BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25716_g2_i1 len=857 path=[395:0-143 539:144-176 15480:177-203
15507:204-204 6269:205-210 15511:211-230 15531:231-239 6303:240-272
6336:273-282 5072:283-319 15563:320-320 14771:321-322 6385:323-370
4333:371-390 6452:391-414 15620:415-418 6480:419-435 6497:436-468
6529:469-588 2655:589-626 15730:627-646 15742:647-663 6721:664-856]

Length=857
                                                                      Score     E

ref|XP_006345416.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          292   7e-94   
ref|NP_001234838.1|  alcohol dehydrogenase-like                         290   4e-93   
ref|XP_009611351.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          289   2e-92   
ref|XP_010659458.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          276   1e-87   
emb|CBI24952.3|  unnamed protein product                                274   9e-87   
ref|XP_008231472.1|  PREDICTED: tetraketide alpha-pyrone reductas...    273   3e-86   
ref|NP_001280189.1|  cinnamoyl-CoA reductase 1                          272   5e-86   
emb|CBI29129.3|  unnamed protein product                                273   6e-86   
ref|XP_007211587.1|  hypothetical protein PRUPE_ppa008618mg             271   9e-86   
emb|CBI29100.3|  unnamed protein product                                270   2e-85   
ref|XP_003633516.1|  PREDICTED: cinnamoyl-CoA reductase 1 isoform X1    270   3e-85   
dbj|BAG13450.2|  phenylacetaldehyde reductase                           270   4e-85   Rosa x damascena [damask rose]
ref|XP_004491683.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          270   4e-85   
ref|XP_002314052.1|  putative cinnamoyl-CoA reductase family protein    270   4e-85   Populus trichocarpa [western balsam poplar]
ref|XP_002285368.1|  PREDICTED: cinnamoyl-CoA reductase 1               269   5e-85   Vitis vinifera
ref|XP_010067832.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          269   6e-85   
gb|KHG03033.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    269   7e-85   
ref|XP_002298395.1|  cinnamyl-alcohol dehydrogenase family protein      268   1e-84   Populus trichocarpa [western balsam poplar]
gb|AHC29025.1|  phenylacetaldehyde reductase                            268   2e-84   
ref|XP_011025488.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    268   2e-84   
emb|CBI29130.3|  unnamed protein product                                267   3e-84   
dbj|BAQ20438.1|  2-phenylethanol                                        267   4e-84   
ref|XP_008231476.1|  PREDICTED: tetraketide alpha-pyrone reductas...    267   4e-84   
ref|XP_002268122.1|  PREDICTED: cinnamoyl-CoA reductase 1               266   6e-84   Vitis vinifera
ref|XP_002268322.1|  PREDICTED: cinnamoyl-CoA reductase 1               266   7e-84   Vitis vinifera
ref|XP_004307229.1|  PREDICTED: tetraketide alpha-pyrone reductas...    266   9e-84   
emb|CBI40606.3|  unnamed protein product                                266   1e-83   
emb|CBI38203.3|  unnamed protein product                                266   1e-83   
emb|CAN65489.1|  hypothetical protein VITISV_003761                     266   1e-83   Vitis vinifera
ref|NP_001289243.1|  CAD protein                                        266   1e-83   
ref|XP_004307230.1|  PREDICTED: tetraketide alpha-pyrone reductas...    266   1e-83   
ref|XP_007218281.1|  hypothetical protein PRUPE_ppa008382mg             266   2e-83   
ref|XP_011013832.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          265   2e-83   
gb|AAY26021.2|  cinnamyl alcohol dehydrogenase                          265   2e-83   Eucommia ulmoides
gb|AFK47029.1|  unknown                                                 265   2e-83   
gb|AAC06319.1|  putative cinnamyl alcohol dehydrogenase                 265   3e-83   Malus domestica [apple tree]
ref|XP_007221091.1|  hypothetical protein PRUPE_ppa017116mg             263   3e-83   
gb|EYU27028.1|  hypothetical protein MIMGU_mgv1a010102mg                265   3e-83   
ref|XP_010246748.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          265   3e-83   
ref|XP_008349860.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          265   3e-83   
gb|AIB06353.1|  cinnamyl alcohol dehydrogenase                          264   4e-83   
ref|XP_003634871.2|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    265   4e-83   
ref|XP_011045419.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          264   5e-83   
ref|XP_007015091.1|  Cinnamyl alcohol dehydrogenase, 82967-79323,...    264   5e-83   
ref|XP_007218683.1|  hypothetical protein PRUPE_ppa008707mg             264   5e-83   
emb|CBI40605.3|  unnamed protein product                                264   5e-83   
ref|XP_004291772.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          264   6e-83   
ref|XP_002263014.1|  PREDICTED: cinnamoyl-CoA reductase 1               264   7e-83   Vitis vinifera
ref|XP_011025551.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          264   7e-83   
ref|XP_010067837.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    264   7e-83   
ref|XP_009374930.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          264   8e-83   
ref|XP_011032045.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          264   9e-83   
ref|XP_011025487.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    263   1e-82   
ref|XP_002314079.1|  cinnamyl-alcohol dehydrogenase family protein      263   1e-82   Populus trichocarpa [western balsam poplar]
gb|ABV44810.1|  cinnamyl alcohol dehydrogenase 1                        262   2e-82   Eriobotrya japonica [loquat]
gb|EYU27029.1|  hypothetical protein MIMGU_mgv1a010102mg                263   2e-82   
ref|XP_008363567.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          263   2e-82   
ref|XP_003633515.2|  PREDICTED: LOW QUALITY PROTEIN: cinnamoyl-Co...    270   3e-82   
ref|XP_006345417.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          263   3e-82   
ref|XP_006446146.1|  hypothetical protein CICLE_v10015912mg             262   3e-82   
emb|CAN71341.1|  hypothetical protein VITISV_002438                     262   4e-82   Vitis vinifera
ref|XP_008363357.1|  PREDICTED: cinnamoyl-CoA reductase 1               262   5e-82   
ref|XP_008354172.1|  PREDICTED: tetraketide alpha-pyrone reductas...    260   5e-82   
ref|XP_011090120.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          261   6e-82   
ref|XP_007015092.1|  Cinnamyl alcohol dehydrogenase, 82967-79323,...    261   6e-82   
ref|XP_011088010.1|  PREDICTED: tetraketide alpha-pyrone reductas...    261   8e-82   
ref|XP_011025485.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    261   8e-82   
ref|XP_008231475.1|  PREDICTED: tetraketide alpha-pyrone reductas...    261   1e-81   
ref|XP_008231479.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          261   1e-81   
gb|AES68255.2|  cinnamyl-alcohol dehydrogenase-like protein             259   1e-81   
gb|KHG07124.1|  Dihydroflavonol-4-reductase                             261   1e-81   
emb|CDP09262.1|  unnamed protein product                                260   2e-81   
ref|XP_008363305.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          259   3e-81   
ref|XP_008353752.1|  PREDICTED: tetraketide alpha-pyrone reductas...    258   3e-81   
pdb|4QTZ|A  Chain A, Crystal Structure Of Cinnamyl-alcohol Dehydr...    259   3e-81   
ref|XP_008349589.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          259   3e-81   
gb|KDP22108.1|  hypothetical protein JCGZ_25939                         262   3e-81   
ref|XP_003598002.1|  Dihydroflavonol-4-reductase                        259   3e-81   
ref|XP_010102363.1|  hypothetical protein L484_015312                   259   4e-81   
ref|XP_008375272.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          256   5e-81   
ref|XP_009354349.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          259   7e-81   
ref|NP_197445.1|  alcohol dehydrogenase-like protein                    259   7e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011080358.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          258   8e-81   
gb|ADO51749.1|  cinnamyl alcohol dehydrogenase                          258   9e-81   
ref|XP_007219627.1|  hypothetical protein PRUPE_ppa024869mg             257   1e-80   
gb|KHM99527.1|  Dihydroflavonol-4-reductase                             257   1e-80   
emb|CDY14000.1|  BnaC09g38260D                                          258   1e-80   
ref|XP_002513513.1|  cinnamoyl-CoA reductase, putative                  261   1e-80   Ricinus communis
ref|XP_011025486.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    258   2e-80   
pdb|4QUK|A  Chain A, Crystal Structure Of Cinnamyl-alcohol Dehydr...    258   2e-80   
ref|XP_011080432.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          258   2e-80   
gb|AIC85610.1|  cinnamyl alcohol dehydrogenase                          255   2e-80   
ref|XP_007131546.1|  hypothetical protein PHAVU_011G022300g             257   2e-80   
ref|XP_009120886.1|  PREDICTED: cinnamoyl-CoA reductase 1 isoform X1    258   3e-80   
ref|XP_010908347.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    257   3e-80   
gb|AFU90744.1|  cinnamyl alcohol dehydrogenase                          257   3e-80   
gb|KDP43569.1|  hypothetical protein JCGZ_16856                         257   3e-80   
ref|XP_007149029.1|  hypothetical protein PHAVU_005G034500g             257   3e-80   
ref|XP_010102362.1|  hypothetical protein L484_015311                   257   3e-80   
gb|EYU31375.1|  hypothetical protein MIMGU_mgv1a010032mg                257   3e-80   
ref|XP_007218282.1|  hypothetical protein PRUPE_ppa008382mg             258   3e-80   
gb|AFK47262.1|  unknown                                                 257   3e-80   
gb|AAM65984.1|  cinnamyl-alcohol dehydrogenase-like protein             257   3e-80   Arabidopsis thaliana [mouse-ear cress]
emb|CAJ43901.1|  cinnamyl alcohol dehydrogenase                         257   4e-80   Quercus ilex [holly oak]
ref|XP_002314053.2|  putative cinnamoyl-CoA reductase family protein    257   5e-80   Populus trichocarpa [western balsam poplar]
ref|XP_006851072.1|  hypothetical protein AMTR_s00025p00240760          256   5e-80   
emb|CDX92530.1|  BnaA10g15690D                                          257   5e-80   
ref|XP_008231477.1|  PREDICTED: tetraketide alpha-pyrone reductas...    256   6e-80   
gb|ACJ85556.1|  unknown                                                 256   6e-80   Medicago truncatula
ref|XP_002871885.1|  hypothetical protein ARALYDRAFT_488833             256   6e-80   
gb|EPS73808.1|  alcohol dehydrogenase-like protein                      256   7e-80   
gb|KHN12530.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    256   9e-80   
ref|XP_010067836.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          256   1e-79   
ref|NP_001242322.1|  uncharacterized protein LOC100809326               256   1e-79   
ref|XP_007029628.1|  NAD(P)-binding Rossmann-fold superfamily pro...    255   1e-79   
gb|KHN20640.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    255   1e-79   
ref|XP_010493007.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    255   1e-79   
ref|XP_008344624.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          252   2e-79   
ref|XP_002267167.2|  PREDICTED: uncharacterized protein LOC100257...    264   2e-79   Vitis vinifera
gb|KDP43566.1|  hypothetical protein JCGZ_16853                         255   2e-79   
ref|XP_008340596.1|  PREDICTED: tetraketide alpha-pyrone reductas...    256   2e-79   
ref|XP_007219354.1|  hypothetical protein PRUPE_ppa019466mg             255   2e-79   
ref|XP_002517788.1|  cinnamoyl-CoA reductase, putative                  255   2e-79   Ricinus communis
emb|CDP09263.1|  unnamed protein product                                254   3e-79   
ref|XP_009354346.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    254   3e-79   
ref|XP_007029632.1|  NAD(P)-binding Rossmann-fold superfamily pro...    254   3e-79   
gb|AFY97683.1|  cinnamyl alcohol dehydrogenase 1                        254   3e-79   
ref|XP_010651224.1|  PREDICTED: cinnamoyl-CoA reductase 1               254   3e-79   
gb|AHF20167.1|  cinnamyl alcohol dehydrogenase                          251   5e-79   
ref|XP_011025483.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    254   6e-79   
ref|NP_001242544.1|  uncharacterized protein LOC100781477               254   6e-79   
ref|XP_010493006.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    254   7e-79   
gb|AHF20168.1|  cinnamyl alcohol dehydrogenase                          252   9e-79   
ref|XP_006602185.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          253   2e-78   
emb|CAA61275.1|  cinnamyl alcohol dehydrogenase                         253   2e-78   Eucalyptus gunnii
ref|XP_010045028.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          253   2e-78   
ref|XP_009354355.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    252   2e-78   
gb|KHN12533.1|  Dihydroflavonol-4-reductase                             252   2e-78   
emb|CBI16354.3|  unnamed protein product                                254   2e-78   
ref|XP_010534743.1|  PREDICTED: cinnamoyl-CoA reductase 1               252   3e-78   
ref|XP_008349583.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          252   3e-78   
ref|XP_008790948.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    252   3e-78   
ref|XP_009354356.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    252   3e-78   
ref|XP_006446144.1|  hypothetical protein CICLE_v100159012mg            251   3e-78   
ref|XP_010908348.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    252   3e-78   
ref|XP_008354954.1|  PREDICTED: tetraketide alpha-pyrone reductas...    252   3e-78   
ref|XP_008366589.1|  PREDICTED: tetraketide alpha-pyrone reductas...    252   3e-78   
ref|XP_010493011.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    252   3e-78   
ref|XP_010905794.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          252   4e-78   
gb|KCW66074.1|  hypothetical protein EUGRSUZ_G033561                    250   4e-78   
ref|XP_008375210.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          251   4e-78   
ref|XP_008231478.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          251   4e-78   
ref|XP_009395948.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          253   5e-78   
ref|XP_010067835.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          251   5e-78   
ref|XP_010045029.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          251   7e-78   
gb|KCW87173.1|  hypothetical protein EUGRSUZ_B03696                     253   7e-78   
ref|XP_006470635.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          251   7e-78   
ref|XP_004307228.1|  PREDICTED: uncharacterized protein LOC101295856    260   8e-78   
ref|XP_008349627.1|  PREDICTED: tetraketide alpha-pyrone reductas...    251   9e-78   
ref|XP_010067842.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    250   1e-77   
ref|XP_004143234.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          250   1e-77   
ref|XP_008790957.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    249   1e-77   
ref|XP_010067827.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          250   1e-77   
ref|XP_010493008.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          250   1e-77   
gb|KCW87172.1|  hypothetical protein EUGRSUZ_B03695                     252   2e-77   
ref|XP_010045026.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          250   2e-77   
gb|AAQ88099.1|  NADPH-dependent cinnamyl alcohol dehydrogenase          250   2e-77   Quercus suber [cork oak]
ref|XP_006393056.1|  hypothetical protein EUTSA_v10011653mg             250   2e-77   
ref|XP_010493010.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    250   2e-77   
ref|XP_002314050.2|  putative cinnamoyl-CoA reductase family protein    250   2e-77   Populus trichocarpa [western balsam poplar]
ref|XP_010519769.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          250   2e-77   
ref|XP_008449698.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          250   2e-77   
ref|XP_008231473.1|  PREDICTED: tetraketide alpha-pyrone reductas...    259   2e-77   
ref|XP_010042035.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          250   2e-77   
ref|XP_010461970.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          250   2e-77   
ref|XP_007052475.1|  NAD(P)-binding Rossmann-fold superfamily pro...    250   2e-77   
ref|XP_010500717.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          250   2e-77   
ref|XP_007149032.1|  hypothetical protein PHAVU_005G034800g             249   3e-77   
ref|XP_008790954.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    249   3e-77   
ref|XP_006851070.1|  hypothetical protein AMTR_s00025p00240180          249   3e-77   
ref|XP_009354351.1|  PREDICTED: tetraketide alpha-pyrone reductas...    249   3e-77   
ref|XP_006400504.1|  hypothetical protein EUTSA_v10014099mg             249   4e-77   
ref|XP_003567728.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          249   6e-77   
ref|XP_010042036.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          248   7e-77   
ref|XP_008375211.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          248   7e-77   
ref|XP_006482921.1|  PREDICTED: tetraketide alpha-pyrone reductas...    248   9e-77   
ref|XP_009144901.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    248   9e-77   
ref|XP_010479624.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          248   1e-76   
ref|XP_008349605.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          248   1e-76   
ref|XP_003598007.1|  CCP                                                248   1e-76   
gb|AFK46906.1|  unknown                                                 248   1e-76   
ref|XP_010102364.1|  hypothetical protein L484_015313                   248   1e-76   
ref|XP_006482922.1|  PREDICTED: tetraketide alpha-pyrone reductas...    248   2e-76   
ref|XP_009413954.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          249   2e-76   
ref|XP_006306213.1|  hypothetical protein CARUB_v10011885mg             248   2e-76   
ref|XP_007218346.1|  hypothetical protein PRUPE_ppa008671mg             248   2e-76   
ref|XP_011078732.1|  PREDICTED: tetraketide alpha-pyrone reductas...    247   2e-76   
ref|XP_006438961.1|  hypothetical protein CICLE_v10031947mg             248   2e-76   
gb|AAX83110.1|  alcohol dehydrogenase-like protein                      247   2e-76   Ocimum basilicum [basil]
ref|XP_010536092.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          247   3e-76   
ref|XP_008790953.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    247   3e-76   
ref|XP_008790952.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    247   3e-76   
ref|XP_010905790.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    249   3e-76   
ref|XP_009114927.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          247   3e-76   
ref|NP_175552.2|  putative alcohol dehydrogenase                        247   3e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010067828.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          246   4e-76   
ref|XP_002517775.1|  cinnamoyl-CoA reductase, putative                  256   4e-76   Ricinus communis
gb|AAD53967.1|  aldehyde reductase                                      246   5e-76   Vigna radiata [mung bean]
ref|XP_009354347.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    246   5e-76   
ref|XP_009592182.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          246   5e-76   
ref|XP_002517778.1|  cinnamoyl-CoA reductase, putative                  246   5e-76   Ricinus communis
gb|EYU46248.1|  hypothetical protein MIMGU_mgv1a010028mg                246   6e-76   
ref|XP_008354915.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          246   8e-76   
ref|XP_010905793.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          248   8e-76   
gb|KHG04265.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    245   1e-75   
ref|XP_007149031.1|  hypothetical protein PHAVU_005G034700g             245   1e-75   
ref|XP_006287932.1|  hypothetical protein CARUB_v10001167mg             247   1e-75   
ref|XP_009107209.1|  PREDICTED: cinnamoyl-CoA reductase 1               245   1e-75   
emb|CDY43911.1|  BnaA05g15210D                                          245   1e-75   
ref|XP_008375204.1|  PREDICTED: tetraketide alpha-pyrone reductas...    245   1e-75   
ref|XP_008449700.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          245   1e-75   
ref|XP_010230911.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          245   2e-75   
gb|KHG04264.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    245   2e-75   
ref|XP_010067830.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          245   2e-75   
ref|XP_011025482.1|  PREDICTED: tetraketide alpha-pyrone reductas...    245   2e-75   
ref|XP_010454218.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    244   2e-75   
ref|XP_010454220.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    244   2e-75   
ref|NP_001234823.1|  phenylacetaldehyde reductase                       244   3e-75   
ref|XP_009354350.1|  PREDICTED: uncharacterized protein LOC103945503    253   3e-75   
ref|XP_010420748.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    244   3e-75   
ref|XP_007149030.1|  hypothetical protein PHAVU_005G034600g             244   4e-75   
gb|KFK35854.1|  hypothetical protein AALP_AA4G045500                    244   4e-75   
ref|XP_010493009.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          244   4e-75   
ref|XP_009368048.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          244   4e-75   
ref|XP_008356774.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          243   5e-75   
ref|XP_006365621.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          244   5e-75   
ref|XP_007015093.1|  Cinnamyl alcohol dehydrogenase, 82967-79323,...    243   6e-75   
ref|XP_010905791.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    244   6e-75   
ref|XP_010673674.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          243   7e-75   
ref|XP_009354348.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    252   7e-75   
ref|XP_004509912.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    243   7e-75   
ref|XP_009368049.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          243   7e-75   
emb|CDY22576.1|  BnaC05g24140D                                          243   7e-75   
gb|KCW66066.1|  hypothetical protein EUGRSUZ_G03353                     245   7e-75   
ref|XP_010454217.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    243   9e-75   
gb|EMS49381.1|  Dihydroflavonol-4-reductase                             243   2e-74   
ref|XP_004156308.1|  PREDICTED: tetraketide alpha-pyrone reductas...    242   2e-74   
ref|XP_008344623.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          242   2e-74   
ref|XP_010420747.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    242   2e-74   
emb|CAJ43716.1|  cinnamoyl alcohol dehydrogenase                        242   2e-74   Plantago major [cart-track plant]
ref|XP_008363307.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          242   2e-74   
ref|XP_010102365.1|  hypothetical protein L484_015314                   242   3e-74   
ref|XP_003607374.1|  Dihydroflavonol-4-reductase                        242   3e-74   
gb|KHN20639.1|  Dihydroflavonol-4-reductase                             242   3e-74   
gb|KFK26207.1|  hypothetical protein AALP_AA8G216400                    242   3e-74   
gb|AFK47425.1|  unknown                                                 242   3e-74   
ref|XP_008375207.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          241   4e-74   
ref|XP_010905788.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    243   4e-74   
gb|EMT10896.1|  Dihydroflavonol-4-reductase                             241   5e-74   
gb|ABV44811.1|  cinnamyl alcohol dehydrogenase 2                        240   5e-74   Eriobotrya japonica [loquat]
dbj|BAA12161.1|  CPRD14 protein                                         241   5e-74   Vigna unguiculata
gb|KCW66071.1|  hypothetical protein EUGRSUZ_G03355                     245   5e-74   
ref|XP_004308687.1|  PREDICTED: uncharacterized protein LOC101310561    249   6e-74   
ref|NP_001242261.1|  uncharacterized protein LOC100804704               241   6e-74   
ref|XP_002517776.1|  cinnamoyl-CoA reductase, putative                  241   6e-74   Ricinus communis
ref|NP_001241540.1|  uncharacterized protein LOC100799213               241   6e-74   
ref|XP_010673676.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    241   9e-74   
ref|XP_007032857.1|  NAD(P)-binding Rossmann-fold superfamily pro...    241   1e-73   
ref|XP_010673664.1|  PREDICTED: tetraketide alpha-pyrone reductas...    240   1e-73   
ref|XP_011091759.1|  PREDICTED: tetraketide alpha-pyrone reductas...    240   1e-73   
ref|XP_010905792.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          242   1e-73   
ref|XP_010673675.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    240   1e-73   
gb|AAX15956.1|  cinnamyl alcohol dehydrogenase 1                        240   2e-73   Nicotiana tabacum [American tobacco]
ref|XP_010905795.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          239   2e-73   
gb|KFK26208.1|  hypothetical protein AALP_AA8G216500                    239   2e-73   
ref|XP_008375206.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          239   2e-73   
ref|XP_010065291.1|  PREDICTED: tetraketide alpha-pyrone reductas...    239   2e-73   
ref|XP_008349652.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          239   3e-73   
ref|XP_007163919.1|  hypothetical protein PHAVU_L005800g                239   3e-73   
ref|XP_009368136.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          241   4e-73   
gb|EMT16440.1|  Dihydroflavonol-4-reductase                             238   4e-73   
ref|XP_006438962.1|  hypothetical protein CICLE_v10031994mg             239   4e-73   
ref|XP_006482918.1|  PREDICTED: tetraketide alpha-pyrone reductas...    239   4e-73   
ref|XP_008349610.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          238   5e-73   
gb|KDP43565.1|  hypothetical protein JCGZ_16852                         238   7e-73   
ref|XP_007149033.1|  hypothetical protein PHAVU_005G034900g             238   8e-73   
ref|XP_002453729.1|  hypothetical protein SORBIDRAFT_04g011550          238   9e-73   
ref|XP_004505624.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          238   1e-72   
gb|KEH19919.1|  cinnamyl alcohol dehydrogenase                          235   1e-72   
ref|XP_009354354.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          238   1e-72   
ref|NP_001150399.1|  LOC100284029                                       238   1e-72   
ref|XP_003628601.1|  Dihydroflavonol-4-reductase                        238   1e-72   
gb|KEH19926.1|  cinnamyl alcohol dehydrogenase                          238   1e-72   
ref|XP_010323594.1|  PREDICTED: alcohol dehydrogenase-like isofor...    236   1e-72   
gb|ACF88378.1|  unknown                                                 238   2e-72   
ref|XP_011090033.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          237   2e-72   
gb|AFK38743.1|  unknown                                                 237   2e-72   
emb|CAN78794.1|  hypothetical protein VITISV_003424                     243   2e-72   
emb|CDP18890.1|  unnamed protein product                                237   2e-72   
ref|XP_006645958.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          236   4e-72   
ref|XP_002891638.1|  hypothetical protein ARALYDRAFT_314503             248   4e-72   
emb|CAN63402.1|  hypothetical protein VITISV_030427                     252   4e-72   
gb|AAG52618.1|AC024261_5  cinnamyl alcohol dehydrogenase, putativ...    248   4e-72   
emb|CDP17812.1|  unnamed protein product                                236   7e-72   
ref|XP_004956189.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          236   7e-72   
gb|ADD23217.1|  cinnamyl alcohol dehydrogenase                          236   7e-72   
gb|EAY74373.1|  hypothetical protein OsI_02260                          235   1e-71   
ref|XP_010067841.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    233   1e-71   
ref|NP_001043234.1|  Os01g0528800                                       235   1e-71   
ref|XP_004987233.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          235   2e-71   
ref|XP_007131545.1|  hypothetical protein PHAVU_011G022200g             234   2e-71   
gb|KEH19920.1|  cinnamyl alcohol dehydrogenase                          234   2e-71   
gb|KHG28629.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    235   2e-71   
ref|XP_007163918.1|  hypothetical protein PHAVU_L005700g                234   2e-71   
ref|XP_011078734.1|  PREDICTED: tetraketide alpha-pyrone reductas...    234   2e-71   
ref|XP_003628576.1|  Dihydroflavonol-4-reductase                        234   3e-71   
ref|XP_003607372.1|  Dihydroflavonol-4-reductase                        234   4e-71   
gb|KCW49548.1|  hypothetical protein EUGRSUZ_K03067                     233   6e-71   
dbj|BAJ90096.1|  predicted protein                                      233   9e-71   
ref|NP_001234830.1|  phenylacetaldehyde reductase                       232   1e-70   
ref|XP_010039187.1|  PREDICTED: tetraketide alpha-pyrone reductas...    233   2e-70   
ref|XP_007052474.1|  NAD(P)-binding Rossmann-fold superfamily pro...    234   4e-70   
gb|KDP43567.1|  hypothetical protein JCGZ_16854                         238   4e-70   
gb|AAC33208.1|  Highly similar to cinnamyl alcohol dehydrogenase,...    230   7e-70   
ref|XP_010673662.1|  PREDICTED: tetraketide alpha-pyrone reductas...    230   9e-70   
gb|KDO83328.1|  hypothetical protein CISIN_1g020747mg                   230   9e-70   
ref|XP_006438965.1|  hypothetical protein CICLE_v10032128mg             230   1e-69   
ref|NP_172419.1|  alcohol dehydrogenase-like protein                    231   2e-69   
ref|XP_006417567.1|  hypothetical protein EUTSA_v10008208mg             229   3e-69   
emb|CAJ43717.1|  cinnamoyl alcohol dehydrogenase                        224   4e-69   
gb|KFK43252.1|  hypothetical protein AALP_AA1G099600                    228   6e-69   
ref|XP_010673673.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          228   8e-69   
ref|XP_008363309.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          228   8e-69   
ref|XP_009618541.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          227   1e-68   
ref|XP_006305369.1|  hypothetical protein CARUB_v10009753mg             227   2e-68   
gb|KDO83333.1|  hypothetical protein CISIN_1g020747mg                   222   4e-68   
gb|AAX15955.1|  cinnamyl alcohol dehydrogenase 1                        226   4e-68   
ref|XP_008790949.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    225   4e-68   
ref|XP_011080359.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          226   5e-68   
dbj|BAJ98589.1|  predicted protein                                      226   5e-68   
gb|EMS47957.1|  Dihydroflavonol-4-reductase                             226   6e-68   
emb|CAN62117.1|  hypothetical protein VITISV_011013                     225   6e-68   
ref|XP_007131544.1|  hypothetical protein PHAVU_011G022100g             225   7e-68   
gb|EMT24500.1|  Dihydroflavonol-4-reductase                             229   7e-68   
ref|XP_006365623.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          225   9e-68   
emb|CDP18888.1|  unnamed protein product                                224   1e-67   
ref|XP_009795334.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          224   1e-67   
ref|XP_010316141.1|  PREDICTED: phenylacetaldehyde reductase isof...    233   2e-67   
ref|XP_006365632.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          224   2e-67   
gb|ABK21028.1|  unknown                                                 223   6e-67   
ref|XP_006391084.1|  hypothetical protein EUTSA_v10019826mg             223   7e-67   
gb|ACZ74589.1|  cinnamoyl CoA reductase-like 2a                         223   7e-67   
gb|KGN48125.1|  Cinnamoyl-CoA reductase                                 230   7e-67   
ref|XP_002889753.1|  cinnamyl-alcohol dehydrogenase family              223   7e-67   
gb|ABK21248.1|  unknown                                                 222   1e-66   
ref|XP_006851071.1|  hypothetical protein AMTR_s00025p00240500          223   1e-66   
emb|CDP18892.1|  unnamed protein product                                222   1e-66   
emb|CDP19307.1|  unnamed protein product                                222   2e-66   
ref|XP_006482920.1|  PREDICTED: tetraketide alpha-pyrone reductas...    230   2e-66   
gb|KCW66064.1|  hypothetical protein EUGRSUZ_G03352                     221   2e-66   
ref|XP_008231498.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          218   3e-66   
gb|EMS66665.1|  Dihydroflavonol-4-reductase                             225   3e-66   
gb|KCW66063.1|  hypothetical protein EUGRSUZ_G03351                     218   8e-66   
emb|CDX94967.1|  BnaC05g07040D                                          220   9e-66   
gb|EYU42999.1|  hypothetical protein MIMGU_mgv1a009774mg                220   1e-65   
ref|XP_008790956.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    219   1e-65   
ref|XP_009413950.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    219   1e-65   
ref|XP_009413953.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    219   2e-65   
gb|ABK22554.1|  unknown                                                 219   2e-65   
ref|XP_007131547.1|  hypothetical protein PHAVU_011G022400g             219   2e-65   
emb|CBI32204.3|  unnamed protein product                                218   2e-65   
ref|XP_006379090.1|  hypothetical protein POPTR_0009s06260g             214   2e-65   
gb|KCW66052.1|  hypothetical protein EUGRSUZ_G03342                     217   3e-65   
ref|XP_006365624.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          218   4e-65   
ref|XP_010673669.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    218   4e-65   
emb|CDP18894.1|  unnamed protein product                                218   6e-65   
ref|XP_009148244.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          217   9e-65   
gb|KDP20157.1|  hypothetical protein JCGZ_00030                         213   1e-64   
ref|XP_010661299.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          216   1e-64   
ref|XP_010673667.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          217   1e-64   
emb|CDP19301.1|  unnamed protein product                                217   1e-64   
ref|XP_009148245.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          217   1e-64   
gb|ACZ74591.1|  cinnamoyl CoA reductase-like 2c                         217   1e-64   
ref|XP_010067838.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    215   1e-64   
gb|ACP20258.1|  cinnamyl-alcohol dehydrogenase                          216   2e-64   
ref|XP_010557804.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          216   2e-64   
emb|CBI40610.3|  unnamed protein product                                216   2e-64   
ref|XP_006304701.1|  hypothetical protein CARUB_v10011960mg             216   2e-64   
ref|XP_011091760.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          216   2e-64   
emb|CDX94966.1|  BnaC05g07050D                                          216   2e-64   
ref|XP_006417568.1|  hypothetical protein EUTSA_v10008138mg             216   3e-64   
ref|XP_010673672.1|  PREDICTED: dihydroflavonol-4-reductase-like        216   3e-64   
ref|XP_010490060.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          215   6e-64   
emb|CDY64748.1|  BnaA06g37880D                                          216   7e-64   
emb|CDP18893.1|  unnamed protein product                                215   7e-64   
ref|XP_010475785.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          215   8e-64   
ref|XP_010673671.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          215   1e-63   
ref|XP_010475788.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          214   1e-63   
ref|XP_010458233.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          214   1e-63   
ref|XP_006379089.1|  hypothetical protein POPTR_0009s06260g             212   2e-63   
emb|CDP18895.1|  unnamed protein product                                214   2e-63   
ref|XP_007015094.1|  Cinnamyl alcohol dehydrogenase, 82967-79323,...    212   3e-63   
gb|ACZ74590.1|  cinnamoyl CoA reductase-like 2b                         213   4e-63   
emb|CDP19302.1|  unnamed protein product                                213   5e-63   
ref|XP_009120887.1|  PREDICTED: cinnamoyl-CoA reductase 1 isoform X2    211   6e-63   
ref|NP_001117255.1|  alcohol dehydrogenase                              211   8e-63   
ref|XP_011078733.1|  PREDICTED: tetraketide alpha-pyrone reductas...    214   9e-63   
emb|CDP17817.1|  unnamed protein product                                212   1e-62   
emb|CDP19303.1|  unnamed protein product                                211   1e-62   
ref|XP_002889755.1|  cinnamyl-alcohol dehydrogenase family              211   2e-62   
gb|KCW87178.1|  hypothetical protein EUGRSUZ_B03705                     211   2e-62   
ref|XP_002889754.1|  cinnamyl-alcohol dehydrogenase family              211   3e-62   
ref|NP_172420.1|  alcohol dehydrogenase                                 211   3e-62   
gb|ACP20256.1|  cinnamyl-alcohol dehydrogenase                          209   4e-62   
ref|XP_003598003.1|  Dihydroflavonol-4-reductase                        209   5e-62   
ref|NP_849625.1|  alcohol dehydrogenase-like protein                    209   6e-62   
ref|NP_172422.2|  alcohol dehydrogenase-like protein                    210   6e-62   
gb|AAC33211.1|  Highly similar to cinnamyl alcohol dehydrogenase,...    210   6e-62   
gb|ACP20257.1|  cinnamyl-alcohol dehydrogenase                          209   1e-61   
ref|XP_009118318.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          209   2e-61   
gb|AAL25555.1|  At1g09500/F14J9_16                                      207   2e-61   
ref|NP_172421.1|  alcohol dehydrogenase-like protein                    209   2e-61   
ref|XP_009127680.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    208   4e-61   
ref|XP_010557803.1|  PREDICTED: tetraketide alpha-pyrone reductas...    207   5e-61   
ref|XP_008790951.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    205   1e-60   
emb|CDY72415.1|  BnaCnng77500D                                          207   1e-60   
gb|KDO61223.1|  hypothetical protein CISIN_1g0202661mg                  204   1e-60   
ref|XP_009354352.1|  PREDICTED: tetraketide alpha-pyrone reductas...    205   2e-60   
gb|KCW66056.1|  hypothetical protein EUGRSUZ_G03345                     204   3e-60   
ref|XP_010490093.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          205   4e-60   
ref|XP_004171433.1|  PREDICTED: tetraketide alpha-pyrone reductas...    204   4e-60   
emb|CDX94965.1|  BnaC05g07060D                                          204   9e-60   
emb|CBI29099.3|  unnamed protein product                                202   9e-60   
ref|XP_009148246.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    204   2e-59   
emb|CDY64747.1|  BnaA06g37870D                                          202   8e-59   
ref|XP_006305357.1|  hypothetical protein CARUB_v10009736mg             201   1e-58   
emb|CDX94968.1|  BnaC05g07030D                                          201   2e-58   
ref|XP_010490072.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    201   2e-58   
ref|XP_010458237.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          200   3e-58   
gb|KDO83327.1|  hypothetical protein CISIN_1g045920mg                   195   5e-58   
ref|XP_010658934.1|  PREDICTED: cinnamoyl-CoA reductase 1 isoform X2    197   6e-58   
emb|CAN76108.1|  hypothetical protein VITISV_033807                     207   7e-58   
gb|AAG60085.1|AC013288_19  cinnamyl alcohol dehydrogenase, putative     198   1e-57   
gb|AGS57528.1|  cinnamyl alcohol dehydrogenase 1                        198   2e-57   
gb|KCW66067.1|  hypothetical protein EUGRSUZ_G03353                     198   2e-57   
ref|NP_176852.2|  alcohol dehydrogenase-like protein                    198   2e-57   
ref|XP_010458235.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    198   3e-57   
emb|CAN73813.1|  hypothetical protein VITISV_028795                     196   5e-57   
emb|CDP14617.1|  unnamed protein product                                196   6e-57   
ref|XP_010475786.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          197   6e-57   
ref|XP_008790950.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    192   1e-55   
gb|EYU46247.1|  hypothetical protein MIMGU_mgv1a010028mg                192   1e-55   
emb|CAJ38377.1|  cinnamyl-alcohol dehydrogenase                         189   2e-55   
gb|KFK43249.1|  hypothetical protein AALP_AA1G099200                    193   3e-55   
gb|KFK43250.1|  hypothetical protein AALP_AA1G099400                    190   1e-54   
ref|XP_011091898.1|  PREDICTED: tetraketide alpha-pyrone reductas...    189   1e-54   
ref|XP_010067840.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    188   4e-54   
ref|XP_002980750.1|  hypothetical protein SELMODRAFT_154000             189   9e-54   
ref|XP_002977011.1|  hypothetical protein SELMODRAFT_175949             189   9e-54   
ref|XP_010458234.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    188   1e-53   
gb|KEH19921.1|  cinnamyl alcohol dehydrogenase                          183   2e-53   
ref|XP_010415215.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          187   2e-53   
ref|XP_008790959.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    185   4e-53   
gb|KEH30630.1|  cinnamoyl-CoA reductase-like protein                    186   4e-53   
ref|XP_006851073.1|  hypothetical protein AMTR_s00025p00241040          182   6e-53   
ref|XP_007136731.1|  hypothetical protein PHAVU_009G069500g             181   6e-53   
ref|XP_010470552.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    186   9e-53   
gb|EPS63475.1|  hypothetical protein M569_11309                         184   1e-52   
ref|XP_009802199.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          180   2e-52   
ref|XP_010511583.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          184   3e-52   
ref|XP_010470551.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    184   4e-52   
gb|KEH19918.1|  cinnamyl alcohol dehydrogenase                          183   4e-52   
gb|KEH19922.1|  cinnamyl alcohol dehydrogenase                          183   4e-52   
gb|KEH19927.1|  cinnamyl alcohol dehydrogenase                          184   5e-52   
ref|XP_011090469.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          178   1e-51   
emb|CAN71364.1|  hypothetical protein VITISV_003513                     181   6e-51   
ref|XP_010490082.1|  PREDICTED: tetraketide alpha-pyrone reductas...    179   9e-51   
ref|NP_001031012.1|  alcohol dehydrogenase-like protein                 179   2e-50   
ref|XP_007136730.1|  hypothetical protein PHAVU_009G069400g             178   2e-50   
gb|KCW87170.1|  hypothetical protein EUGRSUZ_B03694                     179   3e-50   
ref|XP_002988921.1|  cinnamoyl-CoA reductase                            179   4e-50   
ref|XP_009148247.1|  PREDICTED: tetraketide alpha-pyrone reductas...    177   6e-50   
ref|XP_006302493.1|  hypothetical protein CARUB_v10020587mg             179   6e-50   
ref|XP_008790958.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    176   2e-49   
ref|XP_002974909.1|  cinnamoyl-CoA reductase                            177   3e-49   
gb|KHG20050.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    172   3e-49   
ref|XP_001765354.1|  predicted protein                                  176   4e-49   
ref|XP_008354952.1|  PREDICTED: tetraketide alpha-pyrone reductas...    180   8e-49   
ref|XP_003592755.1|  Dihydroflavonol-4-reductase                        170   2e-48   
gb|KEH15660.1|  cinnamyl alcohol dehydrogenase                          169   3e-48   
gb|AFX98068.1|  cinnamoyl-CoA reductase                                 174   3e-48   
ref|XP_006438963.1|  hypothetical protein CICLE_v10032128mg             171   9e-48   
gb|KDO83329.1|  hypothetical protein CISIN_1g020747mg                   171   1e-47   
gb|AEN94093.1|  cinnamyl alcohol dehydrogenase                          166   5e-47   
gb|AFD29890.1|  cinnamoyl-CoA reductase                                 170   5e-47   
gb|AEO13438.1|  cinnamoyl-CoA reductase                                 170   1e-46   
ref|XP_010673663.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    168   1e-46   
gb|ACK76693.1|  cinnamyl alcohol dehydrogenase                          165   8e-46   
gb|ACK76694.1|  cinnamyl alcohol dehydrogenase                          165   8e-46   
ref|XP_003574536.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          169   1e-45   



>ref|XP_006345416.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Solanum tuberosum]
Length=328

 Score =   292 bits (748),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 172/221 (78%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC ++PSV+RVV+TSSTASV+   N  +   V DE W+SD EF EE K
Sbjct  104  DPAVKGTLNVLRSCAKSPSVRRVVITSSTASVICNKNMSTPGAVADETWYSDPEFCEERK  163

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            +WY LSK  AE+AAWK+A EN ID+V+LHP LVIGPLLQP LNFS E I++ I+EG+E  
Sbjct  164  EWYQLSKTLAEQAAWKFAKENAIDLVTLHPGLVIGPLLQPTLNFSCEAIVNVIQEGKEAW  223

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            S     +VDVRDVANAHI AFEVPSA+GRYCLVG    +S VLKI+ +LYPS+ +PE +K
Sbjct  224  SGGIYRFVDVRDVANAHILAFEVPSANGRYCLVGANGYSSLVLKIIQKLYPSITLPENFK  283

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
              LP+ P F+VS +KAKSLGI FT LE+S+KDT+ESL EKN
Sbjct  284  DGLPLTPHFQVSSEKAKSLGIKFTCLELSVKDTVESLMEKN  324



>ref|NP_001234838.1| alcohol dehydrogenase-like [Solanum lycopersicum]
 gb|ABR15770.1| putative alcohol dehydrogenase [Solanum lycopersicum]
Length=328

 Score =   290 bits (742),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 171/221 (77%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC ++PSV+RVV+TSSTASV+   N  +   V DE W+SD EF EE K
Sbjct  104  DPAVKGTLNVLRSCAKSPSVRRVVITSSTASVICNKNMSTPGAVADETWYSDPEFCEERK  163

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            +WY LSK  AE+AAWK+A EN +D+V+LHP LVIGPLLQP LNFS E I+D IKEG+E  
Sbjct  164  EWYQLSKTLAEQAAWKFAKENGVDLVTLHPGLVIGPLLQPTLNFSCEAIVDVIKEGKEAW  223

