                63.9    9e-09    
ref|XP_001350176.1|  mog1 homolog, putative                           63.5    1e-08    
gb|EUR57023.1|  hypothetical protein PFBG_05978                       63.5    1e-08    
ref|XP_004376054.1|  PREDICTED: ran guanine nucleotide release fa...  63.9    1e-08    
ref|XP_007784271.1|  hypothetical protein W97_08212                   63.5    1e-08    
gb|EJT45579.1|  hypothetical protein A1Q1_06025                       63.9    1e-08    
gb|AAF87316.1|AF168714_1  x 005 protein                               62.0    1e-08    
ref|XP_007584371.1|  putative ran-interacting mog1 protein            65.9    1e-08    
ref|XP_445988.1|  hypothetical protein                                63.5    1e-08    
ref|XP_004760267.1|  PREDICTED: ran guanine nucleotide release fa...  63.2    1e-08    
ref|XP_003001969.1|  conserved hypothetical protein                   63.5    2e-08    
ref|XP_003841855.1|  hypothetical protein LEMA_P097850.1              61.6    2e-08    
ref|XP_007006432.1|  hypothetical protein TREMEDRAFT_45196            63.9    2e-08    
emb|CDO66246.1|  nuclear import protein MOG1, putative                62.8    2e-08    
ref|XP_959222.1|  hypothetical protein NCU06875                       63.2    2e-08    
ref|XP_009852972.1|  hypothetical protein NEUTE1DRAFT_117658          63.2    2e-08    
gb|KGB32521.1|  Ran guanine nucleotide release factor                 63.2    2e-08    
emb|CDO70706.1|  hypothetical protein BN946_scf184798.g21             62.8    2e-08    
gb|ERS95453.1|  hypothetical protein HMPREF1624_08331                 63.2    2e-08    
gb|AEY98117.1|  FAFR434Wp                                             62.8    3e-08    
ref|XP_730394.1|  hypothetical protein                                62.4    3e-08    
ref|XP_009656662.1|  hypothetical protein VDAG_02338                  62.4    3e-08    
ref|XP_003718105.1|  hypothetical protein MGG_00867                   62.4    4e-08    
emb|CDI54017.1|  conserved hypothetical protein                       62.0    4e-08    
ref|XP_004194886.1|  Piso0_005408                                     61.6    4e-08    
emb|CEG82667.1|  hypothetical protein RMATCC62417_16709               61.6    5e-08    
gb|KDQ12300.1|  hypothetical protein BOTBODRAFT_34587                 61.6    5e-08    
ref|XP_007360917.1|  Mog1p/PsbP-like protein                          61.6    6e-08    
gb|EFX03758.1|  ran GTPase-binding protein mog1                       61.6    6e-08    
ref|XP_001614241.1|  Ran-interacting Mog1 domain containing protein   61.2    6e-08    
ref|XP_003959748.1|  hypothetical protein KAFR_0K02570                61.6    6e-08    
ref|XP_676434.1|  hypothetical protein                                60.8    7e-08    
ref|XP_002259892.1|  Mog1-like protein                                61.2    7e-08    
dbj|GAK64790.1|  mog1p/PsbP-like protein                              61.2    7e-08    
emb|CDS51052.1|  nuclear import protein MOG1, putative                60.8    7e-08    
ref|XP_008815771.1|  hypothetical protein C922_01950                  60.8    7e-08    
gb|EPX73521.1|  ran GTPase binding protein Mog1                       61.2    8e-08    
emb|CEJ82875.1|  Putative Mog1/PsbP/DUF1795, alpha/beta/alpha san...  61.2    9e-08    
emb|CEI97938.1|  hypothetical protein RMCBS344292_12060               60.8    9e-08    
ref|XP_003035115.1|  hypothetical protein SCHCODRAFT_84496            60.8    1e-07    
gb|EHK43653.1|  hypothetical protein TRIATDRAFT_300133                60.8    1e-07    
ref|XP_004195973.1|  Piso0_005408                                     60.5    1e-07    
ref|XP_009307310.1|  Ran-binding protein                              60.8    1e-07    
ref|XP_005828650.1|  hypothetical protein GUITHDRAFT_112377           60.8    2e-07    
gb|EIF49063.1|  mog1p                                                 60.5    2e-07    
ref|XP_003654433.1|  hypothetical protein THITE_2067339               60.5    2e-07    
ref|NP_985981.2|  AFR434Wp                                            60.5    2e-07    
dbj|GAA87982.1|  hypothetical protein AKAW_06096                      60.5    2e-07    
ref|XP_007264145.1|  Mog1p/PsbP-like protein                          60.1    2e-07    
emb|CEG01066.1|  Mog1/PsbP, alpha/beta/alpha sandwich                 60.5    2e-07    
ref|XP_003345759.1|  hypothetical protein SMAC_05916                  60.1    2e-07    
ref|XP_009691070.1|  multicopy suppressor of ts gsp1                  60.1    2e-07    
ref|XP_007748486.1|  hypothetical protein A1O5_09717                  61.2    2e-07    
emb|CEG66381.1|  hypothetical protein RMATCC62417_02974               59.3    3e-07    
ref|XP_759328.1|  hypothetical protein UM03181.1                      60.1    3e-07    
gb|KDQ59449.1|  hypothetical protein JAAARDRAFT_205498                59.3    3e-07    
ref|XP_001465840.1|  putative Ran-binding protein                     59.7    3e-07    
ref|XP_001683486.1|  putative Ran-binding protein                     59.7    3e-07    
ref|XP_003861059.1|  Ran-binding protein, putative                    59.7    3e-07    
dbj|GAC75219.1|  RAN guanine nucleotide release factor                62.0    4e-07    
ref|XP_004223554.1|  ran-interacting Mog1 domain containing protein   59.3    4e-07    
ref|XP_002614000.1|  hypothetical protein BRAFLDRAFT_118449           62.0    4e-07    
emb|CCE39847.1|  hypothetical protein CPAR2_602660                    59.3    4e-07    
ref|XP_007756015.1|  hypothetical protein A1O7_03808                  60.5    5e-07    
ref|XP_007795595.1|  putative ran-interacting mog1 protein            58.9    5e-07    
ref|XP_452167.1|  hypothetical protein                                58.2    1e-06    
gb|AGO11049.1|  AaceriAFR434Wp                                        58.2    1e-06    
gb|EPY51162.1|  ran GTPase binding protein Mog1                       57.8    1e-06    
gb|ETS60061.1|  hypothetical protein PaG_06055                        57.8    1e-06    
gb|KDN49443.1|  hypothetical protein RSAG8_02145                      57.8    1e-06    
ref|XP_007377336.1|  hypothetical protein SPAPADRAFT_63216            57.4    1e-06    



>ref|XP_008221638.1| PREDICTED: ran guanine nucleotide release factor [Prunus mume]
 ref|XP_008221639.1| PREDICTED: ran guanine nucleotide release factor [Prunus mume]
Length=202

 Score =   337 bits (864),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ D+YSERPLFGGAI STFP+RFQDVS++RQVPDHQE FVDPARDESLIFELLELK +V
Sbjct  1    MSQDIYSERPLFGGAITSTFPLRFQDVSDIRQVPDHQEAFVDPARDESLIFELLELKHEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D+GSATWFLQDLA EQDA+G+MVIEQSGVVEAPGL ++  PAI+TTAVGQM+ISKGRQG
Sbjct  61   GDDGSATWFLQDLATEQDADGSMVIEQSGVVEAPGLCYRNTPAIVTTAVGQMSISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+V+VY+AN+RLKEV  D+L+TAYEP+ IN LSESAS V AG+AVPA Q+G MP+A
Sbjct  121  REAQNIVRVYVANLRLKEVNTDVLVTAYEPVHINPLSESASTVGAGLAVPAVQSGYMPVA  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            EVFKLAVS+FKVNDW LFG+
Sbjct  181  EVFKLAVSSFKVNDWNLFGS  200



>ref|XP_007223470.1| hypothetical protein PRUPE_ppa011657mg [Prunus persica]
 gb|EMJ24669.1| hypothetical protein PRUPE_ppa011657mg [Prunus persica]
Length=202

 Score =   336 bits (861),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ D+YSERPLFGGAI STFP+RFQDVS++RQVPDHQE FVDPARDESLIFELLELK +V
Sbjct  1    MSQDIYSERPLFGGAITSTFPLRFQDVSDIRQVPDHQEAFVDPARDESLIFELLELKHEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D+GSATWFLQDLA EQDA+G+MVIEQSGVVEAPGL ++  PA++TTAVGQM+ISKGRQG
Sbjct  61   GDDGSATWFLQDLATEQDADGSMVIEQSGVVEAPGLCYRNTPAVVTTAVGQMSISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+V+VY+AN+RLKEV  D+L+TAYEP+ IN LSESAS V AG+AVPA Q+G MP+A
Sbjct  121  REAQNIVRVYVANLRLKEVNTDVLVTAYEPVHINPLSESASTVGAGLAVPAVQSGYMPVA  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            EVFKLAVS+FKVNDW LFG+
Sbjct  181  EVFKLAVSSFKVNDWNLFGS  200



>gb|KDP41182.1| hypothetical protein JCGZ_15589 [Jatropha curcas]
Length=203

 Score =   336 bits (861),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M  D ++ERPLFGGAI STFPVRFQDVSNVRQVPD+QEVFVDPARDESLIFELL+ K DV
Sbjct  1    MPEDFHTERPLFGGAIVSTFPVRFQDVSNVRQVPDNQEVFVDPARDESLIFELLDFKHDV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
            ADNGSATWFLQDLANEQDAEG  +IEQSGVVEAP   ++ +PA++TTAVGQMAISKGRQG
Sbjct  61   ADNGSATWFLQDLANEQDAEGCTLIEQSGVVEAPSFLYRNVPAVVTTAVGQMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+V+VYLAN+RLK VT D+LITAYEPI+IN LSESAS V AG+AVPA Q+G +PM+
Sbjct  121  REAQNVVRVYLANLRLKGVTTDVLITAYEPILINPLSESASTVGAGLAVPATQSGFLPMS  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            EVFKLAVSTFKVNDW LFG+
Sbjct  181  EVFKLAVSTFKVNDWNLFGS  200



>ref|XP_008389480.1| PREDICTED: probable ran guanine nucleotide release factor [Malus 
domestica]
Length=202

 Score =   330 bits (847),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ D+YSERPLFGGAI STFP+RFQDVSN+RQVPDHQE FVDPARDESLIFELLE K +V
Sbjct  1    MSQDIYSERPLFGGAITSTFPLRFQDVSNIRQVPDHQEAFVDPARDESLIFELLEFKHEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             DNGSA WFLQDLA EQDAEG+MVIEQSG++EAPGL ++  PA++TTAVGQMAISKGRQG
Sbjct  61   GDNGSANWFLQDLATEQDAEGSMVIEQSGIIEAPGLCYRDTPAVVTTAVGQMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            R+AQN+V+VY+AN+RLK V  D+LITAYEP+ IN LSESA+ V AG AVPA Q+G MP+A
Sbjct  121  RDAQNIVRVYVANLRLKGVNTDVLITAYEPVHINPLSESANTVGAGFAVPAVQSGHMPVA  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            EVFKLAVS+F+VNDW LFG+
Sbjct  181  EVFKLAVSSFRVNDWNLFGS  200



>ref|XP_004228383.1| PREDICTED: probable ran guanine nucleotide release factor isoform 
X2 [Solanum lycopersicum]
Length=203

 Score =   330 bits (846),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            MAVD  +ERPLFGGAI++TFP+RFQDVSNVRQVPDHQE FVDP RDESLI ELL+LK DV
Sbjct  1    MAVDSTAERPLFGGAISTTFPIRFQDVSNVRQVPDHQEAFVDPERDESLIIELLDLKMDV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
            AD+GSATWFLQDLANEQ+AEG  + EQS V EAPGL ++ +PA+ITTAVGQMA++KG+QG
Sbjct  61   ADSGSATWFLQDLANEQEAEGATITEQSAVFEAPGLCYRNMPAVITTAVGQMAVAKGKQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQNLVKVYLAN+RLKEV  D+LITAYEP+VIN LSESA+AV AG+AVPAAQ+G MPMA
Sbjct  121  REAQNLVKVYLANIRLKEVGTDVLITAYEPLVINPLSESATAVGAGMAVPAAQSGVMPMA  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            EVFKLAVS+FKV++W LF +
Sbjct  181  EVFKLAVSSFKVHNWSLFSS  200



>gb|KDO82896.1| hypothetical protein CISIN_1g028780mg [Citrus sinensis]
Length=204

 Score =   330 bits (845),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ D+YSERPLFGGAI+S+FP RFQDVSN+RQVPDHQEVFVDP+RDESLIFELL+ K DV
Sbjct  1    MSGDLYSERPLFGGAISSSFPHRFQDVSNIRQVPDHQEVFVDPSRDESLIFELLDFKLDV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             DNGSA WFLQDLA EQDAEG  ++EQSGVVEAPGL ++ LPA +TTAVGQMAISKGRQG
Sbjct  61   GDNGSAAWFLQDLATEQDAEGCTLLEQSGVVEAPGLRYKDLPATVTTAVGQMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+VKVYLAN+RLKEV  D+L+TAYEP++IN LSESAS V AG+ VPA Q+G M M+
Sbjct  121  REAQNIVKVYLANLRLKEVGTDVLVTAYEPLLINPLSESASTVGAGLPVPATQSGFMQMS  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            EVFKLAVS+FKVNDW LFG 
Sbjct  181  EVFKLAVSSFKVNDWSLFGG  200



>ref|XP_009804047.1| PREDICTED: ran guanine nucleotide release factor isoform X1 [Nicotiana 
sylvestris]
Length=202

 Score =   329 bits (843),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 158/199 (79%), Positives = 177/199 (89%), Gaps = 0/199 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M  D  +ER LFGGAI+STFP+RFQDVSNVRQVPDHQEVFVDP RDESLI ELL+LK DV
Sbjct  1    MPEDSCTERALFGGAISSTFPLRFQDVSNVRQVPDHQEVFVDPGRDESLIIELLDLKLDV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
            AD+GSATWFLQDLANEQDAEG  +IEQS V EAPGL ++  PA+I+TAVGQMA+SKGRQG
Sbjct  61   ADSGSATWFLQDLANEQDAEGATIIEQSAVFEAPGLCYRNTPAVISTAVGQMAVSKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQNLVKVYLAN+RLKEV  DILITAYEP++IN LSE+AS V AG+AVPAAQ+G MPMA
Sbjct  121  REAQNLVKVYLANLRLKEVGTDILITAYEPLLINPLSETASTVGAGIAVPAAQSGIMPMA  180

Query  846  EVFKLAVSTFKVNDWRLFG  902
            EVFKLAVS+FKV+DW LFG
Sbjct  181  EVFKLAVSSFKVHDWSLFG  199



>emb|CDP00320.1| unnamed protein product [Coffea canephora]
Length=202

 Score =   328 bits (842),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 176/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M  D+ +ERPLFGGAI+STFP+RFQDVSN+RQVPDHQEVFVDPARDESLIFELL+ K DV
Sbjct  1    MPEDISAERPLFGGAISSTFPLRFQDVSNIRQVPDHQEVFVDPARDESLIFELLDFKADV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
            ADNGSATWFLQDLA EQ+AEG  VIEQSGV +A GL F  +P II+TAVGQMAISKGRQG
Sbjct  61   ADNGSATWFLQDLAAEQNAEGATVIEQSGVFQADGLQFGDMPTIISTAVGQMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            R AQNLVKVYLAN+RLK V  D+LITAYEPIVIN LSESA AV AGVAVPAAQ+GCMPM 
Sbjct  121  RGAQNLVKVYLANLRLKGVATDVLITAYEPIVINPLSESAIAVGAGVAVPAAQSGCMPMN  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            EVF+LA ++FKVNDW LFGA
Sbjct  181  EVFQLAATSFKVNDWSLFGA  200



>ref|XP_006438670.1| hypothetical protein CICLE_v10032771mg [Citrus clementina]
 ref|XP_006483178.1| PREDICTED: probable ran guanine nucleotide release factor-like 
[Citrus sinensis]
 gb|ESR51910.1| hypothetical protein CICLE_v10032771mg [Citrus clementina]
Length=204

 Score =   328 bits (841),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 176/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ D+YSERPLFGGAI+S+FP RFQDVSN+RQVPDHQEVFVDP+RDESLIFELL+ K DV
Sbjct  1    MSGDLYSERPLFGGAISSSFPHRFQDVSNIRQVPDHQEVFVDPSRDESLIFELLDFKLDV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             DNGSA WFLQDLA EQDAEG  ++E SGVVEAPGL ++ LPA +TTAVGQMAISKGRQG
Sbjct  61   GDNGSAAWFLQDLATEQDAEGCTLLEHSGVVEAPGLRYKDLPATVTTAVGQMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+VKVYLAN+RLKEV  D+L+TAYEP++IN LSESAS V AG+ VPA Q+G M M+
Sbjct  121  REAQNIVKVYLANLRLKEVGTDVLVTAYEPLLINPLSESASTVGAGLPVPATQSGFMQMS  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            EVFKLAVS+FKVNDW LFG 
Sbjct  181  EVFKLAVSSFKVNDWSLFGG  200



>ref|XP_008361789.1| PREDICTED: ran guanine nucleotide release factor-like [Malus 
domestica]
Length=202

 Score =   327 bits (838),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 176/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ D+YSERPLFGGAI STFP+RF+DVSN+RQVPDHQE FVDPARDESLIFELLELK +V
Sbjct  1    MSQDIYSERPLFGGAITSTFPLRFEDVSNIRQVPDHQEAFVDPARDESLIFELLELKHEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             DNGSA WFLQDLA EQDA+ +MVIEQSGV+EAP L +   PA++TTAVGQMAISKGRQG
Sbjct  61   GDNGSANWFLQDLATEQDADXSMVIEQSGVIEAPRLCYXNTPAVVTTAVGQMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+V+VY AN+RLKEV  D+LITAYEP+ IN LSESA+ V AG AVPA Q+G MP+A
Sbjct  121  REAQNIVRVYXANLRLKEVNTDVLITAYEPVHINPLSESANTVGAGFAVPAVQSGHMPVA  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            EVFKLAVS+F+VNDW LFG+
Sbjct  181  EVFKLAVSSFRVNDWNLFGS  200



>ref|XP_011075491.1| PREDICTED: ran guanine nucleotide release factor [Sesamum indicum]
Length=202

 Score =   327 bits (837),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M  D+ +ERPLFGGAI STFP+RF DVS +RQVPDHQEVFVDPARDESLIFELL+LK DV
Sbjct  1    MPEDLCAERPLFGGAIVSTFPLRFVDVSYIRQVPDHQEVFVDPARDESLIFELLDLKTDV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
            AD GSATWFLQDLA+EQDAEGTMV+EQSGV EA GL  ++ PAIITTAVGQMAISKGRQG
Sbjct  61   ADQGSATWFLQDLASEQDAEGTMVLEQSGVFEADGLRCRSSPAIITTAVGQMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+VKVYLAN+RLK+V  D+LITAYEP++IN LSE+A+ V AG+ VPAAQ+GC+PMA
Sbjct  121  REAQNIVKVYLANLRLKDVATDVLITAYEPMLINPLSETAATVGAGLPVPAAQSGCLPMA  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            +VFK AV+TFKVNDW LFGA
Sbjct  181  DVFKSAVTTFKVNDWSLFGA  200



>ref|XP_002524187.1| Nuclear import protein mog1, putative [Ricinus communis]
 gb|EEF38202.1| Nuclear import protein mog1, putative [Ricinus communis]
Length=203

 Score =   326 bits (836),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M  D Y+ERPLFGGAI ++FP+RFQDVSN+RQVPDHQEVFVDPARDESLIFELL+ K D+
Sbjct  1    MPEDSYTERPLFGGAITTSFPLRFQDVSNIRQVPDHQEVFVDPARDESLIFELLDFKHDI  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             DNGSATWFLQDLANEQDAEG  +IEQSGVVEAPGL ++  P +++TAVGQM ISKGRQG
Sbjct  61   GDNGSATWFLQDLANEQDAEGCTLIEQSGVVEAPGLLYRDNPTVVSTAVGQMNISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+V+VYLAN+RLK V++D+LITAYEP++I+ LSE+A  V AG+A+PAAQ+G +PM+
Sbjct  121  REAQNVVRVYLANIRLKGVSSDVLITAYEPVLIHPLSETARTVGAGMAIPAAQSGFLPMS  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            EVFKLAVSTFKVNDW LFG+
Sbjct  181  EVFKLAVSTFKVNDWNLFGS  200



>gb|KHG04175.1| putative ran guanine nucleotide release factor [Gossypium arboreum]
Length=202

 Score =   325 bits (833),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 150/198 (76%), Positives = 175/198 (88%), Gaps = 0/198 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ D+ SERPLFGGAI++TFP+RFQDVSN+RQVPDHQEVFVDPARDESLIFELL+ K DV
Sbjct  1    MSADLLSERPLFGGAISTTFPLRFQDVSNIRQVPDHQEVFVDPARDESLIFELLDYKHDV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D GSA WF+QDLA EQD EG  ++EQS VVEAPGL ++ +PAI+TTAVGQMA+SKGRQG
Sbjct  61   GDEGSAVWFIQDLAIEQDGEGFTLLEQSTVVEAPGLCYKNIPAIVTTAVGQMAVSKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN++KVYLAN+RLKEV  D+LITAYEPIVIN LSESASAV AG+A+PA Q+G MPM 
Sbjct  121  REAQNIIKVYLANIRLKEVGTDVLITAYEPIVINPLSESASAVSAGLAIPATQSGFMPMV  180

Query  846  EVFKLAVSTFKVNDWRLF  899
            E+FKLAV+ FK+NDW LF
Sbjct  181  EIFKLAVTNFKINDWGLF  198



>ref|XP_009603835.1| PREDICTED: ran guanine nucleotide release factor [Nicotiana tomentosiformis]
Length=206

 Score =   325 bits (832),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 180/204 (88%), Gaps = 1/204 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M  D  ++R LFGGAI+STFP+RFQDVSNVRQVPD+QEVFVDPARDESLI ELL+LK DV
Sbjct  1    MPEDSCTDRALFGGAISSTFPLRFQDVSNVRQVPDYQEVFVDPARDESLIIELLDLKVDV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
            AD+GSATWFLQDLANEQDAEGT +IEQS V EA GL ++  PA+I+TAVGQMA+SKGRQG
Sbjct  61   ADSGSATWFLQDLANEQDAEGTTIIEQSAVFEATGLCYRNTPAVISTAVGQMAVSKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQNLVKVYLAN+RLKEV  DIL+TAYEP++IN LSESAS V AGVAVPAAQ+G MPMA
Sbjct  121  REAQNLVKVYLANLRLKEVGTDILVTAYEPLLINPLSESASTVGAGVAVPAAQSGIMPMA  180

Query  846  EVFKLAVSTFKVNDWRLFG-ADRG  914
            EVFKLAV +FKV+DW LFG A RG
Sbjct  181  EVFKLAVPSFKVHDWSLFGTATRG  204



>ref|XP_006366699.1| PREDICTED: probable ran guanine nucleotide release factor-like 
[Solanum tuberosum]
Length=203

 Score =   324 bits (831),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            MA D  ++R LF GA++STFP+RFQDVSNVRQVPDHQEVFVDP RDESLI ELL+LK DV
Sbjct  1    MAGDSTADRSLFVGAVSSTFPIRFQDVSNVRQVPDHQEVFVDPERDESLIIELLDLKMDV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
            AD+GSATWFLQDLANEQ+AEGT + EQS + EAPGL ++ +PA ITTAVGQMA++KGRQG
Sbjct  61   ADSGSATWFLQDLANEQEAEGTTITEQSAMFEAPGLCYRNMPAFITTAVGQMAVAKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQNLVKVYLAN+RLKEV  D+LITAYEP+VIN LSESA+AV AG+AVPAAQ+G MPMA
Sbjct  121  REAQNLVKVYLANIRLKEVGTDVLITAYEPLVINPLSESATAVGAGMAVPAAQSGVMPMA  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            EVFKLAVS+FKV++W LFG+
Sbjct  181  EVFKLAVSSFKVHNWSLFGS  200



>ref|XP_008446339.1| PREDICTED: probable ran guanine nucleotide release factor [Cucumis 
melo]
Length=202

 Score =   324 bits (830),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 174/200 (87%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ D  +ERPLFGGAI STFP+RFQDVSNVRQVPDHQEVFVDP+RDESLIFELL+ K DV
Sbjct  1    MSADFSTERPLFGGAIVSTFPLRFQDVSNVRQVPDHQEVFVDPSRDESLIFELLDFKHDV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             DNGSA WFLQDLA EQDAEG+MVIEQSGV+EAPGL +  +P + TTAVGQMAISKGRQG
Sbjct  61   GDNGSAVWFLQDLATEQDAEGSMVIEQSGVIEAPGLCYGNIPTVATTAVGQMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+V+VYLAN+RLK V  D+LI+AYEPIVIN LSESAS+V +G+  PA+ +G +PM 
Sbjct  121  REAQNIVRVYLANLRLKGVGTDVLISAYEPIVINPLSESASSVGSGLTTPASHSGYIPMP  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            EVFKLAVS+FKV DW LFGA
Sbjct  181  EVFKLAVSSFKVCDWSLFGA  200



>ref|XP_008339915.1| PREDICTED: ran guanine nucleotide release factor-like [Malus 
domestica]
 ref|XP_008339916.1| PREDICTED: ran guanine nucleotide release factor-like [Malus 
domestica]
Length=202

 Score =   323 bits (828),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 175/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ D+YSERPLFGGAI STFP+RF+DVSN+RQVPDHQE FVDPARDESLIFELLELK +V
Sbjct  1    MSQDIYSERPLFGGAITSTFPLRFEDVSNIRQVPDHQEAFVDPARDESLIFELLELKHEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             DNGSA WFLQDLA EQDA+ +MVIEQSGV+EAP L +   PA++TTAVGQMAISKGRQG
Sbjct  61   GDNGSANWFLQDLATEQDADXSMVIEQSGVIEAPRLCYXNTPAVVTTAVGQMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+V+VY AN+RLKEV  D+LITAYEP+ IN LSE+A+ V AG AVPA Q+G MP+A
Sbjct  121  REAQNIVRVYXANLRLKEVNTDVLITAYEPVHINPLSETANTVGAGFAVPAVQSGHMPVA  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            EV KLAVS+F+VNDW LFG+
Sbjct  181  EVSKLAVSSFRVNDWNLFGS  200



>ref|XP_004297310.1| PREDICTED: probable ran guanine nucleotide release factor-like 
[Fragaria vesca subsp. vesca]
Length=202

 Score =   323 bits (827),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            MA + YS+RPLFGGAI+S FP RFQDVSNVRQVPDHQE FVDPARDESLIFELL+LK +V
Sbjct  1    MAEEKYSQRPLFGGAISSLFPDRFQDVSNVRQVPDHQEAFVDPARDESLIFELLDLKPEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             DNGSATWFLQDLA EQDAEG+++IEQSGVVE PGLS+  +PA++TTAVGQMAISKGRQG
Sbjct  61   GDNGSATWFLQDLATEQDAEGSVLIEQSGVVEVPGLSYGNIPAVVTTAVGQMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN V+VY+AN+RLK V+ D+LITAYEPI IN LSESAS V AG+A PA Q+G +PM 
Sbjct  121  REAQNTVRVYVANLRLKGVSTDVLITAYEPIHINPLSESASTVGAGIAAPALQSGHVPMV  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            EVF++AVS+FKVNDW LFG+
Sbjct  181  EVFRVAVSSFKVNDWNLFGS  200



>ref|XP_007046145.1| Mog1/PsbP/DUF1795-like photosystem II reaction center PsbP family 
protein isoform 1 [Theobroma cacao]
 gb|EOY01977.1| Mog1/PsbP/DUF1795-like photosystem II reaction center PsbP family 
protein isoform 1 [Theobroma cacao]
Length=201

 Score =   321 bits (823),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ D+YSERPLFGGAI++TFP+RFQDVSN+RQVPDHQEVFVDPARDESLIFELL+ K +V
Sbjct  1    MSADLYSERPLFGGAISTTFPLRFQDVSNIRQVPDHQEVFVDPARDESLIFELLDYKHEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D+GSA WFLQDLA EQD EG  ++EQS  VEAPGL ++ +PA++TTAVGQMA+SKGRQG
Sbjct  61   GDDGSAVWFLQDLAVEQDGEGFTLLEQSAAVEAPGLRYRNIPAVVTTAVGQMAVSKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN++KVYLAN+RLKEV  D+LITAYEPI+I+ LS+SASAV AG+AVPA Q+G +PM 
Sbjct  121  REAQNIIKVYLANLRLKEVGTDVLITAYEPILIHPLSQSASAVGAGLAVPAMQSGLVPMV  180

Query  846  EVFKLAVSTFKVNDWRLF  899
            EVFKLAV++FKVNDW LF
Sbjct  181  EVFKLAVTSFKVNDWSLF  198



>ref|XP_004228382.1| PREDICTED: probable ran guanine nucleotide release factor isoform 
X1 [Solanum lycopersicum]
Length=221

 Score =   320 bits (821),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 181/218 (83%), Gaps = 18/218 (8%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            MAVD  +ERPLFGGAI++TFP+RFQDVSNVRQVPDHQE FVDP RDESLI ELL+LK DV
Sbjct  1    MAVDSTAERPLFGGAISTTFPIRFQDVSNVRQVPDHQEAFVDPERDESLIIELLDLKMDV  60

Query  486  ADNGSATWFLQDLANEQDAEG------------------TMVIEQSGVVEAPGLSFQTLP  611
            AD+GSATWFLQDLANEQ+AEG                   ++ EQS V EAPGL ++ +P
Sbjct  61   ADSGSATWFLQDLANEQEAEGATRHCKTERARRDIMLHSCLITEQSAVFEAPGLCYRNMP  120

Query  612  AIITTAVGQMAISKGRQGREAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASA  791
            A+ITTAVGQMA++KG+QGREAQNLVKVYLAN+RLKEV  D+LITAYEP+VIN LSESA+A
Sbjct  121  AVITTAVGQMAVAKGKQGREAQNLVKVYLANIRLKEVGTDVLITAYEPLVINPLSESATA  180

Query  792  VRAGVAVPAAQAGCMPMAEVFKLAVSTFKVNDWRLFGA  905
            V AG+AVPAAQ+G MPMAEVFKLAVS+FKV++W LF +
Sbjct  181  VGAGMAVPAAQSGVMPMAEVFKLAVSSFKVHNWSLFSS  218



>ref|XP_003518721.1| PREDICTED: ran guanine nucleotide release factor-like isoform 
X1 [Glycine max]
 ref|XP_006574902.1| PREDICTED: ran guanine nucleotide release factor-like isoform 
X2 [Glycine max]
 ref|XP_006574903.1| PREDICTED: ran guanine nucleotide release factor-like isoform 
X3 [Glycine max]
Length=198

 Score =   319 bits (818),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 170/198 (86%), Gaps = 0/198 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M  D+  + PLFGG IASTFP RFQDVSN+RQVPDHQEVF DP+ DESLIFELLE K DV
Sbjct  1    MPEDIVYQHPLFGGKIASTFPHRFQDVSNIRQVPDHQEVFADPSHDESLIFELLEFKPDV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
            ADNGSA WFLQDLA EQDAEG++VIEQSGV+EAPGL ++ +PA++ TAVGQMAISKGRQG
Sbjct  61   ADNGSAAWFLQDLATEQDAEGSVVIEQSGVLEAPGLMYKNMPAVVITAVGQMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN VKVYLAN+ LK V  D+L+TAYEPIVIN  SESA  V AGVAVPAAQAGCMPM 
Sbjct  121  REAQNFVKVYLANLHLKGVDTDVLVTAYEPIVINPFSESADTVGAGVAVPAAQAGCMPME  180

Query  846  EVFKLAVSTFKVNDWRLF  899
            EVFKLAV++F+V+DW LF
Sbjct  181  EVFKLAVTSFRVHDWGLF  198



>ref|NP_001241181.1| uncharacterized protein LOC100786093 [Glycine max]
 gb|ACU21404.1| unknown [Glycine max]
 gb|KHN01205.1| Putative ran guanine nucleotide release factor [Glycine soja]
Length=198

 Score =   319 bits (817),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 174/198 (88%), Gaps = 0/198 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M  D+  + PLFGG I+STFP RFQDVS++RQVPDHQEVF DP+RDESLIFELLE K DV
Sbjct  1    MPEDIVYQHPLFGGKISSTFPHRFQDVSSIRQVPDHQEVFADPSRDESLIFELLEFKPDV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
            ADNGSA WFLQDLA+EQDAEG++VIEQSGV+EAPGL +   PA++TTAVGQMAISKGRQG
Sbjct  61   ADNGSAGWFLQDLASEQDAEGSVVIEQSGVLEAPGLMYNNTPAVVTTAVGQMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+VKVYLAN+RL+ V  D+L++AYEPIVIN LSESA  V AGVAVPAAQAGCMPM 
Sbjct  121  REAQNIVKVYLANLRLRGVDTDVLVSAYEPIVINPLSESADTVGAGVAVPAAQAGCMPMD  180

Query  846  EVFKLAVSTFKVNDWRLF  899
            EVFKLAV++F+V+DW LF
Sbjct  181  EVFKLAVTSFRVHDWGLF  198



>ref|XP_004135179.1| PREDICTED: probable ran guanine nucleotide release factor-like 
[Cucumis sativus]
 ref|XP_004155313.1| PREDICTED: probable ran guanine nucleotide release factor-like 
[Cucumis sativus]
 gb|KGN51907.1| hypothetical protein Csa_5G605010 [Cucumis sativus]
Length=202

 Score =   319 bits (817),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 174/200 (87%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ D  +ER LFGGAI STFP+RFQDVSNVRQVPDHQEVFVDP+RDESLIFELL+ K DV
Sbjct  1    MSADFSTERALFGGAIVSTFPLRFQDVSNVRQVPDHQEVFVDPSRDESLIFELLDFKHDV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             DNGSA WFLQDLA EQDAEG++VIEQSGV+EAP L +  +P++ TTAVGQMAISKGRQG
Sbjct  61   GDNGSAVWFLQDLATEQDAEGSVVIEQSGVIEAPELCYGNIPSVATTAVGQMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+V+VYLAN+RLK V  D+LI+AYEPIVIN LSESAS+V +G+A PA+ +G MPM 
Sbjct  121  REAQNIVRVYLANLRLKGVGTDVLISAYEPIVINPLSESASSVGSGLATPASHSGYMPMP  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            EVFKLAVS+FKV DW LFGA
Sbjct  181  EVFKLAVSSFKVCDWSLFGA  200



>ref|XP_010683207.1| PREDICTED: probable ran guanine nucleotide release factor [Beta 
vulgaris subsp. vulgaris]
Length=200

 Score =   318 bits (816),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 173/200 (87%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            MA D  +ERPL+GGAIA TFP+RFQD+SNVR+VPDHQE F D  RDESLI ELL+LKQDV
Sbjct  1    MAEDACAERPLYGGAIAMTFPLRFQDLSNVREVPDHQEAFADANRDESLIIELLDLKQDV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
            AD  SA WF+QDLA EQDAEG M+IEQSG++E PGL ++++PA++T+AVGQMAISKGRQG
Sbjct  61   ADEASAVWFIQDLAREQDAEGGMLIEQSGIIEVPGLCYRSMPAVVTSAVGQMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+V+VYLAN+RLKEV  DILITAYEP+VIN LSESA  V AGV  PA Q+GC+PMA
Sbjct  121  REAQNIVRVYLANLRLKEVGTDILITAYEPVVINPLSESAGTVGAGVVAPAEQSGCIPMA  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            EVFKL+VSTFKVNDW LF A
Sbjct  181  EVFKLSVSTFKVNDWSLFNA  200



>ref|XP_009360351.1| PREDICTED: probable ran guanine nucleotide release factor [Pyrus 
x bretschneideri]
Length=202

 Score =   317 bits (813),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 173/198 (87%), Gaps = 0/198 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ D+YSERPLFGGAI STFP+RFQDVSN+RQVPDHQE FVD ARD+SLIFELLE K +V
Sbjct  1    MSQDIYSERPLFGGAITSTFPLRFQDVSNIRQVPDHQEAFVDLARDDSLIFELLEFKHEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             DNGSA WFLQDLA EQD EG+MVIEQSG++EA GL +   PA++TTAVGQMAISKGRQG
Sbjct  61   GDNGSANWFLQDLATEQDNEGSMVIEQSGIIEALGLCYGDAPAVVTTAVGQMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            R+AQN+V+VYLAN+RLKEV  D+LITA+EP+ IN LSESA+ V AG AVPA Q+G MP+A
Sbjct  121  RDAQNIVRVYLANLRLKEVNTDVLITAHEPVHINPLSESANTVGAGFAVPAVQSGHMPVA  180

Query  846  EVFKLAVSTFKVNDWRLF  899
            EVFKLAVS+F+VNDW LF
Sbjct  181  EVFKLAVSSFRVNDWNLF  198



>gb|KDO82895.1| hypothetical protein CISIN_1g028780mg [Citrus sinensis]
Length=200

 Score =   317 bits (811),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 173/200 (87%), Gaps = 4/200 (2%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ D+YSERPLFGGAI+S+FP RFQDVSN+RQVPDHQEVFVDP+RDESLIFELL+ K DV
Sbjct  1    MSGDLYSERPLFGGAISSSFPHRFQDVSNIRQVPDHQEVFVDPSRDESLIFELLDFKLDV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             DNGSA WFLQDLA EQDAEG  ++EQSGVVEAPGL ++ LPA +TTAVGQM    GRQG
Sbjct  61   GDNGSAAWFLQDLATEQDAEGCTLLEQSGVVEAPGLRYKDLPATVTTAVGQM----GRQG  116

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+VKVYLAN+RLKEV  D+L+TAYEP++IN LSESAS V AG+ VPA Q+G M M+
Sbjct  117  REAQNIVKVYLANLRLKEVGTDVLVTAYEPLLINPLSESASTVGAGLPVPATQSGFMQMS  176

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            EVFKLAVS+FKVNDW LFG 
Sbjct  177  EVFKLAVSSFKVNDWSLFGG  196



>ref|XP_010097929.1| hypothetical protein L484_009363 [Morus notabilis]
 gb|EXB73285.1| hypothetical protein L484_009363 [Morus notabilis]
Length=201

