BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25710_g1_i2 len=1141 path=[2736:0-143 2878:144-178 1482:179-220
2954:221-286 3019:287-340 762:341-372 4620:373-463 1112:464-526
1414:527-563 4807:564-573 1559:574-599 4841:600-627 3353:628-699
5830:700-704 5381:705-706 5243:707-721 3445:722-745 5281:746-749
4093:750-775 5873:776-786 331:787-790 5887:791-810 355:811-849
5931:850-857 402:858-927 472:928-987 5992:988-988 5993:989-990
3708:991-1003 3721:1004-1053 6018:1054-1056 119:1057-1073
136:1074-1140]

Length=1141
                                                                      Score     E

gb|AAC35343.1|  short-chain alcohol dehydrogenase                       431   1e-147   Ipomoea trifida
gb|AAC35340.1|  short-chain alcohol dehydrogenase                       426   1e-145   Ipomoea trifida
gb|AAC35341.1|  short-chain alcohol dehydrogenase                       415   2e-141   Ipomoea trifida
gb|AAC35342.1|  short-chain alcohol dehydrogenase                       415   3e-141   Ipomoea trifida
ref|XP_009590019.1|  PREDICTED: secoisolariciresinol dehydrogenas...    273   1e-85    
ref|XP_009618506.1|  PREDICTED: secoisolariciresinol dehydrogenas...    267   3e-83    
ref|XP_009605329.1|  PREDICTED: secoisolariciresinol dehydrogenas...    265   1e-82    
emb|CAA11153.1|  short chain alcohol dehydrogenase                      265   1e-82    Nicotiana tabacum [American tobacco]
ref|XP_006354114.1|  PREDICTED: secoisolariciresinol dehydrogenas...    263   1e-81    
ref|XP_009776711.1|  PREDICTED: secoisolariciresinol dehydrogenas...    262   2e-81    
ref|XP_009611083.1|  PREDICTED: secoisolariciresinol dehydrogenas...    261   2e-80    
ref|XP_004252563.1|  PREDICTED: secoisolariciresinol dehydrogenas...    256   5e-79    
ref|XP_010654127.1|  PREDICTED: secoisolariciresinol dehydrogenas...    253   7e-78    
gb|EYU18091.1|  hypothetical protein MIMGU_mgv1a011664mg                252   2e-77    
ref|XP_002530171.1|  short chain alcohol dehydrogenase, putative        252   2e-77    Ricinus communis
gb|AFL56690.1|  ADH1                                                    252   2e-77    
ref|XP_010314459.1|  PREDICTED: uncharacterized protein LOC100750...    252   3e-77    
ref|XP_002281352.1|  PREDICTED: secoisolariciresinol dehydrogenas...    251   3e-77    Vitis vinifera
ref|XP_011046902.1|  PREDICTED: secoisolariciresinol dehydrogenas...    251   4e-77    
ref|XP_006361625.1|  PREDICTED: secoisolariciresinol dehydrogenas...    251   6e-77    
ref|XP_002281290.1|  PREDICTED: secoisolariciresinol dehydrogenas...    249   1e-76    Vitis vinifera
ref|XP_010654128.1|  PREDICTED: secoisolariciresinol dehydrogenas...    249   1e-76    
ref|XP_009618308.1|  PREDICTED: secoisolariciresinol dehydrogenas...    249   3e-76    
ref|XP_010654129.1|  PREDICTED: secoisolariciresinol dehydrogenas...    249   4e-76    
ref|XP_006361611.1|  PREDICTED: secoisolariciresinol dehydrogenas...    249   5e-76    
ref|XP_009768564.1|  PREDICTED: secoisolariciresinol dehydrogenas...    248   5e-76    
gb|KDP36167.1|  hypothetical protein JCGZ_08811                         248   7e-76    
ref|XP_011094266.1|  PREDICTED: secoisolariciresinol dehydrogenas...    248   8e-76    
ref|XP_006360738.1|  PREDICTED: secoisolariciresinol dehydrogenas...    248   9e-76    
ref|XP_002526911.1|  short chain alcohol dehydrogenase, putative        247   2e-75    Ricinus communis
ref|XP_011094267.1|  PREDICTED: secoisolariciresinol dehydrogenas...    246   3e-75    
ref|XP_006361624.1|  PREDICTED: secoisolariciresinol dehydrogenas...    247   3e-75    
ref|XP_007027908.1|  Short chain alcohol dehydrogenase, putative        245   8e-75    
ref|XP_002309405.1|  alcohol dehydroge family protein                   245   8e-75    Populus trichocarpa [western balsam poplar]
ref|XP_002308448.2|  alcohol dehydroge family protein                   244   2e-74    Populus trichocarpa [western balsam poplar]
gb|KDP36152.1|  hypothetical protein JCGZ_08796                         243   3e-74    
ref|XP_010246807.1|  PREDICTED: secoisolariciresinol dehydrogenas...    243   6e-74    
ref|XP_004252564.1|  PREDICTED: secoisolariciresinol dehydrogenas...    244   6e-74    
ref|XP_007027905.1|  Short chain alcohol dehydrogenase, putative        243   8e-74    
ref|XP_004228706.1|  PREDICTED: secoisolariciresinol dehydrogenas...    243   8e-74    
ref|XP_011046905.1|  PREDICTED: secoisolariciresinol dehydrogenas...    242   9e-74    
gb|KDP25017.1|  hypothetical protein JCGZ_24000                         242   2e-73    
ref|XP_009763487.1|  PREDICTED: secoisolariciresinol dehydrogenas...    242   2e-73    
ref|XP_004249781.1|  PREDICTED: secoisolariciresinol dehydrogenas...    241   2e-73    
ref|XP_002530170.1|  short chain alcohol dehydrogenase, putative        241   3e-73    Ricinus communis
ref|XP_006339318.1|  PREDICTED: secoisolariciresinol dehydrogenas...    241   3e-73    
gb|KDP36156.1|  hypothetical protein JCGZ_08800                         241   3e-73    
ref|XP_007204705.1|  hypothetical protein PRUPE_ppa009636mg             241   5e-73    
gb|KDP36160.1|  hypothetical protein JCGZ_08804                         240   5e-73    
ref|XP_004252598.1|  PREDICTED: secoisolariciresinol dehydrogenas...    240   6e-73    
ref|XP_011046907.1|  PREDICTED: secoisolariciresinol dehydrogenas...    240   7e-73    
ref|XP_008243483.1|  PREDICTED: secoisolariciresinol dehydrogenas...    240   7e-73    
ref|XP_006354216.1|  PREDICTED: secoisolariciresinol dehydrogenas...    239   8e-73    
gb|KDP36168.1|  hypothetical protein JCGZ_08812                         239   2e-72    
gb|KDP32262.1|  hypothetical protein JCGZ_14783                         239   2e-72    
emb|CDP16984.1|  unnamed protein product                                239   3e-72    
ref|XP_006577090.1|  PREDICTED: secoisolariciresinol dehydrogenas...    238   3e-72    
ref|XP_010246256.1|  PREDICTED: secoisolariciresinol dehydrogenas...    238   3e-72    
ref|XP_004506207.1|  PREDICTED: momilactone A synthase-like             238   3e-72    
ref|XP_002309404.1|  alcohol dehydroge family protein                   238   5e-72    Populus trichocarpa [western balsam poplar]
gb|AFK45740.1|  unknown                                                 238   5e-72    
ref|XP_010246261.1|  PREDICTED: secoisolariciresinol dehydrogenas...    238   6e-72    
ref|XP_002323404.1|  alcohol dehydroge family protein                   238   6e-72    Populus trichocarpa [western balsam poplar]
ref|XP_010059357.1|  PREDICTED: secoisolariciresinol dehydrogenas...    238   7e-72    
ref|XP_002533854.1|  short chain alcohol dehydrogenase, putative        237   1e-71    Ricinus communis
ref|XP_010262933.1|  PREDICTED: secoisolariciresinol dehydrogenas...    237   1e-71    
ref|XP_002530176.1|  short chain alcohol dehydrogenase, putative        239   1e-71    Ricinus communis
gb|KHG10215.1|  hypothetical protein F383_13541                         236   1e-71    
gb|KHN33174.1|  Momilactone A synthase                                  237   2e-71    
ref|XP_011046906.1|  PREDICTED: secoisolariciresinol dehydrogenas...    236   2e-71    
ref|XP_011043648.1|  PREDICTED: secoisolariciresinol dehydrogenas...    236   3e-71    
ref|XP_004305639.1|  PREDICTED: momilactone A synthase-like             236   4e-71    
ref|XP_007027903.1|  Short chain alcohol dehydrogenase, putative        234   9e-71    
emb|CDP20435.1|  unnamed protein product                                234   1e-70    
ref|XP_009626741.1|  PREDICTED: secoisolariciresinol dehydrogenas...    233   2e-70    
ref|XP_011094268.1|  PREDICTED: secoisolariciresinol dehydrogenas...    234   2e-70    
ref|XP_006361612.1|  PREDICTED: secoisolariciresinol dehydrogenas...    234   2e-70    
gb|KDP36166.1|  hypothetical protein JCGZ_08810                         233   2e-70    
ref|XP_006338927.1|  PREDICTED: secoisolariciresinol dehydrogenas...    233   3e-70    
ref|XP_002275746.2|  PREDICTED: secoisolariciresinol dehydrogenas...    233   3e-70    Vitis vinifera
ref|XP_002309402.2|  hypothetical protein POPTR_0006s22270g             233   5e-70    Populus trichocarpa [western balsam poplar]
gb|KDP37624.1|  hypothetical protein JCGZ_06967                         233   5e-70    
gb|KDP36151.1|  hypothetical protein JCGZ_08795                         233   6e-70    
gb|ACB87357.1|  secoisolariciresinol dehydrogenase                      232   7e-70    Dysosma versipellis
ref|XP_002275723.3|  PREDICTED: secoisolariciresinol dehydrogenas...    232   7e-70    Vitis vinifera
ref|XP_011022234.1|  PREDICTED: secoisolariciresinol dehydrogenas...    231   2e-69    
ref|XP_006388114.1|  alcohol dehydroge family protein                   231   2e-69    
gb|AHL21380.1|  secoisolariciresinol reductase                          231   2e-69    
gb|KDP36155.1|  hypothetical protein JCGZ_08799                         231   2e-69    
ref|XP_003554453.1|  PREDICTED: secoisolariciresinol dehydrogenas...    231   2e-69    
gb|ABD65462.1|  short chain alcohol dehydrogenase                       231   3e-69    Gossypium hirsutum [American cotton]
gb|ACU23500.1|  unknown                                                 230   4e-69    Glycine max [soybeans]
gb|ADD70246.1|  secoisolariciresinol dehydrogenase                      230   4e-69    
gb|ABN14311.1|  secoisolariciresinol dehydrogenase                      230   6e-69    Sinopodophyllum hexandrum [Himalayan mayapple]
gb|KDP36159.1|  hypothetical protein JCGZ_08803                         229   8e-69    
ref|XP_010246244.1|  PREDICTED: secoisolariciresinol dehydrogenas...    229   1e-68    
sp|Q94KL8.1|SILD_PODPE  RecName: Full=Secoisolariciresinol dehydr...    229   1e-68    Podophyllum peltatum
ref|XP_011046903.1|  PREDICTED: secoisolariciresinol dehydrogenas...    229   2e-68    
gb|KDP36165.1|  hypothetical protein JCGZ_08809                         231   2e-68    
ref|XP_004506206.1|  PREDICTED: momilactone A synthase-like             228   2e-68    
gb|EYU18090.1|  hypothetical protein MIMGU_mgv1a010990mg                228   5e-68    
ref|NP_001239862.1|  uncharacterized protein LOC100794412               226   9e-68    
ref|XP_009372539.1|  PREDICTED: secoisolariciresinol dehydrogenas...    227   1e-67    
dbj|BAB86915.1|  S-locus linked stigma protein 1                        222   2e-67    Ipomoea trifida
ref|XP_011006635.1|  PREDICTED: secoisolariciresinol dehydrogenas...    225   3e-67    
ref|XP_002513344.1|  short chain alcohol dehydrogenase, putative        225   3e-67    Ricinus communis
ref|XP_008351500.1|  PREDICTED: secoisolariciresinol dehydrogenas...    226   3e-67    
ref|XP_009349369.1|  PREDICTED: secoisolariciresinol dehydrogenas...    226   4e-67    
gb|KGN48288.1|  hypothetical protein Csa_6G454360                       224   7e-67    
ref|XP_010651861.1|  PREDICTED: secoisolariciresinol dehydrogenas...    224   8e-67    
ref|XP_006354115.1|  PREDICTED: secoisolariciresinol dehydrogenas...    224   8e-67    
gb|KDP32981.1|  hypothetical protein JCGZ_13012                         223   8e-67    
ref|XP_008462605.1|  PREDICTED: secoisolariciresinol dehydrogenas...    224   9e-67    
ref|XP_010104808.1|  Momilactone A synthase                             226   9e-67    
gb|AFK37606.1|  unknown                                                 224   9e-67    
gb|EPS74091.1|  hypothetical protein M569_00663                         225   9e-67    
ref|XP_003554454.1|  PREDICTED: secoisolariciresinol dehydrogenas...    224   1e-66    
ref|XP_002323403.1|  alcohol dehydroge family protein                   223   2e-66    Populus trichocarpa [western balsam poplar]
ref|XP_009592996.1|  PREDICTED: secoisolariciresinol dehydrogenas...    222   3e-66    
gb|KEH29817.1|  short-chain dehydrogenase/reductase                     223   3e-66    
ref|NP_001238797.1|  uncharacterized protein LOC100750250               221   4e-66    
ref|XP_010691680.1|  PREDICTED: secoisolariciresinol dehydrogenas...    222   5e-66    
ref|XP_010262932.1|  PREDICTED: secoisolariciresinol dehydrogenas...    221   8e-66    
ref|XP_010683629.1|  PREDICTED: secoisolariciresinol dehydrogenas...    222   1e-65    
gb|KHN11533.1|  Momilactone A synthase                                  221   1e-65    
sp|Q94KL7.1|SILD_FORIN  RecName: Full=Secoisolariciresinol dehydr...    221   1e-65    Forsythia x intermedia [cultivated forsythia]
gb|KDP36095.1|  hypothetical protein JCGZ_08739                         221   1e-65    
ref|XP_003546632.1|  PREDICTED: secoisolariciresinol dehydrogenas...    221   1e-65    
ref|XP_011006647.1|  PREDICTED: secoisolariciresinol dehydrogenas...    220   2e-65    
ref|XP_004143392.1|  PREDICTED: zerumbone synthase-like                 221   3e-65    
ref|XP_004170965.1|  PREDICTED: zerumbone synthase-like                 220   3e-65    
ref|XP_007206815.1|  hypothetical protein PRUPE_ppa025923mg             220   4e-65    
ref|XP_003540813.1|  PREDICTED: secoisolariciresinol dehydrogenas...    219   4e-65    
ref|XP_002272206.1|  PREDICTED: secoisolariciresinol dehydrogenas...    219   7e-65    Vitis vinifera
ref|XP_002513332.1|  short chain alcohol dehydrogenase, putative        219   1e-64    Ricinus communis
ref|XP_006430117.1|  hypothetical protein CICLE_v10012261mg             219   1e-64    
ref|XP_010651860.1|  PREDICTED: secoisolariciresinol dehydrogenas...    219   1e-64    
gb|KDP36171.1|  hypothetical protein JCGZ_08815                         219   1e-64    
gb|KHN21176.1|  Momilactone A synthase                                  218   2e-64    
gb|KDP36096.1|  hypothetical protein JCGZ_08740                         218   2e-64    
ref|XP_006481701.1|  PREDICTED: secoisolariciresinol dehydrogenas...    218   3e-64    
ref|XP_004136499.1|  PREDICTED: zerumbone synthase-like                 217   4e-64    
ref|XP_002309406.1|  putative short-chain alcohol dehydrogenase f...    216   6e-64    Populus trichocarpa [western balsam poplar]
gb|KDO35956.1|  hypothetical protein CISIN_1g046809mg                   216   7e-64    
gb|AFK46966.1|  unknown                                                 216   9e-64    
ref|XP_006430116.1|  hypothetical protein CICLE_v10012261mg             217   1e-63    
ref|XP_007132471.1|  hypothetical protein PHAVU_011G096800g             216   1e-63    
gb|KHN21177.1|  Momilactone A synthase                                  218   2e-63    
gb|KDP36172.1|  hypothetical protein JCGZ_08816                         216   2e-63    
gb|ACU19531.1|  unknown                                                 215   2e-63    Glycine max [soybeans]
ref|XP_006384778.1|  hypothetical protein POPTR_0004s21020g             216   2e-63    
gb|KEH29814.1|  short-chain dehydrogenase/reductase                     215   2e-63    
ref|XP_009802753.1|  PREDICTED: secoisolariciresinol dehydrogenas...    215   2e-63    
ref|XP_003540812.1|  PREDICTED: secoisolariciresinol dehydrogenase      215   2e-63    
ref|XP_011043649.1|  PREDICTED: secoisolariciresinol dehydrogenas...    215   3e-63    
ref|XP_008230130.1|  PREDICTED: secoisolariciresinol dehydrogenas...    215   3e-63    
ref|XP_008229671.1|  PREDICTED: secoisolariciresinol dehydrogenas...    215   3e-63    
ref|XP_003538100.1|  PREDICTED: secoisolariciresinol dehydrogenase      214   3e-63    
ref|XP_011043647.1|  PREDICTED: secoisolariciresinol dehydrogenas...    215   4e-63    
gb|AFK35915.1|  unknown                                                 214   4e-63    
ref|XP_009420509.1|  PREDICTED: momilactone A synthase-like             214   5e-63    
ref|XP_007162946.1|  hypothetical protein PHAVU_001G193500g             214   5e-63    
ref|XP_002523206.1|  short chain alcohol dehydrogenase, putative        214   5e-63    Ricinus communis
ref|XP_009618318.1|  PREDICTED: secoisolariciresinol dehydrogenas...    214   7e-63    
gb|KDP36097.1|  hypothetical protein JCGZ_08741                         214   9e-63    
gb|KEH29815.1|  short-chain dehydrogenase/reductase                     213   1e-62    
ref|XP_010917565.1|  PREDICTED: momilactone A synthase-like isofo...    213   1e-62    
gb|AHH81852.1|  short-chain alcohol dehydrogenase                       213   1e-62    
ref|XP_007132474.1|  hypothetical protein PHAVU_011G097100g             213   2e-62    
gb|AHH81851.1|  short-chain alcohol dehydrogenase                       213   2e-62    
ref|XP_011094346.1|  PREDICTED: secoisolariciresinol dehydrogenas...    213   2e-62    
ref|XP_002275768.1|  PREDICTED: tropinone reductase-like 1              213   2e-62    Vitis vinifera
gb|EYU26737.1|  hypothetical protein MIMGU_mgv1a011831mg                213   2e-62    
ref|XP_011094269.1|  PREDICTED: secoisolariciresinol dehydrogenas...    213   2e-62    
ref|XP_002323405.1|  putative short-chain alcohol dehydrogenase f...    213   2e-62    Populus trichocarpa [western balsam poplar]
ref|XP_003553613.1|  PREDICTED: secoisolariciresinol dehydrogenase      213   3e-62    
dbj|BAA89230.1|  wts2L                                                  212   4e-62    Citrullus lanatus [wild melon]
ref|XP_009374964.1|  PREDICTED: secoisolariciresinol dehydrogenas...    212   5e-62    
gb|AHH81853.1|  short-chain alcohol dehydrogenase                       212   5e-62    
ref|XP_006651946.1|  PREDICTED: zerumbone synthase-like                 213   5e-62    
ref|XP_010104811.1|  Momilactone A synthase                             211   7e-62    
dbj|BAE72096.1|  Lactuca sativa short-chain dehydrogenase/reducta...    211   7e-62    Lactuca sativa [cultivated lettuce]
emb|CBI28276.3|  unnamed protein product                                213   9e-62    
ref|XP_002272549.1|  PREDICTED: secoisolariciresinol dehydrogenas...    211   1e-61    Vitis vinifera
ref|XP_011006659.1|  PREDICTED: momilactone A synthase-like             211   1e-61    
ref|XP_010049792.1|  PREDICTED: secoisolariciresinol dehydrogenas...    211   1e-61    
ref|XP_010691689.1|  PREDICTED: secoisolariciresinol dehydrogenas...    210   1e-61    
ref|XP_010061228.1|  PREDICTED: secoisolariciresinol dehydrogenas...    210   2e-61    
gb|ACU18273.1|  unknown                                                 210   2e-61    Glycine max [soybeans]
gb|ABS87381.1|  short-chain dehydrogenase/reductase protein             210   2e-61    Lactuca sativa [cultivated lettuce]
ref|XP_009340877.1|  PREDICTED: secoisolariciresinol dehydrogenas...    210   2e-61    
ref|XP_002526345.1|  short chain alcohol dehydrogenase, putative        210   2e-61    Ricinus communis
ref|XP_008798880.1|  PREDICTED: secoisolariciresinol dehydrogenas...    209   3e-61    
ref|XP_011091814.1|  PREDICTED: xanthoxin dehydrogenase                 210   3e-61    
ref|XP_010061227.1|  PREDICTED: secoisolariciresinol dehydrogenas...    211   3e-61    
ref|XP_008229660.1|  PREDICTED: secoisolariciresinol dehydrogenas...    209   4e-61    
ref|XP_008442887.1|  PREDICTED: tropinone reductase-like 1              209   4e-61    
ref|XP_010104809.1|  Momilactone A synthase                             209   4e-61    
gb|KEH24173.1|  short-chain dehydrogenase/reductase                     209   6e-61    
ref|XP_003554452.1|  PREDICTED: secoisolariciresinol dehydrogenase      209   6e-61    
ref|XP_004981321.1|  PREDICTED: zerumbone synthase-like                 209   7e-61    
gb|KDP34949.1|  hypothetical protein JCGZ_09237                         208   8e-61    
ref|XP_007132475.1|  hypothetical protein PHAVU_011G097200g             208   9e-61    
ref|XP_006384780.1|  alcohol dehydroge family protein                   208   1e-60    
ref|XP_010104807.1|  Momilactone A synthase                             208   1e-60    
ref|XP_007206370.1|  hypothetical protein PRUPE_ppa017863mg             208   1e-60    
ref|XP_010059374.1|  PREDICTED: secoisolariciresinol dehydrogenas...    209   1e-60    
ref|XP_010101928.1|  Momilactone A synthase                             208   2e-60    
ref|XP_007207105.1|  hypothetical protein PRUPE_ppa020955mg             207   2e-60    
ref|XP_007152489.1|  hypothetical protein PHAVU_004G135000g             207   3e-60    
sp|F1SWA0.1|ZERSY_ZINZE  RecName: Full=Zerumbone synthase               207   3e-60    
ref|XP_009411944.1|  PREDICTED: momilactone A synthase-like             207   3e-60    
gb|KHN21175.1|  Momilactone A synthase                                  208   3e-60    
gb|KDP26161.1|  hypothetical protein JCGZ_22863                         207   3e-60    
ref|XP_002272838.1|  PREDICTED: secoisolariciresinol dehydrogenas...    207   3e-60    Vitis vinifera
ref|XP_010059365.1|  PREDICTED: secoisolariciresinol dehydrogenas...    207   4e-60    
gb|KCW83006.1|  hypothetical protein EUGRSUZ_C04389                     206   4e-60    
ref|XP_007152499.1|  hypothetical protein PHAVU_004G135300g             207   4e-60    
ref|XP_010050120.1|  PREDICTED: secoisolariciresinol dehydrogenas...    206   4e-60    
ref|XP_007043248.1|  Short chain alcohol dehydrogenase                  206   4e-60    
ref|XP_007027886.1|  NAD(P)-binding Rossmann-fold superfamily pro...    206   5e-60    
ref|XP_010040326.1|  PREDICTED: secoisolariciresinol dehydrogenas...    206   5e-60    
ref|XP_009340879.1|  PREDICTED: secoisolariciresinol dehydrogenas...    206   6e-60    
ref|XP_006303255.1|  hypothetical protein CARUB_v10009938mg             207   6e-60    
emb|CDP20942.1|  unnamed protein product                                206   6e-60    
emb|CBI28275.3|  unnamed protein product                                218   7e-60    
ref|XP_004981317.1|  PREDICTED: zerumbone synthase-like                 208   7e-60    
ref|XP_010227919.1|  PREDICTED: zerumbone synthase isoform X1           206   8e-60    
ref|XP_008443590.1|  PREDICTED: tropinone reductase-like 1              206   8e-60    
ref|XP_006843399.1|  hypothetical protein AMTR_s00053p00124300          207   9e-60    
ref|XP_003563948.1|  PREDICTED: zerumbone synthase isoform X2           206   1e-59    
dbj|BAE72097.1|  Lactuca sativa short-chain dehydrogenase/reducta...    205   1e-59    Lactuca sativa [cultivated lettuce]
gb|EMT02624.1|  Xanthoxin dehydrogenase                                 206   1e-59    
ref|XP_002523859.1|  short chain alcohol dehydrogenase, putative        205   2e-59    Ricinus communis
emb|CDP06868.1|  unnamed protein product                                205   2e-59    
gb|KCW90500.1|  hypothetical protein EUGRSUZ_A02619                     205   2e-59    
ref|XP_010246229.1|  PREDICTED: secoisolariciresinol dehydrogenas...    205   2e-59    
ref|XP_008437356.1|  PREDICTED: zerumbone synthase-like                 205   2e-59    
gb|KDP34634.1|  hypothetical protein JCGZ_11952                         204   2e-59    
ref|XP_007162945.1|  hypothetical protein PHAVU_001G193400g             204   3e-59    
ref|XP_004494228.1|  PREDICTED: momilactone A synthase-like             204   3e-59    
ref|XP_010067756.1|  PREDICTED: xanthoxin dehydrogenase                 204   3e-59    
ref|XP_010070261.1|  PREDICTED: secoisolariciresinol dehydrogenas...    204   5e-59    
ref|XP_010049793.1|  PREDICTED: secoisolariciresinol dehydrogenas...    204   5e-59    
ref|XP_010931582.1|  PREDICTED: LOW QUALITY PROTEIN: zerumbone sy...    204   6e-59    
ref|XP_004152436.1|  PREDICTED: zerumbone synthase-like                 204   6e-59    
gb|KCW83009.1|  hypothetical protein EUGRSUZ_C04391                     204   7e-59    
ref|XP_010917564.1|  PREDICTED: momilactone A synthase-like             203   8e-59    
gb|KDP42340.1|  hypothetical protein JCGZ_02813                         203   8e-59    
dbj|BAC53872.1|  alcohol dehydroge                                      203   8e-59    Phaseolus lunatus
ref|XP_009340878.1|  PREDICTED: secoisolariciresinol dehydrogenas...    203   9e-59    
ref|XP_007132473.1|  hypothetical protein PHAVU_011G097000g             203   9e-59    
ref|XP_009350131.1|  PREDICTED: secoisolariciresinol dehydrogenas...    203   1e-58    
ref|XP_004302582.1|  PREDICTED: short-chain dehydrogenase reducta...    204   1e-58    
emb|CDP06870.1|  unnamed protein product                                203   1e-58    
ref|XP_010051779.1|  PREDICTED: secoisolariciresinol dehydrogenas...    204   1e-58    
emb|CBI30353.3|  unnamed protein product                                202   1e-58    
emb|CDP06869.1|  unnamed protein product                                202   2e-58    
gb|KDP34955.1|  hypothetical protein JCGZ_09243                         202   2e-58    
ref|XP_008808776.1|  PREDICTED: zerumbone synthase                      202   2e-58    
ref|XP_010104812.1|  Momilactone A synthase                             202   2e-58    
ref|XP_010922188.1|  PREDICTED: zerumbone synthase-like                 202   2e-58    
ref|XP_007043243.1|  Short chain alcohol dehydrogenase                  202   3e-58    
emb|CDP19910.1|  unnamed protein product                                202   3e-58    
gb|ACG37730.1|  sex determination protein tasselseed-2                  202   3e-58    Zea mays [maize]
ref|XP_007027881.1|  Short chain alcohol dehydrogenase                  202   3e-58    
ref|XP_009395947.1|  PREDICTED: zerumbone synthase                      202   4e-58    
gb|EMS67256.1|  Xanthoxin dehydrogenase                                 203   4e-58    
dbj|BAA13541.1|  CPRD12 protein                                         201   4e-58    Vigna unguiculata
ref|XP_004305640.1|  PREDICTED: momilactone A synthase-like             202   4e-58    
ref|XP_006854737.1|  hypothetical protein AMTR_s00030p00244080          201   5e-58    
gb|ACU18308.1|  unknown                                                 201   5e-58    Glycine max [soybeans]
ref|XP_004136701.1|  PREDICTED: momilactone A synthase-like             201   5e-58    
ref|XP_006359043.1|  PREDICTED: xanthoxin dehydrogenase-like            201   5e-58    
ref|XP_003539841.1|  PREDICTED: secoisolariciresinol dehydrogenase      201   5e-58    
ref|XP_006339150.1|  PREDICTED: secoisolariciresinol dehydrogenas...    201   6e-58    
ref|XP_008643649.1|  PREDICTED: short chain alcohol dehydrogenase...    201   6e-58    
ref|XP_003632648.1|  PREDICTED: secoisolariciresinol dehydrogenas...    201   7e-58    
ref|XP_009631422.1|  PREDICTED: xanthoxin dehydrogenase-like            201   8e-58    
ref|XP_006339148.1|  PREDICTED: secoisolariciresinol dehydrogenas...    202   9e-58    
gb|EYU42960.1|  hypothetical protein MIMGU_mgv1a011480mg                201   9e-58    
gb|EAY92297.1|  hypothetical protein OsI_14018                          201   1e-57    
ref|NP_001051666.1|  Os03g0810800                                       201   1e-57    
gb|AEC10992.1|  alcohol dehydrogenase                                   200   2e-57    
ref|XP_002281462.1|  PREDICTED: secoisolariciresinol dehydrogenas...    200   2e-57    
ref|XP_011088939.1|  PREDICTED: secoisolariciresinol dehydrogenas...    199   2e-57    
ref|XP_009387234.1|  PREDICTED: momilactone A synthase-like             200   2e-57    
ref|XP_006481517.1|  PREDICTED: secoisolariciresinol dehydrogenas...    200   2e-57    
emb|CDP06872.1|  unnamed protein product                                201   2e-57    
ref|XP_002466226.1|  hypothetical protein SORBIDRAFT_01g003880          200   3e-57    
ref|XP_008243484.1|  PREDICTED: secoisolariciresinol dehydrogenas...    199   3e-57    
ref|XP_010104810.1|  Momilactone A synthase                             199   3e-57    
ref|XP_006481516.1|  PREDICTED: secoisolariciresinol dehydrogenas...    199   4e-57    
emb|CBI18081.3|  unnamed protein product                                199   4e-57    
ref|XP_008392031.1|  PREDICTED: secoisolariciresinol dehydrogenas...    199   5e-57    
ref|XP_010999596.1|  PREDICTED: xanthoxin dehydrogenase isoform X2      199   5e-57    
ref|XP_009387285.1|  PREDICTED: momilactone A synthase-like             198   5e-57    
ref|XP_008246119.1|  PREDICTED: secoisolariciresinol dehydrogenas...    198   5e-57    
gb|KDO70558.1|  hypothetical protein CISIN_1g024145mg                   199   6e-57    
ref|XP_006854739.1|  hypothetical protein AMTR_s00030p00244330          199   6e-57    
gb|EYU18089.1|  hypothetical protein MIMGU_mgv1a010226mg                199   8e-57    
ref|XP_009605454.1|  PREDICTED: secoisolariciresinol dehydrogenas...    198   8e-57    
ref|XP_008367851.1|  PREDICTED: xanthoxin dehydrogenase-like            198   8e-57    
ref|XP_007202842.1|  hypothetical protein PRUPE_ppa014608mg             197   9e-57    
ref|XP_006428245.1|  hypothetical protein CICLE_v10012415mg             198   9e-57    
ref|XP_006362152.1|  PREDICTED: secoisolariciresinol dehydrogenas...    197   1e-56    
gb|KDP36170.1|  hypothetical protein JCGZ_08814                         198   1e-56    
ref|XP_006481699.1|  PREDICTED: tropinone reductase-like 1-like         197   2e-56    
ref|XP_010039348.1|  PREDICTED: short-chain dehydrogenase reducta...    198   2e-56    
ref|NP_175644.1|  Xanthoxin dehydrogenase                               197   2e-56    
gb|KCW58914.1|  hypothetical protein EUGRSUZ_H01537                     196   3e-56    
emb|CAN78993.1|  hypothetical protein VITISV_001799                     200   3e-56    
ref|XP_008360614.1|  PREDICTED: secoisolariciresinol dehydrogenas...    197   3e-56    
gb|KHN02192.1|  Momilactone A synthase                                  208   3e-56    
ref|XP_010312221.1|  PREDICTED: secoisolariciresinol dehydrogenas...    196   4e-56    
ref|XP_010312220.1|  PREDICTED: secoisolariciresinol dehydrogenas...    197   4e-56    
ref|XP_009399160.1|  PREDICTED: momilactone A synthase-like             196   4e-56    
gb|ADK56099.1|  alcohol dehydrogenase                                   196   5e-56    
ref|XP_006430112.1|  hypothetical protein CICLE_v10012455mg             196   5e-56    
ref|XP_002530512.1|  short chain alcohol dehydrogenase, putative        196   6e-56    
ref|XP_006854740.1|  hypothetical protein AMTR_s00030p00244570          196   7e-56    
ref|XP_002894375.1|  hypothetical protein ARALYDRAFT_474354             196   7e-56    
ref|XP_007026536.1|  NAD(P)-binding Rossmann-fold superfamily pro...    196   8e-56    
gb|KEH24183.1|  short-chain dehydrogenase-reductase                     195   8e-56    
ref|XP_009605456.1|  PREDICTED: secoisolariciresinol dehydrogenas...    195   9e-56    
ref|XP_002265724.1|  PREDICTED: xanthoxin dehydrogenase                 196   1e-55    
ref|XP_010479742.1|  PREDICTED: xanthoxin dehydrogenase                 196   1e-55    
ref|XP_004237828.1|  PREDICTED: xanthoxin dehydrogenase-like            195   1e-55    
ref|XP_006392929.1|  hypothetical protein EUTSA_v10011636mg             197   1e-55    
gb|ADB82907.1|  secoisolariciresinol dehydrogenase                      195   1e-55    
emb|CDY61086.1|  BnaC06g41140D                                          195   1e-55    
ref|XP_002533789.1|  short chain alcohol dehydrogenase, putative        196   2e-55    
ref|XP_009354435.1|  PREDICTED: xanthoxin dehydrogenase                 195   2e-55    
ref|XP_002297758.1|  GLUCOSE INSENSITIVE 1 family protein               195   2e-55    
gb|AFV30207.1|  borneol dehydrogenase                                   194   2e-55    
ref|XP_007148993.1|  hypothetical protein PHAVU_005G031500g             194   3e-55    
ref|XP_009773000.1|  PREDICTED: secoisolariciresinol dehydrogenas...    194   3e-55    
ref|NP_001275184.1|  short-chain dehydrogenase/reductase                194   3e-55    
dbj|BAA06241.1|  TFHP-1 protein                                         192   3e-55    
emb|CBI30356.3|  unnamed protein product                                193   4e-55    
ref|XP_004237829.1|  PREDICTED: xanthoxin dehydrogenase-like            194   4e-55    
ref|XP_002265892.1|  PREDICTED: short-chain dehydrogenase reducta...    195   4e-55    
ref|XP_006430114.1|  hypothetical protein CICLE_v10012444mg             194   4e-55    
ref|XP_004244887.1|  PREDICTED: secoisolariciresinol dehydrogenas...    193   4e-55    
ref|XP_010917566.1|  PREDICTED: momilactone A synthase-like isofo...    192   4e-55    
ref|XP_011089208.1|  PREDICTED: secoisolariciresinol dehydrogenas...    194   5e-55    
ref|XP_006591160.1|  PREDICTED: xanthoxin dehydrogenase-like            194   5e-55    
gb|KHN13691.1|  Xanthoxin dehydrogenase                                 194   5e-55    
ref|XP_003538228.1|  PREDICTED: xanthoxin dehydrogenase-like            193   6e-55    
gb|KCW47495.1|  hypothetical protein EUGRSUZ_K01263                     193   6e-55    
ref|XP_009147691.1|  PREDICTED: xanthoxin dehydrogenase                 193   7e-55    
ref|NP_001275796.1|  short chain alcohol dehydrogenase                  193   7e-55    
ref|XP_009605455.1|  PREDICTED: secoisolariciresinol dehydrogenas...    192   7e-55    
ref|XP_011032578.1|  PREDICTED: short-chain dehydrogenase reducta...    194   8e-55    
ref|XP_009789920.1|  PREDICTED: xanthoxin dehydrogenase-like            193   8e-55    
gb|KDP34951.1|  hypothetical protein JCGZ_09239                         192   9e-55    
ref|XP_007026535.1|  NAD(P)-binding Rossmann-fold superfamily pro...    194   9e-55    
ref|XP_006429516.1|  hypothetical protein CICLE_v10012298mg             194   1e-54    
ref|XP_007140172.1|  hypothetical protein PHAVU_008G089900g             194   1e-54    
ref|XP_007205611.1|  hypothetical protein PRUPE_ppa009084mg             194   1e-54    
emb|CDY52974.1|  BnaA06g01590D                                          193   1e-54    
gb|KDP36169.1|  hypothetical protein JCGZ_08813                         192   1e-54    
ref|XP_010036304.1|  PREDICTED: tropinone reductase-like 1 isofor...    192   1e-54    
ref|XP_010036303.1|  PREDICTED: tropinone reductase-like 1 isofor...    192   1e-54    
sp|H9BFQ0.1|TPRL1_ERYCB  RecName: Full=Tropinone reductase-like 1       192   1e-54    
ref|XP_010035975.1|  PREDICTED: short-chain dehydrogenase reducta...    193   2e-54    
ref|XP_004499827.1|  PREDICTED: xanthoxin dehydrogenase-like            192   2e-54    
ref|XP_006481514.1|  PREDICTED: secoisolariciresinol dehydrogenas...    192   2e-54    
ref|XP_002513092.1|  short chain alcohol dehydrogenase, putative        192   2e-54    
emb|CDP02837.1|  unnamed protein product                                194   2e-54    
ref|XP_010036428.1|  PREDICTED: tropinone reductase-like 1              192   2e-54    
ref|XP_010999595.1|  PREDICTED: xanthoxin dehydrogenase isoform X1      193   2e-54    
ref|XP_006416957.1|  hypothetical protein EUTSA_v10008526mg             191   2e-54    
ref|XP_009388139.1|  PREDICTED: momilactone A synthase-like             191   2e-54    
ref|XP_006354217.1|  PREDICTED: tropinone reductase-like 1-like         192   2e-54    
gb|ACU19262.1|  unknown                                                 192   2e-54    
ref|XP_003623493.1|  Sex determination protein tasselseed-2             192   2e-54    
ref|XP_010500833.1|  PREDICTED: xanthoxin dehydrogenase-like            192   2e-54    
ref|XP_008388874.1|  PREDICTED: short-chain dehydrogenase reducta...    192   3e-54    
ref|XP_009607905.1|  PREDICTED: secoisolariciresinol dehydrogenas...    190   3e-54    
ref|XP_011019045.1|  PREDICTED: short-chain dehydrogenase reducta...    192   3e-54    
ref|XP_009631424.1|  PREDICTED: xanthoxin dehydrogenase-like            191   3e-54    
ref|XP_006367119.1|  PREDICTED: secoisolariciresinol dehydrogenas...    191   4e-54    
ref|XP_008244807.1|  PREDICTED: short-chain dehydrogenase reducta...    192   4e-54    
gb|KGN59172.1|  hypothetical protein Csa_3G778280                       191   5e-54    
ref|XP_002308240.1|  short-chain dehydrogenase/reductase family p...    192   5e-54    
ref|XP_006367118.1|  PREDICTED: secoisolariciresinol dehydrogenas...    191   5e-54    
ref|XP_010024677.1|  PREDICTED: secoisolariciresinol dehydrogenas...    191   7e-54    
ref|XP_006828171.1|  hypothetical protein AMTR_s00023p00118310          191   7e-54    
ref|XP_010038863.1|  PREDICTED: tropinone reductase-like 1              191   8e-54    
ref|XP_004139501.1|  PREDICTED: zerumbone synthase-like                 190   9e-54    
ref|XP_010036300.1|  PREDICTED: tropinone reductase-like 1 isofor...    190   1e-53    
ref|XP_010038800.1|  PREDICTED: tropinone reductase-like 1              190   1e-53    
ref|XP_010036299.1|  PREDICTED: tropinone reductase-like 1 isofor...    190   1e-53    
ref|XP_010277608.1|  PREDICTED: xanthoxin dehydrogenase                 190   1e-53    
ref|XP_009782884.1|  PREDICTED: short-chain dehydrogenase reducta...    191   1e-53    
ref|XP_002323034.2|  short-chain dehydrogenase/reductase family p...    191   1e-53    
gb|ABK24336.1|  unknown                                                 190   2e-53    
ref|XP_010106398.1|  Xanthoxin dehydrogenase                            189   2e-53    
ref|XP_002308449.1|  hypothetical protein POPTR_0006s22330g             189   2e-53    
ref|XP_008442883.1|  PREDICTED: secoisolariciresinol dehydrogenas...    189   2e-53    
gb|ABK25445.1|  unknown                                                 189   2e-53    
gb|AAK83036.1|AF286651_1  TASSELSEED2-like protein                      189   3e-53    
gb|KDP40503.1|  hypothetical protein JCGZ_24502                         189   3e-53    
ref|XP_010523897.1|  PREDICTED: short-chain dehydrogenase reducta...    188   3e-53    
gb|KCW90498.1|  hypothetical protein EUGRSUZ_A02616                     189   3e-53    
ref|NP_001052173.1|  Os04g0179100                                       189   3e-53    
emb|CAH66125.1|  OSIGBa0109M01.3                                        189   4e-53    
ref|XP_006424148.1|  hypothetical protein CICLE_v10029025mg             189   4e-53    
ref|XP_007027880.1|  Short chain alcohol dehydrogenase                  189   4e-53    
ref|XP_010324818.1|  PREDICTED: secoisolariciresinol dehydrogenas...    187   5e-53    
emb|CDP06416.1|  unnamed protein product                                189   5e-53    
ref|XP_009615997.1|  PREDICTED: short-chain dehydrogenase reducta...    189   5e-53    
ref|XP_010264496.1|  PREDICTED: short-chain dehydrogenase reducta...    189   6e-53    
ref|XP_010922187.1|  PREDICTED: zerumbone synthase-like                 188   7e-53    
ref|XP_003534665.1|  PREDICTED: short-chain dehydrogenase reducta...    189   8e-53    
ref|NP_001148513.1|  short chain alcohol dehydrogenase1                 187   8e-53    
emb|CBI30352.3|  unnamed protein product                                187   9e-53    
ref|XP_006481515.1|  PREDICTED: secoisolariciresinol dehydrogenas...    187   9e-53    
ref|XP_004136700.1|  PREDICTED: momilactone A synthase-like             187   1e-52    
ref|XP_008245281.1|  PREDICTED: xanthoxin dehydrogenase                 187   1e-52    
ref|NP_001052174.1|  Os04g0179200                                       187   1e-52    
emb|CAH66124.1|  OSIGBa0109M01.2                                        187   1e-52    
ref|XP_010094675.1|  Sex determination protein tasselseed-2             189   2e-52    
ref|XP_010264497.1|  PREDICTED: short-chain dehydrogenase reducta...    187   2e-52    
ref|XP_007218800.1|  hypothetical protein PRUPE_ppa009814mg             187   2e-52    
gb|KGN59171.1|  hypothetical protein Csa_3G778270                       187   2e-52    
ref|XP_010038862.1|  PREDICTED: tropinone reductase-like 1              187   2e-52    
ref|XP_004249651.1|  PREDICTED: short-chain dehydrogenase reducta...    188   2e-52    
gb|ACN40590.1|  unknown                                                 187   2e-52    
ref|XP_003552289.1|  PREDICTED: short-chain dehydrogenase reducta...    187   2e-52    
sp|H9BFQ1.1|TPRL2_ERYCB  RecName: Full=Tropinone reductase-like 2       187   2e-52    
ref|XP_010683578.1|  PREDICTED: short-chain dehydrogenase reducta...    187   2e-52    
ref|XP_006481700.1|  PREDICTED: tropinone reductase-like 2-like         186   2e-52    
ref|XP_010551306.1|  PREDICTED: xanthoxin dehydrogenase                 187   2e-52    
ref|XP_011041828.1|  PREDICTED: short-chain dehydrogenase reducta...    187   2e-52    
ref|XP_010264499.1|  PREDICTED: short-chain dehydrogenase reducta...    187   3e-52    
gb|KHN29548.1|  Sex determination protein tasselseed-2                  188   3e-52    
gb|KHN40676.1|  Sex determination protein tasselseed-2                  187   3e-52    
ref|XP_002527336.1|  short chain alcohol dehydrogenase, putative        186   3e-52    
ref|XP_010312311.1|  PREDICTED: short-chain dehydrogenase reducta...    187   4e-52    
ref|XP_008370219.1|  PREDICTED: short-chain dehydrogenase reducta...    187   4e-52    
ref|XP_010256990.1|  PREDICTED: short-chain dehydrogenase reducta...    187   4e-52    
gb|AAK83035.1|AF286650_1  CTA                                           186   5e-52    
ref|XP_004135972.1|  PREDICTED: short-chain dehydrogenase reducta...    185   5e-52    
ref|XP_010671866.1|  PREDICTED: xanthoxin dehydrogenase-like            186   6e-52    
ref|XP_006338966.1|  PREDICTED: short-chain dehydrogenase reducta...    186   6e-52    
ref|XP_009776783.1|  PREDICTED: short-chain dehydrogenase reducta...    186   6e-52    
ref|XP_010036305.1|  PREDICTED: tropinone reductase-like 1              186   7e-52    
ref|XP_010102621.1|  Sex determination protein tasselseed-2             186   8e-52    
gb|ABK23507.1|  unknown                                                 186   8e-52    
ref|XP_010264500.1|  PREDICTED: short-chain dehydrogenase reducta...    185   8e-52    
ref|XP_008383843.1|  PREDICTED: xanthoxin dehydrogenase isoform X1      185   8e-52    
emb|CDO98188.1|  unnamed protein product                                185   9e-52    
gb|KEH24184.1|  short-chain dehydrogenase/reductase                     182   1e-51    
ref|XP_009787721.1|  PREDICTED: xanthoxin dehydrogenase-like            185   1e-51    
gb|ABR18410.1|  unknown                                                 184   2e-51    
ref|XP_006424147.1|  hypothetical protein CICLE_v10029025mg             184   2e-51    
ref|XP_004137687.1|  PREDICTED: short-chain dehydrogenase reducta...    185   3e-51    
ref|XP_004143748.1|  PREDICTED: xanthoxin dehydrogenase-like            184   3e-51    
ref|XP_004303064.1|  PREDICTED: xanthoxin dehydrogenase-like            184   3e-51    
ref|XP_008383845.1|  PREDICTED: xanthoxin dehydrogenase isoform X3      184   4e-51    
emb|CDY29039.1|  BnaC07g32450D                                          184   4e-51    
ref|XP_010685947.1|  PREDICTED: sex determination protein tassels...    184   4e-51    
gb|ACN40791.1|  unknown                                                 184   5e-51    
ref|XP_009373111.1|  PREDICTED: short-chain dehydrogenase reducta...    184   5e-51    
ref|XP_008383844.1|  PREDICTED: xanthoxin dehydrogenase isoform X2      183   7e-51    
ref|XP_011046908.1|  PREDICTED: tropinone reductase-like 1              184   7e-51    
ref|XP_009417972.1|  PREDICTED: sex determination protein tassels...    184   7e-51    
emb|CDX90636.1|  BnaA03g41450D                                          183   8e-51    
ref|XP_007008811.1|  NAD(P)-binding Rossmann-fold superfamily pro...    182   1e-50    
gb|KHN33244.1|  Sex determination protein tasselseed-2                  182   2e-50    
gb|KDP22808.1|  hypothetical protein JCGZ_00395                         182   2e-50    
ref|XP_004136145.1|  PREDICTED: short-chain dehydrogenase reducta...    181   2e-50    
ref|XP_003522142.1|  PREDICTED: short-chain dehydrogenase reducta...    182   2e-50    
ref|XP_004169128.1|  PREDICTED: short-chain dehydrogenase reducta...    182   2e-50    
ref|XP_004169130.1|  PREDICTED: short-chain dehydrogenase reducta...    181   2e-50    
gb|EAZ29934.1|  hypothetical protein OsJ_13988                          181   3e-50    
gb|KGN45049.1|  hypothetical protein Csa_7G414460                       181   3e-50    
gb|AGY49282.1|  short chain alcohol dehydrogenase/reductase             181   3e-50    
ref|XP_006444577.1|  hypothetical protein CICLE_v10021745mg             181   3e-50    
ref|XP_002277487.2|  PREDICTED: short-chain dehydrogenase reducta...    181   3e-50    
ref|XP_004492523.1|  PREDICTED: short-chain dehydrogenase reducta...    182   3e-50    
ref|XP_007134614.1|  hypothetical protein PHAVU_010G061700g             182   4e-50    
ref|XP_006468252.1|  PREDICTED: short-chain dehydrogenase reducta...    181   5e-50    
ref|XP_004166485.1|  PREDICTED: LOW QUALITY PROTEIN: xanthoxin de...    181   5e-50    
ref|XP_011077500.1|  PREDICTED: short-chain dehydrogenase reducta...    181   5e-50    
ref|XP_010671863.1|  PREDICTED: zerumbone synthase-like                 180   7e-50    
ref|XP_008442351.1|  PREDICTED: short-chain dehydrogenase reducta...    181   8e-50    
ref|XP_010921066.1|  PREDICTED: LOW QUALITY PROTEIN: sex determin...    181   9e-50    
ref|XP_008782768.1|  PREDICTED: sex determination protein tassels...    179   1e-49    
gb|KCW47819.1|  hypothetical protein EUGRSUZ_K01556                     179   1e-49    
gb|KDP36158.1|  hypothetical protein JCGZ_08802                         178   1e-49    
ref|XP_011033624.1|  PREDICTED: zerumbone synthase isoform X2           180   1e-49    
gb|EPS72418.1|  short chain alcohol dehydrogenase                       179   1e-49    
ref|XP_010529113.1|  PREDICTED: short-chain dehydrogenase reducta...    180   2e-49    
ref|XP_003598766.1|  Short-chain dehydrogenase/reductase                179   2e-49    
ref|XP_008811702.1|  PREDICTED: momilactone A synthase-like             180   2e-49    
emb|CDX78027.1|  BnaA09g32220D                                          179   2e-49    
gb|ABK22745.1|  unknown                                                 179   2e-49    