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            S     +VDVRDVANAHI AFEV SA+GRYCLVG    +S VLKIV +LYPS+ +P+ +K
Sbjct  224  SGGIYRFVDVRDVANAHILAFEVLSANGRYCLVGANGYSSLVLKIVQKLYPSITLPKNFK  283

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
              LP+ P F+VS +KAK LG+ FT LE+S+KDTIESLKEKN
Sbjct  284  DGLPLTPHFQVSSEKAKRLGVKFTCLELSVKDTIESLKEKN  324



>ref|XP_009611351.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Nicotiana tomentosiformis]
Length=330

 Score =   289 bits (739),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 172/221 (78%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAV GTLNVL SC ++ SV+RVV+TSSTASV+   N  +   V DE W+SD E  EE K
Sbjct  106  DPAVSGTLNVLRSCTKSTSVRRVVITSSTASVICNKNMSTPGAVADETWYSDAELCEERK  165

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            +WY LSK  AEEAAWK+A EN +D+V+LHP LVIGPLLQP LNFS E I++ IKEG+E  
Sbjct  166  EWYQLSKTLAEEAAWKFAKENGLDLVTLHPGLVIGPLLQPTLNFSCEAIVNFIKEGKEAW  225

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            S     +VDVRDVANAHI AFEVPSA+GRYCLVG    +S VLKIV +LYPS+ +PE ++
Sbjct  226  SGGIYRFVDVRDVANAHILAFEVPSANGRYCLVGVNGYSSLVLKIVQKLYPSITLPENFE  285

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
              LP++PTF+VS ++AKSLG+NFT LE+S+KDT+ESL EKN
Sbjct  286  DGLPLIPTFQVSSERAKSLGVNFTSLELSVKDTVESLIEKN  326



>ref|XP_010659458.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Vitis vinifera]
Length=325

 Score =   276 bits (706),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 173/221 (78%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGT+NVL SC + PSVKRVVVTSS A+V++   P+++  +IDE+WFSD    +E+K
Sbjct  102  DPALKGTINVLRSCAKFPSVKRVVVTSSMAAVVFTGKPLTSEVLIDESWFSDPVLCKESK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAWK++ EN IDMV+++PA VIGPL+QP LN S+E++L+ I   + F 
Sbjct  162  LWYVLSKTLAEEAAWKFSKENGIDMVTINPAWVIGPLIQPTLNLSAEVVLNLINGAQTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  +   VDVRDVANAHI+A+E+P ASGRYCLV + +  SE +KI+ +LYP LP+PEK  
Sbjct  222  NRSYR-LVDVRDVANAHIQAYEIPEASGRYCLVEKDLHYSETVKILRKLYPELPLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P  P+ +VSQ+K KSLGI+FTPLEVSLKDT+ESLKEKN
Sbjct  281  DDKPYAPSSRVSQEKVKSLGIHFTPLEVSLKDTVESLKEKN  321



>emb|CBI24952.3| unnamed protein product [Vitis vinifera]
Length=326

 Score =   274 bits (700),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 172/221 (78%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGT+NVL SC + PSVKRVVVTSS A+V++   P+++  +IDE+WFSD    +E+K
Sbjct  102  DPALKGTINVLRSCAKFPSVKRVVVTSSMAAVVFTGKPLTSEVLIDESWFSDPVLCKESK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAWK++ EN IDMV+++PA VIGPL+QP LN S+E++L+ I +  + +
Sbjct  162  LWYVLSKTLAEEAAWKFSKENGIDMVTINPAWVIGPLIQPTLNLSAEVVLNLINDTLQQL  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
                   VDVRDVANAHI+A+E+P ASGRYCLV + +  SE +KI+ +LYP LP+PEK  
Sbjct  222  MKISYRLVDVRDVANAHIQAYEIPEASGRYCLVEKDLHYSETVKILRKLYPELPLPEKCA  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P  P+ +VSQ+K KSLGI+FTPLEVSLKDT+ESLKEKN
Sbjct  282  DDKPYAPSSRVSQEKVKSLGIHFTPLEVSLKDTVESLKEKN  322



>ref|XP_008231472.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like isoform 
X1 [Prunus mume]
Length=324

 Score =   273 bits (697),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 173/221 (78%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SCV+  +VKRVV+TSSTA+V++   P++   V+DE WFSD  F E  K
Sbjct  101  DPAVKGTLNVLKSCVKFATVKRVVLTSSTAAVIFNGRPLTPDVVVDETWFSDPFFCENFK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY+LSK  AEEAAWK+A  N ID+V+++P+ VIGPLLQP LN + EMIL+   +  +  
Sbjct  161  QWYVLSKTLAEEAAWKFAEGNGIDLVTINPSYVIGPLLQPSLNLTVEMILNLKNDIEDVN  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            SS ++C  DVRDVA+AH++AFEVPSA+GRYCLVG  +  ++VLKI+ +L+PSL  PEKY+
Sbjct  221  SSIYSCS-DVRDVASAHVQAFEVPSANGRYCLVGHVIPMAKVLKILHELHPSLCPPEKYE  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
               P  PT++VSQ+KAKSLG+NF PLEVSL+DT+ESLKEK 
Sbjct  280  EANPSEPTYQVSQEKAKSLGVNFLPLEVSLRDTVESLKEKG  320



>ref|NP_001280189.1| cinnamoyl-CoA reductase 1 [Prunus mume]
 dbj|BAE48658.1| Cinnamyl alcohol dehydrogenase [Prunus mume]
Length=325

 Score =   272 bits (695),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 170/221 (77%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC ++ S++RVV+TSS A+V Y   P +   V+DE WF+D +F +E+K
Sbjct  102  DPAVKGTLNVLNSCAKSQSIRRVVLTSSIAAVAYNGKPRTPDVVVDETWFTDADFCKESK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+  E  IDMV+++PA+VIGPLLQP LN S+  +L+ IK  R F 
Sbjct  162  LWYVLSKTLAEDAAWKFVKEKGIDMVTINPAMVIGPLLQPTLNTSAAAVLNVIKGARTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +++V+DVANAHI+AFE+PSASGRYCLV      SEV++I+ +LYP L +PEK  
Sbjct  222  NASFG-WINVKDVANAHIQAFEIPSASGRYCLVERVAHFSEVVRILQELYPGLQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PT++VS++KAK LG+ F PLEVSLK+T+ESLKEKN
Sbjct  281  DDKPFVPTYQVSKEKAKKLGVEFIPLEVSLKETVESLKEKN  321



>emb|CBI29129.3| unnamed protein product [Vitis vinifera]
Length=345

 Score =   273 bits (697),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 134/223 (60%), Positives = 170/223 (76%), Gaps = 5/223 (2%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGT+NVLGSC + PSVKRVVVT S ASV++   P++   +IDE+WFSD    +E+K
Sbjct  122  DPALKGTINVLGSCSKVPSVKRVVVTLSLASVLFTGEPLTPEVLIDESWFSDPVLCKESK  181

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREF-  358
            QWY+LSK  AEEAAW ++ EN IDMV ++P  VIGPLLQP LN S+E +L+ I   + F 
Sbjct  182  QWYVLSKTLAEEAAWNFSKENGIDMVMINPGWVIGPLLQPTLNLSAEQVLNLINRAQTFP  241

Query  359  -MSSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEK  535
             +SS    +VDVRDVANAHI+A+E+P ASGRYCLV   +  SE+LKI+ +LYP LP+PEK
Sbjct  242  NISS---WWVDVRDVANAHIQAYEIPEASGRYCLVERDLHNSEILKILRKLYPGLPLPEK  298

Query  536  YKGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
               + P   + +VSQ+KAKSL I+FTPLEVSLKDT+ESLKEKN
Sbjct  299  CADEKPYAASSRVSQEKAKSLVIHFTPLEVSLKDTVESLKEKN  341



>ref|XP_007211587.1| hypothetical protein PRUPE_ppa008618mg [Prunus persica]
 gb|EMJ12786.1| hypothetical protein PRUPE_ppa008618mg [Prunus persica]
Length=325

 Score =   271 bits (694),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 169/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC ++ S++RVV+TSS A+V Y   P +   V+DE WF+D +F +E+K
Sbjct  102  DPAVKGTLNVLNSCAKSQSIRRVVLTSSIAAVAYNGKPRTPDVVVDETWFTDADFCKESK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+  E  IDMV+++PA+VIGPLLQP LN S+  +L+ IK  R F 
Sbjct  162  LWYVLSKTLAEDAAWKFVKEKGIDMVTINPAMVIGPLLQPTLNTSAAAVLNVIKGARTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +++V+DVANAHI AFE+PSASGRYCLV      SEV++I+ +LYP L +PEK  
Sbjct  222  NASFG-WINVKDVANAHIRAFEIPSASGRYCLVERVAHFSEVVRILQELYPGLQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PT++VS++KAK LG+ F PLEVSLK+T+ESLKEKN
Sbjct  281  DDKPFVPTYQVSKEKAKKLGVEFIPLEVSLKETVESLKEKN  321



>emb|CBI29100.3| unnamed protein product [Vitis vinifera]
Length=323

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 168/221 (76%), Gaps = 2/221 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGT+NVLGSC + PSVKRVVVTSS ASV +    ++   ++DE+WFSD  F E++K
Sbjct  101  DPALKGTMNVLGSCAKVPSVKRVVVTSSMASVAFNGKHLAPDVLVDESWFSDPVFCEKSK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAWK+A EN IDMV+++P  VIGPLLQP LN S E +L  +K G  F 
Sbjct  161  LWYMLSKTLAEEAAWKFAKENGIDMVTINPGWVIGPLLQPTLNLSVEEVLKLLK-GDTFP  219

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +     +VDVRDVA AHI+A+E+P+A GRYCLVG  +  SE +KI+ +LYP+L +PEK  
Sbjct  220  NKTHR-WVDVRDVAMAHIQAYELPTARGRYCLVGSILHCSETMKILRKLYPALNLPEKCA  278

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P  PT+ VSQ+K KSLGI+FTPLEVS+KDT+ESL+EKN
Sbjct  279  DDKPYEPTYMVSQEKTKSLGIDFTPLEVSMKDTVESLREKN  319



>ref|XP_003633516.1| PREDICTED: cinnamoyl-CoA reductase 1 isoform X1 [Vitis vinifera]
 emb|CBI29103.3| unnamed protein product [Vitis vinifera]
Length=323

 Score =   270 bits (690),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 168/221 (76%), Gaps = 2/221 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGT++VLGSC + PSVKRVVVTSS ASV +   P++   ++DE+WFSD  F E++K
Sbjct  101  DPALKGTMSVLGSCAKVPSVKRVVVTSSMASVAFNGKPLAPDVLVDESWFSDPVFCEKSK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAWK+A EN IDMV+++P  VIGPLLQP LN S E +L  +K G  F 
Sbjct  161  LWYMLSKTLAEEAAWKFAKENGIDMVTINPGWVIGPLLQPTLNLSVEEVLKLLK-GDTFP  219

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +     +VDVRDVA AHI+A+E+P+A GRYCLVG  +  SE +KI+ +LYP+L +PEK  
Sbjct  220  NKTHR-WVDVRDVAMAHIQAYELPTARGRYCLVGSILHCSETMKILRKLYPALNLPEKCA  278

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P  P + VSQ+K KSLGI+FTPLEVSLKDT+ESL+EKN
Sbjct  279  DDKPYEPAYMVSQEKTKSLGIDFTPLEVSLKDTVESLREKN  319



>dbj|BAG13450.2| phenylacetaldehyde reductase [Rosa x damascena]
 dbj|BAQ20439.1| 2-phenylethanol [Rosa hybrid cultivar]
Length=322

 Score =   270 bits (689),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 171/221 (77%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC ++PS+KRVV+TSS A+V Y   P +   V+DE WF+D +  +E+K
Sbjct  99   DPAVKGTLNVLNSCSKSPSIKRVVLTSSIAAVAYNGKPRTPDVVVDETWFTDPDVCKESK  158

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+  E  IDMV+++PA+VIGPLLQP LN S+  IL+ IK  R + 
Sbjct  159  LWYVLSKTLAEDAAWKFVKEKGIDMVTINPAMVIGPLLQPTLNTSAAAILNIIKGARTYP  218

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +++V+DVANAH++AFE+PSASGRYCLV      +EVL+I+ +LYP L +PEK  
Sbjct  219  NASFG-WINVKDVANAHVQAFEIPSASGRYCLVERVAHFTEVLQIIHELYPDLQLPEKCS  277

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PT++VS++KAKSLGI F PL++SLK+TIESLKEK+
Sbjct  278  DDKPFVPTYQVSKEKAKSLGIEFIPLDISLKETIESLKEKS  318



>ref|XP_004491683.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Cicer arietinum]
Length=325

 Score =   270 bits (689),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 171/220 (78%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SCV++PS+KRVV+TSS A+V Y   P +   V+DE WF+D +F  ++ 
Sbjct  102  DPAVKGTLNVLKSCVKSPSLKRVVLTSSIAAVAYNGKPRTPDVVVDETWFTDPDFCAQSN  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY++SK  AE+AAWK+  EN IDMV+++PA+VIGPLLQP+LN S+  IL+ +   + F 
Sbjct  162  LWYVVSKTLAEDAAWKFVRENNIDMVTINPAMVIGPLLQPVLNTSAAAILNLVNGAQTFA  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI+A+E  SASGRYCLV   +  SE++KI+ Q YPSL +PEK  
Sbjct  222  NASFG-WVNVKDVANAHIQAYENASASGRYCLVERVVHHSEIVKILRQHYPSLQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P +PT++VS++KAKSLGI FTPLEVSLK+T+ESLKEK
Sbjct  281  DDKPYVPTYQVSKEKAKSLGIEFTPLEVSLKETVESLKEK  320



>ref|XP_002314052.1| putative cinnamoyl-CoA reductase family protein [Populus trichocarpa]
 gb|ABK95157.1| unknown [Populus trichocarpa]
 gb|EEE88007.1| putative cinnamoyl-CoA reductase family protein [Populus trichocarpa]
Length=324

 Score =   270 bits (689),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 169/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGT+NVL SC + PS+KRVV+TSS A+V++    ++   V+DE WFSD +F E++K
Sbjct  101  DPALKGTVNVLRSCTKIPSIKRVVITSSMAAVVFNGKSLAPDVVVDETWFSDSDFCEKSK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AEEAAWK+  EN IDMV+L+P LVIGPLLQP LN S+E +LD I   + + 
Sbjct  161  LWYHLSKTLAEEAAWKFTKENGIDMVTLNPGLVIGPLLQPTLNQSAESVLDLINGAKSYP  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ +  +VDVRDVANAHI A E PSA+GRYCLVG  + +SE +KI+S+LYP L IP++  
Sbjct  221  NTTYR-WVDVRDVANAHIYALENPSANGRYCLVGTVIHSSEAVKILSKLYPDLTIPKQCA  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P MP ++VS+++A SLG+ +TPLE SLKDTIESLKEKN
Sbjct  280  DDKPPMPKYQVSKERAASLGVKYTPLEASLKDTIESLKEKN  320



>ref|XP_002285368.1| PREDICTED: cinnamoyl-CoA reductase 1 [Vitis vinifera]
 emb|CBI16353.3| unnamed protein product [Vitis vinifera]
Length=322

 Score =   269 bits (688),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 169/220 (77%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVLGSC +  SVKRVVVTSS A+V Y  NP +   V+DE WF+D +F +  +
Sbjct  99   DPAVKGTLNVLGSCAKASSVKRVVVTSSIAAVAYNRNPRTPDVVVDETWFTDPDFCKGLQ  158

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY++SK  AE+AAWK+A E  IDMV+++PA+VIGPLLQP LN S+  IL+ I  G+ F 
Sbjct  159  LWYVVSKTLAEDAAWKFAKEKGIDMVTINPAMVIGPLLQPTLNTSAAAILNLINGGQTFP  218

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVA AHI+AFEVPSASGRYCLV   +  SE++KI+ +L+P   +PEK  
Sbjct  219  NASFG-WVNVKDVAEAHIQAFEVPSASGRYCLVERVVHYSELVKILKELFPDFQLPEKCA  277

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P +PTF+VS++KAKSLGI F PLEVSLK+T+ESLKEK
Sbjct  278  DDKPFVPTFQVSKEKAKSLGIEFIPLEVSLKETVESLKEK  317



>ref|XP_010067832.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Eucalyptus grandis]
 gb|KCW66062.1| hypothetical protein EUGRSUZ_G03351 [Eucalyptus grandis]
Length=327

 Score =   269 bits (688),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 169/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC +  S+KRVVVTSS A+V Y + P+ + D++DE WFSD +F E++K
Sbjct  104  DPALKGTLNVLRSCAKVSSIKRVVVTSSIATVSYIAKPLMSGDLVDETWFSDPDFCEKSK  163

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK+ AE+AAW+ A EN ID+V+++P +VIGPLLQP +N S EMIL+ +   + F 
Sbjct  164  LWYVLSKILAEKAAWESAKENEIDLVTINPGIVIGPLLQPTVNLSVEMILNFVNGAQTFP  223

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  + C+ DVRDVANAH+ AFE PSA GRYC+VGE M   + LKI+  LYP+L +P+K +
Sbjct  224  NECY-CFADVRDVANAHVLAFENPSACGRYCVVGEVMHCHDALKILQNLYPTLHLPDKCE  282

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P  P ++ S++KA++LG+ FTPLE+SL+DTIESL+EK 
Sbjct  283  DDKPFAPKYEYSREKAEALGVEFTPLEISLRDTIESLREKG  323



>gb|KHG03033.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Gossypium arboreum]
Length=327

 Score =   269 bits (688),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 170/221 (77%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC  TPSVKRVV+TSS A+V Y   P +   V+DE+WF+D E+ +  K
Sbjct  102  DPAVKGTLNVLNSCANTPSVKRVVLTSSIAAVTYNGKPRTPDVVVDESWFTDPEYCKNLK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY++SK  AE++AWK+A E  +DMV ++PA+VIGPLLQP LN S+  +L  IK  + F 
Sbjct  162  LWYVVSKTIAEDSAWKFAKEKGLDMVVVNPAMVIGPLLQPTLNTSAAAVLSLIKGAQTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI+AFE+PSASGRYCLV      SEV+K++S+LYPS  +PEK  
Sbjct  222  NATFG-WVNVKDVANAHIQAFEIPSASGRYCLVERVAHCSEVVKMLSELYPSFQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PT++VS++KAK+LGI FTPL+VSLK+T+ESLKEK 
Sbjct  281  DDKPYVPTYQVSKEKAKTLGIEFTPLDVSLKETVESLKEKG  321



>ref|XP_002298395.1| cinnamyl-alcohol dehydrogenase family protein [Populus trichocarpa]
 gb|EEE83200.1| cinnamyl-alcohol dehydrogenase family protein [Populus trichocarpa]
Length=325

 Score =   268 bits (686),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVLGSC R PS+KRVV+TSS A+V Y   P +   V+DE WFSD E   E+K
Sbjct  102  DPAVKGTLNVLGSCARHPSIKRVVLTSSMAAVAYNRKPRTPDVVVDETWFSDPELCRESK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+A E  +DMV+++P++VIGPLLQP LN S+  IL  IK  + F 
Sbjct  162  LWYVLSKTLAEDAAWKFAKEKGMDMVAINPSMVIGPLLQPTLNTSAAAILSLIKGAQTFS  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +++V+DVANAHI+AFE+ SASGRYCLV      SEV+KI+ +LYP L +PEK  
Sbjct  222  NASFG-WINVKDVANAHIQAFELSSASGRYCLVERVAHHSEVVKILRELYPDLQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +P ++VS++KAKSLGI F PLE S+K+T+ESLKEK 
Sbjct  281  DDKPYVPIYQVSKEKAKSLGIEFIPLEASIKETVESLKEKG  321



>gb|AHC29025.1| phenylacetaldehyde reductase [Rosa rugosa]
Length=322

 Score =   268 bits (685),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 170/221 (77%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC ++PS+KRVV+TSS A+V Y   P +   V+DE WF+D +  +E+K
Sbjct  99   DPAVKGTLNVLNSCSKSPSIKRVVLTSSIAAVAYNGKPRTPDVVVDETWFTDPDVCKESK  158

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK   E  IDMV+++PA+VIGPLLQP LN S+  IL+ IK  R + 
Sbjct  159  LWYVLSKTLAEDAAWKLVKEKGIDMVTINPAMVIGPLLQPTLNTSAAAILNIIKGARTYP  218

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +++V+DVANAH++AFE+PSASGRYCLV      +EVL+I+ +LYP L +PEK  
Sbjct  219  NASFG-WINVKDVANAHVQAFEIPSASGRYCLVERVAHFTEVLQIIHELYPDLQLPEKCS  277

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PT++VS++KAKSLGI F PL++SLK+TIESLKEK+
Sbjct  278  DDKPFVPTYQVSKEKAKSLGIEFIPLDISLKETIESLKEKS  318



>ref|XP_011025488.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Populus 
euphratica]
Length=324

 Score =   268 bits (685),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 169/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGT+NVL SC + PS+KRVV+TSS A+V++    ++   V+DE WFSD +F E++K
Sbjct  101  DPALKGTVNVLRSCTKIPSIKRVVITSSMAAVVFNGKSLAPDVVVDETWFSDSDFCEKSK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AEEAAWK+  EN IDMV+L+P LVIGPLLQP LN S+E +LD I   + + 
Sbjct  161  LWYQLSKTLAEEAAWKFTKENGIDMVTLNPGLVIGPLLQPTLNQSAESVLDLINGAKSYP  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ +  +VDVRDVA+AHI A E PSA+GRYCLVG  + +SE +KI+S+LYP L IP++  
Sbjct  221  NTTYR-WVDVRDVADAHIYALENPSANGRYCLVGTVIHSSEAVKILSKLYPDLTIPKQCA  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P MP ++VS+++A SLG+ +TPLE SLKDTIESLKEKN
Sbjct  280  DDKPPMPKYQVSKERAASLGVKYTPLEASLKDTIESLKEKN  320



>emb|CBI29130.3| unnamed protein product [Vitis vinifera]
Length=323

 Score =   267 bits (683),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 168/221 (76%), Gaps = 2/221 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGT++VLGSC + PSVKRVVVTSS ASV +   P++   ++DE+WFSD  F E++K
Sbjct  101  DPALKGTMSVLGSCAKVPSVKRVVVTSSMASVAFNGKPLAPDVLVDESWFSDPVFCEKSK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAWK+A EN IDMV+++P  VIGPLLQP LN S E +L  +K   +  
Sbjct  161  LWYMLSKTLAEEAAWKFAKENGIDMVTINPGWVIGPLLQPTLNLSVEEVLKLLK--GDIF  218

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
             +  + +VDVRDVA AHI+A+E+ +A GRYCLVG  +  SE +KI+ +LYP+L +PEK  
Sbjct  219  PNKTHRWVDVRDVAMAHIQAYELSTARGRYCLVGSILHCSETMKILRKLYPALNLPEKCA  278

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P  PT+ VSQ+K KSLGI+FTPLEVS+KDT+ESL+EKN
Sbjct  279  DDEPYEPTYMVSQEKTKSLGIDFTPLEVSMKDTVESLREKN  319



>dbj|BAQ20438.1| 2-phenylethanol [Rosa hybrid cultivar]
Length=322

 Score =   267 bits (683),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 170/221 (77%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC ++ S+KRVV+TSS A+V Y   P +   V+DE WF+D +  +E+K
Sbjct  99   DPAVKGTLNVLNSCSKSTSIKRVVLTSSIAAVAYNGKPRTPDVVVDETWFTDPDVCKESK  158

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+  E  IDMV+++PA+VIGPLLQP LN S+  IL+ IK  R + 
Sbjct  159  LWYVLSKTLAEDAAWKFVKEKGIDMVTINPAMVIGPLLQPTLNTSAAAILNIIKGARTYP  218

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAH++AFE+PSASGRYCLV      +EVL+I+ +LYP L +PEK  
Sbjct  219  NASFG-WVNVKDVANAHVQAFEIPSASGRYCLVERVAHFTEVLQIIHELYPDLQLPEKCS  277

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PT++VS++KAKSLGI F PL++SLK+TIESLKEK+
Sbjct  278  DDKPFVPTYQVSKEKAKSLGIEFIPLDISLKETIESLKEKS  318



>ref|XP_008231476.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Prunus 
mume]
Length=324

 Score =   267 bits (682),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 171/221 (77%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SCV+  +VKRVV+TSSTA+V+Y   P++   V+DE WFSD    E  K
Sbjct  101  DPAVKGTLNVLKSCVKFATVKRVVLTSSTAAVIYNGRPLTPDAVVDETWFSDPFVCENLK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            +WY+LSK  AEEAAWK+A  N ID+V+++P+ VIGPLLQP LN + EMIL+   +  +  
Sbjct  161  KWYVLSKTLAEEAAWKFAEGNGIDLVTINPSYVIGPLLQPSLNITVEMILNFKNDIEDVN  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            SS ++C  DVRDVA+AH++AFEVPSA+GRYCLVG     ++VLKI+ +L+PSL  PEKY+
Sbjct  221  SSIYSCS-DVRDVASAHVQAFEVPSANGRYCLVGHVTPMAKVLKILHELHPSLCPPEKYE  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
               P  PT++VSQ+KAKSLG+NF PLEVSL+DT+ES+KE+ 
Sbjct  280  EANPSEPTYQVSQEKAKSLGVNFLPLEVSLRDTVESVKERG  320



>ref|XP_002268122.1| PREDICTED: cinnamoyl-CoA reductase 1 [Vitis vinifera]
 emb|CBI40601.3| unnamed protein product [Vitis vinifera]
Length=326

 Score =   266 bits (681),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 164/221 (74%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGT+NVL SC + PSVKRVVVTSS ++V     P++   +IDE+WFSD    +E+K
Sbjct  102  DPALKGTINVLRSCSKVPSVKRVVVTSSMSAVEQNGKPLTPEVIIDESWFSDAVLCKESK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AEEAAWK++ EN IDMV ++P  V+GPLLQP LN S E IL  +   + F 
Sbjct  162  LWYKLSKTLAEEAAWKFSKENGIDMVMINPGWVLGPLLQPTLNLSVEEILKLLNGVQTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
             +    +VD RDVANAHI+AFE+P ASGRYCLVG     SE L I+ +LYP++ IPEK++
Sbjct  222  KTTSYTWVDARDVANAHIQAFELPEASGRYCLVGTVSHRSETLNILHKLYPAIHIPEKWE  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
                 +PTF+VSQ+KAKSLGI+FTPLEVS+KDT+ESLKEKN
Sbjct  282  DGQTCVPTFRVSQEKAKSLGIHFTPLEVSMKDTVESLKEKN  322



>ref|XP_002268322.1| PREDICTED: cinnamoyl-CoA reductase 1 [Vitis vinifera]
 emb|CBI40597.3| unnamed protein product [Vitis vinifera]
Length=326

 Score =   266 bits (681),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 164/221 (74%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGT+NVL SC + PSVKRVVVTSS ++V     P++   +IDE+WFSD    +E+K
Sbjct  102  DPALKGTINVLRSCSKVPSVKRVVVTSSMSAVEQNGKPLTPEVIIDESWFSDAVLCKESK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AEEAAWK++ EN IDMV ++P  V+GPLLQP LN S E IL  +   + F 
Sbjct  162  LWYKLSKTLAEEAAWKFSKENGIDMVMINPGWVLGPLLQPTLNLSVEEILKLLNGVQTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
             +    +VD RDVANAHI+AFE+P ASGRYCLVG     SE L I+ +LYP++ IPEK++
Sbjct  222  KTTSYTWVDARDVANAHIQAFELPEASGRYCLVGTVSHRSETLNILHKLYPAIHIPEKWE  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
                 +PTF+VSQ+KAKSLGI+FTPLEVS+KDT+ESLKEKN
Sbjct  282  DGQTCVPTFRVSQEKAKSLGIHFTPLEVSIKDTVESLKEKN  322



>ref|XP_004307229.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Fragaria 
vesca subsp. vesca]
Length=323

 Score =   266 bits (680),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 169/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SCV+ PS+KRV++TSS A+V +   P++   VIDE+WFSD  F E++K
Sbjct  102  DPALKGTLNVLRSCVKVPSIKRVIITSSMAAVAFNGKPVAPDVVIDESWFSDPAFCEKSK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAWK+A E  ID+V+++P LVIGPLLQP LN S E IL  I    +F 
Sbjct  162  AWYMLSKTLAEEAAWKFAKEKGIDIVTINPGLVIGPLLQPTLNTSVEPILKLINGTEKFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ +  +VDVRDVANAHI AFE PSASGRYCLVG     S+++KI+  ++P+L +PEK  
Sbjct  222  NTTYR-FVDVRDVANAHILAFENPSASGRYCLVGSVTHCSDIVKILRDIFPALSLPEKSA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P  PT++VS+++A++LG+ +T LEV+LKDT+ESLK+KN
Sbjct  281  DDKPFTPTYQVSKERAETLGVKYTALEVTLKDTVESLKDKN  321



>emb|CBI40606.3| unnamed protein product [Vitis vinifera]
Length=326

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 169/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC + P+++RVVVTSS  +V+Y   P+++  ++DE WFSD  F EE+K
Sbjct  103  DPAVKGTLNVLRSCAKVPAIRRVVVTSSIVAVIYNGKPLTSDVIVDETWFSDPAFCEESK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAWK+A E+ ID+V+++P ++IGP LQP +N + E+IL+ I     F 
Sbjct  163  LWYVLSKTLAEEAAWKFAKEHGIDLVTMNPGVMIGPPLQPTINLTMEIILNMINVPYTFP  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            SS +  +VDVRDVANAHI+AFE+ SASGRYC+V      SE +KI+ +LYP++ +P+K  
Sbjct  223  SSTYK-WVDVRDVANAHIQAFEISSASGRYCMVERITYRSEAIKILHELYPAIHLPQKSA  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P+ PT+++S++K KSL I+F PLEVSLKDTIESLKEKN
Sbjct  282  DDEPLGPTYQISKEKVKSLAIDFIPLEVSLKDTIESLKEKN  322



>emb|CBI38203.3| unnamed protein product [Vitis vinifera]
Length=345

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/220 (58%), Positives = 164/220 (75%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KG +NVL SC + PSVKRVVVTSS  SV++   P+++  +I+E+WFSD     E+K
Sbjct  102  DPALKGIINVLRSCAKVPSVKRVVVTSSMTSVVFTGKPLTSEVLINESWFSDPVLCNESK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAWK++ EN IDMV+++P  VIGPLLQP LN S+E+ L+ I   + F 
Sbjct  162  LWYVLSKTLAEEAAWKFSKENGIDMVTINPGGVIGPLLQPTLNLSAELFLNLINGAQTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  +   VDVRDVANAHI+A+E+P ASGRYCLV   +  SE LKI+ +LYP LP+PEK  
Sbjct  222  NRSYR-LVDVRDVANAHIQAYEIPEASGRYCLVERDLHCSETLKILRKLYPDLPLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P  P+F VSQ+KA SLG +FTPLEVSLKDT+ESL+ +
Sbjct  281  DDKPYAPSFLVSQEKANSLGAHFTPLEVSLKDTVESLRRR  320



>emb|CAN65489.1| hypothetical protein VITISV_003761 [Vitis vinifera]
Length=327

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 167/221 (76%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC + P+++RVVVTSS A+V+Y   P+++  ++DE WFSD  F EE+K
Sbjct  103  DPAVKGTLNVLRSCAKVPAIRRVVVTSSIAAVIYNGKPLTSDVIVDETWFSDPAFCEESK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAWK+A E+ ID+V+++P +V GPLLQP +N + E++L+ I  G +  
Sbjct  163  LWYVLSKTLAEEAAWKFAKEHGIDLVTMNPGVVTGPLLQPTINLTMEILLNMINGGAQTF  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
             S    +VDVRDVANAH++AFE+ SASGRYCLV      SE +KI+ +LYP+L +P+K  
Sbjct  223  PSSTYRWVDVRDVANAHVQAFEISSASGRYCLVERVTYCSEAIKILQELYPALHLPQKNA  282

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P M T+++S++K KSL I+F PLEVSLKDT+E+LKE N
Sbjct  283  DDEPPMATYQISKEKVKSLAIDFIPLEVSLKDTMENLKEMN  323



>ref|NP_001289243.1| CAD protein [Pyrus x bretschneideri]
 gb|AGW45367.1| cinnamyl alcohol dehydrogenase [Pyrus x bretschneideri]
Length=325

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 170/221 (77%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNVL SCV++PS+KRVV+TSS A+V Y   P +   V+DE WF+D +  +E+K
Sbjct  102  EPAVKGTLNVLNSCVKSPSIKRVVLTSSMAAVAYNGKPRTPDVVVDETWFTDPDVCKESK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+  E  ID+V+++PA+VIGPLLQP LN S+  IL+ IK  R F 
Sbjct  162  LWYVLSKTLAEDAAWKFVKEKGIDLVTINPAMVIGPLLQPTLNTSAAAILNVIKGARTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +++V+DVANAHI+AFE P+ASGRYCLV      SEV++++ +LYP+L +PEK  
Sbjct  222  NASFG-WINVKDVANAHIQAFERPTASGRYCLVERVAHFSEVVRVLRELYPTLQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PT+ VS++KAKSLG+ F PL+VSLK+T+ESLKEK 
Sbjct  281  DDKPFVPTYHVSKEKAKSLGVEFIPLDVSLKETVESLKEKG  321



>ref|XP_004307230.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Fragaria 
vesca subsp. vesca]
Length=322

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 168/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SCV+ PS+KRVV+TSS A+V Y  NP++   +IDE+WFSD  F E++K
Sbjct  101  DPALKGTLNVLRSCVKVPSIKRVVITSSMAAVAYNGNPVAPDVIIDESWFSDPAFCEKSK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAWK+A E  ID+V+++P  VIGPLLQP LN S E IL+ I    +F 
Sbjct  161  AWYMLSKTLAEEAAWKFAKEKCIDIVTINPGYVIGPLLQPTLNTSVEPILNLINGTEKFP  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ +  +VDVRDVANAHI A E PSASGRYCLVG     S+++KI+  ++P+L +PEK  
Sbjct  221  NTTYR-FVDVRDVANAHILALENPSASGRYCLVGSVTHCSDIVKILRDIFPALSLPEKSA  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P  PT++VS+++A+ LG+N+TPLE +LKDT+ESL +KN
Sbjct  280  DDKPFTPTYQVSKERAQILGVNYTPLEGTLKDTVESLMDKN  320



>ref|XP_007218281.1| hypothetical protein PRUPE_ppa008382mg [Prunus persica]
 gb|EMJ19480.1| hypothetical protein PRUPE_ppa008382mg [Prunus persica]
Length=324

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 169/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SCV+  +VKRVV+TSSTA+V++   P++   V+DE WFSD    E  K
Sbjct  101  DPAVKGTLNVLKSCVKFATVKRVVLTSSTAAVIFNGRPLTPDVVVDETWFSDPFVCENFK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            +WY+LSK  AEEAAWK+A  N ID+V+++P+ VIGPLLQP LN + EMIL+   +  +  
Sbjct  161  KWYVLSKTLAEEAAWKFAEGNGIDLVTINPSFVIGPLLQPSLNITVEMILNFKNDVEDVN  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            SS ++C  DVRDVA AH++AFEVPSA+GRYCLVG     ++VLKI+ +L+PSL  PEKY+
Sbjct  221  SSIYSCS-DVRDVAAAHVQAFEVPSANGRYCLVGHVTPMAKVLKILHELHPSLCPPEKYE  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
               P  PT++VSQ+KAKSLG+NF PLEVSL DT+ESLKEK 
Sbjct  280  EANPSEPTYQVSQEKAKSLGVNFLPLEVSLSDTVESLKEKG  320



>ref|XP_011013832.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Populus euphratica]
Length=325

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVLGSC + PS+KRVV+TSS A+V Y   P +   V+DE WFSD E   E+K
Sbjct  102  DPAVKGTLNVLGSCAKHPSIKRVVLTSSMAAVAYNGKPRTPDVVVDETWFSDPELCRESK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAW++A E  +DMV+++P++VIGPLLQP LN S+  IL  IK  + F 
Sbjct  162  LWYVLSKTLAEDAAWQFAKEKGMDMVAINPSMVIGPLLQPTLNTSTAAILSLIKGAQTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +++V+DVANAHI+AFE+ SASGRYCLV      SEV+KI+ +LYP L +PEK  
Sbjct  222  NASFG-WINVKDVANAHIQAFELSSASGRYCLVERVAHHSEVVKILRELYPDLQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +P ++VS++KAKSLGI F PLE S+K+T+ESLKEK 
Sbjct  281  DDKPCVPIYQVSKEKAKSLGIEFIPLEASIKETVESLKEKG  321



>gb|AAY26021.2| cinnamyl alcohol dehydrogenase [Eucommia ulmoides]
Length=322

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/220 (58%), Positives = 167/220 (76%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKG++NVLGSC ++PSVKRVV+TSS A+V   S P +   V+DE W SD EF  + K
Sbjct  101  DPAVKGSVNVLGSCAKSPSVKRVVLTSSVAAVAINSRPKNPDVVVDETWHSDVEFCTQRK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAWK+A E  +D+V+++PA+VIGPLLQP LN S+  IL+ +   + + 
Sbjct  161  LWYVLSKTLAEEAAWKFAKEKGLDLVTINPAMVIGPLLQPSLNTSASAILNFLNGAKTYS  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +S    ++DVR+VANAHI+AFE+PSA+GRYCLV      SE+++I+   YP+LP+PEK  
Sbjct  221  NSSMG-WIDVRNVANAHIQAFEIPSANGRYCLVERVAHYSEIVQILRNHYPTLPLPEKCA  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P  PTF+VS++KAKSLGI F PLEVS+KDT+ESLKEK
Sbjct  280  DDNPFQPTFQVSKEKAKSLGIEFIPLEVSIKDTVESLKEK  319



>gb|AFK47029.1| unknown [Lotus japonicus]
Length=325

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 169/220 (77%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SCV +P++KRVV+TSS A+V Y   P +   V+DE WF+D     E K
Sbjct  102  DPAVKGTLNVLKSCVNSPTLKRVVLTSSIAAVAYNGKPRTPDVVVDETWFTDPVLNREAK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAWK+  EN IDMV+++PA+VIGPLLQP+LN S+  +L+ +   + F 
Sbjct  162  MWYVLSKTLAEEAAWKFVRENNIDMVTINPAMVIGPLLQPVLNTSAASVLNFVNGAQTFA  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI+A+E+ SASGR+CLV   +  SE++KI+ +LYP+L +PEK  
Sbjct  222  NASFG-WVNVKDVANAHIQAYEIASASGRHCLVERVVHHSEIVKILRELYPTLQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P +PT++VS++KAKSLGI + PLEVSLK+T+ESLKEK
Sbjct  281  DDKPYVPTYQVSKEKAKSLGIEYIPLEVSLKETVESLKEK  320



>gb|AAC06319.1| putative cinnamyl alcohol dehydrogenase [Malus domestica]
Length=325

 Score =   265 bits (677),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 170/221 (77%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNVL SC ++PS+KRVV+TSS A+V Y   P +   V+DE WF+D +  +E+K
Sbjct  102  EPAVKGTLNVLNSCAKSPSIKRVVLTSSIAAVAYNGKPRTPDVVVDETWFTDPDVCKESK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+  E  ID+V+++PA+VIGPLLQP LN S+  +L+ IK  R F 
Sbjct  162  LWYVLSKTLAEDAAWKFVKEKGIDLVTINPAMVIGPLLQPTLNTSAAAVLNVIKGARTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +++V+DVANAHI+AFE P+ASGRYCLV      SEV++I+ +LYP+L +PEK  
Sbjct  222  NASFG-WINVKDVANAHIQAFERPTASGRYCLVERVAHFSEVVRILRELYPTLQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PT++VS++KAKSLG+ F PL+VSLK+T+ESLKEK 
Sbjct  281  DDKPFVPTYQVSKEKAKSLGVEFIPLDVSLKETVESLKEKG  321



>ref|XP_007221091.1| hypothetical protein PRUPE_ppa017116mg, partial [Prunus persica]
 gb|EMJ22290.1| hypothetical protein PRUPE_ppa017116mg, partial [Prunus persica]
Length=286

 Score =   263 bits (673),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 171/222 (77%), Gaps = 3/222 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SCV+  +VKRVV+TSSTA+V+    P++   V+DE WFSD  F E  K
Sbjct  61   DPAVKGTLNVLKSCVKFATVKRVVLTSSTAAVIVNGRPLTPDVVVDETWFSDPFFCENFK  120

Query  182  --QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGRE  355
              +WY+LSK  AEEAAWK+A  N ID+V+++P+ VIGPLLQP LN + EMIL+   +  +
Sbjct  121  IAKWYVLSKTLAEEAAWKFAEGNGIDLVTINPSYVIGPLLQPSLNLTVEMILNLKNDIED  180

Query  356  FMSSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEK  535
              SS ++C  DVRDVA+AH++AFEVPSA+GRYCLVG     ++VLKI+ +L+PSL  PEK
Sbjct  181  VNSSIYSCS-DVRDVASAHVQAFEVPSANGRYCLVGHVTPMAKVLKILHELHPSLCPPEK  239

Query  536  YKGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
            Y+   P  PT++VSQ+KAKSLG+NF PLEVSL+DT+ESLKEK
Sbjct  240  YEEANPSEPTYQVSQEKAKSLGVNFLPLEVSLRDTVESLKEK  281



>gb|EYU27028.1| hypothetical protein MIMGU_mgv1a010102mg [Erythranthe guttata]
Length=322

 Score =   265 bits (676),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 170/221 (77%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGT+NVL SC + PS+KRVV+TSS ASVM+  +P+++  ++DE W+SD  F EE K
Sbjct  98   DPAVKGTINVLRSCKKVPSIKRVVITSSMASVMFNHSPLNSDAIVDETWYSDPLFCEEKK  157

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            +WY LSK  AE+AAWK+A EN +D+V+LHP  VIGPLLQP LN +SE +L+ ++EG++  
Sbjct  158  EWYALSKTLAEKAAWKFAEENGLDVVTLHPGFVIGPLLQPTLNLTSEALLNLVREGKQLW  217

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +S    YVDVRDVA AHI AFE PSA+GRYCLVG    + E L I+++++PSL +P   +
Sbjct  218  TSGIYRYVDVRDVALAHILAFENPSANGRYCLVGRVTYSFEALGILNRIFPSLDLPHSSE  277