 Score =   316 bits (810),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 175/200 (88%), Gaps = 2/200 (1%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M  +  +ERPLFGGAI++TFP+RFQDVS++RQVPDHQEVFVDPARDESLIFELLELK +V
Sbjct  1    MPEESSTERPLFGGAISATFPLRFQDVSDIRQVPDHQEVFVDPARDESLIFELLELKHEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             DN SATWFLQDLANEQDAEG++VIEQSGV+EA GL ++ +PA++TTAVGQMAISKGRQG
Sbjct  61   GDNESATWFLQDLANEQDAEGSVVIEQSGVIEASGLCYRNIPAVVTTAVGQMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQNL  VY+AN+RLK V  D+L+TAYEPI IN LSESASAV AG  + A Q+GCMPMA
Sbjct  121  REAQNL--VYVANLRLKAVNTDVLVTAYEPIHINPLSESASAVGAGFTIAATQSGCMPMA  178

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            EVF+ AVSTFKV DW LFG+
Sbjct  179  EVFRHAVSTFKVCDWSLFGS  198



>ref|XP_009804048.1| PREDICTED: probable ran guanine nucleotide release factor isoform 
X2 [Nicotiana sylvestris]
Length=198

 Score =   316 bits (809),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 155/199 (78%), Positives = 173/199 (87%), Gaps = 4/199 (2%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M  D  +ER LFGGAI+STFP+RFQDVSNVRQVPDHQEVFVDP RDESLI ELL+LK DV
Sbjct  1    MPEDSCTERALFGGAISSTFPLRFQDVSNVRQVPDHQEVFVDPGRDESLIIELLDLKLDV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
            AD+GSATWFLQDLANEQDAEG      S V EAPGL ++  PA+I+TAVGQMA+SKGRQG
Sbjct  61   ADSGSATWFLQDLANEQDAEGAT----SAVFEAPGLCYRNTPAVISTAVGQMAVSKGRQG  116

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQNLVKVYLAN+RLKEV  DILITAYEP++IN LSE+AS V AG+AVPAAQ+G MPMA
Sbjct  117  REAQNLVKVYLANLRLKEVGTDILITAYEPLLINPLSETASTVGAGIAVPAAQSGIMPMA  176

Query  846  EVFKLAVSTFKVNDWRLFG  902
            EVFKLAVS+FKV+DW LFG
Sbjct  177  EVFKLAVSSFKVHDWSLFG  195



>gb|AES96655.2| Ran guanine nucleotide release factor-like protein [Medicago 
truncatula]
Length=203

 Score =   315 bits (807),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ D+  +RPLFGG I+STFP RFQDVS++RQVPDHQEVF DP+RDESLI ELLE K D+
Sbjct  1    MSQDVVYQRPLFGGKISSTFPNRFQDVSDIRQVPDHQEVFADPSRDESLIVELLEFKPDI  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
            AD+GSA WFLQDLA EQDAEGT+VIEQSGV+EAPGL +  +PA++TTAVGQMAISKGRQG
Sbjct  61   ADDGSAAWFLQDLAREQDAEGTVVIEQSGVLEAPGLMYNNIPAVVTTAVGQMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+VKVYLAN+R+K V  D+LITAYEPIVIN  SESA  V AG+AVPA+QAGCM M 
Sbjct  121  REAQNIVKVYLANLRVKGVDTDVLITAYEPIVINPFSESADTVGAGMAVPASQAGCMSMD  180

Query  846  EVFKLAVSTFKVNDWRLFGADR  911
            EVFKLA ++FKV DW LF A R
Sbjct  181  EVFKLAATSFKVYDWSLFDASR  202



>ref|XP_010044730.1| PREDICTED: probable ran guanine nucleotide release factor [Eucalyptus 
grandis]
 gb|KCW86832.1| hypothetical protein EUGRSUZ_B03429 [Eucalyptus grandis]
Length=202

 Score =   315 bits (806),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 172/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M  ++ SERPLFGGAI+S FP RF+DVSN+RQVPDHQEVFVDP+RDESLIFELL+ K +V
Sbjct  1    MPEELCSERPLFGGAISSKFPNRFEDVSNIRQVPDHQEVFVDPSRDESLIFELLDFKHEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D+GSA WFLQDLA EQDAE   VIEQSGVVEAPGL+++ +PA++TTAVGQMAISKGRQG
Sbjct  61   GDSGSAVWFLQDLATEQDAEQGTVIEQSGVVEAPGLTYRNIPAVVTTAVGQMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            RE QN+V+VYLAN+RLKEV  D+LI AYEPI+IN LSESA  V AG+  PA+Q+G MPMA
Sbjct  121  RETQNIVRVYLANLRLKEVGTDVLIAAYEPILINPLSESARTVGAGLTAPASQSGYMPMA  180

Query  846  EVFKLAVSTFKVNDWRLFG  902
            EVFKLA S+FKVNDW LFG
Sbjct  181  EVFKLAASSFKVNDWSLFG  199



>ref|XP_004490033.1| PREDICTED: ran guanine nucleotide release factor-like isoform 
X1 [Cicer arietinum]
 ref|XP_004490034.1| PREDICTED: ran guanine nucleotide release factor-like isoform 
X2 [Cicer arietinum]
 ref|XP_004490035.1| PREDICTED: ran guanine nucleotide release factor-like isoform 
X3 [Cicer arietinum]
Length=198

 Score =   314 bits (805),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/198 (76%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M  D+  + PLFGG I+STFP RFQDVS++R+VPDHQEVF DP+RDESLIFELLE K DV
Sbjct  1    MPQDVVYQHPLFGGKISSTFPNRFQDVSDIREVPDHQEVFADPSRDESLIFELLEFKPDV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
            ADNGSA WFLQDLA EQDAEGT+VIEQSGV++APGL++   PA++TTAVGQMAISKGRQG
Sbjct  61   ADNGSAAWFLQDLAREQDAEGTVVIEQSGVLDAPGLTYNNTPAVVTTAVGQMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+VKVYLAN+R+K V  D+LITAYEPIVIN  SESA  V AG+AVPAAQAGCM M 
Sbjct  121  REAQNIVKVYLANLRIKGVDTDVLITAYEPIVINPFSESADTVGAGMAVPAAQAGCMSMD  180

Query  846  EVFKLAVSTFKVNDWRLF  899
            EVFKLAV++FKV DW LF
Sbjct  181  EVFKLAVTSFKVYDWGLF  198



>gb|KEH19537.1| Ran guanine nucleotide release factor-like protein [Medicago 
truncatula]
Length=203

 Score =   313 bits (803),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ D+  +RPLFGG I+STFP RFQDVS++RQVPDHQEVF DP+RDESLI ELLE K D+
Sbjct  1    MSQDVVYQRPLFGGRISSTFPNRFQDVSDIRQVPDHQEVFADPSRDESLIVELLEFKPDI  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
            ADNGSA WFLQDLA EQDAEGT++IEQSGV+EAPGL +  +PA++TTAVGQMAISKGRQG
Sbjct  61   ADNGSAAWFLQDLAREQDAEGTVLIEQSGVLEAPGLMYNNIPAVVTTAVGQMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+VKVYLAN+R+K V  D+LITAYEPIVIN  SESA  V AG+AVPA+QAGC+ M 
Sbjct  121  REAQNIVKVYLANLRVKGVDTDVLITAYEPIVINPFSESADTVGAGMAVPASQAGCISMD  180

Query  846  EVFKLAVSTFKVNDWRLFGADR  911
            EVFKLA ++FKV DW LF A R
Sbjct  181  EVFKLAATSFKVYDWSLFDASR  202



>ref|XP_010652166.1| PREDICTED: ran guanine nucleotide release factor [Vitis vinifera]
Length=199

 Score =   312 bits (799),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 171/200 (86%), Gaps = 2/200 (1%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M  D YSERPLFGGAI STFP RFQD+S++RQVPDHQE FVDP RDESL+FELL+LKQDV
Sbjct  1    MPEDYYSERPLFGGAIVSTFPRRFQDLSDIRQVPDHQEAFVDPTRDESLVFELLDLKQDV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
            AD+GSA WFLQDLA EQDAEG  VIEQSGVVEA GL ++ + A++TTAVGQMAISKGRQG
Sbjct  61   ADDGSAVWFLQDLATEQDAEGFTVIEQSGVVEAGGLRYRNMAAVVTTAVGQMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+  VYLAN+RLKEV  D+LITAYEPI+IN  S+SA  V AG+ VPA Q+G MPM 
Sbjct  121  REAQNI--VYLANLRLKEVGTDVLITAYEPILINPFSDSAGTVGAGLPVPAEQSGHMPMT  178

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            EVFK+AVS+FKVNDW LFGA
Sbjct  179  EVFKMAVSSFKVNDWSLFGA  198



>ref|XP_006390983.1| hypothetical protein EUTSA_v10019150mg [Eutrema salsugineum]
 ref|XP_006390984.1| hypothetical protein EUTSA_v10019150mg [Eutrema salsugineum]
 ref|XP_006390985.1| hypothetical protein EUTSA_v10019150mg [Eutrema salsugineum]
 gb|ESQ28269.1| hypothetical protein EUTSA_v10019150mg [Eutrema salsugineum]
 gb|ESQ28270.1| hypothetical protein EUTSA_v10019150mg [Eutrema salsugineum]
 gb|ESQ28271.1| hypothetical protein EUTSA_v10019150mg [Eutrema salsugineum]
Length=203

 Score =   310 bits (794),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 175/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+++   ERPLFGGAI+S FP RFQD SN+RQVPDHQE+FVDP+RDESLIFELL+ K +V
Sbjct  1    MSLEFCPERPLFGGAISSAFPQRFQDASNIRQVPDHQELFVDPSRDESLIFELLDFKTEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             DNGSA+WFL+DLA EQDAEG  +IEQS VVEAPGLSF+ +PA++TTAVG+MAISKGRQG
Sbjct  61   GDNGSASWFLEDLAREQDAEGFKLIEQSEVVEAPGLSFRNIPAVVTTAVGEMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQNLV+VY+AN+RLK V  D L+TAYEPI+IN LSESA+AV AG+AVPA+Q+G MPM 
Sbjct  121  REAQNLVRVYVANLRLKGVETDALVTAYEPILINPLSESANAVGAGLAVPASQSGIMPMC  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            +V K ++STFKVNDW LFG+
Sbjct  181  DVIKQSLSTFKVNDWSLFGS  200



>ref|XP_010258391.1| PREDICTED: probable ran guanine nucleotide release factor [Nelumbo 
nucifera]
Length=202

 Score =   310 bits (793),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 174/200 (87%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M  D   ER LFGGAI+S F +RFQDVSN+R+VPDHQEVFVDPARDESLIFELLELK +V
Sbjct  1    MRGDDCVERFLFGGAISSFFSLRFQDVSNIREVPDHQEVFVDPARDESLIFELLELKHNV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             DN S++WFLQDLA EQDAEG++VI+QSGVVE   L ++ +PAI+TTAVGQMAISKGRQG
Sbjct  61   EDNASSSWFLQDLAVEQDAEGSVVIDQSGVVEVESLRYRNMPAIVTTAVGQMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+V+VYLAN+RLKEV  D+LITAYEPI+IN LSESA  V AG+AV AAQ+GCM MA
Sbjct  121  REAQNIVRVYLANLRLKEVNTDVLITAYEPILINPLSESARTVGAGLAVSAAQSGCMLMA  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            +VFKLAVS+FKV+DW LFGA
Sbjct  181  DVFKLAVSSFKVDDWNLFGA  200



>ref|XP_007157638.1| hypothetical protein PHAVU_002G086500g [Phaseolus vulgaris]
 gb|ESW29632.1| hypothetical protein PHAVU_002G086500g [Phaseolus vulgaris]
Length=198

 Score =   309 bits (791),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M  D+  + PLFGG I+ TFP RFQDVS++R+VP HQEVF DP RDESLI E+LE K D+
Sbjct  1    MPQDITYQHPLFGGKISCTFPNRFQDVSDIREVPGHQEVFADPNRDESLIIEVLEFKPDI  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
            ADNGSA WFLQDLA+EQDAEGT+VIEQSGV+EAPGL++   PA++TTAVGQMAISKGRQG
Sbjct  61   ADNGSAVWFLQDLASEQDAEGTLVIEQSGVLEAPGLTYYNTPAVVTTAVGQMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+VKVYLAN+RLKEV  D+L+TAYEPIVIN LSESA  V AGVAVPAAQ GC PM 
Sbjct  121  REAQNIVKVYLANLRLKEVDTDVLVTAYEPIVINPLSESADTVGAGVAVPAAQVGCTPMD  180

Query  846  EVFKLAVSTFKVNDWRLF  899
            +VFKLAV++F+V DW LF
Sbjct  181  DVFKLAVTSFRVLDWSLF  198



>ref|XP_003613697.1| Ran guanine nucleotide release factor [Medicago truncatula]
Length=402

 Score =   316 bits (809),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ D+  +RPLFGG I+STFP RFQDVS++RQVPDHQEVF DP+RDESLI ELLE K D+
Sbjct  200  MSQDVVYQRPLFGGKISSTFPNRFQDVSDIRQVPDHQEVFADPSRDESLIVELLEFKPDI  259

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
            AD+GSA WFLQDLA EQDAEGT+VIEQSGV+EAPGL +  +PA++TTAVGQMAISKGRQG
Sbjct  260  ADDGSAAWFLQDLAREQDAEGTVVIEQSGVLEAPGLMYNNIPAVVTTAVGQMAISKGRQG  319

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+VKVYLAN+R+K V  D+LITAYEPIVIN  SESA  V AG+AVPA+QAGCM M 
Sbjct  320  REAQNIVKVYLANLRVKGVDTDVLITAYEPIVINPFSESADTVGAGMAVPASQAGCMSMD  379

Query  846  EVFKLAVSTFKVNDWRLFGADR  911
            EVFKLA ++FKV DW LF A R
Sbjct  380  EVFKLAATSFKVYDWSLFDASR  401



>ref|XP_009390729.1| PREDICTED: probable ran guanine nucleotide release factor [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390730.1| PREDICTED: probable ran guanine nucleotide release factor [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390732.1| PREDICTED: probable ran guanine nucleotide release factor [Musa 
acuminata subsp. malaccensis]
Length=202

 Score =   307 bits (787),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 142/192 (74%), Positives = 169/192 (88%), Gaps = 0/192 (0%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGGAI+S FP RFQDVSN+R+VPDHQEVF DP RDESLIFELL+LK +V D GSA W
Sbjct  9    RPLFGGAISSCFPSRFQDVSNIREVPDHQEVFADPDRDESLIFELLDLKHEVGDGGSAVW  68

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVK  689
            FLQD+A EQDAE TMV+E SG +EA GL+    PAI+TTA+G+MAI+KGRQGREAQNLV+
Sbjct  69   FLQDIAREQDAEETMVLEHSGTLEAVGLTSLNGPAIVTTAIGRMAIAKGRQGREAQNLVR  128

Query  690  VYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAVS  869
            VYLAN+RLKEV+ D++ITAYEPI+IN LSESA  VRAG+A+PAAQAGC+PMAEVFKLA++
Sbjct  129  VYLANLRLKEVSTDVVITAYEPILINPLSESARTVRAGLAIPAAQAGCLPMAEVFKLAIT  188

Query  870  TFKVNDWRLFGA  905
             FK++DW LFG+
Sbjct  189  NFKIHDWSLFGS  200



>emb|CDY48395.1| BnaA07g24140D [Brassica napus]
Length=203

 Score =   306 bits (784),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            ERPLFGGAI S FP RFQD SN+RQVPDHQEVFVDP+RDESLIFELL+ K DV DNGSA+
Sbjct  9    ERPLFGGAITSAFPQRFQDASNIRQVPDHQEVFVDPSRDESLIFELLDFKSDVGDNGSAS  68

Query  507  WFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLV  686
            WFLQDLA EQDAE   +I+QS V+EAPGLSF+ +PA++T+AVG+MAISKGRQGREAQNLV
Sbjct  69   WFLQDLAREQDAEAFKLIDQSQVIEAPGLSFRNIPAVVTSAVGEMAISKGRQGREAQNLV  128

Query  687  KVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAV  866
            +VY+AN+RLK V  D+L+TAYEPI+IN LSESA+AV +G+AVPA+Q+G +PM +V K AV
Sbjct  129  RVYVANLRLKGVETDVLVTAYEPILINPLSESANAVGSGLAVPASQSGVLPMCDVIKHAV  188

Query  867  STFKVNDWRLFGA  905
            STF+VNDW LFG+
Sbjct  189  STFRVNDWSLFGS  201



>ref|XP_009104988.1| PREDICTED: probable ran guanine nucleotide release factor [Brassica 
rapa]
Length=202

 Score =   306 bits (783),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 173/200 (87%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ ++  ER LFGGAI S FP RFQD SN+RQVPDHQEVFVDP+RDESLIFELL+ K DV
Sbjct  1    MSTELCLERSLFGGAITSAFPQRFQDASNIRQVPDHQEVFVDPSRDESLIFELLDFKSDV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             DNGSA+WFLQDLA EQDAE   ++EQS V+EAPG+SF+ +PA++T+AVG+MAISKGRQG
Sbjct  61   GDNGSASWFLQDLAREQDAEAFKLVEQSQVIEAPGISFRNIPAVVTSAVGEMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQNLV+VY+AN+RLK V  D+L+TAYEPI+IN LSESA+AV +G+AVPA+Q+G +PM 
Sbjct  121  REAQNLVRVYVANLRLKGVETDVLVTAYEPILINPLSESANAVGSGLAVPASQSGVLPMC  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            +V K AVSTF+VNDW LFG+
Sbjct  181  DVIKHAVSTFRVNDWSLFGS  200



>emb|CDY04293.1| BnaC06g25220D [Brassica napus]
Length=203

 Score =   303 bits (777),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 169/193 (88%), Gaps = 0/193 (0%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            ERPLFGGAI S FP RFQD SN+RQVPDHQEVFVDP+RDESLIFELL+ K DV DNGSA+
Sbjct  9    ERPLFGGAITSAFPQRFQDASNIRQVPDHQEVFVDPSRDESLIFELLDFKSDVGDNGSAS  68

Query  507  WFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLV  686
            WFLQDLA EQDAE   +I+QS V+EAPGLSF+ +PA++T+AVG+MAISKGRQGR+AQNLV
Sbjct  69   WFLQDLAREQDAEAFKLIDQSQVIEAPGLSFRNIPAVVTSAVGEMAISKGRQGRDAQNLV  128

Query  687  KVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAV  866
            +VY+AN+RLK V  D+L+TAYEPI+IN LSESA+AV +G+AVPA+Q+G  PM +V K AV
Sbjct  129  RVYVANLRLKGVETDVLVTAYEPILINPLSESANAVGSGLAVPASQSGISPMCDVIKHAV  188

Query  867  STFKVNDWRLFGA  905
            STF+VNDW LFG+
Sbjct  189  STFRVNDWSLFGS  201



>ref|XP_010551533.1| PREDICTED: ran guanine nucleotide release factor [Tarenaya hassleriana]
 ref|XP_010551534.1| PREDICTED: ran guanine nucleotide release factor [Tarenaya hassleriana]
Length=203

 Score =   303 bits (777),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 175/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ D+ ++RPLFGGAI+S FP RFQDVSNVRQVPD+QEVFVDPARDESLIFELL+ K DV
Sbjct  1    MSADICTDRPLFGGAISSAFPNRFQDVSNVRQVPDNQEVFVDPARDESLIFELLDFKHDV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             DNGSA WFLQDLA EQDAE   ++EQSG++EAPGLS++ +P+++TTAVG+MAISKGRQG
Sbjct  61   GDNGSAAWFLQDLAREQDAENFALMEQSGIMEAPGLSYRNIPSVVTTAVGEMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+V++Y+AN+RLK V+ D+LITA+EPI+IN LSESA+ V AG+AVPAA+ G MP+ 
Sbjct  121  REAQNIVRLYVANLRLKGVSTDVLITAHEPILINPLSESANTVGAGLAVPAAELGFMPVG  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            E  K AVS+FKV+DW LFG+
Sbjct  181  EAIKGAVSSFKVHDWSLFGS  200



>ref|NP_564972.1| Mog1/PsbP/DUF1795-like photosystem II reaction center PsbP family 
protein [Arabidopsis thaliana]
 gb|AAK59847.1| At1g69680/T6C23_12 [Arabidopsis thaliana]
 gb|AAL76126.1| At1g69680/T6C23_12 [Arabidopsis thaliana]
 gb|AAM65567.1| unknown [Arabidopsis thaliana]
 gb|AEE34962.1| Mog1/PsbP/DUF1795-like photosystem II reaction center PsbP family 
protein [Arabidopsis thaliana]
Length=202

 Score =   303 bits (775),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 174/200 (87%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+V++ S RPLFGGAI++ FP RFQDVSN+RQVPDHQEVFVDP+RDESLIFELL+ K +V
Sbjct  1    MSVELCSVRPLFGGAISTVFPQRFQDVSNIRQVPDHQEVFVDPSRDESLIFELLDFKAEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D GSA+WFL DLA+EQDAEG  +IEQS V+EAPGLSF+ + A+ TTA+G+MAISKGRQG
Sbjct  61   GDIGSASWFLNDLASEQDAEGFQLIEQSEVIEAPGLSFRNISAVATTAIGEMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQNLV+VY+AN+RLK V  D+L+TAYEPI+IN LSESA AV +G+AVPA+Q+G MPM 
Sbjct  121  REAQNLVRVYVANIRLKGVDTDVLVTAYEPILINPLSESADAVGSGLAVPASQSGKMPMC  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            ++ K ++STFKVNDW LFG+
Sbjct  181  DIIKQSLSTFKVNDWNLFGS  200



>ref|XP_002887249.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63508.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=202

 Score =   302 bits (774),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 173/200 (87%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ ++ S RPLFGGAI++ FP RFQDVSN+RQVPDHQEVFVDP+RDESLIFELL+ K +V
Sbjct  1    MSGELCSVRPLFGGAISTVFPQRFQDVSNIRQVPDHQEVFVDPSRDESLIFELLDFKTEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D GSA+WFL DLA EQDAEG  +IEQS V+EAPGLSF+ +PAI TTA+G+MAISKGRQG
Sbjct  61   GDIGSASWFLNDLAREQDAEGFQLIEQSEVIEAPGLSFRNIPAIATTAIGEMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQNLV+VY+AN+RLK V  D+L+TAYEPI+IN LS+SA AV +G+AVPA+Q+G MPM 
Sbjct  121  REAQNLVRVYVANLRLKGVDTDVLVTAYEPILINPLSKSADAVGSGLAVPASQSGIMPMC  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            +V K ++STFKVNDW LFG+
Sbjct  181  DVIKQSLSTFKVNDWNLFGS  200



>emb|CDX95907.1| BnaA07g28240D [Brassica napus]
Length=202

 Score =   302 bits (774),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 172/200 (86%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ ++  ERPLFGGAI+S FP RFQD SN+RQVPDHQEVFVDP+RDESLIFELL+ K DV
Sbjct  1    MSNELCPERPLFGGAISSAFPQRFQDASNIRQVPDHQEVFVDPSRDESLIFELLDFKPDV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D GSA+WFL DLA EQDA+G  +IEQS V++ PGLS++ +PAI TTA+G+MAISKGRQG
Sbjct  61   GDIGSASWFLHDLAREQDAQGFKLIEQSHVIDVPGLSYRNIPAIATTAIGEMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQNL+KVY+AN+RLK V  D+L+TAYEPI+IN LSESA+AV +G+AVPA+Q+G MPM 
Sbjct  121  REAQNLLKVYVANIRLKGVETDVLVTAYEPILINPLSESANAVGSGLAVPASQSGIMPMC  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            +V K ++STFKVNDW LFG+
Sbjct  181  DVIKQSLSTFKVNDWSLFGS  200



>ref|XP_009105522.1| PREDICTED: probable ran guanine nucleotide release factor [Brassica 
rapa]
Length=202

 Score =   302 bits (774),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 172/200 (86%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ ++  ERPLFGGAI+S FP RFQD SN+RQVPDHQEVFVDP+RDESLIFELL+ K DV
Sbjct  1    MSNELCPERPLFGGAISSAFPQRFQDASNIRQVPDHQEVFVDPSRDESLIFELLDFKPDV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D GSA+WFL DLA EQDA+G  +IEQS V++ PGLS++ +PAI TTA+G+MAISKGRQG
Sbjct  61   GDVGSASWFLHDLAREQDAQGFKLIEQSHVIDVPGLSYRNIPAIATTAIGEMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQNL+KVY+AN+RLK V  D+L+TAYEPI+IN LSESA+AV +G+AVPA+Q+G MPM 
Sbjct  121  REAQNLLKVYVANIRLKGVETDVLVTAYEPILINPLSESANAVGSGLAVPASQSGIMPMC  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            +V K ++STFKVNDW LFG+
Sbjct  181  DVIKQSLSTFKVNDWSLFGS  200



>emb|CDY66733.1| BnaC06g43570D [Brassica napus]
Length=202

 Score =   300 bits (767),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 172/200 (86%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ ++  ERPLFGGAI+S FP RFQD SN+RQVPDHQEVFVDP+RDESLIFELL+ K DV
Sbjct  1    MSNELCPERPLFGGAISSAFPQRFQDASNIRQVPDHQEVFVDPSRDESLIFELLDFKTDV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D GSA+WFL DLA EQDA+G  +IEQS V++ PGLS++ +P++ TTA+G+MAISKGRQG
Sbjct  61   GDVGSASWFLHDLAREQDAQGFKLIEQSNVIDVPGLSYRNIPSVATTAIGEMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQNL+KVY+AN+RLK V  D+L+TAYEPI+IN LSESA+AV +G+AVPA+Q+G MPM 
Sbjct  121  REAQNLLKVYVANIRLKGVETDVLVTAYEPILINPLSESANAVGSGLAVPASQSGIMPMC  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            +V K ++STFKV+DW LFG+
Sbjct  181  DVIKQSLSTFKVDDWSLFGS  200



>ref|XP_010512019.1| PREDICTED: probable ran guanine nucleotide release factor [Camelina 
sativa]
 ref|XP_010512020.1| PREDICTED: probable ran guanine nucleotide release factor [Camelina 
sativa]
 ref|XP_010512021.1| PREDICTED: probable ran guanine nucleotide release factor [Camelina 
sativa]
Length=202

 Score =   299 bits (765),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 173/200 (87%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ ++ S RPLFGGAI++ FP RF+DVS++RQVPDHQEVFVDP+RDESLIFELL+ K +V
Sbjct  1    MSSELCSMRPLFGGAISTVFPQRFEDVSDIRQVPDHQEVFVDPSRDESLIFELLDFKTEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D GSA+WFL DLA EQDAEG  +IEQS V+EAPGLS++ +PA+ TTA+G+MAISKGRQG
Sbjct  61   GDIGSASWFLNDLAREQDAEGFQLIEQSEVIEAPGLSYRNIPAVATTAIGEMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQNLV+VY+AN+RLK V  D+L+TAYEPI+IN LSESA AV +G+AVPA+Q+G MPM 
Sbjct  121  REAQNLVRVYVANLRLKGVDTDVLVTAYEPILINPLSESADAVGSGLAVPASQSGKMPMR  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            +V K ++STFKVNDW LFG+
Sbjct  181  DVIKQSLSTFKVNDWNLFGS  200



>ref|XP_010937086.1| PREDICTED: ran guanine nucleotide release factor isoform X1 [Elaeis 
guineensis]
 ref|XP_010937087.1| PREDICTED: ran guanine nucleotide release factor isoform X1 [Elaeis 
guineensis]
 ref|XP_010937088.1| PREDICTED: ran guanine nucleotide release factor isoform X1 [Elaeis 
guineensis]
Length=202

 Score =   298 bits (763),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGGAI S FP RFQDVSN+R+VP+HQEVF DP+RDES IFELL+LK++V DNGSA W
Sbjct  9    RPLFGGAITSCFPPRFQDVSNIREVPNHQEVFADPSRDESFIFELLDLKREVGDNGSAVW  68

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVK  689
            FL+D+ANEQDA  TMV+E SG +EA GL     P I+TTAVG+MA++KGRQGREAQNLV+
Sbjct  69   FLRDIANEQDAAETMVLEHSGTLEAVGLGCGGGPTIVTTAVGKMALTKGRQGREAQNLVR  128

Query  690  VYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAVS  869
            VYLAN+RLKEV+ D+LITAYEPI+IN LSESA +V AG AVPAAQ+GC+P+AEVFKLAV+
Sbjct  129  VYLANLRLKEVSTDVLITAYEPILINPLSESARSVGAGPAVPAAQSGCLPVAEVFKLAVT  188

Query  870  TFKVNDWRLFGA  905
             FKV+DW LFG+
Sbjct  189  NFKVHDWSLFGS  200



>ref|XP_006302839.1| hypothetical protein CARUB_v10020969mg [Capsella rubella]
 gb|EOA35737.1| hypothetical protein CARUB_v10020969mg [Capsella rubella]
Length=202

 Score =   297 bits (761),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 173/200 (87%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ ++ S RPLFGGAI++ FP RF+DVSN+RQVPDHQEVFVDP+RDESLIFELL+ K +V
Sbjct  1    MSGELCSVRPLFGGAISTAFPQRFEDVSNIRQVPDHQEVFVDPSRDESLIFELLDFKTEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D GSA+WFL DLA+EQDAEG  +IEQS V+EAPGLS++ +PA+ TTA+G+MAISKGRQG
Sbjct  61   GDIGSASWFLNDLASEQDAEGFQLIEQSEVIEAPGLSYRNIPAVATTAIGEMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQNLV+VY+AN+RLK V  D+L+TAYEPI+IN LSESA AV +G+AVPA+Q+G M M 
Sbjct  121  REAQNLVRVYVANLRLKGVDTDVLVTAYEPILINPLSESADAVGSGLAVPASQSGKMQMC  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            +V K ++STFKVNDW LFG+
Sbjct  181  DVIKQSLSTFKVNDWSLFGS  200



>ref|XP_010470965.1| PREDICTED: probable ran guanine nucleotide release factor [Camelina 
sativa]
 ref|XP_010470966.1| PREDICTED: probable ran guanine nucleotide release factor [Camelina 
sativa]
Length=202

 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 171/200 (86%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ ++ S RPLFGGAI++ FP RF++VSN+RQVPDHQEVFVDP+RDESLIFELL+ K +V
Sbjct  1    MSGELCSMRPLFGGAISTVFPQRFENVSNIRQVPDHQEVFVDPSRDESLIFELLDFKTEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D GSA+WFL DLA EQDAEG  +IEQS V+E PGLS++ +PA+ TTA+G+MAISKGRQG
Sbjct  61   GDIGSASWFLNDLAREQDAEGFQLIEQSEVIETPGLSYRNIPAVATTAIGEMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQNLV+VY+AN+RLK V  D+L+TAYEPI+IN LSESA AV +G+AVPA+Q+G MPM 
Sbjct  121  REAQNLVRVYVANLRLKGVDTDVLVTAYEPILINPLSESADAVGSGLAVPASQSGKMPMC  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
             V K ++STFKVNDW LFG+
Sbjct  181  NVIKQSLSTFKVNDWNLFGS  200



>ref|XP_006827195.1| hypothetical protein AMTR_s00010p00257970 [Amborella trichopoda]
 gb|ERM94432.1| hypothetical protein AMTR_s00010p00257970 [Amborella trichopoda]
Length=200

 Score =   296 bits (758),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 164/198 (83%), Gaps = 0/198 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ D   ERPLFGGAI+S FP RFQDVSN+RQVPDHQEVFVDP RDES+IFELL+LK+DV
Sbjct  1    MSNDPCFERPLFGGAISSAFPNRFQDVSNIRQVPDHQEVFVDPNRDESIIFELLDLKRDV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D+GSA WFLQDLA EQDAEG++VIE +G VE   L    L A+ITTAVGQMAISKGRQG
Sbjct  61   EDSGSALWFLQDLATEQDAEGSLVIEHTGTVEPRELQHNDLQAVITTAVGQMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQNLV+VYLAN+RLK+V  D+LITAYEPI+IN LSESA  V AG A  AAQ GCMP  
Sbjct  121  REAQNLVRVYLANLRLKQVATDVLITAYEPIIINPLSESARTVGAGPAASAAQFGCMPAF  180

Query  846  EVFKLAVSTFKVNDWRLF  899
            +VFKLAV +FKV+DW LF
Sbjct  181  DVFKLAVPSFKVHDWNLF  198



>gb|EYU28737.1| hypothetical protein MIMGU_mgv1a014034mg [Erythranthe guttata]
Length=203

 Score =   296 bits (757),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 172/200 (86%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M  D  + RPLFGGAI STFP RF+DVS VRQVPDHQE FVDPARDESLI ELL+LK DV
Sbjct  1    MPEDFCTHRPLFGGAITSTFPRRFEDVSIVRQVPDHQEAFVDPARDESLIIELLDLKTDV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
            AD GSATWFLQDLA EQDAEGTMV+EQSGV EA G+ F+ +PAIITTAVGQMAISKGRQG
Sbjct  61   ADQGSATWFLQDLATEQDAEGTMVLEQSGVFEADGVRFRGIPAIITTAVGQMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            R+AQN+VKVYLAN+RLK V  D+LITAYEPI+IN  SE+A+AV AGVAVPA Q+GCMPM 
Sbjct  121  RDAQNVVKVYLANLRLKGVATDVLITAYEPILINAASETAAAVGAGVAVPAEQSGCMPMR  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            +VF  AV++FKVNDW LFG+
Sbjct  181  QVFTSAVTSFKVNDWNLFGS  200



>ref|XP_004290499.1| PREDICTED: ran guanine nucleotide release factor-like [Fragaria 
vesca subsp. vesca]
Length=203

 Score =   295 bits (755),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 171/201 (85%), Gaps = 1/201 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSN-VRQVPDHQEVFVDPARDESLIFELLELKQD  482
            MA + YS+  LFGGAI+S FP RFQDVS+ VR+VPDHQE FVDPARDESLIFELL+LK +
Sbjct  1    MAQEKYSQHSLFGGAISSLFPDRFQDVSDDVREVPDHQEAFVDPARDESLIFELLDLKPE  60

Query  483  VADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQ  662
            V DNGSATWFLQDLA EQ+AEG+++IEQSGVVE PGLS+  +PA++TTAVGQMAISK RQ
Sbjct  61   VGDNGSATWFLQDLATEQEAEGSVLIEQSGVVEVPGLSYGNIPAVVTTAVGQMAISKERQ  120

Query  663  GREAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPM  842
            GR+AQN V+VY+AN+RLK V+ D+LITAYEPI IN LSESAS V +  A PA  +G +PM
Sbjct  121  GRDAQNTVRVYVANLRLKGVSTDVLITAYEPIHINPLSESASTVGSSNAAPALHSGHVPM  180

Query  843  AEVFKLAVSTFKVNDWRLFGA  905
             EVF+LA+S+FKV+DW LFG+
Sbjct  181  VEVFRLAISSFKVSDWNLFGS  201



>ref|XP_011038454.1| PREDICTED: probable ran guanine nucleotide release factor isoform 
X2 [Populus euphratica]
Length=197

 Score =   295 bits (754),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 168/199 (84%), Gaps = 3/199 (2%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M  D+ ++RPL+GG+I+STFPVRFQDVSN+RQVPDHQE FVDP+RDESLIFELL+LK DV
Sbjct  1    MTEDICTDRPLYGGSISSTFPVRFQDVSNIRQVPDHQEAFVDPSRDESLIFELLDLKPDV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
            +DNGSA WFLQDLANEQDA+G  ++EQSGVVE P      +  ++TTA+GQM ISK RQG
Sbjct  61   SDNGSAVWFLQDLANEQDAQGFTLVEQSGVVEVP---IGNVSVVVTTAIGQMGISKVRQG  117

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+V+VYLAN+RLK V  D+L+ AYEPI+I+ LSESA+ V AG+  PAAQ+G +PMA
Sbjct  118  REAQNVVQVYLANLRLKNVGTDVLVVAYEPILISPLSESAATVGAGLPAPAAQSGFLPMA  177

Query  846  EVFKLAVSTFKVNDWRLFG  902
            EVFKLAVS FKVNDW LFG
Sbjct  178  EVFKLAVSNFKVNDWNLFG  196



>ref|XP_002319123.1| hypothetical protein POPTR_0013s04750g [Populus trichocarpa]
 gb|ABK93471.1| unknown [Populus trichocarpa]
 gb|EEE95046.1| hypothetical protein POPTR_0013s04750g [Populus trichocarpa]
Length=197

 Score =   294 bits (753),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 167/199 (84%), Gaps = 3/199 (2%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M  D+ ++RPL+GG+I+STFPVRFQDVSN+RQVPDHQE FVDP+RDESLIFELL+LK DV
Sbjct  1    MPEDICTDRPLYGGSISSTFPVRFQDVSNIRQVPDHQEAFVDPSRDESLIFELLDLKPDV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             DNGSA WFLQDLANEQDA+G  ++EQSGVVE P      +  ++TTA+GQM ISK RQG
Sbjct  61   NDNGSAVWFLQDLANEQDAQGFTLVEQSGVVEVP---IGNVSVVVTTAIGQMGISKARQG  117

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+V+VYLAN+RLK V  D+L+ AYEPI+I+ LSESA+ V AG+  PAAQ+G +PMA
Sbjct  118  REAQNVVQVYLANLRLKNVGTDVLVVAYEPILISPLSESAATVGAGLPAPAAQSGFLPMA  177

Query  846  EVFKLAVSTFKVNDWRLFG  902
            EVFKLAVS FKVNDW LFG
Sbjct  178  EVFKLAVSNFKVNDWNLFG  196



>ref|XP_010421615.1| PREDICTED: probable ran guanine nucleotide release factor isoform 
X2 [Camelina sativa]
 ref|XP_010421616.1| PREDICTED: probable ran guanine nucleotide release factor isoform 
X2 [Camelina sativa]
Length=202

 Score =   293 bits (749),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 170/200 (85%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ ++ S RPLFGGAI++ FP RF+DVS++RQVPDHQEVFVDP+RDESLIFELL+ K +V
Sbjct  1    MSGELCSMRPLFGGAISTVFPQRFEDVSDIRQVPDHQEVFVDPSRDESLIFELLDFKTEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D GSA+WFL DLA EQDAEG  +IEQS V+E  GLS++ +PA+ TTA+G+MAISKGRQG
Sbjct  61   GDIGSASWFLNDLAREQDAEGFQLIEQSEVIETTGLSYRNIPAVATTAIGEMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQNLV+VY+AN+RLK V  D+L+T YEPI+IN LSESA AV +G+AVPA+Q+G MPM 
Sbjct  121  REAQNLVRVYVANLRLKGVDTDVLVTTYEPILINPLSESADAVGSGLAVPASQSGKMPMC  180

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            +V K ++STFKVNDW LFG+
Sbjct  181  DVIKQSLSTFKVNDWNLFGS  200



>ref|XP_010421613.1| PREDICTED: probable ran guanine nucleotide release factor isoform 
X1 [Camelina sativa]
 ref|XP_010421614.1| PREDICTED: probable ran guanine nucleotide release factor isoform 
X1 [Camelina sativa]
Length=217