>gb|AAC35343.1| short-chain alcohol dehydrogenase [Ipomoea trifida]
Length=284

 Score =   431 bits (1109),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 243/283 (86%), Positives = 263/283 (93%), Gaps = 6/283 (2%)
 Frame = -1

Query  1069  MAAS------LKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEI  908
             MAAS       KRLEGKVAIITGAANGIGATTARLFA HGCKVIIADIDDKNG+SVA+EI
Sbjct  1     MAASSLQLPVFKRLEGKVAIITGAANGIGATTARLFAQHGCKVIIADIDDKNGHSVAEEI  60

Query  907   GPEYALFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLV  728
             GPEYALFIHCDVRIESHVQ+AVDTTVSRYGKLDIMFSNAG AGSRDTSILEA+ ENINLV
Sbjct  61    GPEYALFIHCDVRIESHVQHAVDTTVSRYGKLDIMFSNAGVAGSRDTSILEASPENINLV  120

Query  727   FDTNVVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLC  548
             F+TNV G+FFCAKHAARVMIPA+KGS+IFSASA++  FGITS TYTASKCA+VGLCKSLC
Sbjct  121   FETNVFGAFFCAKHAARVMIPARKGSVIFSASAASEVFGITSDTYTASKCAVVGLCKSLC  180

Query  547   VEMGKYGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAAL  368
             VEMGKYGI++NCVS  +ILTKLGMSIMPTQDRKLAEEIVAEA N KG +LTTEDVAEAAL
Sbjct  181   VEMGKYGIKANCVSPYVILTKLGMSIMPTQDRKLAEEIVAEASNFKGKTLTTEDVAEAAL  240

Query  367   YLAGDESKYVSGVNLIIDGGYSTTNIGFQVAVEKVLGGGEGTT  239
             YLAGDESK+VSG+NL+IDGG++TTNI FQVAVEKVLGGGEGTT
Sbjct  241   YLAGDESKFVSGLNLLIDGGFTTTNIAFQVAVEKVLGGGEGTT  283



>gb|AAC35340.1| short-chain alcohol dehydrogenase [Ipomoea trifida]
Length=284

 Score =   426 bits (1096),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 238/272 (88%), Positives = 257/272 (94%), Gaps = 0/272 (0%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             KRLEGKVAIITGAANGIGATTARLFA HGCKVIIADIDDKNG+SVA+EIGPEYALFIHCD
Sbjct  12    KRLEGKVAIITGAANGIGATTARLFAQHGCKVIIADIDDKNGHSVAEEIGPEYALFIHCD  71

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             VRIES VQNAVDTTVSRYGKLDIMFSNAG AGSRDTSILEA+ ENINLVF+TNV G+FFC
Sbjct  72    VRIESDVQNAVDTTVSRYGKLDIMFSNAGVAGSRDTSILEASPENINLVFETNVFGAFFC  131

Query  694   AKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSN  515
             AKHAARVMIPA+KGS+IFSASA++  FGITS TYTASKCA+VGLCKSLCVEMGKYGI++N
Sbjct  132   AKHAARVMIPARKGSVIFSASAASEVFGITSDTYTASKCAVVGLCKSLCVEMGKYGIKAN  191

Query  514   CVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVS  335
             CVS  +ILTKLGMSIMPTQDRKLAEEIVAEA N KG +LTTEDVAEAALYLAGDESK+VS
Sbjct  192   CVSPYVILTKLGMSIMPTQDRKLAEEIVAEASNFKGKTLTTEDVAEAALYLAGDESKFVS  251

Query  334   GVNLIIDGGYSTTNIGFQVAVEKVLGGGEGTT  239
             G+NL+IDGG++TTNI FQVAVEKVLGGGE TT
Sbjct  252   GLNLLIDGGFTTTNIAFQVAVEKVLGGGEETT  283



>gb|AAC35341.1| short-chain alcohol dehydrogenase [Ipomoea trifida]
Length=277

 Score =   415 bits (1067),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 234/277 (84%), Positives = 256/277 (92%), Gaps = 6/277 (2%)
 Frame = -1

Query  1069  MAAS------LKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEI  908
             MAAS       KRLEGKVAIITGAANGIGATTARLFA HGCKVIIADIDDKNG+SVA+EI
Sbjct  1     MAASSLQLPVFKRLEGKVAIITGAANGIGATTARLFAQHGCKVIIADIDDKNGHSVAEEI  60

Query  907   GPEYALFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLV  728
             GPEYALFIHCDVRIESHVQ+AVDTTVSRYGKLDIMFSNAG AGSRDTSILEA+ ENINLV
Sbjct  61    GPEYALFIHCDVRIESHVQHAVDTTVSRYGKLDIMFSNAGVAGSRDTSILEASPENINLV  120

Query  727   FDTNVVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLC  548
             F+TNV G+FFCAKHAARVMIPA+KGS+IFSASA++  FGITS TYTASKCA+VGLCKSLC
Sbjct  121   FETNVFGAFFCAKHAARVMIPARKGSVIFSASAASEVFGITSDTYTASKCAVVGLCKSLC  180

Query  547   VEMGKYGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAAL  368
             VEMGKYGI++NCVS  +ILTKLGMSIMPTQDRKLAEEIVAEA N KG +LTTEDVAEAAL
Sbjct  181   VEMGKYGIKANCVSPYVILTKLGMSIMPTQDRKLAEEIVAEASNFKGKTLTTEDVAEAAL  240

Query  367   YLAGDESKYVSGVNLIIDGGYSTTNIGFQVAVEKVLG  257
             YLAGDESK+VSG+NL+IDGG++TTN  FQVAV+K+LG
Sbjct  241   YLAGDESKFVSGLNLLIDGGFTTTNTAFQVAVDKILG  277



>gb|AAC35342.1| short-chain alcohol dehydrogenase [Ipomoea trifida]
 dbj|BAB86916.1| S-Locus linked stigma protein [Ipomoea trifida]
Length=277

 Score =   415 bits (1067),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 235/277 (85%), Positives = 254/277 (92%), Gaps = 6/277 (2%)
 Frame = -1

Query  1069  MAAS------LKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEI  908
             MAAS       KRLEGKVAIITGAANGIGATTARLFA HGCKVIIADIDDKNG SVA+EI
Sbjct  1     MAASSLQLPVFKRLEGKVAIITGAANGIGATTARLFAQHGCKVIIADIDDKNGLSVAEEI  60

Query  907   GPEYALFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLV  728
             GPEYALFIHCDVRIES VQNAVDTTVSRYGKLDIMFSNAG AGSRDTSILEA+ ENINLV
Sbjct  61    GPEYALFIHCDVRIESDVQNAVDTTVSRYGKLDIMFSNAGVAGSRDTSILEASPENINLV  120

Query  727   FDTNVVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLC  548
             F+TNV G+FFCAKHAARVMIPA+KGS+IFSASA++  FGITS TYTASKCA+VGLCKSLC
Sbjct  121   FETNVFGAFFCAKHAARVMIPARKGSVIFSASAASEVFGITSDTYTASKCAVVGLCKSLC  180

Query  547   VEMGKYGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAAL  368
             VEMGKYGI++NCVS  +ILTKLGMSIMPTQDRKLAEEIVAEA N KG +LTTEDVAEAAL
Sbjct  181   VEMGKYGIKANCVSPYVILTKLGMSIMPTQDRKLAEEIVAEASNFKGKTLTTEDVAEAAL  240

Query  367   YLAGDESKYVSGVNLIIDGGYSTTNIGFQVAVEKVLG  257
             YLAGDESK+VSG+NL+IDGG++TTN  FQVAVEK+LG
Sbjct  241   YLAGDESKFVSGLNLLIDGGFTTTNTAFQVAVEKILG  277



>ref|XP_009590019.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
tomentosiformis]
Length=279

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 153/257 (60%), Positives = 194/257 (75%), Gaps = 0/257 (0%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             K+LEGKVA ITG A+GIGA T RLF  HG KV IADI D  G S+  EIG E A+FIHC+
Sbjct  12    KKLEGKVAFITGGASGIGAATTRLFVQHGAKVTIADIQDNLGTSLVHEIGTEKAIFIHCN  71

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V IES VQNAVD T+ ++GKLDIMFSNAG  G   +SILE + + I  VFD N++G+FFC
Sbjct  72    VAIESDVQNAVDATIEKFGKLDIMFSNAGVLGKPISSILEVDYDIIKTVFDVNIIGAFFC  131

Query  694   AKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSN  515
             AKHAARVMIP KKGSIIF+AS +T   G+  H Y ASKCA++GL K++ VE+GKYGI+ N
Sbjct  132   AKHAARVMIPFKKGSIIFTASVATVVSGLVPHAYAASKCAVLGLSKNIGVELGKYGIKVN  191

Query  514   CVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVS  335
             CVS   + T L ++++   DR++A++ +AEA NLKG  L  E+VA+A LYL  D+SKYVS
Sbjct  192   CVSPYYVGTPLALNMLGIADREMADKWIAEAGNLKGALLNEEEVAKAVLYLVSDDSKYVS  251

Query  334   GVNLIIDGGYSTTNIGF  284
             G+NL++DGG+STTN+  
Sbjct  252   GMNLVLDGGFSTTNVAL  268



>ref|XP_009618506.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
tomentosiformis]
Length=285

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 201/265 (76%), Gaps = 0/265 (0%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             KRLE +VA+ITG A+GIGA TARLF  HG KV IADI D  G S+  EIG + A+F+HC+
Sbjct  12    KRLEDQVALITGGASGIGAATARLFVQHGAKVTIADIQDNLGTSLVHEIGIKEAIFVHCN  71

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V IES VQNAVD T++++ KLDIMFSNAG  G   +SILE + + I  VFD N+ G+FFC
Sbjct  72    VSIESDVQNAVDATIAKFTKLDIMFSNAGVMGKPISSILEVDYDIIKNVFDVNIAGAFFC  131

Query  694   AKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSN  515
             AKHAARVMIPAK+G+I+F+ASA+TA +G  SHTYTASK AI+GL K++ VE+GKYGI+ N
Sbjct  132   AKHAARVMIPAKRGAIVFTASAATATYGDVSHTYTASKNAILGLSKNVGVELGKYGIKVN  191

Query  514   CVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVS  335
             CVS   I T L ++ +   DRK+A+++ A   NLKG  L  ++VA+A LYLA D+SKYVS
Sbjct  192   CVSPYTIGTPLALNTLGIDDRKMADKLFAGGGNLKGALLDEDEVAKAVLYLASDDSKYVS  251

Query  334   GVNLIIDGGYSTTNIGFQVAVEKVL  260
             G+NLI+DGGYSTTNI    A +K+ 
Sbjct  252   GLNLILDGGYSTTNIALTEAYKKMF  276



>ref|XP_009605329.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
tomentosiformis]
Length=284

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 197/265 (74%), Gaps = 0/265 (0%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             KRLEGKVA+ITG A+GIGA TARLF  HG KV IADI D  G S+ QEIG E+ +F+HC+
Sbjct  12    KRLEGKVALITGGASGIGAATARLFVQHGAKVTIADIQDNLGTSLVQEIGNEHTIFVHCN  71

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V +ES VQN VD T++++GKLDIMFSNAG  G   +SIL+ + + I  VFD N+VG+FFC
Sbjct  72    VAVESDVQNVVDATIAKFGKLDIMFSNAGIGGKSISSILDVDYDIIKTVFDVNIVGAFFC  131

Query  694   AKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSN  515
             AKHAARVMIP KKGSIIF+ASA+T   GI  H Y+ASK A++G  K++ VE+GKYGI+ N
Sbjct  132   AKHAARVMIPFKKGSIIFTASAATVVSGIVPHAYSASKGAVLGFSKNIGVELGKYGIKVN  191

Query  514   CVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVS  335
             CVS   I T L ++ +   +R++AE+  A   NLKG  L  E+VA+A LYLA D+SKYVS
Sbjct  192   CVSPHYISTPLVLNALGIAEREMAEKWFAAGGNLKGALLDEEEVAKAVLYLASDDSKYVS  251

Query  334   GVNLIIDGGYSTTNIGFQVAVEKVL  260
             G+NL+IDGG+STTN+    A  K+ 
Sbjct  252   GMNLVIDGGFSTTNVALTEAYNKLF  276



>emb|CAA11153.1| short chain alcohol dehydrogenase [Nicotiana tabacum]
 emb|CAA11154.1| short chain alcohol dehydrogenase [Nicotiana tabacum]
Length=284

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 197/265 (74%), Gaps = 0/265 (0%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             KRLEGKVA+ITG A+GIGA TARLF  HG KV IADI D  G S+ QEIG E+ +F+HC+
Sbjct  12    KRLEGKVALITGGASGIGAATARLFVQHGAKVTIADIQDNLGTSLVQEIGNEHTIFVHCN  71

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V +ES VQN VD T++++GKLDIMFSNAG  G   +SIL+ + + I  VFD N+VG+FFC
Sbjct  72    VAVESDVQNVVDATIAKFGKLDIMFSNAGIGGKSISSILDVDYDIIKTVFDVNIVGAFFC  131

Query  694   AKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSN  515
             AKHAARVMIP KKGSIIF+ASA+T   GI  H Y+ASK A++G  K++ VE+GKYGI+ N
Sbjct  132   AKHAARVMIPFKKGSIIFTASAATVVSGIVPHAYSASKGAVLGFSKNIGVELGKYGIKVN  191

Query  514   CVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVS  335
             CVS   I T L ++ +   +R++AE+  A   NLKG  L  E+VA+A LYLA D+SKYVS
Sbjct  192   CVSPHYISTPLVLNALGIAEREIAEKWFAAGGNLKGALLDEEEVAKAVLYLASDDSKYVS  251

Query  334   GVNLIIDGGYSTTNIGFQVAVEKVL  260
             G+NL+IDGG+STTN+    A  K+ 
Sbjct  252   GMNLVIDGGFSTTNVALTEAYNKLF  276



>ref|XP_006354114.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=277

 Score =   263 bits (671),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 149/265 (56%), Positives = 194/265 (73%), Gaps = 1/265 (0%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-FIHC  878
             KRLEGKVAIITG A+GIG  T RLF  HG KV+IAD+ D +G S+ +EIG    + ++HC
Sbjct  9     KRLEGKVAIITGGASGIGEATTRLFTKHGAKVLIADVQDDHGQSIIKEIGENRDVSYVHC  68

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV++E  V+N VD  +S+YGKLDIMFSNAG  G  DT+IL+ + EN   VFD NV G+  
Sbjct  69    DVKVEKDVKNVVDMAISKYGKLDIMFSNAGVPGQPDTTILKLDYENFKNVFDVNVFGALM  128

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
             CAKHA RVMIP KKGSIIF++S ++  +G  +HTY ASK AIVGL K+L VE+G++GIR 
Sbjct  129   CAKHATRVMIPPKKGSIIFTSSIASVTYGDVAHTYLASKHAIVGLAKNLGVELGQHGIRV  188

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             NCVS   + T + M+ +   D++  EE V++  NLKG  L  EDVA+AALYLA DESKY+
Sbjct  189   NCVSPFGVATPMLMNGLGIHDKEEVEEFVSQISNLKGTILEGEDVAQAALYLASDESKYI  248

Query  337   SGVNLIIDGGYSTTNIGFQVAVEKV  263
             SG+N++IDGGYSTTN+  +  + K+
Sbjct  249   SGMNILIDGGYSTTNVALKQGIRKI  273



>ref|XP_009776711.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
sylvestris]
Length=284

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 152/269 (57%), Positives = 190/269 (71%), Gaps = 8/269 (3%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             K+L+GKVA ITG A+GIGA TARLF  HG KVIIADI D    SV QEIG E A FIHCD
Sbjct  12    KKLQGKVAFITGGASGIGAATARLFVQHGAKVIIADIQDSLATSVVQEIGTENATFIHCD  71

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V IES VQNAVD TV+++GKLDIM+SNAG  G   +SILE + + I  VFD N+VG FFC
Sbjct  72    VAIESDVQNAVDATVAKFGKLDIMYSNAGVLGKPISSILEVDYDIIKTVFDVNIVGKFFC  131

Query  694   AKHAARVMIPAKK-gsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
             AKHAARVMIPAKK   +  +++++        HTY+ASK A++GL K++ VE+G+YGIR 
Sbjct  132   AKHAARVMIPAKKGVILFTASASTEVYGAAVPHTYSASKNALLGLSKNVGVELGEYGIRV  191

Query  517   NCVSAAIILTKL---GMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDES  347
             NCVS   I T L   G  I    D+++A++  A   NLKG  L  EDVA+A LYLA D+S
Sbjct  192   NCVSPYYISTPLVLNGFGI----DKQMADKWFAAGGNLKGALLGVEDVAKAVLYLASDDS  247

Query  346   KYVSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             KY SG+NL++DGG+STTN+    A +K+ 
Sbjct  248   KYASGMNLVLDGGFSTTNVALTEAYKKLF  276



>ref|XP_009611083.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
tomentosiformis]
Length=326

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 151/264 (57%), Positives = 189/264 (72%), Gaps = 2/264 (1%)
 Frame = -1

Query  1048  LEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCDVR  869
             LEGKVA +TG A+GIGA TARLF  HG KVIIADI D+   SV QEIG E A F+HCDV 
Sbjct  59    LEGKVAFVTGGASGIGAATARLFVQHGAKVIIADIQDRLATSVVQEIGTENAAFVHCDVA  118

Query  868   IESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFCAK  689
             IES VQNAVD TV+++GKLDIMFSNAG  G   +SILE + + I  VFD N+VG+FFCAK
Sbjct  119   IESDVQNAVDATVAKFGKLDIMFSNAGVLGKPISSILEVDYDIIKTVFDVNIVGAFFCAK  178

Query  688   HAARVMIPAKK-gsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSNC  512
             HAARVMIPAKK   +  +++++        HT +ASK A+VGL K++ VE+G+YGIR NC
Sbjct  179   HAARVMIPAKKGVILFTASASTEVYVPAIMHTSSASKNALVGLSKNVGVELGEYGIRVNC  238

Query  511   VSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVSG  332
             VS   I T L +S     D++ A++  AEA NLKG  L  EDVA+A LYLA D+SKY SG
Sbjct  239   VSPYYISTPLVLSGYGI-DKQTADKWFAEAGNLKGALLGVEDVAKAVLYLASDDSKYASG  297

Query  331   VNLIIDGGYSTTNIGFQVAVEKVL  260
             +NL++DGG+STTN+      +K+ 
Sbjct  298   MNLVLDGGFSTTNVALTDTYKKLF  321



>ref|XP_004252563.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum lycopersicum]
Length=288

 Score =   256 bits (654),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 151/267 (57%), Positives = 190/267 (71%), Gaps = 1/267 (0%)
 Frame = -1

Query  1057  LKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHC  878
             +KRLEGK+AIITG A+GIGA T RL   HG KV IADI D  GN +  EIG E+ +F+HC
Sbjct  11    VKRLEGKIAIITGGASGIGAATTRLLVQHGAKVTIADIQDDVGNLLVHEIGTEHIMFVHC  70

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             +V IES ++N VD T+ ++GKLDIMFSNAG AG   +SIL+ N + I  VFD NVVG+FF
Sbjct  71    NVTIESDIRNVVDATIGKFGKLDIMFSNAGIAGKPISSILDVNYDIIKNVFDVNVVGAFF  130

Query  697   CAKHAARVMIPAK-KgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIR  521
             CAKHAARVMI  K KGSIIF+AS     +G   HTY ASK A++GL K++ VE+G+YGIR
Sbjct  131   CAKHAARVMISTKTKGSIIFTASVVATTYGDLPHTYVASKNAVLGLSKNVGVELGRYGIR  190

Query  520   SNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKY  341
              NC+S + I T L +  +   +R+ AE+   E  NLKG  L  +DVA   LYLA D+SKY
Sbjct  191   VNCISPSGIGTPLALKTLGIDEREKAEKWFGEGGNLKGALLEEQDVANGVLYLASDDSKY  250

Query  340   VSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             VSG+NL+IDGGYSTTN+    A +K+ 
Sbjct  251   VSGLNLVIDGGYSTTNVALGEAYKKLF  277



>ref|XP_010654127.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=282

 Score =   253 bits (646),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 153/267 (57%), Positives = 195/267 (73%), Gaps = 9/267 (3%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALF-IHC  878
             +RL GKVA+ITG A+GIGA+TA+LF  HG KVI+AD+ D+ G SV +EIGPE  +F +HC
Sbjct  9     QRLAGKVALITGGASGIGASTAKLFVKHGAKVIVADVQDQLGLSVCKEIGPEETVFYVHC  68

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV  +S VQNAVDT +S+YGKLDIMFSNAG +G  ++ IL  +  N   VFD NV G+F 
Sbjct  69    DVTCDSDVQNAVDTAISKYGKLDIMFSNAGISGEMESGILLVDNTNFKRVFDVNVYGAFL  128

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AKHAARVMIPAK G IIF++SA +      +H Y ASK A+VGL  +LCVE+G+YGIR 
Sbjct  129   AAKHAARVMIPAKTGCIIFTSSAVSVVSVGATHAYVASKHAVVGLANNLCVELGQYGIRV  188

Query  517   NCVS----AAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
             NC+S    A  IL K G+ IM   +++  EE+V  A NLKGV L  ED+AEAALYL  D+
Sbjct  189   NCISPFGVATPILRK-GLGIM---EKRKVEELVCSAANLKGVVLEAEDIAEAALYLGSDD  244

Query  349   SKYVSGVNLIIDGGYSTTNIGFQVAVE  269
             SKYVSG+NL++DGGYS+TN  F + ++
Sbjct  245   SKYVSGINLVVDGGYSSTNPSFGMVLK  271



>gb|EYU18091.1| hypothetical protein MIMGU_mgv1a011664mg [Erythranthe guttata]
Length=274

 Score =   252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 145/270 (54%), Positives = 193/270 (71%), Gaps = 5/270 (2%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGP-EYALFIHC  878
             KRLEGKVAIITG A+GIG +TARLF HHG KVII D+ D+ G +    IGP E   ++HC
Sbjct  3     KRLEGKVAIITGGASGIGESTARLFVHHGAKVIIGDVQDELGRTACTNIGPPEVISYVHC  62

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV +ES V++AVD  VS++GKLD+MF+NAGT G  DTSIL  + +++  VF  NV G+F 
Sbjct  63    DVTVESDVRDAVDAAVSKHGKLDVMFANAGTPGKSDTSILSTDYDDLKSVFGVNVFGAFL  122

Query  697   CAKHAARVMIPA----KKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             CAKHAARVM+PA    +  +IIF++S ++   G   H Y ASK A+VGL K+LCVEMG+ 
Sbjct  123   CAKHAARVMVPAAGTTRGAAIIFTSSIASVTSGDVPHAYVASKHAVVGLMKNLCVEMGQK  182

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
             G+R NC+S   + T + M  +  +++  A+E V    NLKG  +T +DVAEAA+YLA DE
Sbjct  183   GVRVNCISPFGVATPMLMGALKVREKAEADEFVRGIANLKGEDVTADDVAEAAVYLASDE  242

Query  349   SKYVSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             SKYVSG NL+IDGGYS TNI  + +++K++
Sbjct  243   SKYVSGQNLVIDGGYSLTNIALRESIKKMM  272



>ref|XP_002530171.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF32226.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=282

 Score =   252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 143/267 (54%), Positives = 195/267 (73%), Gaps = 6/267 (2%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL--FIH  881
             KRL+GKVA+ITG A+G+G ++ARLF  HG KV++AD+ D+ G+S+ +E+GP+  +  +IH
Sbjct  12    KRLQGKVALITGGASGMGESSARLFVKHGAKVVVADVQDELGHSLCRELGPDQEIISYIH  71

Query  880   CDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSF  701
             CDV  +S VQNAVD  VS+YGKLDIMFSNAG AG+   SI++   E+   VFD NV G+F
Sbjct  72    CDVTCDSDVQNAVDFAVSKYGKLDIMFSNAGVAGNVYPSIVDTENEDFKRVFDINVFGAF  131

Query  700   FCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIR  521
               AKHAARVMIPAKKG I+F+ S  + +     H Y ASK AI+GL K+L VE+G++GIR
Sbjct  132   LAAKHAARVMIPAKKGCILFTCSYLSVSCFQAIHPYVASKHAILGLSKNLSVELGQHGIR  191

Query  520   SNCVSAAIILTKL---GMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
              NCVS  +++T +    M +M  +  KL +E+V+ + NLK V+L  ED+AEAALYL  DE
Sbjct  192   VNCVSPFVVITPMMRKAMGVMEAEKEKL-QEVVSASANLKNVTLEAEDIAEAALYLVSDE  250

Query  349   SKYVSGVNLIIDGGYSTTNIGFQVAVE  269
             SKYVSG+NL++DGGY+ TN  F + ++
Sbjct  251   SKYVSGMNLVVDGGYTLTNPAFAMEMQ  277



>gb|AFL56690.1| ADH1, partial [Solanum lycopersicum]
Length=288

 Score =   252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 155/269 (58%), Positives = 194/269 (72%), Gaps = 3/269 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             K+LEGK+AIITG A+GIG  TARLF  HG KV IADI D   NS+ +E   E+ +F+HCD
Sbjct  12    KKLEGKIAIITGGASGIGLATARLFIQHGAKVTIADIQDNLVNSLVKE--NEHLMFVHCD  69

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V IES VQN VD TV+++GKLDIMFSNAG AG   +SIL+ + + I  VFD NVVG+F C
Sbjct  70    VAIESDVQNVVDATVAKFGKLDIMFSNAGVAGKSISSILDVDTDIIKNVFDVNVVGAFLC  129

Query  694   AKHAARVMIPAK-KgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
             AKHAARVMI +  KGSIIF+ SA+T  +GI  H+Y ASK A++GLCK++ VE+G+YGI+ 
Sbjct  130   AKHAARVMISSHTKGSIIFTTSAATVVYGIVPHSYAASKSAVLGLCKNIGVELGRYGIKV  189

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             NCVS   I TKL +  +   +R+ AE    E  NLKGV L  +DVA   LYLA D+SKYV
Sbjct  190   NCVSPHYISTKLALDALGIDEREKAERWFGEGGNLKGVLLEEQDVANGVLYLASDDSKYV  249

Query  337   SGVNLIIDGGYSTTNIGFQVAVEKVLGGG  251
             SG+NL+IDGGYSTTN+    A +K+   G
Sbjct  250   SGLNLVIDGGYSTTNVALGEAYKKLFPSG  278



>ref|XP_010314459.1| PREDICTED: uncharacterized protein LOC100750250 isoform X1 [Solanum 
lycopersicum]
Length=288

 Score =   252 bits (643),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 155/269 (58%), Positives = 194/269 (72%), Gaps = 3/269 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             K+LEGK+AIITG A+GIG  TARLF  HG KV IADI D   NS+ +E   E+ +F+HCD
Sbjct  12    KKLEGKIAIITGGASGIGLATARLFIQHGAKVTIADIQDDLVNSLVKE--NEHLMFVHCD  69

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V IES VQN VD TV+++GKLDIMFSNAG AG   +SIL+ + + I  VFD NVVG+F C
Sbjct  70    VAIESDVQNVVDATVAKFGKLDIMFSNAGVAGKSISSILDVDTDIIKNVFDVNVVGAFLC  129

Query  694   AKHAARVMIPAK-KgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
             AKHAARVMI +  KGSIIF+ SA+T  +GI  H+Y ASK A++GLCK++ VE+G+YGI+ 
Sbjct  130   AKHAARVMISSHTKGSIIFTTSAATVVYGIVPHSYAASKSAVLGLCKNIGVELGRYGIKV  189

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             NCVS   I TKL +  +   +R+ AE    E  NLKGV L  +DVA   LYLA D+SKYV
Sbjct  190   NCVSPHYISTKLALDALGIDEREKAERWFGEGGNLKGVLLEEQDVANGVLYLASDDSKYV  249

Query  337   SGVNLIIDGGYSTTNIGFQVAVEKVLGGG  251
             SG+NL+IDGGYSTTN+    A +K+   G
Sbjct  250   SGLNLVIDGGYSTTNVALGEAYKKLFPSG  278



>ref|XP_002281352.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=282

 Score =   251 bits (642),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 145/258 (56%), Positives = 186/258 (72%), Gaps = 1/258 (0%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALF-IHC  878
             +RL GKVA+ITG A+GIGA TA+LF  HG KVI+AD+ D+ G S+ QEIGP   +F +HC
Sbjct  9     QRLAGKVALITGGASGIGACTAKLFVKHGAKVIVADVQDQLGRSLCQEIGPAETVFDVHC  68

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV  +S VQNAVDT +S+YGKLDIMFSNAG  G  ++ I+ ++  N   VFD NV G+F 
Sbjct  69    DVTCDSDVQNAVDTAISKYGKLDIMFSNAGVHGEMESRIILSDNTNFKRVFDVNVYGAFL  128

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AKHAARVMIPAK G IIF++S ++      SH Y ASK A+VGL  +LCVE+G+YGIR 
Sbjct  129   AAKHAARVMIPAKTGCIIFTSSVASVVSEEISHAYVASKHAVVGLANNLCVELGQYGIRV  188

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             NC+S   + T +    +   +++  EE+V+ A NLKGV L  ED+AEAALYL  D+SKYV
Sbjct  189   NCISPFGVATPMLQKGLGIMEKRKVEELVSSAANLKGVVLEAEDIAEAALYLGSDDSKYV  248

Query  337   SGVNLIIDGGYSTTNIGF  284
             SG+NL++DGGYS TN  F
Sbjct  249   SGINLVVDGGYSITNPSF  266



>ref|XP_011046902.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=279

 Score =   251 bits (641),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 154/266 (58%), Positives = 193/266 (73%), Gaps = 8/266 (3%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-FIHC  878
             KRLEGKVA+ITG A+GIGA TARLF  HG KV+IADI D  G+S  QE GP+  + ++HC
Sbjct  12    KRLEGKVALITGGASGIGACTARLFVQHGAKVLIADIQDDLGHSFCQEFGPQETISYVHC  71

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             +V  +S VQNAVDT VS+YGKLDIMF+NAG  G R + IL  + EN   V D NV G F 
Sbjct  72    NVTCDSDVQNAVDTAVSKYGKLDIMFNNAGIPGDRKSGILTCDNENFKRVLDVNVYGGFL  131

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AKHAARVMIPAKKG I+F++S ++  +G  +H YTASK AIVGL K+L VE+G+YGIR 
Sbjct  132   GAKHAARVMIPAKKGCILFTSSVASVLYGELAHAYTASKNAIVGLAKNLSVELGQYGIRV  191

Query  517   NCVSAAIILTKL---GMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDES  347
             N +S   + T L   G+S+     ++ AEE+VA A  LK V L  EDV++AALYLA +ES
Sbjct  192   NSISPYAVATPLLTDGLSMT----KEAAEELVASAATLKDVVLEPEDVSQAALYLASEES  247