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + P    ++VS+++AKSLGI+FTP+EVSLKD+++SLK+K 
Sbjct  278  ENEPANLPYEVSKERAKSLGIDFTPVEVSLKDSVQSLKDKG  318



>ref|XP_010246748.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Nelumbo nucifera]
Length=324

 Score =   265 bits (676),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVLGSC +  SVKRVVVTSS A+V Y   P +   V+DE WFSD EF +ET 
Sbjct  101  DPAVKGTLNVLGSCKKASSVKRVVVTSSMAAVAYNRKPRNPDVVVDETWFSDPEFCKETN  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE AAWK+A EN IDMV+++PA+VIGPLLQP LN S+E IL  +     + 
Sbjct  161  AWYLLSKTLAEAAAWKFAKENGIDMVTINPAMVIGPLLQPTLNTSAEAILKLVNGTNTYP  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++    +V+V+DVANAHI+AFE+PSASGRYCLV   +  S V+KI+ +L+PS  +P K  
Sbjct  221  NATLG-WVNVKDVANAHIQAFEIPSASGRYCLVESVVHYSGVVKILHELFPSFHLPNKCA  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PT++VS++KAKSLGI+F P + SLK+T+ESLKEKN
Sbjct  280  DDKPHVPTYQVSKEKAKSLGIDFIPFKESLKETVESLKEKN  320



>ref|XP_008349860.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Malus domestica]
Length=326

 Score =   265 bits (677),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 170/221 (77%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNVL SC ++PS+KRVV+TSS A+V Y   P +   V+DE WF+D +  +E+K
Sbjct  103  EPAVKGTLNVLNSCAKSPSIKRVVLTSSIAAVAYNGKPRTPDVVVDETWFTDPDVCKESK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+  E  ID+V+++PA+VIGPLLQP LN S+  +L+ IK  R F 
Sbjct  163  LWYVLSKTLAEDAAWKFVKEKGIDLVTINPAMVIGPLLQPTLNTSAAAVLNVIKGARTFP  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +++V+DVANAHI+AFE P+ASGRYCLV      SEV++I+ +LYP+L +PEK  
Sbjct  223  NASFG-WINVKDVANAHIQAFERPTASGRYCLVERVAHFSEVVRILRELYPTLQLPEKCA  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PT++VS++KAKSLG+ F PL+VSLK+T+ESLKEK 
Sbjct  282  DDKPFVPTYQVSKEKAKSLGVEFIPLDVSLKETVESLKEKG  322



>gb|AIB06353.1| cinnamyl alcohol dehydrogenase, partial [Pyrus pyrifolia]
Length=315

 Score =   264 bits (675),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 170/221 (77%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNVL SCV++PS+KRVV+TSS A+V Y   P +   V+DE WF+D +  +E+K
Sbjct  92   EPAVKGTLNVLNSCVKSPSIKRVVLTSSMAAVAYNGKPRTPDVVVDETWFTDPDVCKESK  151

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+  E  ID+V+++PA+VIGPLLQP LN S+  IL+ IK  R F 
Sbjct  152  LWYVLSKTLAEDAAWKFVKEKGIDLVTINPAMVIGPLLQPTLNTSAAAILNVIKGARTFP  211

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +++V+DVANAHI AFE P+ASGRYCLV      SEV++++ +LYP+L +PEK  
Sbjct  212  NASFG-WINVKDVANAHILAFERPTASGRYCLVERVAHFSEVVRVLRELYPTLQLPEKCA  270

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PT++VS++KAKSLG+ F PL+VSLK+T+ESLKEK 
Sbjct  271  DDKPFVPTYQVSKEKAKSLGVEFIPLDVSLKETVESLKEKG  311



>ref|XP_003634871.2| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Vitis vinifera]
Length=327

 Score =   265 bits (676),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 170/222 (77%), Gaps = 2/222 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC + P+++RVVVTSS  +V+Y   P+++  ++DE WFSD  F EE+K
Sbjct  103  DPAVKGTLNVLRSCAKVPAIRRVVVTSSIVAVIYNGKPLTSDVIVDETWFSDPAFCEESK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKE-GREF  358
             WY+LSK  AEEAAWK+A E+ ID+V+++P ++IGP LQP +N + E+IL+ I E    F
Sbjct  163  LWYVLSKTLAEEAAWKFAKEHGIDLVTMNPGVMIGPPLQPTINLTMEIILNMINEVPYTF  222

Query  359  MSSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKY  538
             SS +  +VDVRDVANAHI+AFE+ SASGRYC+V      SE +KI+ +LYP++ +P+K 
Sbjct  223  PSSTYK-WVDVRDVANAHIQAFEISSASGRYCMVERITYRSEAIKILHELYPAIHLPQKS  281

Query  539  KGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
              D P+ PT+++S++K KSL I+F PLEVSLKDTIESLKEKN
Sbjct  282  ADDEPLGPTYQISKEKVKSLAIDFIPLEVSLKDTIESLKEKN  323



>ref|XP_011045419.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Populus euphratica]
Length=325

 Score =   264 bits (675),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVLGSC + PS+KRVV+TSS A+V Y   P +   V+DE WFSD +   E+K
Sbjct  102  DPAVKGTLNVLGSCAKHPSIKRVVLTSSMAAVAYNGKPRTPDVVVDETWFSDPQLCRESK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAW++A E  +DMV+++P++VIGPLLQP LN S+  IL  IK  + F 
Sbjct  162  LWYVLSKTLAEDAAWQFAKEKGMDMVAINPSMVIGPLLQPTLNTSTAAILSLIKGAQTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +++V+DVANAHI+AFE+ SASGRYCLV      SEV+KI+ +LYP L +PEK  
Sbjct  222  NASFG-WINVKDVANAHIQAFELSSASGRYCLVERVAHHSEVVKILRELYPDLQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +P ++VS++KAKSLGI F PLE S+K+T+ESLKEK 
Sbjct  281  DDKPCVPIYQVSKEKAKSLGIEFIPLEASIKETVESLKEKG  321



>ref|XP_007015091.1| Cinnamyl alcohol dehydrogenase, 82967-79323, putative isoform 
1 [Theobroma cacao]
 gb|EOY32710.1| Cinnamyl alcohol dehydrogenase, 82967-79323, putative isoform 
1 [Theobroma cacao]
Length=325

 Score =   264 bits (675),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +T SVKRVV+TSS A+V Y   P +   V+DE WF+D ++ +  K
Sbjct  102  DPAVKGTLNVLNSCAKTSSVKRVVLTSSMAAVAYNGKPRTPDVVVDETWFTDPDYCKGLK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY++SK  AE+AAWK+A E  IDMV+++PA+VIGPLLQP LN S+  +L  IK    F 
Sbjct  162  LWYVVSKTMAEDAAWKFAKEKGIDMVAINPAMVIGPLLQPTLNTSAAAVLSLIKGAETFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI+AFE+PSASGRYCLV      SE++K++ +LYPS  +PEK  
Sbjct  222  NATFG-WVNVKDVANAHIQAFEIPSASGRYCLVERVAHYSEIVKVLQELYPSFQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PT++VS++KAK LGI+F PL+VSLK+T+ESLKEK 
Sbjct  281  DDKPYVPTYQVSKEKAKCLGIDFIPLDVSLKETVESLKEKG  321



>ref|XP_007218683.1| hypothetical protein PRUPE_ppa008707mg [Prunus persica]
 gb|EMJ19882.1| hypothetical protein PRUPE_ppa008707mg [Prunus persica]
Length=322

 Score =   264 bits (675),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 164/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC + PS+KRVV+TSS A+V +   P++   +IDE+WFSD    E+ K
Sbjct  101  DPALKGTLNVLRSCAKVPSIKRVVITSSMAAVAFNGKPLAPDVIIDESWFSDLAVCEKLK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY++SK  AE+AAWK+  ENRIDMV+++P LVIGPLLQP LN S E +L  I     F 
Sbjct  161  LWYMISKTLAEDAAWKFTKENRIDMVAINPGLVIGPLLQPTLNTSVEPVLKLINGAETFP  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  +  +VDVRDVANAHI AFE  SASGRYCLVG     SEV+K++  L+P+L IPEK  
Sbjct  221  NITYR-WVDVRDVANAHILAFENASASGRYCLVGRIAHCSEVVKLLRGLFPALKIPEKCA  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P  P ++VS+++A++LG+ FTPLEV+LKDT+ESLKEKN
Sbjct  280  DDKPFTPIYQVSKERAQALGVKFTPLEVTLKDTVESLKEKN  320



>emb|CBI40605.3| unnamed protein product [Vitis vinifera]
Length=327

 Score =   264 bits (675),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 163/221 (74%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAV GTLNVL SC + PS++RVVVTSS  + ++    ++   ++DE WFSD  F EE+K
Sbjct  103  DPAVNGTLNVLRSCTKVPSIRRVVVTSSIVATIFNGKTLTPDVIVDETWFSDPAFCEESK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAWK+A EN ID+V+++P  VIGP LQP +N + E+IL+ I  G +  
Sbjct  163  LWYVLSKTLAEEAAWKFAKENGIDLVTMNPGFVIGPFLQPTINLTMEIILNLINGGAQTF  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
             S    +VDVRDVANAH++AFE+ SASGRYCLV      SE +KI+ +LYP+L +P+K  
Sbjct  223  PSSTYRWVDVRDVANAHVQAFEISSASGRYCLVERVTYCSEAIKILQELYPALHLPQKNA  282

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P MPT+++S++K KSL I+F PLEVSLKDT+E+LKEKN
Sbjct  283  DDEPPMPTYQISKEKVKSLAIDFIPLEVSLKDTMENLKEKN  323



>ref|XP_004291772.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Fragaria vesca subsp. 
vesca]
Length=321

 Score =   264 bits (674),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 169/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC ++PS+KRVV+TSS A+V Y   P +   V+DE WF+D    +E K
Sbjct  98   DPAVKGTLNVLNSCSKSPSIKRVVLTSSIAAVAYNGKPRTPDVVVDETWFTDPGVCKEQK  157

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+  E  IDMV+++PA+VIGPLLQP LN S+  +L+ IK  R + 
Sbjct  158  LWYVLSKTLAEDAAWKFVKEKGIDMVTINPAMVIGPLLQPTLNTSAAAVLNVIKGARTYP  217

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +++V+DVANAH++AFE PSASGRYCLV      SEV++I+ +LYP L +PEK  
Sbjct  218  NASFG-WINVKDVANAHVQAFENPSASGRYCLVERVAHFSEVVQILHELYPDLQLPEKCS  276

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P++PT++VS++KAKSLGI F PL++SLK+T+ESLKEK+
Sbjct  277  DDKPLVPTYQVSKEKAKSLGIEFVPLDISLKETVESLKEKS  317



>ref|XP_002263014.1| PREDICTED: cinnamoyl-CoA reductase 1 [Vitis vinifera]
 ref|XP_010648113.1| PREDICTED: cinnamoyl-CoA reductase 1 [Vitis vinifera]
 emb|CBI32944.3| unnamed protein product [Vitis vinifera]
Length=324

 Score =   264 bits (674),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 164/220 (75%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC + PS++RVVVTSS A+V +    ++   V+DE WFSD    E+ K
Sbjct  101  DPAVKGTLNVLRSCAKVPSIRRVVVTSSMAAVAFTGQTLTPDVVVDETWFSDPAVCEKLK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAWK+A EN+ID+V+++P LVIGPLLQP LN S E +L  I   + F 
Sbjct  161  LWYMLSKTLAEEAAWKFAKENKIDLVAINPGLVIGPLLQPTLNTSVEPVLKLINGTQTFP  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  +  +VDVRDVANAHI+AFEVPSA+GRYCLV      SEV+KI+ +LYP+  +P+K  
Sbjct  221  NITYR-WVDVRDVANAHIQAFEVPSANGRYCLVSRVTHCSEVVKILHELYPTSNLPDKCA  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P  PT++VSQ++A+SLGINF P+EVS  DT+ESLKEK
Sbjct  280  DDKPFEPTYQVSQERARSLGINFIPVEVSFNDTVESLKEK  319



>ref|XP_011025551.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Populus euphratica]
Length=325

 Score =   264 bits (674),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVLGSC + PS+KRVV+TSS A+V Y   P +   V+DE WFSD     E+K
Sbjct  102  DPAVKGTLNVLGSCAKHPSIKRVVLTSSVAAVAYNGKPRTPDVVVDETWFSDPNLCRESK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+A E  +DMV+++PA+VIGPLLQP LN S+  IL  IK  + F 
Sbjct  162  VWYVLSKTLAEDAAWKFAKEKDMDMVAINPAMVIGPLLQPTLNTSAAAILSLIKGAQTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI+AFE+ SASGRYCLV      SE++KI+ +LYP L +PEK  
Sbjct  222  NASFG-WVNVKDVANAHIQAFELSSASGRYCLVERVAHYSELVKILHELYPDLQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +P ++VS++KAKSLGI F PLE S+K+T+ESLKEK 
Sbjct  281  DDKPYVPIYQVSKEKAKSLGIEFIPLEASVKETVESLKEKG  321



>ref|XP_010067837.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW66050.1| hypothetical protein EUGRSUZ_G03342 [Eucalyptus grandis]
Length=327

 Score =   264 bits (674),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 169/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC +  S+KRVVVTSS A+V Y + P+++ D++DE WFSD EF E++K
Sbjct  104  DPALKGTLNVLRSCAKVSSIKRVVVTSSIATVSYIAKPLTSGDLVDETWFSDPEFCEKSK  163

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK+ AE+A W+ A EN ID+V+++P +VIGPLLQP +N S E+IL+ +   + F 
Sbjct  164  LWYVLSKILAEKAEWELAKENEIDLVTINPGIVIGPLLQPTVNLSVEVILNFVNGAQTFP  223

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  + C+ DVRDVANAH+ AFE PSA GRYC+VGE +   + LKI+  LYP+L +P+K +
Sbjct  224  NECY-CFADVRDVANAHVLAFENPSACGRYCVVGEVIHCHDALKILQNLYPTLHLPDKCE  282

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P    ++ S++KA++LG++FTPLE+SL+DTIESL+EK 
Sbjct  283  DDKPFASKYEYSREKAEALGVDFTPLEISLRDTIESLREKG  323



>ref|XP_009374930.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Pyrus x bretschneideri]
Length=325

 Score =   264 bits (674),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 169/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNVL SC ++PS+KRVV+TSS A+V Y   P +   VIDE WF+D +  +E+K
Sbjct  102  EPAVKGTLNVLNSCAKSPSIKRVVLTSSIAAVAYNGKPRTPDVVIDETWFTDPDVCKESK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+  E  ID+V+++PA+VIGPLLQP LN S+  +L+ IK  R F 
Sbjct  162  LWYVLSKTLAEDAAWKFVKEKGIDLVTINPAMVIGPLLQPTLNTSAAAVLNVIKGARTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +++V+DVANAHI+AFE P+A GRYCLV      SEV++I+ +LYP+L +PEK  
Sbjct  222  NASFG-WINVKDVANAHIQAFESPTAGGRYCLVETVAHFSEVVRILRELYPTLQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PT++VS++KAKSLG+ F PL+VSLK+T+ESLKEK 
Sbjct  281  DDKPFVPTYQVSKEKAKSLGVEFIPLDVSLKETVESLKEKG  321



>ref|XP_011032045.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Populus euphratica]
Length=325

 Score =   264 bits (674),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVLGSC + PS+KRVV+TSS A+V Y   P +   V+DE WFSD     E+K
Sbjct  102  DPAVKGTLNVLGSCAKHPSIKRVVLTSSVAAVAYNGKPRTPDVVVDETWFSDPNLCRESK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+A E  +DMV+++PA+VIGPLLQP LN S+  IL  IK  + F 
Sbjct  162  VWYVLSKTLAEDAAWKFAKEKDMDMVAINPAMVIGPLLQPTLNTSAAAILSLIKGAQTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +++V+DVANAHI+AFE+ SASGRYCLV      SE++KI+ +LYP L +PEK  
Sbjct  222  NASFG-WINVKDVANAHIQAFELSSASGRYCLVERVAHYSELVKILHELYPDLQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +P ++VS++KAKSLGI F PLE S+K+T+ESLKEK 
Sbjct  281  DDKPYVPIYQVSKEKAKSLGIEFIPLEASVKETVESLKEKG  321



>ref|XP_011025487.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Populus 
euphratica]
Length=326

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 169/223 (76%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGT+NVL SC + PS+KRVV+TSS A+V++    ++   V+DE WFSD +F E++K
Sbjct  101  DPALKGTVNVLRSCTKIPSIKRVVITSSMAAVVFNGKSLAPDVVVDETWFSDSDFCEKSK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AEEAAWK+  EN IDMV+L+P LVIGPLLQP LN S+E +LD I   + + 
Sbjct  161  LWYQLSKTLAEEAAWKFTKENGIDMVTLNPGLVIGPLLQPTLNQSAESVLDLINGAKSYP  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPE--K  535
            ++ +  +VDVRDVA+AHI A E PSA+GRYCLVG  + +SE +KI+S+LYP L IP+  +
Sbjct  221  NTTYR-WVDVRDVADAHIYALENPSANGRYCLVGTVIHSSEAVKILSKLYPDLTIPKHGR  279

Query  536  YKGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
               D P MP ++VS+++A SLG+ +TPLE SLKDTIESLKEKN
Sbjct  280  CADDKPPMPKYQVSKERAASLGVKYTPLEASLKDTIESLKEKN  322



>ref|XP_002314079.1| cinnamyl-alcohol dehydrogenase family protein [Populus trichocarpa]
 gb|EEE88034.1| cinnamyl-alcohol dehydrogenase family protein [Populus trichocarpa]
Length=325

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVLGSC + PS++RVV+TSS A+V Y   P +   V+DE WFSD     E+K
Sbjct  102  DPAVKGTLNVLGSCAKHPSIRRVVLTSSVAAVAYNGKPRTPDVVVDETWFSDPNLCRESK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+A E  +DMV+++PA+VIGPLLQP LN S+  IL  IK  + F 
Sbjct  162  VWYVLSKTLAEDAAWKFAKEKDMDMVAINPAMVIGPLLQPTLNTSAAAILSLIKGAQTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +++V+DVANAHI+AFE+ SASGRYCLV      SEV+KI+ +LYP L +PEK  
Sbjct  222  NASFG-WINVKDVANAHIQAFELSSASGRYCLVERVAHYSEVVKILHELYPDLQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +P ++VS++KAKSLG+ F PLE S+K+T+ESLKEK 
Sbjct  281  DDKPYVPIYQVSKEKAKSLGVEFIPLEASVKETVESLKEKG  321



>gb|ABV44810.1| cinnamyl alcohol dehydrogenase 1 [Eriobotrya japonica]
Length=305

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 169/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNVL SC ++PS+KRVV+TSS A+V Y   P +   VIDE WF+D +  +E+K
Sbjct  82   EPAVKGTLNVLNSCAKSPSIKRVVLTSSIAAVAYNGKPRTPDAVIDETWFTDPDVCKESK  141

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+  E  ID+V+++PA+VIGPLLQP LN S+  +L+ +K  R F 
Sbjct  142  LWYVLSKTLAEDAAWKFVKEKGIDLVTINPAMVIGPLLQPTLNTSAAAVLNVVKGARTFP  201

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +++V+D ANAHI+AFE P+ASGRYCLV      SEV++I+ +LYP+L +PEK  
Sbjct  202  NASFG-WINVKDAANAHIQAFESPTASGRYCLVETVAHFSEVVRILRELYPTLQLPEKCA  260

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PT++VS++KAK+LG+ F PL+VSLK+T+ESLKEK 
Sbjct  261  DDKPFVPTYQVSKEKAKNLGVEFIPLDVSLKETVESLKEKG  301



>gb|EYU27029.1| hypothetical protein MIMGU_mgv1a010102mg [Erythranthe guttata]
Length=321

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 171/221 (77%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGT+NVL SC + PS+KRVV+TSS ASVM+  +P+++  ++DE W+SD  F EE K
Sbjct  98   DPAVKGTINVLRSCKKVPSIKRVVITSSMASVMFNHSPLNSDAIVDETWYSDPLFCEEKK  157

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            +WY LSK  AE+AAWK+A EN +D+V+LHP  VIGPLLQP LN +SE +L+ ++EG++  
Sbjct  158  EWYALSKTLAEKAAWKFAEENGLDVVTLHPGFVIGPLLQPTLNLTSEALLNLVREGKQLW  217

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +S    YVDVRDVA AHI AFE PSA+GRYCLVG    + E L I+++++PSL +P   +
Sbjct  218  TSGIYRYVDVRDVALAHILAFENPSANGRYCLVGRVTYSFEALGILNRIFPSLDLPHSEE  277

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             +   +P ++VS+++AKSLGI+FTP+EVSLKD+++SLK+K 
Sbjct  278  NEPANLP-YEVSKERAKSLGIDFTPVEVSLKDSVQSLKDKG  317



>ref|XP_008363567.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Malus domestica]
Length=325

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 170/221 (77%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNVL SC ++PS+KRVV+TSS A+V Y   P +   VIDE WF+D +  +E+K
Sbjct  102  EPAVKGTLNVLNSCAKSPSIKRVVLTSSIAAVAYNGKPRTPDVVIDETWFTDPDVCKESK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+  E  ID+V+++PA+VIGPLLQP LN S+  +L+ IK  R F 
Sbjct  162  LWYVLSKTLAEDAAWKFVKEKGIDLVTINPAMVIGPLLQPTLNTSAAAVLNVIKGARTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +++V+DVANAHI+AFE P+ASGRYCLV      SEV++I+ +L+P+L +PEK  
Sbjct  222  NASFG-WINVKDVANAHIQAFESPTASGRYCLVETVAHFSEVVRILRELHPTLQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PT++VS++KAK+LG+ F PL+VSLK+T+ESLKEK 
Sbjct  281  DDKPFVPTYQVSKEKAKTLGVEFIPLDVSLKETVESLKEKG  321



>ref|XP_003633515.2| PREDICTED: LOW QUALITY PROTEIN: cinnamoyl-CoA reductase 1-like 
[Vitis vinifera]
Length=591

 Score =   270 bits (691),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 168/221 (76%), Gaps = 2/221 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGT+NVLGSC + PSVKRVVVTSS ASV +    ++   ++DE+WFSD  F E++K
Sbjct  101  DPALKGTMNVLGSCAKVPSVKRVVVTSSMASVAFNGKHLAPDVLVDESWFSDPVFCEKSK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAWK+A EN IDMV+++P  VIGPLLQP LN S E +L  +K G  F 
Sbjct  161  LWYMLSKTLAEEAAWKFAKENGIDMVTINPGWVIGPLLQPTLNLSVEEVLKLLK-GDTFP  219

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +     +VDVRDVA AHI+A+E+P+A GRYCLVG  +  SE +KI+ +LYP+L +PEK  
Sbjct  220  NKTHR-WVDVRDVAMAHIQAYELPTARGRYCLVGSILHCSETMKILRKLYPALNLPEKCA  278

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P  PT+ VSQ+K KSLGI+FTPLEVS+KDT+ESL+EKN
Sbjct  279  DDKPYEPTYMVSQEKTKSLGIDFTPLEVSMKDTVESLREKN  319


 Score =   189 bits (481),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            D A+KGT+NVL SC + PSVKRVVVTSS ASV++   P++   +IDE+WFSD    +E+K
Sbjct  431  DLALKGTINVLRSCSKVPSVKRVVVTSSLASVLFTGEPLTPEVLIDESWFSDPVLCKESK  490

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY+LSK  AEEAAW ++ EN IDMV+++P  VIGPLLQP LN S+E +L+ I   + F 
Sbjct  491  QWYVLSKTLAEEAAWNFSKENGIDMVTINPGWVIGPLLQPTLNLSAEQVLNLINGAQTF-  549

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLV  460
             +  + +VDVRDVANAHI+A+E+P ASGRYCLV
Sbjct  550  PNISSWWVDVRDVANAHIQAYEIPEASGRYCLV  582



>ref|XP_006345417.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Solanum tuberosum]
Length=330

 Score =   263 bits (671),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 167/222 (75%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAV+GTLNVL SC ++PSV+RVV+TSSTAS++   N      V DE W+SD EF E+ K
Sbjct  101  EPAVEGTLNVLRSCAKSPSVRRVVITSSTASMICNQNRYIPGAVADETWYSDPEFCEKRK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY LSK  AEEAAW++A +N ID+++LHP LVIGP LQP LNFSSE +L+ I +G+E  
Sbjct  161  QWYNLSKTLAEEAAWEFAKQNGIDLITLHPVLVIGPFLQPSLNFSSEAMLNFITQGKEAW  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKY-  538
            S     +VDVRDVANAHI AFEVPSA+GRY LVG    +S +LKI+ + YPS+ IP  + 
Sbjct  221  SDGVYKFVDVRDVANAHILAFEVPSANGRYSLVGANGYSSSLLKILQKFYPSITIPGNFE  280

Query  539  KGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
            +  LP+ PTF++S ++AK++G+ FT LE+S+KDT+ESL  KN
Sbjct  281  ENGLPLTPTFQISGERAKTIGVKFTRLELSVKDTVESLIHKN  322



>ref|XP_006446146.1| hypothetical protein CICLE_v10015912mg [Citrus clementina]
 ref|XP_006470636.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Citrus sinensis]
 gb|ESR59386.1| hypothetical protein CICLE_v10015912mg [Citrus clementina]
 gb|KDO61219.1| hypothetical protein CISIN_1g020326mg [Citrus sinensis]
Length=327

 Score =   262 bits (670),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGT+NVL SC + PS+KRVV+TSS A+V Y   P +   V+DE WFSD E  +++K
Sbjct  104  DPAVKGTVNVLNSCAKFPSIKRVVLTSSMAAVAYNGKPRTPDVVVDETWFSDPEVCKQSK  163

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+A E  IDMV+++PA+VIGPLLQP LN S+  +L  IK  + + 
Sbjct  164  LWYVLSKTLAEDAAWKFAKEKSIDMVTINPAMVIGPLLQPTLNTSAAAVLSLIKGAQTYP  223

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++    +V+V+DVANAHI+AFEVPSASGRYCLV   +  S+++  V +LYP+  +PEK  
Sbjct  224  NATLG-WVNVKDVANAHIQAFEVPSASGRYCLVERVLHYSKLVNTVHELYPTFELPEKCA  282

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PT++VS++KAK+LGI F PLEVSLK+TIESLKEK 
Sbjct  283  DDKPYVPTYQVSKEKAKNLGIEFIPLEVSLKETIESLKEKG  323



>emb|CAN71341.1| hypothetical protein VITISV_002438 [Vitis vinifera]
Length=327

 Score =   262 bits (670),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 163/221 (74%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAV GTLNVL SC + PS++RVVVTSS  + ++    ++   ++DE WFSD  F EE+K
Sbjct  103  DPAVNGTLNVLRSCTKVPSIRRVVVTSSIVATIFNGKTLTPDVIVDETWFSDPAFCEESK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAWK+A EN ID+V+++P  VIGP LQP +N + E+IL+ I  G +  
Sbjct  163  LWYVLSKTLAEEAAWKFAKENGIDLVTMNPGFVIGPFLQPTINLTMEIILNLINGGAQTF  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
             S    +VDVRDVANAH++AFE+ SASGRYCLV      SE +KI+ +L+P+L +P+K  
Sbjct  223  PSSTYRWVDVRDVANAHVQAFEISSASGRYCLVERVTYCSEAIKILQELFPALYLPQKNA  282

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P MPT+++S++K KSL I+F PLEVSLKDT+E+LKEKN
Sbjct  283  DDEPPMPTYQISKEKVKSLAIDFIPLEVSLKDTMENLKEKN  323



>ref|XP_008363357.1| PREDICTED: cinnamoyl-CoA reductase 1 [Malus domestica]
Length=325

 Score =   262 bits (669),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 169/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNVL SC ++PS+KRVV+TSS A+V Y   P +   VIDE WF+D +  +E+K
Sbjct  102  EPAVKGTLNVLNSCAKSPSIKRVVLTSSIAAVAYNGKPRTPDVVIDETWFTDPDVCKESK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+  E  ID+V+++PA+VIGPLLQP LN S+  +L+ IK  R F 
Sbjct  162  LWYVLSKTLAEDAAWKFVKEKGIDLVTINPAMVIGPLLQPTLNTSAAAVLNVIKGARTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +++V+DVANAHI+AFE P+ASGRYCLV      SEV++I+ +L+P+L +PEK  
Sbjct  222  NASFG-WINVKDVANAHIQAFESPTASGRYCLVETVAHFSEVVRILRELHPTLQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PT++VS++KAK LG+ F PL+VSLK+T+ESLKEK 
Sbjct  281  DDKPFVPTYQVSKEKAKXLGVEFIPLDVSLKETVESLKEKG  321



>ref|XP_008354172.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Malus domestica]
Length=287

 Score =   260 bits (665),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 163/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SCV+ P+VKRV++TSS A+VM    P++   VIDE W+SD+   E+ K
Sbjct  64   DPAVKGTLNVLKSCVKFPTVKRVILTSSMAAVMVNGRPLNPDVVIDETWYSDQAICEQLK  123

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            +WY LSK  AEEAAWK++ EN ID+V+++P+ VIGPLLQP LN S EMIL+ +K G    
Sbjct  124  EWYFLSKTLAEEAAWKFSKENGIDLVTINPSYVIGPLLQPTLNLSVEMILN-LKNGTLPQ  182

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
               F+   DVRDVA AH++AFEVPSASGRYC VG     S+ L I+ +L+P+   PEK  
Sbjct  183  PDYFSLSCDVRDVAFAHVQAFEVPSASGRYCFVGHVTPMSKALSILHELHPTFFPPEKXD  242

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P  P +++S++KAKSLG+NF PLEVSL+DTIESLKEK 
Sbjct  243  DDKPCEPGYQISKEKAKSLGVNFLPLEVSLRDTIESLKEKG  283



>ref|XP_011090120.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Sesamum indicum]
Length=328

 Score =   261 bits (668),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 168/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC +TPS+KRVV+TSS A+V Y   P +   V+DE+W+S+ E  +E +
Sbjct  101  DPALKGTLNVLASCAKTPSIKRVVLTSSVAAVAYNGKPRTPEVVVDESWWSNPELCKEMQ  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY+LSK  AE+AAWK+  E  IDMV+++PA+VIGPLLQP LN S   IL+ I  G  + 
Sbjct  161  QWYVLSKTLAEDAAWKFVKEKGIDMVTINPAMVIGPLLQPTLNTSCAAILNLINGGETYP  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +S F  +++V+DVANAHI AFE PSA+GRYCLV +    SEV+KI+ +LYPSL +PEK  
Sbjct  221  NSTFG-WINVKDVANAHILAFENPSANGRYCLVEKVAHFSEVVKILRELYPSLKLPEKCG  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PT++VS++KAK+LG+ FT LE  +K+T+ESLKEKN
Sbjct  280  DDKPFVPTYQVSKEKAKALGVVFTSLEEGIKETVESLKEKN  320



>ref|XP_007015092.1| Cinnamyl alcohol dehydrogenase, 82967-79323, putative isoform 
2 [Theobroma cacao]
 gb|EOY32711.1| Cinnamyl alcohol dehydrogenase, 82967-79323, putative isoform 
2 [Theobroma cacao]
Length=323

 Score =   261 bits (668),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 168/221 (76%), Gaps = 3/221 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +T SVKRVV+TSS A+V Y   P +   V+DE WF+D ++ +  K
Sbjct  102  DPAVKGTLNVLNSCAKTSSVKRVVLTSSMAAVAYNGKPRTPDVVVDETWFTDPDYCKGLK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY++SK  AE+AAWK+A E  IDMV+++PA+VIGPLLQP LN S+  +L  IKE   F 
Sbjct  162  LWYVVSKTMAEDAAWKFAKEKGIDMVAINPAMVIGPLLQPTLNTSAAAVLSLIKE--TFP  219

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI+AFE+PSASGRYCLV      SE++K++ +LYPS  +PEK  
Sbjct  220  NATFG-WVNVKDVANAHIQAFEIPSASGRYCLVERVAHYSEIVKVLQELYPSFQLPEKCA  278

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PT++VS++KAK LGI+F PL+VSLK+T+ESLKEK 
Sbjct  279  DDKPYVPTYQVSKEKAKCLGIDFIPLDVSLKETVESLKEKG  319



>ref|XP_011088010.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Sesamum 
indicum]
Length=321

 Score =   261 bits (667),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 127/220 (58%), Positives = 160/220 (73%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGT+NVL SC +  S+KR+VVTSS  SVM+  NP++   ++DE WF+DK F +E  
Sbjct  98   DPAVKGTINVLESCKKVSSIKRIVVTSSMTSVMFNYNPVTPDVIVDETWFADKIFCQEKN  157

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY LSK  AE+A W++  EN +D+V+LHP  VIGPLLQP LN +SE  L+ I  G+EF 
Sbjct  158  QWYALSKTLAEKATWEFVEENSLDLVTLHPGYVIGPLLQPTLNLTSEAFLNLIN-GKEFF  216

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +     +VDVRDVA AHI AFE PSASGRYCLVG    +SEV  I+S  +PSL +  K  
Sbjct  217  ADGIYRFVDVRDVALAHILAFENPSASGRYCLVGRVTYSSEVRAILSDSFPSLNLHAKST  276

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             +LP  P ++VS+++AKSLGI FTPLEVSLKDT+E LKEK
Sbjct  277  ENLPARPAYQVSKERAKSLGIKFTPLEVSLKDTVECLKEK  316



>ref|XP_011025485.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Populus 
euphratica]
Length=328

 Score =   261 bits (667),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 129/224 (58%), Positives = 162/224 (72%), Gaps = 3/224 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNVL SC + PSVKRV++TSS ASV +   P++   V+DE WFSD  F    K
Sbjct  101  EPAVKGTLNVLKSCAKFPSVKRVILTSSMASVAFNGKPLTPDVVVDETWFSDSAFCVSNK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREF-  358
             WY+ SK  AEEAAWK+A E  IDMV++HP  VIGPLLQP LN S+EM LD I  G +  
Sbjct  161  LWYMASKTLAEEAAWKFAKEKGIDMVTIHPGFVIGPLLQPTLNSSAEMFLDHINGGAQGA  220

Query  359  --MSSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPE  532
              + S    +VDVRDVA AHI+A E+PSASGRYCLVG     S+ +KI  +LYP+LP+PE
Sbjct  221  PRLPSEIYRFVDVRDVAYAHIQALEIPSASGRYCLVGRVKHFSDAVKIAHELYPTLPLPE  280

Query  533  KYKGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
            K   + P    ++VS++KAK+LG++FTPLEVS+KDT+ESLKEK 
Sbjct  281  KCADENPSPLNYEVSKEKAKTLGLDFTPLEVSVKDTLESLKEKG  324



>ref|XP_008231475.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Prunus 
mume]
Length=326

 Score =   261 bits (667),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 171/223 (77%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SCV+  +VKRVV+TSSTA+V+    P++   V+DE WFSD    E  K
Sbjct  101  DPAVKGTLNVLKSCVKFATVKRVVLTSSTAAVIVNGRPLTPNVVVDETWFSDPLVCENLK  160

Query  182  --QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGRE  355
              +WY+LSK  AEEAAWK+A  N ID+V+++P+ VIGPLLQP LN + EMIL+   +  +
Sbjct  161  IAKWYVLSKTLAEEAAWKFAEGNGIDLVTINPSYVIGPLLQPSLNLTVEMILNFKNDIED  220

Query  356  FMSSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEK  535
              SS ++C  DVRDVA+AH++AFEVPSA+GRYCLVG  +  ++VLKI+ +L+PSL  P+K
Sbjct  221  VNSSIYSCS-DVRDVASAHVQAFEVPSANGRYCLVGHVIPMAKVLKILHELHPSLCPPQK  279

Query  536  YKGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
            Y+   P  PT++VSQ+KAKSLG+NF PLEVSL+DT+ESLKEK 
Sbjct  280  YEEANPSEPTYQVSQEKAKSLGVNFLPLEVSLRDTVESLKEKG  322



>ref|XP_008231479.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Prunus mume]
Length=322

 Score =   261 bits (666),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 164/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC + PS+K+VV+TSS A+V +   P++   +IDE+WFSD    E+ K
Sbjct  101  DPALKGTLNVLRSCAKVPSIKKVVITSSMAAVAFNGKPLAPDVIIDESWFSDLAVCEKLK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY++SK  AEEAAWK+  EN IDMV+++P LVIGPLLQP LN S E +L  +     F 
Sbjct  161  LWYMISKTLAEEAAWKFTKENGIDMVAINPGLVIGPLLQPTLNTSVEPVLKLVNGAETFP  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  +  +VDVRDVANAHI AFE  SASGRYCLVG     SEV+K++  L+P+L IPEK  
Sbjct  221  NITYR-WVDVRDVANAHILAFENASASGRYCLVGRITHCSEVVKLLRDLFPALKIPEKCA  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P  PT++VS+++A++LG+ FTPLEV+L+DT+ESLKEKN
Sbjct  280  DDKPFTPTYQVSKERAQALGVKFTPLEVTLEDTVESLKEKN  320



>gb|AES68255.2| cinnamyl-alcohol dehydrogenase-like protein [Medicago truncatula]
Length=295

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 168/220 (76%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC ++PS+KRVV+TSS A+V Y   P +   V+DE WF+D +F  ++ 
Sbjct  72   DPALKGTLNVLNSCAKSPSLKRVVLTSSIAAVAYNGKPRTPDVVVDETWFTDADFCAKSN  131

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY++SK  AEEAAWK+  EN IDMV+++PA+VIGPLLQP+LN S+  IL+ I   + F 
Sbjct  132  LWYVVSKTLAEEAAWKFVKENNIDMVTINPAMVIGPLLQPVLNTSAAAILNLINGAQTFP  191

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI A+E  SASGR+CLV      SEV++I+ +LYPSL +PEK  
Sbjct  192  NASFG-WVNVKDVANAHILAYENASASGRHCLVERVAHYSEVVRILRELYPSLQLPEKCA  250

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P +P ++VS++KAKSLG+ +TPLEVS+K+T+ESLKEK
Sbjct  251  DDKPYVPIYQVSKEKAKSLGLEYTPLEVSIKETVESLKEK  290



>gb|KHG07124.1| Dihydroflavonol-4-reductase [Gossypium arboreum]
Length=324

 Score =   261 bits (666),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 164/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC + PS+KRVV+TSS A+++Y   P+    V+DE WFSD  F E++K
Sbjct  101  DPAVKGTLNVLRSCAKVPSIKRVVITSSIAAIVYNGRPLGPDVVVDETWFSDPAFCEKSK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAWK+A EN IDMV+++P LVIGPLLQP +N S E IL  I   + F 
Sbjct  161  LWYMLSKTLAEEAAWKFAKENGIDMVTINPGLVIGPLLQPTVNTSVEPILKLINGAKTFP  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F   +DVRDVANAH+ AFE  SA GRY LV   +  SEV++ + +LYP+L +PEK  
Sbjct  221  NATFR-LIDVRDVANAHVLAFENSSACGRYLLVERAVHCSEVVQALRKLYPALSLPEKCA  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             +   +P F+VS+++AKSLG+ FTPLEVSLKDT+ESLKEKN
Sbjct  280  DEKLSVPIFQVSKERAKSLGVKFTPLEVSLKDTVESLKEKN  320



>emb|CDP09262.1| unnamed protein product [Coffea canephora]
Length=324

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVLGSC ++PSVKRVV+TSS A+V +   P +   V+DE W+S  EF ++TK
Sbjct  97   DPALKGTLNVLGSCAKSPSVKRVVLTSSIAAVAFNGKPRTPDVVVDETWWSLPEFCKQTK  156

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+  E  +DMV+++PA+VIGPLLQP LN S+  IL+ I     F 
Sbjct  157  LWYVLSKTLAEDAAWKFVKEKGLDMVTINPAMVIGPLLQPTLNTSAAAILNLINGAETFP  216

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +S    +VDV+DVANAHI AFE PSASGRYCLV   +  SEV+KI+ ++YPS  +PEK  
Sbjct  217  NSSMG-WVDVKDVANAHILAFENPSASGRYCLVERVVHYSEVVKILREIYPSSKLPEKCA  275

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PT++VS++KAKSLG+ F P+E S+K+T+ESLKEKN
Sbjct  276  DDKPFVPTYQVSKEKAKSLGLEFIPVEQSIKETVESLKEKN  316



>ref|XP_008363305.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Malus domestica]
Length=324

 Score =   259 bits (663),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC + PS+KRVV+TSS A+V +   P++   V+DE+WFSD    E++K
Sbjct  103  DPALKGTLNVLRSCAKVPSIKRVVITSSMAAVAFNGKPLAPDVVVDESWFSDVAVCEKSK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY++SK  AEEAAWK+A EN ID+V+++P LVIGPLLQP LN S E +L  +     F 
Sbjct  163  LWYMISKTLAEEAAWKFAKENGIDIVTINPGLVIGPLLQPTLNTSVEPVLKLVNGAERFP  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ +  +VDVRDVA AHI AFE  SASGRYCLVG  +  S+ + I+  L+P+L +PE+  
Sbjct  223  NTTYR-WVDVRDVATAHILAFENASASGRYCLVGRVIHCSDTVNILRDLFPALKLPEECA  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P  PT++VS+++A+SLG+ FTPLEV+LKDT+ESLKEKN
Sbjct  282  DDKPFTPTYQVSKERAQSLGVKFTPLEVTLKDTVESLKEKN  322



>ref|XP_008353752.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Malus domestica]
Length=286

 Score =   258 bits (660),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 164/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SCV+ P+VKRV++TSS A+VM    P++   VIDE W+SD+   E+ K
Sbjct  63   DPAVKGTLNVLKSCVKFPTVKRVILTSSMAAVMVNGRPLNPDVVIDETWYSDQAICEQLK  122

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            +WY LSK  AEEAAWK++ EN ID+V+++P+ VIGPLLQP LN S EMIL+   +    +
Sbjct  123  EWYFLSKTLAEEAAWKFSKENGIDLVTINPSYVIGPLLQPTLNLSVEMILNLKNDIPSII  182

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            SS +    DVRDVA AH++AFEVPSASGRYC VG     S+ L I+ +L+P+   PEK+ 
Sbjct  183  SSNYPSS-DVRDVAFAHVQAFEVPSASGRYCFVGHVTPMSKALSILHELHPTFFPPEKWD  241