 Score =   293 bits (749),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 170/200 (85%), Gaps = 0/200 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ ++ S RPLFGGAI++ FP RF+DVS++RQVPDHQEVFVDP+RDESLIFELL+ K +V
Sbjct  16   MSGELCSMRPLFGGAISTVFPQRFEDVSDIRQVPDHQEVFVDPSRDESLIFELLDFKTEV  75

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D GSA+WFL DLA EQDAEG  +IEQS V+E  GLS++ +PA+ TTA+G+MAISKGRQG
Sbjct  76   GDIGSASWFLNDLAREQDAEGFQLIEQSEVIETTGLSYRNIPAVATTAIGEMAISKGRQG  135

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQNLV+VY+AN+RLK V  D+L+T YEPI+IN LSESA AV +G+AVPA+Q+G MPM 
Sbjct  136  REAQNLVRVYVANLRLKGVDTDVLVTTYEPILINPLSESADAVGSGLAVPASQSGKMPMC  195

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            +V K ++STFKVNDW LFG+
Sbjct  196  DVIKQSLSTFKVNDWNLFGS  215



>ref|XP_011036366.1| PREDICTED: probable ran guanine nucleotide release factor [Populus 
euphratica]
Length=199

 Score =   285 bits (730),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 168/200 (84%), Gaps = 4/200 (2%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M  D+ ++RPLFGGAI+STFPVRFQDVSN+RQVPDHQEVF +P+RDESL+FELL+LK D+
Sbjct  1    MPEDISTDRPLFGGAISSTFPVRFQDVSNIRQVPDHQEVFAEPSRDESLVFELLDLKPDI  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             DNGSA WFLQDLANEQ+A+G  ++ QSGVVE P        A++TTA+GQM ISKGRQG
Sbjct  61   NDNGSAVWFLQDLANEQEAQGFTLVHQSGVVEVP---IGDSSALVTTAIGQMGISKGRQG  117

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+V+VYLAN+RLK    D+L+ A+EPI+I+ LSESASAV  G+ +PAAQ+G +PM+
Sbjct  118  REAQNVVRVYLANLRLKNAGTDVLVVAHEPILISPLSESASAVGPGL-LPAAQSGFLPMS  176

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            EVFK+AVS+FKVNDW LFG 
Sbjct  177  EVFKVAVSSFKVNDWSLFGG  196



>ref|XP_008808045.1| PREDICTED: probable ran guanine nucleotide release factor isoform 
X1 [Phoenix dactylifera]
 ref|XP_008808046.1| PREDICTED: probable ran guanine nucleotide release factor isoform 
X1 [Phoenix dactylifera]
Length=202

 Score =   284 bits (727),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 164/192 (85%), Gaps = 0/192 (0%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGGAI S FP RFQDVSN+R+VPDHQEVF DP+RDESLIFELL+LK +V D+GSA W
Sbjct  9    RPLFGGAITSCFPPRFQDVSNIREVPDHQEVFADPSRDESLIFELLDLKHEVGDDGSAVW  68

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVK  689
            FL+DLANEQDA  TMV+E SG +EA GL +   P I+  AVGQMAISKGRQGREAQNLV+
Sbjct  69   FLRDLANEQDAAETMVLEHSGTLEAVGLGYGGGPTIVKMAVGQMAISKGRQGREAQNLVR  128

Query  690  VYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAVS  869
            VYLAN+RLKEV+ D+LITA+EPI+IN LSESA  V AG AV AAQ+GC+P+AEVFKLAV+
Sbjct  129  VYLANLRLKEVSTDVLITAHEPILINPLSESARTVGAGPAVAAAQSGCLPVAEVFKLAVT  188

Query  870  TFKVNDWRLFGA  905
             FKV+DW LFG+
Sbjct  189  NFKVHDWSLFGS  200



>ref|XP_004975846.1| PREDICTED: probable ran guanine nucleotide release factor-like 
[Setaria italica]
Length=202

 Score =   283 bits (723),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            MA +    RPLFGGAI++ FP RFQDVSN+R+VPDHQEVFVDPARDESLIFELL+LK +V
Sbjct  1    MAGESCVPRPLFGGAISTAFPARFQDVSNIREVPDHQEVFVDPARDESLIFELLDLKGEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D GSA WFL+D+ANEQDA   +V+E SG +E  GL     PA+  T+VGQ+A+SKGRQG
Sbjct  61   DDAGSALWFLRDIANEQDAADNLVVEHSGTLELAGLRLGEAPAVAGTSVGQLAVSKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+V++YLAN+R+K    D+LITAYEP++IN LSESA+AV AG A+PA QAGC+PM+
Sbjct  121  REAQNIVRLYLANIRIKNAATDVLITAYEPLLINPLSESATAVAAGPAIPAEQAGCLPMS  180

Query  846  EVFKLAVSTFKVNDWRLF  899
            E+FKLAV  F V+DW LF
Sbjct  181  EIFKLAVMNFNVHDWNLF  198



>ref|XP_003579899.1| PREDICTED: probable ran guanine nucleotide release factor [Brachypodium 
distachyon]
Length=202

 Score =   281 bits (720),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            MAV+  + RPLFGGAI+S+FP RFQDVSN+R+VPDHQEVFVDPARDESLIFELL+LK +V
Sbjct  1    MAVESSTRRPLFGGAISSSFPFRFQDVSNIREVPDHQEVFVDPARDESLIFELLDLKGEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D GSA WFL+D+ANEQDA   MVIE SG V+  GL      A+  TA+G++A+SKGRQG
Sbjct  61   EDGGSALWFLRDVANEQDAGDDMVIEHSGTVQLAGLRDGEASAVAGTAIGKLAVSKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+V+VYLAN+RLK    D++ITAYEP++IN LSES  AV AG AVPA +AGC+PM+
Sbjct  121  REAQNIVRVYLANLRLKNAATDVVITAYEPLLINPLSESTQAVAAGSAVPAEEAGCLPMS  180

Query  846  EVFKLAVSTFKVNDWRLF  899
            EVF+LAV  F V+DW LF
Sbjct  181  EVFRLAVMNFDVHDWNLF  198



>ref|NP_001131660.1| uncharacterized protein LOC100193020 [Zea mays]
 gb|ACG39132.1| RAN guanine nucleotide release factor [Zea mays]
Length=202

 Score =   277 bits (709),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 157/198 (79%), Gaps = 0/198 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            MA +    +PLFGGAI +TFP RFQDVSN+R+VPDHQEV VDP+RDESLIFELL+LK +V
Sbjct  1    MAGESCVPKPLFGGAIFTTFPDRFQDVSNIREVPDHQEVLVDPSRDESLIFELLDLKGEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D GSA WFLQD+ANEQDA   +V+E SG +E   L     PA+  TAVGQ+A+SKGRQG
Sbjct  61   DDAGSALWFLQDIANEQDAGDNLVVEHSGTLELAALHLGEAPAVAATAVGQLAVSKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+V++YLAN+RLK    D+LITAYEP++IN LSESA AV AG A+PA Q GC+PM+
Sbjct  121  REAQNIVRIYLANIRLKNAATDVLITAYEPLLINPLSESAVAVAAGPAIPAEQVGCLPMS  180

Query  846  EVFKLAVSTFKVNDWRLF  899
            EVFKLAV+ F V DW LF
Sbjct  181  EVFKLAVTNFNVRDWNLF  198



>ref|XP_003558963.1| PREDICTED: probable ran guanine nucleotide release factor [Brachypodium 
distachyon]
Length=202

 Score =   276 bits (707),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            MA +  + R LFGGAI+STFPVRFQDVSN+R+VPDHQEVFVDP+RDESLIFELL+LK +V
Sbjct  1    MASESSTRRLLFGGAISSTFPVRFQDVSNIREVPDHQEVFVDPSRDESLIFELLDLKGEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D GSA WFL+D+ANEQDA  +MV+E SG V+  GL       +  TA+G++A+SKGRQG
Sbjct  61   EDGGSALWFLRDVANEQDAGDSMVVEHSGTVQLAGLRVGEASVVAGTAIGKLAVSKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+++VYLAN+RLK    D++ITAYEP++IN LSESA  V AG AVPA +AGC+PM+
Sbjct  121  REAQNIIRVYLANIRLKNAATDVVITAYEPLLINPLSESAQEVAAGPAVPAEEAGCLPMS  180

Query  846  EVFKLAVSTFKVNDWRLF  899
            EVF+LAV  F V+DW LF
Sbjct  181  EVFRLAVMNFDVHDWNLF  198



>ref|NP_001052985.1| Os04g0459600 [Oryza sativa Japonica Group]
 emb|CAD40907.1| OSJNBa0036B21.25 [Oryza sativa Japonica Group]
 emb|CAE01533.1| OSJNBa0072F16.2 [Oryza sativa Japonica Group]
 dbj|BAF14899.1| Os04g0459600 [Oryza sativa Japonica Group]
 emb|CAH67077.1| OSIGBa0097P08.7 [Oryza sativa Indica Group]
 emb|CAH67445.1| H0219H12.2 [Oryza sativa Indica Group]
 dbj|BAG87979.1| unnamed protein product [Oryza sativa Japonica Group]
 emb|CBW45780.1| ORW1943Ba0077G13.8 [Oryza rufipogon]
Length=202

 Score =   276 bits (706),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 164/198 (83%), Gaps = 0/198 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ +  + RPLFGGAI+STFPVRFQDVSN+RQVPDHQEVFVDPARDESLIFELL+LK +V
Sbjct  1    MSGERCAGRPLFGGAISSTFPVRFQDVSNIRQVPDHQEVFVDPARDESLIFELLDLKGEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D GSA WFL+D+ANEQDA   +V+E SG +E  GL F   PA+  TAVGQ+AISKGRQG
Sbjct  61   EDGGSALWFLRDIANEQDAGDNLVVEHSGTIELGGLRFGDAPAVAGTAVGQLAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+V++YLAN+RLK    D++ITAYEP++IN LSESASAV AG AVPA QAGC+ M+
Sbjct  121  REAQNIVRLYLANIRLKNAATDVVITAYEPLLINPLSESASAVAAGPAVPAEQAGCLAMS  180

Query  846  EVFKLAVSTFKVNDWRLF  899
            E+FKLAV  F V+DW LF
Sbjct  181  EIFKLAVMNFNVHDWNLF  198



>ref|XP_002447961.1| hypothetical protein SORBIDRAFT_06g018890 [Sorghum bicolor]
 gb|EES12289.1| hypothetical protein SORBIDRAFT_06g018890 [Sorghum bicolor]
Length=202

 Score =   275 bits (704),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 157/198 (79%), Gaps = 0/198 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            MA +    RPLFGGAI++TFP RFQDVS++R+VPDHQEV  DP+RDESL+FELL+LK +V
Sbjct  1    MAAESCVPRPLFGGAISTTFPARFQDVSDIREVPDHQEVLFDPSRDESLVFELLDLKGEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D GSA WFL+D+ANEQDA   +V+E SG +E   L     P +  TAVGQMA+SKGRQG
Sbjct  61   DDAGSALWFLRDIANEQDAGDNLVVEHSGTLELAALRLGEAPVVAATAVGQMAVSKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+V++YLAN+RLK    D+LITAYEP++IN LSES +AV AG A+PA QAGC+PM+
Sbjct  121  REAQNIVRLYLANIRLKSAATDVLITAYEPLLINPLSESTAAVAAGPAIPAEQAGCLPMS  180

Query  846  EVFKLAVSTFKVNDWRLF  899
            E+FKLAV  F V+DW LF
Sbjct  181  EIFKLAVMNFNVHDWNLF  198



>ref|XP_002870395.1| hypothetical protein ARALYDRAFT_355491 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46654.1| hypothetical protein ARALYDRAFT_355491 [Arabidopsis lyrata subsp. 
lyrata]
Length=184

 Score =   271 bits (693),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ ++ S RPLFGGAI++ FP RFQDVSN+RQV DHQEVFVDP+RDESLIFELL+ K +V
Sbjct  1    MSGELCSVRPLFGGAISTFFPQRFQDVSNIRQVSDHQEVFVDPSRDESLIFELLDFKTEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D GSA+WFL DLA EQDAEG ++IEQS V+EAPGLSF+ +PAI TTA+G+MAISKGRQG
Sbjct  61   GDIGSASWFLNDLAREQDAEGFLLIEQSEVIEAPGLSFRNIPAIGTTAIGEMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQNLV+VY+AN+RLK +  D+L+TAYEPI+IN LSES  AV +G+ VPA+Q+G MPM 
Sbjct  121  REAQNLVRVYVANLRLKGIDTDVLVTAYEPILINPLSESVDAVGSGLVVPASQSGIMPMC  180

Query  846  EVFK  857
            +V K
Sbjct  181  DVIK  184



>gb|ABK22676.1| unknown [Picea sitchensis]
Length=205

 Score =   271 bits (693),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 153/192 (80%), Gaps = 0/192 (0%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            ERPLFGGAIA TFP RFQD+SN+R+VPDHQEVF DP RDESLI ELL+LK DVADN SA+
Sbjct  13   ERPLFGGAIACTFPQRFQDLSNIREVPDHQEVFADPNRDESLIVELLDLKHDVADNQSAS  72

Query  507  WFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLV  686
            WFLQDLANEQD+ G +V+E   VV    + F     ++T  VGQMA+SKGRQGREA N+V
Sbjct  73   WFLQDLANEQDSAGDLVVESVSVVAPSDVPFLDPATVVTAVVGQMAVSKGRQGREACNIV  132

Query  687  KVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAV  866
            +VYLAN+RLK V  D+LITAYEP++I+ LSESA+ V  G  VPAA  GCMP+ E FKL +
Sbjct  133  RVYLANIRLKGVGTDVLITAYEPLMISALSESAATVGPGAPVPAAATGCMPVVEAFKLCL  192

Query  867  STFKVNDWRLFG  902
            +TFK+++WRLFG
Sbjct  193  ATFKIHNWRLFG  204



>gb|EEC77400.1| hypothetical protein OsI_16161 [Oryza sativa Indica Group]
Length=202

 Score =   269 bits (688),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 162/198 (82%), Gaps = 0/198 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ +  + RPLFGGAI+STFPVRFQDVS +RQVP+HQEVFVDPARD SLIFELL+LK +V
Sbjct  1    MSGERCAGRPLFGGAISSTFPVRFQDVSKIRQVPEHQEVFVDPARDGSLIFELLDLKGEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D GSA WFL+D+ANEQDA   +V+E SG +E  GL F   PA+  TAVGQ+AISKGRQG
Sbjct  61   EDGGSALWFLRDIANEQDAGDNLVVEHSGTIELGGLRFGDAPAVAGTAVGQLAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+V++YLAN+RLK    D++ITAYEP++IN LSESASAV AG AVPA QAGC+ M+
Sbjct  121  REAQNIVRLYLANIRLKNAATDVVITAYEPLLINPLSESASAVAAGPAVPAEQAGCLAMS  180

Query  846  EVFKLAVSTFKVNDWRLF  899
            E+FKLAV  F V+DW LF
Sbjct  181  EIFKLAVMNFNVHDWNLF  198



>ref|XP_006652371.1| PREDICTED: probable ran guanine nucleotide release factor-like 
[Oryza brachyantha]
Length=202

 Score =   269 bits (687),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGGA+++ FPVRFQDVSN+R+VPDHQEVFVDPARDESLIFELL+LK +V D GSA W
Sbjct  9    RPLFGGALSTAFPVRFQDVSNIREVPDHQEVFVDPARDESLIFELLDLKGEVEDAGSALW  68

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVK  689
            FL+D+ANEQDA   +V+E SG +E  GL F   PA+  TAVGQ+A+SKGRQGREAQN+V+
Sbjct  69   FLRDIANEQDAGDNLVVEHSGTLELAGLRFGDTPAVAETAVGQLAVSKGRQGREAQNIVR  128

Query  690  VYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAVS  869
            +YLAN+RLK    D++ITAYEP++IN LSES++AV AG AVPA QAGC+PM+E+FKLAV 
Sbjct  129  LYLANIRLKNAATDVVITAYEPLLINPLSESSTAVAAGPAVPAEQAGCLPMSEIFKLAVM  188

Query  870  TFKVNDWRLF  899
             F V+DW LF
Sbjct  189  NFNVHDWNLF  198



>gb|KCW86831.1| hypothetical protein EUGRSUZ_B03429 [Eucalyptus grandis]
Length=182

 Score =   268 bits (685),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 153/199 (77%), Gaps = 20/199 (10%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M  ++ SERPLFGGAI+S FP RF+DVSN+RQVPDHQ                     +V
Sbjct  1    MPEELCSERPLFGGAISSKFPNRFEDVSNIRQVPDHQ--------------------HEV  40

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D+GSA WFLQDLA EQDAE   VIEQSGVVEAPGL+++ +PA++TTAVGQMAISKGRQG
Sbjct  41   GDSGSAVWFLQDLATEQDAEQGTVIEQSGVVEAPGLTYRNIPAVVTTAVGQMAISKGRQG  100

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            RE QN+V+VYLAN+RLKEV  D+LI AYEPI+IN LSESA  V AG+  PA+Q+G MPMA
Sbjct  101  RETQNIVRVYLANLRLKEVGTDVLIAAYEPILINPLSESARTVGAGLTAPASQSGYMPMA  160

Query  846  EVFKLAVSTFKVNDWRLFG  902
            EVFKLA S+FKVNDW LFG
Sbjct  161  EVFKLAASSFKVNDWSLFG  179



>ref|XP_007046147.1| Mog1/PsbP/DUF1795-like photosystem II reaction center PsbP family 
protein isoform 3 [Theobroma cacao]
 gb|EOY01979.1| Mog1/PsbP/DUF1795-like photosystem II reaction center PsbP family 
protein isoform 3 [Theobroma cacao]
Length=192

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 156/191 (82%), Gaps = 15/191 (8%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ D+YSERPLFGGAI++TFP+RFQDVSN+RQVPDHQ               LL+ K +V
Sbjct  1    MSADLYSERPLFGGAISTTFPLRFQDVSNIRQVPDHQ---------------LLDYKHEV  45

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D+GSA WFLQDLA EQD EG  ++EQS  VEAPGL ++ +PA++TTAVGQMA+SKGRQG
Sbjct  46   GDDGSAVWFLQDLAVEQDGEGFTLLEQSAAVEAPGLRYRNIPAVVTTAVGQMAVSKGRQG  105

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN++KVYLAN+RLKEV  D+LITAYEPI+I+ LS+SASAV AG+AVPA Q+G +PM 
Sbjct  106  REAQNIIKVYLANLRLKEVGTDVLITAYEPILIHPLSQSASAVGAGLAVPAMQSGLVPMV  165

Query  846  EVFKLAVSTFK  878
            EVFKLAV++FK
Sbjct  166  EVFKLAVTSFK  176



>gb|EMT31123.1| hypothetical protein F775_00873 [Aegilops tauschii]
Length=202

 Score =   265 bits (676),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            MA +  + RPLFGGAI++ FP RFQDVSN+R+VPDHQEVFVDPAR+ESLIFELL+LK +V
Sbjct  1    MAGESSTRRPLFGGAISTAFPARFQDVSNIREVPDHQEVFVDPAREESLIFELLDLKGEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D GSA WFL+D+ANEQDA   +V+E SG VE  GL     PA+  TA+G++A+SKGRQG
Sbjct  61   EDGGSALWFLRDVANEQDAGDNLVVEHSGTVELAGLRSGEAPAVAGTAIGKLAVSKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+V++YLAN+RLK    D++ITAYEP++IN LSESA AV AG AVPA QAGC+PM+
Sbjct  121  REAQNIVRLYLANIRLKNAATDLVITAYEPLLINPLSESAQAVAAGPAVPAEQAGCLPMS  180

Query  846  EVFKLAVSTFKVNDWRLF  899
            EVF+LAV  F V+DW LF
Sbjct  181  EVFRLAVMNFDVHDWNLF  198



>gb|EMS54835.1| hypothetical protein TRIUR3_14854 [Triticum urartu]
Length=202

 Score =   264 bits (674),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            MA +  + RPLFGGAI++ FP RFQDVSN+R+VPDHQEV VDPARDESLIFELL+LK +V
Sbjct  1    MAGESSTRRPLFGGAISTAFPARFQDVSNIREVPDHQEVVVDPARDESLIFELLDLKGEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D GSA WFL+D+ANEQDA   +V+E SG VE  GL     PA+  TA+G++A+SKGRQG
Sbjct  61   EDGGSALWFLRDVANEQDAGDNLVVEHSGTVELAGLRSGEAPAVAGTAIGKLAVSKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+V++YLAN+RLK    D++ITAYEP++IN LSESA AV AG AVPA QAGC+PM+
Sbjct  121  REAQNIVRLYLANIRLKNAATDVVITAYEPLLINPLSESAQAVAAGPAVPAEQAGCLPMS  180

Query  846  EVFKLAVSTFKVNDWRLF  899
            EVF+LAV  F V+DW LF
Sbjct  181  EVFRLAVMNFDVHDWNLF  198



>gb|AAG52542.1|AC013289_9 hypothetical protein; 65754-64334 [Arabidopsis thaliana]
Length=186

 Score =   261 bits (668),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 158/200 (79%), Gaps = 16/200 (8%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+V++ S RPLFGGAI++ FP RFQDVSN+RQVPDHQEVFVDP+RDESLIFELL+ K +V
Sbjct  1    MSVELCSVRPLFGGAISTVFPQRFQDVSNIRQVPDHQEVFVDPSRDESLIFELLDFKAEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D GSA+WFL DLA+EQDAEG  +IEQS V+EAPGLSF+ + A+ TTA+G+M        
Sbjct  61   GDIGSASWFLNDLASEQDAEGFQLIEQSEVIEAPGLSFRNISAVATTAIGEM--------  112

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
                    VY+AN+RLK V  D+L+TAYEPI+IN LSESA AV +G+AVPA+Q+G MPM 
Sbjct  113  --------VYVANIRLKGVDTDVLVTAYEPILINPLSESADAVGSGLAVPASQSGKMPMC  164

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            ++ K ++STFKVNDW LFG+
Sbjct  165  DIIKQSLSTFKVNDWNLFGS  184



>ref|XP_011038452.1| PREDICTED: probable ran guanine nucleotide release factor isoform 
X1 [Populus euphratica]
Length=207

 Score =   261 bits (666),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 152/181 (84%), Gaps = 3/181 (2%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M  D+ ++RPL+GG+I+STFPVRFQDVSN+RQVPDHQE FVDP+RDESLIFELL+LK DV
Sbjct  1    MTEDICTDRPLYGGSISSTFPVRFQDVSNIRQVPDHQEAFVDPSRDESLIFELLDLKPDV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
            +DNGSA WFLQDLANEQDA+G  ++EQSGVVE P      +  ++TTA+GQM ISK RQG
Sbjct  61   SDNGSAVWFLQDLANEQDAQGFTLVEQSGVVEVP---IGNVSVVVTTAIGQMGISKVRQG  117

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+V+VYLAN+RLK V  D+L+ AYEPI+I+ LSESA+ V AG+  PAAQ+G +PMA
Sbjct  118  REAQNVVQVYLANLRLKNVGTDVLVVAYEPILISPLSESAATVGAGLPAPAAQSGFLPMA  177

Query  846  E  848
            E
Sbjct  178  E  178



>gb|ACF80176.1| unknown [Zea mays]
 tpg|DAA37466.1| TPA: RAN guanine nucleotide release factor [Zea mays]
Length=202

 Score =   260 bits (664),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 158/198 (80%), Gaps = 0/198 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            MA +    +PLFGGAI +TFP RFQDVSN+R+VPDHQEV VDP+RDESLIFELL+LK +V
Sbjct  1    MAGESCVPKPLFGGAIFTTFPDRFQDVSNIREVPDHQEVLVDPSRDESLIFELLDLKGEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D GSA WFLQD+ANEQDA   +V+E SG +E   L     PA+  TAVGQ+A+SKGRQG
Sbjct  61   DDAGSALWFLQDIANEQDAGDNLVVEHSGTLELAALHLGEAPAVAATAVGQLAVSKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+V++YLAN+RLK    D+LITAYEP++IN LSESA+AV AG A+PA Q GC+PM+
Sbjct  121  REAQNIVRIYLANIRLKNAATDVLITAYEPLLINPLSESAAAVAAGPAIPAEQVGCLPMS  180

Query  846  EVFKLAVSTFKVNDWRLF  899
            EVFKLAV+ F V DW LF
Sbjct  181  EVFKLAVTNFNVRDWNLF  198



>gb|KCW86833.1| hypothetical protein EUGRSUZ_B03429 [Eucalyptus grandis]
Length=174

 Score =   256 bits (654),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = +3

Query  414  QEVFVDPARDESLIFELLELKQDVADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGL  593
            +EVFVDP+RDESLIFELL+ K +V D+GSA WFLQDLA EQDAE   VIEQSGVVEAPGL
Sbjct  9    KEVFVDPSRDESLIFELLDFKHEVGDSGSAVWFLQDLATEQDAEQGTVIEQSGVVEAPGL  68

Query  594  SFQTLPAIITTAVGQMAISKGRQGREAQNLVKVYLANVRLKEVTADILITAYEPIVINLL  773
            +++ +PA++TTAVGQMAISKGRQGRE QN+V+VYLAN+RLKEV  D+LI AYEPI+IN L
Sbjct  69   TYRNIPAVVTTAVGQMAISKGRQGRETQNIVRVYLANLRLKEVGTDVLIAAYEPILINPL  128

Query  774  SESASAVRAGVAVPAAQAGCMPMAEVFKLAVSTFKVNDWRLFG  902
            SESA  V AG+  PA+Q+G MPMAEVFKLA S+FKVNDW LFG
Sbjct  129  SESARTVGAGLTAPASQSGYMPMAEVFKLAASSFKVNDWSLFG  171



>gb|KDO82897.1| hypothetical protein CISIN_1g028780mg [Citrus sinensis]
Length=150

 Score =   250 bits (639),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 135/154 (88%), Gaps = 4/154 (3%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ D+YSERPLFGGAI+S+FP RFQDVSN+RQVPDHQEVFVDP+RDESLIFELL+ K DV
Sbjct  1    MSGDLYSERPLFGGAISSSFPHRFQDVSNIRQVPDHQEVFVDPSRDESLIFELLDFKLDV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             DNGSA WFLQDLA EQDAEG  ++EQSGVVEAPGL ++ LPA +TTAVGQM    GRQG
Sbjct  61   GDNGSAAWFLQDLATEQDAEGCTLLEQSGVVEAPGLRYKDLPATVTTAVGQM----GRQG  116

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVIN  767
            REAQN+VKVYLAN+RLKEV  D+L+TAYEP++I 
Sbjct  117  REAQNIVKVYLANLRLKEVGTDVLVTAYEPLLIK  150



>gb|KEH27812.1| Ran guanine nucleotide release factor-like protein [Medicago 
truncatula]
Length=154

 Score =   250 bits (639),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ D+  +RPLFGG I+STFP RFQDVS++RQVPDHQEVF DP+RDESLI ELLE K D+
Sbjct  1    MSQDVVYQRPLFGGKISSTFPNRFQDVSDIRQVPDHQEVFADPSRDESLIVELLEFKPDI  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
            AD+GSA WFLQDLA EQDAEGT+VIEQSGV+EAPGL +  +PA++TTAVGQMAISKGRQG
Sbjct  61   ADDGSAAWFLQDLAREQDAEGTVVIEQSGVLEAPGLMYNNIPAVVTTAVGQMAISKGRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVIN  767
            REAQN+VKVYLAN+R+K V  D+LITAYEPIVI 
Sbjct  121  REAQNIVKVYLANLRVKGVDTDVLITAYEPIVIK  154



>emb|CBI31975.3| unnamed protein product [Vitis vinifera]
Length=216

 Score =   251 bits (640),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 140/167 (84%), Gaps = 2/167 (1%)
 Frame = +3

Query  405  PDHQEVFVDPARDESLIFELLELKQDVADNGSATWFLQDLANEQDAEGTMVIEQSGVVEA  584
            P   E FVDP RDESL+FELL+LKQDVAD+GSA WFLQDLA EQDAEG  VIEQSGVVEA
Sbjct  51   PLENEAFVDPTRDESLVFELLDLKQDVADDGSAVWFLQDLATEQDAEGFTVIEQSGVVEA  110

Query  585  PGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVKVYLANVRLKEVTADILITAYEPIVI  764
             GL ++ + A++TTAVGQMAISKGRQGREAQN+  VYLAN+RLKEV  D+LITAYEPI+I
Sbjct  111  GGLRYRNMAAVVTTAVGQMAISKGRQGREAQNI--VYLANLRLKEVGTDVLITAYEPILI  168

Query  765  NLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAVSTFKVNDWRLFGA  905
            N  S+SA  V AG+ VPA Q+G MPM EVFK+AVS+FKVNDW LFGA
Sbjct  169  NPFSDSAGTVGAGLPVPAEQSGHMPMTEVFKMAVSSFKVNDWSLFGA  215



>ref|XP_006371112.1| hypothetical protein POPTR_0019s04050g [Populus trichocarpa]
 gb|ERP48909.1| hypothetical protein POPTR_0019s04050g [Populus trichocarpa]
Length=174

 Score =   246 bits (627),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 150/200 (75%), Gaps = 29/200 (15%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M  D+ ++R LFGGAI+STFPVRFQDVSN+RQVPDHQEVF DP+RDESL+FELL+LK D+
Sbjct  1    MPEDISTDR-LFGGAISSTFPVRFQDVSNIRQVPDHQEVFADPSRDESLVFELLDLKPDI  59

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             DNGSA WFLQDLANEQDA+G  +                           M ISKGRQG
Sbjct  60   NDNGSAVWFLQDLANEQDAQGFTL---------------------------MGISKGRQG  92

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+V+VYLAN+RLK    D+L+ A+EPI+I+ LSESASAV  G+ +PAAQ+G +PM+
Sbjct  93   REAQNVVRVYLANLRLKNAGTDVLVVAHEPILISPLSESASAVGPGL-LPAAQSGFLPMS  151

Query  846  EVFKLAVSTFKVNDWRLFGA  905
            EVFK+AVS+FKVNDW LFG 
Sbjct  152  EVFKVAVSSFKVNDWSLFGG  171



>ref|XP_011002024.1| PREDICTED: probable ran guanine nucleotide release factor [Populus 
euphratica]
Length=177

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 145/177 (82%), Gaps = 4/177 (2%)
 Frame = +3

Query  375  FQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWFLQDLANEQDAEGTM  554
             QDVSN+RQVPDHQEVF +P+RDESL+FELL+LK D+ DNGSA WFLQDLANEQDA+G  
Sbjct  2    LQDVSNIRQVPDHQEVFAEPSRDESLVFELLDLKPDINDNGSAVWFLQDLANEQDAQGFT  61

Query  555  VIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVKVYLANVRLKEVTADI  734
            +++ S VVE P        A++TTA+GQM ISKGRQGREAQN+V+VYLAN+RLK    D+
Sbjct  62   LVDHSAVVEVP---IGDSSALVTTAIGQMGISKGRQGREAQNVVRVYLANLRLKNAGTDV  118

Query  735  LITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAVSTFKVNDWRLFGA  905
            L+ A EPI+I+ LSESASAV  G+ +PAAQ+G +PM+EVFK+AVS+FKVNDW LFG 
Sbjct  119  LVVANEPILISPLSESASAVGPGL-LPAAQSGFLPMSEVFKVAVSSFKVNDWSLFGG  174



>ref|XP_008808047.1| PREDICTED: ran guanine nucleotide release factor isoform X2 [Phoenix 
dactylifera]
Length=157

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGGAI S FP RFQDVSN+R+VPDHQEVF DP+RDESLIFELL+LK +V D+GSA W
Sbjct  9    RPLFGGAITSCFPPRFQDVSNIREVPDHQEVFADPSRDESLIFELLDLKHEVGDDGSAVW  68

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVK  689
            FL+DLANEQDA  TMV+E SG +EA GL +   P I+  AVGQMAISKGRQGREAQNLV+
Sbjct  69   FLRDLANEQDAAETMVLEHSGTLEAVGLGYGGGPTIVKMAVGQMAISKGRQGREAQNLVR  128

Query  690  VYLANVRLKEVTADILITAYEPIVIN  767
            VYLAN+RLKEV+ D+LITA+EPI+I 
Sbjct  129  VYLANLRLKEVSTDVLITAHEPILIK  154



>ref|XP_010937089.1| PREDICTED: ran guanine nucleotide release factor isoform X2 [Elaeis 
guineensis]
Length=173

 Score =   230 bits (586),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGGAI S FP RFQDVSN+R+VP+HQEVF DP+RDES IFELL+LK++V DNGSA W
Sbjct  9    RPLFGGAITSCFPPRFQDVSNIREVPNHQEVFADPSRDESFIFELLDLKREVGDNGSAVW  68

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVK  689
            FL+D+ANEQDA  TMV+E SG +EA GL     P I+TTAVG+MA++KGRQGREAQNLV+
Sbjct  69   FLRDIANEQDAAETMVLEHSGTLEAVGLGCGGGPTIVTTAVGKMALTKGRQGREAQNLVR  128

Query  690  VYLANVRLKEVTADILITAYEPIVINL  770
            VYLAN+RLKEV+ D+LITAYEPI+I +
Sbjct  129  VYLANLRLKEVSTDVLITAYEPILIKI  155



>gb|EEE61122.1| hypothetical protein OsJ_15049 [Oryza sativa Japonica Group]
Length=183

 Score =   224 bits (571),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 145/198 (73%), Gaps = 19/198 (10%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ +  + RPLFGGAI+                   QEVFVDPARDESLIFELL+LK +V
Sbjct  1    MSGERCAGRPLFGGAIS-------------------QEVFVDPARDESLIFELLDLKGEV  41

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D GSA WFL+D+ANEQDA   +V+E SG +E  GL F   PA+  TAVGQ+AISKGRQG
Sbjct  42   EDGGSALWFLRDIANEQDAGDNLVVEHSGTIELGGLRFGDAPAVAGTAVGQLAISKGRQG  101

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            REAQN+V++YLAN+RLK    D++ITAYEP++IN LSESASAV AG AVPA QAGC+ M+
Sbjct  102  REAQNIVRLYLANIRLKNAATDVVITAYEPLLINPLSESASAVAAGPAVPAEQAGCLAMS  161

Query  846  EVFKLAVSTFKVNDWRLF  899
            E+FKLAV  F V+DW LF
Sbjct  162  EIFKLAVMNFNVHDWNLF  179



>gb|EPS73516.1| hypothetical protein M569_01241, partial [Genlisea aurea]
Length=152

 Score =   219 bits (559),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 130/152 (86%), Gaps = 4/152 (3%)
 Frame = +3

Query  315  DMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADN  494
            D+++ER LFGGAI++ FP+RFQDVS+VRQVPDHQE FVD +RDES++ ELLELK DVAD 
Sbjct  1    DIFAERRLFGGAISAAFPLRFQDVSSVRQVPDHQEAFVDSSRDESIVLELLELKHDVADT  60

Query  495  GSATWFLQDLANEQDAEGTMVIEQSG---VVEAPGL-SFQTLPAIITTAVGQMAISKGRQ  662
            GSA WFLQDLA++QDAE T ++E+S    +   PGL +F   PA++TTA+GQMA+SKGRQ
Sbjct  61   GSAAWFLQDLADDQDAEVTQLLERSHGDVLTTIPGLTTFGGNPAVVTTAIGQMAVSKGRQ  120

Query  663  GREAQNLVKVYLANVRLKEVTADILITAYEPI  758
            GREAQN+VKVY+AN+RLK+VT D+L+TAYEPI
Sbjct  121  GREAQNIVKVYVANIRLKDVTTDVLVTAYEPI  152



>ref|XP_001768602.1| predicted protein [Physcomitrella patens]
 gb|EDQ66540.1| predicted protein [Physcomitrella patens]
Length=194

 Score =   216 bits (549),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 136/189 (72%), Gaps = 0/189 (0%)
 Frame = +3

Query  336  LFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWFL  515
            LFGGAI+ +FP R+ D+S+ R VP++QE FVDP RDES I ELLELK++VAD GSA WFL
Sbjct  2    LFGGAISCSFPPRYGDISDFRDVPNNQEAFVDPNRDESFIIELLELKENVADAGSARWFL  61

Query  516  QDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVKVY  695
            +DLA EQ  E T+++E    + A  +        +   +G M I+KGRQG EA N V+VY
Sbjct  62   EDLAVEQAFENTLIVEDESRIPAANIPNLEANTTVNAVIGTMEIAKGRQGVEASNNVRVY  121

Query  696  LANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAVSTF  875
            LAN+RL+ V  DILIT YEP+ I+  SESA+AV AG  +PAAQAG +P A+VFK  +STF
Sbjct  122  LANIRLRVVETDILITVYEPLNISEHSESAAAVGAGATLPAAQAGLLPAADVFKQVLSTF  181

Query  876  KVNDWRLFG  902
            +++DW LFG
Sbjct  182  RIHDWSLFG  190



>ref|XP_001781422.1| predicted protein [Physcomitrella patens]
 gb|EDQ53796.1| predicted protein [Physcomitrella patens]
Length=195

 Score =   213 bits (543),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 135/190 (71%), Gaps = 0/190 (0%)
 Frame = +3

Query  336  LFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWFL  515
            LFGGAI  +FP R+ DVS+VR+VP++QE FVD  RDES I ELLELK++V D GSA WFL
Sbjct  3    LFGGAITCSFPRRYTDVSDVREVPNNQEAFVDANRDESFIVELLELKENVTDAGSARWFL  62

Query  516  QDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVKVY  695
            +DL  EQ +E ++V+E+   V A  +        +   +G MA++KGRQG EA N+V+VY
Sbjct  63   EDLTVEQASENSLVVEEENSVPAANVPNLDANTTVNAVIGTMAVAKGRQGPEASNVVRVY  122

Query  696  LANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAVSTF  875
            LAN+RL+ V  DIL+  YEP+VI+  SESA AV AG  VPA QAG MP A+VFK  + TF
Sbjct  123  LANIRLRVVGTDILVIVYEPLVISEHSESAQAVGAGATVPALQAGLMPAADVFKQVLFTF  182

Query  876  KVNDWRLFGA  905
             V+DW LFG+
Sbjct  183  NVHDWSLFGS  192



>ref|XP_010490369.1| PREDICTED: ran guanine nucleotide release factor-like [Camelina 
sativa]
Length=156

 Score =   207 bits (528),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  372  RFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWFLQDLANEQDAEGT  551
            + Q+VSN+RQVPDHQEVFVDP+RDESLIFELL+ K +V D GSA+WFL DLA EQDAEG 
Sbjct  22   KIQNVSNIRQVPDHQEVFVDPSRDESLIFELLDFKNEVGDIGSASWFLNDLAREQDAEGF  81