Query  346   KYVSGVNLIIDGGYSTTNIGFQVAVE  269
             KYVSGVNL+IDGGY+ TN  F +A++
Sbjct  248   KYVSGVNLVIDGGYNLTNPSFSMALK  273



>ref|XP_006361625.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=283

 Score =   251 bits (640),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 154/266 (58%), Positives = 190/266 (71%), Gaps = 1/266 (0%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             KRLEGKVAIITG A+GIGA TA+LF  HG KV IADI +  GNS+  EIG E+ +F+HC+
Sbjct  12    KRLEGKVAIITGGASGIGAATAKLFVQHGAKVTIADIQNDLGNSLVYEIGTEHIMFVHCN  71

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V IE  +QNAVD T++++GKLDIMFSNAG AG   +SI++ + + I  VFD NVVGSF C
Sbjct  72    VAIEFDIQNAVDATIAKFGKLDIMFSNAGIAGKPISSIVDVDYDVIKNVFDVNVVGSFLC  131

Query  694   AKHAARVMIPAK-KgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
             AKHAARVMI    KGSIIF+AS  T  +G T HTY ASK A++GL K++ VE+GKYGIR 
Sbjct  132   AKHAARVMISNNTKGSIIFTASMVTTKYGDTLHTYAASKNAVLGLSKNIGVELGKYGIRV  191

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             NC+S   I T L +       R++ ++  AEA NLKG  L  +DVA   LYLA D+S YV
Sbjct  192   NCISPYAIGTPLALKAFGIAVREMVDKWFAEAGNLKGALLEEQDVANGVLYLASDDSNYV  251

Query  337   SGVNLIIDGGYSTTNIGFQVAVEKVL  260
             SG+NLIIDGGYSTTN+    A  K+ 
Sbjct  252   SGLNLIIDGGYSTTNVALTEAYNKLF  277



>ref|XP_002281290.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Vitis vinifera]
Length=282

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 148/258 (57%), Positives = 189/258 (73%), Gaps = 7/258 (3%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFI-HC  878
             +RL GKVA+ITG A+GIGA+TA+LF  HG KVI+ D+ D+ G SV +EIGPE  +F  HC
Sbjct  9     QRLSGKVALITGGASGIGASTAKLFVKHGAKVIVTDVQDQLGRSVCKEIGPEETVFYDHC  68

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV  +S VQNAVDT +S+YGKLDIMFSNAG +G  D+ IL ++  N   VFD N  G+F 
Sbjct  69    DVTCDSDVQNAVDTAISKYGKLDIMFSNAGISGEVDSEILLSDNTNFKRVFDVNAYGAFL  128

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AKHAARVMIPAK G IIF++S ++   G  SH Y ASK A+VGL  +LCVE+G+YG+R 
Sbjct  129   AAKHAARVMIPAKTGCIIFTSSVASVVSGEISHAYVASKHAVVGLANNLCVELGQYGLRV  188

Query  517   NCVSAAIILTKL---GMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDES  347
             NCVS   + T +   G+ IM   +++  EE+V+ A NLKG +L  ED+AEAALYL  D+S
Sbjct  189   NCVSPFGVPTPMLQKGVGIM---EKRKVEELVSSAANLKGAALEAEDIAEAALYLGSDDS  245

Query  346   KYVSGVNLIIDGGYSTTN  293
             KYVSG+NL++DGGYS TN
Sbjct  246   KYVSGINLVVDGGYSITN  263



>ref|XP_010654128.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Vitis vinifera]
Length=282

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 148/258 (57%), Positives = 189/258 (73%), Gaps = 7/258 (3%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFI-HC  878
             +RL GKVA+ITG A+GIGA+TA+LF  HG KVI+ D+ D+ G SV +EIGPE  +F  HC
Sbjct  9     QRLSGKVALITGGASGIGASTAKLFVKHGAKVIVTDVQDQLGRSVCKEIGPEETVFYDHC  68

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV  +S VQNAVDT +S+YGKLDIMFSNAG +G  D+ IL ++  N   VFD N  G+F 
Sbjct  69    DVTCDSDVQNAVDTAISKYGKLDIMFSNAGISGEVDSEILLSDNTNFKRVFDVNAYGAFL  128

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AKHAARVMIPAK G IIF++S ++   G  SH Y ASK A+VGL  +LCVE+G+YG+R 
Sbjct  129   AAKHAARVMIPAKTGCIIFTSSVASVVSGEISHAYVASKHAVVGLANNLCVELGQYGLRV  188

Query  517   NCVSAAIILTKL---GMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDES  347
             NCVS   + T +   G+ IM   +++  EE+V+ A NLKG +L  ED+AEAALYL  D+S
Sbjct  189   NCVSPFGVPTPMLQKGVGIM---EKRKVEELVSSAANLKGAALEAEDIAEAALYLGSDDS  245

Query  346   KYVSGVNLIIDGGYSTTN  293
             KYVSG+NL++DGGYS TN
Sbjct  246   KYVSGINLVVDGGYSITN  263



>ref|XP_009618308.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
tomentosiformis]
Length=279

 Score =   249 bits (635),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 144/271 (53%), Positives = 194/271 (72%), Gaps = 2/271 (1%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIG-PEYA  893
             +A + +RLEGKVAIITG A+G G +T RLF  +G KV+IAD+ D  G S+   +  P   
Sbjct  7     LAPTSRRLEGKVAIITGGASGFGESTVRLFLQNGAKVVIADVQDNIGQSLCNNLNYPNDV  66

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              +IHCDV  +S V+N +DTT+S+YGKLDIMF+NAG  G+ D +I++++ EN   VFD NV
Sbjct  67    TYIHCDVTSDSDVKNLIDTTISKYGKLDIMFNNAGIPGNLDFNIVDSDNENFKRVFDVNV  126

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
              GSF  AK+AA+VMIPAKKG I+F++S ++   G + H+YT SK A+VGL K+LC E+G+
Sbjct  127   YGSFLGAKYAAKVMIPAKKGVILFTSSVASVNSGESPHSYTVSKHAVVGLTKNLCAELGQ  186

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             YGIR NCVS   + T L +  M   D+ + + I+  + NLKGV  T EDVAEAALYLA D
Sbjct  187   YGIRVNCVSPCAVATPLLVKAM-GADKIVVDGIICSSANLKGVVPTAEDVAEAALYLASD  245

Query  352   ESKYVSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             ESK++SG+NL+IDGGYSTTN  +   ++ VL
Sbjct  246   ESKFISGLNLVIDGGYSTTNQAYMKTIQSVL  276



>ref|XP_010654129.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=282

 Score =   249 bits (635),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 143/255 (56%), Positives = 184/255 (72%), Gaps = 1/255 (0%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALF-IHC  878
             +RL GKVA+ITG A+GIGA TA+LF  HG KVI+AD+ D+ G S+ QEIGP   +F +HC
Sbjct  9     QRLAGKVALITGGASGIGACTAKLFVKHGAKVIVADVQDQLGRSLCQEIGPAETVFHVHC  68

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV  +S VQNAVDT +S+YGKLDIMFSNAG  G  ++ I+ ++  N   VFD NV G+F 
Sbjct  69    DVTCDSDVQNAVDTAISKYGKLDIMFSNAGVHGEMESRIILSDNTNFKRVFDVNVYGAFL  128

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AKHAARVMIPAK G IIF++S ++      SH Y ASK A+VGL  +LCVE+G+YGIR 
Sbjct  129   AAKHAARVMIPAKTGCIIFTSSVASVVSEEISHAYVASKHAVVGLANNLCVELGQYGIRV  188

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             NC+S   + T +    +   +++  EE+V+ A NLKG  L  ED+AEAALYL  D+SKYV
Sbjct  189   NCISPFGVATPMLQKGLGIMEKRKVEELVSSAANLKGAVLEAEDIAEAALYLGSDDSKYV  248

Query  337   SGVNLIIDGGYSTTN  293
             SG+NL++DGGYS TN
Sbjct  249   SGINLVVDGGYSITN  263



>ref|XP_006361611.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=291

 Score =   249 bits (635),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 154/267 (58%), Positives = 196/267 (73%), Gaps = 2/267 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEI-GPEYALFIHC  878
             K+LEGKVA+ITG A+GIGA TARLF  HG KV IADI +  GNS+ ++I   E+ +FIHC
Sbjct  12    KKLEGKVALITGGASGIGAATARLFIQHGAKVTIADIQNDLGNSLVKQIDNNEHIMFIHC  71

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             +V IES VQN VD TV+++GKLDIMFSNAG AG   +SIL+ + + I  VFD NVVG+F 
Sbjct  72    NVAIESDVQNVVDATVAKFGKLDIMFSNAGVAGKSISSILDVDSDIIKNVFDVNVVGAFL  131

Query  697   CAKHAARVMIPAK-KgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIR  521
             CAKHAARVMI    KGSIIF+ SA+T  +GI  H+Y ASK A++GL K++ VE+GKYGI+
Sbjct  132   CAKHAARVMISNNTKGSIIFTTSAATVVYGIVPHSYAASKSAVLGLSKNIGVELGKYGIK  191

Query  520   SNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKY  341
              NCVS   I T L ++ +   +R++ E+  AE  NLKGV L  +DVA   LYLA D+SKY
Sbjct  192   VNCVSPHYISTPLTLNALGIAEREMGEKWFAEGGNLKGVLLDEQDVANGVLYLASDDSKY  251

Query  340   VSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             VSG+NL+IDGGYSTTN+    A +K+ 
Sbjct  252   VSGLNLVIDGGYSTTNVAIGEAYKKLF  278



>ref|XP_009768564.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
sylvestris]
Length=280

 Score =   248 bits (633),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 145/271 (54%), Positives = 195/271 (72%), Gaps = 2/271 (1%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIG-PEYA  893
             +A + +RLEGKVAIITG A+G G +T RLF  +G KV+IAD+ D  G S+ + +  P   
Sbjct  7     LAPTSRRLEGKVAIITGGASGFGESTVRLFLQNGAKVVIADVQDNIGQSLCESLNYPNDV  66

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              +IHCDV  +S V+N +DTT+S+YGKLDIMF+NAG  G+ D +I++++ EN   VFD NV
Sbjct  67    TYIHCDVTSDSDVKNLIDTTISKYGKLDIMFNNAGIPGNLDFNIVDSDNENFKRVFDVNV  126

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
              GSF  AK+AARVMIPAKKG I+F++SA++   G + H+YT SK A+VGL K+LC E+G+
Sbjct  127   YGSFLGAKYAARVMIPAKKGVILFTSSAASVNAGESPHSYTVSKHAVVGLTKNLCAELGQ  186

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +GIR NCVS   + T L +  M    + + + I+  + NLKGV  T EDVAEAALYLA D
Sbjct  187   FGIRVNCVSPCAVATPLLVKAM-GAGKSVVDGIICSSANLKGVVPTAEDVAEAALYLASD  245

Query  352   ESKYVSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             ESK+VSG+NL+IDGGYSTTN  +   ++ VL
Sbjct  246   ESKFVSGLNLVIDGGYSTTNQAYMKTIQSVL  276



>gb|KDP36167.1| hypothetical protein JCGZ_08811 [Jatropha curcas]
Length=272

 Score =   248 bits (632),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 149/270 (55%), Positives = 189/270 (70%), Gaps = 3/270 (1%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             +A   KRL+GKV +ITGAA+GIG ++ARLFA HG KV+IADI D  G+SV  EIG +Y  
Sbjct  5     LAPIAKRLDGKVVLITGAASGIGESSARLFAKHGAKVVIADIQDDLGHSVCNEIGSDY--  62

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
              +HC+V  E+ V+NA+  TVS+YGKLDI+FSNAGT+G    SILE   EN   VFD NV 
Sbjct  63    -VHCNVTNETDVENAIKATVSKYGKLDIVFSNAGTSGDESPSILEVMYENYKKVFDVNVY  121

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             G+F  AKHAA  MIP +KGSIIF++S  +   GI  H Y  SK A+VGL K+LCVE+G+Y
Sbjct  122   GAFLVAKHAASAMIPERKGSIIFTSSVVSVTHGIVPHLYAVSKHALVGLTKNLCVELGQY  181

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
             GIR NC+S   + T L        D+K  EEI++ A NLK + L   DVAEAAL+L  DE
Sbjct  182   GIRVNCISPYGVATPLLREAFGGIDKKKVEEIMSAAANLKDIVLEANDVAEAALFLGSDE  241

Query  349   SKYVSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             SKYVSG+NL++DGGYSTTN+  +  V++  
Sbjct  242   SKYVSGLNLVVDGGYSTTNVAIREKVKEFF  271



>ref|XP_011094266.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Sesamum indicum]
Length=284

 Score =   248 bits (632),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 142/271 (52%), Positives = 191/271 (70%), Gaps = 1/271 (0%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGP-EY  896
             ++++  KRLEGKVA+ITG A+GIG  TARLF  HG KV+IAD+ D+ G +  ++IG  E 
Sbjct  11    LISSMAKRLEGKVAVITGGASGIGEYTARLFVQHGAKVVIADVQDELGQTACRDIGSSEV  70

Query  895   ALFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTN  716
               ++HCDV  E+ V+N V+T VS+YGKLDIMFSNAG  G+ D  IL  + E++  VFD N
Sbjct  71    ISYVHCDVTNETDVENVVNTAVSKYGKLDIMFSNAGVPGNNDPRILATDYEDLRRVFDVN  130

Query  715   VVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMG  536
             V G F CAKHAARVMIPAK+GSI+F++S ++   G+  H Y ASK A+VGL K+LC+E+G
Sbjct  131   VFGGFLCAKHAARVMIPAKRGSIVFTSSVASVTHGVVPHAYVASKHAVVGLTKNLCIELG  190

Query  535   KYGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAG  356
             +YGIR NCVS   + T + M  +   ++   EE+V+   NLKG  +   DVAEA ++L+ 
Sbjct  191   EYGIRVNCVSPFGVATPMLMRTVELDEKAKVEELVSGIANLKGEKMEAVDVAEAVIFLSS  250

Query  355   DESKYVSGVNLIIDGGYSTTNIGFQVAVEKV  263
             DE KYVSG NL+IDGGYS TNI  +  + K+
Sbjct  251   DEGKYVSGQNLVIDGGYSLTNIALREGIRKL  281



>ref|XP_006360738.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=280

 Score =   248 bits (632),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 147/269 (55%), Positives = 189/269 (70%), Gaps = 8/269 (3%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             K+LEGKVAIITG A+GIGA TARLF  HG KV IADI +  GNS+ ++IG E+  F+HC+
Sbjct  12    KKLEGKVAIITGGASGIGAATARLFVQHGAKVTIADIQNDLGNSLVKQIGTEHITFVHCN  71

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V IES VQNAVD T++++GKLDIMFSNAG  G   +SIL+ + + I  VFD NVVG+FFC
Sbjct  72    VTIESDVQNAVDATIAKFGKLDIMFSNAGVLGKPISSILDVDYDTIKDVFDVNVVGAFFC  131

Query  694   AKHAARVMIPAKK-gsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
             AKH ARVMIP KK   +  +++++       SHT T+SK A++GL K+L VE+GKYGIR 
Sbjct  132   AKHDARVMIPNKKGVILFTASASTVVYGTGVSHTSTSSKNAVLGLSKNLGVELGKYGIRV  191

Query  517   NCVSAAIILTKL---GMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDES  347
             NCVS   I T L   G  I    D++ A++   E  NLKG SL  +DVA   LYLA D+S
Sbjct  192   NCVSPYCISTPLMLNGFGI----DKQKADKWFEEGGNLKGASLDEQDVANGVLYLASDDS  247

Query  346   KYVSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             KY+SG NLI+DGG++TTN+    A +K+ 
Sbjct  248   KYMSGHNLILDGGFNTTNVALTKAYKKLF  276



>ref|XP_002526911.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF35464.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=282

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 143/267 (54%), Positives = 192/267 (72%), Gaps = 6/267 (2%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL--FIH  881
             KRLEGKVA+ITG A+G+G ++ARLF  HG KV++AD+ D+ G S+ +E+G +  +  +IH
Sbjct  12    KRLEGKVALITGGASGMGESSARLFVKHGAKVVVADVQDELGYSLCKELGSDQEIISYIH  71

Query  880   CDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSF  701
             CDV  +S VQNAVD  VS+YGKLDIMFSNAG AG+   SI++   E+   VFD NV G+F
Sbjct  72    CDVTCDSDVQNAVDFAVSKYGKLDIMFSNAGVAGNVYPSIVDTENEDFKRVFDINVFGAF  131

Query  700   FCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIR  521
               AKHAARVMIPAKKG I+F+ S  + +     H Y ASK AI+GL K+L VE+G++GIR
Sbjct  132   LAAKHAARVMIPAKKGCILFTCSYLSVSCFQAIHPYVASKHAILGLSKNLSVELGQHGIR  191

Query  520   SNCVSAAIILTKL---GMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
              NCVS  +++T +    M +M  +  KL +E+V+ + NLK V L  ED+AEAALYL  DE
Sbjct  192   VNCVSPFVVITPMMRKAMGVMEAEKEKL-QEVVSASANLKNVMLEAEDIAEAALYLVSDE  250

Query  349   SKYVSGVNLIIDGGYSTTNIGFQVAVE  269
             SKYVSG+NL++DGGY+ TN  F + ++
Sbjct  251   SKYVSGMNLVVDGGYTLTNPAFAMEMQ  277



>ref|XP_011094267.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Sesamum indicum]
Length=280

 Score =   246 bits (628),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 142/267 (53%), Positives = 188/267 (70%), Gaps = 1/267 (0%)
 Frame = -1

Query  1060  SLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGP-EYALFI  884
             S +RLEGKVA+ITG A+GIG  TARLF  HG KV+IAD+ D+ G +  ++IG  E   ++
Sbjct  11    SRQRLEGKVAVITGGASGIGEYTARLFVQHGAKVVIADVQDELGQTACRDIGSSEVISYV  70

Query  883   HCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGS  704
             HCDV  E+ V+N V+T VS+YGKLDIMFSNAG  G+ D  IL  + E++  VFD NV G 
Sbjct  71    HCDVTNETDVENVVNTAVSKYGKLDIMFSNAGVPGNNDPRILATDYEDLRRVFDVNVFGG  130

Query  703   FFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGI  524
             F CAKHAARVMIPAK+GSI+F++S ++   G+  H Y ASK A+VGL K+LC+E+G+YGI
Sbjct  131   FLCAKHAARVMIPAKRGSIVFTSSVASVTHGVVPHAYVASKHAVVGLTKNLCIELGEYGI  190

Query  523   RSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESK  344
             R NCVS   + T + M  +   ++   EE+V+   NLKG  +   DVAEA ++L+ DE K
Sbjct  191   RVNCVSPFGVATPMLMRTVELDEKAKVEELVSGIANLKGEKMEAVDVAEAVIFLSSDEGK  250

Query  343   YVSGVNLIIDGGYSTTNIGFQVAVEKV  263
             YVSG NL+IDGGYS TNI  +  + K+
Sbjct  251   YVSGQNLVIDGGYSLTNIALREGIRKL  277



>ref|XP_006361624.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=309

 Score =   247 bits (631),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 145/256 (57%), Positives = 186/256 (73%), Gaps = 2/256 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIG-PEYALFIHC  878
             +RLEGKVAIITG A+GIGA TARLF H G KV+I DI DK G SVAQ+IG  +  +++HC
Sbjct  40    RRLEGKVAIITGGASGIGAATARLFVHQGAKVVICDIQDKLGTSVAQQIGNKQTIIYVHC  99

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV IES V+N V+TT++++GKLDIMFSNAG  G+  TSI + +   +  +FD NVVG FF
Sbjct  100   DVSIESDVKNVVNTTIAKFGKLDIMFSNAGVIGNPFTSIQDIDYNMVKNIFDVNVVGGFF  159

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
             CAKHAARVMIP KKG IIF+ S  +  +    H YT SK A++GL K++ VE+ KYGIR 
Sbjct  160   CAKHAARVMIPKKKGVIIFTTSIVSTFYSDLVHIYTTSKNALLGLTKNVGVELAKYGIRV  219

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             N VS   I T L ++     ++++A++   E  NLKGV L+ EDVA+  LYLA DES+Y 
Sbjct  220   NSVSPYAISTPLMLNAFKV-NKEMADKWFTEGGNLKGVLLSVEDVADGVLYLASDESRYA  278

Query  337   SGVNLIIDGGYSTTNI  290
             SG+NLIIDGGY+TTN+
Sbjct  279   SGLNLIIDGGYTTTNV  294



>ref|XP_007027908.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
 gb|EOY08410.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
Length=274

 Score =   245 bits (625),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 143/261 (55%), Positives = 183/261 (70%), Gaps = 0/261 (0%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             KRLEGKVA+ITG A+G+G +TARLF  HG KV+IADI D+ G+S+ QE+G E   ++HCD
Sbjct  9     KRLEGKVALITGGASGLGESTARLFVQHGAKVLIADIQDELGHSLCQELGTETISYVHCD  68

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V  ES VQNAV+  VS+Y KLDIM +NAG  G  +  + +A+ EN   VFD NV+G F  
Sbjct  69    VTCESDVQNAVELAVSKYRKLDIMLNNAGIMGHHEVRVTDADTENFKTVFDINVLGGFLG  128

Query  694   AKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSN  515
             AKHAARVM+PAKKG I+F+AS ++     T H Y ASK A+VGL KSL VE+G+YGIR N
Sbjct  129   AKHAARVMVPAKKGCILFTASLASKISMGTPHAYKASKHAVVGLTKSLSVELGEYGIRVN  188

Query  514   CVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVS  335
             C+S   + T L    +   D+K  EE V+ +  LKG  L  ED A AALYLA DE+KY+S
Sbjct  189   CISPHAVATPLFQKTLGVFDKKKGEEAVSASAVLKGAVLEPEDFANAALYLASDEAKYLS  248

Query  334   GVNLIIDGGYSTTNIGFQVAV  272
             GVNL IDGGYS +N  +++ +
Sbjct  249   GVNLTIDGGYSLSNQTWKMGL  269



>ref|XP_002309405.1| alcohol dehydroge family protein [Populus trichocarpa]
 gb|EEE92928.1| alcohol dehydroge family protein [Populus trichocarpa]
Length=277

 Score =   245 bits (625),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 145/271 (54%), Positives = 192/271 (71%), Gaps = 2/271 (1%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             +A+  KRL GKVAIITG A+GIG +T+RLF  HG  VIIAD+ D+ G S+ +E+G E  +
Sbjct  7     LASFAKRLAGKVAIITGGASGIGESTSRLFVEHGANVIIADVQDQVGQSLCKELGTENNV  66

Query  889   F-IHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
             + +HCDV  ++ V+N VD  +S+YGKLDIM++NAG  G+ D +IL    EN   VF+ NV
Sbjct  67    YYVHCDVTSDTDVKNVVDFAISKYGKLDIMYNNAGITGNIDPTILGTENENFKRVFEVNV  126

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
              G F  AKHAARVMIP KKG I+F++S ++ A G + H YT SK A+VGL K+LCVE+G+
Sbjct  127   YGGFLGAKHAARVMIPVKKGVILFTSSVASMACGESPHAYTMSKHAVVGLMKNLCVELGQ  186

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             YGIR NC+S   + T L  + M   D+   E +V E+ NLKGV  + +DVAEAALYL  D
Sbjct  187   YGIRVNCISPCALATPLLRNAMGA-DKSFVEHVVCESANLKGVVPSPKDVAEAALYLGSD  245

Query  352   ESKYVSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             ESKYVSG+NL++DGGYSTTN  F + +  +L
Sbjct  246   ESKYVSGLNLMVDGGYSTTNQSFNMVLRNIL  276



>ref|XP_002308448.2| alcohol dehydroge family protein [Populus trichocarpa]
 gb|EEE91971.2| alcohol dehydroge family protein [Populus trichocarpa]
Length=277

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 146/261 (56%), Positives = 184/261 (70%), Gaps = 1/261 (0%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             ++A   KRLEGKVA+ITG A+GIG ++ RLF  HG KV+IADI D  G+SV +EIG + +
Sbjct  6     LLAPVSKRLEGKVALITGGASGIGESSTRLFVRHGAKVVIADIQDDLGHSVCEEIGSDES  65

Query  892   L-FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTN  716
             L ++HCDV  ES V+ AV+T VS+YGKLDI FSNAG  G  D      + +N   VFDTN
Sbjct  66    LSYVHCDVTRESDVEKAVNTAVSKYGKLDIFFSNAGILGKGDPQASAIDYDNFKRVFDTN  125

Query  715   VVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMG  536
             V G+F  AKHA+RVMIP KKGSII+++S  +   G   H YTASK AIVGL K+LC E+G
Sbjct  126   VYGAFLGAKHASRVMIPEKKGSIIYTSSVVSVIVGNVPHAYTASKHAIVGLTKNLCAELG  185

Query  535   KYGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAG  356
             ++GIR NC+S A + T L  +     +R  A EI +   +LKGV L  EDVAEAALYLA 
Sbjct  186   QFGIRVNCISPAAVPTPLMRNAFGGINRNAALEIASATAHLKGVMLEEEDVAEAALYLAS  245

Query  355   DESKYVSGVNLIIDGGYSTTN  293
             D+SKYVSG+NL++DGG S TN
Sbjct  246   DDSKYVSGLNLVVDGGISATN  266



>gb|KDP36152.1| hypothetical protein JCGZ_08796 [Jatropha curcas]
Length=274

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 147/268 (55%), Positives = 191/268 (71%), Gaps = 1/268 (0%)
 Frame = -1

Query  1063  ASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIG-PEYALF  887
             ++ +RLEGKVA+ITG A+GIG  TARLF   G KV+IAD+ D  G+S+ QE    E   +
Sbjct  5     STTRRLEGKVALITGGASGIGECTARLFVEQGAKVLIADVQDDLGHSICQEFNNQEIISY  64

Query  886   IHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVG  707
             IHC+V  +S V+NAVDT VSRYGKLDIMF+NAG +GS   +IL ++ E    VFD NV G
Sbjct  65    IHCNVTSDSDVKNAVDTAVSRYGKLDIMFNNAGVSGSPGANILGSDNEEFKKVFDVNVFG  124

Query  706   SFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYG  527
              F  AKHAARVMIP KKG I+F+ASA +   G +SH Y ASK A+VGL K+L VE+GKYG
Sbjct  125   PFLGAKHAARVMIPEKKGCILFTASAVSVCLGESSHAYAASKHAVVGLAKNLSVELGKYG  184

Query  526   IRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDES  347
             IR N +S   ++T +  S++   D++ AEE ++   NLK V L  ED+A AALYLA DES
Sbjct  185   IRVNAISPFTVVTPMMKSLLGISDKRAAEEFISSIGNLKTVLLEPEDIANAALYLASDES  244

Query  346   KYVSGVNLIIDGGYSTTNIGFQVAVEKV  263
             KYVSG+NL++DGG+S TN  F +A++ +
Sbjct  245   KYVSGLNLVVDGGFSLTNPSFAIAMKNL  272



>ref|XP_010246807.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
Length=285

 Score =   243 bits (620),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 146/270 (54%), Positives = 186/270 (69%), Gaps = 5/270 (2%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGP----EYALF  887
             KRLEGKVAIITG A+GIG  TARLF HHG KV+IAD+ D+ G ++ QE+G       ALF
Sbjct  12    KRLEGKVAIITGGASGIGKCTARLFVHHGAKVVIADVQDELGQALCQELGSVDEGGNALF  71

Query  886   IHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVG  707
             IHCD+  E+ ++N VD+TVS+YGKLDIMF+NAG +G+   +IL  + + +  V   N+VG
Sbjct  72    IHCDITREADIENVVDSTVSKYGKLDIMFNNAGISGALLPTILGTDKKEVERVLSVNLVG  131

Query  706   SFFCAKHAARVMIPAKKgsiifsasastaafg-itSHTYTASKCAIVGLCKSLCVEMGKY  530
             S   AKHA RVMIP KKG  I   +++  A G  +S+ YT SK  IVGLCK++C E+G+Y
Sbjct  132   SLLGAKHATRVMIPQKKGGSIIFNASAVTAIGCSSSYPYTVSKYGIVGLCKTMCEELGQY  191

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
             GIR NC+S   + T    +I+   DR   E+I  E  NLKGV L  EDVAEAALYLA DE
Sbjct  192   GIRVNCISPYAVATPFFSNILRDMDRNELEKIGHEGANLKGVILKEEDVAEAALYLASDE  251

Query  349   SKYVSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             SKYVSG+NL+IDGGYS  N  F  A+ + +
Sbjct  252   SKYVSGLNLVIDGGYSVANHAFNTALAQAM  281



>ref|XP_004252564.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum lycopersicum]
Length=309

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 146/266 (55%), Positives = 187/266 (70%), Gaps = 2/266 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIG-PEYALFIHC  878
             +RLEGKVAIITG A+GIGA TAR F   G KV+I DI D  G SVAQ+IG  +  +++HC
Sbjct  40    RRLEGKVAIITGGASGIGAATARRFVQQGAKVVICDIQDNLGTSVAQQIGNTQTIIYVHC  99

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV IES VQN V+TT++++GK+DIMFSNAG  G+  TSI + +   I   FD NVVG FF
Sbjct  100   DVSIESDVQNVVNTTIAKFGKIDIMFSNAGVMGNPFTSIQDIDYNMIKKTFDVNVVGGFF  159

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
             CAKHAARVMIP KKG IIF+ S  +  +   +H YTASK A++GL K++ VE+ KYGIR 
Sbjct  160   CAKHAARVMIPKKKGVIIFTTSIVSTLYSDLTHIYTASKNALLGLTKNVGVELAKYGIRV  219

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             N VS   I T L ++     ++++ ++  AE  NLKGV L+ EDVA   LYLA DESKY 
Sbjct  220   NSVSPYAISTPLMLNAFRV-NKEMGDKWFAEGANLKGVLLSVEDVANGVLYLASDESKYA  278

Query  337   SGVNLIIDGGYSTTNIGFQVAVEKVL  260
             SG+NLI+DGGY+TTNI    A +++ 
Sbjct  279   SGLNLILDGGYTTTNIALGEAYKRLF  304



>ref|XP_007027905.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
 gb|EOY08407.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
Length=281

 Score =   243 bits (619),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 142/263 (54%), Positives = 187/263 (71%), Gaps = 1/263 (0%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIG-PEYALFIHC  878
             KRLEGKVA+ITG A+GIG +TARLF  HG KV+IADI D+ G+S+ +E+G P++  +IHC
Sbjct  10    KRLEGKVALITGGASGIGESTARLFVKHGAKVLIADIQDELGHSLCKELGTPDFISYIHC  69

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV  E+ VQNAVD  VS YGKLDIMF+NAG  G  +   + +++EN   V D NV G+F 
Sbjct  70    DVTCETDVQNAVDLAVSEYGKLDIMFNNAGIPGDLEIRAITSDIENFKRVLDVNVFGAFL  129

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AKHAARVMIPAKKG I+F+AS ++      SH YT SK A+VG+ KSL VE+G+YGIR 
Sbjct  130   GAKHAARVMIPAKKGCILFTASVASLVCLGISHAYTTSKHAVVGMTKSLSVELGEYGIRV  189

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             NC+S   ++T L    +   D++  EEI++    LKG  L  EDVA+AAL+LA DE+KY+
Sbjct  190   NCISPHAVVTPLLQKTLGILDKRKGEEILSTTAVLKGTILEPEDVAQAALFLASDEAKYL  249

Query  337   SGVNLIIDGGYSTTNIGFQVAVE  269
             SGVNL +DGGYS  N  ++  ++
Sbjct  250   SGVNLPVDGGYSLNNPTWKTGLQ  272



>ref|XP_004228706.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum lycopersicum]
Length=280

 Score =   243 bits (619),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 142/272 (52%), Positives = 193/272 (71%), Gaps = 0/272 (0%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             ++ S KRLEGKVA+ITG A+GIGATTA+LF  +G KV+I D+ D  G S   EIG E+  
Sbjct  8     VSTSAKRLEGKVAVITGGASGIGATTAKLFVKNGAKVVILDVQDDLGRSFCNEIGLEHIS  67

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             ++HCDV IE  V+ A+D  VS++GK+DIM++NAG  GS  + I   + EN+  VFD NV 
Sbjct  68    YVHCDVTIEKQVEEAIDFVVSKHGKIDIMYNNAGITGSISSGITTTDYENLRKVFDINVF  127

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             G+F  AKHAARVMIPA+KG I+F+AS +    G++ HTY +SK A++GL  +LCVE+G+Y
Sbjct  128   GAFLGAKHAARVMIPARKGVILFTASVTAVVAGMSPHTYASSKHAVIGLSNNLCVELGQY  187

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
             GIR NC++  ++ T +  + +   D    +E V ++ NLK V L TEDVA AA+YLA DE
Sbjct  188   GIRVNCITPHVVATPMLSNFVGGIDGSKVDEAVIKSANLKEVKLETEDVAAAAVYLASDE  247

Query  349   SKYVSGVNLIIDGGYSTTNIGFQVAVEKVLGG  254
             SKYVSG+NL+IDGGYS TN  F + + ++L G
Sbjct  248   SKYVSGLNLMIDGGYSKTNPLFSMCIREILSG  279



>ref|XP_011046905.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=276

 Score =   242 bits (618),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 150/268 (56%), Positives = 191/268 (71%), Gaps = 5/268 (2%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             KRLEGKVA+ITGAA+GIG + ARLF  HG KV+IADI D+ G+SV  EIG +Y   +HCD
Sbjct  12    KRLEGKVALITGAASGIGESAARLFVQHGAKVVIADIQDELGHSVCNEIGSDY---VHCD  68

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSR-DTSILEANLENINLVFDTNVVGSFF  698
             V  E  VQNAV+TT+S+YGKLDIMFSNAG A ++ D SIL    E+   VFD N+ G+F 
Sbjct  69    VTSEIDVQNAVETTISKYGKLDIMFSNAGIAEAKLDISILAFEHEDYKKVFDVNLYGAFL  128

Query  697   CAKHAARVMIPAKKgsiifsasasta-afgitSHTYTASKCAIVGLCKSLCVEMGKYGIR  521
              AKHAA+VMIPAKKGSIIF++S ++     +  + Y  SK A+VGL K+LCVE+G+YGIR
Sbjct  129   SAKHAAKVMIPAKKGSIIFTSSFASVCYGAMLPYAYAVSKHALVGLSKNLCVELGQYGIR  188

Query  520   SNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKY  341
              NC+S   + T L    +   D+K  EE +  + NLK   L   DVAEAALYL GD+SKY
Sbjct  189   VNCISPFGVATPLLRKGLGGIDQKTVEEFICTSANLKEAVLKANDVAEAALYLGGDDSKY  248

Query  340   VSGVNLIIDGGYSTTNIGFQVAVEKVLG  257
             VSG+NL+IDGGYSTTN+  +  +++  G
Sbjct  249   VSGLNLVIDGGYSTTNVAVREQMKEYFG  276



>gb|KDP25017.1| hypothetical protein JCGZ_24000 [Jatropha curcas]
Length=277

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 141/266 (53%), Positives = 188/266 (71%), Gaps = 2/266 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-FIHC  878
             +RL+GKVA+ITG A+GIG ++ARLF   G KV+IADI D+ G S+ +E+G E  + +IHC
Sbjct  12    RRLDGKVALITGGASGIGESSARLFVKQGAKVVIADIQDELGQSLCKELGSEEIISYIHC  71

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV  +SHVQNAVD  VS+YGKLDIMFSNAG AG+ D  IL    E+   VFD NV G+F 
Sbjct  72    DVTNDSHVQNAVDLAVSKYGKLDIMFSNAGIAGNLDPRILATEKEDFKRVFDVNVFGAFL  131

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AKHAA+VMIPAKKG+IIF+AS  +      +H Y  SK A+VGL K+L VE+G+YGIR 
Sbjct  132   AAKHAAKVMIPAKKGNIIFTASVVSVTCLGAAHPYVVSKHALVGLAKNLSVELGEYGIRV  191

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             NC+S  +++T      M   ++ + EE+   A NLK   L  ED+AEAA+YL  +ESKY+
Sbjct  192   NCISPFLVITPQLKRTMELPEKTI-EEVTYAAANLKEAILKQEDIAEAAVYLGSEESKYI  250

Query  337   SGVNLIIDGGYSTTNIGFQVAVEKVL  260
             SG+NL++DGG+S TN  F +A++ + 
Sbjct  251   SGINLVVDGGFSLTNPSFAMAMKNLF  276



>ref|XP_009763487.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
sylvestris]
Length=280

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 141/267 (53%), Positives = 188/267 (70%), Gaps = 0/267 (0%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             KRLEGKVA+ITG A+GIGATTA+ F  +G KV+I D+ D  G+S+  EIGP++  ++HCD
Sbjct  13    KRLEGKVAVITGGASGIGATTAKFFIKNGAKVVILDVQDDLGHSLCNEIGPDHISYVHCD  72

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V  E  V+ A+D  VS+YGKLDIM+SNAG  GS D  I   + EN+  VFD NV G+F  
Sbjct  73    VTNEIQVEKAIDFAVSKYGKLDIMYSNAGITGSVDPRITTTDYENLKKVFDINVFGAFLG  132

Query  694   AKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSN  515
             AKHAARVMIPAK G I+F+AS +    G++ HTY +SK A++GL  +LC E+G+YGIR N
Sbjct  133   AKHAARVMIPAKTGCILFTASVTAVVAGMSPHTYASSKHAVIGLANNLCAELGQYGIRVN  192

Query  514   CVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVS  335
             C++ +++ T +    +   D+   +E V ++ NLK   L  EDVA AA+YLA DESKYVS
Sbjct  193   CITPSVVATPMVSKFVGGIDQSKVDEAVMKSANLKEAKLEVEDVAAAAVYLASDESKYVS  252

Query  334   GVNLIIDGGYSTTNIGFQVAVEKVLGG  254
             G+NL+IDGGYS TN  F + + +VL G
Sbjct  253   GLNLMIDGGYSKTNPLFAMCIREVLSG  279



>ref|XP_004249781.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum lycopersicum]
Length=285

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 144/276 (52%), Positives = 198/276 (72%), Gaps = 7/276 (3%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEI--GPEY  896
             +A + +RLEGKVAI+TG A+G G +T RLF  +G KV+IAD+ D+ G S+  ++   P+ 
Sbjct  8     IAHTSRRLEGKVAIVTGGASGFGESTVRLFLQNGAKVVIADVQDEIGQSLCNDLLNCPKN  67

Query  895   A----LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLV  728
                   +IHCDV   S V+N +D T+S+YGKLDIMF+NAG  G+ D +I++A+ EN   V
Sbjct  68    KNNDFTYIHCDVTKVSDVENLIDATISKYGKLDIMFNNAGIPGNLDFNIIDADNENFKKV  127

Query  727   FDTNVVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLC  548
             FD NV GSF  AK+AARVMIP KKG I+F++S ++ + G + H+YTASK A+VGL K+LC
Sbjct  128   FDVNVYGSFLGAKYAARVMIPEKKGVILFTSSLASVSSGESPHSYTASKHAVVGLMKNLC  187

Query  547   VEMGKYGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAAL  368
              E+G++GIR NCVS   + T + +  M   D+ + + I+  + NLKGV+ T EDVAEAAL
Sbjct  188   AELGQHGIRVNCVSPCAVATPMLVKAMGV-DKSVVDGIICSSANLKGVAPTAEDVAEAAL  246

Query  367   YLAGDESKYVSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             YLA DESK+VSGVNL+IDGGYSTTN+ +   ++ VL
Sbjct  247   YLASDESKFVSGVNLVIDGGYSTTNMSYIKTIQSVL  282



>ref|XP_002530170.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF32225.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=277

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 147/267 (55%), Positives = 192/267 (72%), Gaps = 7/267 (3%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL--FIH  881
             KRLEGKVAIITG A+GIG ++ARLF  HG KVIIADI D+ G+S+ + +G +  +  +IH
Sbjct  12    KRLEGKVAIITGGASGIGESSARLFVKHGAKVIIADIQDELGHSLCKVLGSDQEIISYIH  71

Query  880   CDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSF  701
             CDV  +S +Q AVD  VS+YGKLDIMFSNAGT+     SIL  + ++   VFD NV G+F
Sbjct  72    CDVTSDSDMQKAVDFAVSKYGKLDIMFSNAGTS-CPSPSILATDNQDFKRVFDVNVFGAF  130

Query  700   FCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIR  521
               AKHAARVMIPAK+G IIF+AS  +     + H Y ASK A+VGL K+LCVE+G+YGIR
Sbjct  131   LAAKHAARVMIPAKRGCIIFTASNLSVTCFQSMHPYIASKHAVVGLAKNLCVELGQYGIR  190

Query  520   SNCVSAAIILTKL---GMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
              NCVS   ++T L    M +M  +  K+  E+++++ NLKG  L  EDVAEAA+YL  DE
Sbjct  191   VNCVSPFAVVTPLLKKHMGLMEMEKEKI-RELISKSANLKGAVLEPEDVAEAAVYLGSDE  249