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P  P +++S++KAKSLG+NF PLEVSL+DTIESLKEK 
Sbjct  242  DDKPCEPGYQISKEKAKSLGVNFLPLEVSLRDTIESLKEKG  282



>pdb|4QTZ|A Chain A, Crystal Structure Of Cinnamyl-alcohol Dehydrogenase 
2
Length=321

 Score =   259 bits (663),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 168/220 (76%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC ++PS+KRVV+TSS A+V Y   P +   V+DE WF+D +F  ++ 
Sbjct  98   DPALKGTLNVLNSCAKSPSLKRVVLTSSIAAVAYNGKPRTPDVVVDETWFTDADFCAKSN  157

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY++SK  AEEAAWK+  EN IDMV+++PA+VIGPLLQP+LN S+  IL+ I   + F 
Sbjct  158  LWYVVSKTLAEEAAWKFVKENNIDMVTINPAMVIGPLLQPVLNTSAAAILNLINGAQTFP  217

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI A+E  SASGR+CLV      SEV++I+ +LYPSL +PEK  
Sbjct  218  NASFG-WVNVKDVANAHILAYENASASGRHCLVERVAHYSEVVRILRELYPSLQLPEKCA  276

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P +P ++VS++KAKSLG+ +TPLEVS+K+T+ESLKEK
Sbjct  277  DDKPYVPIYQVSKEKAKSLGLEYTPLEVSIKETVESLKEK  316



>ref|XP_008349589.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Malus domestica]
Length=324

 Score =   259 bits (663),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC + PS+KRVV+TSS A+V +   P++   V+DE+WFSD    E++K
Sbjct  103  DPALKGTLNVLRSCAKVPSIKRVVITSSMAAVAFNGKPLAPDVVVDESWFSDVAVCEKSK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY++SK  AEEAAWK+A EN ID+V+++P LVIGPLLQP LN S E +L  +     F 
Sbjct  163  LWYMISKTLAEEAAWKFAKENGIDIVTINPGLVIGPLLQPTLNTSVEPVLKLVNGAERFP  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ +  +VDVRDVA AHI AFE  SASGRYCLVG  +  S+ + I+  L+P+L +PE+  
Sbjct  223  NTTYR-WVDVRDVATAHILAFENASASGRYCLVGRVIHCSDTVNILRDLFPALKLPEECA  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P  PT++VS+++A+SLG+ FTPLEV+LKDT+ESLKEKN
Sbjct  282  DDKPFTPTYQVSKERAQSLGVKFTPLEVTLKDTVESLKEKN  322



>gb|KDP22108.1| hypothetical protein JCGZ_25939 [Jatropha curcas]
Length=409

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC RTPSVKRVV+TSS A+V Y   P +   V+DE WFSD EF +E K
Sbjct  186  DPAVKGTLNVLNSCARTPSVKRVVLTSSIAAVNYNGKPRTPEVVVDETWFSDPEFCKENK  245

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY++SK  AE+AAWK+A E  ID+V+++PA+VIGPLLQP LN S+  +L  +K  + F 
Sbjct  246  LWYVVSKTLAEDAAWKFAKEKDIDLVAINPAMVIGPLLQPTLNTSAAAVLSLMKGVQTFP  305

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI+AFE+PSASGRYCLV      S+V+  + +LYP    PEK  
Sbjct  306  NATFG-WVNVKDVANAHIQAFEIPSASGRYCLVETVAHYSKVVDTLRELYPDFQFPEKCA  364

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PT++VS++KAK LGI+F PL+VS+K+T+ESLKEK 
Sbjct  365  DDKPYVPTYEVSKEKAKRLGIDFIPLKVSIKETVESLKEKG  405



>ref|XP_003598002.1| Dihydroflavonol-4-reductase [Medicago truncatula]
 gb|AES68253.1| cinnamyl-alcohol dehydrogenase-like protein [Medicago truncatula]
Length=326

 Score =   259 bits (663),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 168/220 (76%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC ++PS+KRVV+TSS A+V Y   P +   V+DE WF+D +F  ++ 
Sbjct  103  DPALKGTLNVLNSCAKSPSLKRVVLTSSIAAVAYNGKPRTPDVVVDETWFTDADFCAKSN  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY++SK  AEEAAWK+  EN IDMV+++PA+VIGPLLQP+LN S+  IL+ I   + F 
Sbjct  163  LWYVVSKTLAEEAAWKFVKENNIDMVTINPAMVIGPLLQPVLNTSAAAILNLINGAQTFP  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI A+E  SASGR+CLV      SEV++I+ +LYPSL +PEK  
Sbjct  223  NASFG-WVNVKDVANAHILAYENASASGRHCLVERVAHYSEVVRILRELYPSLQLPEKCA  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P +P ++VS++KAKSLG+ +TPLEVS+K+T+ESLKEK
Sbjct  282  DDKPYVPIYQVSKEKAKSLGLEYTPLEVSIKETVESLKEK  321



>ref|XP_010102363.1| hypothetical protein L484_015312 [Morus notabilis]
 gb|EXB93324.1| hypothetical protein L484_015312 [Morus notabilis]
Length=328

 Score =   259 bits (663),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC ++ SVKRVV+TSS A+V Y   P +   ++DE WFSD +  +E K
Sbjct  105  DPAVKGTLNVLNSCAKSSSVKRVVLTSSIAAVSYNGKPRTPDVIVDETWFSDPDICKELK  164

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY+LSK  AE+AAWK+  E  ID+V+++PA+VIGPLLQP LN S+  IL+ I   + F+
Sbjct  165  QWYVLSKTLAEDAAWKFVKEKGIDLVTMNPAMVIGPLLQPTLNTSAAAILNLINGAQTFL  224

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +     +V+V+DVANAHI A+EVPSASGRYCLV      SE+++++ +LYPSLP+PEK  
Sbjct  225  NFTLG-WVNVKDVANAHILAYEVPSASGRYCLVESVAHYSEIVRLLRELYPSLPLPEKCA  283

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D   MPT++VS++KA SLGI+F PL+  LK+T+ESLKEK 
Sbjct  284  DDKLFMPTYQVSKEKATSLGIDFIPLKTGLKETVESLKEKQ  324



>ref|XP_008375272.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Malus domestica]
Length=234

 Score =   256 bits (654),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 165/223 (74%), Gaps = 4/223 (2%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SCV+ P+VKRV++TSS A+VM    P++   VIDE W+SD+   E+ K
Sbjct  10   DPAVKGTLNVLKSCVKFPTVKRVILTSSMAAVMVNGRPLNPDVVIDETWYSDQAICEQLK  69

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGR--E  355
            +WY LSK  AEEAAWK++ EN ID+V+++P+ VIGPLLQP LN S EMIL+ +K G    
Sbjct  70   EWYFLSKTLAEEAAWKFSKENGIDLVTINPSYVIGPLLQPTLNLSVEMILN-LKNGHIPS  128

Query  356  FMSSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEK  535
             +SS +    DVRDVA AH++AFEVPSASGRYC VG     S+ L I+ +L+P+   PEK
Sbjct  129  IISSNYPSS-DVRDVAFAHVQAFEVPSASGRYCFVGHVTPMSKALSILHELHPTFFPPEK  187

Query  536  YKGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
               D P  P +++S++KAKSLG+NF PLEVSL+DTIESLKEK 
Sbjct  188  XDDDKPCEPGYQISKEKAKSLGVNFLPLEVSLRDTIESLKEKG  230



>ref|XP_009354349.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Pyrus x bretschneideri]
Length=320

 Score =   259 bits (661),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 163/221 (74%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC + PS+KRVV+TSS ASVM    P+++  V+DE W+SD  F E+ K
Sbjct  102  DPAVKGTLNVLQSCAKFPSIKRVVLTSSIASVMMTGVPLTSDAVLDETWYSDPLFCEKHK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY+LSK  AEE AWK+A  N ID+VSL+P L IGPLLQP LNFS E++ + +   +  +
Sbjct  162  QWYLLSKTLAEETAWKFAKGNGIDLVSLNPGLTIGPLLQPTLNFSVELLQNFMSGTQTTI  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            S+PF   VDVRDVA+AHI+AFE+PSASGRYCLVG+     ++LKI+ QLYP+L + E   
Sbjct  222  SNPF---VDVRDVASAHIQAFEIPSASGRYCLVGQVADDLDILKILRQLYPTLTLAEVVN  278

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
               P    ++VS++KAK LGI F PLE SL+DTIESLKEK 
Sbjct  279  ---PSDSKYQVSKEKAKGLGITFLPLETSLRDTIESLKEKG  316



>ref|NP_197445.1| alcohol dehydrogenase-like protein [Arabidopsis thaliana]
 gb|ABD59060.1| At5g19440 [Arabidopsis thaliana]
 gb|AED92707.1| alcohol dehydrogenase-like protein [Arabidopsis thaliana]
Length=326

 Score =   259 bits (661),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +  SVKRVVVTSS A+V Y   P +    +DE WFSD E  E +K
Sbjct  103  DPAVKGTLNVLNSCAKASSVKRVVVTSSMAAVGYNGKPRTPDVTVDETWFSDPELCEASK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK A E  +D+V+++PA+VIGPLLQP LN S+  IL+ I   + F 
Sbjct  163  MWYVLSKTLAEDAAWKLAKEKGLDIVTINPAMVIGPLLQPTLNTSAAAILNLINGAKTFP  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  F  +V+V+DVANAHI+AFEVPSA+GRYCLV   +  SE++ I+ +LYP+LP+PE+  
Sbjct  223  NLSFG-WVNVKDVANAHIQAFEVPSANGRYCLVERVVHHSEIVNILRELYPNLPLPERCV  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + P +PT++VS+DK +SLGI++ PL+VS+K+T+ESLKEK 
Sbjct  282  DENPYVPTYQVSKDKTRSLGIDYIPLKVSIKETVESLKEKG  322



>ref|XP_011080358.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Sesamum indicum]
Length=324

 Score =   258 bits (660),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 168/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVLGSC +TPS++RVV+TSS  +V +   P +   V+DE W+SD E  ++ +
Sbjct  97   DPALKGTLNVLGSCAKTPSIQRVVLTSSIVAVFFNGKPRTPEVVVDETWWSDPELCKQMQ  156

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY+LSK  AE+AAWK+A E  IDMVS++P++VIGPLLQP LN SS  IL+ I   + + 
Sbjct  157  QWYMLSKTLAEDAAWKFAKEKGIDMVSINPSMVIGPLLQPTLNTSSASILNLINGAKTYP  216

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++    +V+V+DVANAHI AFE PSA+GRYC+V      S+V+KI+ +LYP+L +PEK  
Sbjct  217  NATAG-WVNVKDVANAHILAFENPSANGRYCVVESVAHYSQVVKILHELYPNLQLPEKCA  275

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P MPT++VS+++AK LG+ FTPL+ SLK+T+ESLKEKN
Sbjct  276  DDKPFMPTYQVSKERAKGLGVEFTPLKESLKETVESLKEKN  316



>gb|ADO51749.1| cinnamyl alcohol dehydrogenase [Camellia sinensis]
Length=324

 Score =   258 bits (660),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 165/220 (75%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVLGSC + PSVKRVV+TSS A+V +   P +   V+DE+WFSD EF ++ K
Sbjct  101  DPALKGTLNVLGSCAKNPSVKRVVLTSSVAAVAFNGRPRAPDVVVDESWFSDPEFCKQNK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+     IDMV+++PA+V+GPLLQP LN S+  IL+ I   + F 
Sbjct  161  LWYVLSKTLAEDAAWKFTKGKGIDMVTINPAMVVGPLLQPTLNTSAAAILNVINGSQTFP  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +S F  +V+V+DVANAHI+AFE+PSA+GRYCLV      SEV+KI+ +L+P+  +PEK  
Sbjct  221  NSTFG-WVNVKDVANAHIQAFEIPSANGRYCLVESVAHYSEVVKILQELFPAFQLPEKCA  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P  PT++VS+++ KSLGI F PL+ S+K+T+ESL EK
Sbjct  280  DDKPFTPTYQVSKERTKSLGIEFIPLKQSIKETVESLMEK  319



>ref|XP_007219627.1| hypothetical protein PRUPE_ppa024869mg, partial [Prunus persica]
 gb|EMJ20826.1| hypothetical protein PRUPE_ppa024869mg, partial [Prunus persica]
Length=284

 Score =   257 bits (656),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SCV+  +VKRVV+TSS A+V++   P++   VIDE WFSD    E  K
Sbjct  61   DPAVKGTLNVLKSCVKFATVKRVVLTSSMAAVIFNGRPLTPDVVIDETWFSDPLVCENLK  120

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            +WY LSK  AEEAAWK+A  N ID+V+++P+ VIGPLLQP LN + EM+L+   +  +  
Sbjct  121  EWYFLSKTLAEEAAWKFAKGNGIDLVTINPSYVIGPLLQPSLNATVEMVLNLKNDIPDVT  180

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
             S +    DVRDVA+AH++AFEVPSA+GRYCLVG  +  S+ LKI+ +L+P+L  PEKY+
Sbjct  181  RSNY-LSTDVRDVASAHVQAFEVPSATGRYCLVGHVIPMSKALKILHELHPTLFPPEKYE  239

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
               P  PT++VSQ+KAKSLG+NF P+EVSL+DTIESLKEK 
Sbjct  240  DGNPSEPTYQVSQEKAKSLGVNFLPVEVSLRDTIESLKEKG  280



>gb|KHM99527.1| Dihydroflavonol-4-reductase [Glycine soja]
Length=290

 Score =   257 bits (656),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 165/220 (75%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SCV  P+++RVV+TSS A+V Y   P +   V+DE WFSD +F  E++
Sbjct  67   DPALKGTLNVLKSCVNLPTLERVVLTSSVAAVAYNGKPRTPDVVVDETWFSDPDFCRESQ  126

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AE+AAWK+  EN IDMV+++PA+VIGPLLQP+LN S+  IL+ I   + F 
Sbjct  127  MWYTLSKTLAEDAAWKFVKENNIDMVTINPAMVIGPLLQPVLNTSAASILNIINGAQTFP  186

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI A+E  SA+GRYCLV      SE++KI+  LYP+L  PEK  
Sbjct  187  NASFG-WVNVKDVANAHILAYENASANGRYCLVERVAHHSELVKILRDLYPTLQHPEKCA  245

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P +P ++VS++KAKSLGI +TPLEVSLK+T+ESLKEK
Sbjct  246  DDKPYVPIYQVSKEKAKSLGIEYTPLEVSLKETVESLKEK  285



>emb|CDY14000.1| BnaC09g38260D [Brassica napus]
Length=326

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +  SVKRVVVTSS A+V Y   P++    +DE WFSD E  + +K
Sbjct  103  DPAVKGTLNVLNSCTKASSVKRVVVTSSMAAVAYNGKPLTPDVTVDETWFSDPEVCKTSK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+A E  +D+V+++PA+VIGPLLQP LN S+  IL+ I   + F 
Sbjct  163  MWYVLSKTLAEDAAWKFAKEKGLDIVTINPAMVIGPLLQPTLNTSAAAILNFINGAKTFS  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +S F  +V V+DVANAHI+A+E+PSA+GRYC+V   +  SE++ I+ QLYP+L +PE   
Sbjct  223  NSTFG-WVSVKDVANAHIQAYEIPSANGRYCMVERVLHHSEIVNILRQLYPNLQLPESCA  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + P +PT++VS++K KSLGI++ PLEVS+K+T+ESLKEK 
Sbjct  282  DENPYVPTYQVSKEKIKSLGIDYIPLEVSIKETVESLKEKG  322



>ref|XP_002513513.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
 gb|EEF48916.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
Length=402

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 164/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +TPSVKRVV+TSS A+V Y   P +   V+DE WFSD +F  E+K
Sbjct  179  DPAVKGTLNVLNSCAKTPSVKRVVLTSSIAAVAYNGKPRTPEVVVDETWFSDPDFCRESK  238

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY++SK  AE+AAWK+A E  +D+V+++PA+V+GPLLQP LN S+  +L  +K    F 
Sbjct  239  LWYVVSKTLAEDAAWKFAKEKGLDLVAINPAMVVGPLLQPTLNTSAAAVLSLLKGANTFP  298

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI+AFE+PSASGR+CLV      SEV+ I  +LYP    PEK  
Sbjct  299  NASFG-WVNVKDVANAHIQAFEIPSASGRHCLVERVAHYSEVVNITRELYPDFQFPEKCA  357

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + P +PT++VS++KAK LGI+F PL VSLK+T+ESLKEK 
Sbjct  358  DEKPYVPTYQVSKEKAKGLGIDFIPLNVSLKETVESLKEKG  398



>ref|XP_011025486.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X3 [Populus 
euphratica]
Length=326

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 161/221 (73%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNVL SC + PSVKRV++TSS ASV++   P++   V+DE WFSD  F    K
Sbjct  102  EPAVKGTLNVLKSCAKFPSVKRVILTSSMASVVFNGKPLTPDVVVDETWFSDSAFCVSNK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+ SK  AEEAAWK+A E  IDMV+++P  VIGPLLQP L  ++E+ LD I  G   +
Sbjct  162  LWYMASKTLAEEAAWKFAKEKGIDMVTINPGFVIGPLLQPTLKSTAELFLDHINGGAPRL  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
             S    +VDVRDVA AHI+A E+PSASGRYCLVG     S+ +KI  +LYP+LP+PEK  
Sbjct  222  PSEIYRFVDVRDVAYAHIQALEIPSASGRYCLVGRVKHFSDAVKIAHELYPTLPLPEKCA  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + P    ++VS++KAK+LG++FTPLEVS+KDT+ESLKEK 
Sbjct  282  DENPSPLNYEVSKEKAKTLGLDFTPLEVSVKDTLESLKEKG  322



>pdb|4QUK|A Chain A, Crystal Structure Of Cinnamyl-alcohol Dehydrogenase 
2 Mutant K169a
Length=319

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 167/220 (76%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC ++PS+KRVV+TSS A+V Y   P +   V+DE WF+D +F  ++ 
Sbjct  96   DPALKGTLNVLNSCAKSPSLKRVVLTSSIAAVAYNGKPRTPDVVVDETWFTDADFCAKSN  155

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY++S   AEEAAWK+  EN IDMV+++PA+VIGPLLQP+LN S+  IL+ I   + F 
Sbjct  156  LWYVVSATLAEEAAWKFVKENNIDMVTINPAMVIGPLLQPVLNTSAAAILNLINGAQTFP  215

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI A+E  SASGR+CLV      SEV++I+ +LYPSL +PEK  
Sbjct  216  NASFG-WVNVKDVANAHILAYENASASGRHCLVERVAHYSEVVRILRELYPSLQLPEKCA  274

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P +P ++VS++KAKSLG+ +TPLEVS+K+T+ESLKEK
Sbjct  275  DDKPYVPIYQVSKEKAKSLGLEYTPLEVSIKETVESLKEK  314



>ref|XP_011080432.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Sesamum indicum]
Length=332

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/221 (54%), Positives = 169/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVLGSC +TPSVKRVV+TSS A+++    P +   V+DE W+SD EF ++T+
Sbjct  97   DPALKGTLNVLGSCAKTPSVKRVVLTSSIAAILANGKPRTPELVLDETWWSDPEFCKQTQ  156

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY+LSK  AE+AAWK+  E  +DMV+++P++VIGPLLQP LN SS  IL+ +   + + 
Sbjct  157  QWYLLSKTLAEDAAWKFVKEKGMDMVAINPSMVIGPLLQPTLNTSSAAILNLMNGAKTYP  216

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ +  +V+V+DVANAHI AFE P+A+GRYC+       S+V+KI+ +LYP+  +PEK  
Sbjct  217  NAAYG-WVNVKDVANAHILAFENPTANGRYCMTNRVAHFSQVVKILRELYPTFQLPEKCA  275

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P+ PTF+VS+++AKSLG+ FTPLE ++K+T+ESL EKN
Sbjct  276  DDNPLAPTFQVSKERAKSLGVEFTPLEETIKETVESLMEKN  316



>gb|AIC85610.1| cinnamyl alcohol dehydrogenase, partial [Rosa roxburghii]
Length=245

 Score =   255 bits (651),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 163/215 (76%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC ++PS+KRVV+TSS A+V Y   P +   V+DE WF+D +  +E+K
Sbjct  32   DPAVKGTLNVLNSCSKSPSIKRVVLTSSIAAVAYNGKPRTPDVVVDETWFTDPDVRKESK  91

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+  E  IDMV+++PA+VIGPLLQP LN  +  IL+ IK  + + 
Sbjct  92   LWYVLSKTLAEDAAWKFVKEKGIDMVTINPAMVIGPLLQPTLNTGAAAILNIIKGAQTYP  151

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +++V+DVANAH++AFE+PSASGRYCLV      +EVL+I+ +LYP L +PEK  
Sbjct  152  NASFG-WINVKDVANAHVQAFEIPSASGRYCLVERVAHFNEVLQIIHELYPDLQLPEKCS  210

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIE  646
             D P +PT+ VS++KAKSLGI F PL++SLK+T+E
Sbjct  211  DDKPFVPTYHVSKEKAKSLGIEFIPLDISLKETVE  245



>ref|XP_007131546.1| hypothetical protein PHAVU_011G022300g [Phaseolus vulgaris]
 gb|ESW03540.1| hypothetical protein PHAVU_011G022300g [Phaseolus vulgaris]
Length=324

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 164/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAV GTLNVL SCV++ SVKRVV+TSS A+V Y   P S   V+DE WFS+ ++  E K
Sbjct  101  DPAVNGTLNVLKSCVKSSSVKRVVLTSSVAAVAYNERPKSPEVVVDETWFSNPDYCRELK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK++ EN +D+VS++PA+V+GPLLQ  LN S+  IL+ +     F 
Sbjct  161  MWYLLSKTLAEDAAWKFSKENNLDLVSVNPAMVVGPLLQAELNTSASTILNLVNGSETFP  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  +  +++V+DVANAHI+A+E+ SASGRYCLV      SEV KI+  LYP+  IPEK  
Sbjct  221  NDTYG-WINVKDVANAHIQAYEIASASGRYCLVERVAHFSEVAKILHDLYPTYQIPEKSA  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PTF+VS++KAKSLG+ F PLEVSLK+T+ESLKEKN
Sbjct  280  DDKPYVPTFQVSKEKAKSLGVEFIPLEVSLKETVESLKEKN  320



>ref|XP_009120886.1| PREDICTED: cinnamoyl-CoA reductase 1 isoform X1 [Brassica rapa]
Length=330

 Score =   258 bits (658),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 166/220 (75%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +  SVKRVVVTSS A+V Y   P +    +DE WFSD E  + +K
Sbjct  103  DPAVKGTLNVLNSCTKASSVKRVVVTSSMAAVAYNGKPRTPDVTVDETWFSDPEVCKTSK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+A E  +D+V+++PA+VIGPLLQP LN S+  IL+ I   + F 
Sbjct  163  MWYVLSKTLAEDAAWKFAKEKDLDIVTINPAMVIGPLLQPTLNTSAAAILNFINGAKTFS  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +S F  +V+V+DVANAHI+A+EVPSA+GRYC+V   +  SE++ I+ QLYP+L +PE   
Sbjct  223  NSTFG-WVNVKDVANAHIQAYEVPSANGRYCMVERVLHHSEIVNILRQLYPNLQLPESCA  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             + P +PT++VS++K KS+GI++ PLEVS+K+T+ESLKEK
Sbjct  282  DENPFVPTYQVSKEKIKSIGIDYIPLEVSIKETVESLKEK  321



>ref|XP_010908347.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Elaeis 
guineensis]
Length=324

 Score =   257 bits (657),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 168/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNV  SC++TPSVKR+VVTSS A+V+    P++   V+DE WFS+ E+ ++ K
Sbjct  101  DPAVKGTLNVFSSCIKTPSVKRLVVTSSMAAVIRNGRPLTPDVVVDETWFSNAEYCKQAK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            +WY+LSK  AEEAAWK++ +N IDMV+++PA+VIGPLLQP LN S+  IL+ I     + 
Sbjct  161  KWYVLSKTLAEEAAWKFSKDNSIDMVTINPAMVIGPLLQPTLNTSAAAILNLINGSSTYP  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVA AHI AFEVPSASGRYCLV      +E++KI+ + YP+L +PEK  
Sbjct  221  NASF-VWVNVKDVAIAHILAFEVPSASGRYCLVERVAHYAELVKILHEQYPALKLPEKCA  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +P ++VS++K KSLGI++ PLE S+K+T+ESL+EK 
Sbjct  280  DDKPFVPIYQVSKEKVKSLGIDYIPLETSIKETVESLREKG  320



>gb|AFU90744.1| cinnamyl alcohol dehydrogenase [Punica granatum]
Length=326

 Score =   257 bits (657),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 163/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC +  S++RVV+TSS A+V Y   P +   V+DE WFS  EF  E K
Sbjct  103  DPALKGTLNVLKSCAKVSSIQRVVLTSSVAAVAYNGKPRTPDVVVDETWFSSPEFCRENK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+  E  IDMV+++PA+VIGPLLQP LN S+  IL+ I     F 
Sbjct  163  MWYVLSKTLAEDAAWKFVKEKGIDMVAINPAMVIGPLLQPTLNTSAAAILNIINGAETFP  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAH++AFE+PSASGR+CLV      SEV+KI+ +LYP + +PEK  
Sbjct  223  NASFG-WVNVKDVANAHVQAFEIPSASGRHCLVERVAHYSEVVKILRELYPQIKLPEKCA  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PT++VS++KAKSLGI++ PLE  +K+T+ESLKEK 
Sbjct  282  DDKPFVPTYQVSKEKAKSLGIDYIPLEQGIKETVESLKEKG  322



>gb|KDP43569.1| hypothetical protein JCGZ_16856 [Jatropha curcas]
Length=324

 Score =   257 bits (657),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC +  S+KRVV+TSS A+V +   P++   ++DE WFSD +F E++K
Sbjct  101  DPALKGTLNVLRSCTKVSSIKRVVITSSMAAVAFNGKPLAPDVIVDETWFSDPDFCEKSK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAWK+  EN +DMV+++P LVIGPLLQP LN S+E +L  I    ++ 
Sbjct  161  LWYMLSKTLAEEAAWKFTKENGMDMVTINPGLVIGPLLQPTLNTSAESVLKLINGAEKYP  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ +  +VDVRDVANAHI AFE PSASGRYCLVG  + +SE +KI+ +LYP   +P++  
Sbjct  221  NTTYR-WVDVRDVANAHICAFENPSASGRYCLVGTVIHSSEAMKILHKLYPDNNLPKECT  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P    ++VS+++A+SLG+ FTPL+VSLK+T+ESLKEKN
Sbjct  280  DDKPPATKYQVSKERAESLGVKFTPLDVSLKETVESLKEKN  320



>ref|XP_007149029.1| hypothetical protein PHAVU_005G034500g [Phaseolus vulgaris]
 gb|ESW21023.1| hypothetical protein PHAVU_005G034500g [Phaseolus vulgaris]
Length=329

 Score =   257 bits (657),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 165/220 (75%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SCV +P +KRVV+TSS A+V Y   P +   V+DE WFSD +F  E++
Sbjct  102  DPAVKGTLNVLKSCVNSPVLKRVVLTSSIAAVAYNGKPRTPDVVVDETWFSDPDFCRESQ  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AE+AAWK+  EN ID+V+++PA+V+GPLLQP+LN S+  IL+ +   + F 
Sbjct  162  MWYTLSKTLAEDAAWKFVKENNIDLVTINPAMVVGPLLQPVLNTSAASILNVVNGMQTFQ  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI A+E  SA+GRYCLV      S+VLKI+  LYP+L +P+K  
Sbjct  222  NASFG-WVNVKDVANAHILAYENSSANGRYCLVERVAHYSDVLKILRDLYPTLQLPQKCG  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P +P ++VS++KAKSLGI F PLEVSLK+T+ESLKEK
Sbjct  281  DDKPYVPIYQVSKEKAKSLGIEFIPLEVSLKETVESLKEK  320



>ref|XP_010102362.1| hypothetical protein L484_015311 [Morus notabilis]
 gb|EXB93323.1| hypothetical protein L484_015311 [Morus notabilis]
Length=328

 Score =   257 bits (657),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 164/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC ++ SVKRVV+TSS A+V Y   P +   ++DE WFSD +  +E K
Sbjct  105  DPAVKGTLNVLNSCAKSSSVKRVVLTSSIAAVSYNGKPRTPDVIVDETWFSDPDICKELK  164

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY LSK  AE+AAWK+  E  ID+V+++PALVIGPLLQP LN S+  IL+ I   + F+
Sbjct  165  QWYWLSKTLAEDAAWKFVKEKGIDLVTINPALVIGPLLQPTLNTSAAAILNLINGAQTFL  224

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +     +V+V+DVANAHI A+EVPSASGRYCLV      SE+++++ +LYPSLP+PEK  
Sbjct  225  NLTVG-WVNVKDVANAHILAYEVPSASGRYCLVESVAHYSEIVRLLRELYPSLPLPEKCA  283

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D   MPT++VS++KA SLGI+F PL+  LK+T+ESLKEK 
Sbjct  284  DDKLFMPTYQVSKEKATSLGIDFIPLKTGLKETVESLKEKQ  324



>gb|EYU31375.1| hypothetical protein MIMGU_mgv1a010032mg [Erythranthe guttata]
Length=324

 Score =   257 bits (657),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 163/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVLGSC +TPS+KRVV+TSS A+V Y S P +   V+DE W+SD E   E +
Sbjct  97   DPALKGTLNVLGSCAKTPSIKRVVLTSSVAAVAYNSKPRTPEVVVDETWWSDPEICREMQ  156

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY+LSK  AEEAAWK+  E  IDMV+++PA+VIGPLLQP LN SS  IL  I +   + 
Sbjct  157  QWYVLSKTLAEEAAWKFVKEKGIDMVTINPAMVIGPLLQPTLNTSSAAILGLINDAETYP  216

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +S F  +++V+DVANAHI AFE  SASGRYCLV      SE++ ++ +LYP+  +PEK  
Sbjct  217  NSTFG-WINVKDVANAHILAFENTSASGRYCLVESVAHYSEIVNVLRELYPTYQLPEKCA  275

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +P ++VS++KAKSLG+ FT L+  +K+T+ESLKEKN
Sbjct  276  DDKPFVPKYQVSKEKAKSLGVEFTTLKEGIKETVESLKEKN  316



>ref|XP_007218282.1| hypothetical protein PRUPE_ppa008382mg [Prunus persica]
 gb|EMJ19481.1| hypothetical protein PRUPE_ppa008382mg [Prunus persica]
Length=334

 Score =   258 bits (658),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 169/231 (73%), Gaps = 11/231 (5%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SCV+  +VKRVV+TSSTA+V++   P++   V+DE WFSD    E  K
Sbjct  101  DPAVKGTLNVLKSCVKFATVKRVVLTSSTAAVIFNGRPLTPDVVVDETWFSDPFVCENFK  160

Query  182  ----------QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMIL  331
                      +WY+LSK  AEEAAWK+A  N ID+V+++P+ VIGPLLQP LN + EMIL
Sbjct  161  YELLSLLYVQKWYVLSKTLAEEAAWKFAEGNGIDLVTINPSFVIGPLLQPSLNITVEMIL  220

Query  332  DTIKEGREFMSSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLY  511
            +   +  +  SS ++C  DVRDVA AH++AFEVPSA+GRYCLVG     ++VLKI+ +L+
Sbjct  221  NFKNDVEDVNSSIYSCS-DVRDVAAAHVQAFEVPSANGRYCLVGHVTPMAKVLKILHELH  279

Query  512  PSLPIPEKYKGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
            PSL  PEKY+   P  PT++VSQ+KAKSLG+NF PLEVSL DT+ESLKEK 
Sbjct  280  PSLCPPEKYEEANPSEPTYQVSQEKAKSLGVNFLPLEVSLSDTVESLKEKG  330



>gb|AFK47262.1| unknown [Medicago truncatula]
Length=326

 Score =   257 bits (657),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 167/220 (76%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC ++PS+KRVV+TSS A+V Y   P +   V+ E WF+D +F  ++ 
Sbjct  103  DPALKGTLNVLNSCAKSPSLKRVVLTSSIAAVAYNGKPRTPDVVVGETWFTDADFCAKSN  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY++SK  AEEAAWK+  EN IDMV+++PA+VIGPLLQP+LN S+  IL+ I   + F 
Sbjct  163  LWYVVSKTLAEEAAWKFVKENNIDMVTINPAMVIGPLLQPVLNTSAAAILNLINGAQTFP  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI A+E  SASGR+CLV      SEV++I+ +LYPSL +PEK  
Sbjct  223  NASFG-WVNVKDVANAHILAYENASASGRHCLVERVAHYSEVVRILRELYPSLQLPEKCA  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P +P ++VS++KAKSLG+ +TPLEVS+K+T+ESLKEK
Sbjct  282  DDKPYVPIYQVSKEKAKSLGLEYTPLEVSIKETVESLKEK  321



>gb|AAM65984.1| cinnamyl-alcohol dehydrogenase-like protein [Arabidopsis thaliana]
Length=326

 Score =   257 bits (657),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +  SVKRVVVTSS A+V Y   P +    +DE WFSD E  E +K
Sbjct  103  DPAVKGTLNVLNSCAKASSVKRVVVTSSMAAVGYNGKPRTPDVTVDETWFSDPELCEASK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK A E  +D+V+++PA+VIGPLLQP LN S+  IL+ I   + F 
Sbjct  163  MWYVLSKTLAEDAAWKLAKEKGLDIVTINPAMVIGPLLQPTLNTSAAAILNLINGAKTFP  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  F  +V+V+DVANAHI+ FEVPSA+GRYCLV   +  SE++ I+ +LYP+LP+PE+  
Sbjct  223  NLSFG-WVNVKDVANAHIQTFEVPSANGRYCLVERVVHHSEIVNILRELYPNLPLPERCV  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + P +PT++VS+DK +SLGI++ PL+VS+K+T+ESLKEK 
Sbjct  282  DENPYVPTYQVSKDKTRSLGIDYIPLKVSIKETVESLKEKG  322



>emb|CAJ43901.1| cinnamyl alcohol dehydrogenase [Quercus ilex]
Length=325

 Score =   257 bits (656),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 164/220 (75%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNVL SC + PSVKR VVTSS A+V Y     +   V+DE WFSD +  +ETK
Sbjct  102  EPAVKGTLNVLNSCAKFPSVKRXVVTSSMAAVHYNKKAKTPDVVVDETWFSDPDLCKETK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY+LSK  AEE AWK+A E  ID+V+++PA+VIGP LQP LN S+  IL+ I   + F 
Sbjct  162  QWYMLSKTLAEENAWKFAKEKGIDIVTINPAMVIGPXLQPTLNTSAAAILNLINGAQTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  F  +V+V+DVANAHI+A+E+P+ASGRYCLV   +  SEV++++ +LYPSL +PEK  
Sbjct  222  NVSFG-WVNVKDVANAHIQAYEIPTASGRYCLVESVIHQSEVVRVLRKLYPSLQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P  PT++VS+++ +SLGI + P EVSLK+T+ESLKEK
Sbjct  281  DDKPFAPTYQVSKERTRSLGIEYIPFEVSLKETVESLKEK  320



>ref|XP_002314053.2| putative cinnamoyl-CoA reductase family protein [Populus trichocarpa]
 gb|EEE88008.2| putative cinnamoyl-CoA reductase family protein [Populus trichocarpa]
Length=326

 Score =   257 bits (656),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 159/221 (72%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNVL SC + PSVKRV++TSS ASV++   P++   V+DE WFSD  F    K
Sbjct  102  EPAVKGTLNVLKSCAKFPSVKRVILTSSMASVIFNGKPLTPGVVVDETWFSDSAFCVSNK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+ SK  AEEAAWK+  E  IDMV+++P  VIGPLLQP L  ++E+ LD I  G   +
Sbjct  162  LWYMASKTLAEEAAWKFVKEKGIDMVTINPGFVIGPLLQPTLKSTAELFLDRINGGAPGL  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
             S    +VDVRDVA AHI+A E+PSASGRYCLVG     S+ +KI  +LYP+LP+PEK  
Sbjct  222  PSEIYRFVDVRDVAYAHIQALEIPSASGRYCLVGRVAHFSDAVKIAHELYPTLPLPEKCA  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P    ++VS++KAK+LG++FTPLEVS+KD +ESLKEK 
Sbjct  282  DDKPSPLNYEVSKEKAKTLGLDFTPLEVSVKDILESLKEKG  322



>ref|XP_006851072.1| hypothetical protein AMTR_s00025p00240760 [Amborella trichopoda]
 gb|ERN12653.1| hypothetical protein AMTR_s00025p00240760 [Amborella trichopoda]
Length=320

 Score =   256 bits (655),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 162/220 (74%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +T SVKRVV+TSS A+V+Y  NP +   V+DE WFSD  F +E +
Sbjct  99   DPAVKGTLNVLASCSKTSSVKRVVLTSSVAAVVYNRNPRTPDVVVDETWFSDPAFCKEVQ  158

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAW +A E  ID+V+++PA+VIGPLLQP+LN S   ILD +     + 
Sbjct  159  NWYVLSKTLAEEAAWDFAKEKGIDLVTINPAMVIGPLLQPMLNTSCAAILDLVNGSPTYT  218

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  F  +V+V+DVA AHI A+EVPS SGRYCLV   +  SE++K++  LYP  P+P+K  
Sbjct  219  NGTFG-WVNVKDVAEAHILAYEVPSVSGRYCLVERVVHFSELVKLLHDLYPEYPVPQKCV  277

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             + P  P F+VS+ K ++LG+NFTPLEVSLK+T+ESLKEK
Sbjct  278  DENPFPPKFQVSKKKTQTLGVNFTPLEVSLKETVESLKEK  317



>emb|CDX92530.1| BnaA10g15690D [Brassica napus]
Length=330

 Score =   257 bits (656),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +  SVKRVVVTSS A+V Y   P +    +DE WFSD E  + +K
Sbjct  103  DPAVKGTLNVLNSCTKASSVKRVVVTSSMAAVAYNGKPRTPDVTVDETWFSDPEVCKTSK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+A E  +D+V+++PA+VIGPLLQP LN S+  IL+ I   + F 
Sbjct  163  MWYVLSKTLAEDAAWKFAKEKGLDIVTINPAMVIGPLLQPTLNTSAAAILNFINGAKTFS  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +S F  +V+V+DVANAHI+A+E+PSA+GRYC+V   +  SE++ I+ QLYP+L +PE   
Sbjct  223  NSTFG-WVNVKDVANAHIQAYEIPSANGRYCMVERVLHHSEIVNILRQLYPNLQLPESCA  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + P +PT++VS++K KS+GI++ PLEVS+K+T+ESLKEK 
Sbjct  282  DENPFVPTYEVSKEKIKSIGIDYIPLEVSIKETVESLKEKG  322



>ref|XP_008231477.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like, partial 
[Prunus mume]
Length=327

 Score =   256 bits (655),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 162/220 (74%), Gaps = 1/220 (0%)
 Frame = +2

Query  5    PAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETKQ  184
            PAVKGTLNVL SCV+ P+VKRVV+TSS ASV+    P+++  V+DE WFSD    E+ + 
Sbjct  105  PAVKGTLNVLKSCVKFPTVKRVVLTSSMASVLNNGKPLTSDVVVDETWFSDPLVCEDLEA  164

Query  185  WYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFMS  364
            WY LSK  AEEAAWK+A  N ID+V+L+PA VIGPLLQP LN + EM+L+  K+ +E  +
Sbjct  165  WYFLSKTLAEEAAWKFAKGNGIDLVTLNPAYVIGPLLQPTLNATVEMVLNLKKDMQE-AN  223

Query  365  SPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYKG  544
             P     DVRDVA  HI+AFEVPSA+GRYCLVG      E LKI+ QL+P    PEK++ 
Sbjct  224  KPNYISTDVRDVAYTHIQAFEVPSANGRYCLVGHVTPVFEALKILQQLHPIFCPPEKFED  283

Query  545  DLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
              P  PTF+VSQ+KAKSLG++F PLEVSL+DT+ESLKEK 
Sbjct  284  GSPSEPTFQVSQEKAKSLGVSFLPLEVSLRDTVESLKEKG  323



>gb|ACJ85556.1| unknown [Medicago truncatula]
Length=326

 Score =   256 bits (655),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 167/220 (76%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC ++ S+KRVV+TSS A+V Y   P +   V+DE WF+D +F  ++ 
Sbjct  103  DPALKGTLNVLNSCAKSSSLKRVVLTSSIAAVAYNGKPRTPDVVVDETWFTDADFCAKSN  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY++SK  AEEAAWK+  EN IDMV+++PA+VIGPLLQP+LN S+  IL+ I   + F 
Sbjct  163  LWYVVSKTLAEEAAWKFVKENNIDMVTINPAMVIGPLLQPVLNTSAAAILNLINGAQTFP  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI A+E  SASGR+CLV      SEV++I+ +LYPSL +PEK  
Sbjct  223  NASFG-WVNVKDVANAHILAYENASASGRHCLVERVAHYSEVVRILRELYPSLQLPEKCA  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P +P ++VS++KAKSLG+ +TPLEVS+K+T+ESLKEK
Sbjct  282  DDKPYVPIYQVSKEKAKSLGLEYTPLEVSIKETVESLKEK  321



>ref|XP_002871885.1| hypothetical protein ARALYDRAFT_488833 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48144.1| hypothetical protein ARALYDRAFT_488833 [Arabidopsis lyrata subsp. 
lyrata]
Length=326

 Score =   256 bits (655),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +  SVKRVVVTSS A+V Y   P +    +DE WFSD E  E +K
Sbjct  103  DPAVKGTLNVLNSCTKASSVKRVVVTSSMAAVAYNGKPRTPDVTVDETWFSDPELCETSK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+ AWK A E  +D+V+++PA+VIGPLLQP LN S+  +L+ I   + F 
Sbjct  163  MWYVLSKTLAEDTAWKLAKEKGLDIVTINPAMVIGPLLQPTLNTSAAAVLNLINGAKTFP  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +S F  +V+V+DVANAHI+AFEVPSA+GRYCLV   +  SE++ I+ +LYP+LP+PE+  
Sbjct  223  NSSFG-WVNVKDVANAHIQAFEVPSANGRYCLVERVVHHSEIVNILRELYPNLPLPERCV  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + P +PT++VS++K +SLGI++ PL+VS+K+T+ESLKE+ 
Sbjct  282  DENPYVPTYQVSKEKTRSLGIDYIPLKVSIKETVESLKERG  322