Query  552  MVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVKVYLANVRLKEVTAD  731
             +IEQS V+EAPGLS++ +PA+ TTA+G+MAISKGRQGREAQNLV+VY+AN+RLK V  D
Sbjct  82   QLIEQSEVIEAPGLSYRNIPAVATTAIGEMAISKGRQGREAQNLVRVYVANLRLKGVDTD  141

Query  732  ILITAYEPIVIN  767
            +L+TAYEPI+++
Sbjct  142  VLVTAYEPILMS  153



>ref|XP_006302837.1| hypothetical protein CARUB_v10020969mg [Capsella rubella]
 ref|XP_006302838.1| hypothetical protein CARUB_v10020969mg [Capsella rubella]
 gb|EOA35735.1| hypothetical protein CARUB_v10020969mg [Capsella rubella]
 gb|EOA35736.1| hypothetical protein CARUB_v10020969mg [Capsella rubella]
Length=166

 Score =   202 bits (513),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ ++ S RPLFGGAI++ FP RF+DVSN+RQVPDHQEVFVDP+RDESLIFELL+ K +V
Sbjct  1    MSGELCSVRPLFGGAISTAFPQRFEDVSNIRQVPDHQEVFVDPSRDESLIFELLDFKTEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D GSA+WFL DLA+EQDAEG  +IEQS V+EAPGLS++ +PA+ TTA+G+MAISKGRQG
Sbjct  61   GDIGSASWFLNDLASEQDAEGFQLIEQSEVIEAPGLSYRNIPAVATTAIGEMAISKGRQG  120

Query  666  REAQNLVKV  692
            REAQNLV+V
Sbjct  121  REAQNLVRV  129



>ref|XP_002972959.1| hypothetical protein SELMODRAFT_97898 [Selaginella moellendorffii]
 gb|EFJ26180.1| hypothetical protein SELMODRAFT_97898 [Selaginella moellendorffii]
Length=191

 Score =   189 bits (479),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 133/192 (69%), Gaps = 7/192 (4%)
 Frame = +3

Query  324  SERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSA  503
            +E+PLFGGAI+ + P RFQ VSN+R+     EVF D +RDES+I ELLELK ++ D  SA
Sbjct  5    AEQPLFGGAISCSLPTRFQTVSNIRE-----EVFADASRDESVIVELLELKPEIPDEQSA  59

Query  504  TWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNL  683
            +WFLQDLA+EQDA   M +E    ++   + F     +   AVG++ +SK RQ  +A N+
Sbjct  60   SWFLQDLASEQDA--LMEMESVSQLQPGDVPFLDPSIVKGVAVGKLKVSKSRQSADAANI  117

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLA  863
            V++Y+AN+RL+ V  D+LI+ YEP+ I+ LSESA++V +G AVPAA AGC    EVF+  
Sbjct  118  VRIYMANLRLRSVKTDVLISVYEPLYISALSESAASVGSGFAVPAAVAGCSSALEVFQTI  177

Query  864  VSTFKVNDWRLF  899
            + T KV+DW LF
Sbjct  178  LRTLKVHDWALF  189



>ref|XP_007046146.1| Mog1/PsbP/DUF1795-like photosystem II reaction center PsbP family 
protein isoform 2 [Theobroma cacao]
 gb|EOY01978.1| Mog1/PsbP/DUF1795-like photosystem II reaction center PsbP family 
protein isoform 2 [Theobroma cacao]
Length=113

 Score =   185 bits (470),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ D+YSERPLFGGAI++TFP+RFQDVSN+RQVPDHQEVFVDPARDESLIFELL+ K +V
Sbjct  1    MSADLYSERPLFGGAISTTFPLRFQDVSNIRQVPDHQEVFVDPARDESLIFELLDYKHEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQM  641
             D+GSA WFLQDLA EQD EG  ++EQS  VEAPGL ++ +PA++TTAVGQM
Sbjct  61   GDDGSAVWFLQDLAVEQDGEGFTLLEQSAAVEAPGLRYRNIPAVVTTAVGQM  112



>ref|XP_002993379.1| hypothetical protein SELMODRAFT_236726 [Selaginella moellendorffii]
 gb|EFJ05564.1| hypothetical protein SELMODRAFT_236726 [Selaginella moellendorffii]
Length=191

 Score =   186 bits (472),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 132/192 (69%), Gaps = 7/192 (4%)
 Frame = +3

Query  324  SERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSA  503
            +E+PLFGGAI+ + P RFQ VSN+R+     EVF D +RDES+I ELLELK ++ D  SA
Sbjct  5    AEQPLFGGAISCSLPTRFQTVSNIRE-----EVFADASRDESVIVELLELKPEIPDEQSA  59

Query  504  TWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNL  683
            +WFLQDLA+EQDA   M +E    ++   + F     +   AVG++ +SK RQ  +A N+
Sbjct  60   SWFLQDLASEQDA--LMEMESVSQLQPGDVPFLDPSIVKGVAVGKLKVSKSRQSADAANI  117

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLA  863
            V++Y+AN+RL+ V  D+LI+ YEP+ I+ LSESA++  +G AVPAA AGC    EVF+  
Sbjct  118  VRIYMANLRLRSVKTDVLISVYEPLYISALSESAASGGSGFAVPAAVAGCSSALEVFQTI  177

Query  864  VSTFKVNDWRLF  899
            + T KV+DW LF
Sbjct  178  LRTLKVHDWALF  189



>gb|KHN12221.1| hypothetical protein glysoja_031569 [Glycine soja]
Length=141

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 100/116 (86%), Gaps = 1/116 (1%)
 Frame = +3

Query  555  VIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVKV-YLANVRLKEVTAD  731
            VIEQSGV+EAPGL ++ +PA++ TAVGQMAISKGRQGREAQN VKV YLAN+ LK V  D
Sbjct  26   VIEQSGVLEAPGLMYKNMPAVVITAVGQMAISKGRQGREAQNFVKVVYLANLHLKGVDTD  85

Query  732  ILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAVSTFKVNDWRLF  899
            +L+TAYEPIVIN  SESA  V AGVAVPAAQAGCMPM EVFKLAV++F+V+DW LF
Sbjct  86   VLVTAYEPIVINPFSESADTVGAGVAVPAAQAGCMPMEEVFKLAVTSFRVHDWGLF  141



>ref|XP_008385018.1| PREDICTED: uncharacterized protein LOC103447601 [Malus domestica]
Length=163

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ D+YSERPLFG  I STF +RF+DVSN+RQVPDHQE FVDP  DESL FELLELK  V
Sbjct  1    MSQDIYSERPLFGDXITSTFFLRFEDVSNIRQVPDHQETFVDPTGDESLTFELLELKHXV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQM  641
             DNGSA WFLQD+A EQDA+G+MVIEQSGV++AP L ++   A++TT VGQM
Sbjct  61   GDNGSANWFLQDIATEQDADGSMVIEQSGVIKAPRLCYRNTXAVVTTXVGQM  112



>ref|XP_008352298.1| PREDICTED: uncharacterized protein LOC103415791 [Malus domestica]
Length=158

 Score =   169 bits (428),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ D+Y ERPLFGGAI STF +RF+DVSN RQVPDHQE  VDPA+DESLIFELLELK +V
Sbjct  1    MSQDIYFERPLFGGAITSTFHLRFEDVSNSRQVPDHQEALVDPAQDESLIFELLELKHEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAII  620
             DNGSA WFLQDLA EQDA+G+MVIEQSGV+EAP L ++  PA++
Sbjct  61   DDNGSANWFLQDLATEQDADGSMVIEQSGVIEAPRLYYRNTPAVV  105



>gb|EMT20367.1| hypothetical protein F775_02256 [Aegilops tauschii]
Length=129

 Score =   154 bits (388),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 91/116 (78%), Gaps = 1/116 (1%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            MA +  + RPLFGGAI++ FPVRFQDVSN+R+VPDHQEV VDPARDESLIFELL+LK +V
Sbjct  1    MAGESSTRRPLFGGAISTAFPVRFQDVSNIREVPDHQEVLVDPARDESLIFELLDLKGEV  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISK  653
             D GSA WFL+D+ANEQDA   +V+E SG +E  GL     PA+  TA+G++ +SK
Sbjct  61   EDGGSALWFLRDVANEQDAADNLVVEHSGTIELAGLRSGEAPAVAGTAIGKL-VSK  115



>ref|XP_002504159.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65417.1| predicted protein [Micromonas sp. RCC299]
Length=203

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 119/209 (57%), Gaps = 19/209 (9%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M  D   + PLFGGAI++  P R+ DVS+ R VPD+QEV+ D + DES+I E+LE  ++ 
Sbjct  1    MTTDASRKVPLFGGAISAHLPTRYVDVSDFRPVPDNQEVWTDASVDESVIVEILERVEEG  60

Query  486  ---ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAI------ITTAVGQ  638
               A+ G+A WF +DLA    A        + ++    LS + LPA+       + AVG 
Sbjct  61   PSDAEGGAAGWFWEDLA----AVSECGPNDAHLMSVTRLSSEHLPAMNGRFAAASVAVGT  116

Query  639  MAISKGRQ-GREAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVP  815
            M ++KGR+ G E  N+V+V LAN+RL EV  D+L+T   P+V+   S +A+   AGV + 
Sbjct  117  MKMAKGRERGDERVNVVEVTLANIRLPEVGTDLLVTVNRPLVVAPGSSAAATTGAGV-IG  175

Query  816  AAQAGCMPMAEVFKLAVSTFKVNDWRLFG  902
                G   +  + +    TF V+DW LFG
Sbjct  176  TGGEGWSALRSILE----TFSVDDWSLFG  200



>emb|CCA21121.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=190

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 112/194 (58%), Gaps = 6/194 (3%)
 Frame = +3

Query  324  SERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSA  503
            SE+ LFGG+I+   P  F DVS+ RQVPDHQEV+ + + D+ +I E+L+ +++V D+  A
Sbjct  2    SEKLLFGGSISCFIPQGFDDVSSFRQVPDHQEVYTNFSADQCIIVEILQYEKEVKDDCIA  61

Query  504  TWFLQDLANEQD-AEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQN  680
             +   +LANE + A     + QS +++        +  + +  VG+  ++K  +G   +N
Sbjct  62   QFLFDELANENNCASSDKTVRQSRMLDTSSEPRIGVDCVKSVLVGEQYVAKFHEGSNTKN  121

Query  681  LVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKL  860
            L+++YL  +RL  VT DI+I+   PI IN +S S    +      +A+ G    + +F  
Sbjct  122  LIQIYLGVIRLPSVTTDIMISLSVPIRINPMSSSKDCYQHN-GQNSAEIG----SSIFDK  176

Query  861  AVSTFKVNDWRLFG  902
              ++F++ DWRLFG
Sbjct  177  VYTSFRILDWRLFG  190



>emb|CCI43322.1| unnamed protein product [Albugo candida]
Length=232

 Score =   124 bits (311),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 114/198 (58%), Gaps = 12/198 (6%)
 Frame = +3

Query  324  SERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSA  503
            SE+ LFGG+I+   P  F DVS+ RQVPDHQEV+ + + D+ +I E+L+ +  V D   A
Sbjct  43   SEKNLFGGSISCFIPRDFDDVSSFRQVPDHQEVYTNSSTDQCIIVEILQFETAVKDECIA  102

Query  504  TWFLQDLANE-QDAEGTMVIEQSGVVEA---PGLSFQTLPAIITTAVGQMAISKGRQGRE  671
             +   +LANE Q A     + +S V++A   P +   ++ +I+   VG   +SK  +G  
Sbjct  103  RYLFDELANENQCAASERSVCESKVLDASTPPRIGVDSVKSIL---VGDQYVSKFNEGSN  159

Query  672  AQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEV  851
            A+NL+KVYL  +RL  VT+DILI+   PI IN +S S    +       +Q      +++
Sbjct  160  AKNLIKVYLGVIRLPSVTSDILISVSVPIKINPMSSSRECSQH-----ESQNSIEIGSDI  214

Query  852  FKLAVSTFKVNDWRLFGA  905
            F    ++F++ +W LFG+
Sbjct  215  FDKVFTSFRILNWGLFGS  232



>ref|XP_002906514.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY65915.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=188

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 110/194 (57%), Gaps = 13/194 (7%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGGA++   P  F DVS+ RQVPD+QEVF + A D+ +I ELL+ ++ V D  SA +
Sbjct  3    RPLFGGALSCEIPEGFVDVSSFRQVPDNQEVFANAAIDQCIIVELLQYEESVTDAQSARY  62

Query  510  FLQDLA--NEQDAEGTMVI--EQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQ  677
            F  ++A  N    +  MV+  E++G   AP  +    P +    VG   ++K ++G  A+
Sbjct  63   FFNEVAQSNGCGPDEVMVLLEEKAGAENAP--TNVDAPHVTQLIVGDQRVAKFKEGDHAK  120

Query  678  NLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFK  857
            N+V+VYL N+RL  VT D++++   P+ IN  S S  A +       A       A +FK
Sbjct  121  NVVRVYLGNIRLPGVTTDVVLSMSAPMRINPASSSRDAFQFENNSEVA-------AAIFK  173

Query  858  LAVSTFKVNDWRLF  899
             A+ +F V DW LF
Sbjct  174  QALQSFAVLDWSLF  187



>gb|ETK80685.1| hypothetical protein L915_13708 [Phytophthora parasitica]
Length=188

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 107/193 (55%), Gaps = 11/193 (6%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGGA++   P  F DVS+ RQVPD+QEVF + A D+ +I ELL+ ++ V D  SA +
Sbjct  3    RPLFGGALSCEIPEGFADVSSFRQVPDNQEVFANAATDQCVIVELLQYEESVTDAQSARY  62

Query  510  FLQDLANEQDA---EGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQN  680
            F  ++A        E T+++E+    +    +    P      VG  +++K ++G  A+N
Sbjct  63   FFNEIAQSNGCGPDEVTVLLEEKANTKNAPANIDA-PHTTQIIVGDQSVAKFKEGDHAKN  121

Query  681  LVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKL  860
            +V+VYL N+RL  VT D++++   P+ IN  S S  A +       A A       +FK 
Sbjct  122  VVRVYLGNIRLPGVTTDVVLSMSAPMRINPASSSCDAFQFEDNSEVAAA-------IFKQ  174

Query  861  AVSTFKVNDWRLF  899
            A+ +F V DW LF
Sbjct  175  ALQSFAVLDWSLF  187



>gb|ETI40587.1| hypothetical protein F443_14065 [Phytophthora parasitica P1569]
 gb|ETM40608.1| hypothetical protein L914_13501 [Phytophthora parasitica]
 gb|ETO69292.1| hypothetical protein F444_14096 [Phytophthora parasitica P1976]
Length=188

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 107/193 (55%), Gaps = 11/193 (6%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGGA++   P  F DVS+ RQVPD+QEVF + A D+ +I ELL+ ++ V D  SA +
Sbjct  3    RPLFGGALSCEIPEGFADVSSFRQVPDNQEVFANAATDQCVIVELLQYEESVTDAQSACY  62

Query  510  FLQDLANEQDA---EGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQN  680
            F  ++A        E T+++E+    +    +    P      VG  +++K ++G  A+N
Sbjct  63   FFNEIAQSNGCGPDEVTVLLEEKANTKNAPANIDA-PHTTQIIVGDQSVAKFKEGDHAKN  121

Query  681  LVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKL  860
            +V+VYL N+RL  VT D++++   P+ IN  S S  A +       A A       +FK 
Sbjct  122  VVRVYLGNIRLPGVTTDVVLSMSAPMRINPASSSRDAFQFEDNSEVAAA-------IFKQ  174

Query  861  AVSTFKVNDWRLF  899
            A+ +F V DW LF
Sbjct  175  ALQSFAVLDWSLF  187



>ref|XP_008909556.1| hypothetical protein PPTG_14765 [Phytophthora parasitica INRA-310]
 gb|ETL34107.1| hypothetical protein L916_13607 [Phytophthora parasitica]
 gb|ETL87394.1| hypothetical protein L917_13414 [Phytophthora parasitica]
 gb|ETN05086.1| hypothetical protein PPTG_14765 [Phytophthora parasitica INRA-310]
 gb|ETP10342.1| hypothetical protein F441_13991 [Phytophthora parasitica CJ01A1]
Length=188

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 107/193 (55%), Gaps = 11/193 (6%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGGA++   P  F DVS+ RQVPD+QEVF + A D+ +I ELL+ ++ V D  SA +
Sbjct  3    RPLFGGALSCEIPEGFADVSSFRQVPDNQEVFANAATDQCVIVELLQYEESVTDAQSARY  62

Query  510  FLQDLANEQDA---EGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQN  680
            F  ++A        E T+++E+    +    +    P      VG  +++K ++G  A+N
Sbjct  63   FFNEIAQSNGCGPDEVTVLLEEKANTKNAPANIDA-PHTTQIIVGDQSVAKFKEGDHAKN  121

Query  681  LVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKL  860
            +V+VYL N+RL  VT D++++   P+ IN  S S  A +       A       A +FK 
Sbjct  122  VVRVYLGNIRLPGVTTDVVLSMSAPMRINPASSSRDAFQFEDNSEVA-------AAIFKQ  174

Query  861  AVSTFKVNDWRLF  899
            A+ +F V DW LF
Sbjct  175  ALQSFAVLDWSLF  187



>gb|ETP38504.1| hypothetical protein F442_13908 [Phytophthora parasitica P10297]
Length=188

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 107/193 (55%), Gaps = 11/193 (6%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGGA++   P  F DVS+ RQVPD+QEVF + A D+ +I ELL+ ++ V D  SA +
Sbjct  3    RPLFGGALSCEIPEGFADVSSFRQVPDNQEVFANAATDQCVIVELLQYEESVTDAQSARY  62

Query  510  FLQDLANEQDA---EGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQN  680
            F  ++A        E T+++E+    +    +    P      VG  +++K ++G  A+N
Sbjct  63   FFNEIAQSNGCGPDEVTVLLEEKANTKNAPANIDA-PHTTQIIVGDQSVAKFKEGDHAKN  121

Query  681  LVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKL  860
            +V+VYL N+RL  VT D++++   P+ IN  S S  A +       A       A +FK 
Sbjct  122  VVRVYLGNIRLPGVTTDVVLSMSAPMRINPASSSRDAFQFEDNSEVA-------AAIFKQ  174

Query  861  AVSTFKVNDWRLF  899
            A+ +F V DW LF
Sbjct  175  ALQSFAVLDWSLF  187



>ref|XP_004366301.1| Ran GTPase binding protein [Dictyostelium fasciculatum]
 gb|EGG18397.1| Ran GTPase binding protein [Dictyostelium fasciculatum]
Length=201

 Score =   117 bits (294),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 109/196 (56%), Gaps = 12/196 (6%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            ++ L+GGA+    P RF DVS  RQVPDHQEVFVD   D+S+I ELLE +  + DN SA+
Sbjct  10   KKGLYGGAMEIEIPTRFIDVSQFRQVPDHQEVFVDETSDQSVIIELLERQSHIEDNKSAS  69

Query  507  WFLQDLANEQD--AEGTMVIEQSGV--VEAPGLSFQTLPAIITTAVGQMAISKGRQGREA  674
            +    +++E D  A+G +V     +   E P  + +T   ++    GQ  ++K  +   +
Sbjct  70   FHFDTISDESDIPADGRIVFNHRPIDSAEMPHFTNETPKFLL---FGQQKVAKFNETG-S  125

Query  675  QNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAE-V  851
            +N+V VY+A VRL +   D+LIT Y PI   LL ES+S+ +   +         P+ E  
Sbjct  126  ENIVNVYMAIVRLSKSQTDVLITLYHPI---LLCESSSSAKTVGSTKPDTLYSQPIVEQT  182

Query  852  FKLAVSTFKVNDWRLF  899
            F   + +F + D+ LF
Sbjct  183  FIKILQSFNIKDYSLF  198



>ref|XP_009515564.1| hypothetical protein PHYSODRAFT_284230 [Phytophthora sojae]
 gb|EGZ28289.1| hypothetical protein PHYSODRAFT_284230 [Phytophthora sojae]
Length=188

 Score =   115 bits (287),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 69/193 (36%), Positives = 106/193 (55%), Gaps = 11/193 (6%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGGA++   P  F DVS  RQVPD+QEVF + A D+ +I ELL+ ++ V D  SA +
Sbjct  3    RPLFGGALSCEIPEGFADVSTFRQVPDNQEVFANAATDQCVIVELLQYEESVEDAHSARY  62

Query  510  FLQDLANEQDA---EGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQN  680
            F  ++A        E ++++E++   +    +    P      VG   ++K ++G  A+N
Sbjct  63   FFNEIAQSNGCGPDEVSVLLEEAADAKNAPAAIDA-PHSTQLIVGDQRVAKFKEGDHAKN  121

Query  681  LVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKL  860
            +V+VYL N+RL  VT D++++   P+ IN  S S  A +       A A       +FK 
Sbjct  122  VVRVYLGNIRLPGVTTDVVLSVSAPMRINPASSSRDAFQFENNSEVAAA-------IFKQ  174

Query  861  AVSTFKVNDWRLF  899
            A+ +F V DW LF
Sbjct  175  ALQSFTVLDWSLF  187



>gb|EXX71284.1| Mog1p [Rhizophagus irregularis DAOM 197198w]
Length=188

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 106/197 (54%), Gaps = 15/197 (8%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            ++ LFGG+I+   P  F+D+SNVR VPD+QEVF D   D+S+I E+LE  + VA+  +A 
Sbjct  2    DKELFGGSISMYIPPSFEDISNVRNVPDNQEVFADVNTDQSIIVEILEFVKQVANEDAAK  61

Query  507  WFLQDLANEQDAEGTMVIEQSGVV---EAPGLSFQTLPAIITTAVGQMAISK-GRQGREA  674
            +    +A++ DAE    I Q   +   E P L   T P    T  GQ +++K   +   A
Sbjct  62   YHFDSIASDNDAENFNTIHQITQLTSQEIPNLPSDT-PMYFCT--GQQSVAKFNEKDPSA  118

Query  675  QNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVF  854
            +NLV +Y+A  R      DI+IT   PI+I   S S    + G      Q G     E F
Sbjct  119  RNLVNIYMALFRFPNYDTDIVITYNIPILIGAASSSRQTAQEG----NIQVGF----EEF  170

Query  855  KLAVSTFKVNDWRLFGA  905
            K  ++TFK+N++ LF A
Sbjct  171  KRMLATFKINNYDLFAA  187



>ref|XP_002522406.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF39898.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=130

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +3

Query  693  YLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAVST  872
            YLAN+RLK V++D+LITAYEP++IN LSE+A  V AG+A PAAQ+G +PM+EVFKLAVST
Sbjct  57   YLANIRLKGVSSDVLITAYEPVLINPLSETARTVGAGMAAPAAQSGFLPMSEVFKLAVST  116

Query  873  FKVNDWRLFGA  905
            FKVNDW LFG+
Sbjct  117  FKVNDWNLFGS  127



>gb|KDD73113.1| hypothetical protein H632_c2524p1 [Helicosporidium sp. ATCC 50920]
Length=201

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 77/203 (38%), Positives = 107/203 (53%), Gaps = 8/203 (4%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            + V+    + LFGGAI    P R  DVS+ R VPD+QEVF D A+D+SLI E+LEL   V
Sbjct  3    LEVEALEPKDLFGGAIRMDVPARLADVSDYRPVPDNQEVFSDGAQDQSLIVEILELHASV  62

Query  486  ADNGSATWFLQDLAN-EQDAEGTMVIEQSGVVEAPGLSFQTLPA--IITTAVGQMAISKG  656
            +   SA+++  D+A+   DA  T+    S     P      LPA   I  A+G    SKG
Sbjct  63   SAPESASFYFADVASLNGDASPTLEARGSWEGGGPAEGSSELPAGTPIHWALGTQRASKG  122

Query  657  RQGREAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCM  836
            RQG EA NLV+V +  VRL   + D++I+   P++I     SA +  A  A   A+    
Sbjct  123  RQGAEASNLVQVIVCCVRLAAQSTDLVISLNTPMLI-----SAQSAAAEHAGAGAKTLHQ  177

Query  837  PMAEVFKLAVSTFKVNDWRLFGA  905
                +F   + T  + DW LFG+
Sbjct  178  SAPRLFHAMLQTLSIRDWTLFGS  200



>gb|KFH62880.1| hypothetical protein MVEG_11404 [Mortierella verticillata NRRL 
6337]
Length=198

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/202 (36%), Positives = 109/202 (54%), Gaps = 19/202 (9%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            E+ L+GGAI    P +F ++S+VR+VPDHQEVFV+   D+S+I E+LEL  + +D+  A 
Sbjct  5    EQELYGGAITMNLPRKFGNISHVREVPDHQEVFVNVDEDQSVIVEILELAAEASDDSCAA  64

Query  507  WFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISK----GRQ----  662
            +  Q LA + DAE +  I+   ++    L      A I   +GQ  ++K     RQ    
Sbjct  65   FHYQQLAEDNDAEESSTIQNVSILSNAELPSWPTEAKIYLLLGQQRVAKFNERQRQLESA  124

Query  663  -GREAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMP  839
               + +NLV++ +  VRL     DI+I+   P+ I     +AS+ R       A  G + 
Sbjct  125  SAEDTRNLVQIMMVVVRLPRQETDIVISYNVPLQI----AAASSSR-----EVAHEGDIQ  175

Query  840  MAEV-FKLAVSTFKVNDWRLFG  902
             AEV F+  + +FKV DW LFG
Sbjct  176  EAEVWFRNLIGSFKVRDWGLFG  197



>dbj|GAM27938.1| hypothetical protein SAMD00019534_111140 [Acytostelium subglobosum 
LB1]
Length=198

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 111/195 (57%), Gaps = 13/195 (7%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            +R L+GGAI +T P+RF DV+ +R++PDHQE+ VD   D+S+I ELLE ++ V D+ S  
Sbjct  10   QRELYGGAIHATVPIRFIDVAQIRRIPDHQELLVDDKTDQSIIIELLERQEHVPDDQSIQ  69

Query  507  WFLQDLANEQDA--EGTMVIEQSGVVEAPGLSF-QTLPAIITTAVGQMAISKGRQGREAQ  677
            +    +A+E D   +  +++ Q  +  A    F  ++P  I  A   +A    +    A+
Sbjct  70   FHFNVVADESDVAPDKRLILNQRQLTSADMPHFANSVPKYILKARQMVA----KFNETAE  125

Query  678  NLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRA-GVAVPAAQAGCMPMAEVF  854
            N V VY+A +RL+    D+LIT  EP+   LL+ ++S+V A G  VP+         ++F
Sbjct  126  NTVNVYMAIIRLERCKTDLLITYNEPV---LLAPNSSSVNAVGGTVPSTSEH--DAEQLF  180

Query  855  KLAVSTFKVNDWRLF  899
               +S+ K+ D+ LF
Sbjct  181  IRLLSSIKIVDYSLF  195



>ref|XP_005850724.1| hypothetical protein CHLNCDRAFT_140842 [Chlorella variabilis]
 gb|EFN58622.1| hypothetical protein CHLNCDRAFT_140842 [Chlorella variabilis]
Length=170

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 102/200 (51%), Gaps = 35/200 (18%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M  D   +  LFGGA+  +FP RF D+S  R VPDHQEVF D + D+SL+ E+       
Sbjct  1    MIDDTLVDHELFGGAVGCSFPQRFIDISQFRPVPDHQEVFSDASLDQSLVIEI-------  53

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
                        + +EQ      V+    +   P   F+ L       VGQ A++KG+QG
Sbjct  54   ------------VVDEQ-----RVLTPQDMPRLPPDCFKAL------VVGQQAVAKGQQG  90

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
              A N V++ L  VRL +  +D+LIT   PI I+   +SA+A  AG     A     P+ 
Sbjct  91   SSALNKVQIILCCVRLPQHGSDLLITLNSPIFIS--EKSAAAQHAGAGFKGAHL-LAPL-  146

Query  846  EVFKLAVSTFKVNDWRLFGA  905
             +FK  +++F++N+W LFG 
Sbjct  147  -LFKQIIASFRINNWGLFGG  165



>ref|XP_003285372.1| hypothetical protein DICPUDRAFT_29264 [Dictyostelium purpureum]
 gb|EGC38065.1| hypothetical protein DICPUDRAFT_29264 [Dictyostelium purpureum]
Length=189

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 106/195 (54%), Gaps = 15/195 (8%)
 Frame = +3

Query  321  YSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGS  500
            + +RPL+GGAI  + P RF+D++  RQVPDHQEVFVD   D+S I EL E KQ V D+ +
Sbjct  5    FVKRPLYGGAIEISIPERFRDITQFRQVPDHQEVFVDEKSDQSFIVELNE-KQSVVDDQA  63

Query  501  ATWFLQDLANEQD--AEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREA  674
              +  ++L  E +   E ++V+ Q  +      +F   P  I  A  Q  ++K ++   A
Sbjct  64   ILFHYENLTEELELPKEKSVVLNQRKLTNDELPNFPNNPKYILLA--QQKVAKFKES--A  119

Query  675  QNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVF  854
            +N V +Y+  VRL++   DILI   + I I+  S S +A          Q     +  +F
Sbjct  120  ENTVNLYMLLVRLEKQNTDILIILNDTIEISPASSSKNA--------QTQTNQSEVEALF  171

Query  855  KLAVSTFKVNDWRLF  899
              ++ +FK+ND+ LF
Sbjct  172  LNSIKSFKINDYSLF  186



>ref|XP_003060201.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56153.1| predicted protein [Micromonas pusilla CCMP1545]
Length=227

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 70/217 (32%), Positives = 112/217 (52%), Gaps = 29/217 (13%)
 Frame = +3

Query  336  LFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLE-LKQD-------VAD  491
            LFGGA++++FP R+ DVS+ R VPD+QE + D + DES+I E++E +++D         +
Sbjct  12   LFGGAVSASFPTRYHDVSDFRPVPDNQEAWTDASADESVIVEIVERVERDPMTGDGPSDE  71

Query  492  NGSATWFLQDLANEQDAE---------GTMVIEQS-----GVVEAPGLSFQTL------P  611
             G+A WF +DLA+  DA          G   + +      GV  +  ++  T        
Sbjct  72   EGAAAWFWRDLADVNDASVSSGASELVGVTKLAREDDVPVGVRASTSITNSTEDVDARND  131

Query  612  AIITTAVGQMAISKGRQGREAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASA  791
              ++ A G   ++KGR G +A+N V V LA VRL  V +D+L+T   P+ I   S++   
Sbjct  132  VSVSVARGTQRVAKGRDGDDARNDVFVVLACVRLPRVASDVLVTLNRPLAIAAGSQTTPQ  191

Query  792  VRAGVAVPAAQAGCMPMAEVFKLAVSTFKVNDWRLFG  902
              +G    AA    +   E  +  +S+  + DW LFG
Sbjct  192  TGSGAVADAAAVKTV-AEETLRGILSSLAIEDWGLFG  227



>ref|XP_004364703.1| hypothetical protein CAOG_01835 [Capsaspora owczarzaki ATCC 30864]
 gb|EFW43791.1| hypothetical protein CAOG_01835 [Capsaspora owczarzaki ATCC 30864]
Length=213

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/208 (32%), Positives = 111/208 (53%), Gaps = 18/208 (9%)
 Frame = +3

Query  318  MYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNG  497
            + + R L+GGA+  + P +F DVS +RQ+PDHQEVFV+ A D+S + +LL+ +  V    
Sbjct  7    LLTPRQLYGGAMTISLPDKFADVSGMRQIPDHQEVFVNQANDQSFMVDLLQYQSHVQGAD  66

Query  498  SATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIIT-----TAVGQMAISKGRQ  662
            +A +   ++     AE    +++S V E   L+   +P +          GQ A++K ++
Sbjct  67   AARFHFNEI-----AECNNAVDKSTVTEIVALAPDDIPGLDPLLEKWLLCGQQAVAKYKE  121

Query  663  ----GREAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAG  830
                G  A+N V +YL  VRL   T DI++T  +P+ I   S+++S++            
Sbjct  122  EDKDGDAARNAVMIYLLLVRLPAFTTDIVVTFNDPVFI---SQTSSSMPHSTDTDQFLGE  178

Query  831  CMPMAEVFKLAVSTFKVNDWRLFGADRG  914
             M +  +FKLA+ +  +ND+ LFG D  
Sbjct  179  RMQLP-LFKLALRSLAINDYGLFGQDEA  205



>ref|XP_004995847.1| hypothetical protein PTSG_03267 [Salpingoeca rosetta]
 gb|EGD82611.1| hypothetical protein PTSG_03267 [Salpingoeca rosetta]
Length=192

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 98/192 (51%), Gaps = 8/192 (4%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGGA++ T P RF D+S VRQVP++QEVF D + D+S I E+LEL  D  D  +A +
Sbjct  8    RPLFGGAMSMTVPARFMDISMVRQVPNNQEVFADASTDQSFIIEILELPPDAPDAEAARF  67

Query  510  FLQDLANEQDAEGTMV-IEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLV  686
                +A+E  A  T V  E    V     + Q      T   G   + K R   +  N V
Sbjct  68   HFDVIASEGGALSTEVETETQQRVVMGDNNVQR-----TVMWGLQQVGKHRDRADRANSV  122

Query  687  KVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAV  866
            +V++A  R   V+ADI+++   P+ I+   +SA A        A          VF  A+
Sbjct  123  RVHVACFRAHNVSADIVVSFNSPVFIS--EQSAVAPNVDAQRMAHYNAPEQALAVFTQAI  180

Query  867  STFKVNDWRLFG  902
             T ++NDW LFG
Sbjct  181  DTLQINDWSLFG  192



>gb|EFA74839.1| Ran GTPase binding protein [Polysphondylium pallidum PN500]
Length=194

 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 66/193 (34%), Positives = 103/193 (53%), Gaps = 11/193 (6%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            R L+GGAI  + P RF D++  R +PDHQE FVD   D+S+I ELLE +  VAD+ SA +
Sbjct  7    RQLYGGAIEISIPSRFIDITAFRVIPDHQECFVDDRTDQSIIIELLERQDHVADHESAAF  66

Query  510  FLQDLANEQD--AEGTMVIEQSGVVEAPGLSFQT-LPAIITTAVGQMAISKGRQGREAQN  680
                +A+E D  A+   ++    + +     F+  +P  I   +G+  +SK  +   A+N
Sbjct  67   HFNVVADEADVAADKRTILNHRALTKTDMPHFEDEVPKFI--LLGKQMMSKFNET--AEN  122

Query  681  LVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKL  860
             + VY+A VRL     D+LIT   P+ ++  SES+S    G  VP+       +  +F  
Sbjct  123  TLNVYMAIVRLNRSKTDLLITLNAPLTLS--SESSSVKAVGGTVPSFNP--QEVENIFVE  178

Query  861  AVSTFKVNDWRLF  899
             + T  + D+ LF
Sbjct  179  LLKTLHIKDYSLF  191



>gb|EPZ35087.1| Ran-interacting Mog1 protein domain-containing protein [Rozella 
allomycis CSF55]
Length=184

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 101/194 (52%), Gaps = 19/194 (10%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQD---VADNG  497
            +R L+GGAI+   P  F DVS +R++PDHQEVF D   D S+I EL  + +D   ++   
Sbjct  6    QRSLYGGAISLAIPDAFIDVSTLREIPDHQEVFTDVKTDMSVIIELNTMAEDSESISFGS  65

Query  498  SATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQ  677
            SA  FL    +  D +           E P L  + +   +    G+  ISK R+   A 
Sbjct  66   SAESFLISRDDNVDVQS----------ELPFL--KEVDCKVKLVEGEQRISKFRET--AS  111

Query  678  NLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFK  857
            N+V++YLA +R+  +  DILI+   PIV  L  ES+S+        +A+       +VFK
Sbjct  112  NVVRIYLAVIRIPSIETDILISMNNPIV--LAEESSSSRTVDKEEFSAKNQSEDSLKVFK  169

Query  858  LAVSTFKVNDWRLF  899
              + +FK+NDW LF
Sbjct  170  QILKSFKINDWNLF  183



>gb|KDO16628.1| hypothetical protein SPRG_17826 [Saprolegnia parasitica CBS 223.65]
Length=181

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 104/192 (54%), Gaps = 14/192 (7%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            +R LFGGAI+   P  F DVS  RQVPD+QEVF D A D  +I ELL+++  + D+ +  
Sbjct  2    KRSLFGGAISCDVPSGFADVSEFRQVPDNQEVFADAATDRCVIIELLQMEDTIGDSATGV  61

Query  507  WFLQDLANEQDAEGT-MVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNL  683
            ++  ++A+      T   + Q+  + A  +    +PA I  AVG  A++K ++   A+N+
Sbjct  62   FYFNEIADSNACAPTDRHVAQAFTMPASEVHGLQVPAHI--AVGTQAVAKYKEA--AKNV  117

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLA  863
            ++VY+  +RL   T D++++   PI ++  S S   V   V       G + +  +F+  
Sbjct  118  IQVYVCCLRLPRATTDLVVSVTVPISVDPNSSSRGHVPTDV-----DEGSVFLKAIFR--  170

Query  864  VSTFKVNDWRLF  899
              +  V+DW LF
Sbjct  171  --SLAVHDWDLF  180



>emb|CDX77290.1| BnaC08g03350D [Brassica napus]
Length=110

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 43/70 (61%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +3

Query  555  VIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVKVYLANVRLKEVTADI  734
            ++EQS V++ PGLS++ +P+I +TA+G+MAISKGRQGREAQNL++VY AN+ LK V  D+
Sbjct  40   LVEQSNVIDVPGLSYRNIPSIASTAIGEMAISKGRQGREAQNLLRVYGANIHLKGVETDV  99

Query  735  LITAYEPIVI  764
            L+TAYE I+I
Sbjct  100  LVTAYEHILI  109



>gb|KDO27359.1| hypothetical protein SPRG_06947 [Saprolegnia parasitica CBS 223.65]
Length=181

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 104/192 (54%), Gaps = 14/192 (7%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            +R LFGGAI+   P  F DVS  RQVPD+QEVF D A D  +I ELL+++  + D+ +  
Sbjct  2    KRSLFGGAISCDVPNGFADVSEFRQVPDNQEVFADAATDRCVIIELLQMEDTIGDSATGV  61

Query  507  WFLQDLANEQDAEGT-MVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNL  683
            ++  ++A+      T   + Q+  + A  +    +PA I  AVG  A++K ++   A+N+
Sbjct  62   FYFNEIADSNACAPTDRHVAQAFTMPASEVHGLQVPAHI--AVGTQAVAKYKEA--AKNV  117

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLA  863
            ++VY+  +RL   T D++++   PI ++  S S   V   V       G + +  +F+  
Sbjct  118  IQVYVCCLRLPRATTDLVVSVTVPISVDPNSSSRGHVPTDV-----DEGSVFLKAIFR--  170