Query  349   SKYVSGVNLIIDGGYSTTNIGFQVAVE  269
             SKYVSG+NL++DGGY  TN  F++A++
Sbjct  250   SKYVSGLNLLVDGGYVVTNPSFEIAMK  276



>ref|XP_006339318.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=285

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 145/276 (53%), Positives = 197/276 (71%), Gaps = 7/276 (3%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             +A + KRLEGKVAI+TG A+G G +T RLF  +G KV+IAD+ D+ G S+   +      
Sbjct  8     LAHTSKRLEGKVAIVTGGASGFGESTVRLFLQNGAKVVIADVQDEIGQSLCNNLLNCPNN  67

Query  889   ------FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLV  728
                   +IHCDV   S V+N +DTT+S+YGKLDIMF+NAG  G+ D +I++A+ EN   V
Sbjct  68    NNNDFTYIHCDVTKVSDVENLIDTTISKYGKLDIMFNNAGIPGNLDFNIIDADNENFKKV  127

Query  727   FDTNVVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLC  548
             FD NV GSF  AK+AARVMIPAKKG I+F++S+++ + G + H+YT SK A+VGL K+LC
Sbjct  128   FDVNVYGSFLGAKYAARVMIPAKKGVILFTSSSASVSSGESPHSYTVSKHAVVGLMKNLC  187

Query  547   VEMGKYGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAAL  368
              E+G++GIR NCVS   + T + +  M   D+ + + I+  + NLKGV+ T EDVAEAAL
Sbjct  188   AELGQHGIRVNCVSPCAVATPMLVKAMGV-DKSVVDGIICSSANLKGVAPTAEDVAEAAL  246

Query  367   YLAGDESKYVSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             YLA DESK+VSGVNL+IDGGYSTTN+ +   ++ VL
Sbjct  247   YLASDESKFVSGVNLVIDGGYSTTNMTYIKTIQSVL  282



>gb|KDP36156.1| hypothetical protein JCGZ_08800 [Jatropha curcas]
Length=278

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 145/273 (53%), Positives = 190/273 (70%), Gaps = 1/273 (0%)
 Frame = -1

Query  1078  QLIMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIG-P  902
              L +A + KRLEGKVA+ITG A+GIG  TARLF  HG KV+IAD+ D  G S+ QE   P
Sbjct  4     DLSVALTTKRLEGKVALITGGASGIGECTARLFVKHGAKVLIADVKDDLGLSLCQEFSSP  63

Query  901   EYALFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFD  722
             E   ++HCDV  +S V+ AVD  VSRYGKLDIM++NAG  G  D  IL    E+   VFD
Sbjct  64    ETISYVHCDVSSDSDVKKAVDLAVSRYGKLDIMYNNAGIVGIPDPRILSTENEDFKKVFD  123

Query  721   TNVVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVE  542
              N+ GSF  AKHAARVMIP KKG I+F+AS  + +    ++ YTASK A+VGL K+LC+E
Sbjct  124   VNLFGSFLGAKHAARVMIPNKKGCILFTASLVSVSCLDAAYAYTASKHAVVGLAKNLCIE  183

Query  541   MGKYGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYL  362
             +G+YGIR N +S   + T L +S +  +++K AEE+++    LK V L  ED+A AAL+L
Sbjct  184   LGQYGIRVNSISPFGVATPLLISGLGMKEKKEAEEVISSIATLKEVILEPEDIANAALFL  243

Query  361   AGDESKYVSGVNLIIDGGYSTTNIGFQVAVEKV  263
             A DESKYVSG+NL++DGG+S TN  F VA++ +
Sbjct  244   ASDESKYVSGINLVVDGGFSLTNPSFAVAMKNL  276



>ref|XP_007204705.1| hypothetical protein PRUPE_ppa009636mg [Prunus persica]
 gb|EMJ05904.1| hypothetical protein PRUPE_ppa009636mg [Prunus persica]
Length=283

 Score =   241 bits (614),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 143/276 (52%), Positives = 194/276 (70%), Gaps = 3/276 (1%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGP--EY  896
             +A S KRL+GKVAIITG A+GIG +T RLF  HG KVIIAD+ D+   S+ +E+ P  E 
Sbjct  7     LAPSPKRLDGKVAIITGGASGIGESTVRLFVQHGAKVIIADVQDELSLSLCKELDPDEES  66

Query  895   ALFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTN  716
               +  CDV++ES V+N VD  +S+YGKLDIM++NAG  G+ + +IL A  EN   VFD N
Sbjct  67    VCYTRCDVKVESDVKNVVDLALSKYGKLDIMYNNAGIPGNLEPTILSAGAENFKQVFDVN  126

Query  715   VVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMG  536
             V G+F  AKHAAR MIPAKKG I+F++S ++A+ G + H YT SK A+VGL KSLCVE+G
Sbjct  127   VYGAFLGAKHAARAMIPAKKGVILFTSSVASASCGESPHAYTMSKHAVVGLMKSLCVELG  186

Query  535   KYGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAG  356
             ++GIR NC+S   + T L  ++M   +R   EE++  A  LKG     EDVAEAA+YLA 
Sbjct  187   QHGIRVNCISPCAMATPLLRNVM-GMERDAVEELICAAAVLKGAVPRAEDVAEAAVYLAS  245

Query  355   DESKYVSGVNLIIDGGYSTTNIGFQVAVEKVLGGGE  248
             +ESK+V+G+NL++DGGYSTTN  F + +  ++   +
Sbjct  246   EESKFVNGLNLLVDGGYSTTNQSFSMVLRNLMSSNQ  281



>gb|KDP36160.1| hypothetical protein JCGZ_08804 [Jatropha curcas]
Length=278

 Score =   240 bits (613),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 143/266 (54%), Positives = 187/266 (70%), Gaps = 1/266 (0%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEI-GPEYALFIHC  878
             KRLEGKVA+ITG A+GIG  TARLF  HG KV+IAD+ D  G S+ QE   PE   F+HC
Sbjct  12    KRLEGKVALITGGASGIGECTARLFVKHGAKVLIADVQDDLGLSLCQEFDSPETISFVHC  71

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV  +S V+NAVD  VSRYGKLDIM++NAG  G+ D SIL A  E+   VFD NV GSF 
Sbjct  72    DVSSDSDVKNAVDLAVSRYGKLDIMYNNAGIGGNPDPSILSAENEDFKKVFDVNVFGSFL  131

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AK+AA+VMIP KKG I+F++S ++     + + Y ASK A+VGL K+L VE+G+YGIR 
Sbjct  132   GAKYAAKVMIPNKKGCILFTSSVASVCCSGSLYAYIASKHAVVGLAKNLSVELGQYGIRV  191

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             N +S   + T +  + +  +++K  E+++A A  LK V L  ED+A AALYLA DESKYV
Sbjct  192   NSISPFGVATPMLRNAVGNKEKKEVEQVIASAATLKEVILEPEDIANAALYLASDESKYV  251

Query  337   SGVNLIIDGGYSTTNIGFQVAVEKVL  260
             SG+NL++DGGYS TN  F +A++ + 
Sbjct  252   SGINLVVDGGYSLTNPSFAIAMQSLF  277



>ref|XP_004252598.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum lycopersicum]
Length=281

 Score =   240 bits (613),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 145/267 (54%), Positives = 186/267 (70%), Gaps = 3/267 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA-LFIHC  878
             K+LEGKVAIITG A+GIGA TARLF  HG KVIIADI D  G S+ ++IG E   ++ HC
Sbjct  12    KKLEGKVAIITGGASGIGAATARLFVQHGAKVIIADIQDDLGKSLVKDIGTEQTVIYAHC  71

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             +V IES VQN VD TV+++GKLDIM SNAG +G   TSILE + + I  VFD NVVG+FF
Sbjct  72    NVSIESDVQNVVDATVAKFGKLDIMCSNAGVSGKPITSILEVDHDIIKNVFDVNVVGAFF  131

Query  697   CAKHAARVMIPAKK-gsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIR  521
             CAKHAARVM P KK   +  +++++        HTY +SKCA++GL K++ VE+GKYGIR
Sbjct  132   CAKHAARVMTPNKKGVILFTTSASTVVFGTGVPHTYVSSKCAVLGLSKNVGVELGKYGIR  191

Query  520   SNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKY  341
              NCVS   + T L +     +++K A++   EA NLKG  L  +DVA   LYL  D+SKY
Sbjct  192   VNCVSPYCVSTPLVVDGFGIEEQK-ADKWFEEAGNLKGALLDEQDVANGVLYLTSDDSKY  250

Query  340   VSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             VSG NLI+DGG+STTN+    A +K+ 
Sbjct  251   VSGHNLILDGGFSTTNVALTEAYKKLF  277



>ref|XP_011046907.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Populus euphratica]
Length=277

 Score =   240 bits (612),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 144/271 (53%), Positives = 192/271 (71%), Gaps = 2/271 (1%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             +A+  KRL GKVAIITG A+GIG +T+RLF  HG KVIIAD+ D+ G S+ +E+  E  +
Sbjct  7     LASFAKRLAGKVAIITGGASGIGESTSRLFVEHGAKVIIADVQDQVGQSLCKELLTEDNV  66

Query  889   -FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              ++HCDV  ++ V+N VD  +S+YGKLDIM +NAG  G+ D +IL  + E+   VF+ NV
Sbjct  67    CYVHCDVTSDTDVKNVVDVAISKYGKLDIMHNNAGITGNIDPTILGTDNEDFKRVFEVNV  126

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
              G F  AKHAARVMIP KKG I+F++S ++ A G + H YT SK A+VGL K+LCVE+G+
Sbjct  127   YGGFLGAKHAARVMIPVKKGVILFTSSVASVACGESPHAYTMSKHAVVGLMKNLCVELGQ  186

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             YGIR NC+S   + T L  + M   D+   E +V E+ NLKGV  + +DVAEAALYL  D
Sbjct  187   YGIRVNCISPCALATPLLRNAMGA-DKSFVEHVVCESANLKGVVPSPKDVAEAALYLGSD  245

Query  352   ESKYVSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             ESKYVSG+NL++DGGYSTTN  F + +  +L
Sbjct  246   ESKYVSGLNLMVDGGYSTTNQSFNMVLRNIL  276



>ref|XP_008243483.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Prunus mume]
Length=293

 Score =   240 bits (613),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 144/276 (52%), Positives = 193/276 (70%), Gaps = 3/276 (1%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGP--EY  896
             +A S KRLEGKVAIITG A+GIG +T RLF  HG KVIIAD+ D+   S+ +E+ P  E 
Sbjct  17    LAPSPKRLEGKVAIITGGASGIGESTVRLFVKHGAKVIIADVQDELSLSLCKELDPDEES  76

Query  895   ALFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTN  716
               +I CDV +ES V+N VD  +S+Y KLDIM++NAG  G+ + +IL A  EN   VFD N
Sbjct  77    VCYIRCDVTVESDVKNVVDLALSKYAKLDIMYNNAGIPGNLEPTILSARAENFKQVFDVN  136

Query  715   VVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMG  536
             V G+F  AKHAAR MIPAKKG I+F++S ++A+ G + H YT SK A+VGL KSLCVE+G
Sbjct  137   VYGAFLGAKHAARAMIPAKKGVILFTSSVASASCGESPHAYTMSKHAVVGLMKSLCVELG  196

Query  535   KYGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAG  356
             ++GIR NC+S   + T L  ++M   +R   EE++  A  LKG     EDVAEAA+YLA 
Sbjct  197   QHGIRVNCISPCAMATPLLTNVM-GMERDAVEELICAAAVLKGAVPRAEDVAEAAVYLAS  255

Query  355   DESKYVSGVNLIIDGGYSTTNIGFQVAVEKVLGGGE  248
             +ESK+V+G+NL++DGGYSTTN  F + +  ++   +
Sbjct  256   EESKFVNGLNLLVDGGYSTTNQSFSMVLRNLMSSNQ  291



>ref|XP_006354216.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=271

 Score =   239 bits (611),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 141/258 (55%), Positives = 184/258 (71%), Gaps = 1/258 (0%)
 Frame = -1

Query  1051  RLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-FIHCD  875
             RLEGK+AI+TG A+GIG  T RLF  HG KV+IADI D  G S+ QEIG    + ++HCD
Sbjct  6     RLEGKIAIVTGGASGIGEATTRLFIKHGAKVVIADIQDDLGQSIIQEIGENDVISYMHCD  65

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V++E  V+N VD TVS+YGKLDIMFSNAG +   D++I + + E    VFD NV G+  C
Sbjct  66    VKVEKDVENVVDMTVSKYGKLDIMFSNAGISEELDSTISKIDYEIFKNVFDVNVFGALMC  125

Query  694   AKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSN  515
             AKHA+RVMIPAKKGSIIF++S ++      SHTY ASK A+VGL K+L VE+G++GIR N
Sbjct  126   AKHASRVMIPAKKGSIIFTSSIASVMCAGASHTYLASKHAVVGLAKNLGVELGQHGIRVN  185

Query  514   CVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVS  335
             CVS   + T +  + +   +++  EE V E  NLK   L  EDVA+A LYLA DESKY+S
Sbjct  186   CVSPFCVPTPMLKNGLGIDEKEKIEEFVCEIANLKETILDVEDVAQATLYLASDESKYIS  245

Query  334   GVNLIIDGGYSTTNIGFQ  281
             G+N++IDGG+STTN+  +
Sbjct  246   GMNIVIDGGFSTTNVALK  263



>gb|KDP36168.1| hypothetical protein JCGZ_08812 [Jatropha curcas]
Length=277

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 144/271 (53%), Positives = 187/271 (69%), Gaps = 2/271 (1%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             +A + KRL GKVAIITG A+GIGA T+ LF  HG KV+I D+ D  G S+ +EI     +
Sbjct  7     LAVAAKRLAGKVAIITGGASGIGAATSTLFVKHGAKVVIGDVQDDLGQSLCKEIDQNDTV  66

Query  889   -FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              ++HCDV  +S V+N VD TVS+YGKLDIM++NAG  G  D  IL ++ EN   VFD NV
Sbjct  67    SYLHCDVTDDSDVKNVVDFTVSKYGKLDIMYNNAGITGDVDPKILGSDNENFKRVFDVNV  126

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
              G F  AKHAARVMIP  KG I+F++S ++   G + H YT SK A+VGL K+LCVE+G+
Sbjct  127   YGGFLGAKHAARVMIPKNKGVILFTSSVASKTTGESPHAYTMSKHAVVGLMKNLCVELGQ  186

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             YGIR NC+S   I T L    M + D+   E++V  + NLKGV    EDVAEAA+YL  D
Sbjct  187   YGIRVNCISPCAIATPLLRKAMGS-DKNFVEQVVCASANLKGVVPQPEDVAEAAVYLGSD  245

Query  352   ESKYVSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             ESKYVSG+NL++DGGYSTTN  F + ++ ++
Sbjct  246   ESKYVSGLNLMVDGGYSTTNQSFNMVLKNLV  276



>gb|KDP32262.1| hypothetical protein JCGZ_14783 [Jatropha curcas]
Length=277

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 142/266 (53%), Positives = 189/266 (71%), Gaps = 2/266 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-FIHC  878
             +RL+GKVA+ITG A+GIG ++ARLF   G KV+IADI D+ G S+ +E+G E  + +IHC
Sbjct  12    RRLDGKVALITGGASGIGESSARLFVKQGAKVVIADIQDELGQSLCKELGSEEIISYIHC  71

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV  +S+VQNAVD  VS+YGKLDIMFSNAG AG+ D  IL    E+   VFD NV G+F 
Sbjct  72    DVTNDSNVQNAVDLAVSKYGKLDIMFSNAGIAGNLDPRILATEKEDFKRVFDVNVFGAFL  131

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AKHAA+VMIPAKKG+IIF+ASA +     T H Y  SK A+VGL K+L VE+G+YGIR 
Sbjct  132   AAKHAAKVMIPAKKGNIIFNASAVSVTCVGTPHPYVVSKHALVGLAKNLSVELGEYGIRV  191

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             NC+S  +++T      M   ++ + EE+   A NLK   L  ED+AEAA+YL  +ESKY+
Sbjct  192   NCISPFLVITPQLKRTMELPEKTI-EEVTYAAANLKEAILKQEDIAEAAVYLGSEESKYI  250

Query  337   SGVNLIIDGGYSTTNIGFQVAVEKVL  260
             SG+NL++DGG+S TN  F +A++ + 
Sbjct  251   SGINLVVDGGFSLTNPSFAMAMKNLF  276



>emb|CDP16984.1| unnamed protein product [Coffea canephora]
Length=293

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 147/272 (54%), Positives = 188/272 (69%), Gaps = 8/272 (3%)
 Frame = -1

Query  1066  AASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-  890
             AA  +RLE KVA+ITG A+GIG  TARLF  HG KV++ADI D  G ++ +E+ PE A+ 
Sbjct  10    AAIFRRLEDKVAVITGGASGIGECTARLFVKHGAKVVLADIQDDLGRAICEELNPEGAIS  69

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGS-RDTSILEANL------ENINL  731
             ++HCDV  ESHV+ AVDT +S YGKLDIMFSNAG  G+  D +IL  +       EN   
Sbjct  70    YVHCDVTNESHVRRAVDTAISTYGKLDIMFSNAGIPGNGSDRTILLPDQDSTEYHENFRR  129

Query  730   VFDTNVVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSL  551
             VFD NV G+F CAKHAARVM+PA+KGSII ++S  +  FG   ++Y ASK A++GL K+L
Sbjct  130   VFDVNVFGAFLCAKHAARVMVPAEKGSIIITSSVCSMTFGDVPYSYVASKNAVLGLAKNL  189

Query  550   CVEMGKYGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAA  371
             CVE+G+YGIR NCVS   + T +    +P       E  V+   NLK  ++ TEDVAEAA
Sbjct  190   CVELGQYGIRVNCVSPFGVPTPMLKRALPMVKGNEIEGFVSAIANLKKATVGTEDVAEAA  249

Query  370   LYLAGDESKYVSGVNLIIDGGYSTTNIGFQVA  275
             LYL  DESKY+SG+NL++DGGYSTTN   + A
Sbjct  250   LYLGSDESKYISGLNLVVDGGYSTTNKALKEA  281



>ref|XP_006577090.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Glycine max]
Length=273

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 144/267 (54%), Positives = 189/267 (71%), Gaps = 3/267 (1%)
 Frame = -1

Query  1051  RLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPE--YALFIHC  878
             RLEGKVA+ITG A+GIG  TARLF  HG KVIIADI D  G+S+ Q +        ++HC
Sbjct  4     RLEGKVALITGGASGIGEATARLFLCHGAKVIIADIQDNLGHSLCQNLNSSDNNISYVHC  63

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV  ++ VQNAV+  VSR+GKLDI+FSNAGT G    SI   +  ++  VF+ NV G+F+
Sbjct  64    DVTNDNDVQNAVNAAVSRHGKLDILFSNAGTVGRVSPSITAFDNADLKRVFEVNVFGAFY  123

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AKHAA+VMIP K+GSI+ ++S ++    ++ H YTASK A+VGL K+LCVE+G +GIR 
Sbjct  124   AAKHAAKVMIPEKRGSIVLTSSVASVTHAVSPHAYTASKHAVVGLMKNLCVELGNHGIRV  183

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             NCVS   + T L M+      +++ E++ +EA NLKGV L  ED+AEAAL+LA DESKYV
Sbjct  184   NCVSPYAVATPL-MTRGTRMKKEMVEKVYSEAGNLKGVVLKEEDLAEAALFLASDESKYV  242

Query  337   SGVNLIIDGGYSTTNIGFQVAVEKVLG  257
             SGVNL++DGGYS TN+  + AV K  G
Sbjct  243   SGVNLVVDGGYSVTNVSVKEAVRKFSG  269



>ref|XP_010246256.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Nelumbo nucifera]
Length=281

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 140/274 (51%), Positives = 197/274 (72%), Gaps = 6/274 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             ++A   KRL+GKVA+ITG A GIG +TARLF  HG KV++AD+ D+ G +V  +IG E  
Sbjct  6     LLAPITKRLKGKVALITGGAAGIGESTARLFVRHGAKVVVADVQDELGRAVCNDIGSEET  65

Query  892   L-FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTN  716
             + + HCDV  ++HV++AVD +VS+YGKLDIMF+NA   G     IL  + E+   V D N
Sbjct  66    ICYAHCDVSRDAHVRDAVDMSVSKYGKLDIMFNNAAIPGKSSKEILSTDNEDFKRVVDVN  125

Query  715   VVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMG  536
             + G+F  AKHAARVM+P K+GSI+F++S ++   G T H Y+A+K A+VGL K+LCVE+G
Sbjct  126   LYGAFLGAKHAARVMVPLKRGSILFTSSVASVVNGETPHAYSATKHAVVGLTKNLCVELG  185

Query  535   KYGIRSNCVSAAIILTKLGMSIMP----TQDRKLAEEIVAEAPNLKGVSLTTEDVAEAAL  368
             +YGIR NC+S   ++T +   +M     T++ K+ EE+V+ +  LKGV +T ED+AEAAL
Sbjct  186   RYGIRVNCISPYGVVTGMLRKVMAELGFTEEEKV-EELVSRSTVLKGVKVTAEDMAEAAL  244

Query  367   YLAGDESKYVSGVNLIIDGGYSTTNIGFQVAVEK  266
             YLA DE++YV+G+NLI+DGGYSTTN  F  A+ +
Sbjct  245   YLASDEARYVNGLNLIVDGGYSTTNPSFSSAIAQ  278



>ref|XP_004506207.1| PREDICTED: momilactone A synthase-like [Cicer arietinum]
Length=271

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 140/263 (53%), Positives = 183/263 (70%), Gaps = 4/263 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             +++ SLKRLEGKVA+ITG A+GIG  T RLF+ HG +V+IADI D+ G+S+ +++    A
Sbjct  6     LISTSLKRLEGKVALITGGASGIGEATVRLFSKHGAQVVIADIQDEMGHSICKDLNNSSA  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              F+HCD   E+ V+NAV+TTVS+YGKLDIMF+NAG +G   T+ILE  L     V   N+
Sbjct  66    SFVHCDTTKETDVENAVNTTVSKYGKLDIMFNNAGISGVNKTNILENKLSEFEEVIKVNL  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             +G F   KHA+RVMIPA++GSII +AS   +  G   H YT+SK A++GL ++  VE+G 
Sbjct  126   IGVFLGTKHASRVMIPARRGSIINTASVGGSIGGAAPHAYTSSKHAVLGLMRNTAVELGP  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             YGIR NCVS  ++ T L    +   D    E I+A   NLKGV+L  EDVAEAALYL  D
Sbjct  186   YGIRVNCVSPYLVATPLAKKFLKIDD----EGILAVYSNLKGVNLVPEDVAEAALYLGSD  241

Query  352   ESKYVSGVNLIIDGGYSTTNIGF  284
             ESKYVSG NLI+DGG++  N GF
Sbjct  242   ESKYVSGHNLIVDGGFTAGNSGF  264



>ref|XP_002309404.1| alcohol dehydroge family protein [Populus trichocarpa]
 gb|EEE92927.1| alcohol dehydroge family protein [Populus trichocarpa]
Length=276

 Score =   238 bits (607),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 150/268 (56%), Positives = 191/268 (71%), Gaps = 5/268 (2%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             KRLEGKVA+ITGAA+GIG TTARLF  HG KV+IADI D+ G+SV  EIG +Y   +HCD
Sbjct  12    KRLEGKVALITGAASGIGETTARLFVQHGAKVVIADIQDELGHSVCNEIGSDY---VHCD  68

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSR-DTSILEANLENINLVFDTNVVGSFF  698
             V  E  VQNAV+TT+S++GKLDIMFSNAG A ++ D SIL    E+   VFD N+ G+F 
Sbjct  69    VTSEIDVQNAVETTISKHGKLDIMFSNAGIADAKLDISILAFEHEDYKKVFDVNMYGAFL  128

Query  697   CAKHAARVMIPAKKgsiifsasasta-afgitSHTYTASKCAIVGLCKSLCVEMGKYGIR  521
              AKHAA+VMIPAKKGSIIF++S ++     +  + Y  SK A+VGL K+LCVE+G+YGIR
Sbjct  129   SAKHAAKVMIPAKKGSIIFTSSFASVCYGAMLPYAYAVSKHALVGLTKNLCVELGQYGIR  188

Query  520   SNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKY  341
              NC+S   + T L    +   D+K  EE +  + NLK   L   DVAEAALYL G +SKY
Sbjct  189   VNCISPFGVATPLLRKGLGGIDQKTVEEFICTSANLKEAVLKASDVAEAALYLGGGDSKY  248

Query  340   VSGVNLIIDGGYSTTNIGFQVAVEKVLG  257
             VSG+NL+IDGGYSTTN+  +  +++  G
Sbjct  249   VSGLNLVIDGGYSTTNVAIREQMKEYFG  276



>gb|AFK45740.1| unknown [Lotus japonicus]
Length=274

 Score =   238 bits (606),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 151/272 (56%), Positives = 190/272 (70%), Gaps = 9/272 (3%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEY--ALFIH  881
             KRL+GKVAIITG A+GIGA TA+LF  HG KVIIADI D  G S+ + + P +   ++ H
Sbjct  4     KRLDGKVAIITGGASGIGAATAKLFVQHGAKVIIADIQDDLGMSLCKTLEPNFNNIIYAH  63

Query  880   CDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSF  701
             CDV  +S V+NAVD  VS+YGKLDIM++NAG  G  + SIL ++ E    VFD NV G+F
Sbjct  64    CDVTNDSDVKNAVDMAVSKYGKLDIMYNNAGITGDLNLSILASSDECFKRVFDVNVYGAF  123

Query  700   FCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIR  521
               AKHAARVMIPAK+G I+F++S +    G   H YTASK A++GL KSLCVEMG++GIR
Sbjct  124   LGAKHAARVMIPAKRGVILFTSSIAPILGGEAPHGYTASKHAVLGLMKSLCVEMGEHGIR  183

Query  520   SNCVSAAIILTKLGMSIMPTQDRKLAEEI---VAEAPNLKGVSLTTEDVAEAALYLAGDE  350
              NC++  ++LT L    + T+ +K  EEI   V  A  LK   L  EDVAEAALYL+ DE
Sbjct  184   VNCIAPGVVLTPL----LTTESKKSKEEIRRGVCSAMVLKESVLEEEDVAEAALYLSSDE  239

Query  349   SKYVSGVNLIIDGGYSTTNIGFQVAVEKVLGG  254
             SKYVSGVNL++DGGYSTTN  F  A++    G
Sbjct  240   SKYVSGVNLVLDGGYSTTNGSFTSALKAFSNG  271



>ref|XP_010246261.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Nelumbo nucifera]
Length=281

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 138/274 (50%), Positives = 198/274 (72%), Gaps = 6/274 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             +++  ++RL+GKVA+ITG A GIG +TARLF  HG KV++AD+ D+ G +V  +IG E  
Sbjct  6     VLSTIVRRLKGKVALITGGAAGIGESTARLFVRHGAKVVVADVQDELGRAVCNDIGSEET  65

Query  892   L-FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTN  716
             + + HCDV  ++HV++AVD +VS+YGKLDIMF+NA   G     IL  + E+   V D N
Sbjct  66    ICYAHCDVSRDAHVRDAVDMSVSKYGKLDIMFNNAAIPGKSSKEILSTDNEDFKRVVDVN  125

Query  715   VVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMG  536
             + G+F  AKHAARVM+P K+GSI+F++S ++   G T H Y+A+K A+VGL K+LCVE+G
Sbjct  126   LYGAFLGAKHAARVMVPLKRGSILFTSSVASVVNGETPHAYSATKHAVVGLTKNLCVELG  185

Query  535   KYGIRSNCVSAAIILTKLGMSIMP----TQDRKLAEEIVAEAPNLKGVSLTTEDVAEAAL  368
             +YGIR NC+S   ++T +   +M     T++ K+ EE+V+ +  LKGV +T ED+AEAAL
Sbjct  186   RYGIRVNCISPYGVVTGMLRKVMAELGFTEEEKV-EELVSRSTVLKGVKVTAEDMAEAAL  244

Query  367   YLAGDESKYVSGVNLIIDGGYSTTNIGFQVAVEK  266
             YLA DE++YV+G+NLI+DGGYSTTN  F  A+ +
Sbjct  245   YLASDEARYVNGLNLIVDGGYSTTNPSFSSAIAQ  278



>ref|XP_002323404.1| alcohol dehydroge family protein [Populus trichocarpa]
 gb|EEF05165.1| alcohol dehydroge family protein [Populus trichocarpa]
Length=279

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 145/266 (55%), Positives = 192/266 (72%), Gaps = 2/266 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-FIHC  878
             KRLEGKVA+ITG A+GIG  TARLF  HG KV+IAD+ D  G ++ QE G E  + ++HC
Sbjct  12    KRLEGKVALITGGASGIGECTARLFVQHGSKVLIADVQDDLGRALCQEYGSEEIISYVHC  71

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             +V ++S VQNAVDT VSRYGKLDIMF+NAG +G+  +SIL ++ E+   V + NV G F 
Sbjct  72    NVTVDSDVQNAVDTAVSRYGKLDIMFNNAGISGNTKSSILNSDNEDFMRVLNINVCGGFL  131

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AKHAARVMIPAKKG I+F+AS ++  +G  +H YTASK AIVGL K+L V++G++GIR 
Sbjct  132   GAKHAARVMIPAKKGCILFTASVASVLYGELAHAYTASKNAIVGLAKNLSVDLGQHGIRV  191

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             N +S   + T + ++      ++ AE+ VA A NLK   L  EDVA+AALYLA D+SKYV
Sbjct  192   NSISPTAVATPM-LTDALRMTKEAAEKFVASAANLKEAVLEPEDVAQAALYLASDDSKYV  250

Query  337   SGVNLIIDGGYSTTNIGFQVAVEKVL  260
             SGVNL+IDGGY+ TN    +A++ + 
Sbjct  251   SGVNLVIDGGYNLTNPSLAMAMKSLF  276



>ref|XP_010059357.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
 gb|KCW90497.1| hypothetical protein EUGRSUZ_A02615 [Eucalyptus grandis]
Length=284

 Score =   238 bits (606),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 144/270 (53%), Positives = 196/270 (73%), Gaps = 2/270 (1%)
 Frame = -1

Query  1066  AASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-  890
             A + KRLEGKVAIITG A GIG +TARLF  HG KV++AD+ DK G S+ +E+G E A+ 
Sbjct  15    ALTPKRLEGKVAIITGGAGGIGESTARLFVRHGAKVVVADVQDKLGPSLCEELGAEGAVS  74

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             ++HCDV  +  V+NAVD  V++YGKLDIM++NAG  G    ++L+A+ E+   V D NV 
Sbjct  75    YVHCDVTRDEDVKNAVDFAVAKYGKLDIMYNNAGITGKVYPTVLDADGEDFKRVLDINVC  134

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             G+F  AKHAARVMIPAK+G I+F+AS ++   G + H YT SK A+VGL K+LCVE+G+Y
Sbjct  135   GAFLGAKHAARVMIPAKRGVILFTASIASTCAGESPHAYTTSKHAVVGLMKNLCVELGQY  194

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
             GIR N +S   I T L ++ +  +   LAE + A A  LKG     EDVAEAALYL+GDE
Sbjct  195   GIRVNAISPCGIATPLLVNAVGLEKSMLAEVLSASA-VLKGPVPEPEDVAEAALYLSGDE  253

Query  349   SKYVSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             +K+VSG+NL++DGGY+TTN  F++ +E+++
Sbjct  254   AKFVSGLNLVVDGGYTTTNPTFKMLLERLM  283



>ref|XP_002533854.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF28529.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=276

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 143/267 (54%), Positives = 187/267 (70%), Gaps = 3/267 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-FIHC  878
             KRLEGKVA+ITG A+GIG ++ RLF  HG KVIIAD+ DK GNS+ +E+G E  + ++ C
Sbjct  8     KRLEGKVALITGGASGIGESSVRLFIKHGAKVIIADVQDKLGNSLCKELGSEEIISYVRC  67

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV  +S VQN VD ++S+YGKLDIMFSNAG +G     ++    E+   VFD NV G+F 
Sbjct  68    DVTCDSDVQNVVDFSISKYGKLDIMFSNAGISGKVYPGVVATENEDFKRVFDVNVFGAFL  127

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AKHAARVMIPA+KG I+F+AS  +       H Y ASK A+VGL K+L VE+G+YGIR 
Sbjct  128   AAKHAARVMIPARKGCILFTASNLSVTCSKGMHPYVASKHAVVGLAKNLSVELGQYGIRV  187

Query  517   NCVSAAIILTKLGMSI--MPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESK  344
             NC+S + I+T L      +   +++  +E++    NLKG+ L TEDVAEAA+YL  DESK
Sbjct  188   NCISPSAIVTPLMREFAGVEEIEKEKIQELILATGNLKGILLETEDVAEAAIYLGSDESK  247

Query  343   YVSGVNLIIDGGYSTTNIGFQVAVEKV  263
             YVSG+NL+IDGG S TN  F+  VEK+
Sbjct  248   YVSGINLMIDGGLSLTNPSFEKEVEKL  274



>ref|XP_010262933.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
 ref|XP_010262934.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
 ref|XP_010262935.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
Length=277

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 143/266 (54%), Positives = 194/266 (73%), Gaps = 2/266 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-FIHC  878
             +RLEGKVA+ITG A+GIG +TARLFA+HG KV+IAD++D+ G+S+ +E+G E  + FIHC
Sbjct  12    RRLEGKVALITGGASGIGRSTARLFANHGAKVVIADVEDELGHSICEEVGSEGTICFIHC  71

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV  ++ V+NAVD+TV ++GKLDIMFSNAG  GS    IL+++ EN   V + N  G+F 
Sbjct  72    DVTKDADVRNAVDSTVDKHGKLDIMFSNAGITGSPTKKILDSDNENFRKVLEVNTFGAFL  131

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AKHA RVMIP KKG+IIF++S ++   G T + Y ASK A+VGL K+L VE+G+YGIR 
Sbjct  132   GAKHATRVMIPLKKGTIIFTSSVASVIAGDTPYAYAASKHAVVGLTKNLSVELGQYGIRV  191

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             NC+S   + T +  +    ++ K+ E  ++   NLKGV L  EDVAEAALYLA DES+YV
Sbjct  192   NCISPYGLATPMLRTATGLEEEKI-EAYLSGGANLKGVVLKAEDVAEAALYLASDESRYV  250

Query  337   SGVNLIIDGGYSTTNIGFQVAVEKVL  260
             SG+NL++DGG+S TN   Q+A   +L
Sbjct  251   SGLNLVVDGGFSITNPSCQMAAAGLL  276



>ref|XP_002530176.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF32231.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=340

 Score =   239 bits (609),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 145/258 (56%), Positives = 185/258 (72%), Gaps = 2/258 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-FIHC  878
             KRL GKVAIITG A+GIGA T+ LFA +G KVIIADI +  G S+ QEIG +  + ++HC
Sbjct  13    KRLAGKVAIITGGASGIGAITSALFAQNGAKVIIADIQESLGQSLCQEIGKDGNVSYVHC  72

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV  +  V+N VD  +S+YGKLDIM++NAG +G+ D +IL  + EN   VF+ NV G F 
Sbjct  73    DVTSDKDVKNIVDFAMSKYGKLDIMYNNAGISGNNDPTILGTDNENFKRVFEINVYGGFL  132

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AKHAARVMIPAKKG I+F++S ++   G + H YT SK A+VGL K+LCVE+G+YG+R 
Sbjct  133   GAKHAARVMIPAKKGVILFTSSVASVNCGESPHAYTMSKHAVVGLMKNLCVELGQYGVRV  192

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             NC+S   + T L  + M T D+   E +V  + NLKGV    EDVAEAALYL  DESKYV
Sbjct  193   NCISPCALATPLLRNAMGT-DKSFVEHVVCASANLKGVVPQPEDVAEAALYLGSDESKYV  251

Query  337   SGVNLIIDGGYSTTNIGF  284
             SG+NL++DGGYSTTN  F
Sbjct  252   SGLNLLVDGGYSTTNQSF  269



>gb|KHG10215.1| hypothetical protein F383_13541 [Gossypium arboreum]
Length=272

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 139/255 (55%), Positives = 179/255 (70%), Gaps = 1/255 (0%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIG-PEYALFIHC  878
             KRLEGKVA+ITG A+GIG +T R+F  HG  V++ADI D+ G S+ +++G PE   + HC
Sbjct  10    KRLEGKVALITGGASGIGESTTRVFVEHGATVLVADIQDELGQSLCKQLGSPETVSYTHC  69

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV+ ES VQNAVDT VSRYGKLDIMF+NAG AG  +  ++ +NL N   VFD NV+G F 
Sbjct  70    DVKSESDVQNAVDTAVSRYGKLDIMFNNAGIAGEAEPRLIASNLHNFKRVFDVNVLGGFL  129

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AKHAARVMIPAKKG I+F+AS  +      SH YT SK A+VGL ++L VE+G+YGIR 
Sbjct  130   GAKHAARVMIPAKKGCILFTASIVSKICMGLSHAYTTSKHAVVGLTENLAVELGEYGIRV  189

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             NC+S   I+T L         ++  E I++ A  LKG  L   DVA+AAL+LA D++KY+
Sbjct  190   NCISPYAIVTPLFQKTSGVSKKEKVEGILSAAGVLKGAILEPSDVAQAALFLASDDAKYL  249

Query  337   SGVNLIIDGGYSTTN  293
             +GVNL +DGGYS  N
Sbjct  250   NGVNLPVDGGYSLNN  264



>gb|KHN33174.1| Momilactone A synthase [Glycine soja]
Length=306

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 144/267 (54%), Positives = 189/267 (71%), Gaps = 3/267 (1%)
 Frame = -1

Query  1051  RLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPE--YALFIHC  878
             RLEGKVA+ITG A+GIG  TARLF  HG KVIIADI D  G+S+ Q +        ++HC
Sbjct  37    RLEGKVALITGGASGIGEATARLFLCHGAKVIIADIQDNLGHSLCQNLNSSDNNISYVHC  96

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV  ++ VQNAV+  VSR+GKLDI+FSNAGT G    SI   +  ++  VF+ NV G+F+
Sbjct  97    DVTNDNDVQNAVNAAVSRHGKLDILFSNAGTVGRVSPSITALDNADLKRVFEVNVFGAFY  156

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AKHAA+VMIP K+GSI+ ++S ++    ++ H YTASK A+VGL K+LCVE+G +GIR 
Sbjct  157   AAKHAAKVMIPEKRGSIVLTSSVASVTHAVSPHAYTASKHAVVGLMKNLCVELGNHGIRV  216

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             NCVS   + T L M+      +++ E++ +EA NLKGV L  ED+AEAAL+LA DESKYV
Sbjct  217   NCVSPYAVATPL-MTRGTRMKKEMVEKVYSEAGNLKGVVLKEEDLAEAALFLASDESKYV  275

Query  337   SGVNLIIDGGYSTTNIGFQVAVEKVLG  257
             SGVNL++DGGYS TN+  + AV K  G
Sbjct  276   SGVNLVVDGGYSVTNVSVKEAVRKFPG  302



>ref|XP_011046906.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Populus euphratica]
Length=281

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 142/265 (54%), Positives = 187/265 (71%), Gaps = 2/265 (1%)
 Frame = -1

Query  1051  RLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPE-YALFIHCD  875
             RL GKVAIITG A+GIG +T+RLF  HG KVIIAD+ D+ G S+ +E+  E    ++HCD
Sbjct  17    RLAGKVAIITGGASGIGESTSRLFVEHGAKVIIADVQDQVGQSLCKELLTEDNVCYVHCD  76

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V  ++ V+N VD  +S+YGKLDIM +NAG  G+ D +IL  + E+   VF+ NV G F  
Sbjct  77    VTSDTDVKNVVDVAISKYGKLDIMHNNAGITGNIDPTILGTDNEDFKRVFEVNVYGGFLG  136

Query  694   AKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSN  515
             AKHAARVMIP KKG I+F++S ++ A G + H YT SK A+VGL K+LCVE+G+YGIR N
Sbjct  137   AKHAARVMIPVKKGVILFTSSVASVACGESPHAYTMSKHAVVGLMKNLCVELGQYGIRVN  196

Query  514   CVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVS  335
             C+S   + T L  + M   D+   E +V E+ NLKGV  + +DVAEAALYL  DESKYVS
Sbjct  197   CISPCALATPLLRNAMGA-DKSFVEHVVCESANLKGVVPSPKDVAEAALYLGSDESKYVS  255

Query  334   GVNLIIDGGYSTTNIGFQVAVEKVL  260
             G+NL++DGGYSTTN  F + +  +L
Sbjct  256   GLNLMVDGGYSTTNQSFNMVLRNIL  280