>gb|EPS73808.1| alcohol dehydrogenase-like protein, partial [Genlisea aurea]
Length=322

 Score =   256 bits (654),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVLGSCV+ PSVKRVV+TSS A+V Y + P +   V+DE W+SD E   + +
Sbjct  96   DPAVKGTLNVLGSCVKFPSVKRVVLTSSIAAVAYNAKPRTPDVVVDETWWSDPEICRKFE  155

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY+LSK  AE+AAWK+A E  ID+V+++PA+VIGP+LQP LN SS  IL+ I     F 
Sbjct  156  QWYVLSKTLAEDAAWKFAKEKGIDLVTINPAMVIGPMLQPSLNTSSAAILNLINGAETFP  215

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +++V+DVA AHI A+E PSA+GRYCLV +    SE++KI+  LYPSL +PEK  
Sbjct  216  NTTFG-WINVKDVALAHILAYEDPSANGRYCLVEKVAHASEIVKILRDLYPSLKLPEKCA  274

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + P +PT++VS+ KA SLG+ FTPLE  +K+T+ESLKEKN
Sbjct  275  DEKPFVPTYQVSKGKANSLGVEFTPLEQGVKETVESLKEKN  315



>gb|KHN12530.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Glycine soja]
Length=325

 Score =   256 bits (654),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 165/220 (75%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SCV  P+++RVV+TSS A+V Y   P +   V+DE WFSD  F  E++
Sbjct  102  DPALKGTLNVLKSCVNLPTLERVVLTSSVAAVAYNGKPRTPDVVVDETWFSDPGFCRESQ  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AE+AAWK+  EN IDMV+++PA+VIGPLLQP+LN S+  IL+ I   + F 
Sbjct  162  MWYTLSKTLAEDAAWKFVKENNIDMVTINPAMVIGPLLQPVLNTSAASILNVINGAQTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI A+E  SA+GRYCLV      SE++KI+  LYP+L +PEK  
Sbjct  222  NASFG-WVNVKDVANAHILAYENASANGRYCLVERVAHYSEIVKILRDLYPTLQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P +P ++VS+++AKSLGI +TPLEVSLK+T++SLKEK
Sbjct  281  DDNPYVPIYQVSKERAKSLGIEYTPLEVSLKETVDSLKEK  320



>ref|XP_010067836.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Eucalyptus grandis]
 gb|KCW66054.1| hypothetical protein EUGRSUZ_G03344 [Eucalyptus grandis]
Length=324

 Score =   256 bits (653),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 164/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAV+GTLNVL SC + PS+KRVV+TSS A+V++   P+++  V+DE WFSD  F EE+K
Sbjct  101  DPAVRGTLNVLKSCAKVPSIKRVVLTSSMAAVVFNGKPLTSGVVVDETWFSDPVFCEESK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+A E RID+V ++P  VIGPLLQP +N S E+IL+ +    EF 
Sbjct  161  LWYLLSKTLAEKAAWKFAKEKRIDLVVMNPGHVIGPLLQPTVNLSVELILNFVNGTEEFP  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ +  +VDVRDVA AHI+A E PSASGRYC+VG  M   ++ KI+  LYP+L +PEK +
Sbjct  221  NASYG-FVDVRDVARAHIQALENPSASGRYCIVGGVMHRPDMSKILHHLYPTLRLPEKCE  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D   +   ++S++K + LG+NF PLEVS+K+T+ESLKEK 
Sbjct  280  DDKLAVAAHQISREKVEGLGVNFIPLEVSIKETVESLKEKG  320



>ref|NP_001242322.1| uncharacterized protein LOC100809326 [Glycine max]
 gb|ACU21505.1| unknown [Glycine max]
Length=325

 Score =   256 bits (653),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SCV++PSVKRV++TSS A+V Y   P S   V+DE W+SD ++  E K
Sbjct  102  DPAVKGTLNVLKSCVKSPSVKRVILTSSVAAVAYNKRPKSPEVVVDETWWSDPDYCRELK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+A EN +D+V ++PA+V+GPLLQ  LN S+ +IL+ I  G E  
Sbjct  162  LWYLLSKTLAEDAAWKFAKENDLDLVVVNPAMVVGPLLQAELNTSAAIILNLIN-GSETF  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            S+    +++V+DVANAHI+A+E+ SASGRYCLV      SE+ +I+   YP+  IPEK  
Sbjct  221  SNDTYGWINVKDVANAHIQAYEIASASGRYCLVERVAHYSELARILRDRYPTYQIPEKSA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PTF+VS++KAK+LGI F PLEVSL++T+E+LKEKN
Sbjct  281  DDKPYVPTFQVSKEKAKTLGIEFIPLEVSLRETVETLKEKN  321



>ref|XP_007029628.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY10130.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=324

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 162/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC + PS+KRVV+TSS A+V+Y   P+     +DE WFSD  F E++K
Sbjct  101  DPAVKGTLNVLRSCAKVPSIKRVVITSSVAAVVYNGRPLGPDVKVDETWFSDPTFCEKSK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAWKYA +N IDMV+++P LVIGPLLQP +N S E IL  I     F 
Sbjct  161  LWYMLSKTLAEEAAWKYAKDNGIDMVTVNPGLVIGPLLQPTINASVEPILKLINGAETFP  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ +   +DVRDVANAHI A+E  SA GRY LV   M  SE+++ + +LYP+L +PEK  
Sbjct  221  NTNYR-LIDVRDVANAHILAYENSSACGRYLLVERPMPCSEIVQALRELYPALRLPEKCA  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             +   +P F+VS+D+AKSLG+ FTP+EVS+KDT+ESLKEKN
Sbjct  280  DEKLAIPAFQVSKDRAKSLGVKFTPIEVSIKDTVESLKEKN  320



>gb|KHN20640.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Glycine soja]
Length=325

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SCV++PSVKRV++TSS A+V Y   P S   V+DE W+SD ++  E K
Sbjct  102  DPAVKGTLNVLKSCVKSPSVKRVILTSSVAAVAYNKRPKSPEVVVDETWWSDPDYCRELK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+A EN +D+V ++PA+V+GPLLQ  LN S+ +IL+ I  G E  
Sbjct  162  LWYLLSKTLAEDAAWKFAKENDLDLVVVNPAMVVGPLLQAELNTSAAIILNLIN-GSETF  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            S+    +++V+DVANAHI+A+E+ SASGRYCLV      SE+ +I+   YP+  IPEK  
Sbjct  221  SNDTYGWINVKDVANAHIQAYEIASASGRYCLVERVAHYSELARILRDQYPTYQIPEKSA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PTF+VS++KAK+LGI F PLEVSL++T+E+LKEKN
Sbjct  281  DDKPYVPTFQVSKEKAKTLGIEFIPLEVSLRETVETLKEKN  321



>ref|XP_010493007.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Camelina 
sativa]
Length=326

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +  SVKRVVVTSS A+V Y   P +    +DE WFS+ E  E +K
Sbjct  103  DPAVKGTLNVLNSCAKASSVKRVVVTSSMAAVCYNGKPCTPDVTVDETWFSNPELCEASK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK A E  +++V+++PA+VIGPLLQP LN S+  IL+ I   + F 
Sbjct  163  MWYVLSKTLAEDAAWKLAKEKGLEIVTINPAMVIGPLLQPTLNTSAAAILNLINGAKTFP  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI+AFEVPSA+GRYCLV   +  SEV+ I+ +LYP++P+PE+  
Sbjct  223  NASFG-WVNVKDVANAHIQAFEVPSANGRYCLVERVVHYSEVVSILHELYPNVPLPERCV  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + P  PT++VS++K KSLGI++ PL+VS+K+T+ESLKEK 
Sbjct  282  DENPHAPTYQVSKEKIKSLGIDYVPLQVSIKETVESLKEKG  322



>ref|XP_008344624.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Malus domestica]
Length=239

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 163/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC + PS+KRVV+TSS  S+++   P+SA  V+DE+WFSD  F E+ K
Sbjct  18   DPAVKGTLNVLRSCAKFPSIKRVVLTSSIVSIVFTGKPLSADTVVDESWFSDPAFCEKAK  77

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AEEAAWK+  EN ID+V+++P + IGPLLQP LN SSE++L       +F 
Sbjct  78   LWYALSKTLAEEAAWKFVKENGIDLVAVNPGVAIGPLLQPTLNSSSELLLKLFDGTGKFP  137

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++    +VDVRD+ANAHI AFE PSASGRY +VG     S  +KI+  L+P+L +PEK  
Sbjct  138  NATHR-WVDVRDIANAHILAFENPSASGRYSIVGSVAHYSVAVKILRDLFPALNLPEKCA  196

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P  PT+++S+++A++LG+ +TPL+V+LKD +ESLK+KN
Sbjct  197  DDQPFAPTYQISKERAETLGVVYTPLDVTLKDAVESLKQKN  237



>ref|XP_002267167.2| PREDICTED: uncharacterized protein LOC100257572 isoform X2 [Vitis 
vinifera]
Length=638

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 163/221 (74%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAV GTLNVL SC + PS++RVVVTSS  + ++    ++   ++DE WFSD  F EE+K
Sbjct  414  DPAVNGTLNVLRSCTKVPSIRRVVVTSSIVATIFNGKTLTPDVIVDETWFSDPAFCEESK  473

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAWK+A EN ID+V+++P  VIGP LQP +N + E+IL+ I  G +  
Sbjct  474  LWYVLSKTLAEEAAWKFAKENGIDLVTMNPGFVIGPFLQPTINLTMEIILNLINGGAQTF  533

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
             S    +VDVRDVANAH++AFE+ SASGRYCLV      SE +KI+ +LYP+L +P+K  
Sbjct  534  PSSTYRWVDVRDVANAHVQAFEISSASGRYCLVERVTYCSEAIKILQELYPALHLPQKNA  593

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P MPT+++S++K KSL I+F PLEVSLKDT+E+LKEKN
Sbjct  594  DDEPPMPTYQISKEKVKSLAIDFIPLEVSLKDTMENLKEKN  634


 Score =   241 bits (616),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 116/220 (53%), Positives = 162/220 (74%), Gaps = 3/220 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC + P+++RVVVTSS  +V+Y   P+++  ++DE WFSD  F EE+K
Sbjct  103  DPAVKGTLNVLRSCAKVPAIRRVVVTSSIVAVIYNGKPLTSDVIVDETWFSDPAFCEESK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAWK+A E+ ID+V+++P ++IGP LQP +N + E+IL+ I  G  F 
Sbjct  163  LWYVLSKTLAEEAAWKFAKEHGIDLVTMNPGVMIGPPLQPTINLTMEIILNMIN-GNTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            SS +  +VDVRDVANAHI+AFE+ SASGRYC+V      SE +KI+ +LYP++ +P+K  
Sbjct  222  SSTYK-WVDVRDVANAHIQAFEISSASGRYCMVERITYRSEAIKILHELYPAIHLPQKSA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P+ PT+++S++K KSL I+F PLE   K   E++ EK
Sbjct  281  DDEPLGPTYQISKEKVKSLAIDFIPLE-RRKGMSEAVAEK  319



>gb|KDP43566.1| hypothetical protein JCGZ_16853 [Jatropha curcas]
Length=325

 Score =   255 bits (651),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 162/221 (73%), Gaps = 2/221 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +  SVKRVV+TSS AS+M+   P++   VIDE W SD  + E  K
Sbjct  100  DPAVKGTLNVLKSCAKVHSVKRVVITSSIASIMFNGKPLTPDVVIDETWHSDSAYCESVK  159

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY  +K  AEEAAWK+A EN ID+V++HP  VIGP LQP LN + E+IL+ IK G  F 
Sbjct  160  HWYWYAKTIAEEAAWKFAEENGIDIVTIHPGFVIGPFLQPTLNLTLEVILNHIK-GETFP  218

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  +  +VDVRD+  AHI+AFE+PSA+GRYC+VG  +  +E+L+IV + YP+LP+P+K +
Sbjct  219  NEIYK-FVDVRDIGFAHIQAFELPSANGRYCIVGRVVHFTELLEIVHEKYPTLPLPDKCE  277

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +  F+VS+++AK+LG+ F PLEV++ DTIE LKEK 
Sbjct  278  DDKPFVSKFEVSKERAKTLGVKFIPLEVTIVDTIECLKEKG  318



>ref|XP_008340596.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Malus domestica]
Length=349

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 165/223 (74%), Gaps = 4/223 (2%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SCV+ P+VKRV++TSS A+VM    P++   VIDE W+SD+   E+ K
Sbjct  125  DPAVKGTLNVLKSCVKFPTVKRVILTSSMAAVMVNGRPLNPDVVIDETWYSDQAICEQLK  184

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGR--E  355
            +WY LSK  AEEAAWK++ EN ID+V+++P+ VIGPLLQP LN S EMIL+ +K G    
Sbjct  185  EWYFLSKTLAEEAAWKFSKENGIDLVTINPSYVIGPLLQPTLNLSVEMILN-LKNGHIPS  243

Query  356  FMSSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEK  535
             +SS +    DVRDVA AH++AFEVPSASGRYC VG     S+ L I+ +L+P+   PEK
Sbjct  244  IISSNYPSS-DVRDVAFAHVQAFEVPSASGRYCFVGHVTPMSKALSILHELHPTFFPPEK  302

Query  536  YKGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
               D P  P +++S++KAKSLG+NF PLEVSL+DTIESLKEK 
Sbjct  303  CDDDKPCEPGYQISKEKAKSLGVNFLPLEVSLRDTIESLKEKG  345



>ref|XP_007219354.1| hypothetical protein PRUPE_ppa019466mg [Prunus persica]
 gb|EMJ20553.1| hypothetical protein PRUPE_ppa019466mg [Prunus persica]
Length=324

 Score =   255 bits (651),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 160/220 (73%), Gaps = 1/220 (0%)
 Frame = +2

Query  5    PAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETKQ  184
            PAVKGTLNVL SCV+ P+VKRVV+TSS ASV+    P++   V+DE WFSD    E+ + 
Sbjct  102  PAVKGTLNVLKSCVKFPTVKRVVLTSSMASVLNNGKPLTPDVVVDETWFSDPLVCEDLEA  161

Query  185  WYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFMS  364
            WY LSK  AEEAAWK+A  N ID+V+L+PA VIGPLLQP LN + EM+L+  K+ +E  +
Sbjct  162  WYFLSKTLAEEAAWKFAKGNGIDLVTLNPAYVIGPLLQPTLNATVEMVLNLKKDMQE-AN  220

Query  365  SPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYKG  544
             P     DVRDVA  HI+AFEVPSA+GRYCLVG      E LKI+ QL+P    PEK + 
Sbjct  221  KPNYISTDVRDVAYTHIQAFEVPSANGRYCLVGHVTPVFEALKILQQLHPIFCPPEKLED  280

Query  545  DLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
              P  PTF+VSQ+KAKSLG++F PLEVSL+DT+ESLKEK 
Sbjct  281  GSPAEPTFQVSQEKAKSLGVSFLPLEVSLRDTVESLKEKG  320



>ref|XP_002517788.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
 gb|EEF44595.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
Length=324

 Score =   255 bits (651),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 160/221 (72%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC +  SVKRVV+TSS A+V+    P++A  V+DE W+SD E  +E K
Sbjct  101  DPAIKGTLNVLKSCAKVKSVKRVVITSSMAAVLRSRRPLTADVVVDETWYSDPEVCKELK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AEEAAW +A EN ID+V+++P  VIGP+LQP LN S EMIL+ IK G E  
Sbjct  161  VWYALSKTLAEEAAWNFAKENAIDLVTINPTYVIGPMLQPTLNSSVEMILNLIK-GAETY  219

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
             + +    D+RDV + HI+AFEVPSASGRYC+V   +  SEV+KI+ + YP+L +PEK  
Sbjct  220  PNAYYSSADIRDVVDVHIQAFEVPSASGRYCVVPNVLHYSEVVKIIHEHYPTLHLPEKCD  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
                + P+FKVS +KAKSLGIN+ P EV+LK TIESLKEK 
Sbjct  280  ETQLLSPSFKVSNEKAKSLGINYIPFEVTLKGTIESLKEKG  320



>emb|CDP09263.1| unnamed protein product [Coffea canephora]
Length=323

 Score =   254 bits (650),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 163/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVLGSC ++PSVKRVV+TSS A+V Y     S   V+DE W+S  +  +E K
Sbjct  96   DPALKGTLNVLGSCAKSPSVKRVVLTSSVAAVYYNGRSRSPDVVVDETWWSLPDLCKENK  155

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AA K+  E  +DMV+++PA+VIGPLLQP LN S+  IL+ I     F 
Sbjct  156  LWYVLSKTLAEDAACKFVKEKGLDMVTINPAMVIGPLLQPTLNTSAAAILNLINGAETFP  215

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +S    +VDVRDVANAH+ AFE PSASGRYCLV      SEV+KI+  LYPS+ +PEK  
Sbjct  216  NSTLG-WVDVRDVANAHVLAFENPSASGRYCLVERVAHYSEVVKILHTLYPSVKLPEKCA  274

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PT++VS++KAKSLG+ FTPLE S+K+T+ESLK+KN
Sbjct  275  DDKPFVPTYQVSKEKAKSLGLEFTPLEQSIKETVESLKDKN  315



>ref|XP_009354346.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Pyrus x 
bretschneideri]
Length=324

 Score =   254 bits (650),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 162/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC + PS+KRVV+TSS A+V +   P++   V+DE+WFSD    E++K
Sbjct  103  DPALKGTLNVLRSCAKVPSIKRVVITSSMAAVAFNGKPLAPDVVVDESWFSDVAVCEKSK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY++SK  AEEAAWK+A EN ID+ +++P LV GPLLQP LN S E +L  +     F 
Sbjct  163  LWYMISKTLAEEAAWKFAKENGIDIATINPGLVTGPLLQPTLNTSVEPVLKLVNGAERFP  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ +  +VDVRDVA AHI A E  SASGRYCLVG  + +S+ + I+  L+P+L +PE+  
Sbjct  223  NTTYR-WVDVRDVATAHILALENASASGRYCLVGRVIHSSDTVNILRDLFPALKLPEECA  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P  PT++VS ++A+SLG+ FTPLEV+LKDT+ESLKEKN
Sbjct  282  DDKPFTPTYQVSNERAQSLGVKFTPLEVTLKDTVESLKEKN  322



>ref|XP_007029632.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY10134.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=324

 Score =   254 bits (650),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 161/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC + PS+KRVV+TSS  +V++   P+    ++DE WFS+  F E++K
Sbjct  101  DPAVKGTLNVLRSCAKVPSIKRVVITSSIVAVIFNGRPLGPDVLVDETWFSNPTFCEKSK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAWKYA EN I MV+++P LVIGPLLQP +N S E IL  I     F 
Sbjct  161  LWYMLSKTLAEEAAWKYAKENGIQMVTVNPGLVIGPLLQPTINTSVEPILKLINGAETFP  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ +   +DVRDVANAHI A+E  SA GRY LV   M  SE+++ + +LYP+L +PE+  
Sbjct  221  NTSYR-LIDVRDVANAHIIAYENSSACGRYLLVERVMHCSEIVQALRELYPALRLPERCA  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             +   MP F+VS+D+AKSLG+NFTP EVS+KDT+ESLKEKN
Sbjct  280  DEKVGMPVFQVSKDRAKSLGVNFTPTEVSIKDTVESLKEKN  320



>gb|AFY97683.1| cinnamyl alcohol dehydrogenase 1 [Pyrus pyrifolia]
Length=325

 Score =   254 bits (650),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNVL SC ++PS+K VV+TSS A+V Y   P +   VIDE WF+D +  +E+K
Sbjct  102  EPAVKGTLNVLNSCAKSPSIKGVVLTSSIAAVAYNGKPRTPDVVIDETWFTDPDVCKESK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+  E  ID+V+++PA+VIGPLLQP LN S+  +L+ IK  R F 
Sbjct  162  LWYVLSKTLAEDAAWKFVKEKGIDLVTINPAMVIGPLLQPTLNTSAAAVLNVIKGARTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++  + +++V+DV NAHI+AFE P+A GRYCLV      SEV++I+ +LYP+L +P+K  
Sbjct  222  NAS-SGWINVKDVTNAHIQAFESPTAGGRYCLVETVAHFSEVVRILRELYPTLQLPDKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PT++VS++KAKSLG+ F PL+VSLK+T+ESLKEK 
Sbjct  281  DDKPFVPTYQVSKEKAKSLGVEFIPLDVSLKETVESLKEKG  321



>ref|XP_010651224.1| PREDICTED: cinnamoyl-CoA reductase 1 [Vitis vinifera]
Length=322

 Score =   254 bits (650),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 163/220 (74%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC +TP+VKRVVVTSS A+V+Y   P +   V+DE WFS+++  +E K
Sbjct  99   DPALKGTLNVLSSCAKTPTVKRVVVTSSIAAVVYSGKPRTPEIVVDETWFSNQDICKEMK  158

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AEEAAWK+A E  +D+V+++PA+VIGPLLQP LN S+  IL+ I   + F 
Sbjct  159  HWYALSKTLAEEAAWKFAKEKGMDIVTINPAMVIGPLLQPTLNASAATILNLINGAQIFP  218

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +     +V V+DVA AHI+AFE+PSA+GRYCL   T+  SE++KI+  L+P   +P K  
Sbjct  219  NFTMG-WVHVKDVAEAHIQAFEIPSANGRYCLAERTVHYSEIVKILKDLFPDFQLPVKCA  277

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P MPT+++S++KAKSLGI F PLE SLK+T+ESLKEK
Sbjct  278  DDHPFMPTYQISKEKAKSLGIEFIPLEESLKETVESLKEK  317



>gb|AHF20167.1| cinnamyl alcohol dehydrogenase, partial [Musa acuminata AAA Group]
Length=247

 Score =   251 bits (642),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 166/221 (75%), Gaps = 2/221 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNVL SC +  SVKRVVVTSS A+V+Y   P +   V+DE WFSD E  +  +
Sbjct  25   EPAVKGTLNVLASCKKF-SVKRVVVTSSLAAVVYNDKPKNPDVVVDETWFSDPEVCKRDE  83

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY+LSK  AEEAAWK+A EN ID+V+++P +V+GPLLQ  LN SS +IL+ I +   F+
Sbjct  84   QWYVLSKTLAEEAAWKFAKENAIDIVTINPGMVVGPLLQSTLNTSSALILNLINDSSTFL  143

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVA AHI AFE+PSASGRYCL       S+++KI+ +LYP+LP+PEK  
Sbjct  144  NATFG-WVNVQDVAKAHILAFELPSASGRYCLAERVSHFSDIVKIIRELYPALPLPEKCA  202

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +P ++VS++K KSLG+++ PLE S+K+TIESLK KN
Sbjct  203  DDKPFVPVYQVSKEKYKSLGLDYIPLETSIKETIESLKGKN  243



>ref|XP_011025483.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Populus 
euphratica]
 ref|XP_011025484.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Populus 
euphratica]
Length=329

 Score =   254 bits (648),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 125/224 (56%), Positives = 162/224 (72%), Gaps = 3/224 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNVL SC + PSVKRV++TSS ASV++   P++   V+DE WFSD  F    K
Sbjct  102  EPAVKGTLNVLKSCAKFPSVKRVILTSSMASVVFNGKPLTPDVVVDETWFSDSAFCVSNK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREF-  358
             WY+ SK  AEEAAWK+A E  IDMV+++P  VIGPLLQP L  ++E+ LD I  G +  
Sbjct  162  LWYMASKTLAEEAAWKFAKEKGIDMVTINPGFVIGPLLQPTLKSTAELFLDHINGGAQGA  221

Query  359  --MSSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPE  532
              + S    +VDVRDVA AHI+A E+PSASGRYCLVG     S+ +KI  +LYP+LP+PE
Sbjct  222  PRLPSEIYRFVDVRDVAYAHIQALEIPSASGRYCLVGRVKHFSDAVKIAHELYPTLPLPE  281

Query  533  KYKGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
            K   + P    ++VS++KAK+LG++FTPLEVS+KDT+ESLKEK 
Sbjct  282  KCADENPSPLNYEVSKEKAKTLGLDFTPLEVSVKDTLESLKEKG  325



>ref|NP_001242544.1| uncharacterized protein LOC100781477 [Glycine max]
 gb|ACU21419.1| unknown [Glycine max]
Length=325

 Score =   254 bits (648),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 164/220 (75%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SCV  P+++RVV+TSS A+V Y   P +   V+DE WFSD  F  E++
Sbjct  102  DPALKGTLNVLKSCVNLPTLERVVLTSSVAAVAYNGKPRTPDVVVDETWFSDPGFCRESQ  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AE+AAWK+  EN IDMV+++PA+VIGPLLQP+LN S+  IL+ I   + F 
Sbjct  162  MWYTLSKTLAEDAAWKFVKENNIDMVTINPAMVIGPLLQPVLNTSAASILNVINGAQTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI A+E  SA+GRYCLV      SE++KI+  LYP+L +P K  
Sbjct  222  NASFG-WVNVKDVANAHILAYENASANGRYCLVERVAHYSEIVKILRDLYPTLLLPGKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P +P ++VS++KAKSLGI +TPLEVSLK+T++SLKEK
Sbjct  281  DDNPYVPIYQVSKEKAKSLGIEYTPLEVSLKETVDSLKEK  320



>ref|XP_010493006.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Camelina 
sativa]
Length=327

 Score =   254 bits (648),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 167/222 (75%), Gaps = 2/222 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +  SVKRVVVTSS A+V Y   P +    +DE WFS+ E  E +K
Sbjct  103  DPAVKGTLNVLNSCAKASSVKRVVVTSSMAAVCYNGKPCTPDVTVDETWFSNPELCEASK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEG-REF  358
             WY+LSK  AE+AAWK A E  +++V+++PA+VIGPLLQP LN S+  IL+ I  G + F
Sbjct  163  MWYVLSKTLAEDAAWKLAKEKGLEIVTINPAMVIGPLLQPTLNTSAAAILNLINAGAKTF  222

Query  359  MSSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKY  538
             ++ F  +V+V+DVANAHI+AFEVPSA+GRYCLV   +  SEV+ I+ +LYP++P+PE+ 
Sbjct  223  PNASFG-WVNVKDVANAHIQAFEVPSANGRYCLVERVVHYSEVVSILHELYPNVPLPERC  281

Query  539  KGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
              + P  PT++VS++K KSLGI++ PL+VS+K+T+ESLKEK 
Sbjct  282  VDENPHAPTYQVSKEKIKSLGIDYVPLQVSIKETVESLKEKG  323



>gb|AHF20168.1| cinnamyl alcohol dehydrogenase, partial [Musa acuminata AAA Group]
Length=276

 Score =   252 bits (643),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 166/221 (75%), Gaps = 2/221 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNVL SC +  SVKRVVVTSS A+V+Y   P +   V+DE WFSD E  +  +
Sbjct  54   EPAVKGTLNVLASC-KKFSVKRVVVTSSLAAVVYNDKPKNPDVVVDETWFSDPEVCKRDE  112

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY+LSK  AEEAAWK+A EN ID+V+++P +V+GPLLQ  LN SS +IL+ I +   F+
Sbjct  113  QWYVLSKTLAEEAAWKFAKENAIDIVTINPGMVVGPLLQSTLNTSSALILNLINDSSTFL  172

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVA AHI AFE+PSASGRYCL       S+++KI+ +LYP+LP+PEK  
Sbjct  173  NATFG-WVNVQDVAKAHILAFELPSASGRYCLAERVSHFSDIVKIIRELYPALPLPEKCA  231

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +P ++VS++K KSLG+++ PLE S+K+TIESLK KN
Sbjct  232  DDKPFVPVYQVSKEKYKSLGLDYIPLETSIKETIESLKGKN  272



>ref|XP_006602185.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Glycine max]
Length=325

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/220 (55%), Positives = 164/220 (75%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SCV  P+++RVV+TSS A+V     P++   V+DE WFSD +   E K
Sbjct  102  DPALKGTLNVLKSCVNLPTLERVVLTSSVAAVANNGKPLTPYVVVDETWFSDPDLCREAK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            +WY LSK  AE+AAWK+  EN IDMV+++PA+VIGPLLQP+LN S+  IL+ I     F 
Sbjct  162  RWYTLSKTLAEDAAWKFVKENNIDMVTINPAMVIGPLLQPVLNTSAASILNIINGAETFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ +  +V+V+DVANAHI A+E  SA+GRYCLV      SE++K++  LYP+L +PEK  
Sbjct  222  NASYG-WVNVKDVANAHILAYENASANGRYCLVERVAHYSEIVKVLPDLYPTLQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P +P ++VS++KAKSLGI +TPLEVSLK+T++SLKEK
Sbjct  281  DDKPYVPIYQVSKEKAKSLGIEYTPLEVSLKETVDSLKEK  320



>emb|CAA61275.1| cinnamyl alcohol dehydrogenase [Eucalyptus gunnii]
Length=327

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 162/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC + PS++RVV+TSS A+V Y   P +   V+DE+WFSD +   +T 
Sbjct  104  DPAVKGTLNVLKSCSKAPSLQRVVLTSSMAAVAYNRQPRTPEVVVDESWFSDPDLCRQTN  163

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+  E  IDMV+++PA+VIGPLLQP LN S+  I + I     F 
Sbjct  164  AWYVLSKTLAEDAAWKFVKEKGIDMVTINPAMVIGPLLQPTLNTSAAAIGNLINGAPTFP  223

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI AFEVPSASGRYCLV      SE+++I+ +LYPS  +PEK  
Sbjct  224  NASFG-WVNVKDVANAHILAFEVPSASGRYCLVERIAHYSEIVRILRELYPSAQLPEKSA  282

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +P ++VS++K KSLGIN+ PLE +LK+T+ESLKEK 
Sbjct  283  DDKPFVPIYQVSKEKVKSLGINYIPLEQNLKETVESLKEKG  323



>ref|XP_010045028.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Eucalyptus grandis]
Length=327

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 162/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC + PS++RVV+TSS A+V Y   P +   V+DE+WFSD +   +T 
Sbjct  104  DPAVKGTLNVLKSCSKAPSLQRVVLTSSMAAVAYNRQPRTPEVVVDESWFSDPDLCRQTN  163

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+  E  IDMV+++PA+VIGPLLQP LN S+  I + I     F 
Sbjct  164  AWYVLSKTLAEDAAWKFVKEKGIDMVTINPAMVIGPLLQPTLNTSAAAIGNLINGAPTFP  223

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI AFEVPSASGRYCLV      SE+++I+ +LYPS  +PEK  
Sbjct  224  NASFG-WVNVKDVANAHILAFEVPSASGRYCLVERIAHYSEIVRILRELYPSAQLPEKSA  282

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +P ++VS++K KSLGIN+ PLE +LK+T+ESLKEK 
Sbjct  283  DDKPFVPIYQVSKEKVKSLGINYIPLEQNLKETVESLKEKG  323



>ref|XP_009354355.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Pyrus x 
bretschneideri]
Length=321

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 163/220 (74%), Gaps = 1/220 (0%)
 Frame = +2

Query  5    PAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETKQ  184
            PAVKGTLNVL SCV+ P+VKRVV+TSS A+V+    P++   V+DE W+SD+    + K+
Sbjct  99   PAVKGTLNVLKSCVKFPTVKRVVLTSSMAAVIVNGRPLNPDVVVDETWYSDQAVCAQLKE  158

Query  185  WYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFMS  364
            WY LSK  AEEAAWK++ EN ID+V+++P+ VIGPLLQP LN + +MIL+ +K G     
Sbjct  159  WYFLSKTIAEEAAWKFSKENGIDLVTINPSYVIGPLLQPTLNLTVKMILN-LKNGTLPQP  217

Query  365  SPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYKG  544
              F+   DVRDVA AH++AFEVPSASGRYC VG     S+VL I+ +L+P+   PEK + 
Sbjct  218  DFFSLSCDVRDVAYAHVQAFEVPSASGRYCFVGHVTPVSKVLNILHKLHPTFFPPEKCED  277

Query  545  DLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
            D P  P F++S++KAKSLG++F PLEVSL+DTIESLKEK 
Sbjct  278  DKPCEPGFQISKEKAKSLGVDFLPLEVSLRDTIESLKEKG  317



>gb|KHN12533.1| Dihydroflavonol-4-reductase [Glycine soja]
Length=325

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/220 (55%), Positives = 164/220 (75%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SCV  P+++RVV+TSS A+V     P++   V+DE WFSD +   E K
Sbjct  102  DPALKGTLNVLKSCVNLPTLERVVLTSSVAAVANNGKPLTPYVVVDETWFSDPDLCREAK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            +WY LSK  AE+AAWK+  EN IDMV+++PA+VIGPLLQP+LN S+  IL+ I     F 
Sbjct  162  RWYTLSKTLAEDAAWKFVKENNIDMVTINPAMVIGPLLQPVLNTSAASILNIINGAETFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ +  +V+V+DVANAHI A+E  SA+GRYCLV      SE++K++  LYP+L +PEK  
Sbjct  222  NASYG-WVNVKDVANAHILAYENASANGRYCLVERVAHYSEIVKVLPDLYPTLQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P +P ++VS++KAKSLGI +TPLEVSLK+T++SLKEK
Sbjct  281  DDNPYVPIYQVSKEKAKSLGIEYTPLEVSLKETVDSLKEK  320



>emb|CBI16354.3| unnamed protein product [Vitis vinifera]
Length=379

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 163/220 (74%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC +TP+VKRVVVTSS A+V+Y   P +   V+DE WFS+++  +E K
Sbjct  156  DPALKGTLNVLSSCAKTPTVKRVVVTSSIAAVVYSGKPRTPEIVVDETWFSNQDICKEMK  215

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AEEAAWK+A E  +D+V+++PA+VIGPLLQP LN S+  IL+ I   + F 
Sbjct  216  HWYALSKTLAEEAAWKFAKEKGMDIVTINPAMVIGPLLQPTLNASAATILNLINGAQIFP  275

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +     +V V+DVA AHI+AFE+PSA+GRYCL   T+  SE++KI+  L+P   +P K  
Sbjct  276  NFTMG-WVHVKDVAEAHIQAFEIPSANGRYCLAERTVHYSEIVKILKDLFPDFQLPVKCA  334

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P MPT+++S++KAKSLGI F PLE SLK+T+ESLKEK
Sbjct  335  DDHPFMPTYQISKEKAKSLGIEFIPLEESLKETVESLKEK  374



>ref|XP_010534743.1| PREDICTED: cinnamoyl-CoA reductase 1 [Tarenaya hassleriana]
Length=325

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 164/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGT+NVL SC++T SVKRVV+TSS A+V +   P +   V+DE WF+D ++    K
Sbjct  102  DPAVKGTINVLNSCLKTSSVKRVVLTSSIAAVAFNGKPRTPETVVDETWFADPDYCRAAK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+A EN + +VS++PA+VIGPLLQP LN S+  +L  IK  + F 
Sbjct  162  LWYVLSKTLAEDAAWKFAKENDMQLVSINPAMVIGPLLQPTLNTSAAAVLSLIKGAQTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI+AFE PSA+GRYCLV      SEV+ I+ +LYP   +PEK  
Sbjct  222  NATFG-WVNVKDVANAHIQAFENPSANGRYCLVERVAHYSEVVDILHKLYPDFQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             +   +PT+KVS++KA+SLGI F PLEVS+K+T+ESLK+K 
Sbjct  281  DEKQYIPTYKVSKEKAESLGIEFVPLEVSIKETVESLKDKG  321



>ref|XP_008349583.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Malus domestica]
 ref|XP_008363306.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Malus domestica]
Length=322

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 163/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC + PS+KRVV+TSS  S+++   P+SA  V+DE+WFSD  F E+ K
Sbjct  101  DPAVKGTLNVLRSCAKFPSIKRVVLTSSIVSIVFTGKPLSADTVVDESWFSDPAFCEKAK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AEEAAWK+  EN ID+V+++P + IGPLLQP LN SSE++L       +F 
Sbjct  161  LWYALSKTLAEEAAWKFVKENGIDLVAVNPGVAIGPLLQPTLNSSSELLLKLFDGTGKFP  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++    +VDVRD+ANAHI AFE PSASGRY +VG     S  +KI+  L+P+L +PEK  
Sbjct  221  NATHR-WVDVRDIANAHILAFENPSASGRYSIVGSVAHYSVAVKILRDLFPALNLPEKCA  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P  PT+++S+++A++LG+ +TPL+V+LKD +ESLK+KN
Sbjct  280  DDQPFAPTYQISKERAETLGVVYTPLDVTLKDAVESLKQKN  320



>ref|XP_008790948.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Phoenix 
dactylifera]
Length=330

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 160/221 (72%), Gaps = 2/221 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNV GSC++TPSVKRVVVTSS A+V+    P +   V+D  WFS  EF E+ K
Sbjct  101  DPAVKGTLNVFGSCIKTPSVKRVVVTSSMATVVCNGRPQTPDVVVDATWFSSAEFCEQEK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AEEAAWKY+ +N IDMV++HP  VIGPLLQP LN SS + L+ I  G  + 
Sbjct  161  LWYPLSKTLAEEAAWKYSKDNSIDMVTIHPGAVIGPLLQPTLNSSSALFLNLIN-GSTYP  219

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  F  +V+V+DVA AHI AFEVPSA GRYCLV      SE++KI+ + YP+L +PEK  
Sbjct  220  NLSFG-WVNVKDVAMAHILAFEVPSARGRYCLVERVAHYSEIVKILREQYPALKLPEKCA  278

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P  P ++VS++K KSLGI++ P+E S+K+T+ESLKEK 
Sbjct  279  DDKPFPPIYQVSKEKEKSLGIDYIPIETSIKETVESLKEKG  319



>ref|XP_009354356.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Pyrus x 
bretschneideri]
Length=321

 Score =   252 bits (643),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 164/220 (75%), Gaps = 1/220 (0%)
 Frame = +2

Query  5    PAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETKQ  184
            PAVKGTLNVL SCV+ P+VKRVV+TSS A+V+    P++   V+DE W+SD+    + K+
Sbjct  99   PAVKGTLNVLKSCVKFPTVKRVVLTSSMAAVIVNGRPLNPDVVVDETWYSDQAVCAQLKE  158

Query  185  WYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFMS  364
            WY LSK  AEEAAWK++ EN ID+V+++P+ VIGPLLQP LN + +MIL+   +  + +S
Sbjct  159  WYFLSKTIAEEAAWKFSKENGIDLVTINPSYVIGPLLQPTLNLTVKMILNLKNDVHDVIS  218

Query  365  SPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYKG  544
            S +    DVRDVA AH++AFEVPSASGRYC VG     S+VL I+ +L+P+   PEK + 
Sbjct  219  SNY-ISSDVRDVAYAHVQAFEVPSASGRYCFVGHVTPVSKVLNILHKLHPTFFPPEKCED  277

Query  545  DLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
            D P  P F++S++KAKSLG++F PLEVSL+DTIESLKEK 
Sbjct  278  DKPCEPGFQISKEKAKSLGVDFLPLEVSLRDTIESLKEKG  317



>ref|XP_006446144.1| hypothetical protein CICLE_v100159012mg, partial [Citrus clementina]
 gb|ESR59384.1| hypothetical protein CICLE_v100159012mg, partial [Citrus clementina]
 gb|KDO61222.1| hypothetical protein CISIN_1g0202661mg, partial [Citrus sinensis]
Length=284

 Score =   251 bits (640),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 164/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC + PS+KRVV+TSS A+V+    P +   V+DE WFSD E  ++++
Sbjct  61   DPAVKGTLNVLNSCAKFPSIKRVVLTSSMAAVLNTGKPRTPDVVVDETWFSDPEVCKQSE  120

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AE+AAWK+A E  ID+V+++PA+VIGPLLQP LN S+  +L  IK  + + 
Sbjct  121  LWYPLSKTLAEDAAWKFAKEKSIDLVTINPAMVIGPLLQPTLNTSAAAVLSLIKGAQTYP  180

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  F  +V+V+DVANAHI+AFEVPSA+GRYCLV      SE++ I+ +LYP+  +PEK  
Sbjct  181  NVTFG-WVNVKDVANAHIQAFEVPSANGRYCLVERVSHYSEIVNIIRELYPAFQLPEKCA  239

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PT++V ++K K+LGI F P+EVSLK+TIESLKEK 
Sbjct  240  DDKPHVPTYQVLKEKVKNLGIEFIPVEVSLKETIESLKEKG  280



>ref|XP_010908348.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Elaeis 
guineensis]
Length=323

 Score =   252 bits (643),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 167/221 (76%), Gaps = 2/221 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNV  SC++TPSVKR+VVTSS A+V+    P++   V+DE WFS+ E+ ++ K
Sbjct  101  DPAVKGTLNVFSSCIKTPSVKRLVVTSSMAAVIRNGRPLTPDVVVDETWFSNAEYCKQAK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAWK++ +N IDMV+++PA+VIGPLLQP LN S+  IL+ I     + 
Sbjct  161  -WYVLSKTLAEEAAWKFSKDNSIDMVTINPAMVIGPLLQPTLNTSAAAILNLINGSSTYP  219

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVA AHI AFEVPSASGRYCLV      +E++KI+ + YP+L +PEK  
Sbjct  220  NASF-VWVNVKDVAIAHILAFEVPSASGRYCLVERVAHYAELVKILHEQYPALKLPEKCA  278

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +P ++VS++K KSLGI++ PLE S+K+T+ESL+EK 
Sbjct  279  DDKPFVPIYQVSKEKVKSLGIDYIPLETSIKETVESLREKG  319



>ref|XP_008354954.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Malus domestica]
Length=326

 Score =   252 bits (643),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 158/223 (71%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNVL SC + P+VKRVV+TSS ASV     P+++  V+DE W+SD    E+ +
Sbjct  101  EPAVKGTLNVLKSCAKFPTVKRVVLTSSMASVSVNGKPLTSDVVLDETWYSDPLVCEKNE  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            +WY LSK  AEEAAWKYA EN ID+V+++P  VIGPLLQP LN   EMI + I  G    
Sbjct  161  RWYALSKTLAEEAAWKYAKENGIDLVTMNPGFVIGPLLQPTLNLXVEMIQNLIT-GTGTK  219

Query  362  SSPFNCY--VDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEK  535
            + P + Y  +DVRDV +AHI AFEVPSASGRYCLV      SEVLKI+  LYP+L +PEK
Sbjct  220  TLPLSNYRSIDVRDVVSAHILAFEVPSASGRYCLVSNVTHASEVLKIIQDLYPTLHLPEK  279