Query  864  VSTFKVNDWRLF  899
              +  V+DW LF
Sbjct  171  --SLAVHDWDLF  180



>ref|XP_009827090.1| hypothetical protein H257_04339 [Aphanomyces astaci]
 gb|ETV83660.1| hypothetical protein H257_04339 [Aphanomyces astaci]
Length=183

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 105/194 (54%), Gaps = 16/194 (8%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            ++ L+GGA++   PV F DVS  RQVPD+QEVF D A D  +I ELLEL+  V    ++ 
Sbjct  2    KQDLYGGALSCEIPVGFADVSEFRQVPDNQEVFADAATDRCIIVELLELESTVVGPATSE  61

Query  507  WFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTA---VGQMAISKGRQGREAQ  677
            ++  ++A         +     +++    + Q LP + TTA   +G+  ++K ++   ++
Sbjct  62   FYFHEIAESNKC----MRHDCTILQTFLATEQDLPGLATTAHVTIGKQCVAKFKEA--SK  115

Query  678  NLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFK  857
            N +++Y+  +RL  VT D++++   P+    L  S+S+ R G     A  G + +  + +
Sbjct  116  NTMQLYVCCIRLPTVTTDLVVSVTVPL---QLHPSSSSSRDGPTATNADEGLLFLKGILR  172

Query  858  LAVSTFKVNDWRLF  899
                T KV++W LF
Sbjct  173  ----TLKVHNWGLF  182



>ref|XP_008614781.1| hypothetical protein SDRG_10563 [Saprolegnia diclina VS20]
 gb|EQC31774.1| hypothetical protein SDRG_10563 [Saprolegnia diclina VS20]
Length=181

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 105/192 (55%), Gaps = 14/192 (7%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            +R LFGGAI+   P  F DVS  RQVPD+QEVF D   D  +I ELL++++ + ++ + T
Sbjct  2    KRSLFGGAISCDVPSGFADVSEFRQVPDNQEVFADAVTDRCVIIELLQMEETIGESATGT  61

Query  507  WFLQDLANEQDAEGT-MVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNL  683
            ++  ++A+      T   + Q+  + A  +    +PA I  AVG  A++K ++   A+N+
Sbjct  62   FYFNEIADSNACAPTDRHVAQAFTMPASEVHGLQVPAHI--AVGTQAVAKYKEA--AKNV  117

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLA  863
            ++VY+  +RL   T D++++   PI ++  S S   +   V       G + +  +F+  
Sbjct  118  IQVYVCCLRLPRATTDLVVSVTVPISVDPNSSSRGHIPTDV-----DEGSVFLKAIFR--  170

Query  864  VSTFKVNDWRLF  899
              +  V+DW LF
Sbjct  171  --SLAVHDWDLF  180



>gb|KFM27018.1| putative ran guanine nucleotide release factor [Auxenochlorella 
protothecoides]
Length=187

 Score = 97.8 bits (242),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 69/201 (34%), Positives = 108/201 (54%), Gaps = 21/201 (10%)
 Frame = +3

Query  309  AVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVA  488
            A +  +E  +FGGAI+   P R QDVS+ R VPDHQE+F D ARD+SLI E++E  QD  
Sbjct  4    ASEPLNEIKIFGGAISVPLPSRLQDVSDFRPVPDHQEIFTDAARDQSLIVEVVEF-QDQP  62

Query  489  DNGSATWFLQDLANEQDAEGTMV--IEQSGVVEAPGLSFQTLPAI-ITTAVGQMAISKGR  659
            D  +A +F +DLA+   A  + +  ++  G  + P L     P++ ++ A GQ  ++K  
Sbjct  63   DEDAAGFFFKDLADVGQAVSSRLDSVQGLGSRDVPHLP----PSLYVSLAAGQHTVAKSG  118

Query  660  QGREAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMP  839
               EA   ++V LA++R+    +D+LI+      ++  S S  A  +    P      + 
Sbjct  119  AASEALA-IQVLLADIRIPAHGSDLLIS------LHTRSSSLGAQESETEAP------LQ  165

Query  840  MAEVFKLAVSTFKVNDWRLFG  902
              E+FK  +   K+ DW LFG
Sbjct  166  GPELFKSILKGLKILDWGLFG  186



>gb|EWM24485.1| Mog1/PsbP/DUF1795, alpha/beta/alpha sandwich [Nannochloropsis 
gaditana]
Length=246

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 79/139 (57%), Gaps = 7/139 (5%)
 Frame = +3

Query  336  LFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWFL  515
            LFGGAI  + P  F   S++RQVPD+QEVF+D A D SLI ELL+L++D     +AT+F 
Sbjct  17   LFGGAITISLPASFSSASDIRQVPDNQEVFIDDASDASLILELLDLERDKEGLEAATYFF  76

Query  516  QDLANEQDAEGTMVIEQ---SGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLV  686
             DLA   DA+   +  +   SG    P L+     A+    VG   +SK      A   V
Sbjct  77   NDLAEHNDAQNATIQYKEDLSGTSLVPNLAAYPTYAL----VGTQTVSKFHAADAALLPV  132

Query  687  KVYLANVRLKEVTADILIT  743
            ++YL NVRL++   D+L+T
Sbjct  133  RIYLVNVRLQQTGTDVLLT  151



>gb|AAI55965.1| Mog1 protein [Xenopus laevis]
Length=187

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 88/153 (58%), Gaps = 17/153 (11%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLF GA+++  P   QDVS +R++PD+QEVF   + D+S+I ELLE ++ V+D+ +A +
Sbjct  6    RPLFAGALSAILPPFLQDVSELREIPDNQEVFAHTSTDQSIIVELLEYQEGVSDSEAARY  65

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLP--AIITTAVGQMAISKGRQ-----GR  668
              +D+A+  DAEG     QS V     LS + LP   +  T      +  G Q       
Sbjct  66   HFEDVASSNDAEG-----QSEV-----LSVEPLPLAQLTLTDCTNAWLLTGHQLVAKFNE  115

Query  669  EAQNLVKVYLANVRLKEVTADILITAYEPIVIN  767
            EA+N V +++A  RL + T D+L+T  +P  IN
Sbjct  116  EARNTVNIHMALFRLPQHTTDLLVTFNDPAAIN  148



>ref|XP_006627500.1| PREDICTED: ran guanine nucleotide release factor-like [Lepisosteus 
oculatus]
Length=191

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/193 (33%), Positives = 99/193 (51%), Gaps = 12/193 (6%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
             PLFGGA+++  P    D+S +R++PD+QEVF     D+SLI ELLE +  V D  +A +
Sbjct  9    HPLFGGALSAVLPHSICDISELREIPDNQEVFAHQHSDQSLIVELLEYQSHVLDGEAARY  68

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAV--GQMAISKGRQGREAQNL  683
              +D+A   +A G  V E    +E    +  +LP   +  +  G   +SK  +  EA+N 
Sbjct  69   HFEDVARSNEAGGPGVSEVRS-LEPLAKALLSLPDCSSAWLLAGTQLVSKFNE--EAKNT  125

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLA  863
            V +YL   RL + + DI++T  +P+ I+ LS S          P          E F+L 
Sbjct  126  VNIYLGLFRLPQHSTDIMVTFNDPVSISPLSSSTGGASEMATAPWT-------LEDFRLV  178

Query  864  VSTFKVNDWRLFG  902
            + T ++ D  +FG
Sbjct  179  LHTLRLLDPAVFG  191



>gb|AAI50379.1| Si:ch211-268m12.6 protein [Danio rerio]
Length=183

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 87/156 (56%), Gaps = 5/156 (3%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGGA+++ FP    D+S +RQ+PD+QEVF     D+S+I ELLE +  V D  +A +
Sbjct  3    RPLFGGALSAVFPSSVMDISELRQIPDNQEVFAHSQTDQSIIIELLEYQSQVQDADAARY  62

Query  510  FLQDLANEQDA--EGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNL  683
              +D+A    A   GT  +     V    +S Q   +    +  Q+ +SK  +  EA+N 
Sbjct  63   HFEDVAGSNKAIENGTWEVRVVEQVPQSEISMQECSSAWLLSGAQL-VSKFNE--EAKNT  119

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASA  791
            V V+    RL + T DIL+T  +P+ IN LS SA+ 
Sbjct  120  VNVHQCLFRLPQFTTDILMTFNDPVFINPLSSSAAG  155



>ref|NP_001093465.1| ran guanine nucleotide release factor [Danio rerio]
 ref|XP_005165551.1| PREDICTED: ran guanine nucleotide release factor isoform X1 [Danio 
rerio]
 ref|XP_005165552.1| PREDICTED: ran guanine nucleotide release factor isoform X1 [Danio 
rerio]
 ref|XP_009300097.1| PREDICTED: ran guanine nucleotide release factor isoform X1 [Danio 
rerio]
Length=183

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 87/156 (56%), Gaps = 5/156 (3%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGGA+++ FP    D+S +RQ+PD+QEVF     D+S+I ELLE +  V D  +A +
Sbjct  3    RPLFGGALSAVFPSSVMDISELRQIPDNQEVFAHSQTDQSIIIELLEYQSQVQDADAARY  62

Query  510  FLQDLANEQDA--EGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNL  683
              +D+A    A   GT  +     V    +S Q   +    +  Q+ +SK  +  EA+N 
Sbjct  63   HFEDVAGSNKAIENGTWEVRVVEQVPQSEISMQECSSAWLLSGAQL-VSKFNE--EAKNT  119

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASA  791
            V V+    RL + T DIL+T  +P+ IN LS SA+ 
Sbjct  120  VNVHQCLFRLPQFTTDILMTFNDPVFINPLSSSAAG  155



>ref|XP_008868883.1| hypothetical protein H310_05827 [Aphanomyces invadans]
 gb|ETW02278.1| hypothetical protein H310_05827 [Aphanomyces invadans]
Length=183

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 107/195 (55%), Gaps = 18/195 (9%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            + PL+GGA++   P  F DVS  RQVPD+QEVF + A D  +I ELLEL+  V+   ++ 
Sbjct  2    KHPLYGGALSCEIPRGFADVSEFRQVPDNQEVFAEAATDRCIIVELLELEASVSGTATSE  61

Query  507  WFLQDLANEQD-AEGTMVIEQSGVVEAPGLSFQTLPAIITTA---VGQMAISKGRQGREA  674
            ++  ++A   + A     I Q+ +      + Q +P + TTA   +G+  ++K ++   +
Sbjct  62   FYFHEIAESNNCAPNDCTILQTLLA-----TEQDIPGLATTAFVTIGKQCVAKFKEA--S  114

Query  675  QNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVF  854
            +N +++Y+  VRL  V+ D++I+   P  + L   S+S+  A +A  A +        + 
Sbjct  115  KNTMQLYVCCVRLPNVSTDLVISVTVP--LQLHPSSSSSRDAPIATNADEG-----QLIL  167

Query  855  KLAVSTFKVNDWRLF  899
            K  + T +V+DW LF
Sbjct  168  KGLLRTLEVHDWGLF  182



>ref|XP_005649301.1| Mog1p/PsbP-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE24757.1| Mog1p/PsbP-like protein [Coccomyxa subellipsoidea C-169]
Length=191

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 108/194 (56%), Gaps = 20/194 (10%)
 Frame = +3

Query  336  LFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWFL  515
            LFGGA     P RF+DVSN+R VPD+QEV+ D + D+S++ E++++   V D+ S     
Sbjct  13   LFGGAAEIAVPSRFEDVSNIRPVPDNQEVYSDASVDQSIVVEVVQVD--VPDSDSCQHCF  70

Query  516  QDLAN-----EQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQN  680
             DLAN      Q  E   V+    +   PG +++ +       VGQ  +SKGRQG +A N
Sbjct  71   NDLANVSGASMQQIESETVLNPQDIPGVPGEAYKVV------IVGQQMVSKGRQGTDAAN  124

Query  681  LVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKL  860
              +V +A +RLK+V++D+LI    PI ++  S +A  +      P  ++  +    + + 
Sbjct  125  --RVIMAIIRLKQVSSDVLIILNTPISVSASSAAAKDIG-----PGERSEHLMAPSLLRR  177

Query  861  AVSTFKVNDWRLFG  902
             ++TFK+ D+ LFG
Sbjct  178  VLATFKIKDYSLFG  191



>ref|NP_001081994.1| RAN guanine nucleotide release factor [Xenopus laevis]
 emb|CAC35704.1| mog1 protein [Xenopus laevis]
Length=187

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 88/153 (58%), Gaps = 17/153 (11%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLF GA+++  P   QDVS +R++PD+QEVF   + D+S+I ELLE ++ V+D+ +A +
Sbjct  6    RPLFAGALSAILPPFLQDVSELREIPDNQEVFAHTSTDQSIIVELLEYQEGVSDSEAARY  65

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLP--AIITTAVGQMAISKGRQ-----GR  668
              +D+A+  DAEG     QS V     LS + LP   +  T      +  G Q       
Sbjct  66   HFEDVASSNDAEG-----QSEV-----LSVEPLPLAQLTLTDCTNAWLLTGLQLVAKFNE  115

Query  669  EAQNLVKVYLANVRLKEVTADILITAYEPIVIN  767
            EA+N V +++A  RL + T D+L+T  +P  IN
Sbjct  116  EARNTVNIHMALFRLPQHTTDLLVTFNDPAAIN  148



>ref|XP_004919461.1| PREDICTED: ran guanine nucleotide release factor isoform X4 [Xenopus 
(Silurana) tropicalis]
Length=189

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 87/153 (57%), Gaps = 17/153 (11%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
             PLF GA ++  P   QDVS +R++PD+QEVF   A D+S+I ELLE ++ V+D+ +A +
Sbjct  8    HPLFAGAFSAVLPPFSQDVSELREIPDNQEVFAHNATDQSIIVELLEYQEGVSDSDAARY  67

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLP--AIITTAVGQMAISKGRQ-----GR  668
              +D+A+  DAEG     QS V     LS + LP   +  TA     +  G Q       
Sbjct  68   HFEDVASSNDAEG-----QSEV-----LSVEPLPLAQLTLTACTNAWVLTGHQLVAKFNE  117

Query  669  EAQNLVKVYLANVRLKEVTADILITAYEPIVIN  767
            EA+N V +++A  RL + + D+L+T  +P  IN
Sbjct  118  EARNAVTIHMALFRLPQHSTDMLVTFNDPAAIN  150



>gb|AAH86495.1| rangnrf-prov protein, partial [Xenopus (Silurana) tropicalis]
Length=212

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 87/153 (57%), Gaps = 17/153 (11%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
             PLF GA ++  P   QDVS +R++PD+QEVF   A D+S+I ELLE ++ V+D+ +A +
Sbjct  31   HPLFAGAFSAVLPPFSQDVSELREIPDNQEVFAHNATDQSIIVELLEYQEGVSDSDAARY  90

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLP--AIITTAVGQMAISKGRQ-----GR  668
              +D+A+  DAEG     QS V     LS + LP   +  TA     +  G Q       
Sbjct  91   HFEDVASSNDAEG-----QSEV-----LSVEPLPLAQLTLTACTNAWVLTGHQLVAKFNE  140

Query  669  EAQNLVKVYLANVRLKEVTADILITAYEPIVIN  767
            EA+N V +++A  RL + + D+L+T  +P  IN
Sbjct  141  EARNAVTIHMALFRLPQHSTDMLVTFNDPAAIN  173



>ref|XP_005715050.1| unnamed protein product [Chondrus crispus]
 emb|CDF35231.1| unnamed protein product [Chondrus crispus]
Length=211

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/200 (35%), Positives = 106/200 (53%), Gaps = 14/200 (7%)
 Frame = +3

Query  324  SERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQ--DVADNG  497
            + R LFGGA+  + P  F DVS +R VPD+QE F     D SLI ELL+ +    VA   
Sbjct  17   TPRDLFGGAMTLSLPPFFTDVSRLRGVPDNQEAFAHAETDRSLIVELLQQEHPLPVAHTL  76

Query  498  SATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTL----PAI-ITTAVGQMAISKGRQ  662
            +AT+ L +LA++  A  + ++  + +   P   F  L    PA+ ++ A G   ++K + 
Sbjct  77   AATFHLDELASDSAALSSNLVYSAAL---PPDDFPLLKQGDPALQVSVAHGVHTVAKFKD  133

Query  663  GREAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQ-AGCMP  839
                 + V V+LA + L  VT D+L+   +P+V++    SA   R G  V  +Q +    
Sbjct  134  AESLASQVNVHLACITLPRVTTDLLVVFNDPVVLHPWGSSA---RVGSQVANSQESNPER  190

Query  840  MAEVFKLAVSTFKVNDWRLF  899
             AE+F  A+ T +VNDW LF
Sbjct  191  RAELFDHALRTLQVNDWSLF  210



>gb|ADO28291.1| ran guanine nucleotide release factor [Ictalurus furcatus]
Length=182

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 85/146 (58%), Gaps = 7/146 (5%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGGA+++  P   +D+S +R++PD+QEVF     D+S+I ELLE +  V D+ +A +
Sbjct  3    RPLFGGAMSAVLPSNTKDISELREIPDNQEVFAHTHTDQSIIIELLEYQSHVEDSQAARY  62

Query  510  FLQDLA--NEQDAEGTMVIEQSGVVEAPGLSF-QTLPAIITTAVGQMAISKGRQGREAQN  680
              +D+A  N+    G M + +   V    LS  Q   A I T  G   ISK  +  EA+N
Sbjct  63   HFEDVAGSNKVMEAGQMEVMEVQCVPQEQLSLSQCSSAWILT--GAQLISKFNE--EAKN  118

Query  681  LVKVYLANVRLKEVTADILITAYEPI  758
            +VK++L   RL E T DILIT  +P 
Sbjct  119  IVKIHLCLFRLPEYTTDILITFNDPF  144



>ref|XP_008405579.1| PREDICTED: ran guanine nucleotide release factor [Poecilia reticulata]
Length=194

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 80/143 (56%), Gaps = 3/143 (2%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGGA+++  P    D+S +R++PD+QEVF  P  D+SLI ELLE +  VAD  +A +
Sbjct  13   RPLFGGALSAVVPYNVTDISELREIPDNQEVFAHPHTDQSLIVELLEYQGQVADQDAARY  72

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAV-GQMAISKGRQGREAQNLV  686
             L+D+A     +     E S VV  P      L       + G   +SK  +  EA+N V
Sbjct  73   HLEDIAGSNKTQEPGAFEVSDVVALPKAEASLLECSSAWMLKGTQCVSKFDE--EARNTV  130

Query  687  KVYLANVRLKEVTADILITAYEP  755
             ++L  +RL + + DILIT  +P
Sbjct  131  SIHLGLLRLPQFSTDILITFNDP  153



>ref|XP_004067673.1| PREDICTED: ran guanine nucleotide release factor-like [Oryzias 
latipes]
Length=188

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/193 (36%), Positives = 101/193 (52%), Gaps = 15/193 (8%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGG++++ FP    DVS  R +PD+QEVF     D+SLI EL+E + DVAD  +A +
Sbjct  9    RPLFGGSMSAVFPSNATDVSVFRDIPDNQEVFAHAHTDQSLIVELVEYQADVADPDAARF  68

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIIT-TAVGQMAISKGRQGREAQNLV  686
             L+D+A    A G    E +GV+E P      +       A G   ++K  +  E +N V
Sbjct  69   HLEDIAGSNGAVGAS--EVTGVLELPRAELSLVECSSAWKATGAQRVAKFNE--ETRNAV  124

Query  687  KVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA-EVFKLA  863
             V+L   RL + + D+LIT  +P  I+  S SA+          A+A   P   + F+  
Sbjct  125  TVHLGVFRLPQFSTDVLITFNDPQSISPGSSSAA---------LAEAHREPWTLQDFQRL  175

Query  864  VSTFKVNDWRLFG  902
            + T  +ND  LFG
Sbjct  176  LQTVTLNDPGLFG  188



>ref|XP_010901293.1| PREDICTED: ran guanine nucleotide release factor [Esox lucius]
Length=219

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/194 (33%), Positives = 101/194 (52%), Gaps = 13/194 (7%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGGA+++T P   +D+S +R++PD+QEVF     D+S+I ELLE +  V +  +A +
Sbjct  36   RPLFGGALSATIPYSAKDISELREIPDNQEVFAHCHTDQSIIVELLEFQNHVQNEDAARY  95

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPG--LSFQTLPAIITTAVGQMAISKGRQGREAQNL  683
              +D+A    A      E   VV  P   LS +   +       Q+     +   EA+N 
Sbjct  96   HFEDVAGSNKALAPGTSEVRTVVALPKSQLSLEECSSAWLLTGTQLV---AKFNEEAKNT  152

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA-EVFKL  860
            V  YL   RL + + DIL+T  +P+ I+L  +S+SAV A       Q G  P     F+ 
Sbjct  153  VTFYLGLFRLPQFSTDILVTFNDPLSISL--DSSSAVAAD-----QQVGTEPWTLNNFQC  205

Query  861  AVSTFKVNDWRLFG  902
             + + +++D  +FG
Sbjct  206  LLQSLRLHDPGVFG  219



>ref|XP_002948983.1| hypothetical protein VOLCADRAFT_89409 [Volvox carteri f. nagariensis]
 gb|EFJ49918.1| hypothetical protein VOLCADRAFT_89409 [Volvox carteri f. nagariensis]
Length=182

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 96/198 (48%), Gaps = 34/198 (17%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            +R L+GGA+    P R  DVS++R VPDHQEVF+D   D++LIFE++E    VAD     
Sbjct  11   QRELWGGAVTCAVPARMLDVSDIRPVPDHQEVFLDSDADQALIFEIVEHDGAVADTDCGR  70

Query  507  WFLQDLANEQDA-----EGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGRE  671
               +D A   +A     E    +E + V   P  +++ L        G+  + +GR+ ++
Sbjct  71   HAFEDAAEGNEATSHTLEAVTSLEAAAVPNVPATAYKCL------VQGRQMVRRGREAKD  124

Query  672  AQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEV  851
             +    V LA +R  +V +D+LI+   P         A+A+ A V               
Sbjct  125  TE----VMLAVLRFPQVQSDLLISLSTPAAAAESRSEATAIIAQV---------------  165

Query  852  FKLAVSTFKVNDWRLFGA  905
                ++T ++ DWRLFGA
Sbjct  166  ----LATLEILDWRLFGA  179



>ref|XP_008118596.1| PREDICTED: ran guanine nucleotide release factor [Anolis carolinensis]
Length=193

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 67/198 (34%), Positives = 101/198 (51%), Gaps = 23/198 (12%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
             PLFGGA +   P    DVS +RQVPD+QEVFV P+ D+SLI ELLE +  V D  +  +
Sbjct  12   HPLFGGAFSVCLPPGSIDVSEMRQVPDNQEVFVHPSTDQSLIIELLEYQAGVPDENATRY  71

Query  510  FLQDLANEQDAEGTM-VIEQSGVVEAPGLSFQTLPAII----TTAVGQMAISK--GRQGR  668
              +DLA   DA  T  ++ Q           Q LP ++     ++  Q+   +   +   
Sbjct  72   HFEDLA---DASSTAEILNQE----------QFLPQLLALEGCSSAWQLTARQLVAKFNE  118

Query  669  EAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAE  848
            EA+N V ++LA +RL +   D+L+T  +P  I+ LS SA+    G  VP   +      E
Sbjct  119  EAKNEVTLHLALLRLPQYGTDLLLTFNDPTRIHPLSSSAA---QGTEVPPPFSQAPWTVE  175

Query  849  VFKLAVSTFKVNDWRLFG  902
             F     + +++D  +FG
Sbjct  176  HFHTFARSLRLHDPGIFG  193



>ref|XP_007550639.1| PREDICTED: ran guanine nucleotide release factor isoform X1 [Poecilia 
formosa]
Length=194

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 82/146 (56%), Gaps = 9/146 (6%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGGA+++  P    D+S +R++PD+QEVF  P  D+SLI ELLE +  VAD  +A +
Sbjct  13   RPLFGGALSAVVPYNVTDISELREIPDNQEVFAHPHTDQSLIVELLEYQGQVADQDAARY  72

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAP----GLSFQTLPAIITTAVGQMAISKGRQGREAQ  677
              +D+A    A      E S VV  P     LS  +   ++    G   +SK  +  EA+
Sbjct  73   HFEDIAGSNKAHEPGAFEVSDVVALPKAEVSLSECSSAWMLK---GTQCVSKFNE--EAR  127

Query  678  NLVKVYLANVRLKEVTADILITAYEP  755
            N V ++L  +RL + + DILIT  +P
Sbjct  128  NTVSIHLGLLRLPQFSTDILITFNDP  153



>ref|NP_001188207.1| ran guanine nucleotide release factor [Ictalurus punctatus]
 gb|ADO29215.1| ran guanine nucleotide release factor [Ictalurus punctatus]
Length=182

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 84/146 (58%), Gaps = 7/146 (5%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGGA+++  P   +D+S +R++PD+QEVF     D+S+I ELLE +  V D+ +A +
Sbjct  3    RPLFGGAMSAVLPSNTKDISELREIPDNQEVFAHTHTDQSIIIELLEYQSHVEDSQAARY  62

Query  510  FLQDLA--NEQDAEGTMVIEQSGVVEAPGLSF-QTLPAIITTAVGQMAISKGRQGREAQN  680
              +D+A  N+    G M + +   V    LS  Q   A I T  G   ISK  +  E +N
Sbjct  63   HFEDVAGSNKVMEAGQMEVMEVQCVPQEQLSLSQCSSAWILT--GAQLISKFNE--ETKN  118

Query  681  LVKVYLANVRLKEVTADILITAYEPI  758
            +VK++L   RL E T DILIT  +P 
Sbjct  119  IVKIHLCLFRLPEYTTDILITFNDPF  144



>ref|XP_001743170.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ91884.1| predicted protein [Monosiga brevicollis MX1]
Length=191

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 100/193 (52%), Gaps = 10/193 (5%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQD--VADNGS  500
            ER L  GA+    P RF+DVS  RQVPD QEVFVD   D+S+I E+LE+  D      G+
Sbjct  5    ERALLEGAMRIGLPARFEDVSAFRQVPDTQEVFVDVRTDQSVIVEILEMVPDATATGQGA  64

Query  501  ATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQN  680
            A +    LA++ DA  + + ++  +   P   F     + + ++G   ++K  +  E  N
Sbjct  65   ADFHFNSLAHDNDALESHIEQRDQLRPLP---FNGYVVVRSVSIGVQRVAKFNEAAERAN  121

Query  681  LVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKL  860
             V+V++A  R   V+ DI+++  +PI IN  S SA AV A        A  +     F+ 
Sbjct  122  QVRVHVACFRFPHVSTDIVVSWNQPIEINASSSSAEAVDAAALAQNGDALSL-----FQP  176

Query  861  AVSTFKVNDWRLF  899
             + +F V DW +F
Sbjct  177  MIESFAVLDWSIF  189



>ref|XP_009107587.1| PREDICTED: uncharacterized protein LOC103833243 [Brassica rapa]
Length=269

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 61/75 (81%), Gaps = 5/75 (7%)
 Frame = +3

Query  555  VIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVKVYLANVR-----LKE  719
            ++EQS V++ PGLS++ +P++ +TA+G++AISKGRQGREAQNL++VY+AN+R     LK 
Sbjct  194  LVEQSNVIDVPGLSYRNIPSVASTAIGELAISKGRQGREAQNLLRVYVANIRLANIHLKG  253

Query  720  VTADILITAYEPIVI  764
            V   +L+T YEPI+I
Sbjct  254  VETGVLVTTYEPILI  268



>ref|XP_002941865.2| PREDICTED: ran guanine nucleotide release factor isoform X1 [Xenopus 
(Silurana) tropicalis]
Length=297

 Score = 94.4 bits (233),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 87/153 (57%), Gaps = 17/153 (11%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
             PLF GA ++  P   QDVS +R++PD+QEVF   A D+S+I ELLE ++ V+D+ +A +
Sbjct  116  HPLFAGAFSAVLPPFSQDVSELREIPDNQEVFAHNATDQSIIVELLEYQEGVSDSDAARY  175

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLP--AIITTAVGQMAISKGRQ-----GR  668
              +D+A+  DAEG     QS V     LS + LP   +  TA     +  G Q       
Sbjct  176  HFEDVASSNDAEG-----QSEV-----LSVEPLPLAQLTLTACTNAWVLTGHQLVAKFNE  225

Query  669  EAQNLVKVYLANVRLKEVTADILITAYEPIVIN  767
            EA+N V +++A  RL + + D+L+T  +P  IN
Sbjct  226  EARNAVTIHMALFRLPQHSTDMLVTFNDPAAIN  258



>ref|XP_004919459.1| PREDICTED: ran guanine nucleotide release factor isoform X2 [Xenopus 
(Silurana) tropicalis]
Length=295

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 87/153 (57%), Gaps = 17/153 (11%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
             PLF GA ++  P   QDVS +R++PD+QEVF   A D+S+I ELLE ++ V+D+ +A +
Sbjct  114  HPLFAGAFSAVLPPFSQDVSELREIPDNQEVFAHNATDQSIIVELLEYQEGVSDSDAARY  173

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLP--AIITTAVGQMAISKGRQ-----GR  668
              +D+A+  DAEG     QS V     LS + LP   +  TA     +  G Q       
Sbjct  174  HFEDVASSNDAEG-----QSEV-----LSVEPLPLAQLTLTACTNAWVLTGHQLVAKFNE  223

Query  669  EAQNLVKVYLANVRLKEVTADILITAYEPIVIN  767
            EA+N V +++A  RL + + D+L+T  +P  IN
Sbjct  224  EARNAVTIHMALFRLPQHSTDMLVTFNDPAAIN  256



>ref|XP_007434965.1| PREDICTED: ran guanine nucleotide release factor-like isoform 
X1 [Python bivittatus]
Length=189

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 102/197 (52%), Gaps = 11/197 (6%)
 Frame = +3

Query  315  DMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADN  494
            D   E PLFGGA +   P    D+S +RQVPD+QEVFV P+ D+S+I ELLE +  V D 
Sbjct  3    DEPQESPLFGGAFSGHLPPGSLDISEMRQVPDNQEVFVHPSTDQSIIMELLEYQAGVPDE  62

Query  495  GSATWFLQDLANEQDAEGTMVIEQSGVVEAPG-LSFQTLPAIITTAVGQMAISKGRQGRE  671
             +A +  +D+A   ++    ++ Q     AP  L+F+   +      G+  ++K  +  E
Sbjct  63   NAARYHFEDIAG--NSASIEILSQDHF--APDLLAFEGCSSAWQL-TGRQQVAKFNE--E  115

Query  672  AQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEV  851
            A+N V V+L  +RL +   D+L+T  +P  IN LS SA        VP A +      E 
Sbjct  116  AKNDVTVHLVLLRLPQYRTDLLVTFNDPTWINPLSTSAVQT---TEVPLAPSQPPWTVEH  172

Query  852  FKLAVSTFKVNDWRLFG  902
            F     + ++ D  LFG
Sbjct  173  FHAFARSLRLLDPGLFG  189



>ref|XP_003974013.1| PREDICTED: ran guanine nucleotide release factor-like [Takifugu 
rubripes]
Length=193

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 91/158 (58%), Gaps = 7/158 (4%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGGA+++  P    D+S++R++PD+QEVF  P  D+SLI EL+E +  V D  +A +
Sbjct  12   RPLFGGALSAAIPSSATDISDLREIPDNQEVFAHPHTDQSLIVELVEYQGQVEDQDAAKY  71

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTA---VGQMAISKGRQGREAQN  680
              +D+A+   A      E + VV  P    +   +  +TA    G   ++K  +  EA+N
Sbjct  72   HFEDIASSNKALAAGAFEVTNVV--PLSKSEVSLSDCSTAWMLTGTQCVAKFNE--EARN  127

Query  681  LVKVYLANVRLKEVTADILITAYEPIVINLLSESASAV  794
            +V ++L   RL + + +IL+T  +P  IN  S SA++V
Sbjct  128  MVTLHLGLFRLPQFSTEILVTFNDPERINPESSSAASV  165



>ref|XP_005795606.1| PREDICTED: ran guanine nucleotide release factor-like [Xiphophorus 
maculatus]
Length=212

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 82/146 (56%), Gaps = 9/146 (6%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGGA+++  P    D+S +R++PD+QEVF  P  D+SLI ELLE +  VAD  +A +
Sbjct  31   RPLFGGALSAVIPYNVTDISELREIPDNQEVFAHPHTDQSLIVELLEYQGQVADQDAARY  90

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAP----GLSFQTLPAIITTAVGQMAISKGRQGREAQ  677
              +D+A    A+     + S V   P     LS  +   ++    G   +SK  +  EA+
Sbjct  91   HFEDIAGSNKAQEPGAFDVSNVAALPKAEVSLSECSSAWMLK---GTQCVSKFNE--EAR  145

Query  678  NLVKVYLANVRLKEVTADILITAYEP  755
            N V ++L  +RL + + DILIT  +P
Sbjct  146  NTVSIHLGLLRLPQFSTDILITFNDP  171



>emb|CDH56151.1| ran guanine nucleotide release factor-like [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=183

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 100/195 (51%), Gaps = 19/195 (10%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPL+GGAI+      F DVSNVRQVPD+QEVFVD    +SLI ELLE  + V ++  A +
Sbjct  4    RPLYGGAISCPVGNSFLDVSNVRQVPDNQEVFVDMDTQQSLIIELLEPVEAVNED-IARF  62

Query  510  FLQDLANEQ---DAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGRE-AQ  677
              Q LA++    +A    VI+       P L   T   I+    G   ++K  + ++ A 
Sbjct  63   HFQQLADDNEATEAHVNSVIKLDSKTAVPRLPSDT--TIVHMLRGTQKVAKFNEAKDMAY  120

Query  678  NLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFK  857
            N V++ +A VRL +V  D++I+   PI++   S   +   A V             +  +
Sbjct  121  NTVEIRMAVVRLAQVETDLVISINAPILVAPGSTDQATTAANV------------EQHIE  168

Query  858  LAVSTFKVNDWRLFG  902
              +S  +VNDW LFG
Sbjct  169  AILSQLQVNDWSLFG  183



>emb|CDQ80495.1| unnamed protein product [Oncorhynchus mykiss]
Length=248

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 86/154 (56%), Gaps = 5/154 (3%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGGA+++T P   +D+S +R++PD+QEVF     D+S+I ELLEL+  V +  +A +
Sbjct  63   RPLFGGALSATIPHSAKDISELREIPDNQEVFAHDHNDQSIIVELLELQSHVQNGDAARY  122

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPG--LSFQTLPAIITTAVGQMAISKGRQGREAQNL  683
              +D+A    A      E   VV  P   LS +   +      G   ++K  +  EA+N 
Sbjct  123  HFEDVAGSNKASAPGTSEVRAVVALPKSDLSLEGCSSAFLL-TGTQCVAKFNE--EAKNT  179

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESA  785
            V ++L   RL + + D+L+T  +P+ I+  S SA
Sbjct  180  VTIHLGLFRLPQFSTDVLVTFNDPLSISPGSSSA  213



>ref|XP_008305349.1| PREDICTED: ran guanine nucleotide release factor [Cynoglossus 
semilaevis]
 ref|XP_008305350.1| PREDICTED: ran guanine nucleotide release factor [Cynoglossus 
semilaevis]
Length=193

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 94/161 (58%), Gaps = 13/161 (8%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGGA+++  P    DVS++R++PD+QEVF     D+SLI EL+E +  V+D  SA +
Sbjct  12   RPLFGGALSAVIPHSATDVSDLREIPDNQEVFAHAHTDQSLIVELVEFQAQVSDQDSALY  71

Query  510  FLQDLANEQDA--EGTMVIEQSGVVEAP----GLSFQTLPAIITTAVGQMAISKGRQGRE  671
              +D+A+   A   GT  +  S VV  P     LS  +   +++   G   +SK  +  +
Sbjct  72   HFEDIADSNKALEPGTFAV--SNVVALPPTEISLSECSSAWMLS---GTQCVSKFNE--Q  124

Query  672  AQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAV  794
            A+N V ++L   RL + T +IL+T  +P +I+  S SA++V
Sbjct  125  ARNTVTIHLGLFRLPQFTTEILVTFNDPQIISPDSSSAASV  165



>ref|XP_005999833.1| PREDICTED: ran guanine nucleotide release factor [Latimeria chalumnae]
Length=203

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 64/201 (32%), Positives = 102/201 (51%), Gaps = 20/201 (10%)
 Frame = +3

Query  336  LFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWFL  515
            LFGG+ ++  P   +D+S  + +PD+QEVF+    D+S+I ELLE +  +AD  +A +  
Sbjct  11   LFGGSFSAVLPPNRKDISEFQDIPDNQEVFIHTRTDQSIIVELLEYQGHLADQDAARYHF  70

Query  516  QDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPA--IITTAVGQMAISKGRQ-----GREA  674
            +D+A+  DA G+   E+S V     LS + LP+  +            GRQ       +A
Sbjct  71   EDIASSNDASGS---EKSEV-----LSVELLPSDRLSFPECSSAWFLSGRQLVAKFNEQA  122

Query  675  QNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEV-  851
            +N V VYL   RL + T DIL+T   P VI  LS S+ +     + P A    +      
Sbjct  123  RNTVNVYLGLFRLPQYTTDILVTFNHPTVIGPLSSSSGSASVQGSFPTAAGEALEATPAW  182

Query  852  ----FKLAVSTFKVNDWRLFG  902
                F++ + TF++ +  +FG
Sbjct  183  NLNHFQILLQTFRLLNPTVFG  203



>ref|XP_003439948.1| PREDICTED: ran guanine nucleotide release factor-like [Oreochromis 
niloticus]
Length=191

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 101/195 (52%), Gaps = 17/195 (9%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
             PLFGGA+++  P    D+S +R++PD+QEVF     D+SLI EL+E +  VAD  +A +
Sbjct  10   HPLFGGALSAVIPHSATDISELREIPDNQEVFAHAHTDQSLIVELVEYQGQVADQDAARY  69

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAP----GLSFQTLPAIITTAVGQMAISKGRQGREAQ  677
              +D+A    A      E + VV  P     LS  +   ++T   G  ++SK  +  EA+
Sbjct  70   HFEDIAGSNKALEPGAFEVTSVVTLPKSELSLSECSTAWMLT---GTQSVSKFNE--EAR  124

Query  678  NLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFK  857
            N V ++L   RL + + D+LIT  +P  I+   ES+SA   G            M + F+
Sbjct  125  NSVTIHLGLFRLPQFSTDVLITFNDPQSIS--PESSSACAVGTHQQPW------MVKDFQ  176