>ref|XP_011043648.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=279

 Score =   236 bits (601),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 145/266 (55%), Positives = 191/266 (72%), Gaps = 2/266 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-FIHC  878
             KRLEGKVA+ITG A+GIG  TARLF  HG KV+IAD+ D  G ++ QE G E  + ++HC
Sbjct  12    KRLEGKVALITGGASGIGECTARLFVQHGSKVLIADVQDDLGLALCQEYGSEEIISYVHC  71

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             +V ++S VQNAVDT VSRYGKLDIMF+NAG +G+  +SIL ++ E+   V + NV G F 
Sbjct  72    NVTVDSDVQNAVDTAVSRYGKLDIMFNNAGISGNSKSSILNSDNEDFMRVLNINVYGGFL  131

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AKHAARVMIPAKKG I+F+AS ++  +G  +H YTASK AIVGL K+L V++G++GIR 
Sbjct  132   GAKHAARVMIPAKKGCILFTASVASVLYGELAHAYTASKNAIVGLAKNLSVDLGQHGIRV  191

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             N +S   + T + ++      ++  E+ VA A NLK   L  EDVA+AALYLA D+SKYV
Sbjct  192   NSISPTAVATPM-LTDGLRMTKEAVEKFVASAANLKEAVLEPEDVAQAALYLASDDSKYV  250

Query  337   SGVNLIIDGGYSTTNIGFQVAVEKVL  260
             SGVNL+IDGGY+ TN    +AV+ + 
Sbjct  251   SGVNLVIDGGYNLTNPSLAMAVKSLF  276



>ref|XP_004305639.1| PREDICTED: momilactone A synthase-like [Fragaria vesca subsp. 
vesca]
Length=288

 Score =   236 bits (601),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 143/271 (53%), Positives = 196/271 (72%), Gaps = 3/271 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGP--EYALFIH  881
             ++LEGKVAIITG A+GIG +TARLF +HG KVIIAD+ D+   S+ +E+ P  E   ++H
Sbjct  17    RKLEGKVAIITGGASGIGESTARLFVYHGAKVIIADVQDELALSLCKELDPDQESIPYVH  76

Query  880   CDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSF  701
             CDV I+S V+N VD  +S YGKLDIM++NAG  G+ D +IL A+ +N   VFD NV G+F
Sbjct  77    CDVTIDSDVKNVVDVAISNYGKLDIMYNNAGIPGNLDPTILGADHQNFKQVFDVNVYGAF  136

Query  700   FCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIR  521
               AKHAARVMIPAK GSI+F++S ++A+ G +SH YT SK A+VGL KSLCVE+G+YGIR
Sbjct  137   LGAKHAARVMIPAKNGSILFTSSVTSASCGESSHAYTMSKHAVVGLMKSLCVELGQYGIR  196

Query  520   SNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKY  341
              NC+S   + T L  + M  + + + EE++  +  LKGV   +EDVA+AA++LA +ESK+
Sbjct  197   VNCISPCAMATPLLTNAMGLE-KNVVEELICASAVLKGVVPRSEDVADAAVFLASEESKF  255

Query  340   VSGVNLIIDGGYSTTNIGFQVAVEKVLGGGE  248
             V G+NL++DGGYSTTN  F   +  V+   +
Sbjct  256   VGGLNLLVDGGYSTTNQSFSRVLRNVMSSNQ  286



>ref|XP_007027903.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
 gb|EOY08405.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
Length=277

 Score =   234 bits (598),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 138/271 (51%), Positives = 183/271 (68%), Gaps = 2/271 (1%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             +A++L+RL+GKVA+ITG A+GIG  TARLF H G KV+IADI D  G S+ +E+G +   
Sbjct  7     VASNLRRLQGKVALITGGASGIGECTARLFVHQGAKVVIADIQDDLGQSICEELGHQSIS  66

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             ++HCDV  +S V+NAVD  VS YG LDIMF+NAG AG  D SI+ ++ E    V D NV 
Sbjct  67    YVHCDVTRDSDVRNAVDLAVSTYGSLDIMFNNAGIAGP-DKSIVSSDDEKFKKVLDVNVF  125

Query  709   GSFFCAKHAARVMIPAKKg-siifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             G +  AK+AA+VMIPA+KG  +  S+  S        H Y  SK A+VGL K+LCVE+G+
Sbjct  126   GGYLGAKYAAKVMIPARKGCILFTSSVFSVIGGTDAGHAYVTSKHALVGLAKNLCVELGQ  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             YGIR NC+S   + T L        +++  EE+V++  NLKG  L  +DVA+AALYLA D
Sbjct  186   YGIRVNCISPFGVATPLLRKPFGMMEKEKVEELVSKGANLKGTVLKPDDVAQAALYLASD  245

Query  352   ESKYVSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             ESKYVSG+NL+IDGGYSTTN      ++ + 
Sbjct  246   ESKYVSGLNLVIDGGYSTTNPSMSTVIKSLF  276



>emb|CDP20435.1| unnamed protein product [Coffea canephora]
Length=280

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 138/266 (52%), Positives = 191/266 (72%), Gaps = 2/266 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-FIHC  878
             KRLEGKVAIITG A+G G +T RLF  HG +VIIAD+ D  G+S+ +E+     + F+HC
Sbjct  15    KRLEGKVAIITGGASGFGESTVRLFVQHGARVIIADVQDDLGHSLREELSSSGDVTFVHC  74

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV  +  V+N VD  +S+YGKLDIM++NAG  G+ D +I++A+ EN   VFD NV G+F 
Sbjct  75    DVTKDIDVKNLVDLAMSQYGKLDIMYNNAGIPGNLDFTIVDADNENFKRVFDVNVYGAFL  134

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AK+AA+VMIPAKKG I+F++S ++ + G + H+YT SK A+VGL K+LCVE+G+YGIR 
Sbjct  135   GAKYAAKVMIPAKKGVILFTSSLASVSCGESPHSYTVSKHAVVGLTKNLCVELGQYGIRV  194

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             NC+S   + T L  + M   D+K  E I+  + NLKGV  T EDVAEAALYL+ D +K+V
Sbjct  195   NCISPCAVATPLLRNAMGL-DQKAVEGIICASANLKGVVPTAEDVAEAALYLSSDAAKFV  253

Query  337   SGVNLIIDGGYSTTNIGFQVAVEKVL  260
             SG+NL++DGGYS TN  +   ++ ++
Sbjct  254   SGLNLVVDGGYSATNQSYMTIIKSLM  279



>ref|XP_009626741.1| PREDICTED: secoisolariciresinol dehydrogenase-like, partial [Nicotiana 
tomentosiformis]
Length=268

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 138/266 (52%), Positives = 186/266 (70%), Gaps = 0/266 (0%)
 Frame = -1

Query  1051  RLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCDV  872
             RLEGKVA+ITG A+GIGATTA+ F  +G KV+I D+ D  G+S+  EIG ++  ++HCDV
Sbjct  2     RLEGKVAVITGGASGIGATTAKFFVKNGAKVVILDVQDDFGHSLCNEIGSDHISYVHCDV  61

Query  871   RIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFCA  692
               E  V+ A+D  VS+YGKLDIM++NAG  GS D  I   + EN+  VFD NV G+F  A
Sbjct  62    TNEIQVEKAIDFAVSKYGKLDIMYNNAGITGSIDPRITTTDYENLKKVFDINVFGAFLGA  121

Query  691   KHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSNC  512
             KHAARVMIPAK G I+F+AS +    G++ HTY +SK A++GL  +LC E+G+YGIR NC
Sbjct  122   KHAARVMIPAKTGCILFTASVTAVVAGMSPHTYASSKHAVIGLANNLCAELGQYGIRVNC  181

Query  511   VSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVSG  332
             ++ +++ T +    +   D+   +E V ++ NLK   L  EDVA AA+YLA DESKYVSG
Sbjct  182   ITPSVVATPMVSIFVGGIDQSKVDEAVMKSANLKEAKLEVEDVAAAAVYLASDESKYVSG  241

Query  331   VNLIIDGGYSTTNIGFQVAVEKVLGG  254
             +NL+IDGGYS TN  F + + +VL G
Sbjct  242   LNLMIDGGYSKTNPLFAMCIREVLSG  267



>ref|XP_011094268.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Sesamum indicum]
Length=275

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 135/255 (53%), Positives = 187/255 (73%), Gaps = 2/255 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIG-PEYALFIHC  878
             +RLEGKVAIITG A+G G +TARLFA HG KV+IAD+ D  G S+ +++  P+   ++HC
Sbjct  10    RRLEGKVAIITGGASGFGESTARLFARHGAKVVIADVQDDRGQSLCRDLNLPDQISYVHC  69

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV  +S V+N VD  VS+YG LDIMF+NAG  G+ D +I +A+ +N   VF+ NV G+F 
Sbjct  70    DVTSDSDVRNVVDFAVSKYGNLDIMFNNAGIPGNLDFTIADADNDNFKRVFEVNVYGAFL  129

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AKHAARVMIP +KG I+F++S ++   G   ++Y+ASK A+VGL K+LCVE+G+YGIR 
Sbjct  130   GAKHAARVMIPERKGVILFTSSVASVVSGECPYSYSASKHAVVGLMKNLCVELGQYGIRV  189

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             N +S   + T + ++     D+ + ++I+  + NLKGV  T EDVAEAALYL+ DESK+V
Sbjct  190   NSISPCAVATPM-LTGAVGLDKAVVDDIIRASANLKGVMPTAEDVAEAALYLSSDESKFV  248

Query  337   SGVNLIIDGGYSTTN  293
             SG+NL++DGGYSTTN
Sbjct  249   SGLNLVVDGGYSTTN  263



>ref|XP_006361612.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=281

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 140/267 (52%), Positives = 187/267 (70%), Gaps = 3/267 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-FIHC  878
             K+LEGKVAIITG A+GIGA TARLF  HG KV+IADI +  GNS+ ++IG E  + ++HC
Sbjct  12    KKLEGKVAIITGGASGIGAATARLFVQHGAKVVIADIQNDLGNSLVKQIGTEQTIIYVHC  71

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             +V IES V+N VD T++++GKLDIM SNAG  G   +SIL+ + + I  VFD NVVG+FF
Sbjct  72    NVSIESDVKNVVDATIAKFGKLDIMCSNAGVLGKPISSILDVDHDIIKDVFDVNVVGAFF  131

Query  697   CAKHAARVMIPAKK-gsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIR  521
             CAKHAARVMIP KK   +  +++++        HTY +SK A++GL  ++ VE+GKYGIR
Sbjct  132   CAKHAARVMIPNKKGVILFTASASTVVFGAGVPHTYASSKTAVLGLSTNVGVELGKYGIR  191

Query  520   SNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKY  341
              NCVS   I T L ++    +++K A++   E  NLKG  L  +DVA A LYL  D+SKY
Sbjct  192   VNCVSPYYISTPLVVNGFGVEEQK-ADKWFEEGGNLKGALLDEQDVANAMLYLTSDDSKY  250

Query  340   VSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             VSG NLI+DGG+STTN+    A +K+ 
Sbjct  251   VSGHNLILDGGFSTTNVAITEAYKKLF  277



>gb|KDP36166.1| hypothetical protein JCGZ_08810 [Jatropha curcas]
Length=281

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 181/269 (67%), Gaps = 4/269 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIG-PEYALFIHC  878
             KRLEGKV +ITG A+GIG  TARLF  HG KV+IADI D  G S+ QE   PE   ++HC
Sbjct  12    KRLEGKVVLITGGASGIGECTARLFVKHGAKVLIADIQDDLGQSLCQEFSSPETISYVHC  71

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRD---TSILEANLENINLVFDTNVVG  707
             +V  +S V+NAVD  VSRYGKLDIMF+NAG  G+ D   T IL    ++   V D NV G
Sbjct  72    NVSSDSDVKNAVDLAVSRYGKLDIMFNNAGILGNPDFSNTRILPTENQDFKKVIDVNVFG  131

Query  706   SFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYG  527
             +F   KHAAR+MIP KKG I+F+AS  +     + H Y ASK A+VGL K+LCVE+G+YG
Sbjct  132   AFLGTKHAARIMIPNKKGCILFTASLVSVCCLDSPHAYAASKHAVVGLAKNLCVELGQYG  191

Query  526   IRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDES  347
             IR N +S     T +  +     ++K AEE+++    LKGV L TED+A AAL+LA DES
Sbjct  192   IRVNSISPFAAATPMLRNAFGMMEKKEAEEVISSIATLKGVVLETEDIANAALFLASDES  251

Query  346   KYVSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             KYVSG+NL++DGG+S TN    +A++ + 
Sbjct  252   KYVSGINLVVDGGFSLTNPSLAIAMQSLF  280



>ref|XP_006338927.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=279

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 144/258 (56%), Positives = 179/258 (69%), Gaps = 3/258 (1%)
 Frame = -1

Query  1057  LKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-FIH  881
              KRLEGKVA+ITG A+GIG    RLF  HG KV++ADI D  G ++ +E+G    + F H
Sbjct  11    FKRLEGKVAVITGGASGIGEAATRLFTKHGAKVVVADIQDDLGQALCKELGSNDTISFTH  70

Query  880   CDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGS-RDTSILEANLENINLVFDTNVVGS  704
             CDV  E+ ++NA+D  VSRYGKLDIMFSNAG  G+ +D SIL  +  N   VFD NV G+
Sbjct  71    CDVTNENDMENAIDRAVSRYGKLDIMFSNAGITGNMKDPSILATDYNNFKNVFDVNVYGA  130

Query  703   FFCAKHAARVMIPAKKgsiifsasastaafgitSH-TYTASKCAIVGLCKSLCVEMGKYG  527
             F  AK AA+ MIP KKGSI+F++S ++   GI S  TY +SK A+VGL   L VE+GKYG
Sbjct  131   FLGAKIAAKAMIPTKKGSILFTSSVASVIGGIGSPITYASSKHAVVGLTNHLAVELGKYG  190

Query  526   IRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDES  347
             IR NC+S   + T L   I+   D++ AEEI+ E  NLKG  L  ED+AEAA+YL  DES
Sbjct  191   IRVNCISPYTVATPLVREILGKMDKEKAEEIIMETANLKGGILEPEDIAEAAVYLGSDES  250

Query  346   KYVSGVNLIIDGGYSTTN  293
             KYVSGVNL+IDGGYS TN
Sbjct  251   KYVSGVNLVIDGGYSKTN  268



>ref|XP_002275746.2| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=280

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 152/266 (57%), Positives = 191/266 (72%), Gaps = 2/266 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPE-YALFIHC  878
             KRLEGKVAIITG A+GIG +TARLF  HG KVIIAD+ D  G S+ + +G    A F+HC
Sbjct  12    KRLEGKVAIITGGASGIGESTARLFVRHGAKVIIADVQDDIGLSICEALGSHGTASFVHC  71

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV  +S V+N VDT VS+YGKLDIMF+NAG +G+ D +IL    EN   VFD NV G+F 
Sbjct  72    DVTSDSDVKNVVDTAVSKYGKLDIMFNNAGISGNLDPTILGTENENFRRVFDVNVYGAFL  131

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AKHAARVMIPAKKG I+F++S ++   G + H YT SK A+VGL K+LCVE+G++GIR 
Sbjct  132   GAKHAARVMIPAKKGVILFTSSVASVTSGESPHAYTMSKHAVVGLTKNLCVELGQHGIRV  191

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             NC+S   I T L  + M  + +K  E IV  + NLKGV    EDVAEAA+YL  DESKYV
Sbjct  192   NCISPCAIATPLLRNAMGLE-KKTVEGIVCASANLKGVVAEAEDVAEAAVYLGSDESKYV  250

Query  337   SGVNLIIDGGYSTTNIGFQVAVEKVL  260
             SG+NL++DGGYSTTN  F + V+ ++
Sbjct  251   SGLNLVVDGGYSTTNQSFTMVVKALV  276



>ref|XP_002309402.2| hypothetical protein POPTR_0006s22270g, partial [Populus trichocarpa]
 gb|EEE92925.2| hypothetical protein POPTR_0006s22270g, partial [Populus trichocarpa]
Length=275

 Score =   233 bits (593),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 146/251 (58%), Positives = 181/251 (72%), Gaps = 8/251 (3%)
 Frame = -1

Query  1048  LEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-FIHCDV  872
             LEGKVA+ITG A+GIGA TARLF  HG KV+IADI D  G+S  QE GP+  + ++HC+V
Sbjct  1     LEGKVALITGGASGIGACTARLFVQHGAKVLIADIQDDLGHSFCQEFGPQETISYVHCNV  60

Query  871   RIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFCA  692
               +S VQNAVDT V +YGKLDIMF+NAG  G R + IL  + EN   V D NV G F  A
Sbjct  61    TCDSDVQNAVDTAVFKYGKLDIMFNNAGIPGDRKSGILTCDNENFKRVLDVNVYGGFLGA  120

Query  691   KHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSNC  512
             KHAARVMIPAKKG I+F++S ++  +G  +H YTASK AIVGL K+L VE+G+YGIR N 
Sbjct  121   KHAARVMIPAKKGCILFTSSVASVLYGELAHAYTASKNAIVGLAKNLSVELGQYGIRVNS  180

Query  511   VSAAIILTKL---GMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKY  341
             +S   + T L   G+S+     ++ AEE+VA A  LK V L  EDV++AALYLA +ESKY
Sbjct  181   ISPYAVATPLLTDGLSMT----KEAAEELVASAATLKDVVLEPEDVSQAALYLASEESKY  236

Query  340   VSGVNLIIDGG  308
             VSGVNL+IDGG
Sbjct  237   VSGVNLVIDGG  247



>gb|KDP37624.1| hypothetical protein JCGZ_06967 [Jatropha curcas]
Length=279

 Score =   233 bits (593),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 147/267 (55%), Positives = 187/267 (70%), Gaps = 6/267 (2%)
 Frame = -1

Query  1051  RLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-FIHCD  875
             RLEGKVAIITG A+GIG +T RLF  HG KVII DI D  G+S+ QE+  +  L +IHCD
Sbjct  11    RLEGKVAIITGGASGIGESTVRLFLKHGAKVIIGDIQDTLGHSLCQELNSKETLSYIHCD  70

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V  +S VQNAV+  +S+YGKLDIMFSNAG AG+ D SI++   E+    FD NV G+F  
Sbjct  71    VTCDSDVQNAVNFAISKYGKLDIMFSNAGIAGNMD-SIIDIKNEDFKRCFDVNVFGAFLV  129

Query  694   AKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSN  515
             AKHAARVMIPAKKG IIF+AS  +       H Y ASK A+VGL K+L +E+GKYGIR N
Sbjct  130   AKHAARVMIPAKKGCIIFTASNLSVTCFQGMHPYIASKHAVVGLAKNLSIELGKYGIRVN  189

Query  514   CVSAAIILTKL---GMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESK  344
             CVS   + T L      ++  +  K+ +E+V+ + NLK V L  EDVAEA ++L  DESK
Sbjct  190   CVSPFAVATPLFRKSTGLVDMEKEKI-QELVSGSGNLKEVILEPEDVAEAVVFLGSDESK  248

Query  343   YVSGVNLIIDGGYSTTNIGFQVAVEKV  263
             YVSG+NL+IDGGYS TN  F++A++ +
Sbjct  249   YVSGLNLVIDGGYSLTNPSFELAMKSL  275



>gb|KDP36151.1| hypothetical protein JCGZ_08795 [Jatropha curcas]
Length=281

 Score =   233 bits (593),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 187/269 (70%), Gaps = 4/269 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-FIHC  878
             KRL+GKVA+ITG A+GIG +TARLF   G KVIIAD+ D  G S+ +E+G E  + +IHC
Sbjct  12    KRLQGKVALITGGASGIGESTARLFVEQGAKVIIADVQDNLGLSLCKELGLEEIISYIHC  71

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV  +S V+NAVD  VS+YGKLDIMFSNA  +G+ D++IL    E+   V D N  G F 
Sbjct  72    DVTNDSDVKNAVDLAVSKYGKLDIMFSNAAISGTSDSTILGTENEDFKRVLDVNTFGGFL  131

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AKHAARVMIPAKKGSI+F++SA+        H Y  SK A+VGL K+L VE+G+YGIR 
Sbjct  132   SAKHAARVMIPAKKGSILFTSSAAAVTSAGAPHPYAVSKHALVGLAKNLSVELGQYGIRV  191

Query  517   NCVSAAIILT---KLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDES  347
             N VS  +++T   K  M +M  +D K+ E I     NLKGV    ED+AEAA+YL  DES
Sbjct  192   NVVSPFVVVTPMLKKSMGLMEIEDEKINEAITTHVANLKGVVCEPEDIAEAAVYLVSDES  251

Query  346   KYVSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             KYVSG+NL++DGG+S TN  F +A++ +L
Sbjct  252   KYVSGLNLVVDGGFSITNPSFALAMKNLL  280



>gb|ACB87357.1| secoisolariciresinol dehydrogenase [Dysosma versipellis]
Length=278

 Score =   232 bits (592),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 141/271 (52%), Positives = 180/271 (66%), Gaps = 3/271 (1%)
 Frame = -1

Query  1066  AASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIG-PEYAL  890
             A+S  RL+ KVAIITG A GIG TTA+LF  +G KV+IADI D +G  V + IG P+   
Sbjct  8     ASSTNRLQDKVAIITGGAGGIGETTAKLFVRYGAKVVIADISDDHGQKVCKNIGSPDVIS  67

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             F+HCDV  +  V+N VD T++++GKLDIMF N G  G+   SILEA  E+   V D NV 
Sbjct  68    FVHCDVTEDEDVRNLVDATIAKHGKLDIMFGNVGVLGTTPYSILEAGNEDFKRVMDINVY  127

Query  709   GSFFCAKHAARVMIPAKK-gsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             G+F  AKHAARVMIPAKK   +  ++ +S  A    SH YTA+K A++GL  SLC E+G+
Sbjct  128   GAFLVAKHAARVMIPAKKGSIVSTASISSFTAGEGVSHVYTATKHAVLGLTTSLCTELGQ  187

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             YG+R NCVS  I+ + L   +    D    EE+  +A NLKG  L  EDVA+A  YLAGD
Sbjct  188   YGVRVNCVSPYIVASPLLTDVFRV-DSSRVEELAHQAANLKGTLLRAEDVADAVAYLAGD  246

Query  352   ESKYVSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             ESKYVSG+NL+IDGGY+ TN  F  A++  L
Sbjct  247   ESKYVSGLNLVIDGGYTRTNPAFPTALKHGL  277



>ref|XP_002275723.3| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=277

 Score =   232 bits (592),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 139/276 (50%), Positives = 188/276 (68%), Gaps = 5/276 (2%)
 Frame = -1

Query  1072  IMAASL---KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGP  902
             +M+A++   +RL GKVA+ITG A+GIG  TARLF  HG KVI+AD+ D+ G S+ QEIG 
Sbjct  1     MMSAAIPITQRLAGKVALITGGASGIGECTARLFVKHGAKVIVADVQDQLGRSLCQEIGS  60

Query  901   EYALF-IHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVF  725
             E  +F +HCDV  ++ +QNAVDT +S+YGKLDIMFSNAG +G  ++ I+ ++  N   VF
Sbjct  61    EETIFYVHCDVTCDADIQNAVDTAISKYGKLDIMFSNAGISGEMESRIILSDNTNFKRVF  120

Query  724   DTNVVGSFFCAKHAARVMIPAKKg-siifsasastaafgitSHTYTASKCAIVGLCKSLC  548
             D N  G+F   KHAARVMIPAK G  I  ++  S  A G   + Y ASK A+VGL  +LC
Sbjct  121   DVNAYGAFLAGKHAARVMIPAKTGCIIFTASVVSVVAEGAIPYAYVASKHAVVGLANNLC  180

Query  547   VEMGKYGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAAL  368
             VE+G+YGIR NC+S   + T +        ++   E++V+ + NLKG+ L  EDVA+AAL
Sbjct  181   VELGQYGIRVNCISPFGVATPMLRQGAGMIEKSKVEDLVSSSANLKGIVLEAEDVAKAAL  240

Query  367   YLAGDESKYVSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             YL  D+SKYVSG+NL++DGGYS TN  F    + +L
Sbjct  241   YLGSDDSKYVSGMNLVVDGGYSITNPSFGSVFKTLL  276



>ref|XP_011022234.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=268

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 140/263 (53%), Positives = 182/263 (69%), Gaps = 4/263 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             +++A+L+RLEGKVA+ITG ++GIG +TARLF  HG KV+IADI D+ G+SV +E+ PE A
Sbjct  6     LVSAALRRLEGKVALITGGSSGIGESTARLFVKHGAKVVIADIQDELGHSVCKELEPEPA  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              FIHCDV  E  V+NAV+T VS+YGKLDIMF+NAG  G+  T+ILE +      +   N+
Sbjct  66    SFIHCDVTQEKDVENAVNTAVSKYGKLDIMFNNAGIGGTPKTNILENDKAEFEKIICVNL  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             VG+F   KHAARVMIPA++GSII +AS      G  SH YT+SK  ++GL ++  VE+G 
Sbjct  126   VGAFLGTKHAARVMIPARRGSIITTASVCAIIGGGLSHAYTSSKHGVLGLTRNTAVELGH  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             YGIR NCVS   + T L  +     D    +E+     NLKG  L  ED+AEAALYL  D
Sbjct  186   YGIRVNCVSPYAVPTPLFKNFFKMND----DELKCIYSNLKGAVLQAEDIAEAALYLGSD  241

Query  352   ESKYVSGVNLIIDGGYSTTNIGF  284
             ESKYVSG NL++DGG++  N GF
Sbjct  242   ESKYVSGHNLVVDGGFTIVNRGF  264



>ref|XP_006388114.1| alcohol dehydroge family protein [Populus trichocarpa]
 gb|ERP47028.1| alcohol dehydroge family protein [Populus trichocarpa]
Length=271

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 139/263 (53%), Positives = 184/263 (70%), Gaps = 4/263 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             +++A+L+RLEGKVA+ITG ++GIG +TARLF  HG KV+IADI D+ G+SV +E+ PE A
Sbjct  6     LVSAALRRLEGKVALITGGSSGIGESTARLFVKHGAKVVIADIQDELGHSVCKELEPEPA  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              FIHCDV  E  V+NAV+T VS+YGKLDIMF+NAGT G+  T+I+E +      +   N+
Sbjct  66    SFIHCDVTQEKDVENAVNTAVSKYGKLDIMFNNAGTGGTPKTNIIENDKAEFEKIICANL  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             VG+F   KHAARVMIPA++GSII +AS      G +SH YT+SK  ++GL ++  VE+G+
Sbjct  126   VGAFLGTKHAARVMIPARRGSIITTASVCAIIGGGSSHAYTSSKHGVLGLMRNTAVELGQ  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             YGIR NCVS   + T L  +     D    +E+     NLK   L  ED+AEAALYL  D
Sbjct  186   YGIRVNCVSPYAVPTPLFKNFFKMND----DEVSCIYSNLKEAVLEAEDIAEAALYLGSD  241

Query  352   ESKYVSGVNLIIDGGYSTTNIGF  284
             ESKYVSG NL++DGG++  N GF
Sbjct  242   ESKYVSGHNLVVDGGFTIVNPGF  264



>gb|AHL21380.1| secoisolariciresinol reductase, partial [Dysosma pleiantha]
Length=278

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 141/271 (52%), Positives = 180/271 (66%), Gaps = 3/271 (1%)
 Frame = -1

Query  1066  AASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIG-PEYAL  890
             A+S  RL+ KVAIITG A GIG TTA+LF  +G KV+IADI D +G  V + IG P+   
Sbjct  8     ASSTNRLQDKVAIITGGAGGIGETTAKLFIRYGAKVVIADISDDHGQKVCKNIGSPDVIS  67

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             F+HCDV  +  V+N VDTT++++GKLDIMF N G   +   SILEA  E+   V D NV 
Sbjct  68    FVHCDVTKDEDVRNLVDTTIAKHGKLDIMFGNVGVLSTTPYSILEAGNEDFKRVMDINVY  127

Query  709   GSFFCAKHAARVMIPAKK-gsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             G+F  AKHAARVMIPAKK   +  ++ +S  A    SH YTA+K A++GL  SLC E+G+
Sbjct  128   GAFLVAKHAARVMIPAKKGSIVFTASISSFTAGEGVSHVYTATKHAVLGLTTSLCTELGQ  187

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             YG+R NCVS  I+ + L   +    D    EE+  +A NLKG  L  EDVA+A  YLAGD
Sbjct  188   YGVRVNCVSPYIVASPLLTDVFGV-DSSRVEELAHQAANLKGTLLRAEDVADAVAYLAGD  246

Query  352   ESKYVSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             ESKYVSG+NL+IDGGY+ TN  F  A++  L
Sbjct  247   ESKYVSGLNLVIDGGYTRTNPAFPTALKHGL  277



>gb|KDP36155.1| hypothetical protein JCGZ_08799 [Jatropha curcas]
Length=280

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 139/268 (52%), Positives = 177/268 (66%), Gaps = 4/268 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-FIHC  878
             KRLEGKVA+ITG A+GIG    RLF  HG KV+IAD+ D+ G S+ QE   +  + ++HC
Sbjct  13    KRLEGKVALITGGASGIGEAAVRLFVEHGAKVVIADVQDELGLSLCQEFSSQENICYVHC  72

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV  +  V+NAVD   SRYGKLDIM+SNAG  G  +T +L  + EN   VFD NV G+F 
Sbjct  73    DVTSDEDVKNAVDLAFSRYGKLDIMYSNAGIGGKLETEVLGCSNENFKKVFDVNVFGAFL  132

Query  697   CAKHAARVMIPAKK--gsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGI  524
              AKHAARVMIPAKK       S S+        SH Y +SK A+VGL K+L VE+G+YGI
Sbjct  133   VAKHAARVMIPAKKGCILFTASVSSVIGMGDAASHAYASSKYALVGLSKNLSVELGQYGI  192

Query  523   RSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESK  344
             R N +S   + T L +S     ++K AEE+++    LK   L  EDVA+AALYLA DESK
Sbjct  193   RVNSISPFAVATPL-VSKGLNMEKKKAEELISSTGILKEAVLEAEDVAQAALYLASDESK  251

Query  343   YVSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             YVSG+NLI+DGGYS TN  F +A++ + 
Sbjct  252   YVSGLNLIVDGGYSLTNPSFGLAMKSLF  279



>ref|XP_003554453.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Glycine max]
 gb|KHN02190.1| Momilactone A synthase [Glycine soja]
Length=278

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 141/258 (55%), Positives = 185/258 (72%), Gaps = 8/258 (3%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-FIHC  878
             KRLE KVA+ITG A+GIG  TARLF  HG KV+IADI D  G+S+ Q +     + ++HC
Sbjct  11    KRLEDKVALITGGASGIGEATARLFLRHGAKVVIADIQDNLGHSLCQNLNSGNNISYVHC  70

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV  ++ VQ AV   VSR+GKLDI+FSNAG  G+ D+SI+  +  ++  VF+ NV G+F+
Sbjct  71    DVTNDNDVQIAVKAAVSRHGKLDILFSNAGIGGNSDSSIIALDPADLKRVFEVNVFGAFY  130

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AKHAA +MIP K GSI+F++SA +     + H YTASK A+VGL K+LCVE+GK+GIR 
Sbjct  131   AAKHAAEIMIPRKIGSIVFTSSAVSVTHPGSPHPYTASKYAVVGLMKNLCVELGKHGIRV  190

Query  517   NCVSAAIILTKL---GMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDES  347
             NC+S   + T L   GM +    ++++ EE+ AEA NLKGV L  ED+AEAAL+LA DES
Sbjct  191   NCISPYAVATPLLTRGMGM----EKEMVEELFAEAGNLKGVVLKEEDLAEAALFLASDES  246

Query  346   KYVSGVNLIIDGGYSTTN  293
             KYVSGVNL++DGGYS  N
Sbjct  247   KYVSGVNLVVDGGYSVNN  264



>gb|ABD65462.1| short chain alcohol dehydrogenase [Gossypium hirsutum]
Length=284

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 134/265 (51%), Positives = 182/265 (69%), Gaps = 0/265 (0%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             KRL+GKVA+ITG A+G+G  TA LF  HG KV+IADI D+ G+SV QE+G E   ++HCD
Sbjct  9     KRLDGKVALITGGASGLGKCTATLFVKHGAKVLIADIQDELGDSVCQELGTENISYVHCD  68

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             +  +S V+NAV+  VS+YGKLDIMF+NA T G  +T +  A+ E+   VFD NV+G F  
Sbjct  69    ITCKSDVENAVNLAVSKYGKLDIMFNNADTHGDNETRVTHASTEDFKKVFDINVLGGFLG  128

Query  694   AKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSN  515
             AK+AARVM+PAKKG I+F++S ++     + H Y ASK A+ GL KSL VE+G++GIR N
Sbjct  129   AKYAARVMVPAKKGCILFTSSLASKISFGSPHAYKASKHAVAGLTKSLAVELGEHGIRVN  188

Query  514   CVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVS  335
              +S   ILT +    +   D+K  EE++A +  LKG  L  ED A AALYLA DE+K++S
Sbjct  189   SISPHAILTPMFQKSIGIPDKKKGEEMIAASAVLKGTVLEPEDFAHAALYLASDEAKFIS  248

Query  334   GVNLIIDGGYSTTNIGFQVAVEKVL  260
             GVNL +DGGYS +N  ++  +    
Sbjct  249   GVNLPLDGGYSFSNQSWKAGIRSTF  273



>gb|ACU23500.1| unknown [Glycine max]
Length=278

 Score =   230 bits (587),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 141/258 (55%), Positives = 185/258 (72%), Gaps = 8/258 (3%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-FIHC  878
             KRLE KVA+ITG A+GIG  TARLF  HG KV+IADI D  G+S+ Q +     + ++HC
Sbjct  11    KRLEDKVALITGGASGIGEATARLFLRHGAKVVIADIQDNLGHSLCQNLNSGNNISYVHC  70

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV  ++ VQ AV   VSR+GKLDI+FSNAG  G+ D+SI+  +  ++  VF+ NV G+F+
Sbjct  71    DVTNDNDVQIAVKAAVSRHGKLDILFSNAGIGGNSDSSIIALDPADLKRVFEINVFGAFY  130

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AKHAA +MIP K GSI+F++SA +     + H YTASK A+VGL K+LCVE+GK+GIR 
Sbjct  131   AAKHAAEIMIPRKIGSIVFTSSAVSVTHPGSPHPYTASKYAVVGLMKNLCVELGKHGIRV  190

Query  517   NCVSAAIILTKL---GMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDES  347
             NC+S   + T L   GM +    ++++ EE+ AEA NLKGV L  ED+AEAAL+LA DES
Sbjct  191   NCISPYAVATPLLTRGMGM----EKEMVEELFAEAGNLKGVVLKEEDLAEAALFLASDES  246

Query  346   KYVSGVNLIIDGGYSTTN  293
             KYVSGVNL++DGGYS  N
Sbjct  247   KYVSGVNLVVDGGYSVNN  264



>gb|ADD70246.1| secoisolariciresinol dehydrogenase [Dysosma tsayuensis]
Length=278

 Score =   230 bits (587),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 140/271 (52%), Positives = 181/271 (67%), Gaps = 3/271 (1%)
 Frame = -1

Query  1066  AASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIG-PEYAL  890
             A+S  RL+ KVAIITG A GIG TTA+LF  +G KV+IADI D +G  V + IG P+   
Sbjct  8     ASSTNRLQDKVAIITGGAGGIGETTAKLFVRYGAKVVIADISDDHGQKVCKNIGSPDVIS  67

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             F+HCDV  +  V+N VDTT++++GKLDIMF N G   +   SILEA  E+   V D NV 
Sbjct  68    FVHCDVTKDEDVRNLVDTTIAKHGKLDIMFGNVGVLSTTPYSILEAGNEDFKRVMDINVY  127

Query  709   GSFFCAKHAARVMIPAKK-gsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             G+F  AKHAARVMIPAKK   +  ++ +S  A    SH YTA+K A++GL  SLC E+G+
Sbjct  128   GAFLVAKHAARVMIPAKKGSIVFTASISSFTAGEGVSHAYTATKHAVLGLTTSLCTELGQ  187

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +GIR NCVS  ++ + L   +    D    EE+  +A NLKG+ L  EDVA+A  YLAGD
Sbjct  188   HGIRVNCVSPYVVASPLLTDVFGV-DSSRVEELAHQAANLKGILLRAEDVADAVAYLAGD  246

Query  352   ESKYVSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             ESKYVSG+NL+IDGGY+ TN  F  A++  L
Sbjct  247   ESKYVSGLNLVIDGGYTRTNPAFPTALKHGL  277



>gb|ABN14311.1| secoisolariciresinol dehydrogenase [Sinopodophyllum hexandrum]
Length=278

 Score =   230 bits (586),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 140/271 (52%), Positives = 180/271 (66%), Gaps = 3/271 (1%)
 Frame = -1

Query  1066  AASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIG-PEYAL  890
             A+S  RL+ KVAIITG A GIG TTA+LF  +G KV+IADI D +G  V   IG P+   
Sbjct  8     ASSTNRLQDKVAIITGGAGGIGETTAKLFVRYGAKVVIADISDDHGQKVCNNIGSPDVIS  67

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             F+HCDV  +  V+N VDTT++++GKLDIMF N G   +   SILEA  E+   V D NV 
Sbjct  68    FVHCDVTKDEDVRNLVDTTIAKHGKLDIMFGNVGVLSTTPYSILEAGNEDFKRVMDINVY  127

Query  709   GSFFCAKHAARVMIPAKK-gsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             G+F  AKHAARVMIPAKK   +  ++ +S  A    SH YTA+K A++GL  SLC E+G+
Sbjct  128   GAFLVAKHAARVMIPAKKGSIVFTASISSFTAGEGVSHVYTATKHAVLGLTTSLCTELGQ  187

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +GIR NCVS  ++ + L   +    D    EE+  +A NLKG+ L  EDVA+A  YLAGD
Sbjct  188   HGIRVNCVSPYVVASPLLTDVFGV-DSSRVEELAHQAANLKGILLRAEDVADAVAYLAGD  246

Query  352   ESKYVSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             ESKYVSG+NL+IDGGY+ TN  F  A++  L
Sbjct  247   ESKYVSGLNLVIDGGYTRTNPAFPTALKHGL  277



>gb|KDP36159.1| hypothetical protein JCGZ_08803 [Jatropha curcas]
Length=279

 Score =   229 bits (585),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 144/266 (54%), Positives = 184/266 (69%), Gaps = 2/266 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIG-PEYALFIHC  878
             KRLEGKVA+ITG A+GIG  TAR+F  HG KV+IADI D  G S+ QE   PE   ++HC
Sbjct  12    KRLEGKVALITGGASGIGECTARVFVKHGAKVLIADIQDDLGKSICQEYSSPETISYVHC  71

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV  +S V+NAVD  VSRYGKLDIMF+NAG +G+ +  I   + ++   V D NV G+F 
Sbjct  72    DVSSDSDVKNAVDLAVSRYGKLDIMFNNAGISGTMEQRISSTDNQDFKKVIDVNVFGAFL  131

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AKHAARVMIP KKG I+FSASA +     + H YT SK A+VGL K+L VE+G+YGIR 
Sbjct  132   GAKHAARVMIPNKKGCILFSASAVSVCCVESPHAYTTSKHAVVGLAKNLSVELGQYGIRV  191

Query  517   NCVSAAIILTK-LGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKY  341
             N +S   + T  L  ++    ++K  EE V+ + NLK V L  ED+A AALYLA DESKY
Sbjct  192   NSISPFGVATPMLRNALGGVVEKKEVEEAVSSSANLKEVILEPEDIAHAALYLASDESKY  251

Query  340   VSGVNLIIDGGYSTTNIGFQVAVEKV  263
             VSG+NL++DGGYS TN  F +A++ +
Sbjct  252   VSGINLVVDGGYSLTNPSFAIAMKNL  277



>ref|XP_010246244.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
Length=282

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 135/271 (50%), Positives = 187/271 (69%), Gaps = 1/271 (0%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPE-YA  893
             +A + KRLEGKVAIITG A+GIG +TA+LF  HG KV++AD+ D+ G+S+ +E+  E  A
Sbjct  7     VAPTTKRLEGKVAIITGGASGIGKSTAKLFVRHGAKVVVADVQDELGHSLCRELDSEDTA  66

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              F+HCDV  E+ VQ+ VD+ VS+YGKLDIM++NA   G+ +  +LE + ++   V   N+
Sbjct  67    FFVHCDVSKEADVQSLVDSVVSKYGKLDIMYNNAAIPGNLNPELLETDPKDFERVLSVNL  126

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             +G+F  AKHAARVMIP KKGSI+F++S  +A    + + Y  SK A+VGL KSLC E+G+
Sbjct  127   IGAFLGAKHAARVMIPQKKGSILFTSSVVSAISCGSPYPYGVSKYALVGLAKSLCGELGQ  186