Query  536  YKGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             +      P + +S +KAK LGINF PLEVSL+DTIESLKEK 
Sbjct  280  CEIGSTSDPKYSISAEKAKGLGINFLPLEVSLRDTIESLKEKG  322



>ref|XP_008366589.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Malus domestica]
Length=326

 Score =   252 bits (643),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 158/223 (71%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNVL SC + P+VKRV +TSS ASV     P+++  V+DE W+SD    E+ +
Sbjct  101  EPAVKGTLNVLKSCAKFPTVKRVXLTSSMASVSVNGKPLTSDVVLDETWYSDPLVCEKNE  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            +WY LSK  AEEAAWKYA EN ID+V+++P  VIGPLLQP LN S EMI + I  G    
Sbjct  161  RWYALSKTLAEEAAWKYAKENGIDLVTMNPGFVIGPLLQPTLNLSVEMIQNLIT-GTGTK  219

Query  362  SSPFNCY--VDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEK  535
            + P + Y  +DVRDV +AHI AFEVPSASGRYCLV      SEVLKI+  LYP+L +PEK
Sbjct  220  TLPLSNYRSIDVRDVVSAHILAFEVPSASGRYCLVSNVTHASEVLKIIQDLYPTLHLPEK  279

Query  536  YKGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             +      P + +S +KAK LGINF PLEVSL+DTIESLKEK 
Sbjct  280  CEIGSTSDPKYSISAEKAKGLGINFLPLEVSLRDTIESLKEKG  322



>ref|XP_010493011.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Camelina 
sativa]
Length=326

 Score =   252 bits (643),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 164/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +  S+KRVVVTSS A+V Y   P +    +DE WFSD E  E +K
Sbjct  103  DPAVKGTLNVLNSCAKASSIKRVVVTSSMAAVNYNGKPCTPDVTVDETWFSDPEHCEASK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK A E  +++V+++PA+VIGPLLQP LN S+  IL+ I   + F 
Sbjct  163  MWYVLSKTLAEDAAWKLAKEKGLEIVTINPAMVIGPLLQPTLNTSAAAILNLINGAKTFP  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  F  +V V+DVANAHI+AFEVPSA+GRYC+V      S+V+ I+ +LYP++P+PE+  
Sbjct  223  NVSFG-WVYVKDVANAHIQAFEVPSANGRYCMVERVAHFSDVVSILHELYPNVPLPERCV  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + P MPT++VS++K KSLGI++ PL+VS+K+T+ESLKEK 
Sbjct  282  DENPYMPTYQVSKEKIKSLGIDYIPLKVSIKETVESLKEKG  322



>ref|XP_010905794.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Elaeis guineensis]
Length=324

 Score =   252 bits (643),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 161/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNV  SCV+TP +KRVVVTSS A+V Y   P +   V+DE WFS  EF ++ K
Sbjct  101  DPAVKGTLNVFSSCVKTPCIKRVVVTSSMAAVAYNGRPRTPDVVVDETWFSSAEFCKQAK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAWK++ +N IDMV+++PA+VIGPLLQP LN S+  IL+ I     + 
Sbjct  161  MWYVLSKTLAEEAAWKFSKDNSIDMVTINPAMVIGPLLQPTLNTSAAAILNLINGSSTYP  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVA AHI AFEVPSASGRYCLV      +E++KI+   YP+L +PE   
Sbjct  221  NASFG-WVNVKDVAKAHILAFEVPSASGRYCLVERVAHYAELVKILHDQYPALKLPEMCA  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +P ++VS++K KSLGI++ P+E S+ +T+ESL+EK 
Sbjct  280  DDEPFVPIYQVSKEKTKSLGIDYIPVETSIMETVESLREKG  320



>gb|KCW66074.1| hypothetical protein EUGRSUZ_G033561, partial [Eucalyptus grandis]
Length=284

 Score =   250 bits (639),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 167/223 (75%), Gaps = 5/223 (2%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC +  SVKRVVVTSSTA+V + + P+++  VIDE W+SD EF +++K
Sbjct  61   DPALKGTLNVLRSCAKASSVKRVVVTSSTAAVAFSAKPLTSGIVIDETWYSDPEFCKKSK  120

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAW++A EN ID+V+++P  +IGP+LQP +NFS E+IL+ I   + F 
Sbjct  121  LWYMLSKTLAEKAAWEFAKENGIDLVTINPGYMIGPILQPSVNFSVEIILNLINGAQTF-  179

Query  362  SSPFNCY--VDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEK  535
              P  CY  VDVRDVA+AHI AFE  SA GRYCLV +T+   +VL+I+  LYP+L +P+K
Sbjct  180  --PNTCYRFVDVRDVAHAHILAFENHSAHGRYCLVAKTVHCHDVLQILRNLYPTLHLPKK  237

Query  536  YKGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + + P     ++S  KA++LG++FTPLEVSL+DT+E LKEK 
Sbjct  238  CEDEKPFSLKNEISTKKAEALGVDFTPLEVSLRDTVECLKEKG  280



>ref|XP_008375210.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Malus domestica]
Length=321

 Score =   251 bits (642),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 159/221 (72%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC + P+VKRVV+TSS ASV     P+++  V+DE W+SD  F E+T+
Sbjct  102  DPAVKGTLNVLKSCAKFPAVKRVVLTSSMASVGIXGKPLTSDVVMDETWYSDPXFCEKTE  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY LSK  AEEAAWK+A  N ID+VS+HP +VIGPLLQP LN S E  LD +   +   
Sbjct  162  QWYPLSKTLAEEAAWKFAKGNGIDLVSIHPGIVIGPLLQPTLNLSIEYFLDLMSGIKTLF  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
             +  + +VDVRDVA+AHI+AFE PSASGRYCLV +   + + LKI+ +LYP+L +PE   
Sbjct  222  IN--HTFVDVRDVASAHIQAFEXPSASGRYCLVAQVADSPDTLKILRELYPTLSLPELGN  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
               P    F+VS++KAK LGI F PLE SLKDT+ESLKEK 
Sbjct  280  ---PSDSKFQVSREKAKGLGITFLPLETSLKDTVESLKEKG  317



>ref|XP_008231478.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Prunus mume]
Length=323

 Score =   251 bits (642),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 161/221 (73%), Gaps = 2/221 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAV GTLNVL SCV+  +VKRVV+TSS ASVM    P+++  VIDE W+SD+   E  K
Sbjct  101  DPAVNGTLNVLKSCVKFSTVKRVVLTSSMASVMMSGKPLTSDVVIDETWYSDQVVCENHK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY+LSK  AE+AAW+YA  N ID+V ++P  VIGPLLQP LN S E+  + I   +   
Sbjct  161  QWYMLSKTLAEKAAWEYAKGNGIDLVIMNPGFVIGPLLQPTLNLSVELFQNLISGTQTIP  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
             S +  ++DVRDVA+AHI+AFE+PSA+GR+CLVG     S+ LKI+ QLYP+L +PEK +
Sbjct  221  VSNYR-FIDVRDVASAHIQAFELPSAAGRFCLVGHVASVSKTLKILRQLYPTL-LPEKCE  278

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
               P  PT++VS +KAK LGI F PLEVSL+DT+ESLKEK 
Sbjct  279  VGTPPEPTYQVSVEKAKGLGITFLPLEVSLRDTVESLKEKG  319



>ref|XP_009395948.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Musa acuminata subsp. 
malaccensis]
Length=368

 Score =   253 bits (646),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 166/221 (75%), Gaps = 2/221 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNVL SC +  SVKRVVVTSS A+V+Y   P +   V+DE WFSD E  +  +
Sbjct  146  EPAVKGTLNVLASCKKF-SVKRVVVTSSLAAVVYNDKPKNPDVVVDETWFSDPEVCKRDE  204

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY+LSK  AEEAAWK+A EN ID+V+++P +V+GPLLQ  LN SS +IL+ I     F+
Sbjct  205  QWYVLSKTLAEEAAWKFAKENAIDIVTINPGMVVGPLLQSTLNTSSALILNLINGSSTFL  264

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVA AHI AFE+PSASGRYCL       S+++KI+ +LYP+LP+PEK  
Sbjct  265  NATFG-WVNVQDVAKAHILAFELPSASGRYCLAERVSHFSDIVKIIRELYPALPLPEKCA  323

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +P +++S++K KSLG+++ PLE S+K+TIESLKEKN
Sbjct  324  DDKPFVPVYQISKEKYKSLGLDYIPLETSIKETIESLKEKN  364



>ref|XP_010067835.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Eucalyptus grandis]
 gb|KCW66055.1| hypothetical protein EUGRSUZ_G03345 [Eucalyptus grandis]
Length=324

 Score =   251 bits (642),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 164/223 (74%), Gaps = 5/223 (2%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL S  +  S+KRVVVTSS A+V + + P+++  VIDE W SD EF E++K
Sbjct  101  DPALKGTLNVLRSFAKASSIKRVVVTSSMAAVAFSAKPVTSGVVIDETWHSDPEFCEKSK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAW++A EN ID+V+++P  VIGP+LQP +NFS E+IL+ +   + F 
Sbjct  161  LWYMLSKTLAEKAAWEFAKENGIDLVTINPGYVIGPILQPTVNFSVEIILNLLNGAQTF-  219

Query  362  SSPFNCY--VDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEK  535
              P  CY  VDVRDVA AHI AFE  SA GRYCLVG+ +   + LKI+  LYP+L +PEK
Sbjct  220  --PNKCYRFVDVRDVALAHILAFENHSAHGRYCLVGDVVHCHDALKILRNLYPTLHLPEK  277

Query  536  YKGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + + P +  +++S+ KA+SLG+NFTP EVSL+DT+E LKEK 
Sbjct  278  CEDEKPFLSKYEISRKKAESLGVNFTPFEVSLRDTVECLKEKG  320



>ref|XP_010045029.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Eucalyptus grandis]
Length=327

 Score =   251 bits (641),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 162/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC + PSV+RVV+TSS A+V+Y   P +   V+DE+WFSD +   +T 
Sbjct  104  DPAVKGTLNVLKSCSKAPSVQRVVLTSSIAAVVYNGQPRTPEVVVDESWFSDPDLCRQTN  163

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+  E  IDMV+++PA+VIGPLLQP LN S+  I + I     F 
Sbjct  164  AWYLLSKTLAEDAAWKFVKEKGIDMVTINPAMVIGPLLQPTLNTSAAAIGNLINGAPTFP  223

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI AFEVPSASGRYCLV      SE+++I+ +LYPS+ +PEK  
Sbjct  224  NASFG-WVNVKDVANAHILAFEVPSASGRYCLVERIAHCSEIVRILRELYPSVQLPEKSA  282

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +P ++VS++K KSLGI+  PL  SLK+T+ESLKEK 
Sbjct  283  DDKPFVPIYQVSKEKVKSLGIDCIPLNQSLKETVESLKEKG  323



>gb|KCW87173.1| hypothetical protein EUGRSUZ_B03696 [Eucalyptus grandis]
Length=375

 Score =   253 bits (645),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 162/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC + PS++RVV+TSS A+V Y   P +   V+DE+WFSD +   +T 
Sbjct  152  DPAVKGTLNVLKSCSKAPSLQRVVLTSSMAAVAYNRQPRTPEVVVDESWFSDPDLCRQTN  211

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+  E  IDMV+++PA+VIGPLLQP LN S+  I + I     F 
Sbjct  212  AWYVLSKTLAEDAAWKFVKEKGIDMVTINPAMVIGPLLQPTLNTSAAAIGNLINGAPTFP  271

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI AFEVPSASGRYCLV      SE+++I+ +LYPS  +PEK  
Sbjct  272  NASFG-WVNVKDVANAHILAFEVPSASGRYCLVERIAHYSEIVRILRELYPSAQLPEKSA  330

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +P ++VS++K KSLGIN+ PLE +LK+T+ESLKEK 
Sbjct  331  DDKPFVPIYQVSKEKVKSLGINYIPLEQNLKETVESLKEKG  371



>ref|XP_006470635.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Citrus sinensis]
Length=328

 Score =   251 bits (641),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 164/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC + PS+KRVV+TSS A+V+    P +   V+DE WFSD E  ++++
Sbjct  105  DPAVKGTLNVLNSCAKFPSIKRVVLTSSMAAVLNTGKPRTPDVVVDETWFSDPEVCKQSE  164

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AE+AAWK+A E  ID+V+++PA+VIGPLLQP LN S+  +L  IK  + + 
Sbjct  165  LWYPLSKTLAEDAAWKFAKEKSIDLVTINPAMVIGPLLQPTLNTSAAAVLSLIKGAQTYP  224

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  F  +V+V+DVANAHI+AFEVPSA+GRYCLV      SE++ I+ +LYP+  +PEK  
Sbjct  225  NVTFG-WVNVKDVANAHIQAFEVPSANGRYCLVERVSHYSEIVNIIRELYPAFQLPEKCA  283

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PT++V ++K K+LGI F P+EVSLK+TIESLKEK 
Sbjct  284  DDKPHVPTYQVLKEKVKNLGIEFIPVEVSLKETIESLKEKG  324



>ref|XP_004307228.1| PREDICTED: uncharacterized protein LOC101295856 [Fragaria vesca 
subsp. vesca]
Length=638

 Score =   260 bits (664),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 164/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVLGSCV+  SVKRVV+TSS A+V Y    ++    IDE+WFSD  F E+TK
Sbjct  417  DPALKGTLNVLGSCVKISSVKRVVITSSMAAVAYNGKHLADDVTIDESWFSDPAFCEKTK  476

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AEEAAWK+A E  ID+++++P  VIGPLLQP LNFS E +L  +    +F+
Sbjct  477  LWYQLSKTLAEEAAWKFAKEKGIDVITINPGWVIGPLLQPTLNFSVEPVLKLVNGTEKFL  536

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++    +VDVRDVANAHI AFE PSASGRYCLVG     SEV+K++  + P L +P K  
Sbjct  537  NTTHR-FVDVRDVANAHILAFENPSASGRYCLVGSIKHCSEVVKMLHDISPDLNLPNKCA  595

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P  PT++VS+++A+SLG+ +TPLEV+L+DT+ESLK+KN
Sbjct  596  DDKPFTPTYQVSKERAQSLGVKYTPLEVTLEDTVESLKDKN  636


 Score =   238 bits (608),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 155/207 (75%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SCV+ PSVKRVV+TSS A+V +   P ++   IDE WFSD  F E++K
Sbjct  106  DPALKGTLNVLESCVKVPSVKRVVITSSIATVAFNGKPETSDVTIDETWFSDPAFCEKSK  165

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK+ AE+AAW++A E  ID+V+++PA VIGPLLQP LN S+E +L+ +    +F 
Sbjct  166  LWYVLSKILAEQAAWEFAKEKGIDIVTINPAWVIGPLLQPTLNLSAEQVLNLVNGKEQFP  225

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  +  +VDVRDVANAHI AFE PSA GRYCLVG T   SE++K++S ++P+L +P+K  
Sbjct  226  NKNYR-FVDVRDVANAHILAFENPSAWGRYCLVGSTNHCSEIVKMLSSIFPTLTLPDKCA  284

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLE  622
             D P  PT +VS+++A+SLG+ +T LE
Sbjct  285  DDEPFPPTCQVSKERAQSLGVKYTLLE  311



>ref|XP_008349627.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Malus domestica]
Length=326

 Score =   251 bits (640),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 158/223 (71%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNVL SC + P+VKRVV+TSS ASV     P+++  V+DE W+SD    E+ +
Sbjct  101  EPAVKGTLNVLKSCAKFPTVKRVVLTSSMASVSVNGKPLTSDVVLDETWYSDPLVCEKNE  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            +WY LSK  AEEAAWKYA EN ID+V+++P  VIGPLLQP LN   EMI + I  G    
Sbjct  161  RWYALSKTLAEEAAWKYAKENGIDLVTMNPGFVIGPLLQPTLNLXVEMIQNLIT-GTGTK  219

Query  362  SSPFNCY--VDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEK  535
            + P + Y  +DVRDV +AHI AFEVPSASGRYCLV      SEVLKI+  LYP+L +PEK
Sbjct  220  TLPLSNYRSIDVRDVVSAHILAFEVPSASGRYCLVSNVTHASEVLKIIQDLYPTLHLPEK  279

Query  536  YKGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             +      P + +S +KAK LGINF PLEVSL+DTIESLKEK 
Sbjct  280  CEIGSSSDPKYPISAEKAKGLGINFLPLEVSLRDTIESLKEKG  322



>ref|XP_010067842.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW66049.1| hypothetical protein EUGRSUZ_G03341 [Eucalyptus grandis]
Length=324

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 161/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAV+GTLN+L SC + PS+KRVV+TSS A+V+    P+++  V+DE WFSD  F +E+K
Sbjct  101  NPAVEGTLNILRSCAKVPSIKRVVLTSSMAAVVCNGKPLTSDVVVDETWFSDPAFCKESK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAW +A ENR+D+V ++P  VIGPLLQP +N S EMIL+ +   + F+
Sbjct  161  LWYVLSKTLAEKAAWDFARENRMDLVVINPGHVIGPLLQPTINLSMEMILNLVNGAQTFL  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  +  +VDVRDVA+AHI A E PSASGRYC+ GE +    VLKI+   YP+L +PEK +
Sbjct  221  NISYK-FVDVRDVADAHILALENPSASGRYCMAGEAIHCHGVLKILHNFYPTLHLPEKCE  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P     +VS+++ + LG+ F PLEVSL+DT+ESLKEK 
Sbjct  280  NDKPYESAPRVSREQIEGLGVKFIPLEVSLRDTVESLKEKG  320



>ref|XP_004143234.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Cucumis sativus]
Length=325

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 161/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL S  ++ SVKRVV+TSS A+V Y   P +   VIDE WFS+ E  +E K
Sbjct  102  DPALKGTLNVLKSVAKSSSVKRVVLTSSMAAVAYSGQPRNPDTVIDETWFSNPEICKEMK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAW +  E  IDMV+++PA+VIGPLLQP LN S+E IL+ I   + F 
Sbjct  162  LWYVLSKTLAEEAAWNFVKEKGIDMVTINPAMVIGPLLQPTLNTSAEAILNLISGAQTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +S F  +V+V+DVANAHI A+EVPSA+GRYCLV   +  S ++K++  LYPSL +P+K  
Sbjct  222  NSTFG-WVNVKDVANAHILAYEVPSANGRYCLVESVIHYSGIVKLLHDLYPSLQLPDKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P  P ++VS +KAK+LGI F PL  SLK+T+ESLKEKN
Sbjct  281  DDKPFTPVYQVSVEKAKNLGIQFIPLAESLKETVESLKEKN  321



>ref|XP_008790957.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X3 [Phoenix 
dactylifera]
Length=297

 Score =   249 bits (637),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 162/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKG LNV GSC++TPSVKRVVVTSS A+V++   P +   VID  WFS  EF E+ K
Sbjct  67   DPAVKGALNVFGSCIKTPSVKRVVVTSSMAAVLHNGRPQTPDVVIDATWFSSVEFCEQEK  126

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            +WY LSK  AEEAAWK++ +N IDMV++HP +VIGPLLQP LN SS M+L+ +     + 
Sbjct  127  KWYPLSKTLAEEAAWKFSKDNSIDMVTIHPGVVIGPLLQPTLNESSAMLLNLLNGSSTYP  186

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  F  +V+V+DVA AHI AFEVPSASGRY LV      SE++KI+ + YP+L +PEK  
Sbjct  187  NLRFP-WVNVKDVAMAHILAFEVPSASGRYFLVERVAHYSEIVKILREQYPALKLPEKCV  245

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +P ++VS++K KSLGI++ P+  S+K+T+ESLKEK 
Sbjct  246  DDKPFLPIYQVSKEKEKSLGIDYVPIVTSIKETVESLKEKG  286



>ref|XP_010067827.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Eucalyptus grandis]
Length=324

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 167/223 (75%), Gaps = 5/223 (2%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC +  SVKRVVVTSSTA+V + + P+++  VIDE W+SD EF +++K
Sbjct  101  DPALKGTLNVLRSCAKASSVKRVVVTSSTAAVAFSAKPLTSGIVIDETWYSDPEFCKKSK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAW++A EN ID+V+++P  +IGP+LQP +NFS E+IL+ I   + F 
Sbjct  161  LWYMLSKTLAEKAAWEFAKENGIDLVTINPGYMIGPILQPSVNFSVEIILNLINGAQTF-  219

Query  362  SSPFNCY--VDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEK  535
              P  CY  VDVRDVA+AHI AFE  SA GRYCLV +T+   +VL+I+  LYP+L +P+K
Sbjct  220  --PNTCYRFVDVRDVAHAHILAFENHSAHGRYCLVAKTVHCHDVLQILRNLYPTLHLPKK  277

Query  536  YKGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + + P     ++S  KA++LG++FTPLEVSL+DT+E LKEK 
Sbjct  278  CEDEKPFSLKNEISTKKAEALGVDFTPLEVSLRDTVECLKEKG  320



>ref|XP_010493008.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Camelina sativa]
Length=326

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 164/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +  SVKRVVVTSS A+V     P +    +DE WFSD E  E +K
Sbjct  103  DPAVKGTLNVLNSCAKASSVKRVVVTSSMAAVNCNGKPRTPDVTVDETWFSDPELCEASK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK A E  +++V+++PA+VIGPLLQP LN S+  IL+ I   + F 
Sbjct  163  MWYVLSKTLAEDAAWKLAKEKGLEIVTINPAMVIGPLLQPTLNTSAATILNLINGAKTFP  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  F  +V+V+DVANAHI+AFEVPSA+GRYC+V      SE++ I+ +LYP++P+PEK +
Sbjct  223  NVSFG-WVNVKDVANAHIQAFEVPSANGRYCMVERVAHYSEMVSILHELYPNVPLPEKCE  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + P  PT++VS++K KSLGI++ PL+VS+K+T+ESLKEK 
Sbjct  282  DENPYAPTYQVSKEKIKSLGIDYVPLKVSIKETVESLKEKG  322



>gb|KCW87172.1| hypothetical protein EUGRSUZ_B03695 [Eucalyptus grandis]
Length=384

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 162/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC + PSV+RVV+TSS A+V+Y   P +   V+DE+WFSD +   +T 
Sbjct  161  DPAVKGTLNVLKSCSKAPSVQRVVLTSSIAAVVYNGQPRTPEVVVDESWFSDPDLCRQTN  220

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+  E  IDMV+++PA+VIGPLLQP LN S+  I + I     F 
Sbjct  221  AWYLLSKTLAEDAAWKFVKEKGIDMVTINPAMVIGPLLQPTLNTSAAAIGNLINGAPTFP  280

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI AFEVPSASGRYCLV      SE+++I+ +LYPS+ +PEK  
Sbjct  281  NASFG-WVNVKDVANAHILAFEVPSASGRYCLVERIAHCSEIVRILRELYPSVQLPEKSA  339

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +P ++VS++K KSLGI+  PL  SLK+T+ESLKEK 
Sbjct  340  DDKPFVPIYQVSKEKVKSLGIDCIPLNQSLKETVESLKEKG  380



>ref|XP_010045026.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Eucalyptus grandis]
 gb|KCW87169.1| hypothetical protein EUGRSUZ_B03694 [Eucalyptus grandis]
Length=327

 Score =   250 bits (639),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 161/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC + PSVKRVV+TSS  +V +   P++   V+DENWFSD EF  + K
Sbjct  104  DPALKGTLNVLKSCSKAPSVKRVVLTSSMGAVAFTGQPLTVDVVVDENWFSDPEFCRKRK  163

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AE+AAWK+  E  I+MV+++P LVIGPLLQP LN S+  I + +   + F 
Sbjct  164  MWYALSKTLAEDAAWKFVKEKGINMVTINPGLVIGPLLQPTLNTSAAAIANLVNGAQTFP  223

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++     V+V+DVA+AH+ AFE PSASGRYCLV      SE+++I+ +LYPSL +PEK  
Sbjct  224  NASTR-LVNVKDVADAHVLAFENPSASGRYCLVERVAHYSEIVRILRELYPSLQLPEKCT  282

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P  P+++VS+DKA+SLG+++ PLE SLK+T+ESLKEK 
Sbjct  283  DDKPFAPSYQVSKDKARSLGLDYIPLEQSLKETVESLKEKG  323



>gb|AAQ88099.1| NADPH-dependent cinnamyl alcohol dehydrogenase [Quercus suber]
 emb|CAJ43900.1| cinnamyl alcohol dehydrogenase [Quercus suber]
Length=326

 Score =   250 bits (639),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 162/220 (74%), Gaps = 0/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNVL SC + PSVKRVVVTSS A+V       +   V+DE WFSD +  +ETK
Sbjct  102  EPAVKGTLNVLNSCAKFPSVKRVVVTSSMAAVHCNKKAKAPDVVVDETWFSDPDVCKETK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY+LSK  AEE  WK+A E  ID+V+++PA+VIGPLLQP LN S+  IL+ I    +  
Sbjct  162  QWYMLSKTLAEENVWKFAKEKGIDIVTINPAMVIGPLLQPTLNTSAAAILNLINGTHQTF  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
             +    +V+V+DVANAHI+A+E+P+ASGRYCLV   +  SEV++++ +LYPS+ +PEK  
Sbjct  222  PNVAFGWVNVKDVANAHIQAYEIPTASGRYCLVESVIHHSEVVRVLRKLYPSVQLPEKCA  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P  PT++VS+++ +SLGI + P EVSLK+T+ESLKEK
Sbjct  282  DDKPFAPTYQVSKERTRSLGIEYIPFEVSLKETVESLKEK  321



>ref|XP_006393056.1| hypothetical protein EUTSA_v10011653mg [Eutrema salsugineum]
 gb|ESQ30342.1| hypothetical protein EUTSA_v10011653mg [Eutrema salsugineum]
Length=325

 Score =   250 bits (639),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/221 (54%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGT+NVL SC++T SVKRVV+TSS A+V +   P +   ++DE+WF+D E+   +K
Sbjct  102  DPAVKGTINVLSSCMKTSSVKRVVLTSSIAAVAFNGVPRTPETIVDESWFADPEYCRASK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE AAWK+A EN I +VS++PA+VIGPLLQP LN S+  +L  IK  + F 
Sbjct  162  LWYVLSKTLAENAAWKFAKENDIQLVSINPAMVIGPLLQPTLNTSAAAVLSLIKGAQTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI+AFE P+A+GRYCLV      SEV+ I+  LYP   +PEK  
Sbjct  222  NATFG-WVNVKDVANAHIQAFENPTANGRYCLVERVAHYSEVVNILHDLYPDFQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             +   +PT+KVS++KA+SLG++F PLEVS+K+T+ESL++K 
Sbjct  281  DEKIYIPTYKVSKEKAESLGVDFVPLEVSIKETVESLRDKG  321



>ref|XP_010493010.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Camelina 
sativa]
Length=327

 Score =   250 bits (639),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 163/221 (74%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +  S+KRVVVTSS A+V Y   P +    +DE WFSD E  E +K
Sbjct  103  DPAVKGTLNVLNSCAKASSIKRVVVTSSMAAVNYNGKPCTPDVTVDETWFSDPEHCEASK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK A E  +++V+++PA+VIGPLLQP LN S+  IL+ I  G +  
Sbjct  163  MWYVLSKTLAEDAAWKLAKEKGLEIVTINPAMVIGPLLQPTLNTSAAAILNLINAGAKTF  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
             +    +V V+DVANAHI+AFEVPSA+GRYC+V      S+V+ I+ +LYP++P+PE+  
Sbjct  223  PNVSFGWVYVKDVANAHIQAFEVPSANGRYCMVERVAHFSDVVSILHELYPNVPLPERCV  282

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + P MPT++VS++K KSLGI++ PL+VS+K+T+ESLKEK 
Sbjct  283  DENPYMPTYQVSKEKIKSLGIDYIPLKVSIKETVESLKEKG  323



>ref|XP_002314050.2| putative cinnamoyl-CoA reductase family protein [Populus trichocarpa]
 gb|EEE88005.2| putative cinnamoyl-CoA reductase family protein [Populus trichocarpa]
Length=325

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 158/221 (71%), Gaps = 3/221 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC +  S++RVV+TSS A+ +Y   P++   VIDE W+SD    +E K
Sbjct  104  DPALKGTLNVLRSCAKVHSIRRVVLTSSAAACIYSGKPLNHDVVIDETWYSDPAICKELK  163

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AEEAAW +A EN  D+V++HP+ VIGPLLQP LN S EMILD +     + 
Sbjct  164  AWYALSKTLAEEAAWNFAKENATDLVTVHPSFVIGPLLQPTLNLSVEMILDLVNGAETYP  223

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  + C +DVRDVANAHI+AFE+PSASGRY L       SEVLKI+ + YP+L +PEK  
Sbjct  224  NGYYRC-IDVRDVANAHIQAFEIPSASGRYVLTAYVTTFSEVLKIIRENYPTLRLPEKST  282

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
              +     ++VS++KAK+LGINFTPL++SL DTIESLKEK 
Sbjct  283  ESM--FKPYQVSKEKAKTLGINFTPLDLSLVDTIESLKEKG  321



>ref|XP_010519769.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Tarenaya hassleriana]
Length=320

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 164/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +T +VKRVVVTSS A+V Y   P +   ++DE WFSD E  + +K
Sbjct  98   DPAVKGTLNVLNSCSKTSTVKRVVVTSSMAAVAYNGKPRTPDVMVDETWFSDPEVCKASK  157

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WYILSK  AEEAAWKYA E  ID+V+++PA+VIGPLLQP LN S+  I   I   + F 
Sbjct  158  MWYILSKTLAEEAAWKYAKEKGIDIVTINPAMVIGPLLQPTLNTSAAAISSLINGTKTFP  217

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +S F  +V+V+DVANAHI AFE PSA+GRYCLV      SEV+ I+ +L+P+L +PEK  
Sbjct  218  NSSFG-WVNVKDVANAHILAFENPSANGRYCLVESVAHHSEVVNILRELFPNLQLPEKCA  276

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + P +PT++VS+++AKSLGI++ PL+VS+++T+ESLK K 
Sbjct  277  DEKPYVPTYQVSKERAKSLGIDYIPLKVSIQETVESLKGKG  317



>ref|XP_008449698.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Cucumis melo]
 ref|XP_008449699.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Cucumis melo]
Length=325

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 161/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL S  ++ SVKRVV+TSS A+V Y   P +   VIDE WFS+ E  +E K
Sbjct  102  DPALKGTLNVLKSVAKSSSVKRVVLTSSMAAVAYNGQPRNPDTVIDETWFSNPEICKELK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAW +  E  IDM++++PA+VIGPLLQP LN S+E IL+ I   + F 
Sbjct  162  LWYVLSKTLAEEAAWNFVREKGIDMITINPAMVIGPLLQPTLNTSAEAILNLISGAQTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +S F  +V+V+DVANAHI A+EVPSA+GRYCLV   +  S ++KI+  LYPSL +P+K  
Sbjct  222  NSTFG-WVNVKDVANAHILAYEVPSANGRYCLVESVIHYSGIVKILHDLYPSLQLPDKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P  P ++VS +KAK+LGI F PL  SLK+T+ESLKEKN
Sbjct  281  DDKPFTPVYQVSVEKAKNLGIQFIPLVESLKETVESLKEKN  321



>ref|XP_008231473.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like isoform 
X2 [Prunus mume]
Length=635

 Score =   259 bits (661),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 169/223 (76%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGT+NVL SCV+  +VKRVV+TSS A+V+    P++   V+DE WFSD  F E  K
Sbjct  410  DPAVKGTVNVLKSCVKFATVKRVVLTSSMAAVIVNGRPLNPDVVVDETWFSDPFFCENFK  469

Query  182  --QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGRE  355
              +WY+LSK  AEEAAWK+A  N ID+V+++P+ VIGPLLQP LN + EMIL+   +  +
Sbjct  470  IAKWYVLSKTLAEEAAWKFAEGNGIDLVTINPSYVIGPLLQPSLNLTVEMILNLKNDIED  529

Query  356  FMSSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEK  535
              SS + C  DVRDVA+AH++AFEVPSA+GRYCLVG  +  + VLKI+ +L+PSL  PEK
Sbjct  530  VNSSIYLCS-DVRDVASAHVQAFEVPSANGRYCLVGHVIPMANVLKILHELHPSLCPPEK  588

Query  536  YKGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
            Y+   P  PT++VSQ+KAKSLG+NF PLEVSL+DT+ESLKEK 
Sbjct  589  YEEANPSEPTYQVSQEKAKSLGVNFLPLEVSLRDTVESLKEKG  631


 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 162/210 (77%), Gaps = 5/210 (2%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SCV+  +VKRVV+TSSTA+V++   P++   V+DE WFSD  F E  K
Sbjct  101  DPAVKGTLNVLKSCVKFATVKRVVLTSSTAAVIFNGRPLTPDVVVDETWFSDPFFCENFK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEG---R  352
            QWY+LSK  AEEAAWK+A  N ID+V+++P+ VIGPLLQP LN + EMIL+ +K G   +
Sbjct  161  QWYVLSKTLAEEAAWKFAEGNGIDLVTINPSYVIGPLLQPSLNLTVEMILN-LKNGTLQQ  219

Query  353  EFMSSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPE  532
             +M+  F  + DVRDVA+AH++AFEVPSA+GRYCLVG  +  ++VLKI+ +L+PSL  PE
Sbjct  220  LYMNFLFQSF-DVRDVASAHVQAFEVPSANGRYCLVGHVIPMAKVLKILHELHPSLCPPE  278

Query  533  KYKGDLPIMPTFKVSQDKAKSLGINFTPLE  622
            KY+   P  PT++VSQ+KAKSLG+NF PLE
Sbjct  279  KYEEANPSEPTYQVSQEKAKSLGVNFLPLE  308



>ref|XP_010042035.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Eucalyptus grandis]
Length=324

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 162/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAV+GTLNVL SC + PS+KRVV TSS A+V+    P+++  V+DE WFSD  F EE+K
Sbjct  101  NPAVRGTLNVLKSCAKVPSIKRVVATSSMAAVVLNGKPLTSGVVVDETWFSDPVFCEESK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAW++A E RID+V ++P  VIGPLLQP +N S E+IL+ +    EF 
Sbjct  161  LWYMLSKTLAEKAAWEFAKEKRIDLVVMNPGHVIGPLLQPTVNLSVELILNFVNGTEEFP  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ +  +VDVRDVA AHI+A E PSASGRYC+VG  M   ++ KI+  LYP+L +PEK +
Sbjct  221  NASYG-FVDVRDVARAHIQAVENPSASGRYCVVGGVMHRPDMSKILHHLYPTLRLPEKCE  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + P +   ++S++K + LG+N  PLEVS+K+T+ESLKEK 
Sbjct  280  DNKPAVAAHRISREKVEGLGVNLIPLEVSIKETVESLKEKG  320



>ref|XP_010461970.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Camelina sativa]
Length=325

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGT+NVL SC++T SVKRVV+TSS A+V +   P +   ++DE+WF+D E+   +K
Sbjct  102  DPAVKGTINVLSSCLKTSSVKRVVLTSSIAAVAFNGMPRTPETIVDESWFADPEYCRASK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE AAWK+A EN + +VS++PA+VIGPLLQP LN S+  +L  IK  + F 
Sbjct  162  LWYVLSKTLAENAAWKFAEENELQLVSINPAMVIGPLLQPTLNTSAAAVLSLIKGAQTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI+AFE P+A+GRYCLV      SEV+ I++ LYP   +PEK  
Sbjct  222  NATFG-WVNVKDVANAHIQAFENPTANGRYCLVERVAHYSEVVNILNDLYPEFQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             +   +PT+KVS++KA+SLG+ F PLEVS+K+T+ESL++K 
Sbjct  281  DEKIYIPTYKVSKEKAESLGVEFVPLEVSIKETVESLRDKG  321



>ref|XP_007052475.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOX96632.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=326

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 165/222 (74%), Gaps = 4/222 (2%)
 Frame = +2

Query  5    PAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETKQ  184
            PA+KGTLNVL SC + PS+KRVV+TSS ASV++   P++   ++DE WFSD  F EE+K 
Sbjct  103  PALKGTLNVLKSCAKVPSIKRVVLTSSMASVLFNGKPLTPDVMVDETWFSDPRFCEESKL  162

Query  185  WYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFMS  364
            WY+ SK  AEEAAW +  +N ID+V+++P +VIGPLLQP LN +SE+IL+  K    F S
Sbjct  163  WYMASKTLAEEAAWSFTKDNGIDLVTINPGVVIGPLLQPALNLTSELILNLTKGEHTFPS  222

Query  365  SPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYKG  544
              F   +DVRDVA AHI+AFE+PSASGRYCLV   +   E+LK++S+ YP+L + EK  G
Sbjct  223  PTFR-LIDVRDVAYAHIQAFEIPSASGRYCLVERIVHYLEILKVLSEHYPALGLQEKC-G  280

Query  545  DL--PIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
            DL  P+  T+++S++KAKSLG++F P EVSLK+ +ESLKEK 
Sbjct  281  DLNKPLERTYQISKEKAKSLGVSFIPWEVSLKEIVESLKEKG  322



>ref|XP_010500717.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Camelina sativa]
Length=333

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGT+NVL SC++T SVKRVV+TSS A+V +   P +   ++DE+WF+D E+   +K
Sbjct  110  DPAVKGTINVLSSCLKTSSVKRVVLTSSIAAVAFNGMPRTPETIVDESWFADPEYCRASK  169

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE AAWK+A EN + +VS++PA+VIGPLLQP LN S+  +L  IK  + F 
Sbjct  170  LWYVLSKTLAENAAWKFAEENELQLVSINPAMVIGPLLQPTLNTSAAAVLSLIKGAQTFP  229

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI+AFE P+A+GRYCLV      SEV+ I++ LYP   +PEK  
Sbjct  230  NATFG-WVNVKDVANAHIQAFENPTANGRYCLVERVAHYSEVVNILNDLYPEFQLPEKCA  288

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             +   +PT+KVS++KA+SLG+ F PLEVS+K+T+ESL++K 
Sbjct  289  DEKIYIPTYKVSKEKAESLGVEFVPLEVSIKETVESLRDKG  329



>ref|XP_007149032.1| hypothetical protein PHAVU_005G034800g [Phaseolus vulgaris]
 gb|ESW21026.1| hypothetical protein PHAVU_005G034800g [Phaseolus vulgaris]
Length=325

 Score =   249 bits (637),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 163/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SCV +P++KRVV+TSS A+V +   P +   V+DE W+SD E+ +E  
Sbjct  102  DPALKGTLNVLKSCVNSPTLKRVVLTSSIAAVSFNYRPKTPDVVVDETWYSDPEYCKENG  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AE+AAWK+  EN ID+V+++PALV GPLLQP LN S+ ++L+ +   + F 
Sbjct  162  LWYNLSKTLAEDAAWKFVKENNIDLVTVNPALVSGPLLQPELNTSASVVLNLVNGAQTFK  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +     +VDVRDVA AHI A+E  SA+GRY LV      SEV+KI+  LYP+L IPEK +
Sbjct  222  NDIVG-WVDVRDVAMAHILAYESASANGRYLLVDRVAHFSEVVKILRDLYPTLQIPEKCE  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +P F+VS++KAKSLG+ FTPLEVSLKDT+ESLKEKN
Sbjct  281  DDKPYVPIFQVSKEKAKSLGLEFTPLEVSLKDTVESLKEKN  321



>ref|XP_008790954.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Phoenix 
dactylifera]
Length=331

 Score =   249 bits (637),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 162/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKG LNV GSC++TPSVKRVVVTSS A+V++   P +   VID  WFS  EF E+ K
Sbjct  101  DPAVKGALNVFGSCIKTPSVKRVVVTSSMAAVLHNGRPQTPDVVIDATWFSSVEFCEQEK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            +WY LSK  AEEAAWK++ +N IDMV++HP +VIGPLLQP LN SS M+L+ +     + 
Sbjct  161  KWYPLSKTLAEEAAWKFSKDNSIDMVTIHPGVVIGPLLQPTLNESSAMLLNLLNGSSTYP  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  F  +V+V+DVA AHI AFEVPSASGRY LV      SE++KI+ + YP+L +PEK  
Sbjct  221  NLRFP-WVNVKDVAMAHILAFEVPSASGRYFLVERVAHYSEIVKILREQYPALKLPEKCV  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +P ++VS++K KSLGI++ P+  S+K+T+ESLKEK 
Sbjct  280  DDKPFLPIYQVSKEKEKSLGIDYVPIVTSIKETVESLKEKG  320



>ref|XP_006851070.1| hypothetical protein AMTR_s00025p00240180 [Amborella trichopoda]
 gb|ERN12651.1| hypothetical protein AMTR_s00025p00240180 [Amborella trichopoda]
Length=318

 Score =   249 bits (636),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 164/220 (75%), Gaps = 3/220 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVLGSC +T SVKRV+VTSS A+V+   NP +   V+DE WFSD    ++ K
Sbjct  99   DPAVKGTLNVLGSCSKTLSVKRVIVTSSMAAVLVNRNPQNPDVVVDETWFSDPTVCKDIK  158

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAW +A E  ID+V+++PA+VIGPLLQP LN S   IL+ +     ++
Sbjct  159  SWYVLSKTLAEKAAWDFAKEKGIDLVTINPAMVIGPLLQPTLNTSCAAILNLVNGSPTYV  218

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            S+ F  +V+V+DVA AHI A+EVPSASGRYC+    + +SE++K++ +LYP  P+P+K  
Sbjct  219  SANFG-WVNVKDVAEAHILAYEVPSASGRYCMTERVVHSSEIVKLLHELYPEYPVPQKCA  277

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             +    PTFKVS++KA+ LG+NF PLEVSLK+T+ESLKEK
Sbjct  278  DE--NRPTFKVSKEKAQKLGVNFIPLEVSLKETVESLKEK  315



>ref|XP_009354351.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like isoform 
X1 [Pyrus x bretschneideri]
Length=326

 Score =   249 bits (637),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 159/223 (71%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNVL SCV+ P+VKRVV+TSS ASV     P+++  V+DE W+SD    E+ +
Sbjct  101  EPAVKGTLNVLKSCVKIPTVKRVVLTSSMASVSVNGKPLTSDVVLDETWYSDPLVCEKNE  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            +WY LSK  AEEAA KYA EN ID+V+++P  VIGPLLQP LN S EMI + I  G    
Sbjct  161  RWYALSKTLAEEAACKYAKENGIDLVTMNPGFVIGPLLQPTLNLSVEMIQNLIT-GTGTK  219