Query  858  LAVSTFKVNDWRLFG  902
              V T  +++  LFG
Sbjct  177  RLVQTLTLHNPGLFG  191



>emb|CDS02651.1| hypothetical protein LRAMOSA00056 [Absidia idahoensis var. thermophila]
Length=183

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 98/195 (50%), Gaps = 19/195 (10%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPL+GGAI+      F DVSNVRQVPD+QEVFVD    +SLI ELLE  + V ++  A +
Sbjct  4    RPLYGGAISCPVGNSFLDVSNVRQVPDNQEVFVDMETQQSLIIELLEPVEAVNED-IARF  62

Query  510  FLQDLANEQ---DAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGRE-AQ  677
              Q LA++    DA    V +       P L   T   I+    G   ++K  + ++ A 
Sbjct  63   HFQQLADDNEAIDAHVDSVTKLDSKTAVPCLPSDT--TIVHLLRGTQKVAKFNEAKDMAY  120

Query  678  NLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFK  857
            N V++ +A +RL +V  D++I+   P+++       S   A  A    Q+          
Sbjct  121  NTVEIRMAVIRLAQVETDLVISINAPVLV----APGSTDHATTATNVDQS--------IA  168

Query  858  LAVSTFKVNDWRLFG  902
              +S  +VNDW LFG
Sbjct  169  AILSQLQVNDWSLFG  183



>ref|XP_005732275.1| PREDICTED: ran guanine nucleotide release factor-like isoform 
X1 [Pundamilia nyererei]
Length=198

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 99/193 (51%), Gaps = 13/193 (7%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
             PLFGGA+++  P    D+S +R++PD+QEVF     D+SLI EL+E +  VAD  +A +
Sbjct  17   HPLFGGALSAVIPHSATDISELREIPDNQEVFAHAHTDQSLIVELVEYQGQVADQDAARY  76

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAV--GQMAISKGRQGREAQNL  683
              +D+A    A      E + VV  P  S  +L    T  +  G   +SK  +  EA+N 
Sbjct  77   HFEDIAGSNKALEPGAFEVTSVVALPK-SELSLSECSTAWMLSGTQCVSKFNE--EARNS  133

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLA  863
            V ++L   RL + + D+LIT  +P  I+   ES+SA   G            M + F+  
Sbjct  134  VTIHLGLFRLPQFSTDVLITFNDPQSIS--PESSSACAVGTHQQPW------MVKDFQHL  185

Query  864  VSTFKVNDWRLFG  902
            V T  +++  LFG
Sbjct  186  VQTLTLHNPGLFG  198



>ref|XP_004557275.1| PREDICTED: ran guanine nucleotide release factor-like isoform 
X1 [Maylandia zebra]
Length=198

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 86/157 (55%), Gaps = 5/157 (3%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
             PLFGGA+++  P    D+S +R++PD+QEVF     D+SLI EL+E +  VAD  +A +
Sbjct  17   HPLFGGALSAVIPHSATDISELREIPDNQEVFAHAHTDQSLIVELVEYQGQVADQDAARY  76

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAV--GQMAISKGRQGREAQNL  683
              +D+A    A      E + VV  P  S  +L    T  +  G   +SK  +  EA+N 
Sbjct  77   HFEDIAGSNKALEPGAFEVTSVVALPK-SELSLSECSTAWMLSGTQCVSKFNE--EARNS  133

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAV  794
            V ++L   RL + + D+LIT  +P  I+  S SA AV
Sbjct  134  VTIHLGLFRLPQFSTDVLITFNDPQSISPESSSACAV  170



>ref|XP_005923290.1| PREDICTED: ran guanine nucleotide release factor-like isoform 
X2 [Haplochromis burtoni]
 ref|XP_005923291.1| PREDICTED: ran guanine nucleotide release factor-like isoform 
X3 [Haplochromis burtoni]
Length=193

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 99/193 (51%), Gaps = 13/193 (7%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
             PLFGGA+++  P    D+S +R++PD+QEVF     D+SLI EL+E +  VAD  +A +
Sbjct  12   HPLFGGALSAVIPHSATDISELREIPDNQEVFAHAHTDQSLIVELVEYQGQVADQDAARY  71

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAV--GQMAISKGRQGREAQNL  683
              +D+A    A      E + VV  P  S  +L    T  +  G   +SK  +  EA+N 
Sbjct  72   HFEDIAGSNKALEPGAFEVTSVVALPK-SELSLSECSTAWMLSGTQCVSKFNE--EARNS  128

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLA  863
            V ++L   RL + + D+LIT  +P  I+   ES+SA   G            M + F+  
Sbjct  129  VTIHLGLFRLPQFSTDVLITFNDPQSIS--PESSSACAVGTHQQPW------MVKDFQHL  180

Query  864  VSTFKVNDWRLFG  902
            V T  +++  LFG
Sbjct  181  VQTLTLHNPGLFG  193



>ref|XP_005732276.1| PREDICTED: ran guanine nucleotide release factor-like isoform 
X2 [Pundamilia nyererei]
 ref|XP_005732277.1| PREDICTED: ran guanine nucleotide release factor-like isoform 
X3 [Pundamilia nyererei]
Length=193

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 99/193 (51%), Gaps = 13/193 (7%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
             PLFGGA+++  P    D+S +R++PD+QEVF     D+SLI EL+E +  VAD  +A +
Sbjct  12   HPLFGGALSAVIPHSATDISELREIPDNQEVFAHAHTDQSLIVELVEYQGQVADQDAARY  71

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAV--GQMAISKGRQGREAQNL  683
              +D+A    A      E + VV  P  S  +L    T  +  G   +SK  +  EA+N 
Sbjct  72   HFEDIAGSNKALEPGAFEVTSVVALPK-SELSLSECSTAWMLSGTQCVSKFNE--EARNS  128

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLA  863
            V ++L   RL + + D+LIT  +P  I+   ES+SA   G            M + F+  
Sbjct  129  VTIHLGLFRLPQFSTDVLITFNDPQSIS--PESSSACAVGTHQQPW------MVKDFQHL  180

Query  864  VSTFKVNDWRLFG  902
            V T  +++  LFG
Sbjct  181  VQTLTLHNPGLFG  193



>ref|XP_005923289.1| PREDICTED: ran guanine nucleotide release factor-like isoform 
X1 [Haplochromis burtoni]
Length=198

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 99/193 (51%), Gaps = 13/193 (7%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
             PLFGGA+++  P    D+S +R++PD+QEVF     D+SLI EL+E +  VAD  +A +
Sbjct  17   HPLFGGALSAVIPHSATDISELREIPDNQEVFAHAHTDQSLIVELVEYQGQVADQDAARY  76

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAV--GQMAISKGRQGREAQNL  683
              +D+A    A      E + VV  P  S  +L    T  +  G   +SK  +  EA+N 
Sbjct  77   HFEDIAGSNKALEPGAFEVTSVVALPK-SELSLSECSTAWMLSGTQCVSKFNE--EARNS  133

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLA  863
            V ++L   RL + + D+LIT  +P  I+   ES+SA   G            M + F+  
Sbjct  134  VTIHLGLFRLPQFSTDVLITFNDPQSIS--PESSSACAVGTHQQPW------MVKDFQHL  185

Query  864  VSTFKVNDWRLFG  902
            V T  +++  LFG
Sbjct  186  VQTLTLHNPGLFG  198



>ref|XP_004557276.1| PREDICTED: ran guanine nucleotide release factor-like isoform 
X2 [Maylandia zebra]
Length=193

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 86/157 (55%), Gaps = 5/157 (3%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
             PLFGGA+++  P    D+S +R++PD+QEVF     D+SLI EL+E +  VAD  +A +
Sbjct  12   HPLFGGALSAVIPHSATDISELREIPDNQEVFAHAHTDQSLIVELVEYQGQVADQDAARY  71

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAV--GQMAISKGRQGREAQNL  683
              +D+A    A      E + VV  P  S  +L    T  +  G   +SK  +  EA+N 
Sbjct  72   HFEDIAGSNKALEPGAFEVTSVVALPK-SELSLSECSTAWMLSGTQCVSKFNE--EARNS  128

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAV  794
            V ++L   RL + + D+LIT  +P  I+  S SA AV
Sbjct  129  VTIHLGLFRLPQFSTDVLITFNDPQSISPESSSACAV  165



>ref|XP_006790194.1| PREDICTED: ran guanine nucleotide release factor-like [Neolamprologus 
brichardi]
Length=193

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 98/193 (51%), Gaps = 13/193 (7%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
             PLFGGA+++  P    D+S +R++PD+QEVF     D+SLI EL+E +  VAD  +A +
Sbjct  12   HPLFGGALSAVIPHSATDISELREIPDNQEVFAHAHTDQSLIVELVEYQGQVADQDAARY  71

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAV--GQMAISKGRQGREAQNL  683
              +D+A    A      E + VV  P  S   L    T  +  G   +SK  +  EA+N 
Sbjct  72   HFEDIAGSNKALEPGAFEVTSVVALPK-SELCLSECSTAWMLSGTQCVSKFNE--EARNS  128

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLA  863
            V ++L   RL + + D+LIT  +P  I+   ES+SA   G            M + F+  
Sbjct  129  VTIHLGLFRLPQFSTDVLITFNDPQSIS--PESSSACAVGTHQQPW------MVKDFQHL  180

Query  864  VSTFKVNDWRLFG  902
            V T  +++  LFG
Sbjct  181  VQTLTLHNPGLFG  193



>ref|XP_500317.1| YALI0A21098p [Yarrowia lipolytica]
 emb|CAG84255.1| YALI0A21098p [Yarrowia lipolytica CLIB122]
Length=164

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 95/195 (49%), Gaps = 38/195 (19%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVD--PARDESLIFELLELKQDVADNGSA  503
            + LFGGA+ +  P  F D S  RQVPD QEVFVD  PA +ESLIF++LE   D  D    
Sbjct  4    KELFGGALTALVPTSFADASQFRQVPDTQEVFVDDGPA-EESLIFDILEKISDADDTAIK  62

Query  504  TWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNL  683
            T F + +A        +  EQ    E P          I T +G+    K   G+E++ L
Sbjct  63   THFGEIVAINGGESRIVTSEQLQGTEYP----------IWTCLGEQETKK--WGKESEEL  110

Query  684  VKVYL--ANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFK  857
             KV +  A +RL++V+ DI+I+       N+L               AQ G   + E+ K
Sbjct  111  TKVTICVALIRLEKVSTDIVIS------YNVLKGE-----------RAQEGYERLKEIAK  153

Query  858  LAVSTFKVNDWRLFG  902
                +FKVNDW LFG
Sbjct  154  ----SFKVNDWNLFG  164



>ref|XP_008275660.1| PREDICTED: ran guanine nucleotide release factor [Stegastes partitus]
 ref|XP_008275661.1| PREDICTED: ran guanine nucleotide release factor [Stegastes partitus]
Length=193

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 82/146 (56%), Gaps = 9/146 (6%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
             PLFGGA+++  P    DVS +R++PD+QEVFV    D+SLI EL+E +  VAD  +A +
Sbjct  12   HPLFGGALSAVVPHSATDVSELREIPDNQEVFVHAHTDQSLIVELVEYQAQVADQDAARY  71

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAP----GLSFQTLPAIITTAVGQMAISKGRQGREAQ  677
              +D+A    A      E + VV  P     LS  +   ++T   G   +SK  +  EA+
Sbjct  72   HFEDIAGSNKALEPGAFEVTTVVALPKPELSLSECSSAWMLT---GTQCVSKFNE--EAR  126

Query  678  NLVKVYLANVRLKEVTADILITAYEP  755
            N V ++L  +RL + + D+LIT  +P
Sbjct  127  NTVTLHLGLLRLPQFSTDVLITFNDP  152



>ref|XP_001700745.1| ran-binding protein Mog1 [Chlamydomonas reinhardtii]
 gb|EDP06999.1| ran-binding protein Mog1 [Chlamydomonas reinhardtii]
Length=191

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 95/193 (49%), Gaps = 16/193 (8%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            R L+GGA+  + P R  DVS++R VPDHQE++ D   D+++IFE++E    V D  +   
Sbjct  13   RELWGGAVTCSLPARMLDVSDMRPVPDHQEIWADTGVDQAVIFEIVEHDAAVPDGEAGRH  72

Query  510  FLQDLA--NEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNL  683
              +D A  NE  A     +   GV + PG+   +   ++    G+  + +G+Q  +    
Sbjct  73   MFEDAAVGNEAVAAAVESVAALGVQDVPGVPEASYRCVVR---GRQTMRRGQQAAD----  125

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLA  863
              V LA +RL  V++D+LIT   P      S   + V AG  V A   G     E+    
Sbjct  126  TCVLLAVLRLPHVSSDLLITLSTP------SAPQTPV-AGAVVSAPALGEGEQQELMAAV  178

Query  864  VSTFKVNDWRLFG  902
            + + +V  W LFG
Sbjct  179  LRSLRVQSWELFG  191



>ref|XP_007434966.1| PREDICTED: ran guanine nucleotide release factor-like isoform 
X2 [Python bivittatus]
Length=152

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 86/156 (55%), Gaps = 8/156 (5%)
 Frame = +3

Query  315  DMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADN  494
            D   E PLFGGA +   P    D+S +RQVPD+QEVFV P+ D+S+I ELLE +  V D 
Sbjct  3    DEPQESPLFGGAFSGHLPPGSLDISEMRQVPDNQEVFVHPSTDQSIIMELLEYQAGVPDE  62

Query  495  GSATWFLQDLANEQDAEGTMVIEQSGVVEAPG-LSFQTLPAIITTAVGQMAISKGRQGRE  671
             +A +  +D+A   ++    ++ Q     AP  L+F+   +      G+  ++K  +  E
Sbjct  63   NAARYHFEDIAG--NSASIEILSQDHF--APDLLAFEGCSSAWQL-TGRQQVAKFNE--E  115

Query  672  AQNLVKVYLANVRLKEVTADILITAYEPIVINLLSE  779
            A+N V V+L  +RL +   D+L+T  +P  I   SE
Sbjct  116  AKNDVTVHLVLLRLPQYRTDLLVTFNDPTWIKQPSE  151



>ref|XP_637974.1| Ran GTPase binding protein [Dictyostelium discoideum AX4]
 sp|Q54ML6.1|MOG1_DICDI RecName: Full=Probable ran guanine nucleotide release factor; 
Short=RanGNRF [Dictyostelium discoideum]
 gb|EAL64470.1| Ran GTPase binding protein [Dictyostelium discoideum AX4]
Length=195

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 61/200 (31%), Positives = 99/200 (50%), Gaps = 15/200 (8%)
 Frame = +3

Query  315  DMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADN  494
            + + +R L+GGAI    P RF DV++ R +PDHQE+F D   D+S+I EL E  QD   N
Sbjct  3    ETFEKRQLYGGAIEIDIPRRFIDVTSYRHIPDHQELFSDEKSDQSVIIELNEF-QDHISN  61

Query  495  GSATW-----FLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGR  659
             +A        ++D     D    +   +    E P     ++P  +  A  Q  I+K  
Sbjct  62   ANAIKHHYEVLVEDAGISTDKSVILNFRELTQAEMPNFD-ASIPKYVLLA--QQKIAKFN  118

Query  660  QGREAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMP  839
            +   A+N + +Y+A VRL++   D+LIT  E I +   S S + V+  +     Q+    
Sbjct  119  ET--AENTINIYMALVRLEKSKTDLLITFNEAIALAPTSSSVAVVQ-NLTPSNDQSKS--  173

Query  840  MAEVFKLAVSTFKVNDWRLF  899
              ++F   + +FK+ D+ LF
Sbjct  174  -EQLFLTMLKSFKIKDYSLF  192



>gb|ACX55053.1| Mog1 protein [Euglena gracilis]
Length=172

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 87/180 (48%), Gaps = 18/180 (10%)
 Frame = +3

Query  381  DVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWFLQDLANEQDAEGTMVI  560
            D S++RQVPD+ EVFVDP  D  ++ ELL++  DV  +  A +  Q+LA E  AE     
Sbjct  6    DASDIRQVPDNDEVFVDPDTDSCIVVELLDVNADVPLDQLALFHFQELAKENRAEA----  61

Query  561  EQSGVVEAPGLSFQTLP----AIITTAVGQMAISKGRQGREAQNLVKVYLANVRL-KEVT  725
            E    V  P  +   LP    A   T  GQ  ++K ++   A NLV +YLA VRL     
Sbjct  62   EVGSCVVLPDSAMPHLPPTPQAFKQTLFGQQKVAKFKE--IAANLVNIYLAVVRLGPPHN  119

Query  726  ADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAVSTFKVNDWRLFGA  905
             +ILIT   P+ I+  S SA     G      +A       VF   +++F V D+   G 
Sbjct  120  TEILITLSAPVAIHPDSSSAGLTPLGGNTALCEA-------VFGQLLASFNVRDYSFLGG  172



>ref|XP_003880103.1| putative mog1 protein [Neospora caninum Liverpool]
 emb|CBZ50068.1| putative mog1 protein [Neospora caninum Liverpool]
Length=174

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 99/192 (52%), Gaps = 26/192 (14%)
 Frame = +3

Query  333  PLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWF  512
            PLFGGA+A   P  F+DVS +RQVPD+QEVF+D + + S++ E++E +++V+D  ++ +F
Sbjct  5    PLFGGAMACQLPDTFKDVSTIRQVPDNQEVFMDMSSERSVVIEIVEYQENVSDGDASRFF  64

Query  513  LQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG--REAQNLV  686
              DLA E  A    +        +    ++  P I  +    + ++KG Q   ++    V
Sbjct  65   FCDLAKENGATDAQL--------SSSFIWKDEPRIPISERHVVIVAKGVQQLRQDGTKRV  116

Query  687  KVYLANVRLKEVTADILITAY-EPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLA  863
             V +A +R+    A+ILI+ Y EP   +     AS V A  +V            VF+  
Sbjct  117  PVEMAIIRVPGHNAEILISLYGEP---SDGEPDASKVDAEDSV------------VFEQL  161

Query  864  VSTFKVNDWRLF  899
            +  F + D+ LF
Sbjct  162  IGAFVITDYSLF  173



>ref|XP_008022833.1| hypothetical protein SETTUDRAFT_127511 [Setosphaeria turcica 
Et28A]
 gb|EOA89956.1| hypothetical protein SETTUDRAFT_127511 [Setosphaeria turcica 
Et28A]
Length=192

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 92/201 (46%), Gaps = 21/201 (10%)
 Frame = +3

Query  321  YSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGS  500
            +   PL+GGAI    P  F D SN+RQ+PDHQEV++D     S++ E+LE     +D+ +
Sbjct  3    FKNTPLYGGAITMDLPSNFADASNIRQIPDHQEVYLDTNGYTSIVVEILEYVDKPSDDEA  62

Query  501  ATWFLQDLANEQDAEGTMVIEQSGVV------EAP--GLSFQTLPAIITTAVGQMAISKG  656
              +   DL +    + T VI Q  V       E P  GLSF     I T        S  
Sbjct  63   LQYHFADLVDGT-GDATSVIAQEKVCMKLMPPELPALGLSF-----IQTPPSPTSTSSPP  116

Query  657  RQGREAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCM  836
            R  R+      + L  +RLKE   D++I+   P   +   E A+  + G   P       
Sbjct  117  RPNRKTPEYTYIQLVLLRLKEQGTDLMISINTP---HYPGEYAAPAQPGAETPLMLDSNG  173

Query  837  PMAEVFKLAVSTFKVNDWRLF  899
              A+V +    +F+VN+W LF
Sbjct  174  IRAKVLE----SFQVNEWGLF  190



>gb|EJK64591.1| hypothetical protein THAOC_14659, partial [Thalassiosira oceanica]
Length=253

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 61/206 (30%), Positives = 96/206 (47%), Gaps = 37/206 (18%)
 Frame = +3

Query  336  LFGGAI-ASTFPVRFQDVSNVRQVPDHQEVF---VDPARDESLIFELLELKQDVADNGSA  503
            LFGGA+  S  P  ++DVS +RQ PDHQEVF   V+      L+FE+L+ ++ V D  + 
Sbjct  68   LFGGAVLCSGIPSSWRDVSQIRQCPDHQEVFQGCVEETGGVLLVFEVLQHQERVEDESAG  127

Query  504  TWFLQDLANEQDAEGTMVIEQSGVV------------EAPGLSF-QTLPAIITTAVGQMA  644
             +FL DLA+   A  + V+  SG V              P L        +   + G+  
Sbjct  128  AFFLSDLADSNRAAESSVV--SGRVIKSLDDAVDVKDALPSLRIPDGFSGVACISRGRQK  185

Query  645  ISKGRQGREAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQ  824
            +++G+ GR     + +++  +RL+ V  D +I+   P     L E +SA +         
Sbjct  186  VAQGKDGRNEARWIDIHMCVLRLRCVETDFVISLSVP-----LGEESSAAQ---------  231

Query  825  AGCMPMAEVFKLAVSTFKVNDWRLFG  902
                   E+F   +  FK+ DW LFG
Sbjct  232  ----DSHEIFSEILRGFKIIDWNLFG  253



>gb|EPY36533.1| Ran-binding protein [Angomonas deanei]
 gb|EPY37801.1| Ran-binding protein [Angomonas deanei]
 gb|EPY38781.1| Ran-binding protein [Angomonas deanei]
Length=202

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 103/202 (51%), Gaps = 24/202 (12%)
 Frame = +3

Query  336  LFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWFL  515
            L+GGAI+   P   QD+S  RQVPD+QE++ D     ++I E+LE +  V D  +AT+F 
Sbjct  8    LYGGAISCELPTTLQDMSQWRQVPDNQEMYSDVDTGATIIAEILERQDTVPDKEAATFFY  67

Query  516  QDLANEQDA-------EGTMVIEQSGVVEAPGLSF-QTLP-----AIITTAVGQMAISKG  656
             DLAN           E T  +E S V   PGL+   +LP     A I TA G   ISK 
Sbjct  68   YDLANANGCWKEQCTLESTQSLEPSAV---PGLAAGSSLPHYQPCAYICTADGTQLISKY  124

Query  657  RQGREAQNLVKVYLANVRLK-EVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGC  833
               +  ++ V V +A +R +  + A+++++   P+ I+  S  A  ++  +    A+   
Sbjct  125  TNEKGKESEVSVRIAVLRYEAPIAAELMLSLSNPVKIHPESSDAKVIKRTL---TAEESF  181

Query  834  MPMAEVFKLAVSTFKVNDWRLF  899
            +    +FK  V +  ++++ LF
Sbjct  182  L----LFKRVVESLAIHNYGLF  199



>gb|ESW98610.1| hypothetical protein HPODL_05254 [Ogataea parapolymorpha DL-1]
Length=174

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 99/199 (50%), Gaps = 32/199 (16%)
 Frame = +3

Query  321  YSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFV-----DPARDESLIFELLELKQDV  485
            + E  L+GGAI +  P    D S +RQ+PD QEVFV         ++++IF+LLE    V
Sbjct  3    FEETQLYGGAITTQIPAGLIDASTLRQIPDTQEVFVAGPDTQLGPEDAIIFDLLE-SVGV  61

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
            AD+ +A +  Q+LA    AE   ++E +  ++ P  +F   PA +   VG     K   G
Sbjct  62   ADDAAAEYHFQELAKLNGAENAKILE-AAKIQCP--NFAQDPAYVL--VGSQEAKK--WG  114

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
            R+   LV V L  +RL++V  D+LIT   P               G  +PAA+       
Sbjct  115  RDQTELV-VLLGLIRLQKVQTDLLITYNLP-----------GSDFGPRIPAAK-------  155

Query  846  EVFKLAVSTFKVNDWRLFG  902
            +V + A+ + +V DW LFG
Sbjct  156  QVIQHALESLRVQDWSLFG  174



>gb|EME39846.1| hypothetical protein DOTSEDRAFT_74672 [Dothistroma septosporum 
NZE10]
Length=191

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 101/192 (53%), Gaps = 17/192 (9%)
 Frame = +3

Query  336  LFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWFL  515
            LFGGAI +  P  FQDVS +RQVPD+QEV++D     S+ F++LE  +  +D  +  + L
Sbjct  11   LFGGAIVAEIPSTFQDVSTIRQVPDNQEVYLDSEGFTSITFDILERVERESDVEALKFHL  70

Query  516  QDLANEQDAEGTMVIEQSGVVEA-PGLSFQTLPAIITTAVGQMAISKGRQGREAQ-NLVK  689
             D+ +E   +  +    + V+ + PG    TL A  T+  G+      R+GR  +   V 
Sbjct  71   ADVVDEDAGQTRLYSSGTAVLASMPGTPVLTLLA--TSPPGEK-----RRGRANEPEFVG  123

Query  690  VYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAG-CMPMAEVFKLAV  866
            + +A +RL+    D+++T      +N+     S  +AG+ V   + G  +  A+V K  V
Sbjct  124  ILMALIRLEAQKTDVVVT------VNVPHLPGSYEKAGLRVEEGRYGPLLEAAQVVKDKV  177

Query  867  -STFKVNDWRLF  899
              +F+V DW LF
Sbjct  178  LGSFEVRDWGLF  189



>ref|XP_010729399.1| PREDICTED: ran guanine nucleotide release factor-like [Larimichthys 
crocea]
Length=207

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 81/146 (55%), Gaps = 9/146 (6%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGGA+++  P    DVS +R++PD+QEVF     D+SLI EL+E +  VAD  +A +
Sbjct  26   RPLFGGALSAALPHSAADVSQLREIPDNQEVFAHAHTDQSLIVELVEYQGQVADQDAARY  85

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAP----GLSFQTLPAIITTAVGQMAISKGRQGREAQ  677
              +D+A    A      + + VV  P     LS  +   ++T   G   +SK  +  EA+
Sbjct  86   HFEDIAGSNQALEPGAFQVTSVVLLPKSELSLSDCSSAWMLT---GTQRVSKFNE--EAR  140

Query  678  NLVKVYLANVRLKEVTADILITAYEP  755
            N V ++L   RL + + ++LIT  +P
Sbjct  141  NTVTLHLGLFRLPQFSTEVLITFNDP  166



>gb|ELW63572.1| Ran guanine nucleotide release factor [Tupaia chinensis]
Length=146

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 77/142 (54%), Gaps = 5/142 (4%)
 Frame = +3

Query  333  PLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWF  512
            PLFGGA ++  P R  DVS++R VPD+QEVF  P  D+SLI ELLEL+  V    +A + 
Sbjct  8    PLFGGAFSAILPTRAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVRGEAAARYH  67

Query  513  LQDLANEQDAEGTMVIE-QSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVK  689
             +D+   Q A   +V   Q   +E   LS     A + +   Q+A    ++ ++    V 
Sbjct  68   FEDVGGVQGARAVLVESVQPLGLENLALSSCCQEAWVLSGKQQVA----KENQQVAKDVT  123

Query  690  VYLANVRLKEVTADILITAYEP  755
            V+ A +RL +   D+L+T  +P
Sbjct  124  VHQALLRLPQYQTDLLLTFNQP  145



>emb|CEG82666.1| hypothetical protein RMATCC62417_16709 [Rhizopus microsporus]
Length=184

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 89/197 (45%), Gaps = 21/197 (11%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGGAI       F D S++RQVPD+QEVFVD    +S I ELLE   D  D   A +
Sbjct  3    RPLFGGAIVCPIRPSFLDASSIRQVPDNQEVFVDTETQQSFIVELLE-PADARDQEIAKF  61

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQ------GRE  671
              Q L  + +A        S +V       + +  ++     ++ +  G+Q       ++
Sbjct  62   HFQQLCEDNEAAD------SAIVSVEHCKPEEITPLLPKDTTEVYLLHGKQMVAKFNEKD  115

Query  672  AQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEV  851
            A N + + LA VR  +V+ D +I+   P+ +        A  +  A    QA    + + 
Sbjct  116  ALNTIDILLAVVRFNQVSTDCVISMNVPVQV--------AANSSEAESFTQANVDLVKQD  167

Query  852  FKLAVSTFKVNDWRLFG  902
                +   +V DW LFG
Sbjct  168  MMTILQGLQVKDWSLFG  184



>ref|NP_001032537.1| ran guanine nucleotide release factor [Bos taurus]
 sp|Q32PE2.1|MOG1_BOVIN RecName: Full=Ran guanine nucleotide release factor; Short=RanGNRF; 
AltName: Full=Ran-binding protein MOG1 [Bos taurus]
 gb|AAI08152.1| RAN guanine nucleotide release factor [Bos taurus]
Length=186

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 97/195 (50%), Gaps = 15/195 (8%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            + PLFGGA ++T P    DVS++R VPDHQEVF     D+SLI ELLEL+  V    +A 
Sbjct  6    DNPLFGGAFSATLPPGAIDVSDLRPVPDHQEVFCHRVTDQSLIVELLELQAHVQGEEAAR  65

Query  507  WFLQDLANEQDAEGTMV-IEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNL  683
            +  +D+   Q+A    V   Q  V+E   L      A I +  GQ  ++K  Q  +    
Sbjct  66   YHFEDVGGVQEARAVQVETVQPLVLEKLALRGCCQEAWILS--GQQQVAKENQ--QVAKY  121

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLA  863
            V ++ A +RL +   D+L+T  +P   N     +S     +++P    G       F+  
Sbjct  122  VTLHQALLRLPQYQTDLLLTFNQPPPEN----RSSLGPENLSIPPWSLG------DFEQL  171

Query  864  VSTFKVNDWRLFGAD  908
            V++  ++D  +FG +
Sbjct  172  VTSLTLHDPNIFGPE  186



>ref|XP_002370023.1| mog1 protein, putative [Toxoplasma gondii ME49]
 gb|EPT32039.1| Ran-interacting Mog1 protein [Toxoplasma gondii ME49]
 gb|KFH14557.1| Ran-interacting Mog1 protein [Toxoplasma gondii MAS]
Length=183

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 82/145 (57%), Gaps = 13/145 (9%)
 Frame = +3

Query  333  PLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWF  512
            PLFGGA+A   P  F+DVS +RQVPD+QEVF+D + + S++ E++E ++ V+D  +A +F
Sbjct  14   PLFGGAMACDLPDTFKDVSTIRQVPDNQEVFMDMSSERSVVIEIVEYQETVSDGDAARFF  73

Query  513  LQDLANEQDAEGTMVIEQSGVV--EAPGLSF-QTLPAIITTAVGQMAISKGRQGREAQNL  683
              DLA E  A  T V   S  +  + P +   +    I+T  V Q+  +  ++       
Sbjct  74   FCDLAKENGA--TEVQRTSSFIWKDEPQIPVSKQFVVIVTGGVQQLCQNDPKR-------  124

Query  684  VKVYLANVRLKEVTADILITAY-EP  755
            + V L  +RL    A+ILI+ Y EP
Sbjct  125  IPVQLGIIRLPGHNAEILISLYGEP  149



>ref|XP_006819515.1| PREDICTED: ran guanine nucleotide release factor-like [Saccoglossus 
kowalevskii]
Length=186

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/196 (30%), Positives = 102/196 (52%), Gaps = 19/196 (10%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            +R LFGGA+         D+S +R++PD+QEVF  P+ D+S+I E+LE +Q + D  + +
Sbjct  6    DRQLFGGALTVVLLNGAVDISELREIPDNQEVFAHPSTDQSMIIEILEYQQ-IEDKNAVS  64

Query  507  WFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAV--GQMAISKGRQGREAQN  680
            +   D+A   D+  + V     + E   L   ++    +  +  G+  I+K  +  +A+N
Sbjct  65   FHFHDIAESNDSSCSEV----QITEEIPLQQISVKDCCSAWLLSGKQCIAKFNE--QAKN  118

Query  681  LVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAG-CMPMA-EVF  854
             V V++A  RL + + DIL++  +P  I+  S S         +PA +     P   + F
Sbjct  119  TVNVHMALFRLPQFSTDILMSFNDPEYISASSSS--------HIPAEEYNKSQPWTLQQF  170

Query  855  KLAVSTFKVNDWRLFG  902
            K +++T KV D  +FG
Sbjct  171  KQSITTLKVLDTSIFG  186



>gb|EPR58474.1| Ran-interacting Mog1 protein [Toxoplasma gondii GT1]
 gb|KFG47640.1| Ran-interacting Mog1 protein [Toxoplasma gondii FOU]
Length=183

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 78/144 (54%), Gaps = 11/144 (8%)
 Frame = +3

Query  333  PLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWF  512
            PLFGGA+A   P  F+DVS +RQVPD+QEVF+D + + S++ E++E ++ V+D  +A +F
Sbjct  14   PLFGGAMACDLPDTFKDVSTIRQVPDNQEVFMDMSSERSVVIEIVEYQETVSDGDAARFF  73

Query  513  LQDLANEQDAEGTMVIEQSGVV--EAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLV  686
              DLA E  A  T V   S  +  + P +       +I T   Q     G +       +
Sbjct  74   FCDLAKENGA--TEVQRTSSFIWKDEPQIPVSKQFVVIVTGGVQQLCQNGPK------RI  125

Query  687  KVYLANVRLKEVTADILITAY-EP  755
             V L  +RL    A+ILI+ Y EP
Sbjct  126  PVQLGIIRLPGHNAEILISLYGEP  149



>gb|EGU85381.1| hypothetical protein FOXB_04092 [Fusarium oxysporum Fo5176]
 gb|EMT66884.1| Putative ran guanine nucleotide release factor [Fusarium oxysporum 
f. sp. cubense race 4]
 gb|ENH65065.1| Putative ran guanine nucleotide release factor [Fusarium oxysporum 
f. sp. cubense race 1]
 emb|CCT67468.1| related to MOG1-required for nuclear-protein import [Fusarium 
fujikuroi IMI 58289]
 gb|EWG53794.1| hypothetical protein FVEG_12147 [Fusarium verticillioides 7600]
 gb|EWG53795.1| hypothetical protein FVEG_12147 [Fusarium verticillioides 7600]
 gb|EWZ01535.1| hypothetical protein FOYG_01142 [Fusarium oxysporum FOSC 3-a]
 gb|EWZ01536.1| hypothetical protein FOYG_01142 [Fusarium oxysporum FOSC 3-a]
 gb|EWZ47574.1| hypothetical protein FOZG_03470 [Fusarium oxysporum Fo47]
 gb|EWZ47575.1| hypothetical protein FOZG_03470 [Fusarium oxysporum Fo47]
 gb|EWZ92623.1| hypothetical protein FOWG_05708 [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EWZ92624.1| hypothetical protein FOWG_05708 [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EXA42837.1| hypothetical protein FOVG_07914 [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXA42838.1| hypothetical protein FOVG_07914 [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXK97830.1| hypothetical protein FOQG_02872 [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXK97831.1| hypothetical protein FOQG_02872 [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXL52905.1| hypothetical protein FOCG_06409 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL52906.1| hypothetical protein FOCG_06409 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL77614.1| hypothetical protein FOPG_07963 [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXL77615.1| hypothetical protein FOPG_07963 [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXL92465.1| hypothetical protein FOIG_14429 [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXL92466.1| hypothetical protein FOIG_14429 [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXM21210.1| hypothetical protein FOTG_11035 [Fusarium oxysporum f. sp. vasinfectum 
25433]
 gb|EXM21211.1| hypothetical protein FOTG_11035 [Fusarium oxysporum f. sp. vasinfectum 
25433]
Length=197

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 64/202 (32%), Positives = 93/202 (46%), Gaps = 18/202 (9%)
 Frame = +3

Query  321  YSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGS  500
            Y   PLFGGAI    P +F DVS +RQVPD+QEV++D     S+IF++ E    V  +GS
Sbjct  4    YINTPLFGGAITCDLPAKFADVSKLRQVPDNQEVWIDQDGFTSIIFDITER---VGGSGS  60

Query  501  A--------TWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKG  656
                     T  L+D+    D + T+ I  +   E   L   T PA    +     +++ 
Sbjct  61   GPEVDGRAMTTHLEDMVG-SDID-TVKIWNTAETEFSNLEPGT-PAYTLISTQTPRVNQS  117

Query  657  RQGREAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCM  836
            R    A +   + L  +RL++   DILIT   P +     E+   +  G       A   
Sbjct  118  RDSTSAPDFTAIILTLLRLEKAKTDILITINVPHIKGEYDEAEVDLELGRQGKLIGAAVE  177

Query  837  PMAEVFKLAVSTFKVNDWRLFG  902
              A ++    STFK+ DW LFG
Sbjct  178  YSATIW----STFKIKDWGLFG  195



>gb|EXK44900.1| hypothetical protein FOMG_03548 [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXK44901.1| hypothetical protein FOMG_03548 [Fusarium oxysporum f. sp. melonis 
26406]
Length=197

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 64/202 (32%), Positives = 93/202 (46%), Gaps = 18/202 (9%)
 Frame = +3

Query  321  YSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGS  500
            Y   PLFGGAI    P +F DVS +RQVPD+QEV++D     S+IF++ E    V  +GS
Sbjct  4    YISTPLFGGAITCDLPAKFADVSKLRQVPDNQEVWIDQDGFTSIIFDITER---VGGSGS  60

Query  501  A--------TWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKG  656
                     T  L+D+    D + T+ I  +   E   L   T PA    +     +++ 
Sbjct  61   GPEVDGRAMTTHLEDMVG-SDID-TVKIWNTAETEFSNLEPGT-PAYTLISTQTPRVNQS  117

Query  657  RQGREAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCM  836
            R    A +   + L  +RL++   DILIT   P +     E+   +  G       A   
Sbjct  118  RDSTSAPDFTAIILTLLRLEKAKTDILITINVPHIKGEYDEAEVDLELGRQGKLIGAAVE  177

Query  837  PMAEVFKLAVSTFKVNDWRLFG  902
              A ++    STFK+ DW LFG
Sbjct  178  YSATIW----STFKIKDWGLFG  195



>ref|XP_007321305.1| hypothetical protein SERLADRAFT_473971 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN95995.1| hypothetical protein SERLA73DRAFT_185471 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO21519.1| hypothetical protein SERLADRAFT_473971 [Serpula lacrymans var. 
lacrymans S7.9]
Length=179

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 94/193 (49%), Gaps = 18/193 (9%)
 Frame = +3

Query  324  SERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSA  503
            +++ LFGGAI +  P R  DVSN+RQVPD+QEVFV      S + E+LE      D+G+A
Sbjct  5    AQKELFGGAIVADLPPRVIDVSNLRQVPDNQEVFVYAENSVSFVIEILEAVAAPDDHGAA  64

Query  504  TWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNL  683
             +    LA++ DAEG  V++   V+   G      P+ I    G   I K    R   + 
Sbjct  65   RFHFDSLAHDNDAEGCTVLDIQDVINDRG---DDTPSPIVLQ-GTQQIRK--YNRPVLDQ  118