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             YGIR N +S   I T +   ++   +    EE+     NLKGV L  ED+AEAA++LA D
Sbjct  187   YGIRVNVISPYGIATPMLGHVLGNMESSKVEEVTYGGANLKGVILKEEDIAEAAVFLASD  246

Query  352   ESKYVSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             ES+YVSG+NL++DGGYST N  F  A+ K  
Sbjct  247   ESRYVSGLNLLVDGGYSTVNAAFPTAIAKAF  277



>sp|Q94KL8.1|SILD_PODPE RecName: Full=Secoisolariciresinol dehydrogenase, partial [Podophyllum 
peltatum]
 pdb|2BGK|A Chain A, X-Ray Structure Of Apo-Secoisolariciresinol Dehydrogenase
 pdb|2BGK|B Chain B, X-Ray Structure Of Apo-Secoisolariciresinol Dehydrogenase
 pdb|2BGL|A Chain A, X-Ray Structure Of Binary-Secoisolariciresinol Dehydrogenase
 pdb|2BGM|A Chain A, X-Ray Structure Of Ternary-Secoisolariciresinol Dehydrogenase
 gb|AAK38664.1| rhizome secoisolariciresinol dehydrogenase [Podophyllum peltatum]
 gb|ABD78859.1| secoisolariciresinol dehydrogenase [Dysosma tsayuensis]
Length=278

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 141/270 (52%), Positives = 178/270 (66%), Gaps = 3/270 (1%)
 Frame = -1

Query  1063  ASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIG-PEYALF  887
             +S  RL+ KVAIITG A GIG TTA+LF  +G KV+IADI D +G  V   IG P+   F
Sbjct  9     SSTNRLQDKVAIITGGAGGIGETTAKLFVRYGAKVVIADIADDHGQKVCNNIGSPDVISF  68

Query  886   IHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVG  707
             +HCDV  +  V+N VDTT++++GKLDIMF N G   +   SILEA  E+   V D NV G
Sbjct  69    VHCDVTKDEDVRNLVDTTIAKHGKLDIMFGNVGVLSTTPYSILEAGNEDFKRVMDINVYG  128

Query  706   SFFCAKHAARVMIPAKK-gsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             +F  AKHAARVMIPAKK   +  ++ +S  A    SH YTA+K A++GL  SLC E+G+Y
Sbjct  129   AFLVAKHAARVMIPAKKGSIVFTASISSFTAGEGVSHVYTATKHAVLGLTTSLCTELGEY  188

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
             GIR NCVS  I+ + L   +    D    EE+  +A NLKG  L  EDVA+A  YLAGDE
Sbjct  189   GIRVNCVSPYIVASPLLTDVFGV-DSSRVEELAHQAANLKGTLLRAEDVADAVAYLAGDE  247

Query  349   SKYVSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             SKYVSG+NL+IDGGY+ TN  F  A++  L
Sbjct  248   SKYVSGLNLVIDGGYTRTNPAFPTALKHGL  277



>ref|XP_011046903.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
 ref|XP_011046904.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=277

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 146/261 (56%), Positives = 182/261 (70%), Gaps = 1/261 (0%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             ++A   KRLEGKVA+ITG A+GIG ++ARLF  HG KV+IADI D  G+SV +EI    +
Sbjct  6     LLAPVSKRLEGKVALITGGASGIGESSARLFVRHGAKVVIADIQDDPGHSVCEEICSNES  65

Query  892   L-FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTN  716
             L ++ CDV  ES V+ AV+T VS+YGKLDI FSNAG  G  D      + +N   VFDTN
Sbjct  66    LSYVRCDVTRESDVEKAVNTAVSKYGKLDIFFSNAGIFGKGDPQASAIDYDNFKRVFDTN  125

Query  715   VVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMG  536
             V G+F  AKHA+RVMIP KKGSII+S+S  +   G   H YTASK AIVGL K+LC E+G
Sbjct  126   VYGAFLGAKHASRVMIPEKKGSIIYSSSLVSVIVGNVPHAYTASKHAIVGLTKNLCAELG  185

Query  535   KYGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAG  356
             ++GIR NC+S A + T L  +      R  A EI + A +LKGV L  EDVA+AALYLA 
Sbjct  186   QFGIRVNCISPAAVPTPLMRNAFGGISRNAALEIASAAAHLKGVMLEEEDVAQAALYLAS  245

Query  355   DESKYVSGVNLIIDGGYSTTN  293
             D+SKYVSG+NL++DGG S TN
Sbjct  246   DDSKYVSGLNLVVDGGISATN  266



>gb|KDP36165.1| hypothetical protein JCGZ_08809 [Jatropha curcas]
Length=354

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 138/269 (51%), Positives = 187/269 (70%), Gaps = 1/269 (0%)
 Frame = -1

Query  1063  ASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIG-PEYALF  887
             ++ KRL+GK A+ITG A+GIG  TARLF  HG KV+IAD+ D  G S+ QE   PE   +
Sbjct  85    STTKRLDGKDALITGGASGIGECTARLFVKHGAKVLIADVQDDLGLSLCQEFSSPETISY  144

Query  886   IHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVG  707
             +HCDV  +S V+NAVD  VSRYGKLDIM++NAG  G+ D  IL    E+   VFD NV G
Sbjct  145   VHCDVSSDSDVKNAVDLAVSRYGKLDIMYNNAGIGGNPDPRILSTENEDFKKVFDVNVFG  204

Query  706   SFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYG  527
             SF  AK+AA+VMIP KKG I+F++S ++ +   + H YTASK A+VGL K+L +E+G+YG
Sbjct  205   SFLGAKYAAKVMIPNKKGCILFTSSLASVSSSGSPHAYTASKHAVVGLAKNLSIELGQYG  264

Query  526   IRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDES  347
             I  N +S   + T L  + +  +++K  E+++A A  LK V L  ED+A AALYLA DES
Sbjct  265   IGVNSISPFGVATPLLRNAVGNKEKKEVEQVIASAATLKEVILEPEDIANAALYLARDES  324

Query  346   KYVSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             KYVSG+NL++DGG+S TN  F +A++ + 
Sbjct  325   KYVSGINLVVDGGFSLTNPSFAIAMQSLF  353



>ref|XP_004506206.1| PREDICTED: momilactone A synthase-like [Cicer arietinum]
Length=271

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 138/263 (52%), Positives = 180/263 (68%), Gaps = 4/263 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             +++ASL+RLEGKVA+ITG A+GIG  TARLF+ HG +V+IADI D+ G+S+ +++    A
Sbjct  6     LVSASLRRLEGKVALITGGASGIGEATARLFSKHGAQVVIADIQDEMGHSICKDLNKSTA  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              ++HCD   E  ++NAV+TTVS+YGKLDIMF+NAG  G   T+ILE  L     V   N+
Sbjct  66    SYVHCDTTKEKDIENAVNTTVSKYGKLDIMFNNAGIVGVNKTNILENKLSEFEEVIKVNL  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             +G F   KHA+RVMIPA++GSII +AS   +  G  SH  T+SK A++GL K+  VE+G 
Sbjct  126   IGVFLGTKHASRVMIPARRGSIINTASVCGSIGGGASHACTSSKHAVLGLMKNTAVELGP  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             YGIR NCVS  ++ T L        D    E I     NLKGV+L  EDVAEAALYL  D
Sbjct  186   YGIRVNCVSPYVVATPLAKKFFKLDD----EGIQGVYSNLKGVNLVPEDVAEAALYLGSD  241

Query  352   ESKYVSGVNLIIDGGYSTTNIGF  284
             ESKYVSG NL++DGG++  N GF
Sbjct  242   ESKYVSGHNLVVDGGFTVGNSGF  264



>gb|EYU18090.1| hypothetical protein MIMGU_mgv1a010990mg [Erythranthe guttata]
Length=295

 Score =   228 bits (581),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 133/255 (52%), Positives = 180/255 (71%), Gaps = 2/255 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIG-PEYALFIHC  878
             +RL+GKVAIITG A+G G  TARLF  HG KV+IAD+ D  G S+ +EI  P+   ++HC
Sbjct  27    RRLQGKVAIITGGASGFGEATARLFVLHGAKVVIADVQDDRGQSLCREINLPDQISYVHC  86

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV  ++ V  AVD  VS+YG LD+MF+NAG  G  D ++ +A+ +N   VF+ NV G+F 
Sbjct  87    DVTSDADVSAAVDFAVSKYGGLDVMFNNAGIPGKLDFAVADADNDNFKRVFEVNVYGAFL  146

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AKHAARVMIPA KG ++F++S ++   G + H Y  SK A+VG+ ++LCVE+G++GIR 
Sbjct  147   GAKHAARVMIPAGKGVVLFTSSNASVVAGESPHPYAVSKHAVVGMMRNLCVELGEHGIRV  206

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             NC+S   + T L  S M   D+ +  +I+  A  LKGV  T +DVA AALYL+GDESK+V
Sbjct  207   NCISPGAVATPLLTSSMGV-DKAVVNDILRAAATLKGVVPTEDDVAAAALYLSGDESKFV  265

Query  337   SGVNLIIDGGYSTTN  293
             SG+NL+IDGGYSTTN
Sbjct  266   SGLNLVIDGGYSTTN  280



>ref|NP_001239862.1| uncharacterized protein LOC100794412 [Glycine max]
 gb|ACU19399.1| unknown [Glycine max]
 gb|KHN44551.1| Momilactone A synthase [Glycine soja]
Length=269

 Score =   226 bits (577),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 144/262 (55%), Positives = 181/262 (69%), Gaps = 6/262 (2%)
 Frame = -1

Query  1063  ASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFI  884
             A  +RL+GKVAIITG A+G+GA TARLF+ HG  V+IADI D  G SVA+E+  E A ++
Sbjct  9     APFRRLDGKVAIITGGASGLGAATARLFSKHGAYVVIADIQDDLGLSVAKEL--ESASYV  66

Query  883   HCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGS  704
             HCDV  E  V+N V+TTVS+YGKLDIMF+NAG +    TSIL+ N  +   V   N+VG 
Sbjct  67    HCDVTKEEDVENCVNTTVSKYGKLDIMFNNAGVSDEIKTSILDNNKSDFERVISVNLVGP  126

Query  703   FFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGI  524
             F   KHAARVMIPAKKG II +AS +    G  +H YT+SK A++GL K+  VE+G++GI
Sbjct  127   FLGTKHAARVMIPAKKGCIINTASVAGCIGGGATHAYTSSKHALIGLTKNTAVELGQHGI  186

Query  523   RSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESK  344
             R NC+S  +++T L        + K+  EI +   NLKG  L   DVAEAALYLAGDESK
Sbjct  187   RVNCLSPYLVVTPLSKKYFNIDEDKI-REIYS---NLKGAHLVPNDVAEAALYLAGDESK  242

Query  343   YVSGVNLIIDGGYSTTNIGFQV  278
             YVSG NL+IDGGY+  N GF V
Sbjct  243   YVSGHNLVIDGGYTDVNAGFTV  264



>ref|XP_009372539.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
 ref|XP_009372540.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
 ref|XP_009372541.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
 ref|XP_009372542.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
 ref|XP_009372544.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
 ref|XP_009372545.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
 ref|XP_009372546.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
 ref|XP_009372547.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
 ref|XP_009372548.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
 ref|XP_009372550.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=285

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 136/256 (53%), Positives = 183/256 (71%), Gaps = 3/256 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPE--YALFIH  881
             KRLEGKVAIITG A+GIG +TARLF  HG KVIIAD+ D+   S  +E+ P+     +I 
Sbjct  14    KRLEGKVAIITGGASGIGESTARLFVFHGAKVIIADVQDELALSFCKELDPDGDSISYIR  73

Query  880   CDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSF  701
             CDV ++S V+N VD  +S YG+LDIM++NAG +G  D +IL A+ EN   VFD NV G+F
Sbjct  74    CDVTVDSDVKNVVDVALSMYGRLDIMYNNAGVSGKLDPTILGADGENFKQVFDVNVYGAF  133

Query  700   FCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIR  521
               AKHAAR MIPAKKG I+F++S ++   G ++H Y  SK A+VGL KSLCV++G++GIR
Sbjct  134   LGAKHAARAMIPAKKGVILFTSSVASVTCGQSTHAYAMSKHAVVGLMKSLCVDLGQHGIR  193

Query  520   SNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKY  341
              NC+S   + T    +++  + R   EE++  +  LKGV    EDVAEAA+YLA D+SK+
Sbjct  194   VNCISPGAMATPFLTNLLGIE-RNTVEEMICASAVLKGVVPRAEDVAEAAVYLASDQSKF  252

Query  340   VSGVNLIIDGGYSTTN  293
             V+G+NL++DGGYSTTN
Sbjct  253   VNGLNLLVDGGYSTTN  268



>dbj|BAB86915.1| S-locus linked stigma protein 1 [Ipomoea trifida]
Length=160

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             KRLEGKVAIITGAANGIGATTARLFA HGCKVIIADIDDKNG+SVA+EIGPEYALFIHCD
Sbjct  12    KRLEGKVAIITGAANGIGATTARLFAQHGCKVIIADIDDKNGHSVAEEIGPEYALFIHCD  71

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             VRIES VQNAVDTTVSRYGKLDIMFSNAG AGSRDTSILEA+ ENINLVF+TNV G+FFC
Sbjct  72    VRIESDVQNAVDTTVSRYGKLDIMFSNAGVAGSRDTSILEASPENINLVFETNVFGAFFC  131

Query  694   AKHAARVMIPAKK  656
             AKHAARVMIPA+K
Sbjct  132   AKHAARVMIPARK  144



>ref|XP_011006635.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=271

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 135/263 (51%), Positives = 180/263 (68%), Gaps = 4/263 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             +++A+L+RLEGKVA+ITG ++GIG + ARLFA HG KV+IAD+ D+ G+SV +E+  E A
Sbjct  6     LVSAALRRLEGKVALITGGSSGIGESAARLFAKHGAKVVIADVQDELGHSVCEELKNESA  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              F+HCDV  E  V+NAV+T VS++GKLDIMF+NAG  GS   +IL+ +      V   N+
Sbjct  66    SFVHCDVTQEKDVENAVNTAVSKHGKLDIMFNNAGVVGSPKPNILDNDKAEFEKVISVNI  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             VG+F   KHAARVMIPA++GSII +AS      G+ SH YT+SK  ++GL ++  VE+G+
Sbjct  126   VGAFLGTKHAARVMIPARRGSIISTASVCGTIGGVASHAYTSSKHGVIGLMRNTAVELGQ  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +GIR NCVS  ++ T L        D K+         NLK   L  EDVAEAAL+L  D
Sbjct  186   HGIRVNCVSPYLVSTPLAKDFFKLDDNKVNRVY----SNLKEAVLKAEDVAEAALFLGSD  241

Query  352   ESKYVSGVNLIIDGGYSTTNIGF  284
             ESKYVSG NLI+DGG++  N GF
Sbjct  242   ESKYVSGHNLIVDGGFTIVNPGF  264



>ref|XP_002513344.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF48747.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=283

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 136/270 (50%), Positives = 185/270 (69%), Gaps = 6/270 (2%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-FIHC  878
             KRLEGKVA+ITG A+G+GAT+A+LF  HG KV+IADI D+ G+S+ ++IG +  + ++HC
Sbjct  12    KRLEGKVALITGGASGLGATSAKLFVEHGAKVLIADIQDEIGSSLCKQIGSQDIISYVHC  71

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV  +S V+NAVD  VS+YGKLDIMF+NAG AG  DT IL    E    VF  N+ G++ 
Sbjct  72    DVTCDSDVRNAVDLAVSKYGKLDIMFNNAGVAGKLDTRILATENEEFKRVFKINMFGAYL  131

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AKHAARVMIPAKKG I+F++S   +    + H Y  SK A+ G  K+LCVE+G+YGIR 
Sbjct  132   GAKHAARVMIPAKKGCILFTSSNGASTCLQSPHPYVVSKHALNGFAKNLCVELGQYGIRV  191

Query  517   NCVSAAIILTKL-----GMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             NC+S  ++ T L     G   +     K  +++V+ A NLK   L  ED+A AALYLA D
Sbjct  192   NCISPFLVATPLVAKNFGKVEVDDLTMKTVQDLVSTAGNLKAAILEPEDIANAALYLASD  251

Query  352   ESKYVSGVNLIIDGGYSTTNIGFQVAVEKV  263
             +SKYVSG+NL++DGGYS  N    ++++ +
Sbjct  252   DSKYVSGMNLVVDGGYSICNPSIAMSLQNL  281



>ref|XP_008351500.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Malus domestica]
 ref|XP_008360592.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Malus domestica]
Length=286

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 139/271 (51%), Positives = 190/271 (70%), Gaps = 3/271 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGP--EYALFIH  881
             KRLEGKVAIITG A+GIG +TARLF  HG KV IAD+ D+   S+ +E+    E   +I 
Sbjct  15    KRLEGKVAIITGGASGIGESTARLFVFHGAKVXIADVQDELALSLCKELNSDGESISYIR  74

Query  880   CDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSF  701
             CDV I+S V+N VD  +S+YGKLDIM++NAG +G  D SIL A+ EN   VFD NV G+F
Sbjct  75    CDVTIDSDVKNVVDVALSKYGKLDIMYNNAGISGKLDPSILGADAENFKQVFDVNVYGAF  134

Query  700   FCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIR  521
               AKHAAR MI AKKG I+F++S ++A+ G ++H YT SK A+VGL KSLCV++G++GIR
Sbjct  135   LGAKHAARAMIAAKKGVILFTSSVASASCGESTHAYTMSKHAVVGLMKSLCVDLGQHGIR  194

Query  520   SNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKY  341
              NC+S   + T L  ++M  + +   EE++  +  LKG     EDVAEAA+YLA +ESK+
Sbjct  195   VNCISPCAMATPLLTNLMGIE-KNTVEELICASAVLKGAVPRAEDVAEAAVYLASEESKF  253

Query  340   VSGVNLIIDGGYSTTNIGFQVAVEKVLGGGE  248
             V+G+NL++DGGYSTTN    + +  ++   +
Sbjct  254   VNGLNLLVDGGYSTTNQSLSMVLRNLMSSNQ  284



>ref|XP_009349369.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
 ref|XP_009349694.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=286

 Score =   226 bits (575),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 140/264 (53%), Positives = 188/264 (71%), Gaps = 3/264 (1%)
 Frame = -1

Query  1078  QLIMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGP-  902
              L+   S KRLEGKVAIITG A+GIG +TARLF  HG KV+IAD+ D+   S+ +E+   
Sbjct  7     SLVPVPSPKRLEGKVAIITGGASGIGESTARLFVFHGAKVVIADVQDELALSLCKELNSD  66

Query  901   -EYALFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVF  725
              E   +I CDV I+  V+N VD  +S+YGKLDIM++NAG +G  D SIL A+ EN   VF
Sbjct  67    GESISYIRCDVTIDLDVKNVVDVALSKYGKLDIMYNNAGISGKLDPSILGADAENFKQVF  126

Query  724   DTNVVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCV  545
             D NV G+F  AKHAAR MI AKKG I+F++S ++A+ G ++H YT SK A+VGL KSLCV
Sbjct  127   DVNVYGAFLGAKHAARAMIAAKKGVILFTSSVASASCGESTHAYTMSKHAVVGLMKSLCV  186

Query  544   EMGKYGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALY  365
             E+G++GIR NC+S   + T L  ++M  + +   E+++  +  LKG     EDVAEAA+Y
Sbjct  187   ELGQHGIRVNCISPCAMATPLLTNLMGIE-KNTVEKLICASAVLKGAVPRAEDVAEAAVY  245

Query  364   LAGDESKYVSGVNLIIDGGYSTTN  293
             LA +ESK+V+G+NL++DGGYSTTN
Sbjct  246   LASEESKFVNGLNLLVDGGYSTTN  269



>gb|KGN48288.1| hypothetical protein Csa_6G454360 [Cucumis sativus]
Length=279

 Score =   224 bits (572),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 137/264 (52%), Positives = 179/264 (68%), Gaps = 2/264 (1%)
 Frame = -1

Query  1060  SLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-FI  884
             S KRL GKVA+ITGAA+G G +TARLF  HG +V++AD+ D     + +E+G E  + +I
Sbjct  7     SSKRLNGKVALITGAASGFGKSTARLFVQHGARVVLADVQDNLAQPLCKELGSEETVSYI  66

Query  883   HCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGS  704
             HCDV  +S V+ AVD  V RYGKLDIM++NAG  G  D +IL  N EN   VF+ NV G 
Sbjct  67    HCDVTRDSDVKEAVDFAVERYGKLDIMYNNAGITGQMDPTILGTNGENFKKVFEVNVYGG  126

Query  703   FFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGI  524
             F  AKHAARVMIP + G I+F++S ++   G + H Y  SK A+VGL ++LCVE+G++GI
Sbjct  127   FLGAKHAARVMIPNRSGVILFTSSVASVNSGESPHAYAMSKHAVVGLMRNLCVELGEFGI  186

Query  523   RSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESK  344
             R N VS   I T L  + +   +++L EE+V  +  LKGV  T EDVAEAALYL  DES+
Sbjct  187   RVNSVSPGAIATPLLRNALGFTEKEL-EEVVRSSAILKGVVATAEDVAEAALYLCSDESR  245

Query  343   YVSGVNLIIDGGYSTTNIGFQVAV  272
              +SG NL++DGGYST N  F  AV
Sbjct  246   VISGHNLVVDGGYSTANRSFSAAV  269



>ref|XP_010651861.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Vitis vinifera]
Length=267

 Score =   224 bits (571),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 138/264 (52%), Positives = 178/264 (67%), Gaps = 4/264 (2%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             ++A+ +RL+GKVA+ITG A+GIG +TARLF+ HG KV+IADI D  G SV +++ P  A 
Sbjct  7     ISAAARRLQGKVALITGGASGIGESTARLFSRHGAKVVIADIQDNLGLSVCKDLSPTSAS  66

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             F+HCDV  E  V+NAV+  V+ +GKLDIMF+NAG AG     IL+ +      V + NVV
Sbjct  67    FVHCDVTNEKEVENAVNLAVATHGKLDIMFNNAGIAGEAKPHILDNDKTEFERVLNVNVV  126

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             G+F   KHAARVMIPA  GSII +AS  +   G  SH YT+SK A+VGL ++  VE+GKY
Sbjct  127   GAFLGTKHAARVMIPAGNGSIITTASVCSTVGGGASHAYTSSKHAVVGLARNAAVELGKY  186

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
             GIR NCVS  ++ T L   +    D    + +     NLKG  L  EDVAEAALYLAGDE
Sbjct  187   GIRVNCVSPYLVATPLAKDLFKLDD----DGVSGVYSNLKGKVLNAEDVAEAALYLAGDE  242

Query  349   SKYVSGVNLIIDGGYSTTNIGFQV  278
             SKYVSG NL++DGG++  N  F +
Sbjct  243   SKYVSGHNLLVDGGFTVVNPSFGI  266



>ref|XP_006354115.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=280

 Score =   224 bits (572),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 140/272 (51%), Positives = 192/272 (71%), Gaps = 0/272 (0%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             ++ S KRL+GKVA+ITG A+GIGATTA+LF  +G KV+I D+ D  G S   EIG E+  
Sbjct  8     VSTSAKRLDGKVAVITGGASGIGATTAKLFVKNGAKVVILDVQDDLGLSFCDEIGLEHIS  67

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             ++HCDV IE  V+ A+D  VS++GK+DIM++NAG  GS    I   + EN+  VFD NV 
Sbjct  68    YVHCDVTIEKQVEEAIDFVVSKHGKIDIMYNNAGITGSISLGITTTDYENLKKVFDINVF  127

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             G+F  AKHAARVMIPAKKG I+F+AS +    G++SHTY +SK A++GL  +LCVE+G+Y
Sbjct  128   GAFLGAKHAARVMIPAKKGVILFTASVTAVVAGMSSHTYASSKHAVIGLSNNLCVELGQY  187

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
             GIR NC++  ++ T +  + +   D+   +E + ++ NLK   L  EDVA AA+YLA DE
Sbjct  188   GIRVNCITPHVVATPMLTNFVGGIDQSKVDEALTKSANLKEAKLEAEDVAAAAVYLASDE  247

Query  349   SKYVSGVNLIIDGGYSTTNIGFQVAVEKVLGG  254
             SKYVSG+NL+IDGGYS TN  F + + ++L G
Sbjct  248   SKYVSGLNLMIDGGYSKTNPLFPMCIREILSG  279



>gb|KDP32981.1| hypothetical protein JCGZ_13012 [Jatropha curcas]
Length=243

 Score =   223 bits (568),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 123/241 (51%), Positives = 168/241 (70%), Gaps = 3/241 (1%)
 Frame = -1

Query  973  HGCKVIIADIDDKNGNSVAQEIGPE-YALFIHCDVRIESHVQNAVDTTVSRYGKLDIMFS  797
            HG K+IIADI D+ G S+ +++GPE    ++HCD+  +S VQNAVD  + +YGKLDIMFS
Sbjct  2    HGAKIIIADIQDELGYSLCKQLGPEEICSYVHCDITNDSDVQNAVDLAIFKYGKLDIMFS  61

Query  796  NAGTAGSRDTSILEANLENINLVFDTNVVGSFFCAKHAARVMIPAKKgsiifsasastaa  617
            NAG +G  D  IL    E+   VFD NV G+F  AKHAAR+MIPAKKG I+F++S  +  
Sbjct  62   NAGISGPMDPRILTTENEDFKRVFDVNVFGAFLAAKHAARIMIPAKKGCILFTSSLVSVT  121

Query  616  fgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSNCVSAAIILTKLGMSI--MPTQDRKLA  443
                 H Y ASK A+VGL K+L VE+G+YGIR NC+S    +T L  +   +   +++  
Sbjct  122  CLQAPHAYAASKHALVGLAKNLAVEIGQYGIRVNCISPYAAVTPLLRNSLGLMEIEKEKI  181

Query  442  EEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVSGVNLIIDGGYSTTNIGFQVAVEKV  263
            EE+++++ NLKGV L  ED+AEAA+YL  DESKYVSG+NL++DGGYS TN  F +A++ +
Sbjct  182  EEMISDSANLKGVVLEPEDIAEAAVYLGSDESKYVSGINLVVDGGYSLTNPSFAMAMKSL  241

Query  262  L  260
            L
Sbjct  242  L  242



>ref|XP_008462605.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Cucumis melo]
Length=279

 Score =   224 bits (571),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 141/274 (51%), Positives = 184/274 (67%), Gaps = 3/274 (1%)
 Frame = -1

Query  1060  SLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-FI  884
             S KRL GKVA+ITGAA+G G +TARLF  HG +V++AD+ D     + +E+G E ++ +I
Sbjct  7     SSKRLNGKVALITGAASGFGKSTARLFVQHGARVVLADVQDNLAQPLCKELGSEESVSYI  66

Query  883   HCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGS  704
             HCDV  +S V+NAVD  V RYGKLDIM++NAG  G  D +IL  + EN   VF+ NV G 
Sbjct  67    HCDVTSDSDVKNAVDFAVERYGKLDIMYNNAGITGQMDPTILGTDGENFKKVFEVNVYGG  126

Query  703   FFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGI  524
             F  AKHAARVMIP + G I+F++S ++   G + H Y  SK A+VGL ++LCVE+G++GI
Sbjct  127   FLGAKHAARVMIPNRSGVILFTSSVASVNSGESPHAYAMSKHAVVGLMRNLCVELGEFGI  186

Query  523   RSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESK  344
             R N VS   I T L  + +    ++L EE+V  +  LKGV  T EDVAEAALYL  DES+
Sbjct  187   RVNSVSPGAIATPLLRNALGFTKKEL-EEVVRSSAILKGVVATAEDVAEAALYLCSDESR  245

Query  343   YVSGVNLIIDGGYSTTNIGFQVAV-EKVLGGGEG  245
              +SG NL++DGGYST N  F  AV  KV    EG
Sbjct  246   VISGHNLVVDGGYSTANRSFSAAVIRKVSSAFEG  279



>ref|XP_010104808.1| Momilactone A synthase [Morus notabilis]
 gb|EXC01949.1| Momilactone A synthase [Morus notabilis]
Length=323

 Score =   226 bits (575),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 135/264 (51%), Positives = 190/264 (72%), Gaps = 2/264 (1%)
 Frame = -1

Query  1048  LEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGP-EYALFIHCDV  872
             LEGKVAIITG A+G+G  TARLF  HG KV+IADI D+ G S++QE+GP +   ++HCDV
Sbjct  52    LEGKVAIITGGASGLGEGTARLFVRHGAKVVIADIQDELGLSLSQELGPSDVVSYVHCDV  111

Query  871   RIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFCA  692
               +S V++ VD  VS++GKLDIM++NAG  G  D +IL ++ +N   VF+ NV G F  A
Sbjct  112   TSDSDVKSLVDFAVSKHGKLDIMYNNAGITGDLDPTILGSDNDNFKRVFEVNVFGGFLGA  171

Query  691   KHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSNC  512
             KHAARVMIPA+KG I+F++S ++ + G + H YT SK A+VGL K+LCVE+G++GIR N 
Sbjct  172   KHAARVMIPARKGVILFTSSVASESCGESPHAYTVSKHAVVGLMKNLCVELGQHGIRVNS  231

Query  511   VSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVSG  332
             +S + + T L +S     ++ + + ++  +  LKG     EDVAEAA+YLA DE+KYV+G
Sbjct  232   ISPSAVATPL-LSNAIGIEKSVVDGLICTSAVLKGPPPGPEDVAEAAVYLASDEAKYVNG  290

Query  331   VNLIIDGGYSTTNIGFQVAVEKVL  260
             VNL++DGGYSTTN  F +A+  ++
Sbjct  291   VNLMVDGGYSTTNPSFGMALRSLM  314



>gb|AFK37606.1| unknown [Medicago truncatula]
 gb|KEH29818.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=271

 Score =   224 bits (571),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 137/270 (51%), Positives = 183/270 (68%), Gaps = 4/270 (1%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             +++A+L+RLEGKVA+ITG A+GIG  TARLF++HG +V+IADI D  G+S+ QE+    A
Sbjct  6     LVSAALRRLEGKVALITGGASGIGEATARLFSNHGAQVVIADIQDDIGHSICQELHKSSA  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              ++HCDV  E  ++NAV+TTVS++GKLDIMF+NAG  G   T+ILE  L     V D N+
Sbjct  66    TYVHCDVTKEKDIENAVNTTVSKHGKLDIMFNNAGITGINKTNILENKLSEFQEVIDINL  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
              G F   KHAARVM P ++GSII +AS      G+ SH YT+SK A+VGL K+  +E+G 
Sbjct  126   TGVFLGTKHAARVMTPVRRGSIINTASVCGCIGGVASHAYTSSKHAVVGLMKNTAIELGP  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             YGIR NCVS  ++ T L  +     D    + ++    NLKG +L  +DVAEAALYL  D
Sbjct  186   YGIRVNCVSPYVVGTPLAKNFFKLDD----DGVLDVYSNLKGANLLPKDVAEAALYLGSD  241

Query  352   ESKYVSGVNLIIDGGYSTTNIGFQVAVEKV  263
             ESKYVSG NL++DGG +  N GF +  + V
Sbjct  242   ESKYVSGHNLVVDGGLTVGNNGFCIFKQSV  271



>gb|EPS74091.1| hypothetical protein M569_00663 [Genlisea aurea]
Length=318

 Score =   225 bits (574),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 132/281 (47%), Positives = 193/281 (69%), Gaps = 12/281 (4%)
 Frame = -1

Query  1057  LKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIG-PEYALFIH  881
              KRL+ KVA+ITG A+G G TTARLF  HG KV+IAD+ D+ G  + +E+  P+   ++H
Sbjct  11    FKRLDDKVAVITGGASGFGETTARLFLRHGAKVVIADVQDERGRCICEELSFPDQISYVH  70

Query  880   CDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSF  701
             CDV  +S V++AVD  V +YG+LD+MF+NAG  G  D +I +A+ +N   VF+ NV G F
Sbjct  71    CDVTKDSDVKSAVDFAVDKYGRLDVMFNNAGIPGRLDFTISDADNDNFKRVFEVNVYGGF  130

Query  700   FCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIR  521
               AKHAARVMIPA++G I+F++S ++   G + H+Y  SK A+VGL K+LCVE+G++GIR
Sbjct  131   LGAKHAARVMIPARRGVILFTSSVASVISGESPHSYATSKHAVVGLMKNLCVELGQHGIR  190

Query  520   SNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKY  341
              N +S   + T L  + M + D+ + E+I+ ++  LKG + T +DVAEAA+YL+ DE+K+
Sbjct  191   VNSISPCAVATPLLTTAM-SVDKSVVEKIICDSATLKGATPTADDVAEAAVYLSSDEAKF  249

Query  340   VSGVNLIIDGGYSTTNIGFQVAVEKVLGGGEGTT*SSAHRF  218
             VSG+NL++DGGYS TN  +  A++           S+ HRF
Sbjct  250   VSGLNLVVDGGYSATNQSYTRALKS----------SAQHRF  280



>ref|XP_003554454.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Glycine max]
Length=287

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 143/271 (53%), Positives = 185/271 (68%), Gaps = 9/271 (3%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGP------EYA  893
             KRL+GKVA+ITG A+GIG  TA+LF  HG KV+IADI D  G+S+ Q +        +  
Sbjct  13    KRLDGKVALITGGASGIGEATAKLFLRHGAKVVIADIQDNLGHSLCQSLNSSDKNNNDDI  72

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRD--TSILEANLENINLVFDT  719
              ++HCDV  +  V+ AV+  VSR+GKLDI+FSNAG  G  D   SI   +  ++  VF+ 
Sbjct  73    SYVHCDVTNDKDVETAVNAAVSRHGKLDILFSNAGITGRSDCSNSITAIDSGDLKRVFEV  132

Query  718   NVVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEM  539
             NV G+F+ AKHAA+VMIP KKGSI+F+AS ++ +    +H Y ASK A+VGL K+LCVE+
Sbjct  133   NVFGAFYAAKHAAKVMIPRKKGSIVFTASIASVSNAGWAHPYAASKNAVVGLMKNLCVEL  192

Query  538   GKYGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLA  359
             GK+GIR NCVS   + T +    M  +  K AEEI  EA NLKGV L  +DVAEA L+LA
Sbjct  193   GKHGIRVNCVSPYAVGTPMLTRAMRMEKEK-AEEIYLEAANLKGVVLKEKDVAEATLFLA  251

Query  358   GDESKYVSGVNLIIDGGYSTTNIGFQVAVEK  266
              DESKYVSGVNL++DGGY+TTN   + A  K
Sbjct  252   SDESKYVSGVNLVVDGGYTTTNSSSKQAFTK  282



>ref|XP_002323403.1| alcohol dehydroge family protein [Populus trichocarpa]
 gb|EEF05164.1| alcohol dehydroge family protein [Populus trichocarpa]
Length=279

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 136/267 (51%), Positives = 180/267 (67%), Gaps = 2/267 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-FIHC  878
             KRLEGKVA+ITG A+GIG  +ARLF  HG KV+IADI D  G ++ + +G + ++ +IHC
Sbjct  12    KRLEGKVALITGGASGIGECSARLFVQHGAKVLIADIQDDLGEALCKNLGSQESISYIHC  71

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGS-RDTSILEANLENINLVFDTNVVGSF  701
             DV  +S V+NAVD  VS+YGKLDIMF+NAG  G+ +   IL   +E+   V D N+ G+F
Sbjct  72    DVTCDSDVKNAVDMAVSKYGKLDIMFNNAGIVGTCKAPRILAVEIEDFKRVLDVNLFGAF  131

Query  700   FCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIR  521
               AKHAARVMIPAKKG I+F+ S  T +   + H Y ASK A+VGL K+L VE+G++GIR
Sbjct  132   LGAKHAARVMIPAKKGCILFTGSLVTVSCCSSPHAYAASKHAVVGLTKNLAVELGQHGIR  191

Query  520   SNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKY  341
              NC+S   I T + +  M  + RK  E + + +  LK   L  ED A AA+YLA DESKY
Sbjct  192   VNCISLFTIATPMVIESMGIEKRKFEEFLSSSSAILKETLLEPEDFANAAIYLASDESKY  251

Query  340   VSGVNLIIDGGYSTTNIGFQVAVEKVL  260
              SG+NL+IDGGYS TN    +A+  + 
Sbjct  252   TSGINLVIDGGYSLTNPTLPLALRSLF  278



>ref|XP_009592996.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
tomentosiformis]
Length=258

 Score =   222 bits (566),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 132/246 (54%), Positives = 171/246 (70%), Gaps = 1/246 (0%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-FIHC  878
             KRLEGKVA ITG A+GIG   ARLF  HG K++IADI D  G S+  EIG    + +IHC
Sbjct  13    KRLEGKVAFITGGASGIGEAAARLFIKHGAKIVIADIQDDLGQSIIDEIGERGEVSYIHC  72

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV++E +V+NAVD  +S+Y KLDIMFSNAG     +++IL  + +N   V + NV G+  
Sbjct  73    DVKVEKNVENAVDMAISKYRKLDIMFSNAGIPEELNSTILNIDYDNFKNVIEVNVFGALM  132

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
             CAKHAARVMIPA KGSIIF++S ++      +HTY ASK A+VG  K+L VE+G++GIR 
Sbjct  133   CAKHAARVMIPANKGSIIFTSSVASVTHSGVAHTYLASKHAVVGFAKNLGVELGQHGIRV  192

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             NCVS   + T +  +    ++++  EE V+E  NLKG  L  EDVAEAALYLA DESKY+
Sbjct  193   NCVSPFCVATPMLRNGFRIKEKEKTEEFVSEVANLKGTILEAEDVAEAALYLASDESKYI  252

Query  337   SGVNLI  320
             SG NL+
Sbjct  253   SGTNLV  258



>gb|KEH29817.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=271

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 136/269 (51%), Positives = 182/269 (68%), Gaps = 4/269 (1%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             +AA L+RLEGKVA+ITG A+GIG  TARLF  HG +VIIADI D  G SV +++    A 
Sbjct  7     VAAVLRRLEGKVALITGGASGIGEATARLFTEHGAQVIIADIQDDKGYSVCKDLHKSSAS  66

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             ++HCDV  E  ++NAV+TT+S YGKLDIMF+NAG  G+  T+ILE  L     V + N+V
Sbjct  67    YVHCDVTKEKDIENAVNTTISMYGKLDIMFNNAGIVGANKTNILEYKLSEFEEVINVNLV  126

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             G F   KHA+RVMIPA++GSII +AS   +  G+ SH YT+SK A++GL ++  +E+G +
Sbjct  127   GVFLGTKHASRVMIPARRGSIINTASVCGSIGGMASHAYTSSKHAVLGLMRNTAIELGPF  186

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
              IR NCVS  I+ T +  + +   D    E ++    NLKG +L  +DVAEA+LYL  DE
Sbjct  187   SIRVNCVSPYIVATPMAKNFLKLDD----EGLLGLYSNLKGTNLVPKDVAEASLYLGSDE  242

Query  349   SKYVSGVNLIIDGGYSTTNIGFQVAVEKV  263
             SKYVSG NL++DG  S +N GF V  + V
Sbjct  243   SKYVSGHNLVVDGAVSVSNNGFSVFGQSV  271



>ref|NP_001238797.1| uncharacterized protein LOC100750250 [Solanum lycopersicum]
 gb|ADD85105.1| hypothetical protein [Solanum lycopersicum]
Length=225

 Score =   221 bits (562),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 123/215 (57%), Positives = 156/215 (73%), Gaps = 1/215 (0%)
 Frame = -1

Query  892  LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
            +F+HCDV IES VQN VD TV+++GKLDIMFSNAG AG   +SIL+ + + I  VFD NV
Sbjct  1    MFVHCDVAIESDVQNVVDATVAKFGKLDIMFSNAGVAGKSISSILDVDTDIIKNVFDVNV  60

Query  712  VGSFFCAKHAARVMIPAK-KgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMG  536
            VG+F CAKHAARVMI +  KGSIIF+ SA+T  +GI  H+Y ASK A++GLCK++ VE+G
Sbjct  61   VGAFLCAKHAARVMISSHTKGSIIFTTSAATVVYGIVPHSYAASKSAVLGLCKNIGVELG  120

Query  535  KYGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAG  356
            +YGI+ NCVS   I TKL +  +   +R+ AE    E  NLKGV L  +DVA   LYLA 
Sbjct  121  RYGIKVNCVSPHYISTKLALDALGIDEREKAERWFGEGGNLKGVLLEEQDVANGVLYLAS  180

Query  355  DESKYVSGVNLIIDGGYSTTNIGFQVAVEKVLGGG  251
            D+SKYVSG+NL+IDGGYSTTN+    A +K+   G
Sbjct  181  DDSKYVSGLNLVIDGGYSTTNVALGEAYKKLFPSG  215



>ref|XP_010691680.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691681.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691682.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691683.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691684.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691685.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691686.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
Length=269