Query  362  SSPFNCY--VDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEK  535
            + P + Y  +DVRDV +AHI AFEVPSASGRYCLV      SEVLKI+  LYP+L +PE+
Sbjct  220  TLPISNYRSIDVRDVVSAHILAFEVPSASGRYCLVSNVTHASEVLKIIQDLYPTLHLPEE  279

Query  536  YKGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             +      P + VS +KAK LGINF PLEVSL+DTIESLKEK 
Sbjct  280  CEIGTTSDPKYPVSAEKAKGLGINFLPLEVSLRDTIESLKEKG  322



>ref|XP_006400504.1| hypothetical protein EUTSA_v10014099mg [Eutrema salsugineum]
 gb|ESQ41957.1| hypothetical protein EUTSA_v10014099mg [Eutrema salsugineum]
Length=326

 Score =   249 bits (636),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 164/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +  SVKRVVVTSS A+V Y   P +    +DE WFSD E  + +K
Sbjct  103  DPAVKGTLNVLNSCTKASSVKRVVVTSSMAAVGYNGKPRTPEVTVDETWFSDPELCKASK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+A E  + +V+++PA+VIGPLLQP LN S+  IL+ I   + F 
Sbjct  163  MWYVLSKTLAEDAAWKFAKEKGLAIVTINPAMVIGPLLQPTLNTSAAAILNFINGAKTFA  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI+AFEV SA+GRYCLV      SEV+ I+ +LYP+L +PE+  
Sbjct  223  NASFG-WVNVKDVANAHIQAFEVSSANGRYCLVERVAHHSEVVNILRELYPNLQLPERCV  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + P +PT++VS++K +SLGI++ PL+VS+K+T+ESLKEK 
Sbjct  282  DENPYVPTYEVSKEKTRSLGIDYIPLKVSIKETVESLKEKG  322



>ref|XP_003567728.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Brachypodium distachyon]
Length=329

 Score =   249 bits (635),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/221 (54%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +  S+KRVV+TSS A+V++  NP+S   V+D+  FS  E  E+ K
Sbjct  106  DPAVKGTLNVLASCKKASSLKRVVLTSSMAAVVFTENPLSPEVVVDDTSFSIPELCEKAK  165

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            +WY+LSK  AE+AAWK++ +N ID+V+++PA+VIGPLLQP LN S++++L  I     ++
Sbjct  166  EWYVLSKTLAEQAAWKFSKDNGIDLVTINPAMVIGPLLQPTLNTSAQLVLYLISGSPVYL  225

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  F  +V+V+DVA AH+ A EVPSASGRYC+V   +  SE++KI+ ++YPSLP+P+K  
Sbjct  226  NYSFG-WVNVKDVALAHVLACEVPSASGRYCMVDRVIHFSEIVKIIHEMYPSLPVPDKCA  284

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P  PT++VS+DK KSLGI  TP E SLK+TIE LK+K+
Sbjct  285  DDQPFAPTYQVSRDKVKSLGIELTPFETSLKETIECLKDKS  325



>ref|XP_010042036.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Eucalyptus grandis]
Length=324

 Score =   248 bits (634),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 120/223 (54%), Positives = 162/223 (73%), Gaps = 5/223 (2%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC +  S+KRVVVTSS A+V + + P+++  VIDE W SD EF E++K
Sbjct  101  DPALKGTLNVLRSCAKASSIKRVVVTSSMAAVAFTAKPLTSGVVIDETWHSDPEFCEKSK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAW++A EN ID+V+++P  VIGP+LQP +N + + IL+ I   + F 
Sbjct  161  LWYMLSKTLAEKAAWEFAKENGIDLVTINPGYVIGPILQPTVNLTVQTILNFINGAQTF-  219

Query  362  SSPFNCY--VDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEK  535
              P  CY  VDVRDV  AHI AFE  SA GRYCLVGE +   + L+I+  LYP+L +PEK
Sbjct  220  --PNTCYRFVDVRDVTLAHILAFENHSAHGRYCLVGEVVHCHDALQILRNLYPTLHLPEK  277

Query  536  YKGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + + P    +++S+ KA++LG+NFTPLEVSL+DT+E LKEK 
Sbjct  278  CEDEKPFSSKYEISRKKAEALGVNFTPLEVSLRDTVECLKEKG  320



>ref|XP_008375211.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Malus domestica]
Length=321

 Score =   248 bits (634),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 163/221 (74%), Gaps = 3/221 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAV GTLNVL SCV+ P+VKRVV+TSS A+VM    P+++  V+DE W+SD    E+ K
Sbjct  102  DPAVNGTLNVLKSCVKFPTVKRVVITSSMATVMMSGKPLASDVVVDETWYSDPLVCEKYK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY++SK  AE+AAW++A  N ID+V++HP  VIGPLLQP LN + E I   I  G +  
Sbjct  162  QWYMVSKTLAEKAAWEFAKGNEIDLVTIHPGFVIGPLLQPTLNLTVEPIQKLIT-GTKPT  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
             S F  +VDVRDVA+AHI+AF VPSASGRYCLVG    T EVLKI+ +LYP+L +PEK++
Sbjct  221  VSNFR-FVDVRDVASAHIQAFAVPSASGRYCLVGHVADTFEVLKILRELYPTL-LPEKFE  278

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
                  P ++VS +KAK LG++F PLE++L+DT+ESLKEK 
Sbjct  279  IGNTSDPKYQVSSEKAKGLGVSFLPLEITLRDTVESLKEKG  319



>ref|XP_006482921.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like isoform 
X1 [Citrus sinensis]
Length=321

 Score =   248 bits (633),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 159/221 (72%), Gaps = 3/221 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC R  S+KRVVVTSS  S ++   P++   ++DE WFSD +  +E K
Sbjct  100  DPAVKGTLNVLRSCARVDSIKRVVVTSSIVSTLFTGTPLTPDVIVDEMWFSDLDVCKELK  159

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY +SK  AE+AAWK+A EN ID+V++HP LV+GPLLQP LN S E+IL  I +G    
Sbjct  160  HWYAISKTLAEQAAWKFAEENGIDLVTIHPGLVLGPLLQPNLNLSVEVILKLI-QGSPIY  218

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
             SP+   VDVRDVA+AHI+A EVP A+GRY +VG     +EV+  + Q YP++ +PEK +
Sbjct  219  PSPYRL-VDVRDVAHAHIQALEVPMANGRYMMVGRVTHDNEVVNFLCQNYPAMHLPEKSE  277

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D    PT+ VSQ++AKSLGINF P E+S+KDTIESLKEK 
Sbjct  278  -DYKYEPTYHVSQERAKSLGINFMPWELSVKDTIESLKEKG  317



>ref|XP_009144901.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Brassica 
rapa]
Length=325

 Score =   248 bits (634),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 163/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGT+NVL +C++TPSVKRVV+TSS ASV +   P +   ++DE+WF+D E+    K
Sbjct  102  DPAVKGTINVLSTCLKTPSVKRVVLTSSIASVAFNGMPRTPETIVDESWFADPEYCRAAK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE AAWK+A EN + +VS++ A+VIGPLLQP LN S+  +L  IK  + F 
Sbjct  162  LWYVLSKTLAENAAWKFAKENDLQLVSINAAMVIGPLLQPTLNTSAAAVLSLIKGAQTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI+AFE P+A+GRYCLV      SEV+ I+  LYP   +PEK  
Sbjct  222  NATFG-WVNVKDVANAHIQAFENPTANGRYCLVERVAHYSEVVNILHDLYPDFQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             +   +PT+KVS++KA+SLG+ F PLEVS+K+T+ESL++K 
Sbjct  281  DEKIYIPTYKVSKEKAESLGVEFVPLEVSIKETVESLQDKG  321



>ref|XP_010479624.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Camelina sativa]
Length=333

 Score =   248 bits (634),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGT+NVL SC++T SVKRVV+TSS A+V +   P +   ++DE+WF+D E+   +K
Sbjct  110  DPAVKGTINVLSSCLKTSSVKRVVLTSSIAAVAFNGMPRTPDTIVDESWFADPEYCRASK  169

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE AAWK+A EN + +VS++PA+VIGPLLQP LN S+  +L  IK  + F 
Sbjct  170  LWYVLSKTLAENAAWKFAEENDLQLVSINPAMVIGPLLQPTLNTSAAAVLSLIKGAQTFP  229

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI+AFE P+A+GRYCLV      SEV+ I++ LYP   +PE+  
Sbjct  230  NATFG-WVNVKDVANAHIQAFENPTANGRYCLVERVAHYSEVVNILNDLYPEFQLPERCA  288

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             +   +PT+KVS++KA+SLG+ F PLEVS+K+T+ESL++K 
Sbjct  289  DEKIYIPTYKVSKEKAESLGVEFVPLEVSIKETVESLRDKG  329



>ref|XP_008349605.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Malus domestica]
Length=326

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 157/222 (71%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNV  SC +  +VKRVV+TSS ASV+    P+++  V DE W+SD  F E+ K
Sbjct  101  EPAVKGTLNVXKSCXKFTTVKRVVLTSSMASVIMSGKPLTSDVVFDETWYSDPLFCEKNK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKE-GREF  358
            QWY+LSK  AEEAAWKYA  N ID+V+++P LVIGPLLQP LN S + I + I   G E 
Sbjct  161  QWYVLSKTLAEEAAWKYAKANGIDLVTMNPGLVIGPLLQPTLNLSVKXIQNLITSTGTET  220

Query  359  MSSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKY  538
            +      +VDVRDV +AH  AFEVPSASGRYCLV     +SEVL+I+ +LYP+L  PEK 
Sbjct  221  LPLSNYRFVDVRDVXSAHXLAFEVPSASGRYCLVSNVTHSSEVLRIIQELYPTLHHPEKC  280

Query  539  KGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
            +      P ++VS +KAK LGINF PLEVSL+DTIES KEK 
Sbjct  281  EIGXTSDPIYQVSXEKAKGLGINFRPLEVSLRDTIESXKEKG  322



>ref|XP_003598007.1| CCP [Medicago truncatula]
 gb|AES68258.1| cinnamyl-alcohol dehydrogenase-like protein [Medicago truncatula]
Length=322

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/220 (55%), Positives = 161/220 (73%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+ GTLNVL SC ++P +KRVV+TSS A+V Y   P +   V+DE WF+D +F  +  
Sbjct  99   DPALNGTLNVLKSCAKSPLLKRVVLTSSAAAVAYNEKPRTPDVVVDETWFTDADFCAKLN  158

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY +SK  AEEAAWK+  EN IDMV+++PA+VIGPLLQP+LN S+  IL+ I   + F 
Sbjct  159  LWYAVSKTLAEEAAWKFVKENNIDMVTINPAMVIGPLLQPVLNTSAAAILNLINGTQTFP  218

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +S    +V V+DVANAHI A+E  SASGR+CLV      SE++KI+ +LYPSL +PEK  
Sbjct  219  NSTLG-WVYVKDVANAHILAYENASASGRHCLVESVAHYSEIVKILRELYPSLQLPEKCA  277

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P +PT++ S++KA SLGI +TPLEVS+K+T+ESLKEK
Sbjct  278  DDKPYVPTYQFSKEKATSLGIEYTPLEVSIKETVESLKEK  317



>gb|AFK46906.1| unknown [Lotus japonicus]
Length=324

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 162/220 (74%), Gaps = 2/220 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC ++PSVKRVV+TSS ++V +   P S   V+DE WFSD  F  E+K
Sbjct  102  DPAVKGTLNVLKSCAKSPSVKRVVLTSSVSAVQFNERPKSPEVVVDETWFSDPVFCRESK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AE+AAWK+  EN+IDMV L+P+LV GPLLQP +N+S E IL+ I  G  F 
Sbjct  162  LWYTLSKTLAEDAAWKFVNENKIDMVVLNPSLVSGPLLQPEVNYSVERILNLIN-GVPFP  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +S    +VDV+DVA AHI+A+E+ SASGRYCLV   +  SE+ +I+  LYP++ I  + +
Sbjct  221  NSSMG-WVDVKDVAKAHIQAYEIASASGRYCLVERVVHYSELARILGDLYPTIQISNRCE  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             + P +PT++ SQ+KAKSLGI FTPLE+S+K T+ES +EK
Sbjct  280  DNGPYVPTYQYSQEKAKSLGIEFTPLEISIKGTVESFREK  319



>ref|XP_010102364.1| hypothetical protein L484_015313 [Morus notabilis]
 gb|EXB93325.1| hypothetical protein L484_015313 [Morus notabilis]
Length=328

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 163/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL +C ++PSVKRVV+TSS A+V+Y   P +    +DE WFS  +  +E K
Sbjct  105  DPAIKGTLNVLNACAKSPSVKRVVLTSSIAAVVYTGKPRTPDVTVDETWFSIPDICKELK  164

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+  +  IDMV+++PA+VIGPLLQP LN SS +I + I   + F 
Sbjct  165  LWYVLSKTLAEDAAWKFVKQKGIDMVTINPAMVIGPLLQPTLNASSAVISNLINGAQTFP  224

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +     +V+V+DVANAHI A+EVPSASGRY LV      SE+++I+ +LYPS P+P++  
Sbjct  225  NFTVG-WVNVKDVANAHILAYEVPSASGRYVLVESVSHYSEIVRILRELYPSAPLPDRCA  283

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P MPT++VS+ KAKSLGI++ PL+ SLK+T+ESLKEK 
Sbjct  284  DDKPFMPTYQVSKGKAKSLGIDYIPLKTSLKETVESLKEKQ  324



>ref|XP_006482922.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like isoform 
X2 [Citrus sinensis]
Length=326

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 159/221 (72%), Gaps = 3/221 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC R  S+KRVVVTSS  S ++   P++   ++DE WFSD +  +E K
Sbjct  105  DPAVKGTLNVLRSCARVDSIKRVVVTSSIVSTLFTGTPLTPDVIVDEMWFSDLDVCKELK  164

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY +SK  AE+AAWK+A EN ID+V++HP LV+GPLLQP LN S E+IL  I +G    
Sbjct  165  HWYAISKTLAEQAAWKFAEENGIDLVTIHPGLVLGPLLQPNLNLSVEVILKLI-QGSPIY  223

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
             SP+   VDVRDVA+AHI+A EVP A+GRY +VG     +EV+  + Q YP++ +PEK +
Sbjct  224  PSPYRL-VDVRDVAHAHIQALEVPMANGRYMMVGRVTHDNEVVNFLCQNYPAMHLPEKSE  282

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D    PT+ VSQ++AKSLGINF P E+S+KDTIESLKEK 
Sbjct  283  -DYKYEPTYHVSQERAKSLGINFMPWELSVKDTIESLKEKG  322



>ref|XP_009413954.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Musa acuminata subsp. 
malaccensis]
Length=376

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 162/221 (73%), Gaps = 2/221 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNVL SC +  SVK+VVVTSS A+V Y S P +   V+DE WFS  E  E+ K
Sbjct  154  EPAVKGTLNVLASC-KNSSVKKVVVTSSMAAVAYNSKPRTPDVVVDETWFSSPEVCEQQK  212

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY+LSK  AEEAAWK++ EN ID+V+++P +V GPLLQ  LN SS  IL+ I     F 
Sbjct  213  QWYVLSKTLAEEAAWKFSKENGIDIVTINPGMVTGPLLQSTLNTSSAAILNLINGSSTFP  272

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVA AH+ AFE+PSASGRYCLV   +  SE+LKI+ +LYPS  +P+K  
Sbjct  273  NATFG-WVNVQDVAMAHVLAFELPSASGRYCLVERVVHYSEILKIIHELYPSFQLPDKCA  331

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +P +KVS++K KSLG+ + PLE S+K+TIESLKEKN
Sbjct  332  DDKPFVPVYKVSKEKFKSLGLYYIPLETSIKETIESLKEKN  372



>ref|XP_006306213.1| hypothetical protein CARUB_v10011885mg [Capsella rubella]
 gb|EOA39111.1| hypothetical protein CARUB_v10011885mg [Capsella rubella]
Length=333

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 164/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGT+NVL SC++T SVKRVV+TSS A+V +   P +   ++DE+WF+D E+   +K
Sbjct  110  DPAVKGTINVLSSCLKTSSVKRVVLTSSIAAVAFNGMPRTPETIVDESWFADPEYCRASK  169

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE AAWK+A EN + +VS++PA+VIGPLLQP LN S+  +L  IK  + F 
Sbjct  170  LWYVLSKTLAENAAWKFAEENDLQLVSINPAMVIGPLLQPTLNTSAAAVLSLIKGAQTFP  229

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI+AFE P+A+GRYCLV      SEV+ I+  LYP   +PEK  
Sbjct  230  NATFG-WVNVKDVANAHIQAFENPTANGRYCLVERVAHYSEVVNILQDLYPDFLLPEKCA  288

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             +   +PT+KVS++KA+SLG+ F PLEVS+K+T+ESL++K 
Sbjct  289  DEKIYIPTYKVSKEKAESLGVEFVPLEVSIKETVESLRDKG  329



>ref|XP_007218346.1| hypothetical protein PRUPE_ppa008671mg [Prunus persica]
 gb|EMJ19545.1| hypothetical protein PRUPE_ppa008671mg [Prunus persica]
Length=323

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 160/221 (72%), Gaps = 2/221 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAV GTLNVL SCV+  +VKRVV+TSS ASVM    P+++  VIDE  +SD+   E  K
Sbjct  101  DPAVNGTLNVLKSCVKFSTVKRVVLTSSMASVMLSGKPLTSDVVIDETCYSDQVVCENHK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY+LSK  AE+AAW+YA  N ID+V ++P  VIGPLLQP LN S E+I + I   +   
Sbjct  161  QWYMLSKTLAEKAAWEYAKGNGIDLVIMNPGFVIGPLLQPTLNLSVELIQNLISGTQTTP  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
             S +  ++DVRDVA+AHI+AFEVPSA+GRYCLVG     S+ LKI+ QLYP+L + EK +
Sbjct  221  VSNYR-FIDVRDVASAHIQAFEVPSAAGRYCLVGHVASVSKTLKILRQLYPTL-LSEKCE  278

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
               P  PT++VS +KAK LGI F PLEVSL+DT+ESLKEK 
Sbjct  279  VGAPPEPTYQVSVEKAKGLGITFLPLEVSLRDTVESLKEKG  319



>ref|XP_011078732.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Sesamum 
indicum]
Length=319

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 158/221 (71%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLN+L SC +  SVKRVVVTSSTAS+++         +IDE WFSD +F EE K
Sbjct  101  EPAVKGTLNILRSCSKVTSVKRVVVTSSTASLVFNRKTKGPDVLIDETWFSDPDFCEENK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AE+AAWK+A EN ID+V +HP  V+GPLLQP LN +SE  LD IK G+E  
Sbjct  161  LWYPLSKTLAEKAAWKFAEENGIDLVVMHPGFVLGPLLQPTLNATSEFFLDLIK-GKELF  219

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
              P+  +VDVRDVA AHI AFE PSA+GRYCLV   +  S  L+I+ +LYPSL IP    
Sbjct  220  --PWYPFVDVRDVAYAHIMAFENPSAAGRYCLVERVLHHSGFLQILKKLYPSLNIPTISA  277

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             +    PT +VS++KA+SLGI F P+EVS KDT+ESLKEKN
Sbjct  278  AE---NPTHQVSKEKAESLGIKFMPMEVSFKDTVESLKEKN  315



>ref|XP_006438961.1| hypothetical protein CICLE_v10031947mg [Citrus clementina]
 gb|ESR52201.1| hypothetical protein CICLE_v10031947mg [Citrus clementina]
Length=353

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 159/220 (72%), Gaps = 3/220 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC R  S+KRVVVTSS  S ++   P++   ++DE WFSD +  +E K
Sbjct  132  DPAVKGTLNVLRSCARVDSIKRVVVTSSIVSTLFTGTPLTPDVIVDEMWFSDLDVCKELK  191

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY +SK  AE+AAWK+A EN ID+V++HP LV+GPLLQP LN S E+IL  I +G    
Sbjct  192  HWYAISKTLAEQAAWKFAEENGIDLVTIHPGLVLGPLLQPNLNLSVEVILKLI-QGSPIY  250

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
             SP+   VDVRDVA+AHI+A EVP A+GRY +VG     +EV+  + Q YP++ +PEK +
Sbjct  251  PSPYRL-VDVRDVAHAHIQALEVPMANGRYMMVGRVTHDNEVVNFLCQNYPAMHLPEKSE  309

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D    PT+ VSQ++AKSLGINF P E+S+KDTIESLKEK
Sbjct  310  -DYKYEPTYHVSQERAKSLGINFMPWELSVKDTIESLKEK  348



>gb|AAX83110.1| alcohol dehydrogenase-like protein [Ocimum basilicum]
Length=325

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 162/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVLGSCV+T SVK++V+TSS A+V Y   P +   ++DE W+SD E  ++ +
Sbjct  102  DPALKGTLNVLGSCVKTSSVKKIVLTSSIAAVAYCGKPRTPEVIVDETWWSDPEICKQMQ  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+  E  IDMV+++PA+VIGPLLQP LN S+  IL+ I     + 
Sbjct  162  LWYVLSKTLAEDAAWKFVKEKDIDMVAINPAMVIGPLLQPTLNTSAAAILNLINGAETYP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +S F  +++V+DVA+AHI AFE  SASGRYCLV      SEV+KI+  LYP+  +PEK  
Sbjct  222  NSSFG-WINVKDVAHAHILAFENASASGRYCLVERVAHFSEVVKILRGLYPTYKLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +P ++VS++KAKSLG+ FTPLE  +K+T+E LKEKN
Sbjct  281  DDKPFVPIYQVSKEKAKSLGLEFTPLEEGIKETVERLKEKN  321



>ref|XP_010536092.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Tarenaya hassleriana]
Length=321

 Score =   247 bits (630),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/220 (55%), Positives = 160/220 (73%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +T SVKRVVVTSS A+V+    P +    +DE WFSD EF E +K
Sbjct  98   DPAVKGTLNVLNSCAKTSSVKRVVVTSSMAAVVCNGKPRTPDVTVDETWFSDSEFCEASK  157

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAWK+  E  IDMV+++PA+VIGPLLQP LN S+ +I + +   + F 
Sbjct  158  LWYVLSKTLAEEAAWKFCKEKGIDMVTINPAMVIGPLLQPTLNTSAAVIANLMNGSKTFP  217

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +S    +V+V+DVAN+HI AFE PSA GRYCLV      SE++ I+ +LYP+L +PEK  
Sbjct  218  NSTLG-WVNVKDVANSHILAFENPSADGRYCLVESVAHYSEIVNILRELYPNLQLPEKCA  276

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             + P MPT++VS+++ KSLGI +  L+VS+ +T+ESLKEK
Sbjct  277  DENPYMPTYQVSKERVKSLGIEYITLKVSINETVESLKEK  316



>ref|XP_008790953.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Phoenix 
dactylifera]
Length=323

 Score =   247 bits (630),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 163/221 (74%), Gaps = 2/221 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNV  SC++TP VKRVVVTSS A+V +   P +   V+DE WFS  E  ++ K
Sbjct  101  DPAVKGTLNVFSSCIKTP-VKRVVVTSSMAAVAFNGRPRTPDVVVDETWFSSAEVCKQAK  159

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAWK++ +N IDMV+++PA+VIGPLLQP LN S+  IL+ I     + 
Sbjct  160  LWYVLSKTLAEEAAWKFSKDNSIDMVTINPAMVIGPLLQPTLNTSAAAILNLINGSCTYP  219

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVA AHI AFEVPSASGRYCLV      ++++KI+ + YP+L +PEK  
Sbjct  220  NTTFG-WVNVKDVAMAHILAFEVPSASGRYCLVERVAHYAQLVKILHEQYPALKLPEKCA  278

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +P ++VS++K KSLGI++ PLE S+K+T+ESL+EK 
Sbjct  279  DDKPFVPIYQVSKEKVKSLGIDYIPLETSIKETVESLREKG  319



>ref|XP_008790952.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Phoenix 
dactylifera]
Length=323

 Score =   247 bits (630),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 163/221 (74%), Gaps = 2/221 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNV  SC++TP VKRVVVTSS A+V +   P +   V+DE WFS  E  ++ K
Sbjct  101  DPAVKGTLNVFSSCIKTP-VKRVVVTSSMAAVAFNGRPRTPDVVVDETWFSSAEVCKQAK  159

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAWK++ +N IDMV+++PA+VIGPLLQP LN S+  IL+ I     + 
Sbjct  160  LWYVLSKTLAEEAAWKFSKDNSIDMVTINPAMVIGPLLQPTLNTSAAAILNLINGSCTYP  219

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVA AHI AFEVPSASGRYCLV      ++++KI+ + YP+L +PEK  
Sbjct  220  NTTFG-WVNVKDVAMAHILAFEVPSASGRYCLVERVAHYAQLVKILHEQYPALKLPEKCA  278

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +P ++VS++K KSLGI++ PLE S+K+T+ESL+EK 
Sbjct  279  DDKPFVPIYQVSKEKVKSLGIDYIPLETSIKETVESLREKG  319



>ref|XP_010905790.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X2 [Elaeis 
guineensis]
Length=392

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 158/221 (71%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNV  SCV+TPSV+RVVVTS+  SV Y   P +   ++DE WFS+ EF ++ K
Sbjct  169  EPAVKGTLNVFSSCVKTPSVRRVVVTSTMGSVYYNGRPRTPDIIVDETWFSNAEFCKQEK  228

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AEE AWK++ +N IDMV++HPA VIGPLLQP LN S+   L  I     + 
Sbjct  229  MWYQLSKTLAEEVAWKFSKDNSIDMVTIHPAFVIGPLLQPTLNTSAAEFLKLINGSSTYP  288

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  +  +V+V+DVA AHI AFEVPSASGRYCLV      SE++KI+ + Y +L +PEK  
Sbjct  289  NVTYG-WVNVKDVAMAHILAFEVPSASGRYCLVESVAHCSEIVKILHEQYSALKLPEKCA  347

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P+MP + VS++KAKSLGI++ PLE S+K+ ++SLKEK 
Sbjct  348  DDKPLMPIYHVSKEKAKSLGIDYIPLETSIKEIVKSLKEKG  388



>ref|XP_009114927.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Brassica rapa]
Length=325

 Score =   247 bits (630),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 162/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGT+NVL +C++TPSVKRVV+TSS A+V +   P +   ++DE+WF+D E+    K
Sbjct  102  DPAVKGTINVLSTCLKTPSVKRVVLTSSIAAVAFNGMPRTPDTIVDESWFADPEYCRAAK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE AAWK+A EN + +VS++ A+VIGPLLQP LN S+  +L  IK  + F 
Sbjct  162  LWYVLSKTLAENAAWKFAKENDMQLVSINAAMVIGPLLQPTLNTSAAAVLSLIKGAQTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI+AFE P A+GRYCLV      SEV+ I+  LYP   +PEK  
Sbjct  222  NATFG-WVNVKDVANAHIQAFENPDANGRYCLVERVAHYSEVVNILHDLYPDFQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             +   +PT+KVS++KA+SLG+ F PLEVS+K+T+ESL++K 
Sbjct  281  DEKIFIPTYKVSKEKAESLGVEFVPLEVSIKETVESLQDKG  321



>ref|NP_175552.2| putative alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AAY78648.1| putative cinnamyl-alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AEE32665.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=325

 Score =   247 bits (630),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 161/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGT+NVL SC++T SVKRVV+TSS A+V +   P +   ++DE WF+D ++   +K
Sbjct  102  DPAVKGTINVLSSCLKTSSVKRVVLTSSIAAVAFNGMPRTPETIVDETWFADPDYCRASK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE AAWK+A EN + +VS++PA+VIGPLLQP LN S+  +L  IK  + F 
Sbjct  162  LWYVLSKTLAENAAWKFAKENNLQLVSINPAMVIGPLLQPTLNTSAAAVLSLIKGAQTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI+AFE P A GRYCLV      SEV+ I+  LYP   +PEK  
Sbjct  222  NATFG-WVNVKDVANAHIQAFENPDADGRYCLVERVAHYSEVVNILHDLYPDFQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             +   +PT+KVS++KA+SLG+ F PLEVS+K+T+ESL++K 
Sbjct  281  DEKIYIPTYKVSKEKAESLGVEFVPLEVSIKETVESLRDKG  321



>ref|XP_010067828.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Eucalyptus grandis]
Length=324

 Score =   246 bits (629),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 162/223 (73%), Gaps = 5/223 (2%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +  S+KRVVVTSS A+V + + P+++  VIDE W SD EF +++K
Sbjct  101  DPAVKGTLNVLRSCAKASSIKRVVVTSSMATVAFSAKPVTSGIVIDETWDSDPEFCQKSK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WYILSK FAE+AAW++A EN ID+V ++P  V GP LQP +NFS  +IL+ I   + F 
Sbjct  161  LWYILSKTFAEKAAWEFAKENGIDLVIINPGHVFGPFLQPTVNFSVGLILNLINGAQTF-  219

Query  362  SSPFNCY--VDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEK  535
              P  CY  VDVRDVA+AHI AFE  SA GRYCLV +T+   +VL+I+  LYP+L +P+K
Sbjct  220  --PNTCYIFVDVRDVAHAHILAFENHSAHGRYCLVAKTVHCHDVLQILRNLYPTLHLPKK  277

Query  536  YKGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + + P     ++S  KA++LG++FTPLEVSL+DT+E LKEK 
Sbjct  278  CEDEKPFSSKDEISTKKAEALGVDFTPLEVSLRDTVECLKEKG  320



>ref|XP_002517775.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
 gb|EEF44582.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
Length=666

 Score =   256 bits (653),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 162/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAV+GTLNVL SC + PSVKRVV+TSS ++VM+   P++   VIDE W SD+ F EE +
Sbjct  443  DPAVRGTLNVLKSCAKFPSVKRVVITSSISAVMFNGKPLTPDVVIDETWNSDQAFCEEKQ  502

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY +SK  AE AAWK++ EN IDMV+++P  VIGP LQP LN ++E+IL  +   + + 
Sbjct  503  LWYAVSKTLAEAAAWKFSKENGIDMVTINPGFVIGPFLQPTLNITTEVILKHVNGAQTYP  562

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  +  +VD+RDV NAHI+AFE PSASGRYCLV      SEVL IV + YPSL +PEK  
Sbjct  563  NDNYR-FVDIRDVGNAHIQAFERPSASGRYCLVASVTHFSEVLNIVRKHYPSLQLPEKCV  621

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + P +  ++VS +KAK+LGI+FTPLEV++KDTIESL+EK 
Sbjct  622  DEKPFVSKYEVSNEKAKTLGIDFTPLEVTVKDTIESLREKG  662


 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 149/207 (72%), Gaps = 2/207 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PA+KGTLNVL SC + PS+KRV+VTSS A+V     P++   V+DE W+SD  F E+ K
Sbjct  137  EPAIKGTLNVLNSCSKLPSIKRVIVTSSMAAVTCNGRPLTPDVVVDETWYSDPAFCEQNK  196

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+A E  ID+V+++P  VIGP LQP+ N + E+IL+ IK G+ F 
Sbjct  197  LWYMLSKTLAEDAAWKFAKEYGIDLVTINPGWVIGPFLQPMPNLTLEIILNRIK-GQTFP  255

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +     +VDVRD+ANAH+ AFE P ASGRYCLV      SE LKI+ + YP++ +PEK  
Sbjct  256  NENLR-FVDVRDIANAHLLAFEKPEASGRYCLVERVAHLSEFLKILCKQYPTMCVPEKCS  314

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLE  622
             D P +P ++VS++K K+LG++FTPLE
Sbjct  315  DDKPFVPKYEVSKEKIKALGLDFTPLE  341



>gb|AAD53967.1| aldehyde reductase [Vigna radiata]
Length=325

 Score =   246 bits (629),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 162/220 (74%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SCV +P++KRVV+TSS A+V +   P +   V+DE W+SD E+ + T 
Sbjct  102  DPAVKGTLNVLKSCVNSPTLKRVVLTSSIAAVAFSDRPKNPDVVVDETWYSDPEYCKRTG  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AE+AAWK+A EN ID+V+++PALV+GPLLQP+LN S+ ++L  +   + F 
Sbjct  162  LWYNLSKTLAEDAAWKFAKENNIDLVTMNPALVVGPLLQPVLNTSAAIVLGLVNGAKTFK  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++    +VDV+DVA AHI A+E  SA+GRY LV       +  KI+  LYP+L IP+K +
Sbjct  222  NASLG-WVDVKDVALAHILAYENASANGRYLLVERVAHFGDAAKILRDLYPTLQIPDKCE  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P+ P F+VS++KAKSLGI++ PLEVSLKDT+ESLKEK
Sbjct  281  DDKPLEPIFQVSKEKAKSLGIDYIPLEVSLKDTVESLKEK  320



>ref|XP_009354347.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Pyrus x 
bretschneideri]
Length=324

 Score =   246 bits (629),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 161/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC + PS+KRVV+TSS A+V +   P++   V+DE+WFSD    E++K
Sbjct  103  DPALKGTLNVLRSCAKVPSIKRVVITSSMAAVAFNGKPLAPDVVVDESWFSDVAVCEKSK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY++SK  AEEAAWK+A EN ID+ +++P LV GPLLQP LN S E +L  +     F 
Sbjct  163  LWYMISKTLAEEAAWKFAKENGIDIATINPGLVTGPLLQPTLNTSVEPVLKLVNGAERFP  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ +  +VDVRDVA AHI A E  SASGRYCLVG  + +S+ + I+  L+P+L +PE+  
Sbjct  223  NTTYR-WVDVRDVATAHILALENASASGRYCLVGRVIHSSDTVNILRDLFPALKLPEECA  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P  PT++VS+++A++LG+  TPLEV+LKD +ESLK+KN
Sbjct  282  DDKPFTPTYQVSKERAETLGVVCTPLEVTLKDAVESLKQKN  322



>ref|XP_009592182.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Nicotiana tomentosiformis]
Length=322

 Score =   246 bits (628),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 163/220 (74%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLN+LGSC + PSVKRVV+TSS A+V Y   P +   V+DE+W++  ++  E +
Sbjct  101  DPAVKGTLNLLGSCAKAPSVKRVVLTSSIAAVAYSGQPRTPEVVVDESWWTSPDYCREKQ  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+  E  IDMV+++PA+VIGPLLQP LN SS  +L+ +     + 
Sbjct  161  LWYVLSKTLAEDAAWKFVKEKGIDMVAINPAMVIGPLLQPTLNTSSGAVLNLVNGAETYP  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +S F  +V+V+DVANAHI AFE PSA+GRY +V      S++LKI+  LYP++ +PEK  
Sbjct  221  NSTFG-WVNVKDVANAHILAFENPSANGRYLMVERVAHYSDILKILRDLYPTMRLPEKCA  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P+M  ++VS+++AK+LG+ FTPLE S+K+T+ESLKEK
Sbjct  280  DDNPLMQNYQVSKERAKNLGVKFTPLEESIKETVESLKEK  319



>ref|XP_002517778.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
 gb|EEF44585.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
Length=324

 Score =   246 bits (628),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 157/221 (71%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA++GTLNVL SC +  SVKRVV+TSS  +V+Y   P++   VIDE W SD E  +E K
Sbjct  101  DPAIEGTLNVLKSCAKVQSVKRVVITSSMVAVVYSRRPLTGDVVIDETWHSDPEVCKEIK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AEEAAW +A EN ID+V+++P  VIGP+LQP LN + EMIL  +  G +  
Sbjct  161  DWYALSKTLAEEAAWNFAKENAIDLVTINPTYVIGPMLQPTLNSTVEMILK-LTNGSQTY  219

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
             + +   +D+RDV +AHI+AFEVPSASGRYCLV   +  SEV+KI+ + YP+L +PEK +
Sbjct  220  PNAYYPSIDIRDVVDAHIQAFEVPSASGRYCLVANMLHYSEVVKIIHEHYPTLHLPEKCE  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
                + P  KVS +K K+LGIN+ P EV+L+DTIESLKEK 
Sbjct  280  ETPLLSPCVKVSDEKVKTLGINYIPFEVTLQDTIESLKEKG  320



>gb|EYU46248.1| hypothetical protein MIMGU_mgv1a010028mg [Erythranthe guttata]
Length=324

 Score =   246 bits (628),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 161/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PA+KGTLNVL SC +TP+VKRVV+TSS  +V     P +   V+DE W+SD  F  + +
Sbjct  97   NPALKGTLNVLRSCAKTPTVKRVVLTSSIVAVFANGKPRTPEVVVDETWWSDPLFCRQMQ  156

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY+LSK  AEEAAWK+  E  IDMV+++PA+VIGPLLQP LN SS  IL+ I  G E  
Sbjct  157  QWYMLSKTLAEEAAWKFVKEKGIDMVAINPAMVIGPLLQPTLNTSSAAILNLIN-GAEAY  215

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
             +  + +V+V+DVANAHI AFE PSA+GRYC+V      SE+  I+  LYP+  +PEK  
Sbjct  216  PNVTSGWVNVKDVANAHILAFENPSANGRYCMVESVAHFSEIANILRGLYPTFRLPEKCA  275

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PT++VS+++AKSLG+ FTPLE S+K+T+ESL+EKN
Sbjct  276  DDKPFVPTYQVSKERAKSLGVEFTPLEESIKETVESLEEKN  316



>ref|XP_008354915.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Malus domestica]
Length=320

 Score =   246 bits (627),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 156/225 (69%), Gaps = 14/225 (6%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +  S+ RVV+TSS ASVM    P+++  V+DE W+SD  F E+ K
Sbjct  102  DPAVKGTLNVLQSCAKFRSITRVVLTSSLASVMMTGAPLTSDVVLDETWYSDPLFCEKHK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY+LSK  AEE AWK+A  N ID+VSL+P L IGPLLQP LNFS E++       R FM
Sbjct  162  QWYLLSKTLAEETAWKFAKGNGIDLVSLNPGLTIGPLLQPTLNFSVELL-------RNFM  214

Query  362  SSP----FNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIP  529
            S       N +VDVRDVA+AHI+AFE+PSASGRYCLVG+     + LKI+ QLYP+L + 
Sbjct  215  SGTPTTFSNPFVDVRDVASAHIQAFEIPSASGRYCLVGQVADDLDTLKILRQLYPTLTLN  274

Query  530  EKYKGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
            E      P    +KVS++KA  LGI F PLE SL+ TIESLKEK 
Sbjct  275  EVVN---PSDSKYKVSKEKAXGLGITFLPLETSLRXTIESLKEKG  316



>ref|XP_010905793.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Elaeis guineensis]
Length=389

 Score =   248 bits (633),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 160/221 (72%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SCV+TPSV+RVVVTSS A+V Y   P +   ++DE WFS  EF ++ K
Sbjct  166  DPAVKGTLNVLSSCVKTPSVRRVVVTSSMATVYYNGRPRTPNVIVDETWFSSVEFCKQEK  225

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK+ AEEAAWK++ +N IDMV++HPA VIGPLLQP LN S+ + L  I     + 
Sbjct  226  LWYQLSKILAEEAAWKFSKDNSIDMVTIHPAFVIGPLLQPTLNASAAVFLKLINGSSTYP  285

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ +   V+V+DVA AHI AFEVPSASGRYCLV      S+++KI+ + YP+L +PE   
Sbjct  286  NASYG-LVNVKDVAMAHILAFEVPSASGRYCLVESVAHYSDIVKILHEQYPALKLPEMCA  344

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P++P + VS++KAKSLGI++  LE S+ + ++SLKEK 
Sbjct  345  DDKPLVPIYHVSREKAKSLGIDYILLETSIMEIVKSLKEKG  385



>gb|KHG04265.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Gossypium arboreum]
Length=324

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/222 (54%), Positives = 162/222 (73%), Gaps = 2/222 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC + PS+KRVV+T+S  SV+Y   P++   V+DE WFSD  F E+ K
Sbjct  100  DPAIKGTLNVLKSCAKVPSIKRVVITASIVSVVYNGKPLTPDVVVDETWFSDSRFCEKNK  159

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+ SK  AEEAAW++A ENR+D+V L+P  V+GPLLQP LN +SE++L   + G    
Sbjct  160  LWYMASKTLAEEAAWRFAEENRMDLVVLNPGFVVGPLLQPSLNCTSEVVLAHTR-GENIF  218

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKY-  538
             S     VDV+DVA AHI+AFE+PSA+GRYCLV   ++  E+LK +++LYP+L +  K  
Sbjct  219  PSSIYWLVDVQDVAYAHIQAFEIPSATGRYCLVERVVEFPEILKTLNELYPTLGLERKCE  278

Query  539  KGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
            + D P+   ++VSQ+KAKSLG++FTP E SL++T+ESLKEK 
Sbjct  279  EHDDPLKRIYQVSQEKAKSLGLSFTPWERSLQETVESLKEKG  320



>ref|XP_007149031.1| hypothetical protein PHAVU_005G034700g [Phaseolus vulgaris]
 gb|ESW21025.1| hypothetical protein PHAVU_005G034700g [Phaseolus vulgaris]
Length=325

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 160/221 (72%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SCV++P++KRVV+TSS A+V +   P +   V+DE W+SD E+ +E  
Sbjct  102  DPALKGTLNVLKSCVKSPTLKRVVLTSSIAAVSFNYRPKTPDVVVDETWYSDPEYCKENG  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AE+AAWK+  EN ID+V+++PALV+GPLLQP LN SS M+LD +     F 
Sbjct  162  IWYNLSKTLAEDAAWKFVKENNIDLVTMNPALVVGPLLQPELNTSSAMVLDLVDGSPTFK  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +     +VDVRDVA AH+ A+E  SA+GRY LV      S V+KI+  LYP+L +PEK  
Sbjct  222  NITLG-WVDVRDVAMAHVLAYESASANGRYLLVERVTHFSNVVKILRDLYPTLQLPEKCV  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P  P F+VS++KAKSLGI + PLEVS+KDT+ESLKEKN
Sbjct  281  DDKPYDPAFQVSKEKAKSLGIEYIPLEVSIKDTVESLKEKN  321



>ref|XP_006287932.1| hypothetical protein CARUB_v10001167mg [Capsella rubella]
 gb|EOA20830.1| hypothetical protein CARUB_v10001167mg [Capsella rubella]
Length=382

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/221 (54%), Positives = 164/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +  SVKRVVVTSS A+V     P +    +DE WFSD +  E +K
Sbjct  159  DPAVKGTLNVLNSCAKASSVKRVVVTSSMAAVTLNGKPRTPDVTVDETWFSDPQLCEASK  218

