BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25712_g4_i2 len=103 path=[1182:0-41 8068:42-102]

Length=103
                                                                      Score     E

gb|AAZ07913.1|  NBS-LRR protein                                       56.2    1e-08   Ipomoea batatas [batate]
ref|XP_009796828.1|  PREDICTED: putative disease resistance prote...  49.7    2e-05   
ref|XP_009614610.1|  PREDICTED: putative disease resistance prote...  48.1    7e-05   
gb|AAL30110.1|  resistance gene analog                                44.3    3e-04   Solanum phureja x Solanum stenotomum
emb|CAC79995.1|  kinase                                               44.3    3e-04   Solanum pinnatisectum
gb|AAL30111.1|  resistance gene analog                                44.3    3e-04   Solanum phureja x Solanum stenotomum
emb|CAC79997.1|  kinase                                               44.3    3e-04   Solanum pinnatisectum



>gb|AAZ07913.1| NBS-LRR protein [Ipomoea batatas]
Length=169

 Score = 56.2 bits (134),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    ESTTKSSTDLSQLHVLLEKIQSILSGKRFLLVMD  103
            ES TKSSTDLSQL +LLEKI+S LSGKRFLLVMD
Sbjct  48   ESITKSSTDLSQLQLLLEKIKSTLSGKRFLLVMD  81



>ref|XP_009796828.1| PREDICTED: putative disease resistance protein RGA3 [Nicotiana 
sylvestris]
Length=929

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    ESTTKSSTDLSQLHVLLEKIQSILSGKRFLLVMD  103
            ES TKSS DLSQLH+LLE+IQ  +S KRF LV+D
Sbjct  260  ESLTKSSPDLSQLHMLLERIQECVSKKRFFLVLD  293



>ref|XP_009614610.1| PREDICTED: putative disease resistance protein RGA3 [Nicotiana 
tomentosiformis]
Length=929

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    ESTTKSSTDLSQLHVLLEKIQSILSGKRFLLVMD  103
            ES TKSS +LSQLH+LLE+IQ  +S KRF LV+D
Sbjct  260  ESLTKSSPNLSQLHMLLERIQECVSKKRFFLVLD  293



>gb|AAL30110.1| resistance gene analog [Solanum phureja x Solanum stenotomum]
Length=170

 Score = 44.3 bits (103),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    ESTTKSSTDLSQLHVLLEKIQSILSGKRFLLVMD  103
            E  TKSS +LS+ H+LLE+IQ  +S KRF LV+D
Sbjct  44   EGLTKSSPNLSEFHMLLERIQECVSKKRFFLVLD  77



>emb|CAC79995.1| kinase [Solanum pinnatisectum]
 emb|CAC79996.1| kinase [Solanum pinnatisectum]
Length=174

 Score = 44.3 bits (103),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    ESTTKSSTDLSQLHVLLEKIQSILSGKRFLLVMD  103
            E  TKSS +LS+ H+LLE+IQ  +S KRF LV+D
Sbjct  47   EGLTKSSPNLSEFHMLLERIQECVSKKRFFLVLD  80



>gb|AAL30111.1| resistance gene analog [Solanum phureja x Solanum stenotomum]
Length=171

 Score = 44.3 bits (103),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    ESTTKSSTDLSQLHVLLEKIQSILSGKRFLLVMD  103
            E  TKSS +LS+ H+LLE+IQ  +S KRF LV+D
Sbjct  45   EGLTKSSPNLSEFHMLLERIQECVSKKRFFLVLD  78



>emb|CAC79997.1| kinase [Solanum pinnatisectum]
Length=174

 Score = 44.3 bits (103),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    ESTTKSSTDLSQLHVLLEKIQSILSGKRFLLVMD  103
            E  TKSS +LS+ H+LLE+IQ  +S KRF LV+D
Sbjct  47   EGLTKSSPNLSEFHMLLERIQECVSKKRFFLVLD  80



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 527207176184