 Score =   222 bits (565),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 138/263 (52%), Positives = 176/263 (67%), Gaps = 5/263 (2%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             + A+ +RLEGKVA+ITG A+GIG  TA LF  HG KV+IADI D  G SV + +GP  A 
Sbjct  7     LTAAARRLEGKVALITGGASGIGEYTAELFTKHGAKVMIADIQDDLGQSVCKNLGPSVAS  66

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDT-SILEANLENINLVFDTNV  713
             +IHCDV  E+HVQNAVD+TV++Y KLDIMF+NAG AGS    +IL+        +   N+
Sbjct  67    YIHCDVTNEAHVQNAVDSTVAKYEKLDIMFNNAGIAGSYPKLNILDITQSEFEEIIKVNL  126

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             +G F   KHAARVMIPAK+GSII +AS  +   G   H YT+SK  IVGL ++  VE+GK
Sbjct  127   IGPFLGTKHAARVMIPAKQGSIITTASTCSVIGGGAPHAYTSSKHGIVGLTRNTAVELGK  186

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             YGIR NCVS  +I T L  + +   D    E +     NLKG S   EDVA AAL+LA D
Sbjct  187   YGIRVNCVSPHVISTPLVKNFLKLDD----EGVSKFYSNLKGASCKVEDVANAALFLASD  242

Query  352   ESKYVSGVNLIIDGGYSTTNIGF  284
             +SK++SG NL++DGG++  N GF
Sbjct  243   DSKFISGHNLVVDGGFTIMNPGF  265



>ref|XP_010262932.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
Length=268

 Score =   221 bits (564),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 135/265 (51%), Positives = 180/265 (68%), Gaps = 4/265 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             +++A +KRLEGKVA+ITG A+GIG +T RLF  HG KV+IAD+ D  G+SV  +IG + A
Sbjct  7     VLSAVVKRLEGKVALITGGASGIGESTVRLFCRHGAKVVIADVQDDLGHSVCNDIGSKAA  66

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              F+HCDV  ESH++ AVDTTV++YGKLDIMF+NAG  G+ + +IL+ +      V   N+
Sbjct  67    SFVHCDVTNESHIRKAVDTTVAKYGKLDIMFNNAGIVGTPNPNILDNDKGEFEQVLAVNI  126

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
              G F   KHAARVMIPA++GSII +AS  +   G+ SH YT SK A+VGL K+  VE+GK
Sbjct  127   TGPFLGTKHAARVMIPARRGSIISTASVCSLVGGVASHAYTCSKHAVVGLTKNAAVELGK  186

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +G+R NCVS  +++T L        D   +  I +   NLKG  L  EDVAEA LYL  D
Sbjct  187   FGVRVNCVSPYLVVTPLTKKFF-NLDENGSPGIYS---NLKGRMLWPEDVAEAVLYLGSD  242

Query  352   ESKYVSGVNLIIDGGYSTTNIGFQV  278
             +S YVSG NL++DGG++  N  F +
Sbjct  243   DSLYVSGHNLVVDGGFTIVNPAFGI  267



>ref|XP_010683629.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
Length=289

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 138/278 (50%), Positives = 184/278 (66%), Gaps = 14/278 (5%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEI-----------  908
             +RL+GKVAIITG A+G G  TARLF  HG KVIIAD+ D+ G  +  +I           
Sbjct  12    ERLKGKVAIITGGASGFGEATARLFVQHGAKVIIADVQDEKGIILCNDIIASNTTNHHGN  71

Query  907   --GPEYALFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENIN  734
                 E   ++HC+V  E+ V+N VD T+S++GKLDIMF+NAG  G  D +I+ A +EN  
Sbjct  72    NNDVELISYVHCNVSDETDVKNLVDLTISKHGKLDIMFNNAGIPGDIDPTIVGATIENFK  131

Query  733   LVFDTNVVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKS  554
              VF+ NV G F  AKHAARVMIP+K G I+F++S ++   G + H YT SK AI+GL K+
Sbjct  132   KVFNINVFGGFLGAKHAARVMIPSKSGVILFTSSLASLVAGESPHAYTMSKHAIIGLMKN  191

Query  553   LCVEMGKYGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEA  374
             LCVEMG+YGIR N +S   + T L +S     D+   +E++ E+  LKGV+    DVA A
Sbjct  192   LCVEMGQYGIRVNAISPCGVATPL-LSNALGMDKGAVDELLCESAVLKGVAPEALDVAHA  250

Query  373   ALYLAGDESKYVSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             AL+LA DE+K+VSGVN +IDGGYS TN  F +AV+K+ 
Sbjct  251   ALFLASDEAKFVSGVNFVIDGGYSVTNPSFSMAVKKLF  288



>gb|KHN11533.1| Momilactone A synthase [Glycine soja]
Length=269

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 141/264 (53%), Positives = 182/264 (69%), Gaps = 6/264 (2%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             ++A  +RL+GKVAIITG A+G+GA TARLF+ HG  V+IADI D  G SVA+E+  E A 
Sbjct  7     VSAPFRRLDGKVAIITGGASGLGAATARLFSKHGAHVVIADIQDDLGLSVAKEL--ESAS  64

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             ++HCDV  E+ V+N V+T VS+YGKLDIMF+NAG      TSI++ +  +   V   N+V
Sbjct  65    YVHCDVTNENDVENCVNTAVSKYGKLDIMFNNAGIIDEIKTSIVDNSKSDFERVIGVNLV  124

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             G F   KHAARVMIPAKKG II +AS +    G  +H YT+SK A++GL K+  VE+G++
Sbjct  125   GPFLGTKHAARVMIPAKKGCIINTASVAGCIGGGATHAYTSSKHALIGLTKNTAVELGQH  184

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
             GIR NC+S  +++T L        + K+  EI +   NLKG  L   DVAEAALYLAGDE
Sbjct  185   GIRVNCLSPYLVVTPLSKKYFNIDEDKI-REIYS---NLKGAHLVPNDVAEAALYLAGDE  240

Query  349   SKYVSGVNLIIDGGYSTTNIGFQV  278
             SKYVSG NL+IDGGY+  N GF V
Sbjct  241   SKYVSGHNLVIDGGYTDVNAGFTV  264



>sp|Q94KL7.1|SILD_FORIN RecName: Full=Secoisolariciresinol dehydrogenase, partial [Forsythia 
x intermedia]
 gb|AAK38665.1| stem secoisolariciresinol dehydrogenase [Forsythia x intermedia]
Length=277

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 136/260 (52%), Positives = 175/260 (67%), Gaps = 0/260 (0%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             ++ A  +RLEGKVA+ITG A+GIG TTA+LF+ HG KV IAD+ D+ G+SV + IG   +
Sbjct  7     VLTAIARRLEGKVALITGGASGIGETTAKLFSQHGAKVAIADVQDELGHSVVEAIGTSNS  66

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              +IHCDV  E  V+NAVD TVS YGKLDIMFSNAG +      I++    +   VF  NV
Sbjct  67    TYIHCDVTNEDGVKNAVDNTVSTYGKLDIMFSNAGISDPNRPRIIDNEKADFERVFSVNV  126

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
              G F C KHAARVMIPA+ G+II +AS S+   G +SH Y  SK A++GL ++L VE+G+
Sbjct  127   TGVFLCMKHAARVMIPARSGNIISTASLSSTMGGGSSHAYCGSKHAVLGLTRNLAVELGQ  186

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +GIR NC+S   + T LG      ++ +  E ++  A NLKG     EDVA AALYLA D
Sbjct  187   FGIRVNCLSPFGLPTALGKKFSGIKNEEEFENVINFAGNLKGPKFNVEDVANAALYLASD  246

Query  352   ESKYVSGVNLIIDGGYSTTN  293
             E+KYVSG NL IDGG+S  N
Sbjct  247   EAKYVSGHNLFIDGGFSVCN  266



>gb|KDP36095.1| hypothetical protein JCGZ_08739 [Jatropha curcas]
Length=275

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 139/263 (53%), Positives = 183/263 (70%), Gaps = 6/263 (2%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL---FI  884
             KRL+GKVA+ITG A+GIG  TARLFA HG KV+IAD+ +K G S+++EI  E      +I
Sbjct  12    KRLQGKVALITGGASGIGEATARLFARHGAKVLIADVQNKLGQSLSEEIRSETGQPVSYI  71

Query  883   HCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGS  704
              CDV  E+ V+NAV+T VS +GKLDIM++NAG  G  D +IL    E+   V D N+ G+
Sbjct  72    QCDVTQETDVENAVNTAVSMHGKLDIMYNNAGIIGKFDPNILSLEREDFKSVMDINLYGA  131

Query  703   FFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGI  524
             F  AKHAARVM+P KKG+I+F+AS +   +G T   Y ASK A+VGL K+L VE+GKYGI
Sbjct  132   FLGAKHAARVMVPEKKGNILFTASVAAVTYGGTPLPYAASKHAVVGLTKNLAVELGKYGI  191

Query  523   RSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESK  344
             R NC+S A I T +   IM   D K  +E+     NLKGV +  +DVAEAALYL  +ESK
Sbjct  192   RVNCISPAGIPTPMAAKIMGA-DIKTVQEVSMAVANLKGVKIEADDVAEAALYLGSEESK  250

Query  343   YVSGVNLIIDGGYST--TNIGFQ  281
             +VSG+NL++DGG+S   ++ GF+
Sbjct  251   FVSGLNLVVDGGHSLRHSDFGFE  273



>ref|XP_003546632.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Glycine max]
Length=269

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 141/264 (53%), Positives = 181/264 (69%), Gaps = 6/264 (2%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             ++A  +RLEGKVAIITG A+G+GA TARLF+ HG  V+IADI D  G SVA+E+  E A 
Sbjct  7     VSAPFRRLEGKVAIITGGASGLGAATARLFSKHGAHVVIADIQDDLGLSVAKEL--ESAS  64

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             ++HCD   E+ V+N V+T VS+YGKLDIMF+NAG      TSI++ +  +   V   N+V
Sbjct  65    YVHCDATNENDVENCVNTAVSKYGKLDIMFNNAGIIDEIKTSIVDNSKSDFERVIGVNLV  124

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             G F   KHAARVMIPAKKG II +AS +    G  +H YT+SK A++GL K+  VE+G++
Sbjct  125   GPFLGTKHAARVMIPAKKGCIINTASVAGCIGGGATHAYTSSKHALIGLTKNTAVELGQH  184

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
             GIR NC+S  +++T L        + K+  EI +   NLKG  L   DVAEAALYLAGDE
Sbjct  185   GIRVNCLSPYLVVTPLSKKYFNIDEDKI-REIYS---NLKGAHLVPNDVAEAALYLAGDE  240

Query  349   SKYVSGVNLIIDGGYSTTNIGFQV  278
             SKYVSG NL+IDGGY+  N GF V
Sbjct  241   SKYVSGHNLVIDGGYTDVNAGFTV  264



>ref|XP_011006647.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=271

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 132/263 (50%), Positives = 180/263 (68%), Gaps = 4/263 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             +++A+L+RLEGKVA+ITG ++GIG + ARLFA HG KV+IAD+ D+ G+ V +E+  E A
Sbjct  6     LVSAALRRLEGKVALITGGSSGIGESAARLFAKHGAKVVIADVQDELGHFVCEELKNESA  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              F+HCDV  E  V+NAV+T VS++GKLDIMF+NAG A +   +IL+ +      V   N+
Sbjct  66    SFVHCDVTQEKDVENAVNTAVSKHGKLDIMFNNAGAADTPKPNILDNDKAEFEKVLSVNI  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             VG+F   KHAARVMIPA++GSII +AS      G+ SH YT+SK  ++GL ++  VE+G+
Sbjct  126   VGAFLGTKHAARVMIPARRGSIISTASVCGTIGGVASHAYTSSKHGVIGLMRNTAVELGQ  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +GIR NCVS  ++LT L        D     E+     NL+   L  ED+AEAAL+L  D
Sbjct  186   HGIRVNCVSPYVVLTPLVKDFFKLDDN----EVNRFYSNLREAVLKAEDIAEAALFLGSD  241

Query  352   ESKYVSGVNLIIDGGYSTTNIGF  284
             ESKYVSG NLI+DGG++  N GF
Sbjct  242   ESKYVSGHNLIVDGGFTIVNPGF  264



>ref|XP_004143392.1| PREDICTED: zerumbone synthase-like [Cucumis sativus]
Length=284

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 135/260 (52%), Positives = 177/260 (68%), Gaps = 2/260 (1%)
 Frame = -1

Query  1060  SLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-FI  884
             S KRL GKVA+ITGAA+G G +TARLF  HG +V++AD+ D     + +E+G E  + +I
Sbjct  7     SSKRLNGKVALITGAASGFGKSTARLFVQHGARVVLADVQDNLAQPLCKELGSEETVSYI  66

Query  883   HCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGS  704
             HCDV  +S V+ AVD  V RYGKLDIM++NAG  G  D +IL  N EN   VF+ NV G 
Sbjct  67    HCDVTRDSDVKEAVDFAVERYGKLDIMYNNAGITGQMDPTILGTNGENFKKVFEVNVYGG  126

Query  703   FFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGI  524
             F  AKHAARVMIP + G I+F++S ++   G + H Y  SK A+VGL ++LCVE+G++GI
Sbjct  127   FLGAKHAARVMIPNRSGVILFTSSVASVNSGESPHAYAMSKHAVVGLMRNLCVELGEFGI  186

Query  523   RSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESK  344
             R N VS   I T L  + +   +++L EE+V  +  LKGV  T EDVAEAALYL  DES+
Sbjct  187   RVNSVSPGAIATPLLRNALGFTEKEL-EEVVRSSAILKGVVATAEDVAEAALYLCSDESR  245

Query  343   YVSGVNLIIDGGYSTTNIGF  284
              +SG NL++DGGYST N  F
Sbjct  246   VISGHNLVVDGGYSTANRSF  265



>ref|XP_004170965.1| PREDICTED: zerumbone synthase-like, partial [Cucumis sativus]
Length=281

 Score =   220 bits (561),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 135/260 (52%), Positives = 177/260 (68%), Gaps = 2/260 (1%)
 Frame = -1

Query  1060  SLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-FI  884
             S KRL GKVA+ITGAA+G G +TARLF  HG +V++AD+ D     + +E+G E  + +I
Sbjct  7     SSKRLNGKVALITGAASGFGKSTARLFVQHGARVVLADVQDNLAQPLCKELGSEETVSYI  66

Query  883   HCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGS  704
             HCDV  +S V+ AVD  V RYGKLDIM++NAG  G  D +IL  N EN   VF+ NV G 
Sbjct  67    HCDVTRDSDVKEAVDFAVERYGKLDIMYNNAGITGQMDPTILGTNGENFKKVFEVNVYGG  126

Query  703   FFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGI  524
             F  AKHAARVMIP + G I+F++S ++   G + H Y  SK A+VGL ++LCVE+G++GI
Sbjct  127   FLGAKHAARVMIPNRSGVILFTSSVASVNSGESPHAYAMSKHAVVGLMRNLCVELGEFGI  186

Query  523   RSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESK  344
             R N VS   I T L  + +   +++L EE+V  +  LKGV  T EDVAEAALYL  DES+
Sbjct  187   RVNSVSPGAIATPLLRNALGFTEKEL-EEVVRSSAILKGVVATAEDVAEAALYLCSDESR  245

Query  343   YVSGVNLIIDGGYSTTNIGF  284
              +SG NL++DGGYST N  F
Sbjct  246   VISGHNLVVDGGYSTANRSF  265



>ref|XP_007206815.1| hypothetical protein PRUPE_ppa025923mg [Prunus persica]
 gb|EMJ08014.1| hypothetical protein PRUPE_ppa025923mg [Prunus persica]
Length=272

 Score =   220 bits (560),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 135/263 (51%), Positives = 176/263 (67%), Gaps = 4/263 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             ++AA+ +RLEGKVA+ITG A+GIG +TARLF+ HG KV+IAD+ D    SV +++ P   
Sbjct  8     LLAAAARRLEGKVALITGGASGIGESTARLFSKHGAKVVIADVQDDLAESVCRDLSPSPT  67

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
             LF+HCDV  E  V+NAV TT ++YG+LDIMF+NAG  G+   +IL+ +      V   N+
Sbjct  68    LFVHCDVTKEEDVENAVQTTTNKYGELDIMFNNAGIIGTNKPNILDNDKVEFEQVIRVNL  127

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             VG+F   KHAARVMIPA KGSII +AS  +   G  SH YT+SK  +VGL ++  VE+G+
Sbjct  128   VGAFLGIKHAARVMIPAGKGSIINTASVCSTIGGCASHAYTSSKHGLVGLVRNTAVELGQ  187

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +GIR NCVS   + TKL        D    + +     NLKG  L  ED+AEAALYL  D
Sbjct  188   HGIRVNCVSPYAVATKLAKEFFKIDD----DGVHGAYSNLKGRVLKAEDIAEAALYLGSD  243

Query  352   ESKYVSGVNLIIDGGYSTTNIGF  284
             ESKYVSG NL++DGGY+  N GF
Sbjct  244   ESKYVSGHNLLVDGGYTIMNAGF  266



>ref|XP_003540813.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Glycine max]
Length=271

 Score =   219 bits (559),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 143/265 (54%), Positives = 180/265 (68%), Gaps = 8/265 (3%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             ++A ++RLEGKVAIITG A+GIG  TARLF+ HG  V+IADI D  G S+ + +  E A 
Sbjct  7     VSAPIRRLEGKVAIITGGASGIGEATARLFSKHGAHVVIADIQDDLGLSLCKHL--ESAS  64

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             ++HCDV  E  V+N V+T VS+YGKLDIM +NAG      TSIL+ N  +   V   N+V
Sbjct  65    YVHCDVTKEEDVENCVNTAVSKYGKLDIMLNNAGICDEIKTSILDNNKSDFESVISVNLV  124

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             G F   KHAARVMI AK+GSII +AS +    G+ +H YT+SK A++GL KS  VE+G++
Sbjct  125   GPFLGTKHAARVMIAAKRGSIINTASVAGTLGGVATHAYTSSKHALIGLMKSTAVELGQF  184

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEA-PNLKGVSLTTEDVAEAALYLAGD  353
             GIR NCVS  ++ T L       +   + EE V E   NLKGV L   DVAEAALYLAGD
Sbjct  185   GIRVNCVSPYVVPTPL-----TKKHANIDEEGVREIYSNLKGVHLVPNDVAEAALYLAGD  239

Query  352   ESKYVSGVNLIIDGGYSTTNIGFQV  278
             ESKYVSG NL++DGGY+  NIGF V
Sbjct  240   ESKYVSGHNLVLDGGYTDVNIGFSV  264



>ref|XP_002272206.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=268

 Score =   219 bits (558),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 136/265 (51%), Positives = 178/265 (67%), Gaps = 5/265 (2%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIG-PEYA  893
             ++A+ +RL+GKVA+ITG A+GIG +TARLF+ HG KV+IADI D  G SV +E+  P  A
Sbjct  7     ISAAARRLQGKVALITGGASGIGESTARLFSRHGAKVVIADIQDNLGQSVCKELSSPTSA  66

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              F+HCDV  E  V+NA++  V++YGKLDIMF+NAG  G    +IL+ +      + + NV
Sbjct  67    SFVHCDVTSEKDVENAINVAVAKYGKLDIMFNNAGIVGESKPNILDNDKTEFEKILNVNV  126

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             VG+F   KHAARVMIPA  GSII +AS  +   G+ SH YT+SK A+VGL ++  VE+GK
Sbjct  127   VGAFLGTKHAARVMIPAGNGSIITTASVCSTVGGVASHAYTSSKHAVVGLARNAAVELGK  186

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             YGIR NCVS  +++T L        D   +        NLKG  L  EDVAEAALYLA +
Sbjct  187   YGIRVNCVSPYLVVTPLAKDFFKLDDDGAS----GVYSNLKGKVLNPEDVAEAALYLASE  242

Query  352   ESKYVSGVNLIIDGGYSTTNIGFQV  278
             ESKYVSG NL+IDGG++  N  F +
Sbjct  243   ESKYVSGHNLLIDGGFTIVNPAFGI  267



>ref|XP_002513332.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF48735.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=284

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 136/259 (53%), Positives = 179/259 (69%), Gaps = 6/259 (2%)
 Frame = -1

Query  1051  RLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-FIHCD  875
             RLEGKVA+ITG A+GIGA TA+LF  +G KV++AD+ D+ G+++ +++G E  + ++HCD
Sbjct  13    RLEGKVAVITGGASGIGAGTAKLFVRNGAKVVVADVQDELGHNLCKQLGSEDIISYVHCD  72

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V  +S ++NAVD  VS+YGKLDIMFSNAG AG  D +IL  + ++ N VF+ NV G F  
Sbjct  73    VTSDSDMKNAVDLAVSKYGKLDIMFSNAGIAGGMDNTILGTDNDDFNRVFEINVFGGFLA  132

Query  694   AKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSN  515
             AKHAARVMIPAKKGSI+F++S S A      H Y  SK A+ GL K+LC E+G+YGIR N
Sbjct  133   AKHAARVMIPAKKGSILFTSSNSAATCLCAPHPYATSKHALNGLAKNLCAELGQYGIRVN  192

Query  514   CVSA-----AIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
             C+S        +L   G++           + V+ A  LKG  L  EDVAEAA+YLA DE
Sbjct  193   CISPFGVITPFLLQSFGLTEANEMITNKIHQAVSSAAILKGEILEVEDVAEAAVYLASDE  252

Query  349   SKYVSGVNLIIDGGYSTTN  293
             SK+VSG+NL+IDGGYS  N
Sbjct  253   SKFVSGMNLVIDGGYSIAN  271



>ref|XP_006430117.1| hypothetical protein CICLE_v10012261mg [Citrus clementina]
 gb|ESR43357.1| hypothetical protein CICLE_v10012261mg [Citrus clementina]
Length=275

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 132/260 (51%), Positives = 177/260 (68%), Gaps = 1/260 (0%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             +++A  +RLEGKVA ITG A+GIGA TA++FA  G KV+IADI ++ G+SV + IG   +
Sbjct  6     VLSAITRRLEGKVAFITGGASGIGACTAKVFAQQGAKVVIADIQEQLGHSVVESIGTSNS  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              ++HCDV  ESH++NA+D TV+ +GKLDIMF+NAG  G+  T I++    +   V   NV
Sbjct  66    SYVHCDVTNESHIKNAIDQTVATHGKLDIMFNNAGIGGANKTRIIDNEKADFERVLSVNV  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
              G F   KHAARVMIPA+ GSI+ +AS S+      SH Y  +K A++GL K+  VE+G+
Sbjct  126   TGVFLGIKHAARVMIPARSGSILSTASVSSRVGAAASHAYCCAKHAVLGLTKNAAVELGQ  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +GIR NC+S   + T L  S +   D  L E  +  A NLKGV+L TED+A AALYLA D
Sbjct  186   FGIRVNCLSPYALATPLATSFVGITDEDL-EGFMNSAANLKGVTLRTEDIAYAALYLASD  244

Query  352   ESKYVSGVNLIIDGGYSTTN  293
             E+KYVSG NL IDGG++  N
Sbjct  245   EAKYVSGHNLFIDGGFTIVN  264



>ref|XP_010651860.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Vitis vinifera]
Length=288

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 137/257 (53%), Positives = 172/257 (67%), Gaps = 4/257 (2%)
 Frame = -1

Query  1048  LEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCDVR  869
             LEGKVA+ITG A+GIG +TARLF+ HG KV+IADI D  G SV +++ P  A F+HCDV 
Sbjct  35    LEGKVALITGGASGIGESTARLFSRHGAKVVIADIQDNLGLSVCKDLSPTSASFVHCDVT  94

Query  868   IESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFCAK  689
              E  V+NAV+  V+ +GKLDIMF+NAG AG     IL+ +      V + NVVG+F   K
Sbjct  95    NEKEVENAVNLAVATHGKLDIMFNNAGIAGEAKPHILDNDKTEFERVLNVNVVGAFLGTK  154

Query  688   HAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSNCV  509
             HAARVMIPA  GSII +AS  +   G  SH YT+SK A+VGL ++  VE+GKYGIR NCV
Sbjct  155   HAARVMIPAGNGSIITTASVCSTVGGGASHAYTSSKHAVVGLARNAAVELGKYGIRVNCV  214

Query  508   SAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVSGV  329
             S  ++ T L   +    D    + +     NLKG  L  EDVAEAALYLAGDESKYVSG 
Sbjct  215   SPYLVATPLAKDLFKLDD----DGVSGVYSNLKGKVLNAEDVAEAALYLAGDESKYVSGH  270

Query  328   NLIIDGGYSTTNIGFQV  278
             NL++DGG++  N  F +
Sbjct  271   NLLVDGGFTVVNPSFGI  287



>gb|KDP36171.1| hypothetical protein JCGZ_08815 [Jatropha curcas]
Length=276

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 131/269 (49%), Positives = 179/269 (67%), Gaps = 6/269 (2%)
 Frame = -1

Query  1069  MAASL-----KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIG  905
             MAAS      +RLEGKVA+ITG A+GIG  TA++FAHHG K++IAD+ D+ G +V+Q +G
Sbjct  1     MAASFISAVARRLEGKVALITGGASGIGECTAKVFAHHGAKIVIADVQDELGQAVSQALG  60

Query  904   PEYALFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVF  725
             P  + ++HC+V  E+H++NAVD  V+ YGKLDIMF+NAG        I++   E+   V 
Sbjct  61    PSNSTYVHCNVTNEAHIKNAVDKAVATYGKLDIMFNNAGIVDPNKPRIIDNEKEDFERVL  120

Query  724   DTNVVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCV  545
               NV G F   KHAARVMIPA+KGSII +AS S+      SH YT SK A++GL ++  +
Sbjct  121   SVNVTGVFLGIKHAARVMIPARKGSIICTASISSLVGAAASHAYTCSKHAVLGLTRNAAI  180

Query  544   EMGKYGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALY  365
             E+G++G+R NC+S   + T L    +   D  L E ++    +LKGV+L  EDVA AALY
Sbjct  181   ELGQFGVRVNCLSPYALATPLATKFVGLDDEGL-ENLMDSLASLKGVTLKAEDVANAALY  239

Query  364   LAGDESKYVSGVNLIIDGGYSTTNIGFQV  278
             LA DE +Y++G NL IDGG+S  N  FQ+
Sbjct  240   LASDEGRYINGHNLAIDGGFSIHNPSFQL  268



>gb|KHN21176.1| Momilactone A synthase [Glycine soja]
Length=269

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 142/265 (54%), Positives = 180/265 (68%), Gaps = 8/265 (3%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             ++A ++RLEGKVAIITG A+GIG  TARLF+ HG  ++IADI D  G S+ + +  E A 
Sbjct  7     VSAPIRRLEGKVAIITGGASGIGEATARLFSKHGAHLVIADIQDDLGLSLCKHL--ESAS  64

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             ++HCDV  E  V+N V+T VS+YGKLDIM +NAG      TSIL+ N  +   V   N+V
Sbjct  65    YVHCDVTKEEDVENCVNTAVSKYGKLDIMLNNAGICDEIKTSILDNNKSDFESVISVNLV  124

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             G F   KHAARVMI AK+GSII +AS +    G+ +H YT+SK A++GL KS  VE+G++
Sbjct  125   GPFLGTKHAARVMIAAKRGSIINTASVAGILGGVATHAYTSSKHALIGLMKSTAVELGQF  184

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEA-PNLKGVSLTTEDVAEAALYLAGD  353
             GIR NCVS  ++ T L       +   + EE V E   NLKGV L   DVAEAALYLAGD
Sbjct  185   GIRVNCVSPYVVPTPL-----TKKHANIDEEGVREIYSNLKGVHLVPNDVAEAALYLAGD  239

Query  352   ESKYVSGVNLIIDGGYSTTNIGFQV  278
             ESKYVSG NL++DGGY+  NIGF V
Sbjct  240   ESKYVSGHNLVLDGGYTDVNIGFSV  264



>gb|KDP36096.1| hypothetical protein JCGZ_08740 [Jatropha curcas]
Length=269

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 142/272 (52%), Positives = 175/272 (64%), Gaps = 14/272 (5%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEY--  896
             MA   KRL+GKVA+ITG A+GIG  TARLFA  G KV+I DI    G+SV+ +I  E   
Sbjct  1     MATLAKRLQGKVALITGGASGIGEATARLFARQGAKVVITDIQSDLGHSVSNQIESESNQ  60

Query  895   -ALFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDT  719
                +IHCDV  ES VQNAV+  VS +G LDIMF+NAG  G+ + SIL    E+   V D 
Sbjct  61    PVSYIHCDVSKESDVQNAVNAAVSMHGHLDIMFNNAGITGNYNPSILSIEREDFKKVMDI  120

Query  718   NVVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEM  539
             NV G    AKHAARVMIP KKG+I+F++S +   +G   H YT SK AIVGL K+L VE+
Sbjct  121   NVYGGLLGAKHAARVMIPEKKGAILFTSSVAAVTYGGVPHAYTTSKHAIVGLTKNLAVEL  180

Query  538   GKYGIRSNCVSAAIILTK-----LGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEA  374
             GKYGIR NC+S A + T      LGM      D K  EE      NLKGV +   D+AEA
Sbjct  181   GKYGIRVNCISPAAVATPSVVKALGM------DEKQIEEFNLAIANLKGVKVDANDMAEA  234

Query  373   ALYLAGDESKYVSGVNLIIDGGYSTTNIGFQV  278
             ALYLA  ESK+VSG+NL++DGG+S    G+ +
Sbjct  235   ALYLASGESKFVSGLNLVVDGGFSLRQSGYGI  266



>ref|XP_006481701.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Citrus sinensis]
Length=275

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 132/260 (51%), Positives = 176/260 (68%), Gaps = 1/260 (0%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             +++A  +RLEGKVA ITG A+GIGA TA++FA  G KV+IADI ++ G+SV + IG   +
Sbjct  6     VLSAITRRLEGKVAFITGGASGIGACTAKVFAQQGAKVVIADIQEELGHSVVESIGTSNS  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              ++HCDV  ESH++NA+D TV+ +GKLDIMF+NAG  G   T I++    +   V   NV
Sbjct  66    SYVHCDVTNESHIKNAIDQTVATHGKLDIMFNNAGIGGPNKTRIIDNEKADFERVLSVNV  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
              G F   KHAARVMIPA+ GSI+ +AS S+      SH Y  +K A++GL K+  VE+G+
Sbjct  126   TGVFLGIKHAARVMIPARSGSILSTASVSSRVGAAASHAYCCAKHAVLGLTKNAAVELGQ  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +GIR NC+S   + T L  S +   D  L E  +  A NLKGV+L TED+A AALYLA D
Sbjct  186   FGIRVNCLSPYALATPLATSFVGITDEDL-EGFMNSAANLKGVTLRTEDIAYAALYLASD  244

Query  352   ESKYVSGVNLIIDGGYSTTN  293
             E+KYVSG NL IDGG++  N
Sbjct  245   EAKYVSGHNLFIDGGFTIVN  264



>ref|XP_004136499.1| PREDICTED: zerumbone synthase-like [Cucumis sativus]
 ref|XP_004164969.1| PREDICTED: zerumbone synthase-like [Cucumis sativus]
 gb|KGN59173.1| hypothetical protein Csa_3G778290 [Cucumis sativus]
Length=273

 Score =   217 bits (553),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 129/255 (51%), Positives = 179/255 (70%), Gaps = 2/255 (1%)
 Frame = -1

Query  1057  LKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHC  878
             L+RLEGKVAIITG A+GIGA+  R+F  +G K+IIADI D+ G  +A E+G + + ++HC
Sbjct  10    LRRLEGKVAIITGGASGIGASAVRIFHENGAKIIIADIQDEVGQKIADELGEDVS-YLHC  68

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV  E  V N VD  V R+GKLDIM+SNAG      + IL+    +++ V   NV+G+F+
Sbjct  69    DVSKEEDVSNVVDAAVYRHGKLDIMYSNAGVIDRSFSGILDVTKSDLDKVLSVNVMGAFW  128

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AKHAARVMIP K G I+F++S++T   G++SH Y +SKCA++GL ++LCVE+G++GIR 
Sbjct  129   GAKHAARVMIPQKNGCILFTSSSTTNIAGLSSHPYASSKCAVLGLVRNLCVELGQHGIRV  188

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             NCV+  ++ T +     P Q   L E +V    NLKG  L  +D+A+AALYL  DE+KYV
Sbjct  189   NCVAPFVVATAIAGPRNPMQVEAL-ETMVTSWANLKGCVLKADDIAKAALYLVSDEAKYV  247

Query  337   SGVNLIIDGGYSTTN  293
             SG+NL++DGGYS  N
Sbjct  248   SGLNLVVDGGYSVVN  262



>ref|XP_002309406.1| putative short-chain alcohol dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE92929.1| putative short-chain alcohol dehydrogenase family protein [Populus 
trichocarpa]
Length=270

 Score =   216 bits (551),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 129/261 (49%), Positives = 175/261 (67%), Gaps = 1/261 (0%)
 Frame = -1

Query  1060  SLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIH  881
             S K LEGKVA+ITG A+GIG  TA++FAHHG KV++ADI D++G S+A+ +GP  + ++H
Sbjct  6     SFKWLEGKVALITGGASGIGECTAKVFAHHGAKVVVADIQDESGRSLAKALGPSNSTYVH  65

Query  880   CDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSF  701
             CDV  E+ V+NAV+  V+ YGKLDIMF+NAG A      I++    +   V  TNV G F
Sbjct  66    CDVTDEAQVKNAVNAAVTTYGKLDIMFNNAGIADESKARIIDNEKVDFERVLQTNVTGVF  125

Query  700   FCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIR  521
                KHAARVMIP + G+II +AS S+      SH Y  SK A++GL K+  VE+G++GIR
Sbjct  126   LGIKHAARVMIPGRNGTIISTASVSSKVGAAASHAYCCSKHAVLGLTKNAAVELGQFGIR  185

Query  520   SNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKY  341
              NC+S   + T L   ++   D +L E ++     LKGV+L  EDVA AALYLA DE++Y
Sbjct  186   VNCLSPYALATPLAKQVIGLDDEQL-ENLMHAFGTLKGVTLQAEDVANAALYLASDEARY  244

Query  340   VSGVNLIIDGGYSTTNIGFQV  278
             VSG NL IDGG++  N  F++
Sbjct  245   VSGHNLFIDGGFTIQNPSFRM  265



>gb|KDO35956.1| hypothetical protein CISIN_1g046809mg, partial [Citrus sinensis]
Length=269

 Score =   216 bits (551),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 133/259 (51%), Positives = 174/259 (67%), Gaps = 1/259 (0%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
              A+ L RLEGKVA ITG A+GIGA TA++FA  G KV+IADI ++ G+SV + IG   + 
Sbjct  1     FASGLCRLEGKVAFITGGASGIGACTAKVFAQQGAKVVIADIQEELGHSVVESIGTSNSS  60

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             ++HCDV  ESH++NA+D TV+ +GKLDIMF+NAG  G   T I++    +   V   NV 
Sbjct  61    YVHCDVTNESHIKNAIDQTVATHGKLDIMFNNAGIGGPNKTRIIDNEKADFERVLSVNVT  120

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             G F   KHAARVMIPA+ GSI+ +AS S+      SH Y  +K A++GL K+  VE+G++
Sbjct  121   GVFLGIKHAARVMIPARSGSILSTASVSSRVGAAASHAYCCAKHAVLGLTKNAAVELGQF  180

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
             GIR NC+S   + T L  S +   D  L E  +  A NLKGV+L TED+A AALYLA DE
Sbjct  181   GIRVNCLSPYALATPLATSFVGITDEDL-EGFMNSAANLKGVTLRTEDIAYAALYLASDE  239

Query  349   SKYVSGVNLIIDGGYSTTN  293
             +KYVSG NL IDGG++  N
Sbjct  240   AKYVSGHNLFIDGGFTIVN  258



>gb|AFK46966.1| unknown [Lotus japonicus]
Length=270

 Score =   216 bits (550),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 140/274 (51%), Positives = 182/274 (66%), Gaps = 13/274 (5%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             +++A+L+RLEGKVA+ITG A+GIG  TARLF+ HG +V+IADI D  G+SV +++  E A
Sbjct  6     LVSAALRRLEGKVALITGGASGIGEATARLFSKHGAQVVIADIQDDLGHSVCKDL--ESA  63

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              F+HC+V  E  V+ AV+  VS++GKLDIMF+NAG +G+ +TSIL         VF  NV
Sbjct  64    SFVHCNVTKEDEVETAVNMAVSKHGKLDIMFNNAGISGNNNTSILNNTKSEFEQVFSVNV  123

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
              G+F   KHAARVMIPA++GSII +AS S    G   H YT+SK A+VGL ++  VE+  
Sbjct  124   SGAFLGTKHAARVMIPARRGSIINTASTSGVIGGGAPHPYTSSKHAVVGLMRNTAVELEA  183

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAP----NLKGVSLTTEDVAEAALY  365
             YG+R NCVS   + T +  +       KL EE   E P    NLKG  L  EDVAEA LY
Sbjct  184   YGVRVNCVSPYFVPTPMVKNFF-----KLGEE--DEVPKFYSNLKGADLVPEDVAEAVLY  236

Query  364   LAGDESKYVSGVNLIIDGGYSTTNIGFQVAVEKV  263
             L  DESKYVSG NL++DGG++  N GF V  + V
Sbjct  237   LGSDESKYVSGHNLVVDGGFTVLNNGFCVFGQSV  270



>ref|XP_006430116.1| hypothetical protein CICLE_v10012261mg [Citrus clementina]
 gb|ESR43356.1| hypothetical protein CICLE_v10012261mg [Citrus clementina]
Length=312

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 133/259 (51%), Positives = 175/259 (68%), Gaps = 1/259 (0%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
              A+ L RLEGKVA ITG A+GIGA TA++FA  G KV+IADI ++ G+SV + IG   + 
Sbjct  44    FASGLCRLEGKVAFITGGASGIGACTAKVFAQQGAKVVIADIQEQLGHSVVESIGTSNSS  103

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             ++HCDV  ESH++NA+D TV+ +GKLDIMF+NAG  G+  T I++    +   V   NV 
Sbjct  104   YVHCDVTNESHIKNAIDQTVATHGKLDIMFNNAGIGGANKTRIIDNEKADFERVLSVNVT  163

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             G F   KHAARVMIPA+ GSI+ +AS S+      SH Y  +K A++GL K+  VE+G++
Sbjct  164   GVFLGIKHAARVMIPARSGSILSTASVSSRVGAAASHAYCCAKHAVLGLTKNAAVELGQF  223

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
             GIR NC+S   + T L  S +   D  L E  +  A NLKGV+L TED+A AALYLA DE
Sbjct  224   GIRVNCLSPYALATPLATSFVGITDEDL-EGFMNSAANLKGVTLRTEDIAYAALYLASDE  282

Query  349   SKYVSGVNLIIDGGYSTTN  293
             +KYVSG NL IDGG++  N
Sbjct  283   AKYVSGHNLFIDGGFTIVN  301



>ref|XP_007132471.1| hypothetical protein PHAVU_011G096800g [Phaseolus vulgaris]
 gb|ESW04465.1| hypothetical protein PHAVU_011G096800g [Phaseolus vulgaris]
Length=269

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 135/265 (51%), Positives = 179/265 (68%), Gaps = 6/265 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             +++A+ KRLEGKVA+ITG A+GIG  TARLF+ HG  V+IADI D  G S+++E+  E A
Sbjct  6     LISAAGKRLEGKVAMITGGASGIGEATARLFSKHGAHVVIADIQDHLGLSLSKEL--ESA  63

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              +IHCDV  E HV+NAV+T VS++GKLD MF+NAG  G+  TSIL+        V + N+
Sbjct  64    SYIHCDVTNEDHVENAVNTVVSKHGKLDTMFNNAGITGANKTSILDNTKSEFEAVINVNL  123

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             VG F   KHAARVMIPA +GSI+ +AS   +  G+ SH YT+SK  +VGL ++  VE+G 
Sbjct  124   VGVFLGTKHAARVMIPAGRGSIVNTASVCGSIGGVASHAYTSSKHGVVGLTRNTAVELGA  183

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +G+R NCVS  ++ T L  +     D+     +     NLKG  L  +DVAEAALYLA D
Sbjct  184   FGVRVNCVSPYVVATPLAKNFFKLDDKG----VHGVYTNLKGAVLEPKDVAEAALYLASD  239

Query  352   ESKYVSGVNLIIDGGYSTTNIGFQV  278
             ESKYVSG NL++DG ++  N GF V
Sbjct  240   ESKYVSGHNLVVDGAFTVVNNGFCV  264



>gb|KHN21177.1| Momilactone A synthase [Glycine soja]
Length=340

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 142/265 (54%), Positives = 180/265 (68%), Gaps = 8/265 (3%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             ++A ++RLEGKVAIITG A+GIG  TARLF+ HG  ++IADI D  G S+ + +  E A 
Sbjct  76    VSAHVRRLEGKVAIITGGASGIGEATARLFSKHGAHLVIADIQDDLGLSLCKHL--ESAS  133