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLA  863
            V++ L+  R+K    DI++T   P+   L ++  +  R  VA          +   F   
Sbjct  119  VEIMLSLFRVKRKDIDIVVTVNIPV---LAADGGAISRERVA---------GIKTDFDKL  166

Query  864  VSTFKVNDWRLFG  902
            V + ++ D+ LF 
Sbjct  167  VRSLQIIDYSLFA  179



>ref|XP_005959833.1| PREDICTED: ran guanine nucleotide release factor isoform X1 [Pantholops 
hodgsonii]
Length=186

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 97/193 (50%), Gaps = 15/193 (8%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            + PLFGGA ++T P    DVS++R VPD+QEVF  P  D+SLI ELLEL+  V    +A 
Sbjct  6    DYPLFGGAFSATLPPGAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQGHVQGEEAAR  65

Query  507  WFLQDLANEQDAEGTMV-IEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNL  683
            +  +D+   Q+A    V   Q  V+E   L      A I +  GQ  ++K  Q  +    
Sbjct  66   YHFEDVGGVQEARAVQVETVQPLVLENLALRGCCQEAWILS--GQQQVAKENQ--QVAKY  121

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLA  863
            V ++ A +RL +   D+L+T  +P   N     +S     +++P    G       F+  
Sbjct  122  VTLHQALLRLPQYQTDLLLTFNQPPPEN----RSSLGPENLSIPPWSLG------DFEQL  171

Query  864  VSTFKVNDWRLFG  902
            V++  ++D  +FG
Sbjct  172  VTSLTLHDPNIFG  184



>emb|CEI96871.1| hypothetical protein RMCBS344292_11019 [Rhizopus microsporus]
Length=184

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 94/195 (48%), Gaps = 17/195 (9%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGGAI       F D S++RQVPD+QEVFVD    +S I ELLE   D  D   A +
Sbjct  3    RPLFGGAIVCPIRPSFLDASSIRQVPDNQEVFVDTETQQSFIVELLE-PADAQDQEIAKF  61

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAV---GQMAISKGRQGREAQN  680
              Q L  + +A  ++++        P      LP   T      G+  ++K  + ++A N
Sbjct  62   HFQQLCEDNEAADSVIVSVEHC--KPEDITPLLPKDTTEVYLLHGKQMVAKFNE-KDALN  118

Query  681  LVKVYLANVRLKEVTADILITAYEPI-VINLLSESASAVRAGVAVPAAQAGCMPMAEVFK  857
             + + L  VR  +V+ D +I+   P+ V    SE+ S  +A V +  A+   M +     
Sbjct  119  TIDILLVVVRFNQVSTDCVISMNVPVQVAANSSEAESFTQANVDL--AKQDIMTI-----  171

Query  858  LAVSTFKVNDWRLFG  902
              +   +V DW LFG
Sbjct  172  --LQGLQVRDWNLFG  184



>ref|XP_006151803.1| PREDICTED: ran guanine nucleotide release factor isoform X1 [Tupaia 
chinensis]
Length=187

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 95/191 (50%), Gaps = 14/191 (7%)
 Frame = +3

Query  333  PLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWF  512
            PLFGGA ++  P R  DVS++R VPD+QEVF  P  D+SLI ELLEL+  V    +A + 
Sbjct  8    PLFGGAFSAILPTRAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVRGEAAARYH  67

Query  513  LQDLANEQDAEGTMVIE-QSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVK  689
             +D+   Q A   +V   Q   +E   LS     A + +   Q+A    ++ ++    V 
Sbjct  68   FEDVGGVQGARAVLVESVQPLGLENLALSSCCQEAWVLSGKQQVA----KENQQVAKDVT  123

Query  690  VYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAVS  869
            V+ A +RL +   D+L+T  +P   N      S     +++P    G       F+  V+
Sbjct  124  VHQALLRLPQYQTDLLLTFNQPPPDN---NRLSLDPENLSLPPWSLG------DFEQLVT  174

Query  870  TFKVNDWRLFG  902
            +  ++D  +FG
Sbjct  175  SLTLHDPNIFG  185



>ref|XP_001802458.1| hypothetical protein SNOG_12232 [Phaeosphaeria nodorum SN15]
 gb|EAT80644.1| hypothetical protein SNOG_12232 [Phaeosphaeria nodorum SN15]
Length=186

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 60/203 (30%), Positives = 93/203 (46%), Gaps = 31/203 (15%)
 Frame = +3

Query  321  YSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGS  500
            ++  PLFGGAI    P  F D S +R+VPDHQEV++D     +++ E+LE     +D  +
Sbjct  3    FTNTPLFGGAITVDLPSNFADTSTIREVPDHQEVYLDAGGYSNIVIEILEYVDKPSDEEA  62

Query  501  ATWFLQDLANEQDAEGTMVIEQ-------SGVVE--APGLSFQTLPAIITTAVGQMAISK  653
              +   DL ++   + T +++Q        GV E  A GL+F   PA  T          
Sbjct  63   LQYHFSDLVDDT-GDSTNILQQEKVTFGKDGVKEKNAMGLTFIQTPAPPTDPR-------  114

Query  654  GRQGREAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGC  833
                R+    V ++L  +RLKE   DI+ T      IN+        +A    P  +   
Sbjct  115  ----RKTPEFVYIHLLLLRLKEQDTDIMAT------INIPHYKDEYEKAE---PGEETNL  161

Query  834  MPMAEVFKLAV-STFKVNDWRLF  899
            M  ++  +  V  TF+V +W LF
Sbjct  162  MKDSKAIREKVLGTFEVKEWGLF  184



>ref|XP_001933700.1| conserved hypothetical protein [Pyrenophora tritici-repentis 
Pt-1C-BFP]
 gb|EDU45890.1| conserved hypothetical protein [Pyrenophora tritici-repentis 
Pt-1C-BFP]
Length=186

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 96/197 (49%), Gaps = 19/197 (10%)
 Frame = +3

Query  321  YSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGS  500
            ++  PL+GGAI    P  F D S +RQ+PD+QEV++D +   S++ E+LE     +D  +
Sbjct  3    FTNTPLYGGAITVDLPSSFADASQIRQIPDNQEVYLDNSGYSSIVVEILEYVDKSSDEEA  62

Query  501  ATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPA--IITTAVGQMAIS-KGRQGRE  671
              +   DL +  D + T V+EQ G       S ++LP+  ++T +  Q   S      R+
Sbjct  63   LQYHFADLVDGTD-DATTVVEQVGA------SMKSLPSTPLLTLSFVQTPPSINPHPNRK  115

Query  672  AQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEV  851
                  ++L  +RLKE   DILIT      IN+        +  +     +   M  +++
Sbjct  116  TPEYTFIHLLLLRLKEQETDILIT------INVPHYPGEYEKPAMG--QQETELMRSSKL  167

Query  852  FKLAV-STFKVNDWRLF  899
             +  V  TF+V +W LF
Sbjct  168  VREKVLETFEVKEWGLF  184



>ref|XP_006151804.1| PREDICTED: ran guanine nucleotide release factor isoform X2 [Tupaia 
chinensis]
Length=182

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 77/142 (54%), Gaps = 5/142 (4%)
 Frame = +3

Query  333  PLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWF  512
            PLFGGA ++  P R  DVS++R VPD+QEVF  P  D+SLI ELLEL+  V    +A + 
Sbjct  8    PLFGGAFSAILPTRAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVRGEAAARYH  67

Query  513  LQDLANEQDAEGTMVIE-QSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVK  689
             +D+   Q A   +V   Q   +E   LS     A + +   Q+A    ++ ++    V 
Sbjct  68   FEDVGGVQGARAVLVESVQPLGLENLALSSCCQEAWVLSGKQQVA----KENQQVAKDVT  123

Query  690  VYLANVRLKEVTADILITAYEP  755
            V+ A +RL +   D+L+T  +P
Sbjct  124  VHQALLRLPQYQTDLLLTFNQP  145



>ref|XP_005894886.1| PREDICTED: ran guanine nucleotide release factor [Bos mutus]
 ref|XP_010841341.1| PREDICTED: ran guanine nucleotide release factor isoform X1 [Bison 
bison bison]
 tpg|DAA18691.1| TPA: ran guanine nucleotide release factor [Bos taurus]
 gb|ELR57044.1| Ran guanine nucleotide release factor [Bos mutus]
Length=186

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 96/193 (50%), Gaps = 15/193 (8%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            + PLFGGA ++T P    DVS++R VPDHQEVF     D+SLI ELLEL+  V    +A 
Sbjct  6    DYPLFGGAFSATLPPGAIDVSDLRPVPDHQEVFCHRVTDQSLIVELLELQAHVQGEEAAR  65

Query  507  WFLQDLANEQDAEGTMV-IEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNL  683
            +  +D+   Q+A    V   Q  V+E   L      A I +  GQ  ++K  Q  +    
Sbjct  66   YHFEDVGGVQEARAVQVETVQPLVLENLALRGCCQEAWILS--GQQQVAKENQ--QVAKY  121

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLA  863
            V ++ A +RL +   D+L+T  +P   N     +S     +++P    G       F+  
Sbjct  122  VTLHQALLRLPQYQTDLLLTFNQPPPEN----RSSLGPENLSIPPWSLG------DFEQL  171

Query  864  VSTFKVNDWRLFG  902
            V++  ++D  +FG
Sbjct  172  VTSLTLHDPNIFG  184



>gb|EKC39311.1| Ran guanine nucleotide release factor [Crassostrea gigas]
Length=186

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 80/154 (52%), Gaps = 5/154 (3%)
 Frame = +3

Query  336  LFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWFL  515
            LFGGA++   P   +D+S++RQ+PD+QEVF  P  D+S+I E+LE   D  D  +     
Sbjct  8    LFGGALSVLLPSNAKDISDLRQIPDNQEVFAHPVTDQSIIIEILEYV-DKDDEEAIRTHF  66

Query  516  QDLANEQDAE-GTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVKV  692
             DLA++ D + G  +I Q+  +    L            +GQ  +SK  +   A+N V +
Sbjct  67   SDLASDNDVQSGDAIIAQTEKIPDTDLKMTQCDNAYYI-LGQQNVSKFNEA--AKNTVDM  123

Query  693  YLANVRLKEVTADILITAYEPIVINLLSESASAV  794
            ++   R+ + T DIL+T   P  IN  S S   V
Sbjct  124  HIGLFRISKFTTDILVTFNNPSNINPESSSHKPV  157



>ref|XP_007881326.1| hypothetical protein PFL1_05600 [Pseudozyma flocculosa PF-1]
 gb|EPQ26965.1| hypothetical protein PFL1_05600 [Pseudozyma flocculosa PF-1]
Length=188

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 96/203 (47%), Gaps = 25/203 (12%)
 Frame = +3

Query  318  MYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELK------Q  479
            M   R LFGGAI + FP  F D S +RQVPD+QEV +    D S I E+L+L       Q
Sbjct  1    MSETRDLFGGAITAQFPTGFLDASQLRQVPDNQEVLIRNDSDVSCIIEVLQLATEEGAGQ  60

Query  480  DVADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAII---TTAVGQMAIS  650
            D+  + +  +    LA++  A  + +     +  AP       PA     +  VG   I 
Sbjct  61   DL--DKAIRFHFGSLAHDNSASSSNIESVRHLEPAPSTVQHEEPAPTPRPSLLVGTQVIK  118

Query  651  KGRQGREAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAG  830
            K  +  E  +LV++ LA  RL+  + D++++  EP+     +E+A         P+A   
Sbjct  119  KFGKATEPDDLVRIRLALWRLEGKSVDLVMSLNEPLPRGTAAEAA---------PSAD--  167

Query  831  CMPMAEVFKLAVSTFKVNDWRLF  899
               +   F+ A ++ K+ DW LF
Sbjct  168  ---LDAAFEQAAASLKIRDWSLF  187



>gb|KFA65339.1| hypothetical protein S40285_07157 [Stachybotrys chlorohalonata 
IBT 40285]
Length=197

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 61/206 (30%), Positives = 89/206 (43%), Gaps = 26/206 (13%)
 Frame = +3

Query  321  YSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGS  500
            Y   PL+GGAI    P +F DVS +RQVPD+QEV++D     S+IF++ E    V  +GS
Sbjct  4    YISTPLYGGAIVCDLPEKFADVSKLRQVPDNQEVWIDQDGFTSIIFDITER---VGSSGS  60

Query  501  A--------TWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTL----PAIITTAVGQMA  644
                     T  L+++           IE   +       F  L    PA    A     
Sbjct  61   GPEIDGRAITTHLEEMVGSD-------IETVKIWNTAETDFSRLEGNVPAYTLIATQTPH  113

Query  645  ISKGRQGREAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQ  824
            +SK R+   A +   + +  +RL+++  DILIT   P +     E    +  G       
Sbjct  114  VSKSREQTSAPDFTAIIMTLLRLEKIRTDILITINVPHIKGEYDEDDVDLELGKQGKLIG  173

Query  825  AGCMPMAEVFKLAVSTFKVNDWRLFG  902
                  A ++    STFK+ DW LFG
Sbjct  174  DAVEHSARIW----STFKIKDWGLFG  195



>gb|KEY64752.1| hypothetical protein S7711_05402, partial [Stachybotrys chartarum 
IBT 7711]
 gb|KFA79146.1| hypothetical protein S40288_05695, partial [Stachybotrys chartarum 
IBT 40288]
Length=196

 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 61/206 (30%), Positives = 89/206 (43%), Gaps = 26/206 (13%)
 Frame = +3

Query  321  YSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGS  500
            Y   PL+GGAI    P +F DVS +RQVPD+QEV++D     S+IF++ E    V  +GS
Sbjct  4    YLSTPLYGGAIVCDLPEKFADVSKLRQVPDNQEVWIDQDGFTSIIFDITER---VGSSGS  60

Query  501  A--------TWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTL----PAIITTAVGQMA  644
                     T  L+++           IE   +       F  L    PA    A     
Sbjct  61   GPEIDGRAITTHLEEMVGSD-------IETVKIWNTAETDFSRLEGNVPAYTLIATQTPH  113

Query  645  ISKGRQGREAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQ  824
            +SK R+   A +   + +  +RL+++  DILIT   P +     E    +  G       
Sbjct  114  VSKSREQTSAPDFTAIIMTLLRLEKIRTDILITINVPHIKGEYDEDDVDLELGKQGKLIG  173

Query  825  AGCMPMAEVFKLAVSTFKVNDWRLFG  902
                  A ++    STFK+ DW LFG
Sbjct  174  DAVEHSARIW----STFKIKDWGLFG  195



>gb|KFA53000.1| hypothetical protein S40293_05907 [Stachybotrys chartarum IBT 
40293]
Length=197

 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 61/206 (30%), Positives = 89/206 (43%), Gaps = 26/206 (13%)
 Frame = +3

Query  321  YSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGS  500
            Y   PL+GGAI    P +F DVS +RQVPD+QEV++D     S+IF++ E    V  +GS
Sbjct  4    YLSTPLYGGAIVCDLPEKFADVSKLRQVPDNQEVWIDQDGFTSIIFDITER---VGSSGS  60

Query  501  A--------TWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTL----PAIITTAVGQMA  644
                     T  L+++           IE   +       F  L    PA    A     
Sbjct  61   GPEIDGRAITTHLEEMVGSD-------IETVKIWNTAETDFSRLEGNVPAYTLIATQTPH  113

Query  645  ISKGRQGREAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQ  824
            +SK R+   A +   + +  +RL+++  DILIT   P +     E    +  G       
Sbjct  114  VSKSREQTSAPDFTAIIMTLLRLEKIRTDILITINVPHIKGEYDEDDVDLELGKQGKLIG  173

Query  825  AGCMPMAEVFKLAVSTFKVNDWRLFG  902
                  A ++    STFK+ DW LFG
Sbjct  174  DAVEHSARIW----STFKIKDWGLFG  195



>gb|KFG61141.1| Ran-interacting Mog1 protein [Toxoplasma gondii RUB]
 gb|KFH03599.1| Ran-interacting Mog1 protein [Toxoplasma gondii VAND]
Length=183

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 77/144 (53%), Gaps = 11/144 (8%)
 Frame = +3

Query  333  PLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWF  512
            PLFGGA+    P  F+DVS +RQVPD+QEVF+D + + S++ E++E ++ V+D  +A +F
Sbjct  14   PLFGGAMTCDLPDTFKDVSTIRQVPDNQEVFMDMSSERSVVIEIVEYQETVSDGDAARFF  73

Query  513  LQDLANEQDAEGTMVIEQSGVV--EAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLV  686
              DLA E  A  T V   S  +  + P +       +I T   Q     G +       +
Sbjct  74   FCDLAKENGA--TEVQRTSSFIWKDEPQIPVSKQFVVIVTGGVQQLCQNGPK------RI  125

Query  687  KVYLANVRLKEVTADILITAY-EP  755
             V L  +RL    A+ILI+ Y EP
Sbjct  126  PVQLGIIRLPGHNAEILISLYGEP  149



>ref|XP_007550640.1| PREDICTED: ran guanine nucleotide release factor isoform X2 [Poecilia 
formosa]
Length=169

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGGA+++  P    D+S +R++PD+QEVF  P  D+SLI ELLE +  VAD  +A +
Sbjct  13   RPLFGGALSAVVPYNVTDISELREIPDNQEVFAHPHTDQSLIVELLEYQGQVADQDAARY  72

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAP  587
              +D+A    A      E S VV  P
Sbjct  73   HFEDIAGSNKAHEPGAFEVSDVVALP  98



>ref|XP_388124.1| hypothetical protein FG07948.1 [Fusarium graminearum PH-1]
 ref|XP_009263663.1| hypothetical protein FPSE_12271 [Fusarium pseudograminearum CS3096]
 gb|EKJ67563.1| hypothetical protein FPSE_12271 [Fusarium pseudograminearum CS3096]
 gb|ESU14286.1| hypothetical protein FGSG_07948 [Fusarium graminearum PH-1]
 gb|EYB30416.1| hypothetical protein FG05_07948 [Fusarium graminearum]
 emb|CEF83906.1| unnamed protein product [Fusarium graminearum]
Length=195

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/199 (32%), Positives = 94/199 (47%), Gaps = 19/199 (10%)
 Frame = +3

Query  333  PLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSA---  503
            PL+GGAI    P +F DVS +RQVPD+QEV++D     S+IF++ E    V  +GS    
Sbjct  8    PLYGGAITCDLPAKFADVSKLRQVPDNQEVWIDQDGFTSIIFDITER---VGGSGSGPEV  64

Query  504  -----TWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGR  668
                 T  L+D+    D + T+ I  +   E   L+      +I+T      +SK R   
Sbjct  65   DGRAMTTHLEDMVG-SDID-TVKIWNTAETEFTRLNGTPAYTLISTQTPH--VSKSRDTT  120

Query  669  EAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAE  848
             A +   + L  +RL++   DILIT   P +     ES   +  G             A+
Sbjct  121  SAPDFTAIILTLLRLEKEKTDILITINVPHIKGEYDESEVDLELGRQGKLIGDAVEYSAK  180

Query  849  VFKLAVSTFKVNDWRLFGA  905
            +++    TFK+ DW LFGA
Sbjct  181  IWE----TFKIKDWGLFGA  195



>ref|XP_004594816.1| PREDICTED: ran guanine nucleotide release factor isoform X1 [Ochotona 
princeps]
Length=187

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/193 (31%), Positives = 97/193 (50%), Gaps = 14/193 (7%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            + PLFGGA ++  P    DVS++R VPD+QEVF  P  D+SLI ELLEL+  V    +A 
Sbjct  6    DYPLFGGAFSAILPPGAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVCGEAAAR  65

Query  507  WFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLV  686
            +  +D+   Q A    V E    + +  L+ ++         G+  ++K  Q  +    V
Sbjct  66   YHFEDVGGVQGARSQQV-ESVQSLGSESLALRSCCPEAWVLSGKQQVAKENQ--QVAKDV  122

Query  687  KVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAG-VAVPAAQAGCMPMAEVFKLA  863
             V+ A +RL +   D+L+T  +P      S++ S++  G V+ P    G       F+  
Sbjct  123  AVHQALLRLPQYETDVLLTFNQPPT----SDNRSSLSPGNVSPPPWSLG------DFEQL  172

Query  864  VSTFKVNDWRLFG  902
            V++  ++D  +FG
Sbjct  173  VTSLNLHDPTIFG  185



>gb|ESS30069.1| Ran-interacting Mog1 protein [Toxoplasma gondii VEG]
 gb|KFG36250.1| Ran-interacting Mog1 protein [Toxoplasma gondii p89]
 gb|KFG41564.1| Ran-interacting Mog1 protein [Toxoplasma gondii GAB2-2007-GAL-DOM2]
Length=183

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 73/142 (51%), Gaps = 7/142 (5%)
 Frame = +3

Query  333  PLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWF  512
            PLFGGA+A   P  F+DVS +RQVPD+QEVF+D + + S++ E++E +  V+D  +A +F
Sbjct  14   PLFGGAMACDLPDTFKDVSTIRQVPDNQEVFMDMSSERSVVIEIVEYQATVSDGDAARFF  73

Query  513  LQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVKV  692
              DLA E  A            + P +       +I T   Q     G +       + V
Sbjct  74   FCDLAKENGAAEVQRTSSFIWKDEPQIPVSKQFVVIVTGGVQQLCQNGPK------RIPV  127

Query  693  YLANVRLKEVTADILITAY-EP  755
             L  +RL    A+ILI+ Y EP
Sbjct  128  QLGIIRLPGHNAEILISLYGEP  149



>ref|XP_008886228.1| Ran-interacting Mog1 protein [Hammondia hammondi]
 gb|KEP63114.1| Ran-interacting Mog1 protein [Hammondia hammondi]
Length=183

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 77/144 (53%), Gaps = 11/144 (8%)
 Frame = +3

Query  333  PLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWF  512
            PLFGGA+A   P  F+DVS +RQVPD+QEVF+D +   S++ E++E ++ V+D  +A +F
Sbjct  14   PLFGGAMACDLPDTFKDVSTIRQVPDNQEVFMDMSSQRSVVIEIVEYQKSVSDGDAARFF  73

Query  513  LQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQ--GREAQNLV  686
              DLA E  A        + V       ++  P I  +    + ++ G Q   +     +
Sbjct  74   FCDLAKENGA--------TEVQRTSSFIWKDEPRIPVSGQFVVVVTSGVQQLRQNGPKRI  125

Query  687  KVYLANVRLKEVTADILITAY-EP  755
             V +  +RL    A+ILI+ Y EP
Sbjct  126  PVQMGIIRLPGHNAEILISLYGEP  149



>ref|NP_001272372.1| ran guanine nucleotide release factor isoform 4 [Mus musculus]
Length=182

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 91/191 (48%), Gaps = 19/191 (10%)
 Frame = +3

Query  333  PLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWF  512
            PLFGGA ++  P    DVS++R VPD+QEVF  P  D+SLI ELLEL+  V    +A + 
Sbjct  8    PLFGGAFSAILPTGAIDVSDLRPVPDNQEVFCHPVTDQSLIIELLELQAHVQGEAAARYH  67

Query  513  LQDLANEQDAEGTMVIE-QSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVK  689
             +D+   Q A    V+  Q   +E   LS +       +  G+  ++K     E Q  V 
Sbjct  68   FEDVGRVQGARAVHVLSVQPLCLE--NLSLRGCCQDAWSLSGKQQVAK-----ENQQDVT  120

Query  690  VYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAVS  869
            ++ A +RL +   D+L+T  +P        S S     ++ P            F+  V+
Sbjct  121  LHQALLRLPQYQTDLLLTFNQPPC-----HSRSLGPENLSCPPWSLS------NFEQLVT  169

Query  870  TFKVNDWRLFG  902
            +  ++D  LFG
Sbjct  170  SLTLHDPNLFG  180



>gb|ESL11297.1| Ran-binding protein [Trypanosoma rangeli SC58]
Length=221

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 99/223 (44%), Gaps = 29/223 (13%)
 Frame = +3

Query  285  RTPLLC*MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFEL  464
            RTP      +    E  LFGGAI    P    DVS+ RQVPD QEV+ +      +I EL
Sbjct  6    RTPAAATRKMSGEREVELFGGAIRCRLPATAVDVSDFRQVPDTQEVYTEAETGVCIIVEL  65

Query  465  LELKQDVADNGSATWFLQDLANEQDA-EGTMVIEQ----------------SGVVEAPGL  593
            L  + DV D     +F  DLA   D  +G   ++                 SG   A G 
Sbjct  66   LARQADVRDEDCGAFFFSDLARANDCRDGDFKLDAQRPIALTDYPHVAQLPSGAAAASGR  125

Query  594  SFQTLPAIITTAVGQMAISKGRQGREAQNLVKVYLANVR-LKEVTADILITAYEPIVINL  770
              +     + + + +++  K  QG+E  N V V LA +R L  +++D++++   P  I+ 
Sbjct  126  --RCAYGCVASGLQRISKFKNEQGKE--NEVFVALAVLRFLPSISSDVVLSVSAPQWIHP  181

Query  771  LSESASAVRAGVAVPAAQAGCMPMAEVFKLAVSTFKVNDWRLF  899
             S  A  VR          G   +  V + AVS+F+V DW LF
Sbjct  182  ESSEACVVR-------HLRGREEVLAVLQRAVSSFEVRDWSLF  217



>ref|XP_010766915.1| PREDICTED: ran guanine nucleotide release factor [Notothenia 
coriiceps]
 ref|XP_010766916.1| PREDICTED: ran guanine nucleotide release factor [Notothenia 
coriiceps]
Length=190

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 78/148 (53%), Gaps = 5/148 (3%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
             PLFGGA+++  P   +D S +R++PD+QEVFV    D+SLI EL+E +  V +  +A +
Sbjct  9    HPLFGGALSAVLPHSAKDTSELREIPDNQEVFVHEHTDQSLIVELVEYQSQVENEDAARY  68

Query  510  FLQDLANEQDAEGTMVIEQSGVV--EAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNL  683
              +D+A    A      E + VV      LS     +      G   +SK  +  EA+N 
Sbjct  69   HFEDIAGSNKALEPDAFEVTSVVPLSKSELSLSDCSSAW-MLTGTQCVSKFNE--EARNS  125

Query  684  VKVYLANVRLKEVTADILITAYEPIVIN  767
            V ++L   RL + + D+LIT  +P  I+
Sbjct  126  VTLHLGLFRLPQFSTDVLITFNDPQRIS  153



>ref|XP_004012731.1| PREDICTED: ran guanine nucleotide release factor [Ovis aries]
Length=186

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 97/193 (50%), Gaps = 15/193 (8%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            + PLFGGA ++T P    DVS++R VPD+QEVF     D+SLI ELLEL+  V    +A 
Sbjct  6    DYPLFGGAFSATLPPGAIDVSDLRPVPDNQEVFCHRVTDQSLIVELLELQAHVQGEEAAR  65

Query  507  WFLQDLANEQDAEGTMV-IEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNL  683
            +  +D+   Q+A    V   Q  V+E   L      A I +  GQ  ++K  Q  +    
Sbjct  66   YHFEDVGGVQEARAVQVETVQPLVLENLALRGCCQEAWILS--GQQQVAKENQ--QVAKY  121

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLA  863
            V ++ A +RL +   D+L+T  +P   N     +S     +++P+   G       F+  
Sbjct  122  VTLHQALLRLPQYQTDLLLTFNQPPPEN----RSSLAPENLSIPSWSLG------DFEQL  171

Query  864  VSTFKVNDWRLFG  902
            V++  ++D  +FG
Sbjct  172  VTSLTLHDPNIFG  184



>ref|XP_006062972.1| PREDICTED: ran guanine nucleotide release factor isoform X1 [Bubalus 
bubalis]
Length=186

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 96/193 (50%), Gaps = 15/193 (8%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            + PLFGGA ++T P    DVS++R VPD+QEVF     D+SLI ELLEL+  V    +A 
Sbjct  6    DYPLFGGAFSATLPPGAIDVSDLRPVPDNQEVFCHRVTDQSLIVELLELQAHVQGEEAAR  65

Query  507  WFLQDLANEQDAEGTMV-IEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNL  683
            +  +D+   Q+A    V   Q  V+E   L      A I +  GQ  ++K  Q  +    
Sbjct  66   YHFEDVGGVQEARAVQVETVQPLVLENLALRGCCQEAWILS--GQQQVAKENQ--QVAKY  121

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLA  863
            V ++ A +RL +   D+L+T  +P   N LS         +++P    G       F+  
Sbjct  122  VTLHQALLRLPQYQTDLLLTFNQPPPENRLSLGPE----NLSIPPWSLG------DFEQL  171

Query  864  VSTFKVNDWRLFG  902
            V++  ++D  +FG
Sbjct  172  VTSLTLHDPNIFG  184



>ref|XP_005349867.1| PREDICTED: ran guanine nucleotide release factor isoform X1 [Microtus 
ochrogaster]
Length=185

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 92/191 (48%), Gaps = 16/191 (8%)
 Frame = +3

Query  333  PLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWF  512
            PLFGGA ++  P    DVS++R VPD+QEVF  P  D+SLI ELLEL+  V    +A + 
Sbjct  8    PLFGGAFSAILPPGAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVRGEAAARYH  67

Query  513  LQDLANEQDAEGTMVIE-QSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVK  689
             +D+   Q A    V+  Q   +E   L      A   +   Q+A    ++ ++    V 
Sbjct  68   FEDVGGVQGARAVHVLSVQPLCLENLSLRGSCQDAWFLSGKQQVA----KENQQVAKDVT  123

Query  690  VYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAVS  869
            ++ A +RL +   D+L+T  +P      S S S     ++ P    G       F+  V+
Sbjct  124  LHQALLRLPQYQTDLLLTFNQPP-----SNSRSLGPENLSCPPWSLG------NFEQLVT  172

Query  870  TFKVNDWRLFG  902
            +  ++D  +FG
Sbjct  173  SLTLHDPNIFG  183



>ref|XP_006973545.1| PREDICTED: ran guanine nucleotide release factor [Peromyscus 
maniculatus bairdii]
Length=185

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 90/190 (47%), Gaps = 14/190 (7%)
 Frame = +3

Query  333  PLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWF  512
            PLFGGA ++  P    DVS++R VPD+QEVF  P  D+SLI ELLEL+  V    +A + 
Sbjct  8    PLFGGAFSAILPPGAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVRGEAAARYH  67

Query  513  LQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVKV  692
             +D+   Q A    V+    +     LS +          G+  ++K  Q  +    V +
Sbjct  68   FEDVGGVQGARAVHVLSVKPLC-LDNLSLRGCCQDAWFLSGKQQVAKENQ--QVAKDVTL  124

Query  693  YLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAVST  872
            Y A +RL +   D+L+T  +P      S S S     ++ P    G       F+  V++
Sbjct  125  YQALLRLPQYQTDLLLTFNQPP-----SNSRSLGPENLSCPPWSLG------NFEQLVTS  173

Query  873  FKVNDWRLFG  902
              ++D  +FG
Sbjct  174  LTLHDPNIFG  183



>ref|XP_002719058.1| PREDICTED: ran guanine nucleotide release factor isoform X1 [Oryctolagus 
cuniculus]
Length=186

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 96/192 (50%), Gaps = 13/192 (7%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            + PLFGGA ++  P    DVS++R VPD+QEVF  P  D+SLI ELLEL+  V    +A 
Sbjct  6    DYPLFGGAFSAILPPGAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVRGEAAAR  65

Query  507  WFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLV  686
            +  +D+   Q A    V +    + +  L+ +T         G+  ++K  Q + A+N V
Sbjct  66   YHFEDVGGVQGARAQQV-DSVQTLSSESLALRTYCPEAWVLSGKQQVAKENQ-QVAKN-V  122

Query  687  KVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAV  866
             V+ A +RL +   D+L+T  +P   N     +S     ++ P    G       F+  V
Sbjct  123  TVHQALLRLPQYQTDLLLTFNQPPPDN----RSSLGPGNLSPPPWSLG------DFEQLV  172

Query  867  STFKVNDWRLFG  902
            ++  ++D  +FG
Sbjct  173  TSLNLHDPNIFG  184



>gb|EMD97534.1| hypothetical protein COCHEDRAFT_1190382 [Bipolaris maydis C5]
 gb|ENI01328.1| hypothetical protein COCC4DRAFT_75047 [Bipolaris maydis ATCC 
48331]
Length=190

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 84/191 (44%), Gaps = 13/191 (7%)
 Frame = +3

Query  333  PLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWF  512
            PL+GGAI    P  + D S +RQ+P HQEV++      S++ E+LE     +D  +  + 
Sbjct  7    PLYGGAITVDLPSNYSDASLIRQIPSHQEVYLHNTGYTSIVLEILEYVDKPSDEEALQYH  66

Query  513  LQDLANEQDAEGTMVIEQSGVVEA-PGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVK  689
              DL +      TMV +  G ++  P     TL  I T           R+  E      
Sbjct  67   FADLVDGTGDATTMVAQAKGEMKNLPQTPILTLTFIQTPPSPAAGAPPARKTPE---YTF  123

Query  690  VYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAV-  866
            + L  VRLKE   DI+IT   P      S +AS        P+++   M  A+  K  V 
Sbjct  124  IQLILVRLKEQATDIMITINSPHYPGEYSPAAS--------PSSETQLMTQAKRIKEKVL  175

Query  867  STFKVNDWRLF  899
             +F + DW LF
Sbjct  176  DSFAIKDWGLF  186



>emb|CBJ29147.1| conserved unknown protein [Ectocarpus siliculosus]
Length=294

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 78/159 (49%), Gaps = 14/159 (9%)
 Frame = +3

Query  309  AVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV-  485
            A D  + R LFGGA+    P  + DVS++RQVPDHQEVF       S++ E+L  + D+ 
Sbjct  5    AGDDATLRKLFGGAMECLLPAAYVDVSDLRQVPDHQEVFASKEDGISIVIEVLSFEADIN  64

Query  486  ------ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEA--PGLSFQTLPAIITTAVGQM  641
                   D  SA  F  DLA    A  +       + ++  P L+  T  A+     G+ 
Sbjct  65   MDEQARKDGASARHFFDDLAAANGATSSACDFCGDLSDSIMPKLASYTKSAL----AGRQ  120

Query  642  AISKGRQGREAQNLVKVYLANVRLKEVTADILITAYEPI  758
             ++K RQ     + V++YL NVRL  V  D+LIT   P 
Sbjct  121  TVAKFRQ-DAPPDAVRLYLVNVRLPNVGTDLLITVNVPC  158



>ref|XP_005959834.1| PREDICTED: ran guanine nucleotide release factor isoform X2 [Pantholops 
hodgsonii]
Length=179

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 95/193 (49%), Gaps = 22/193 (11%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            + PLFGGA ++T P    DVS++R VPD+QEVF  P  D+SLI ELLEL+  V    +A 
Sbjct  6    DYPLFGGAFSATLPPGAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQGHVQGEEAAR  65

Query  507  WFLQDLANEQDAEGTMV-IEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNL  683
            +  +D+   Q+A    V   Q  V+E   L      A I +  GQ  ++K          
Sbjct  66   YHFEDVGGVQEARAVQVETVQPLVLENLALRGCCQEAWILS--GQQQVAK---------Y  114

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLA  863
            V ++ A +RL +   D+L+T  +P   N     +S     +++P    G       F+  
Sbjct  115  VTLHQALLRLPQYQTDLLLTFNQPPPEN----RSSLGPENLSIPPWSLG------DFEQL  164

Query  864  VSTFKVNDWRLFG  902
            V++  ++D  +FG
Sbjct  165  VTSLTLHDPNIFG  177



>ref|NP_067304.1| ran guanine nucleotide release factor isoform 2 [Mus musculus]
 sp|Q9JIB0.1|MOG1_MOUSE RecName: Full=Ran guanine nucleotide release factor; Short=RanGNRF; 
AltName: Full=Ran-binding protein MOG1 [Mus musculus]
 gb|AAF91320.1| Ran-interacting protein MOG1 [Mus musculus]
 gb|AAH38470.1| RAN guanine nucleotide release factor [Mus musculus]
 gb|AAH87921.1| RAN guanine nucleotide release factor [Mus musculus]
 gb|EDL10465.1| mCG11240 [Mus musculus]
Length=185

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 91/191 (48%), Gaps = 16/191 (8%)
 Frame = +3

Query  333  PLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWF  512
            PLFGGA ++  P    DVS++R VPD+QEVF  P  D+SLI ELLEL+  V    +A + 
Sbjct  8    PLFGGAFSAILPTGAIDVSDLRPVPDNQEVFCHPVTDQSLIIELLELQAHVQGEAAARYH  67

Query  513  LQDLANEQDAEGTMVIE-QSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVK  689
             +D+   Q A    V+  Q   +E   LS +       +  G+  ++K  Q  +    V 
Sbjct  68   FEDVGRVQGARAVHVLSVQPLCLE--NLSLRGCCQDAWSLSGKQQVAKENQ--QVAKDVT  123

Query  690  VYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAVS  869
            ++ A +RL +   D+L+T  +P        S S     ++ P            F+  V+
Sbjct  124  LHQALLRLPQYQTDLLLTFNQPPC-----HSRSLGPENLSCPPWSLS------NFEQLVT  172

Query  870  TFKVNDWRLFG  902
            +  ++D  LFG
Sbjct  173  SLTLHDPNLFG  183



>ref|XP_004594817.1| PREDICTED: ran guanine nucleotide release factor isoform X2 [Ochotona 
princeps]
Length=183

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 57/192 (30%), Positives = 93/192 (48%), Gaps = 16/192 (8%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            + PLFGGA ++  P    DVS++R VPD+QEVF  P  D+SLI ELLEL+  V    +A 
Sbjct  6    DYPLFGGAFSAILPPGAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVCGEAAAR  65

Query  507  WFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLV  686
            +  +D+   Q A    V E    + +  L+ ++         G+  ++K  Q  +    V
Sbjct  66   YHFEDVGGVQGARSQQV-ESVQSLGSESLALRSCCPEAWVLSGKQQVAKENQ--QVAKDV  122

Query  687  KVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAV  866
             V+ A +RL +   D+L+T  +P        ++S     V+ P    G       F+  V
Sbjct  123  AVHQALLRLPQYETDVLLTFNQP-------PTSSLSPGNVSPPPWSLG------DFEQLV  169

Query  867  STFKVNDWRLFG  902
            ++  ++D  +FG
Sbjct  170  TSLNLHDPTIFG  181



>ref|XP_007931678.1| hypothetical protein MYCFIDRAFT_87248 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME77939.1| hypothetical protein MYCFIDRAFT_87248 [Pseudocercospora fijiensis 
CIRAD86]
Length=193

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 60/203 (30%), Positives = 99/203 (49%), Gaps = 19/203 (9%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            MA + +    LFGGAI +  P  F+DVS +RQVPD+QEV++D     S++F++LE  +  
Sbjct  1    MAANQFKTVELFGGAIIADIPATFEDVSQIRQVPDNQEVYLDKEGFSSIVFDILERVEKN  60