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK A E  +++V+++PA+VIGPLLQP LN S+  IL+ I   + F 
Sbjct  219  MWYVLSKTLAEDAAWKLAKEKGLEIVTINPAMVIGPLLQPTLNTSAAAILNLINGAKTFP  278

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +S F  +V+V+DVANAHI+AFEVPSA+GRYC+V      SE++ I+ +LYP++P+PE+  
Sbjct  279  NSSFG-WVNVKDVANAHIQAFEVPSANGRYCMVESVAHYSELVNILHELYPNVPLPERCV  337

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + P +PT++VS++K KSLGI++  L+VS+K+T+ESLKEK 
Sbjct  338  DENPYVPTYQVSKEKIKSLGIDYISLKVSIKETVESLKEKG  378



>ref|XP_009107209.1| PREDICTED: cinnamoyl-CoA reductase 1 [Brassica rapa]
 emb|CDY65726.1| BnaAnng20950D [Brassica napus]
 emb|CDY03618.1| BnaC03g68770D [Brassica napus]
Length=325

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 161/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGT+NVL +C++TPSVKRVV+TSS A+V +   P +   ++DE WF+D ++    K
Sbjct  102  DPAVKGTINVLSTCLKTPSVKRVVLTSSIAAVAFNGMPRTPDTIVDETWFADPDYCRAAK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE AAWK+A EN + +VS++ A+VIGPLLQP LN S+  +L  IK  + F 
Sbjct  162  LWYVLSKTLAENAAWKFAKENDMQLVSINAAMVIGPLLQPTLNTSAAAVLSLIKGAQTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI+AFE P A+GRYCLV      SEV+ I+  LYP   +PEK  
Sbjct  222  NATFG-WVNVKDVANAHIQAFENPEANGRYCLVERVAHYSEVVNILHDLYPDFQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             +   +PT+KVS++KA+SLG+ F PLEVS+K+T+ESL++K 
Sbjct  281  DEKIFIPTYKVSKEKAESLGVEFVPLEVSIKETVESLQDKG  321



>emb|CDY43911.1| BnaA05g15210D [Brassica napus]
Length=325

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 161/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGT+NVL +C++TPSVKRVV+TSS ASV +   P +   ++DE WF+D  +    K
Sbjct  102  DPAVKGTINVLSTCLKTPSVKRVVLTSSIASVAFNGMPRTPETIVDETWFADPGYCRAAK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE AAWK+A EN + +VS++ A+VIGPLLQP LN S+  +L  IK  + F 
Sbjct  162  LWYVLSKTLAENAAWKFAKENDLQLVSINAAMVIGPLLQPTLNTSAAAVLSLIKGAQTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI+AFE P+A+GRYCLV      SEV+ I+  LYP   +PEK  
Sbjct  222  NATFG-WVNVKDVANAHIQAFENPTANGRYCLVERVAHYSEVVNILHDLYPDFQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             +   +PT+KVS++KA+SLG+ F PLEVS+K+T+ESL++K 
Sbjct  281  DEKIYIPTYKVSKEKAESLGVEFVPLEVSIKETVESLQDKG  321



>ref|XP_008375204.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Malus domestica]
Length=321

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 157/223 (70%), Gaps = 9/223 (4%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNVL SC + P+VKRVV+TSS A+V     P+++  VIDE W+SD  F EE K
Sbjct  102  EPAVKGTLNVLKSCAKFPAVKRVVLTSSLAAVKVNGKPLTSDVVIDETWYSDPLFCEEIK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY LSK  AEEAAWK++  N ID+V++HP   IGPLL+P LN S E +L+ +      +
Sbjct  162  QWYPLSKTLAEEAAWKFSEGNGIDLVAIHPGFAIGPLLRPTLNLSVEFLLNLMSG----I  217

Query  362  SSPF--NCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEK  535
             +PF    +VDVRDVA AHI+AFEVPSASGRYCLV +     + LKI+ +LYP+L +PE 
Sbjct  218  ETPFIDYAFVDVRDVAFAHIQAFEVPSASGRYCLVAQVADGPDTLKILQELYPTLSLPEP  277

Query  536  YKGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
                 P    F+VS++KAK LGI F PLE SLKDT+ESLKEK 
Sbjct  278  GN---PSGSKFQVSKEKAKCLGITFRPLETSLKDTVESLKEKG  317



>ref|XP_008449700.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Cucumis melo]
Length=325

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/221 (54%), Positives = 164/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PA+KGTLNVL S  +  SVKRVV+TSS A+V Y + P +   ++DE+WFSD +   + +
Sbjct  102  EPALKGTLNVLNSVAKASSVKRVVLTSSMAAVSYNTKPQTPQTIVDESWFSDPDMCRDQE  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AEEAAW +  E  ID+V+++PA+VIGPLLQP LN S++ IL+ I  G  F 
Sbjct  162  IWYSLSKTLAEEAAWNFVKEKGIDLVTINPAMVIGPLLQPTLNTSAQAILNLISGGETFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +S F  +V+V+DVANAHIEA+E+P+A+GRYCLV   +  SE++KI+ QLYPS+ +P+K  
Sbjct  222  NSAFG-WVNVKDVANAHIEAYEIPTANGRYCLVERALHYSEMVKILHQLYPSIQLPQKAA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             +   +  ++VS +KAKSLGI+F PLE SLK+T+ESLKEKN
Sbjct  281  DEKLFVLAYQVSTEKAKSLGIDFIPLEDSLKETVESLKEKN  321



>ref|XP_010230911.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Brachypodium distachyon]
Length=329

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/221 (54%), Positives = 161/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAV+GTLNVL SC +  S+KRVVVTSS A+V Y   P +   V+DE WFS  E  E+ +
Sbjct  106  DPAVEGTLNVLRSC-KKASIKRVVVTSSMAAVAYNEKPRTPDVVVDETWFSHPELCEKNQ  164

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY+LSK  AE+AAWK++ +N  +MV+++PA+VIGPLLQP LN S+E+IL  I       
Sbjct  165  QWYVLSKTLAEDAAWKFSKDNGFEMVTINPAMVIGPLLQPTLNTSAEVILKLINGSSSTY  224

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
             +    +++V+DVA AHI A+EVPSA+GRYC+V      SE+LKI+ +LYP+LP+P+K  
Sbjct  225  PNFSFGWINVKDVALAHILAYEVPSANGRYCMVERVAHHSEILKIIHELYPNLPVPDKCA  284

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PT++VS+DK +SLG+   PLE S+K+TIESLKEK 
Sbjct  285  DDGPFVPTYQVSKDKIRSLGLQLIPLETSIKETIESLKEKG  325



>gb|KHG04264.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Gossypium arboreum]
Length=334

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/222 (54%), Positives = 162/222 (73%), Gaps = 2/222 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC + PS+KRVV+T+S  SV+Y   P++   V+DE WFSD  F E+ K
Sbjct  110  DPAIKGTLNVLKSCAKVPSIKRVVITASIVSVVYNGKPLTPDVVVDETWFSDSRFCEKNK  169

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+ SK  AEEAAW++A ENR+D+V L+P  V+GPLLQP LN +SE++L   + G    
Sbjct  170  LWYMASKTLAEEAAWRFAEENRMDLVVLNPGFVVGPLLQPSLNCTSEVVLAHTR-GENIF  228

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKY-  538
             S     VDV+DVA AHI+AFE+PSA+GRYCLV   ++  E+LK +++LYP+L +  K  
Sbjct  229  PSSIYWLVDVQDVAYAHIQAFEIPSATGRYCLVERVVEFPEILKTLNELYPTLGLERKCE  288

Query  539  KGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
            + D P+   ++VSQ+KAKSLG++FTP E SL++T+ESLKEK 
Sbjct  289  EHDDPLKRIYQVSQEKAKSLGLSFTPWERSLQETVESLKEKG  330



>ref|XP_010067830.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Eucalyptus grandis]
Length=324

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/223 (52%), Positives = 161/223 (72%), Gaps = 5/223 (2%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC +  S+KRVVVTSS  +V++ + P+++  VIDE W SD EF E++K
Sbjct  101  DPALKGTLNVLRSCAKASSIKRVVVTSSMTAVLFSAKPLTSGIVIDETWHSDPEFCEKSK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAW++A E  ID+V+++P  VIGP+LQP +N + + IL+ I   + F 
Sbjct  161  LWYMLSKTLAEKAAWEFAKEKGIDLVTINPGYVIGPILQPTVNLTVQTILNFINGAQTF-  219

Query  362  SSPFNCY--VDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEK  535
              P  CY  VDVRDV  AHI AFE  SA GRYC+VGE +   + L+I+  LYP+L +PEK
Sbjct  220  --PNTCYRFVDVRDVTLAHILAFENHSAHGRYCVVGEVIHCHDALQILRNLYPTLHLPEK  277

Query  536  YKGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + + P    +++S+ KA++LG+NFTPLEVSL+DT+E LKEK 
Sbjct  278  CEDEKPFSSKYEISRKKAEALGVNFTPLEVSLRDTVECLKEKG  320



>ref|XP_011025482.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Populus 
euphratica]
Length=341

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 157/221 (71%), Gaps = 3/221 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC +  S++RVV+TSS+A+ +Y   P++   VIDE W SD    +E K
Sbjct  120  DPALKGTLNVLRSCAKVHSIRRVVLTSSSATCLYSGKPLNHDVVIDETWHSDPAICKELK  179

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AEEAAW +A EN  D+V++HP+ VIGPLLQP LNFS EMIL+ +     + 
Sbjct  180  AWYALSKTLAEEAAWNFAKENATDLVTVHPSFVIGPLLQPTLNFSVEMILNLVNGAETYP  239

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  + C +DVRDVANAHI+AFE+PSASGRY L       SEVLKI+ + YP+L +PEK  
Sbjct  240  NEYYRC-IDVRDVANAHIQAFEIPSASGRYGLTAHVTTFSEVLKIIHENYPTLRLPEKST  298

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
                    ++VS++KA++L INFTPL++SL DTIESLKEK 
Sbjct  299  EGR--FKPYQVSKEKAQTLSINFTPLDLSLVDTIESLKEKG  337



>ref|XP_010454218.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Camelina 
sativa]
Length=326

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 162/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +  SVKRVVVTSS A+V Y     +    +DE WFSD E  E +K
Sbjct  103  DPAVKGTLNVLNSCAKASSVKRVVVTSSMAAVNYNGKLCTPDVTVDETWFSDPEHCEASK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK A E  +D+V+++PA+VIGPLLQP LN S+ ++L+ I   + F 
Sbjct  163  MWYVLSKTLAEDAAWKLAKEKGLDIVTINPAMVIGPLLQPTLNTSAAVVLNLINGAKTFP  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  F  +V V+DVANAHI+AFEVPSA+GRYC+V      S+++ I+  LYP++P+PE   
Sbjct  223  NVSFG-WVYVKDVANAHIQAFEVPSANGRYCMVERVAHYSDIVSILHDLYPNVPLPESCV  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + P +PT++VS++K KSLGI++ PL+VS+K+T+ESLK+K 
Sbjct  282  DENPYIPTYQVSKEKIKSLGIDYIPLKVSIKETVESLKKKG  322



>ref|XP_010454220.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X3 [Camelina 
sativa]
Length=326

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 162/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +  SVKRVVVTSS A+V Y     +    +DE WFSD E  E +K
Sbjct  103  DPAVKGTLNVLNSCAKASSVKRVVVTSSMAAVNYNGKLCTPDVTVDETWFSDPEHCEASK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK A E  +D+V+++PA+VIGPLLQP LN S+ ++L+ I   + F 
Sbjct  163  MWYVLSKTLAEDAAWKLAKEKGLDIVTINPAMVIGPLLQPTLNTSAAVVLNLINGAKTFP  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  F  +V V+DVANAHI+AFEVPSA+GRYC+V      S+++ I+  LYP++P+PE   
Sbjct  223  NVSFG-WVYVKDVANAHIQAFEVPSANGRYCMVERVAHYSDIVSILHDLYPNVPLPESCV  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + P +PT++VS++K KSLGI++ PL+VS+K+T+ESLK+K 
Sbjct  282  DENPYIPTYQVSKEKIKSLGIDYIPLKVSIKETVESLKKKG  322



>ref|NP_001234823.1| phenylacetaldehyde reductase [Solanum lycopersicum]
 gb|ABR15768.1| phenylacetaldehyde reductase [Solanum lycopersicum]
Length=328

 Score =   244 bits (624),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 161/220 (73%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLN+LGSC + PSVKRVV+TSS A+V Y   P +   V+DE+W++  ++ +E +
Sbjct  101  DPAVKGTLNLLGSCAKAPSVKRVVLTSSIAAVAYSGQPRTPEVVVDESWWTSPDYCKEKQ  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+  E  IDMV ++PA+VIGPLLQP LN SS  +L  +     + 
Sbjct  161  LWYVLSKTLAEDAAWKFVKEKGIDMVVVNPAMVIGPLLQPTLNTSSAAVLSLVNGAETYP  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +S F  +V+V+DVANAHI AFE PSA+GRY +V      S++LKI+  LYP++ +PEK  
Sbjct  221  NSSFG-WVNVKDVANAHILAFENPSANGRYLMVERVAHYSDILKILRDLYPTMQLPEKCA  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P+M  ++VS++KAKSLGI FT LE S+K+T+ESLKEK
Sbjct  280  DDNPLMQNYQVSKEKAKSLGIEFTTLEESIKETVESLKEK  319



>ref|XP_009354350.1| PREDICTED: uncharacterized protein LOC103945503 [Pyrus x bretschneideri]
Length=636

 Score =   253 bits (646),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 132/223 (59%), Positives = 161/223 (72%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNVL SCV+ P+VKRVV+TSS ASV+    P+++  V+DE W+SD    E+ K
Sbjct  411  EPAVKGTLNVLKSCVKFPTVKRVVLTSSMASVLVNGKPLTSDVVLDETWYSDPLVCEKNK  470

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            +WY LSK  AEEAA KYA EN ID+V+++P  VIGPLLQP LN S EMI + I  G+   
Sbjct  471  RWYALSKTLAEEAACKYAKENGIDLVTMNPGFVIGPLLQPTLNVSVEMIQNLIT-GKVTK  529

Query  362  SSPFNCY--VDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEK  535
            + P + Y  +DVRDV +AHI AFEVPSASGRYCLV      SEVLKI+  LYP+L +PEK
Sbjct  530  TLPLSNYRSIDVRDVVSAHILAFEVPSASGRYCLVSNVTHASEVLKIIQDLYPTLHLPEK  589

Query  536  YKGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             +      P + VS +KAK LGINF PLEVSL+DTIESLKEK 
Sbjct  590  CEIGGTSDPKYPVSAEKAKGLGINFLPLEVSLRDTIESLKEKG  632


 Score =   223 bits (568),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 149/213 (70%), Gaps = 5/213 (2%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAV+GTLNVL SC++ P++KRVV+TSS ASV     P+++  V+DE W+SD    E+ K
Sbjct  102  EPAVRGTLNVLKSCMKFPAIKRVVLTSSMASVTGTGTPLTSDVVLDETWYSDSLLCEKNK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            +WY LSK  AEEAAWK+A  N ID+VS++P + IGPLLQP LN S E+  + I  G +  
Sbjct  162  EWYPLSKTLAEEAAWKFAEGNGIDLVSMNPGIAIGPLLQPTLNLSVEIFRNLI-SGIQTS  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
               +  +VDVRDVA+AHI AFEVPSASGRYCLVG    + + LKI+ Q YP+L +PE   
Sbjct  221  YKNYR-FVDVRDVASAHIRAFEVPSASGRYCLVGHVADSPDTLKILQQFYPTLCLPEFGN  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDT  640
               P    ++VS++KAK LGI F PLE SL+D+
Sbjct  280  ---PSDSKYQVSKEKAKGLGITFLPLETSLRDS  309



>ref|XP_010420748.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Camelina 
sativa]
Length=326

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 162/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +  SVKRVVVTSS A+V     P +    +DE WFS  E  E +K
Sbjct  103  DPAVKGTLNVLNSCAKASSVKRVVVTSSMAAVTLNGKPRTPDVTVDETWFSTPELCEASK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK A E  +++V+++PA+VIGPLLQP LN S+  IL+ I   + F 
Sbjct  163  MWYVLSKTLAEDAAWKLAKEKGLEIVTINPAMVIGPLLQPTLNTSAAAILNLINGAKTFP  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI+AFEVPSA+GRYC+V      SE++ I+ +LYP++P+PE+  
Sbjct  223  NASFG-WVNVKDVANAHIQAFEVPSANGRYCMVERVAHYSELVSILHELYPNVPLPERCV  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + P   T++VS++K KSLGI++ PL+VS+K+T+ESLKEK 
Sbjct  282  DENPHASTYQVSKEKIKSLGIDYVPLKVSIKETVESLKEKG  322



>ref|XP_007149030.1| hypothetical protein PHAVU_005G034600g [Phaseolus vulgaris]
 gb|ESW21024.1| hypothetical protein PHAVU_005G034600g [Phaseolus vulgaris]
Length=325

 Score =   244 bits (623),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 160/221 (72%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SCV++P++KRVV+TSS A+V +   P +   V+DE W+SD E+ +E  
Sbjct  102  DPALKGTLNVLKSCVKSPTLKRVVLTSSVAAVSFNYRPKTPDVVVDETWYSDPEYCKENG  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AE+AAWK+A EN ID+V+++PALV+GPLLQP LN SS M+L  +     F 
Sbjct  162  LWYNLSKTLAEDAAWKFAKENNIDLVTMNPALVVGPLLQPELNTSSAMVLSLVDGSPTFG  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +     +VDVRDVA AHI A+E  SA+GRY LV      S+V+K +  LYP+L +PEK  
Sbjct  222  NVTLG-WVDVRDVAMAHILAYESASANGRYVLVERVAHFSDVVKFLRDLYPTLQLPEKCV  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P  P F+VS++KAKSLGI + PLEVS+KDT+ESLKEKN
Sbjct  281  DDKPYDPIFQVSKEKAKSLGIEYIPLEVSIKDTVESLKEKN  321



>gb|KFK35854.1| hypothetical protein AALP_AA4G045500 [Arabis alpina]
Length=325

 Score =   244 bits (623),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 162/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGT+NVL SC++T SVKRVV+TSS A+V +   P +   ++DE+WF+D ++   +K
Sbjct  102  DPAVKGTINVLSSCLKTSSVKRVVLTSSIAAVAFNGMPRTPDTIVDESWFADPDYCRASK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE +AW +A EN + +VS++PA+VIGPLLQP LN S+  +L  IK  + F 
Sbjct  162  LWYVLSKTLAENSAWTFAKENDMQLVSINPAMVIGPLLQPTLNTSAAAVLSLIKGAQTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI+AFE P A+GRYCLV      SEV+ I+  LYP   +PEK  
Sbjct  222  NATFG-WVNVKDVANAHIQAFENPDANGRYCLVERVAHYSEVVNILHDLYPDFQLPEKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             +   +PT+KVS++KA+SLG+ F PLEVS+K+T+ESL++K 
Sbjct  281  DEKIFIPTYKVSKEKAESLGVEFVPLEVSIKETVESLRDKG  321



>ref|XP_010493009.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Camelina sativa]
Length=326

 Score =   244 bits (623),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/221 (54%), Positives = 162/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC ++ S+KRVVVTSS A+V     P +    +DE WFS  E  E +K
Sbjct  103  DPAVKGTLNVLNSCAKSSSLKRVVVTSSMAAVTLNGKPRTPDVTVDETWFSTPELCEASK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAWK A E  +++V+++PA+VIGPLLQP LN S+  ILD I   + F 
Sbjct  163  MWYVLSKTLAEEAAWKLAKEKGLEIVTINPAMVIGPLLQPTLNTSAAAILDLINGAKTFP  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +S F  +V+V+DVANAHI+AFEV SA+GRYC+V      SE++ I+ +LYP++P+PE+  
Sbjct  223  NSSFG-WVNVKDVANAHIQAFEVGSANGRYCMVERVAHYSELVSILHELYPNVPLPERCV  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + P   T++VS++K KSLGI++ PL+VS+K+T+ESLKEK 
Sbjct  282  DENPHASTYQVSKEKIKSLGIDYVPLKVSIKETVESLKEKG  322



>ref|XP_009368048.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Pyrus x bretschneideri]
Length=321

 Score =   244 bits (622),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 156/223 (70%), Gaps = 9/223 (4%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNVL SC + P+VKRVV+TSS A+V     P+++  VIDE W+SD  F EE K
Sbjct  102  EPAVKGTLNVLKSCAKFPAVKRVVLTSSLAAVKVNGKPLTSDVVIDETWYSDPLFCEEIK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY LSK  AEEAAWK+A  N ID+V++HP   IGPLL+P LN S   +L+ +      +
Sbjct  162  QWYPLSKTLAEEAAWKFAKGNGIDLVAIHPGFAIGPLLRPTLNLSVGFLLNLMSG----I  217

Query  362  SSPF--NCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEK  535
             +PF    +VDVRD+A AHI+AFEVPSASGRYCLV +     + LKI+ +LYP+L +PE 
Sbjct  218  KTPFIDYAFVDVRDIAFAHIQAFEVPSASGRYCLVAQVADGPDTLKILQELYPTLSLPEP  277

Query  536  YKGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
                 P    F+VS++KAK LGI F PLE SLKDT+ESLKEK 
Sbjct  278  GN---PSGSKFQVSKEKAKCLGITFRPLETSLKDTVESLKEKG  317



>ref|XP_008356774.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Malus domestica]
Length=302

 Score =   243 bits (620),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 158/223 (71%), Gaps = 9/223 (4%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNVL SC + P+VKRVV+TSS ASV     P+++  V DE  +SD  F E+TK
Sbjct  83   EPAVKGTLNVLKSCAKFPAVKRVVLTSSVASVRMSGKPLTSDVVFDETCYSDPLFCEKTK  142

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY LSK+ AEEAAWK+A  N I++VS+HP  VIGP LQP LN S E +L+ I  G E  
Sbjct  143  QWYPLSKILAEEAAWKFAKGNGIELVSIHPGFVIGPPLQPTLNVSIEFLLNII-SGIEI-  200

Query  362  SSPFNCY--VDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEK  535
              PF  Y  VDVRDVA+AHI+AFEVPSASGRYCLV      ++ LKI+ +LYP+L +PE 
Sbjct  201  --PFVNYTFVDVRDVASAHIQAFEVPSASGRYCLVAHVADRTDTLKILRELYPTLSLPEL  258

Query  536  YKGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
                 P    F+VS++KAK LGI F PLE SLKDT+ESLKEK 
Sbjct  259  GN---PSDTKFQVSREKAKGLGITFLPLETSLKDTVESLKEKG  298



>ref|XP_006365621.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Solanum tuberosum]
Length=328

 Score =   244 bits (622),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/220 (54%), Positives = 161/220 (73%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLN+LGSC + PSVKRVV+TSS A+V Y   P +   V+DE+W++  ++ +E +
Sbjct  101  DPAVKGTLNLLGSCAKAPSVKRVVLTSSIAAVAYSGQPRTPEVVVDESWWTSPDYCKEKQ  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK+  E  IDMV ++PA+VIGPLLQP LN SS  +L  +     + 
Sbjct  161  LWYVLSKTLAEDAAWKFVKEKGIDMVVVNPAMVIGPLLQPTLNTSSAAVLSLVNGAETYP  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +S F  +V+V+DVANAHI AFE PSA+GRY +V      S++LKI+  LYP++ +PEK  
Sbjct  221  NSSFG-WVNVKDVANAHILAFENPSANGRYLMVERVAHYSDILKILRDLYPTMQLPEKCA  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P+M  ++VS++KAKSLG+ FT LE S+K+T+ESLKEK
Sbjct  280  DDNPLMQNYQVSREKAKSLGVEFTTLEESIKETVESLKEK  319



>ref|XP_007015093.1| Cinnamyl alcohol dehydrogenase, 82967-79323, putative isoform 
3 [Theobroma cacao]
 gb|EOY32712.1| Cinnamyl alcohol dehydrogenase, 82967-79323, putative isoform 
3 [Theobroma cacao]
Length=316

 Score =   243 bits (621),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 160/221 (72%), Gaps = 10/221 (5%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +T SVKRVV+TSS A+V Y   P +   V+DE WF+D ++ +  K
Sbjct  102  DPAVKGTLNVLNSCAKTSSVKRVVLTSSMAAVAYNGKPRTPDVVVDETWFTDPDYCKGLK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY++SK  AE+AAWK+A E  IDMV+++PA+VIGPLLQP LN S+  +L  IK    F 
Sbjct  162  LWYVVSKTMAEDAAWKFAKEKGIDMVAINPAMVIGPLLQPTLNTSAAAVLSLIKGAETFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI+AFE+PSASGRYCLV      SE++K++ +L           
Sbjct  222  NATFG-WVNVKDVANAHIQAFEIPSASGRYCLVERVAHYSEIVKVLQELCAD--------  272

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +PT++VS++KAK LGI+F PL+VSLK+T+ESLKEK 
Sbjct  273  -DKPYVPTYQVSKEKAKCLGIDFIPLDVSLKETVESLKEKG  312



>ref|XP_010905791.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X3 [Elaeis 
guineensis]
Length=332

 Score =   244 bits (622),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 119/222 (54%), Positives = 158/222 (71%), Gaps = 2/222 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNV  SCV+TPSV+RVVVTS+  SV Y   P +   ++DE WFS+ EF ++ K
Sbjct  108  EPAVKGTLNVFSSCVKTPSVRRVVVTSTMGSVYYNGRPRTPDIIVDETWFSNAEFCKQEK  167

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AEE AWK++ +N IDMV++HPA VIGPLLQP LN S+   L  I     + 
Sbjct  168  MWYQLSKTLAEEVAWKFSKDNSIDMVTIHPAFVIGPLLQPTLNTSAAEFLKLINGSSTYP  227

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPE-KY  538
            +  +  +V+V+DVA AHI AFEVPSASGRYCLV      SE++KI+ + Y +L +PE + 
Sbjct  228  NVTYG-WVNVKDVAMAHILAFEVPSASGRYCLVESVAHCSEIVKILHEQYSALKLPENRC  286

Query  539  KGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
              D P+MP + VS++KAKSLGI++ PLE S+K+ ++SLKEK 
Sbjct  287  ADDKPLMPIYHVSKEKAKSLGIDYIPLETSIKEIVKSLKEKG  328



>ref|XP_010673674.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=326

 Score =   243 bits (621),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 118/220 (54%), Positives = 160/220 (73%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +  S+KRVV+TSS  +V+     ++   ++DE+WFSD +F   +K
Sbjct  103  DPAVKGTLNVLNSCAKFSSIKRVVLTSSITAVVRNGKSLNLEVLVDESWFSDPDFCRNSK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AEEAAWK+A EN IDMV+++PA+VIGPLLQP LN S+  I + +     + 
Sbjct  163  MWYVLSKTLAEEAAWKFAKENGIDMVTINPAMVIGPLLQPTLNTSAASIANLLNGSETYP  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +  F  ++ V+DVA AHI A EVPSA+GRYCLV      SE++KI+ +LYP+  +PEK  
Sbjct  223  NLTFG-WIHVKDVATAHILALEVPSANGRYCLVETVTPFSEIVKILRELYPNAALPEKCA  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             D P+ P++KVS++KA+SLGI+F PLE SLK+T+E LKEK
Sbjct  282  DDNPLKPSYKVSKNKARSLGIDFIPLETSLKETVECLKEK  321



>ref|XP_009354348.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X3 [Pyrus x 
bretschneideri]
Length=630

 Score =   252 bits (643),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 160/221 (72%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC + PS+KRVV+TSS  S+++   P+SA  V+DE+WFSD  F E+ K
Sbjct  409  DPAVKGTLNVLRSCAKFPSIKRVVLTSSIVSIVFTGKPLSADTVVDESWFSDPAFCEKAK  468

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AEEAAWK+A EN ID+V+L+P + IGPLLQP LN SSE +L       +F 
Sbjct  469  LWYALSKTLAEEAAWKFAKENGIDLVALNPGMAIGPLLQPTLNSSSEPLLKLFDGTGKFP  528

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +     +VDVRD+ANAHI AFE PSASGRY +VG     S  +KI+  L+P+L +PEK  
Sbjct  529  NVTHR-WVDVRDIANAHILAFENPSASGRYSIVGSVAHYSVAVKILRDLFPALSLPEKCA  587

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P  PT+ +S+++A++LG+  TPLEV+LKD +ESLK+KN
Sbjct  588  DDQPFAPTYHISKERAETLGVVCTPLEVTLKDAVESLKQKN  628


 Score =   228 bits (580),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 149/207 (72%), Gaps = 2/207 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC + PS+KRVV+TSS A+V +   P++   V+DE+WFSD    E++K
Sbjct  103  DPALKGTLNVLRSCAKVPSIKRVVITSSMAAVAFNGKPLAPDVVVDESWFSDVAVCEKSK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY++SK  AEEAAWK+A EN ID+ +++P LV GPLLQP LN S E +L  +   R F 
Sbjct  163  LWYMISKTLAEEAAWKFAKENGIDIATINPGLVTGPLLQPTLNTSVEPVLKLVNAER-FP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ +  +VDVRDVA AHI A E  SASGRYCLVG  + +S+ + I+  L+P+L +PE+  
Sbjct  222  NTTYR-WVDVRDVATAHILALENASASGRYCLVGRVIHSSDTVNILRDLFPALKLPEECA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLE  622
             D P  PT++VS ++A+SLG+ FTPLE
Sbjct  281  DDKPFTPTYQVSNERAQSLGVKFTPLE  307



>ref|XP_004509912.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Cicer arietinum]
 ref|XP_004509913.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Cicer arietinum]
Length=324

 Score =   243 bits (621),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 164/221 (74%), Gaps = 2/221 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC R+PSVKRV++TSS ++V + S PI+   V+DE WFSD +F  E++
Sbjct  102  DPALKGTLNVLKSCARSPSVKRVILTSSVSAVKFSSRPITPEVVVDETWFSDPDFCRESE  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AE AAWK+  EN IDMV ++P++V+GPLLQP +N S E IL+ I  G  F 
Sbjct  162  LWYTLSKTLAEAAAWKFVNENNIDMVVINPSMVVGPLLQPEINESVEPILNLIN-GVPFP  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  ++DV+DVA+AHI A+E+ SA+GRYCL    +  SE+ +I+  LYP++ I +K  
Sbjct  221  NNAFG-WLDVKDVADAHILAYEIASANGRYCLAERVVHYSEIARILRDLYPTIQISDKCV  279

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P +P +++S++KA SLG+ FTPLEVSLK+T+ES +EKN
Sbjct  280  NDEPYVPPYQLSKEKANSLGVKFTPLEVSLKETVESFREKN  320



>ref|XP_009368049.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Pyrus x bretschneideri]
Length=321

 Score =   243 bits (621),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 156/222 (70%), Gaps = 9/222 (4%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PAVKGTLNVL SC + P+VKRVV+TSS ASV     P+++  V+DE W+SD  F +E K
Sbjct  102  EPAVKGTLNVLKSCAKFPAVKRVVITSSLASVRLSGKPLTSDVVMDETWYSDPLFCKEIK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY LSK  AEEAAWK+A  N ID+V++HP  VIGPLLQP LN S E +L+ +      M
Sbjct  162  QWYPLSKTLAEEAAWKFAKGNGIDLVTIHPGFVIGPLLQPSLNLSVEFLLNLMSG----M  217

Query  362  SSPFNCY--VDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEK  535
             +PF  Y  VDVRDVA AHI+AFEVPSASGRYCLV +     + LKI+ +LYP+L + E 
Sbjct  218  ETPFINYAFVDVRDVAFAHIQAFEVPSASGRYCLVAQVADGPDTLKILRELYPTLSLCEP  277

Query  536  YKGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
                 P    F+VS++KAK LGI F PLE SLKDT+ESL EK
Sbjct  278  GN---PSGSKFQVSREKAKCLGITFLPLETSLKDTVESLMEK  316



>emb|CDY22576.1| BnaC05g24140D [Brassica napus]
Length=325

 Score =   243 bits (621),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 161/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGT+NVL +C++TPSVKRVV+TSS A+V +   P +   ++DE+WF+D E+    K
Sbjct  102  DPAVKGTINVLSTCLKTPSVKRVVLTSSIAAVAFNGMPRTPDTIVDESWFADPEYCRAAK  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE AAWK+A EN + +VS++ A+VIGPLLQP LN S+  +L  IK  + F 
Sbjct  162  LWYVLSKTLAENAAWKFAKENDMQLVSINAAMVIGPLLQPTLNTSAAAVLSLIKGAQTFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++ F  +V+V+DVANAHI+AFE P A+GRYCLV      SEV+ I+  LYP   +P+K  
Sbjct  222  NATFG-WVNVKDVANAHIQAFENPDANGRYCLVERVAHYSEVVNILHDLYPDFQLPQKCS  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             +   +PT+KVS++KA+ LG+ F PLEVS+K+T+ESL++K 
Sbjct  281  DEKIFIPTYKVSKEKAEFLGVEFVPLEVSIKETVESLQDKG  321



>gb|KCW66066.1| hypothetical protein EUGRSUZ_G03353 [Eucalyptus grandis]
Length=372

 Score =   245 bits (625),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 117/223 (52%), Positives = 161/223 (72%), Gaps = 5/223 (2%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPA+KGTLNVL SC +  S+KRVVVTSS  +V++ + P+++  VIDE W SD EF E++K
Sbjct  149  DPALKGTLNVLRSCAKASSIKRVVVTSSMTAVLFSAKPLTSGIVIDETWHSDPEFCEKSK  208

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAW++A E  ID+V+++P  VIGP+LQP +N + + IL+ I   + F 
Sbjct  209  LWYMLSKTLAEKAAWEFAKEKGIDLVTINPGYVIGPILQPTVNLTVQTILNFINGAQTF-  267

Query  362  SSPFNCY--VDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEK  535
              P  CY  VDVRDV  AHI AFE  SA GRYC+VGE +   + L+I+  LYP+L +PEK
Sbjct  268  --PNTCYRFVDVRDVTLAHILAFENHSAHGRYCVVGEVIHCHDALQILRNLYPTLHLPEK  325

Query  536  YKGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + + P    +++S+ KA++LG+NFTPLEVSL+DT+E LKEK 
Sbjct  326  CEDEKPFSSKYEISRKKAEALGVNFTPLEVSLRDTVECLKEKG  368



>ref|XP_010454217.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Camelina 
sativa]
Length=326

 Score =   243 bits (620),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 162/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +  SVKRVVVTSS A+V     P +    +DE WFS  E  E +K
Sbjct  103  DPAVKGTLNVLNSCAKASSVKRVVVTSSMAAVTSNGKPRTPDVTVDETWFSTPELCEASK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY+LSK  AE+AAWK A E  +++V+++PA+VIGPLLQP LN S+  IL+ I   + + 
Sbjct  163  MWYVLSKTLAEDAAWKLAKEKGLEIVTINPAMVIGPLLQPTLNTSAAAILNLINGAKTYP  222

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +S F  +V+V+DVANAHI+AFEVPSA+GRYC+V      SE++ I+ +LYP++P+PE+  
Sbjct  223  NSSFG-WVNVKDVANAHIQAFEVPSANGRYCMVERVAHYSEMVSILHELYPNVPLPERCV  281

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             + P   T++VS++K KSLGI++ PL+VS+K+T+ESLKEK 
Sbjct  282  DENPHASTYQVSKEKIKSLGIDYVPLKVSIKETVESLKEKG  322



>gb|EMS49381.1| Dihydroflavonol-4-reductase [Triticum urartu]
Length=330

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 158/221 (71%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAV GTLNVL SC +  S+KRV+VTSS A+V Y   P +   V+DE WFS  E  E+ K
Sbjct  102  DPAVDGTLNVLRSC-KKASIKRVIVTSSMAAVAYNGKPRTPDVVVDETWFSSAEVCEKNK  160

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
            QWY+LSK  AEEAAWKYA +N +++++++P +VIGPLLQP LN S+E IL  I       
Sbjct  161  QWYVLSKTLAEEAAWKYANDNGLEIITINPTMVIGPLLQPTLNTSTEAILKFINGSSSTY  220

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            ++    +++V+DVA AHI A+EVPSA+GRYC+V   +  S+++KI+ ++YP  P+P+K  
Sbjct  221  ANFCFGWINVKDVALAHILAYEVPSANGRYCMVERVIHHSDLVKIIHEMYPEFPVPDKCA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
             D P  P ++VS+DK +SLG+  TPLE SLK+TIESLKEK 
Sbjct  281  DDAPFAPIYQVSKDKIRSLGMELTPLETSLKETIESLKEKG  321



>ref|XP_004156308.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Cucumis 
sativus]
Length=325

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 162/220 (74%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            +PA+KGTLNVL S  +  SVKRVV+TSS A+V Y + P +   ++DE+WFSD +   + +
Sbjct  102  EPALKGTLNVLNSVAKASSVKRVVLTSSMAAVSYNTKPQTPQTIVDESWFSDPDMCRDQE  161

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFM  361
             WY LSK  AEEAAW +  E  ID+V+++PA+VIGPLLQP LN S++ IL+ I  G  F 
Sbjct  162  IWYCLSKTLAEEAAWNFVKEKGIDLVTINPAMVIGPLLQPTLNTSAQAILNLISGGETFP  221

Query  362  SSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYK  541
            +S F  +V+V+DVA AHIEA+E+P+A+GRYCLV   +  SE++KI+ QLYPS+ +P+K  
Sbjct  222  NSAFG-WVNVKDVAKAHIEAYEIPTANGRYCLVERALHYSEIVKILHQLYPSIQLPQKAA  280

Query  542  GDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEK  661
             +   +  ++VS +KAKSLGI+F PLE SLK+T+ESLKEK
Sbjct  281  DEKLFVLAYQVSTEKAKSLGIDFIPLEDSLKETVESLKEK  320



>ref|XP_008344623.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Malus domestica]
Length=320

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 159/222 (72%), Gaps = 9/222 (4%)
 Frame = +2

Query  5    PAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETKQ  184
            PAVKGTLNVL SC + P+VKRVV+TSS ASVM    P+++  V+DE W+SD+ F E+ KQ
Sbjct  102  PAVKGTLNVLKSCAKFPTVKRVVLTSSIASVMGTGTPLTSDVVLDETWYSDQLFFEKHKQ  161

Query  185  WYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFMS  364
            WY LSK  AEEAAWK+A  N ID+VS++P +VIGPL QP LN S + +L+ I      + 
Sbjct  162  WYPLSKTLAEEAAWKFAEGNGIDLVSMNPGMVIGPLFQPTLNLSVKFLLNFISG----VQ  217

Query  365  SPFNCY--VDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKY  538
            +P   Y  VDVRDVA+AHI+AFEVPSASGRYCLVG+     + L+I+ QLYP+L +PE  
Sbjct  218  TPVVNYAFVDVRDVASAHIKAFEVPSASGRYCLVGQVADGPDTLQILRQLYPTLCLPEFG  277

Query  539  KGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
                P    ++VS++K K LGI F PLE SL+DT+ESLKEK 
Sbjct  278  N---PSDSKYQVSKEKVKGLGITFLPLETSLRDTVESLKEKG  316



>ref|XP_010420747.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Camelina 
sativa]
Length=327

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/222 (54%), Positives = 163/222 (73%), Gaps = 2/222 (1%)
 Frame = +2

Query  2    DPAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETK  181
            DPAVKGTLNVL SC +  SVKRVVVTSS A+V     P +    +DE WFS  E  E +K
Sbjct  103  DPAVKGTLNVLNSCAKASSVKRVVVTSSMAAVTLNGKPRTPDVTVDETWFSTPELCEASK  162

Query  182  QWYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEG-REF  358
             WY+LSK  AE+AAWK A E  +++V+++PA+VIGPLLQP LN S+  IL+ I  G + F
Sbjct  163  MWYVLSKTLAEDAAWKLAKEKGLEIVTINPAMVIGPLLQPTLNTSAAAILNLINAGAKTF  222

Query  359  MSSPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKY  538
             ++ F  +V+V+DVANAHI+AFEVPSA+GRYC+V      SE++ I+ +LYP++P+PE+ 
Sbjct  223  PNASFG-WVNVKDVANAHIQAFEVPSANGRYCMVERVAHYSELVSILHELYPNVPLPERC  281

Query  539  KGDLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
              + P   T++VS++K KSLGI++ PL+VS+K+T+ESLKEK 
Sbjct  282  VDENPHASTYQVSKEKIKSLGIDYVPLKVSIKETVESLKEKG  323



>emb|CAJ43716.1| cinnamoyl alcohol dehydrogenase [Plantago major]
Length=317

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 160/220 (73%), Gaps = 2/220 (1%)
 Frame = +2

Query  5    PAVKGTLNVLGSCVRTPSVKRVVVTSSTASVMYKSNPISATDVIDENWFSDKEFAEETKQ  184
            PA+KGTLNVL S  +TPSVKRVV+TSS A+V +   P +   V+DE WFSD+ F  E K 
Sbjct  98   PALKGTLNVLNSVAKTPSVKRVVLTSSEAAVSFNGKPRTPEVVVDETWFSDEVFCRENKL  157

Query  185  WYILSKVFAEEAAWKYAGENRIDMVSLHPALVIGPLLQPILNFSSEMILDTIKEGREFMS  364
            WY+LSK  AE AAWK+A E  ID++S++PALV+GPLLQP LN SS ++LD +K G E  +
Sbjct  158  WYVLSKTLAESAAWKFAKEKGIDLISMNPALVVGPLLQPTLNTSSAVVLDMLK-GSETYA  216

Query  365  SPFNCYVDVRDVANAHIEAFEVPSASGRYCLVGETMQTSEVLKIVSQLYPSLPIPEKYKG  544
            +    +V+V+DVAN HI A+E PSASGRY +V      SE +KI+  LYP + +P K + 
Sbjct  217  NVSVGWVNVKDVANGHILAYETPSASGRYVMVERVAHYSEAVKILRDLYPDMKLPTKCQS  276

Query  545  DLPIMPTFKVSQDKAKSLGINFTPLEVSLKDTIESLKEKN  664
            + P +P ++VS+D+ KSLGI  TPLEVS+K+T++SLKEKN
Sbjct  277  E-PFLPIYQVSKDRIKSLGIELTPLEVSIKETVDSLKEKN  315



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1688554632492