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSF-QTLPAIITTAVGQMAISKGRQ  662
             D  +  + L D+ +E   + T+         + G +F   +P      +   +    +Q
Sbjct  61   NDIEALKYHLSDIVDEDAGQTTL--------HSTGSAFLSKMPTTTAMTLLATSPPGEKQ  112

Query  663  -GREAQ-NLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCM  836
             GR  + + V V L  VRL++   DI+I       IN+     S V+  V   A + G +
Sbjct  113  RGRPNEPDFVGVLLIVVRLQQQKTDIVIA------INVPHLPGSYVKEDVDPAAGKYGNL  166

Query  837  PMAE--VFKLAVSTFKVNDWRLF  899
              A   V +  + +F++ DW LF
Sbjct  167  LEAGKLVKEKVLESFEIKDWGLF  189



>ref|XP_847168.1| Ran-binding protein [Trypanosoma brucei brucei TREU927]
 gb|AAX79656.1| Ran-binding protein, putative [Trypanosoma brucei]
 gb|AAZ13102.1| Ran-binding protein, putative [Trypanosoma brucei brucei TREU927]
 emb|CBH13365.1| RNA-binding protein, putative [Trypanosoma brucei gambiense DAL972]
Length=206

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 61/206 (30%), Positives = 97/206 (47%), Gaps = 29/206 (14%)
 Frame = +3

Query  336  LFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWFL  515
            L+GGAI S+FP    DVS++RQVPD QEV+ +      +I ELL  + +V+++    +F 
Sbjct  8    LYGGAITSSFPATMVDVSDMRQVPDTQEVYTEVETGMCIIIELLAREHEVSNDNCGNYFF  67

Query  516  QDL--ANEQDAEGTMVIEQ---------------SGVVEAPGLSFQTLPAIITTAVGQMA  644
             DL  AN  + EG  +  Q               SG V A G  + T   +I+   G   
Sbjct  68   IDLAKANGCNTEGYNLKPQHQLHPTDYPLVSQPPSGSVAASG-RYCTFGCVIS---GHQH  123

Query  645  ISKGRQGREAQNLVKVYLANVRLK-EVTADILITAYEPIVINLLSESASAVRAGVAVPAA  821
            ISK    +  +N + V ++ +R +  ++ D+LI+   P  I+  S  A  V+   +    
Sbjct  124  ISKYTNEKGKENDILVVMSVLRFEPPISTDVLISISAPQWIHPESSEARVVQKLRSEEEV  183

Query  822  QAGCMPMAEVFKLAVSTFKVNDWRLF  899
             A       V +  + +F + DW LF
Sbjct  184  TA-------VMRRILLSFNIRDWGLF  202



>gb|EJU05527.1| Mog1p/PsbP-like protein [Dacryopinax sp. DJM-731 SS1]
Length=188

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 57/192 (30%), Positives = 87/192 (45%), Gaps = 12/192 (6%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            R LFGGAI    P    D S+ RQ+PD QEVF+D   D S + E+LEL    +   +AT+
Sbjct  2    RELFGGAITVNLPDELIDASDFRQIPDTQEVFLDKESDVSFVIEILELVNTPSFGDAATF  61

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVK  689
                LA++ DAEG  + E    V+           + T   G+  + K    R   + V+
Sbjct  62   HFDSLAHDNDAEGKRIDEVVPPVDLSPPPCPPNQPVPTLLTGRQFVRKF--NRPEPDEVR  119

Query  690  VYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAVS  869
            + LA  R+    AD++++   P+           + A   VP  +        VF  AV 
Sbjct  120  IVLALFRIPAKNADVVMSMNFPV----------KLEATGPVPDVERKWEFWRIVFMTAVQ  169

Query  870  TFKVNDWRLFGA  905
            +F++ D+ LF  
Sbjct  170  SFQIVDFGLFAG  181



>ref|XP_005693612.1| PREDICTED: ran guanine nucleotide release factor isoform X1 [Capra 
hircus]
Length=186

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 96/193 (50%), Gaps = 15/193 (8%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            + PLFGGA ++T P    DVS++R VPD+QEVF     D+SLI ELLEL+  V    +A 
Sbjct  6    DYPLFGGAFSTTLPPGAIDVSDLRPVPDNQEVFCHRVTDQSLIVELLELQAHVQGEEAAR  65

Query  507  WFLQDLANEQDAEGTMV-IEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNL  683
            +  +D+   Q+A    V   Q  V+E   L      A I +  GQ  ++K  Q  +    
Sbjct  66   YHFEDVGGVQEARAVQVETVQPLVLENLALRGCCQEAWILS--GQQQVAKENQ--QVAKY  121

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLA  863
            V ++ A +RL +   D+L+T  +P   N     +S     +++P    G       F+  
Sbjct  122  VTLHQALLRLPQYQTDLLLTFNQPPPEN----RSSLGPENLSIPPWSLG------DFEQL  171

Query  864  VSTFKVNDWRLFG  902
            V++  ++D  +FG
Sbjct  172  VTSLTLHDPNIFG  184



>ref|XP_008268967.1| PREDICTED: ran guanine nucleotide release factor isoform X2 [Oryctolagus 
cuniculus]
Length=182

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 78/143 (55%), Gaps = 3/143 (2%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            + PLFGGA ++  P    DVS++R VPD+QEVF  P  D+SLI ELLEL+  V    +A 
Sbjct  6    DYPLFGGAFSAILPPGAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVRGEAAAR  65

Query  507  WFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLV  686
            +  +D+   Q A    V +    + +  L+ +T         G+  ++K  Q + A+N V
Sbjct  66   YHFEDVGGVQGARAQQV-DSVQTLSSESLALRTYCPEAWVLSGKQQVAKENQ-QVAKN-V  122

Query  687  KVYLANVRLKEVTADILITAYEP  755
             V+ A +RL +   D+L+T  +P
Sbjct  123  TVHQALLRLPQYQTDLLLTFNQP  145



>gb|KFY47891.1| hypothetical protein V496_10399 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
Length=196

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 92/203 (45%), Gaps = 23/203 (11%)
 Frame = +3

Query  321  YSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLEL-----KQDV  485
            Y + PLFGGA+ +  P  F DVS +RQVPD+QEV++D     S+IF++ E        D 
Sbjct  4    YRKTPLFGGALTAELPTSFADVSTIRQVPDNQEVYLDKEGFTSIIFDITERVGPAGSTDA  63

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D  + T  L+D+    D++  ++   S  V      F  LP   T A   +A    R  
Sbjct  64   TDGAALTIHLEDIV---DSDSDLLKVWSTTV----TQFSNLPE-DTPAYTLIATQTPRPD  115

Query  666  REAQN----LVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGC  833
             +A+N       + L  +RL+    D+LIT   P +    SE    +  G      Q   
Sbjct  116  PDARNPAPDFTAIVLNLIRLEREKTDVLITINVPHIKGEYSEEDVDLELG-----KQGKL  170

Query  834  MPMA-EVFKLAVSTFKVNDWRLF  899
            +  A E   +   +FKV DW LF
Sbjct  171  ISNAVEYASVIWESFKVRDWGLF  193



>ref|XP_005220404.1| PREDICTED: ran guanine nucleotide release factor isoform X1 [Bos 
taurus]
 ref|XP_010841342.1| PREDICTED: ran guanine nucleotide release factor isoform X2 [Bison 
bison bison]
Length=179

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 94/193 (49%), Gaps = 22/193 (11%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            + PLFGGA ++T P    DVS++R VPDHQEVF     D+SLI ELLEL+  V    +A 
Sbjct  6    DYPLFGGAFSATLPPGAIDVSDLRPVPDHQEVFCHRVTDQSLIVELLELQAHVQGEEAAR  65

Query  507  WFLQDLANEQDAEGTMV-IEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNL  683
            +  +D+   Q+A    V   Q  V+E   L      A I +  GQ  ++K          
Sbjct  66   YHFEDVGGVQEARAVQVETVQPLVLENLALRGCCQEAWILS--GQQQVAK---------Y  114

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLA  863
            V ++ A +RL +   D+L+T  +P   N     +S     +++P    G       F+  
Sbjct  115  VTLHQALLRLPQYQTDLLLTFNQPPPEN----RSSLGPENLSIPPWSLG------DFEQL  164

Query  864  VSTFKVNDWRLFG  902
            V++  ++D  +FG
Sbjct  165  VTSLTLHDPNIFG  177



>ref|XP_009050017.1| hypothetical protein LOTGIDRAFT_213480 [Lottia gigantea]
 gb|ESO99532.1| hypothetical protein LOTGIDRAFT_213480 [Lottia gigantea]
Length=189

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 92/166 (55%), Gaps = 8/166 (5%)
 Frame = +3

Query  306  MAVDMYSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDV  485
            M+ +  SE+ L+GGA+    P +  DVS +R VPD+QEVF     D+S+IF++LE  ++ 
Sbjct  1    MSSNGQSEQSLYGGAMTVILPPQAIDVSQIRDVPDNQEVFTHNVTDQSIIFDILEYIEE-  59

Query  486  ADNGSATWFLQDLA---NEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKG  656
             D+ +     Q++A      D + T +I    + +   L  +   A     +GQ  ++K 
Sbjct  60   PDHQAIQSHFQEVAEYNKASDNDVTKIISIEEISKDELLLTECTKAYY--VLGQQKVAKF  117

Query  657  RQGREAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAV  794
             +   A+NL+ ++L   RL + + DILIT+ +P++I+  S S +A+
Sbjct  118  NET--AKNLMNLHLGLFRLPQFSTDILITSNDPVIISPESSSHNAI  161



>emb|CDI74610.1| mog1 protein, putative [Eimeria praecox]
Length=184

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 92/190 (48%), Gaps = 17/190 (9%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            RPLFGGA++   P    D+S +  VPD QE FV+     S+I E+LE +Q + D  +A +
Sbjct  11   RPLFGGAMSCEIPNFLDDMSKILVVPDQQEAFVNDDGSISVIIEVLEHQQ-IPDANAAEF  69

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVK  689
            F +DL  E  A  + ++E   V   P          + +  G+  + K  +G  A + V 
Sbjct  70   FFKDLMEENSALSSRILESWLV---PKGESPVARHTVASLKGEFDVKK--KGAGAPDHVC  124

Query  690  VYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAVS  869
            V LA +R+ E  AD++I+      +N  +  A  +       A   G   +   F+L + 
Sbjct  125  VRLAAIRIPEHQADVVIS------MNERANEACGLSG-----AKTGGSGSLDHTFRLIIE  173

Query  870  TFKVNDWRLF  899
            +FK+ ++ LF
Sbjct  174  SFKILNYELF  183



>ref|XP_003466271.1| PREDICTED: ran guanine nucleotide release factor [Cavia porcellus]
Length=186

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 99/195 (51%), Gaps = 23/195 (12%)
 Frame = +3

Query  333  PLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWF  512
            PLFGGA ++ FP    DVS++R VPD+QEVF  P  D+SLI ELLEL+  V    +A + 
Sbjct  8    PLFGGAFSAVFPRGAIDVSDLRPVPDNQEVFCHPRTDQSLIVELLELQAHVQGEAAARYH  67

Query  513  LQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQ--GREAQNLV  686
             +D+   Q   G+ V++   V     L+ ++L   +     +  +  G+Q   +E Q + 
Sbjct  68   FEDVGRVQ---GSRVLQVESVQP---LNLESL--ALRGCCQEAWVLSGKQQVAKENQQVA  119

Query  687  K---VYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFK  857
            K   ++ A +R+ +   D+L+T   P   N     +S    G++ P+   G       F+
Sbjct  120  KDVILHQALLRVPQYQTDLLVTFNHPPPDN----RSSLGPEGLSPPSWNLG------DFE  169

Query  858  LAVSTFKVNDWRLFG  902
              V++  ++D  +FG
Sbjct  170  QLVTSLTLHDPNIFG  184



>dbj|BAB26824.1| unnamed protein product [Mus musculus]
Length=185

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 90/191 (47%), Gaps = 16/191 (8%)
 Frame = +3

Query  333  PLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWF  512
            PLFGGA ++  P    DVS++R VPD+QEVF  P  D+SLI ELLEL+  V     A + 
Sbjct  8    PLFGGAFSAILPTGAIDVSDLRPVPDNQEVFCHPVTDQSLIIELLELQAHVQGERGARYH  67

Query  513  LQDLANEQDAEGTMVIE-QSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVK  689
             +D+   Q A    V+  Q   +E   LS +       +  G+  ++K  Q  +    V 
Sbjct  68   FEDVGRVQGARAVHVLSVQPLCLE--NLSLRGCCQDAWSLSGKQQVAKENQ--QVAKDVT  123

Query  690  VYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAVS  869
            ++ A +RL +   D+L+T  +P        S S     ++ P            F+  V+
Sbjct  124  LHQALLRLPQYQTDLLLTFNQPPC-----HSRSLGPENLSCPPWSLS------NFEQLVT  172

Query  870  TFKVNDWRLFG  902
            +  ++D  LFG
Sbjct  173  SLTLHDPNLFG  183



>ref|NP_001099260.1| ran guanine nucleotide release factor [Rattus norvegicus]
 gb|EDM04828.1| rCG35454 [Rattus norvegicus]
Length=185

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/191 (30%), Positives = 90/191 (47%), Gaps = 16/191 (8%)
 Frame = +3

Query  333  PLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWF  512
            PLFGGA ++  P    DVS++R VPD+QEVF  P  D+SLI ELLEL+  V    +A + 
Sbjct  8    PLFGGAFSAILPRGAIDVSDLRPVPDNQEVFCHPVTDQSLIIELLELQAHVQGEAAARYH  67

Query  513  LQDLANEQDAEGTMVIE-QSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVK  689
             +D+   Q A    V+  Q   +E   L      A   +   Q+A    ++ ++    V 
Sbjct  68   FEDVGGVQGARSVHVLSVQPLCLENLSLRGCCQDAWFLSGKQQVA----KENQQVAKDVT  123

Query  690  VYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAVS  869
            ++ A +RL +   D+L+T  +P        S       ++ P    G       F+  V+
Sbjct  124  LHQALLRLPQYQTDLLLTFNQPPC-----HSRPLGPENLSCPPWSLG------NFEQLVT  172

Query  870  TFKVNDWRLFG  902
            +  ++D  LFG
Sbjct  173  SLTLHDPNLFG  183



>ref|NP_001171272.1| ran guanine nucleotide release factor isoform B [Homo sapiens]
 gb|AAG01291.1|AF265205_1 MOG1 isoform B [Homo sapiens]
 emb|CAG33487.1| RANGNRF [Homo sapiens]
 gb|AAI00018.1| RANGNRF protein [Homo sapiens]
 dbj|BAF83088.1| unnamed protein product [Homo sapiens]
Length=146

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/142 (34%), Positives = 76/142 (54%), Gaps = 5/142 (4%)
 Frame = +3

Query  333  PLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWF  512
            PLFGGA ++  P+   DVS++R VPD+QEVF  P  D+SLI ELLEL+  V    +A + 
Sbjct  8    PLFGGAFSAILPMGAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVRGEAAARYH  67

Query  513  LQDLANEQDAEGTMVIE-QSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVK  689
             +D+   Q A    V   Q   +E   L  +   A + +   Q+A    ++ ++    V 
Sbjct  68   FEDVGGVQGARAVHVESVQPLSLENLALRGRCQEAWVLSGKQQIA----KENQQVAKDVT  123

Query  690  VYLANVRLKEVTADILITAYEP  755
            ++ A +RL +   D+L+T  +P
Sbjct  124  LHQALLRLPQYQTDLLLTFNQP  145



>ref|XP_004266912.1| PREDICTED: ran guanine nucleotide release factor [Orcinus orca]
Length=186

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 59/193 (31%), Positives = 96/193 (50%), Gaps = 15/193 (8%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            + PLFGGA ++T P    DVS++R+VPD+QEVF     D+SLI ELLEL+  V    +A 
Sbjct  6    DYPLFGGAFSATLPPGAIDVSDLRRVPDNQEVFCHRVTDQSLILELLELQAHVQGEEAAR  65

Query  507  WFLQDLANEQDAEGTMV-IEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNL  683
            +  +D+   Q+A    V   Q  ++E   L      A I +   Q+A    ++ ++    
Sbjct  66   YHFEDVGGVQEARVVQVEAVQPLLLENLALRGCCQEAWILSGKQQVA----KENQQVAKY  121

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLA  863
            V +Y A +RL +   D L+T  +P   N     +S     +++P    G       F+  
Sbjct  122  VTLYQALLRLPQYQTDFLLTFNQPPPEN----RSSLGPENLSLPPWSLG------DFEQL  171

Query  864  VSTFKVNDWRLFG  902
            V++  ++D  +FG
Sbjct  172  VTSLTLHDPNIFG  184



>gb|ELR08333.1| hypothetical protein GMDG_03128 [Pseudogymnoascus destructans 
20631-21]
Length=196

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 91/203 (45%), Gaps = 23/203 (11%)
 Frame = +3

Query  321  YSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLEL-----KQDV  485
            Y + PLFGGA+ +  P  F DVS +RQVPD+QEV++D     S+IF++ E        D 
Sbjct  4    YRKTPLFGGALTAELPTTFADVSTIRQVPDNQEVYLDKEGFTSIIFDITERVGPSGSTDA  63

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D  + T  LQD+    D++  ++     V       F  LP   T A   +A    +  
Sbjct  64   TDGAALTIHLQDIV---DSDSDLL----KVWSTTDTQFSNLPP-DTPAYTLIATQTPQPD  115

Query  666  REAQN----LVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGC  833
             EA+N       + L  +RL+    D+LIT   P +    SE    +  G      Q   
Sbjct  116  PEARNPAPDFTAIVLNLIRLERERTDVLITINVPHIKGEYSEEDVDLELG-----RQGKL  170

Query  834  MPMA-EVFKLAVSTFKVNDWRLF  899
            +  A E   +   +FKV DW LF
Sbjct  171  ISNAVEYASVIWESFKVRDWGLF  193



>ref|XP_007295313.1| ran-interacting Mog1 protein [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD14194.1| ran-interacting Mog1 protein [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=194

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 90/200 (45%), Gaps = 19/200 (10%)
 Frame = +3

Query  321  YSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLEL-----KQDV  485
            Y+  PLFGGA+    P  F DVS +RQVPDHQEV++D     S+IF++ E          
Sbjct  4    YTSTPLFGGALIVDLPSSFADVSTIRQVPDHQEVYLDKDGFTSIIFDITERVGLPGTGPA  63

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISK--GR  659
             D  + T  L+D+ +  D       +   V       F  LP   T A   +A      +
Sbjct  64   VDGAALTTHLEDIVDSDD-------DTVKVWNTSNTQFSKLPD-KTPAYTLIATQTPPPQ  115

Query  660  QGREAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMP  839
             G ++ +   + L  VRL+  + DILIT   P +    +     ++ G      ++    
Sbjct  116  PGSKSPDFTAIVLTLVRLERESTDILITINVPHIKGEYTVEEVDMQMGKQGKLIESAVEY  175

Query  840  MAEVFKLAVSTFKVNDWRLF  899
             A++++    TFK+ DW LF
Sbjct  176  AAKIWE----TFKIKDWGLF  191



>gb|KFY85744.1| hypothetical protein V500_08149 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=196

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 62/203 (31%), Positives = 92/203 (45%), Gaps = 23/203 (11%)
 Frame = +3

Query  321  YSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLEL-----KQDV  485
            + + PLFGGA+ +  P  F DVS +RQVPD+QEV++D     S+IF++ E        D 
Sbjct  4    FRKTPLFGGALTADLPTTFADVSTIRQVPDNQEVYLDKEGFTSIIFDITERVGPAGSTDA  63

Query  486  ADNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D  + T  L+D+    D++  ++     V       F  LP   T A   +A    R  
Sbjct  64   TDGAALTIHLEDIV---DSDTDLL----KVWSTTSTQFSNLPP-DTPAYTLIATQTPRPD  115

Query  666  REAQN----LVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGC  833
             EA+N       + L  +RL++   D+LIT   P +    SE    +  G      Q   
Sbjct  116  PEARNPAPDFTAIVLNLIRLEKEKTDVLITINVPHIKGEYSEEDVDLELG-----KQGKL  170

Query  834  MPMA-EVFKLAVSTFKVNDWRLF  899
            +  A E   +   +FKV DW LF
Sbjct  171  ISNAVEYASVIWESFKVRDWGLF  193



>ref|XP_003929270.1| PREDICTED: ran guanine nucleotide release factor isoform X1 [Saimiri 
boliviensis boliviensis]
Length=186

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 93/195 (48%), Gaps = 23/195 (12%)
 Frame = +3

Query  333  PLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWF  512
            PLFGGA ++  P    DVS++R VPD+QEVF  P  D+SLI ELLEL+  V    +A + 
Sbjct  8    PLFGGAFSAILPTGAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVVGEAAARYH  67

Query  513  LQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQ--GREAQNLV  686
             +D+   Q A          V     LS +TL   +     +  +  G+Q   +E Q + 
Sbjct  68   FEDVGGVQGARAVH------VESVQPLSLETL--ALRGCCQEAWVLSGKQQIAKENQQVA  119

Query  687  K---VYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFK  857
            K   ++ A +RL +   D+L+T  +P   N     +S     ++ P    G       F+
Sbjct  120  KDVTLHQALLRLPQYQTDLLLTFNQPPADN----RSSLGPENLSPPPWSLG------EFE  169

Query  858  LAVSTFKVNDWRLFG  902
              V++  ++D  +FG
Sbjct  170  QLVTSLTLHDPNIFG  184



>emb|CDJ68253.1| mog1 protein, putative [Eimeria necatrix]
Length=187

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/191 (32%), Positives = 94/191 (49%), Gaps = 17/191 (9%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            R LFGGA+    P    D+S +  VPD QE FV+     S+I E+LE  Q V D  +A +
Sbjct  12   RSLFGGAMTCDIPEFLDDMSKIMIVPDQQEAFVNDDGSISVIIEVLE-HQPVPDTQAAEF  70

Query  510  FLQDLANEQDAEGTMVIEQSGV-VEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLV  686
            F  DL  E  +  + +++ S V  E P +    L  +     G+  + K R  R    LV
Sbjct  71   FFNDLMAENSSLSSRILDTSIVPKEEPPMQGHALAFL----KGEFQVQKKRAARPDHVLV  126

Query  687  KVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAV  866
            +  LA VR+ E  ADI+I+  E +     +E+A        + AA +    + + F+L V
Sbjct  127  R--LAIVRIPEHRADIVISMNERV-----TETADGHGNHAEIGAAGS----LDDAFRLIV  175

Query  867  STFKVNDWRLF  899
             +F++ D+ LF
Sbjct  176  ESFRILDYGLF  186



>ref|XP_002921197.1| PREDICTED: ran guanine nucleotide release factor-like [Ailuropoda 
melanoleuca]
 gb|EFB18788.1| hypothetical protein PANDA_010061 [Ailuropoda melanoleuca]
Length=186

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 94/193 (49%), Gaps = 15/193 (8%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            + PLFGGA ++T P    DVS++R VPD+QEVF     D+SLI ELLEL+  V    +A 
Sbjct  6    DYPLFGGAFSATLPPGALDVSDLRPVPDNQEVFCHRVTDQSLIVELLELQAHVQGQEAAR  65

Query  507  WFLQDLANEQDAEGTMVIE-QSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNL  683
            +  +D+   Q A    V   Q  ++E   L      A + +   Q+A    ++ ++A   
Sbjct  66   YHFEDVGGVQGARALQVDSVQPLLLENLALRSCCQEAWVLSGKQQVA----KENQQAAKD  121

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLA  863
            V V+ A +RL     D+L+T  +P   N LS         +++P    G       F+  
Sbjct  122  VTVHQALLRLPRYQTDLLLTFNDPPPDNRLSLGPE----NLSLPPWSLG------DFEQL  171

Query  864  VSTFKVNDWRLFG  902
            V++  + D  +FG
Sbjct  172  VTSLTLQDPNIFG  184



>ref|XP_001504868.1| PREDICTED: ran guanine nucleotide release factor isoform X1 [Equus 
caballus]
Length=186

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 97/193 (50%), Gaps = 15/193 (8%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            + PLFGGA ++T P    DVS++R VPD+QEVF     D+SLI ELLEL+  V    +A 
Sbjct  6    DYPLFGGAFSATLPPGAIDVSDLRPVPDNQEVFCHRLTDQSLIVELLELQAQVRGEAAAR  65

Query  507  WFLQDLANEQDAEGTMV-IEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNL  683
            +  +D+   Q+A    V   Q  ++E   L      A + +   Q+A    ++ ++   +
Sbjct  66   YHFEDVGGVQEARAVQVEAVQPLLLENLALRGCCQEAWVLSGKQQVA----KEHQQVAEV  121

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLA  863
            V ++ A +RL +   D+L+T  +P+  N     +S     ++ P    G       F+  
Sbjct  122  VTLHQALLRLPQYQTDLLLTFNQPLPDN----RSSLGPENLSPPPWSLG------DFEQL  171

Query  864  VSTFKVNDWRLFG  902
            VS+  ++D  +FG
Sbjct  172  VSSLTLHDPNIFG  184



>ref|XP_005657094.1| PREDICTED: RAN guanine nucleotide release factor isoform X1 [Sus 
scrofa]
Length=186

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 96/192 (50%), Gaps = 15/192 (8%)
 Frame = +3

Query  333  PLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWF  512
            PLFGGA ++T P    DVS++R VPD+QEVF     D+SLI ELLEL+  V    +A + 
Sbjct  8    PLFGGAFSATLPPGAIDVSDLRPVPDNQEVFCHRETDQSLIVELLELQAHVQGEEAARYH  67

Query  513  LQDLANEQDAEGTMVIE-QSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVK  689
             +D+   Q+A    V   Q  ++E   L      A I +   Q+A    ++ ++    V 
Sbjct  68   FEDVGGVQEARAVQVEAVQPLLLENLALRGCCQEAWILSGKQQVA----KENQQVAKCVT  123

Query  690  VYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAVS  869
            ++ A +RL +   D+L+T  +P   N     +S     +++P    G       F+  V+
Sbjct  124  LHQALLRLPQYQTDLLLTFNQPPPEN----RSSLGPENLSLPPWSLG------DFEQLVT  173

Query  870  TFKVNDWRLFGA  905
            +  ++D  +FG+
Sbjct  174  SLTLHDPNIFGS  185



>emb|CCC49672.1| putative Ran-binding protein [Trypanosoma vivax Y486]
Length=206

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 68/208 (33%), Positives = 98/208 (47%), Gaps = 31/208 (15%)
 Frame = +3

Query  333  PLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWF  512
            PL+GGAI  T P+   DVS +RQVPD QEV+ +      +IFELL  ++ V +     +F
Sbjct  7    PLYGGAITCTLPLSMVDVSELRQVPDTQEVYTEVETGTCVIFELLARERGVGNEECGAYF  66

Query  513  LQDL--ANEQDAEGTMVIEQSGV--VEAPGLS-----------FQTLPAIITTAVGQMAI  647
              DL  AN    E      Q  +  V+ P +S           F    A + T  G+  +
Sbjct  67   YADLARANGCGKEDFTFSPQETLCAVDYPQISGPSSGLDEANRFACAFACLVT--GRQRV  124

Query  648  SKGRQGREAQNLVKVYLANVRLK-EVTADILITAYEPIVINLLSESASAV---RAGVAVP  815
            SK    +  +N V V +A +R +  V+ DI+I+   P  I+  S  A  V   R+   V 
Sbjct  125  SKYTNEKGKENDVLVVMAVLRFEPPVSTDIIISISAPQRIHPESSEARVVQRLRSDEEV-  183

Query  816  AAQAGCMPMAEVFKLAVSTFKVNDWRLF  899
                    MA + +L ++TFKV DW LF
Sbjct  184  --------MAMIRRL-LATFKVKDWGLF  202



>gb|EPT05899.1| hypothetical protein FOMPIDRAFT_1154477 [Fomitopsis pinicola 
FP-58527 SS1]
Length=180

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 87/193 (45%), Gaps = 21/193 (11%)
 Frame = +3

Query  330  RPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATW  509
            R LFGGAI +T P    D S++RQVPD QEVF+ P    S+I E+L+  +       A +
Sbjct  7    RELFGGAITATLPTSLIDASDLRQVPDTQEVFLYPDSSVSIIVEILQCVEPTEAADIAKF  66

Query  510  FLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGR--EAQNL  683
              + LA++ DA    V+E   V +         P++  T  G   + K       E Q L
Sbjct  67   HFESLAHDNDAVEKTVLE---VCQPTSEGSGNPPSLPITLRGTQLVCKFNHAHPDELQIL  123

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLA  863
            + VY    RLKE   D++++   PI       S  A        AA+       E F  A
Sbjct  124  LAVY----RLKEQNVDLVVSMNVPI-----KTSDGATTTANDFTAAR-------ETFSAA  167

Query  864  VSTFKVNDWRLFG  902
            V + ++ D+ LF 
Sbjct  168  VESLRIVDYGLFA  180



>ref|XP_006738276.1| PREDICTED: ran guanine nucleotide release factor [Leptonychotes 
weddellii]
Length=188

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/191 (30%), Positives = 95/191 (50%), Gaps = 13/191 (7%)
 Frame = +3

Query  333  PLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWF  512
            PLFGGA ++T P    DVS++R VPD+QEVF     D+SL+ ELLEL+  V    +A + 
Sbjct  8    PLFGGAFSATLPPGALDVSDLRPVPDNQEVFCHRVTDQSLVVELLELQAHVQGEEAARYH  67

Query  513  LQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISK-GRQGREAQNLVK  689
             +D+   Q A   M ++    +    L+ ++         G+  ++K  +QGR A++ V 
Sbjct  68   FEDVGGVQGARA-MQVDSVQPLPLENLALRSFCQEAWVLSGKQQVAKENQQGRVAKD-VT  125

Query  690  VYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAVS  869
             +   +RL     D+L+T  +P   N LS         +++P    G       F+  V+
Sbjct  126  AHQTLLRLPRYQTDLLLTFNDPPPDNRLSLGPE----NLSLPPWSLG------DFEQLVT  175

Query  870  TFKVNDWRLFG  902
            +  ++D  +FG
Sbjct  176  SLTLHDPNIFG  186



>ref|XP_004329214.1| PREDICTED: ran guanine nucleotide release factor [Tursiops truncatus]
Length=186

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 59/193 (31%), Positives = 95/193 (49%), Gaps = 15/193 (8%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            + PLFGGA ++T P    DVS++R VPD+QEVF     D+SLI ELLEL+  V    +A 
Sbjct  6    DYPLFGGAFSATLPPGAIDVSDLRPVPDNQEVFCHRVTDQSLILELLELQAHVQGEEAAR  65

Query  507  WFLQDLANEQDAEGTMV-IEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNL  683
            +  +D+   Q+A    V   Q  ++E   L      A I +   Q+A    ++ ++    
Sbjct  66   YHFEDVGGVQEARVVQVEAVQPLLLENLALRGCCQEAWILSGKQQVA----KENQQVAKY  121

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLA  863
            V +Y A +RL +   D L+T  +P   N     +S     +++P    G       F+  
Sbjct  122  VTLYQALLRLPQYQTDFLLTFNQPPPEN----RSSLGPENLSLPPWSLG------DFEQL  171

Query  864  VSTFKVNDWRLFG  902
            V++  ++D  +FG
Sbjct  172  VTSLTLHDPNIFG  184



>ref|XP_849976.2| PREDICTED: ran guanine nucleotide release factor isoformX2 [Canis 
lupus familiaris]
Length=194

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 77/151 (51%), Gaps = 5/151 (3%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            + PLFGGA ++T P    DVS++R VPD+QEVF     D+SLI ELLEL+  V    +A 
Sbjct  14   DYPLFGGAFSATLPPGALDVSDLRPVPDNQEVFCHRVTDQSLIVELLELQAHVQGEEAAR  73

Query  507  WFLQDLANEQDAEGTMVIE-QSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNL  683
            +  +D+   Q+A    V   Q  + E   L      A + +   Q+A    ++  +    
Sbjct  74   YHFEDVGGMQEARALQVDSVQPLLSENLALRSYCQEAWVLSGKQQVA----KENHQVAKD  129

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLS  776
            V V+ A +RL     D+L+T  EP   N LS
Sbjct  130  VMVHQALLRLPRYQTDVLVTFNEPPPDNRLS  160



>ref|NP_001272371.1| ran guanine nucleotide release factor isoform 3 [Mus musculus]
Length=178

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/191 (30%), Positives = 89/191 (47%), Gaps = 23/191 (12%)
 Frame = +3

Query  333  PLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSATWF  512
            PLFGGA ++  P    DVS++R VPD+QEVF  P  D+SLI ELLEL+  V    +A + 
Sbjct  8    PLFGGAFSAILPTGAIDVSDLRPVPDNQEVFCHPVTDQSLIIELLELQAHVQGEAAARYH  67

Query  513  LQDLANEQDAEGTMVIE-QSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLVK  689
             +D+   Q A    V+  Q   +E   LS +       +  G+  ++K          V 
Sbjct  68   FEDVGRVQGARAVHVLSVQPLCLE--NLSLRGCCQDAWSLSGKQQVAKD---------VT  116

Query  690  VYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAVS  869
            ++ A +RL +   D+L+T  +P        S S     ++ P            F+  V+
Sbjct  117  LHQALLRLPQYQTDLLLTFNQPPC-----HSRSLGPENLSCPPWSLS------NFEQLVT  165

Query  870  TFKVNDWRLFG  902
            +  ++D  LFG
Sbjct  166  SLTLHDPNLFG  176



>ref|XP_006062973.1| PREDICTED: ran guanine nucleotide release factor isoform X2 [Bubalus 
bubalis]
Length=179

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 94/193 (49%), Gaps = 22/193 (11%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            + PLFGGA ++T P    DVS++R VPD+QEVF     D+SLI ELLEL+  V    +A 
Sbjct  6    DYPLFGGAFSATLPPGAIDVSDLRPVPDNQEVFCHRVTDQSLIVELLELQAHVQGEEAAR  65

Query  507  WFLQDLANEQDAEGTMV-IEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNL  683
            +  +D+   Q+A    V   Q  V+E   L      A I +  GQ  ++K          
Sbjct  66   YHFEDVGGVQEARAVQVETVQPLVLENLALRGCCQEAWILS--GQQQVAK---------Y  114

Query  684  VKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLA  863
            V ++ A +RL +   D+L+T  +P   N LS         +++P    G       F+  
Sbjct  115  VTLHQALLRLPQYQTDLLLTFNQPPPENRLSLGPE----NLSIPPWSLG------DFEQL  164

Query  864  VSTFKVNDWRLFG  902
            V++  ++D  +FG
Sbjct  165  VTSLTLHDPNIFG  177



>ref|XP_002142144.1| nuclear import protein mog1 [Cryptosporidium muris RN66]
 gb|EEA07795.1| nuclear import protein mog1, putative [Cryptosporidium muris 
RN66]
Length=180

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 90/191 (47%), Gaps = 16/191 (8%)
 Frame = +3

Query  327  ERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSAT  506
            +  L+G +I    P  F D+S +R VPDHQEVFVD   + S+IFE+L+ + D+  +    
Sbjct  5    QHQLYGDSIRVEIPRNFIDISKIRDVPDHQEVFVDDLSESSIIFEILQ-QTDLKSDQIGE  63

Query  507  WFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQGREAQNLV  686
            ++ +DLA+  ++  + V+    +V+     F       +T  G   + K  Q  E    +
Sbjct  64   YYFKDLADCNESTSSEVLYSEPLVQYNKEFF------TSTCFGIQQVQKRYQEGERNENL  117

Query  687  KVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMAEVFKLAV  866
             +Y+  +R+     DILI+       N + +    +    A+  +      + E+ K  +
Sbjct  118  YLYVLVIRILMKKTDILIS------FNSVMKQDQRIVQENAIYYSND---TIQEIIKHIL  168

Query  867  STFKVNDWRLF  899
             TF + +W LF
Sbjct  169  ETFTIRNWDLF  179



>gb|EPB86349.1| hypothetical protein HMPREF1544_06888 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=188

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 91/199 (46%), Gaps = 18/199 (9%)
 Frame = +3

Query  324  SERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVADNGSA  503
            S + LFGGAI       F D S  RQ+PD+QEVFVD    +SLIFELLE + +  +   A
Sbjct  2    SAQELFGGAIMVPVLGSFVDASQFRQIPDNQEVFVDMNTQQSLIFELLE-QVEATNEQVA  60

Query  504  TWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG------  665
             +  Q LA++ +A       +S V     L  Q +  ++     ++ + +G Q       
Sbjct  61   KYHFQQLADDNEA------AESTVTLVDNLKPQDVSPLLPQDATEIYVLQGSQKIAKFNE  114

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
              A N V++ L  VRL +V  D +I+   P+ +   S    +V    AV         M 
Sbjct  115  SNAFNTVEIILVVVRLTKVETDFVISVNAPVKLASTSSEQESVNETSAVTIDTVK-QEML  173

Query  846  EVFKLAVSTFKVNDWRLFG  902
             + K      +V DW LFG
Sbjct  174  TILK----GLQVKDWSLFG  188



>gb|KHO01136.1| Ran-interacting protein Mog1 [Metarhizium album ARSEF 1941]
Length=197

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 90/199 (45%), Gaps = 12/199 (6%)
 Frame = +3

Query  321  YSERPLFGGAIASTFPVRFQDVSNVRQVPDHQEVFVDPARDESLIFELLELKQDVA----  488
            Y   PL+GGAI    P +F DVS +RQVPD+QEV++D     S+IF++ E   +      
Sbjct  4    YHGMPLYGGAIVCDIPDKFADVSKLRQVPDNQEVWIDKDGFTSIIFDITERVGEPGHGPE  63

Query  489  -DNGSATWFLQDLANEQDAEGTMVIEQSGVVEAPGLSFQTLPAIITTAVGQMAISKGRQG  665
             D  + T  L+D+    D + T+ I  +   E   L  +  PA    A     I + RQG
Sbjct  64   IDGRAMTIHLEDMVG-SDID-TVKIWNTAETEFSRLESKP-PAYTLIATQTPRIGQSRQG  120

Query  666  REAQNLVKVYLANVRLKEVTADILITAYEPIVINLLSESASAVRAGVAVPAAQAGCMPMA  845
                +   + +  +RL++  +DILIT   P +     E    +  G             A
Sbjct  121  GSPPDFTAIIMTLLRLEKYNSDILITINVPHIKGEYDEDEVDLELGKQGKLIGDAVEYSA  180

Query  846  EVFKLAVSTFKVNDWRLFG  902
             +++    + K+ DW LFG
Sbjct  181  RIWE----SLKIKDWELFG  195



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2217996789222