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             ++HCDV  E  V+N V+T VS+YGKLDIM +NAG      TSIL+ N  +   V   N+V
Sbjct  134   YVHCDVTKEEDVENCVNTAVSKYGKLDIMLNNAGICDEIKTSILDNNKSDFESVISVNLV  193

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             G F   KHAARVMI AK+GSII +AS +    G+ +H YT+SK A++GL KS  VE+G++
Sbjct  194   GPFLGTKHAARVMIAAKRGSIINTASVAGTLGGVATHAYTSSKHALIGLMKSTAVELGQF  253

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEA-PNLKGVSLTTEDVAEAALYLAGD  353
             GIR NCVS  ++ T L       +   + EE V E   NLKGV L   DVAEAALYLAGD
Sbjct  254   GIRVNCVSPYVVPTPL-----TKKHANIDEEGVREIYSNLKGVHLVPNDVAEAALYLAGD  308

Query  352   ESKYVSGVNLIIDGGYSTTNIGFQV  278
             ESKYVSG NL++DGGY+  NIGF V
Sbjct  309   ESKYVSGHNLVLDGGYTDVNIGFSV  333



>gb|KDP36172.1| hypothetical protein JCGZ_08816 [Jatropha curcas]
Length=277

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 131/269 (49%), Positives = 178/269 (66%), Gaps = 6/269 (2%)
 Frame = -1

Query  1069  MAASL-----KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIG  905
             MAAS      +RLEGKVA+ITG A+GIG  TA++FAHHG K++IAD+ D+ G +V+Q +G
Sbjct  1     MAASFISAVARRLEGKVALITGGASGIGECTAKVFAHHGAKLVIADVQDELGQAVSQALG  60

Query  904   PEYALFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVF  725
             P  + ++HC+V  E+H++NAVD  V+ YGKLDIMF+NAG        I++   E+   V 
Sbjct  61    PSNSTYVHCNVTNEAHIKNAVDKAVATYGKLDIMFNNAGIVDPNKPRIIDNEKEDFERVL  120

Query  724   DTNVVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCV  545
               NV G F   KHAARVMIPA+KGSII +AS S+      SH YT SK A++GL ++  +
Sbjct  121   SVNVTGVFLGIKHAARVMIPARKGSIICTASISSLVGAAASHAYTCSKHAVLGLTRNAAI  180

Query  544   EMGKYGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALY  365
             E+G++G+R NC+S   + T L    +   D  L E ++    +LKGV+L  EDVA AALY
Sbjct  181   ELGQFGVRVNCLSPYALATPLATKFVGLDDEGL-ENLMDSLASLKGVTLKAEDVANAALY  239

Query  364   LAGDESKYVSGVNLIIDGGYSTTNIGFQV  278
             LA DE +Y++G NL IDGG S  N  FQ+
Sbjct  240   LASDEGRYINGHNLAIDGGISIHNPSFQM  268



>gb|ACU19531.1| unknown [Glycine max]
Length=269

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 140/264 (53%), Positives = 180/264 (68%), Gaps = 6/264 (2%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             ++A  +RLEGKVAIITG A+G+GA TARLF+ HG  V+IADI D  G SVA+E+  E A 
Sbjct  7     VSAPFRRLEGKVAIITGGASGLGAATARLFSKHGAHVVIADIQDDLGLSVAKEL--ESAS  64

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             ++HCDV  E  V+N V+T VS+YGKLDI+F+NAG      TSI++ +  +   V    +V
Sbjct  65    YVHCDVTNEIDVENCVNTAVSKYGKLDIIFNNAGIIDEIKTSIVDNSKSDFERVIGVILV  124

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             G F   KHAARVMIPAKKG II +AS +    G  +H YT+SK A++GL K+  VE+G++
Sbjct  125   GPFLGTKHAARVMIPAKKGCIINTASVAGCIGGGATHAYTSSKHALIGLTKNTAVELGQH  184

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
             GIR NC+S  +++T L        + K+  EI +   NLKG  L   DVAEAALYLAGDE
Sbjct  185   GIRVNCLSPYLVVTPLSKKYFNIDEDKI-REIYS---NLKGAHLVPNDVAEAALYLAGDE  240

Query  349   SKYVSGVNLIIDGGYSTTNIGFQV  278
             SKYVSG NL+IDGGY+  N GF V
Sbjct  241   SKYVSGHNLVIDGGYTDVNAGFTV  264



>ref|XP_006384778.1| hypothetical protein POPTR_0004s21020g [Populus trichocarpa]
 gb|ERP62575.1| hypothetical protein POPTR_0004s21020g [Populus trichocarpa]
Length=305

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 132/256 (52%), Positives = 174/256 (68%), Gaps = 4/256 (2%)
 Frame = -1

Query  1051  RLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCDV  872
             RLEGKVA+ITG ++GIG + ARLFA HG KV+IAD+ D+ G+SV +E+  E A F+HCDV
Sbjct  47    RLEGKVALITGGSSGIGESAARLFAKHGAKVVIADVQDELGHSVCEELKTESASFVHCDV  106

Query  871   RIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFCA  692
               E  V+NAV+T VS++GKLDIMF+NAG  G+   +IL+ +      V   NVVG+F   
Sbjct  107   TQEKDVENAVNTAVSKHGKLDIMFNNAGIVGTPKPNILDNDKAEFEKVISVNVVGAFLGT  166

Query  691   KHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSNC  512
             KHAARVMIP ++GSII +AS      G+ SH YT+SK  ++GL ++  VE+G++GIR NC
Sbjct  167   KHAARVMIPVRRGSIISTASVCGTIGGVASHAYTSSKHGVIGLMRNTAVELGQHGIRVNC  226

Query  511   VSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVSG  332
             VS  ++LT L        D    +E+     NLK   L  ED+AEAAL+L  DESKYVSG
Sbjct  227   VSPYVVLTPLVKDFFKLDD----DEVNRLYSNLKEAVLKAEDIAEAALFLGSDESKYVSG  282

Query  331   VNLIIDGGYSTTNIGF  284
              NLI+DGG++  N GF
Sbjct  283   HNLIVDGGFTIVNPGF  298



>gb|KEH29814.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=265

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 136/269 (51%), Positives = 176/269 (65%), Gaps = 4/269 (1%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             M  S  RLEGKVA+ITG A+GIG  TARLF+ HG +V+IADI D  G+S+ +E+    + 
Sbjct  1     MLNSFTRLEGKVALITGGASGIGEATARLFSEHGAQVVIADIQDDKGHSICKELQKSSSS  60

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             ++ CDV  E  ++NAV+TTV +YGKLDIMF+NAG +G   T ILE  L     V   N+ 
Sbjct  61    YVRCDVTKEEDIENAVNTTVFKYGKLDIMFNNAGISGVNKTKILENKLSEFEDVIKVNLT  120

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             G F   KHAARVMIPA++GSII +AS   +  G   H YT+SK A+VGL ++  +E+G +
Sbjct  121   GVFLGTKHAARVMIPARRGSIINTASVGGSIGGCAPHAYTSSKHAVVGLMRNTAIELGPF  180

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
             GIR NCVS   + T +  +     D   A +I +   NLKG +L  +DVAEAALYL  DE
Sbjct  181   GIRVNCVSPYFLATPMVTNFFKLDDGG-ALDIFS---NLKGTNLVPKDVAEAALYLGSDE  236

Query  349   SKYVSGVNLIIDGGYSTTNIGFQVAVEKV  263
             SKYVSG+NL+IDGG S  N GF V  + V
Sbjct  237   SKYVSGLNLVIDGGVSVANNGFCVFEQSV  265



>ref|XP_009802753.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
sylvestris]
 ref|XP_009802755.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
sylvestris]
Length=276

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 127/255 (50%), Positives = 177/255 (69%), Gaps = 2/255 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIG-PEYALFIHC  878
             KRLEGKVAI+TG A+GIG  TA+LF+ HG KV+IAD+ D+  NSV+  +G P ++++IHC
Sbjct  12    KRLEGKVAIVTGGASGIGEATAKLFSEHGAKVVIADVQDERSNSVSNALGSPSHSIYIHC  71

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV  E HVQNAVD T+S +GKLDI+  NAG +      I++   E+   V   NV G F 
Sbjct  72    DVTNEDHVQNAVDRTISTFGKLDIIICNAGISDETKPRIIDNTKEDFERVLSINVTGVFL  131

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
             C KHAARVM+PA+ G II +AS S+      SH Y +SK A++GL K+L VE+G++GIR 
Sbjct  132   CMKHAARVMVPARSGCIISTASVSSRVGAAASHAYCSSKHAVLGLTKNLAVELGQFGIRV  191

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             NC+S   ++T L   ++  ++ ++ E  ++ A NLKG  L  +DVA+AAL+LAG++SKY+
Sbjct  192   NCLSPYAMVTPLATKVVGLEN-EMFETALSMAGNLKGAILRVDDVAKAALFLAGEDSKYI  250

Query  337   SGVNLIIDGGYSTTN  293
             SG NL IDGG++  N
Sbjct  251   SGHNLFIDGGFTVYN  265



>ref|XP_003540812.1| PREDICTED: secoisolariciresinol dehydrogenase [Glycine max]
Length=269

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 136/265 (51%), Positives = 179/265 (68%), Gaps = 6/265 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             +++A+ +RLEGKVAIITG A+GIG  TARLF+ HG  V+IADI D  G S+ + +  E A
Sbjct  6     LVSATGRRLEGKVAIITGGASGIGEATARLFSKHGAHVVIADIQDDLGLSICKHL--ESA  63

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              ++HCDV  E+ V+N V+TTVS++GKLDIMF+NAG  G   TSIL+        V + N+
Sbjct  64    SYVHCDVTNETDVENCVNTTVSKHGKLDIMFNNAGITGVNKTSILDNTKSEFEEVINVNL  123

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             VG F   KHAARVMIPA++GSI+ +AS   +  G+ SH YT+SK A+VGL K+  VE+G 
Sbjct  124   VGVFLGTKHAARVMIPARRGSIVNTASVCGSIGGVASHAYTSSKHAVVGLTKNTAVELGA  183

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +G+R NCVS  ++ T L  +     D    + +     NLKG  L   DVAEAALYLA D
Sbjct  184   FGVRVNCVSPYVVATPLAKNFFKLDD----DGVQGIYSNLKGTDLVPNDVAEAALYLASD  239

Query  352   ESKYVSGVNLIIDGGYSTTNIGFQV  278
             ESKYVSG NL++DGG++  N GF V
Sbjct  240   ESKYVSGHNLVVDGGFTVVNSGFCV  264



>ref|XP_011043649.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=276

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 127/259 (49%), Positives = 172/259 (66%), Gaps = 0/259 (0%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             KRL+GKVA+ITG A+GIG  TA++F+HHG KVIIADI D+ G+SV + +GP  + ++ CD
Sbjct  12    KRLQGKVALITGGASGIGECTAKVFSHHGAKVIIADIQDELGHSVVEALGPSNSTYVRCD  71

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V  E+ ++N VDT +S YGKLDIM +NAG A    + I++  + +   V   NV G F  
Sbjct  72    VTEEAQIKNVVDTAISTYGKLDIMLNNAGIADDNKSRIIDNEMADFERVLKINVTGVFLG  131

Query  694   AKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSN  515
              KHAARVMIPA+ G+II +AS S+      SH Y  SK A++GL ++   E+G++GIR N
Sbjct  132   IKHAARVMIPARSGTIISTASVSSLLGAAASHAYCCSKHAVLGLTRNAAAELGQFGIRVN  191

Query  514   CVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVS  335
             C+S   + T L    +   D +  E  +    NLKGV+L TEDVA AALYLA DE++Y+S
Sbjct  192   CLSPYALATPLARKFIGVDDDEALEIAMNSFANLKGVTLKTEDVANAALYLASDEARYIS  251

Query  334   GVNLIIDGGYSTTNIGFQV  278
             G NL IDGG+S  N  FQ+
Sbjct  252   GHNLFIDGGFSVQNPTFQM  270



>ref|XP_008230130.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Prunus mume]
Length=272

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 132/263 (50%), Positives = 174/263 (66%), Gaps = 4/263 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             ++AA+ +RLEGKVA+ITG A+GIG +TARLF+ HG KV+IAD+ D    SV +++ P   
Sbjct  8     LLAAAARRLEGKVALITGGASGIGESTARLFSKHGAKVVIADVQDDFAESVCRDLSPSST  67

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              F+HCDV  E  V+NAV T  ++YG+LDIMF+NAG  G+   +IL+ +      V   N+
Sbjct  68    SFVHCDVTKEEDVENAVQTATNKYGELDIMFNNAGIIGTNKPNILDNDRVEFEQVIRVNL  127

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             VG+F   KHAARVMIPA KGSII +AS  +   G  SH YT+SK  +VGL ++  VE+G+
Sbjct  128   VGAFLGIKHAARVMIPAGKGSIINTASVCSTIGGCASHAYTSSKHGLVGLVRNTAVELGQ  187

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +GIR NCVS  ++ T L        D    + +     NLKG  L  ED+AEAALYL  D
Sbjct  188   HGIRVNCVSPYVVPTPLAKEFFKLDD----DGVHGAYSNLKGGVLRAEDIAEAALYLGSD  243

Query  352   ESKYVSGVNLIIDGGYSTTNIGF  284
             ESKYVSG NL++DGGY+  N GF
Sbjct  244   ESKYVSGHNLLVDGGYTIVNAGF  266



>ref|XP_008229671.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Prunus mume]
Length=272

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 132/263 (50%), Positives = 170/263 (65%), Gaps = 4/263 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             ++AA+ +RLEGKVA+ITG A+GIG + ARLF+ HG KV+IAD+ D    SV +++ P   
Sbjct  8     LLAAAARRLEGKVAVITGGASGIGESAARLFSKHGAKVVIADVQDDLAESVCRDLSPSST  67

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              F+HCDV  E  V+NAV T  ++YGKLDIMF+NAG  G    +IL+ +      V   N+
Sbjct  68    SFVHCDVTKEEDVENAVKTATNKYGKLDIMFNNAGVVGMTKPNILDNDKVEFEQVIRVNL  127

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             VG+F   KHAARVMIPA KGSII +AS  +   G   H YT+SK  +VGL ++  VE+G+
Sbjct  128   VGAFLGIKHAARVMIPAGKGSIINTASVCSTIGGCAPHAYTSSKHGLVGLVRNTAVELGQ  187

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +GIR NCVS  I+ T L        D KL         NLKG  L  ED+ EAALYL  D
Sbjct  188   HGIRVNCVSPYIVSTPLAKEFFKLDDDKLH----GAYSNLKGGVLKAEDIVEAALYLGSD  243

Query  352   ESKYVSGVNLIIDGGYSTTNIGF  284
             ESKYVSG NL++DGG++  N GF
Sbjct  244   ESKYVSGHNLLVDGGFTIVNAGF  266



>ref|XP_003538100.1| PREDICTED: secoisolariciresinol dehydrogenase [Glycine max]
 gb|KHN08820.1| Momilactone A synthase [Glycine soja]
Length=269

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 135/259 (52%), Positives = 175/259 (68%), Gaps = 6/259 (2%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             +RLEGKVA+I+G A+GIG  TARLF+ HG  V+IADI D  G S+ + +  E A ++HCD
Sbjct  12    RRLEGKVALISGGASGIGEATARLFSKHGAHVVIADIQDDLGLSLCKHL--ESASYVHCD  69

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V  E+ VQNAV+T +S+YG LDIMF+NAG      TSIL+ +  +   V   N+VG F  
Sbjct  70    VTNENDVQNAVNTAISKYGNLDIMFNNAGIIDEIKTSILDNSKFDFERVISVNLVGPFLG  129

Query  694   AKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSN  515
              KHAARVMIPAK+GSII +AS +    G  SH YT+SK A++GL K+  VE+G++GIR N
Sbjct  130   TKHAARVMIPAKRGSIINTASVAGTFSGGASHAYTSSKHALIGLMKNTAVELGQFGIRVN  189

Query  514   CVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVS  335
             C+S  ++ T L        + +  E       NLKGV L   DVAEAALYLAGDESKYVS
Sbjct  190   CLSPYVVATPLTKKCFNLDEDRNGEIY----SNLKGVHLVPNDVAEAALYLAGDESKYVS  245

Query  334   GVNLIIDGGYSTTNIGFQV  278
             G NL++DGG++  N+GF V
Sbjct  246   GHNLVLDGGFTNLNVGFSV  264



>ref|XP_011043647.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=281

 Score =   215 bits (547),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 145/274 (53%), Positives = 181/274 (66%), Gaps = 3/274 (1%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             I  A  KRLEGKVA+ITG A+GIG  TA+LF  HG KV+IADI D  G  V++ +G +  
Sbjct  7     ITLACSKRLEGKVALITGGASGIGECTAKLFVLHGAKVVIADIQDDLGEMVSKNLGSQET  66

Query  892   L-FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGS-RDTSILEANLENINLVFDT  719
             + +IHCDV  +S V+ AVD  VS+YGKLDIMF+NAG  G+ +   IL+   E    V D 
Sbjct  67    ISYIHCDVTCDSDVKKAVDMAVSKYGKLDIMFNNAGVIGTCKAPRILDVENEEFKRVLDV  126

Query  718   NVVGSFFCAKHAARVMIPAKKgsiifsasastaa-fgitSHTYTASKCAIVGLCKSLCVE  542
             N+ G+F  AKHAARVMIPAKKG I+F+ S  TA   G T H Y ASK A+VGL K+L VE
Sbjct  127   NLFGAFLGAKHAARVMIPAKKGCILFTGSVITATCTGATPHPYFASKHAVVGLAKNLAVE  186

Query  541   MGKYGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYL  362
             +G +GIR NC+S     T L    M  + RK+ E I + +  LK V L  ED+A AA+YL
Sbjct  187   LGGHGIRVNCISPFATATPLITESMGIEKRKIEEFISSSSAILKEVLLEPEDIANAAVYL  246

Query  361   AGDESKYVSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             A DESKYVSG+NL+IDGGYS  N     AV+ +L
Sbjct  247   ASDESKYVSGINLVIDGGYSLINPTLPSAVKSLL  280



>gb|AFK35915.1| unknown [Medicago truncatula]
Length=272

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 132/270 (49%), Positives = 182/270 (67%), Gaps = 3/270 (1%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             +++ +L+RLEGKVA+ITG A+GIG  TARLF+ HG +V+IADI D  G+S+ +E+    +
Sbjct  6     LVSNALRRLEGKVALITGGASGIGEATARLFSEHGAQVVIADIQDDKGHSICKELQKSSS  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              ++ CDV  E  ++NAV+TTV +YGKLDIMF+NAG +G   T ILE  L     V   N+
Sbjct  66    SYVRCDVTKEEDIENAVNTTVFKYGKLDIMFNNAGISGVNKTKILENKLSEFEDVIKVNL  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
              G F   KHA+RVMIPA++GSII +AS   +  G+  H YT++K A+VGL ++  +E+G+
Sbjct  126   TGVFLGTKHASRVMIPARRGSIINTASVCGSIGGVAPHAYTSAKHAVVGLMRNTAIELGR  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +GIR NCVS  I+ T L   +         ++++    NLKG +L  +DVAEAALYL  D
Sbjct  186   FGIRVNCVSPYIVATPL---VKKYFKLDDDDDVLDVYSNLKGANLVPKDVAEAALYLGSD  242

Query  352   ESKYVSGVNLIIDGGYSTTNIGFQVAVEKV  263
             ESKYVSG NL+IDGG++  N GF V  E V
Sbjct  243   ESKYVSGHNLVIDGGFTVVNNGFCVFGESV  272



>ref|XP_009420509.1| PREDICTED: momilactone A synthase-like [Musa acuminata subsp. 
malaccensis]
Length=266

 Score =   214 bits (545),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 129/259 (50%), Positives = 171/259 (66%), Gaps = 1/259 (0%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             + +S KRLEGKVA+ITG A+GIG +TA+LF  +G +V+IADI D  G ++   +G   A 
Sbjct  8     LPSSAKRLEGKVAVITGGASGIGESTAKLFVRYGARVVIADIQDDKGRALCDLLGTADAC  67

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             ++HCDV  ES ++NAVDT V+R+GKLDIMFSNAGT       + +++      V   NVV
Sbjct  68    YVHCDVTDESDMRNAVDTAVARFGKLDIMFSNAGTLREFGKGLADSDKAEFERVMAVNVV  127

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             G+F   KHAARVM PA++GSI+ + S ++   G+   +Y  SK A+VGL KS   E+G +
Sbjct  128   GAFLATKHAARVMAPARRGSIVITGSTASVLGGVVPLSYVCSKHAVVGLMKSAAAELGAH  187

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
             G+R NCVS   ++T L M +M   D    E  V  + NLKGV  T EDVAEA  YL GDE
Sbjct  188   GVRVNCVSPHGVMTPLMMGVM-GMDEAATEAFVERSANLKGVKATAEDVAEAVAYLGGDE  246

Query  349   SKYVSGVNLIIDGGYSTTN  293
             S+YVSG NL++DGGYS T 
Sbjct  247   SRYVSGANLMVDGGYSVTK  265



>ref|XP_007162946.1| hypothetical protein PHAVU_001G193500g [Phaseolus vulgaris]
 gb|ESW34940.1| hypothetical protein PHAVU_001G193500g [Phaseolus vulgaris]
Length=279

 Score =   214 bits (546),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 187/263 (71%), Gaps = 2/263 (1%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             MA+ +KRLEGKVAIITG A+GIGA+TA+LF  HG KVIIAD+ D  G+S+ +       +
Sbjct  1     MASLVKRLEGKVAIITGGASGIGASTAKLFLQHGAKVIIADVQDALGHSLCKTFSTNTPI  60

Query  889   -FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              ++HCDV  +S ++N V+  +++YGKLDIM++NAG +G  + SI+ ++ E    VF+ NV
Sbjct  61    HYLHCDVTSDSDIKNVVEVAITKYGKLDIMYNNAGISGDSNRSIVTSDEEEFKRVFEVNV  120

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
              G+F  +KHAAR M+PAK+G I+F++S ++   G T+H Y  SK A+VGL K+LCVE+G+
Sbjct  121   YGAFLGSKHAARFMVPAKRGVILFTSSVASILGGETTHAYAVSKHAVVGLMKNLCVELGQ  180

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +GIR NCV    + T + ++     ++K  +E++ +   LKG  L  ED+A+AA+YL  D
Sbjct  181   HGIRVNCVCPGGVPTPM-LNKALKMNKKETQEVLCKVAVLKGTVLEAEDIAKAAVYLCSD  239

Query  352   ESKYVSGVNLIIDGGYSTTNIGF  284
             E+K+VSGVN ++DGGYSTTN+ F
Sbjct  240   EAKFVSGVNFVLDGGYSTTNMSF  262



>ref|XP_002523206.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF39237.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=270

 Score =   214 bits (545),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 175/265 (66%), Gaps = 4/265 (2%)
 Frame = -1

Query  1078  QLIMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPE  899
              L++  + +RLEGKVA+ITGAA  IG   AR F  HG KV+IADI D  G SVA++ G +
Sbjct  4     NLLLPPAARRLEGKVALITGAATSIGECIARSFCKHGAKVVIADIQDDLGQSVAKDHGQD  63

Query  898   YALFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDT  719
              A+F+HCDV +ES V+NAVDT VS +GKLDIM +NA T   R  SI++ +L ++      
Sbjct  64    VAMFVHCDVSVESDVKNAVDTAVSIFGKLDIMVNNAATGEPRKPSIVDNDLADVERALRV  123

Query  718   NVVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEM  539
             N++G F   KHAARVMIPA++GSII   S  ++  G+ SH+YT +K  IVGL ++   E+
Sbjct  124   NLIGPFLGTKHAARVMIPARQGSIITLGSVCSSVGGVASHSYTIAKHGIVGLARNAAAEL  183

Query  538   GKYGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLA  359
             G++GIR N +S   I T L M +   ++   +        NL+GV L  EDVAEAA+YLA
Sbjct  184   GRFGIRVNYLSPYFIETPLSMKLFEEEEDGRS----GVYSNLEGVKLKQEDVAEAAIYLA  239

Query  358   GDESKYVSGVNLIIDGGYSTTNIGF  284
              DESK+VSG NL +DGG++T N  F
Sbjct  240   SDESKFVSGHNLALDGGFTTINPAF  264



>ref|XP_009618318.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
tomentosiformis]
Length=290

 Score =   214 bits (546),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 126/255 (49%), Positives = 177/255 (69%), Gaps = 2/255 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIG-PEYALFIHC  878
             KRLEGKVAI+TG A+GIG  TA+LF+ HG KV+IAD+ D+ GNSV+  +G P ++++IHC
Sbjct  26    KRLEGKVAIVTGGASGIGEATAKLFSEHGAKVVIADVQDELGNSVSNALGSPSHSIYIHC  85

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV  E HVQNAVD T+S +GKLDIM  NAG +      I++   E+   V   NV G F 
Sbjct  86    DVTNEDHVQNAVDRTISTFGKLDIMICNAGISDETKPRIIDNMKEDFERVLSINVTGVFL  145

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
               KHAARVM+P + G II +AS S+      SH Y +SK A++GL K+L VE+G++GIR 
Sbjct  146   SMKHAARVMVPTRSGCIISTASVSSRVGAAASHAYCSSKHAVLGLTKNLAVELGQFGIRV  205

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             NC+S   ++T L + ++  ++    E+ ++ A NL+GV+L  +DVA+AAL+LA D++KY+
Sbjct  206   NCLSPYAMVTPLAVKVVGLENEAF-EKALSSAGNLQGVTLKVDDVAKAALFLASDDAKYI  264

Query  337   SGVNLIIDGGYSTTN  293
             SG NL IDGG++  N
Sbjct  265   SGHNLFIDGGFTVYN  279



>gb|KDP36097.1| hypothetical protein JCGZ_08741 [Jatropha curcas]
Length=273

 Score =   214 bits (544),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 138/264 (52%), Positives = 176/264 (67%), Gaps = 15/264 (6%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA-  893
             +A   KRLEGKVA+ITG A+GIG +TARLFAHHG KV+IADI  + G+SVA++I  E   
Sbjct  7     LAPITKRLEGKVALITGGASGIGESTARLFAHHGAKVVIADIQSELGHSVAEKIRSETGQ  66

Query  892   --LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDT  719
               +++ C+V  E+ V+NA++ TVS YGKLDIMF+NAG AGS + SI  A  E+   V + 
Sbjct  67    PVIYVDCNVVNETEVENAINKTVSVYGKLDIMFNNAGIAGSLNASISSAEREDFMRVLEV  126

Query  718   NVVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEM  539
             NV G    AKHAARVMIP KK   I   ++  +A     H YTASK A+VGL K+L VE+
Sbjct  127   NVYGGVLGAKHAARVMIPRKK-GCILFTASLASALYGAQHAYTASKHAVVGLTKNLAVEL  185

Query  538   GKYGIRSNCVSA-----AIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEA  374
             G+YGIR NC+S      A+I   LG+      D K  +E  +E  NLK V L  +DVAEA
Sbjct  186   GQYGIRVNCISPGPVPTALITKPLGL------DAKQVQEWGSEMANLKEVKLDADDVAEA  239

Query  373   ALYLAGDESKYVSGVNLIIDGGYS  302
             ALYLA D+SK+VSG+NL +DG  S
Sbjct  240   ALYLASDDSKFVSGLNLFVDGAAS  263



>gb|KEH29815.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=266

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 133/269 (49%), Positives = 178/269 (66%), Gaps = 3/269 (1%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             M  S  RLEGKVA+ITG A+GIG  TARLF+ HG +V+IADI D  G+S+ +E+    + 
Sbjct  1     MLNSFTRLEGKVALITGGASGIGEATARLFSEHGAQVVIADIQDDKGHSICKELQKSSSS  60

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             ++ CDV  E  ++NAV+TTV +YGKLDIMF+NAG +G   T ILE  L     V   N+ 
Sbjct  61    YVRCDVTKEEDIENAVNTTVFKYGKLDIMFNNAGISGVNKTKILENKLSEFEDVIKVNLT  120

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             G F   KHA+RVMIPA++GSII +AS   +  G+  H YT++K A+VGL ++  +E+G++
Sbjct  121   GVFLGTKHASRVMIPARRGSIINTASVCGSIGGVAPHAYTSAKHAVVGLMRNTAIELGRF  180

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
             GIR NCVS  I+ T L   +         ++++    NLKG +L  +DVAEAALYL  DE
Sbjct  181   GIRVNCVSPYIVATPL---VKKYFKLDDDDDVLDVYSNLKGANLVPKDVAEAALYLGSDE  237

Query  349   SKYVSGVNLIIDGGYSTTNIGFQVAVEKV  263
             SKYVSG NL+IDGG++  N GF V  E V
Sbjct  238   SKYVSGHNLVIDGGFTVVNNGFCVFGESV  266



>ref|XP_010917565.1| PREDICTED: momilactone A synthase-like isoform X1 [Elaeis guineensis]
Length=272

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 131/260 (50%), Positives = 180/260 (69%), Gaps = 1/260 (0%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             ++ ++  RLEGKVA+ITG A+GIG  TA+LF  HG +V+IADI D  G ++ + +G   A
Sbjct  6     VLTSAAGRLEGKVALITGGASGIGEATAKLFTRHGARVMIADIQDDKGRALCESLGSAVA  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              ++HCDV  ESHV++AVD  VSR+GKLDIMF+NAG AGS    I E+   +   V   N+
Sbjct  66    SYVHCDVTDESHVRDAVDAAVSRHGKLDIMFNNAGIAGSLCMQIRESEKADFERVMGINL  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             VGS+   KHAARVMIPA++GSI+ + S ++AA GI S  YT SK A+VGL +S  VE+G+
Sbjct  126   VGSYLGTKHAARVMIPARRGSIVMTGSVASAAPGIGSAAYTCSKPAVVGLMRSAAVELGQ  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +G+R NCVS   + T L  +       ++ EE + +   LKGV L  EDVAEA L+L  +
Sbjct  186   FGVRVNCVSPYGVATPLATTSFGIGVEEV-EEFMHKHAILKGVRLKVEDVAEAVLFLGSE  244

Query  352   ESKYVSGVNLIIDGGYSTTN  293
             E++YVSGVNL++DGG++TTN
Sbjct  245   EARYVSGVNLLVDGGFTTTN  264



>gb|AHH81852.1| short-chain alcohol dehydrogenase [Perilla citriodora]
 gb|AHH81854.1| short-chain alcohol dehydrogenase [Perilla citriodora]
Length=277

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 128/259 (49%), Positives = 174/259 (67%), Gaps = 1/259 (0%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             +RLEGKVA+ITG A GIG +TA+LF+ HG KV I D+ D+ G+SV ++IGP  + +IHCD
Sbjct  12    RRLEGKVALITGGAAGIGESTAKLFSKHGAKVAIVDVHDELGHSVIKQIGPSNSTYIHCD  71

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V  E  V+NAVD TVS YGKLDIMF+NAG A      I++    +   V   NV G F  
Sbjct  72    VTNEDDVRNAVDKTVSTYGKLDIMFNNAGIADQPKLRIVDNEKHDFERVLAVNVTGVFLG  131

Query  694   AKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSN  515
              KHAARVMIPA+ G+II +AS ++   G  +H YT SK A+VGL ++  +E+G+YGIR N
Sbjct  132   MKHAARVMIPARGGAIISTASIASGMGGAATHAYTCSKHAVVGLTRNSAIELGQYGIRVN  191

Query  514   CVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVS  335
             C+S   + + L    +  +D +L E ++ +  NLKG +L  +D+A AAL+LA D++KYVS
Sbjct  192   CMSPYALASDLSRKYLGIEDEEL-ERMMNDKANLKGTTLKADDIANAALFLASDDAKYVS  250

Query  334   GVNLIIDGGYSTTNIGFQV  278
             G NL IDGG++  N   QV
Sbjct  251   GQNLFIDGGFTIFNSAMQV  269



>ref|XP_007132474.1| hypothetical protein PHAVU_011G097100g [Phaseolus vulgaris]
 gb|ESW04468.1| hypothetical protein PHAVU_011G097100g [Phaseolus vulgaris]
Length=268

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 140/267 (52%), Positives = 179/267 (67%), Gaps = 8/267 (3%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             +++A++KRLEGKVAIITG A+GIG  TARLF+ HG  V+IADI D  G S+  E+  E A
Sbjct  6     VVSAAVKRLEGKVAIITGGASGIGEATARLFSEHGAHVVIADIQDDLGLSLCNEL--ESA  63

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
             +++HCDV  E  V+  V+  VS+YGKLDI+ +NAGT      SI+E +  +   V + N+
Sbjct  64    VYVHCDVTKEEDVEKCVNVAVSKYGKLDIVLNNAGTCDEFKRSIVENSKCDFERVINVNL  123

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             VG F   KHAARVMIPAK+G II ++S +    G   H YT SK  +VGL K+  VE+G+
Sbjct  124   VGPFLGTKHAARVMIPAKRGCIINTSSVAGCIGGGAPHAYTISKHGLVGLTKNTAVELGQ  183

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEA-PNLKGVSLTTEDVAEAALYLAG  356
             +GIR NCVS  ++ T L       +   L EE V EA  NLKG  L   DVAEAALYLAG
Sbjct  184   FGIRVNCVSPYVVATPL-----LNKYFNLDEEGVREAYSNLKGSYLVPNDVAEAALYLAG  238

Query  355   DESKYVSGVNLIIDGGYSTTNIGFQVA  275
             DESK+VSG NL+IDGG++TTN GF V 
Sbjct  239   DESKFVSGHNLVIDGGFTTTNAGFSVG  265



>gb|AHH81851.1| short-chain alcohol dehydrogenase [Perilla citriodora]
Length=275

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 129/262 (49%), Positives = 175/262 (67%), Gaps = 1/262 (0%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             +RLEGKVA+ITG ANGIG   A+LF+ HG KV+IADI D+ G +V ++IGPE + ++HCD
Sbjct  12    RRLEGKVALITGGANGIGECAAKLFSKHGAKVVIADIQDQLGEAVVRQIGPENSTYVHCD  71

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V  E+ V+NAVD  VS YGKLDIM++NA T       I++   ++   V   NV G F  
Sbjct  72    VTDENDVRNAVDKAVSTYGKLDIMYNNAATIDFGAHPIVDNEKKDFERVMAVNVTGVFLG  131

Query  694   AKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSN  515
              KHAARVMIP ++G II +AS +    G  +H YT SK A++GL K+L +E+G+YGIR N
Sbjct  132   MKHAARVMIPVRRGVIISTASIAGHLGGTATHAYTCSKHAVIGLSKNLAIELGQYGIRVN  191

Query  514   CVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVS  335
             CVS   + TKL    +   D +L E++  +  NL+G +L  +D+A AAL+LA D++KYVS
Sbjct  192   CVSPYALATKLSKKYLKL-DHELFEKMSHDKGNLQGATLKPDDIANAALFLASDDAKYVS  250

Query  334   GVNLIIDGGYSTTNIGFQVAVE  269
             G NL IDGG++  N   QV  E
Sbjct  251   GQNLFIDGGFTVFNSAMQVFKE  272



>ref|XP_011094346.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Sesamum indicum]
Length=268

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 134/255 (53%), Positives = 178/255 (70%), Gaps = 4/255 (2%)
 Frame = -1

Query  1051  RLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCDV  872
             RLEGKVA+ITG A GIG  TA+LFA HG KVIIADI D+ G+++ +E  P  + ++HCDV
Sbjct  4     RLEGKVALITGGARGIGEATAKLFAKHGAKVIIADIQDERGHAICKEF-PSIS-YVHCDV  61

Query  871   RIESHVQNAVDTTVSRYGKLDIMFSNAG-TAGSRDTSILEANLENINLVFDTNVVGSFFC  695
               ES V++AVD  VS++GKLDIMF+NAG T   + +S+L++   +   VF+ NV G+F  
Sbjct  62    TKESDVKSAVDGAVSQHGKLDIMFNNAGITVPMQYSSVLDSEKSHFEKVFNVNVYGAFLG  121

Query  694   AKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSN  515
             AKHAARVMIPAKKGSIIF++S S         +Y +SK A++GL   LC+E+GK+GIR N
Sbjct  122   AKHAARVMIPAKKGSIIFTSSVSAVTALEFPISYASSKYAVIGLTNQLCLELGKHGIRVN  181

Query  514   CVSAAIILTKLGMSIMPTQ-DRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             C+S  +I T +    M    D K A E VA +  LKG  +  +D+AEAA++L  DESKYV
Sbjct  182   CISPFLIPTPMLADAMGGAVDVKKAAEWVAASATLKGPPVEADDIAEAAIFLGSDESKYV  241

Query  337   SGVNLIIDGGYSTTN  293
             SG+NL++DGGYS  N
Sbjct  242   SGLNLVVDGGYSKVN  256



>ref|XP_002275768.1| PREDICTED: tropinone reductase-like 1 [Vitis vinifera]
Length=275

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 131/259 (51%), Positives = 181/259 (70%), Gaps = 1/259 (0%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
              A+  KRLEGKVAI+TG A+GIGA+T RLF  +G KVIIADI D  G  +  ++G + + 
Sbjct  8     FASPSKRLEGKVAIVTGGASGIGASTVRLFWENGAKVIIADIQDDLGQDITNKLGQDVS-  66

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             +IHCDV  E  VQN VDTT+S++G+LDIM++NAG       SIL+    +++ +   N+V
Sbjct  67    YIHCDVSNEDDVQNLVDTTISKHGRLDIMYNNAGILDRHLGSILDTQKSDLDRLIGVNLV  126

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             GSF  AKHAARVMIP KKG I+F+AS  T+  GI++H+Y  +K  I GL ++L  E+G+Y
Sbjct  127   GSFLGAKHAARVMIPQKKGCILFTASCCTSIAGISTHSYAVTKYGIWGLARNLAAELGQY  186

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
             GIR NCVS   ++T +G   + +++ + AE  ++E  NLKG  L +E VA AALYLA DE
Sbjct  187   GIRVNCVSPYGLITGMGQQGLTSEEVEAAEASLSEMGNLKGEVLKSEGVARAALYLASDE  246

Query  349   SKYVSGVNLIIDGGYSTTN  293
             + YVSG+NL++DGG+S  N
Sbjct  247   ASYVSGLNLVVDGGFSVVN  265



>gb|EYU26737.1| hypothetical protein MIMGU_mgv1a011831mg [Erythranthe guttata]
Length=269

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 123/260 (47%), Positives = 174/260 (67%), Gaps = 3/260 (1%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             +++A  KRLEGKVA+ITG A  +G+ TA+LF  HG K++IAD+ D  G  + + + P+ A
Sbjct  6     LLSAVAKRLEGKVALITGGAGRLGSATAKLFHEHGAKILIADVQDDLGRRICKTLSPQTA  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              +IHCD+  ESHV+NAV+  +S++GKLDIMF+NAG  G  +T +L     +   V + N+
Sbjct  66    SYIHCDITNESHVENAVEEAISKHGKLDIMFNNAGVMGPTNTDMLVETKSDFERVLNVNI  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
              G+F   KHAARVM PA +G+II +AS S+   G  +H YT+SK A++GL ++  VE+G+
Sbjct  126   TGTFLGTKHAARVMKPAHRGTIINTASVSSVIGGACTHAYTSSKHAVLGLTRNTAVELGR  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             YGIR NCVS     + +    +    R   + +V    NL G +LT EDVA+A LYLA D
Sbjct  186   YGIRVNCVSPYAFASPMSRGAL---GRDKDDPMVDIYSNLDGSNLTAEDVAQAVLYLASD  242

Query  352   ESKYVSGVNLIIDGGYSTTN  293
             ES+YVSG NL++DGG+S TN
Sbjct  243   ESRYVSGSNLVVDGGFSVTN  262



>ref|XP_011094269.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Sesamum indicum]
Length=276

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 130/260 (50%), Positives = 171/260 (66%), Gaps = 1/260 (0%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             +++A  +RLEGKVA++TG A+GIG  TA+LF+ HG KV IADI D+  +SV   IG   +
Sbjct  6     LVSALTRRLEGKVALVTGGASGIGECTAKLFSKHGAKVAIADIQDELAHSVVNSIGHSNS  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              +IHCDV  E HV+NAVD TVS YGKLDIMF+NAG A      I++    +   V   NV
Sbjct  66    TYIHCDVTNEDHVKNAVDKTVSTYGKLDIMFNNAGIADRPKPRIIDNEKSDFERVMSINV  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
              G F   KHAARVM+PA+ G+II +AS  +   G  +H YT SK A+VGL ++L VE+G+
Sbjct  126   TGVFLGMKHAARVMVPARSGTIISTASLGSGIGGAATHAYTCSKHAVVGLTRNLAVELGQ  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +GIR NC+S   + T L    +   D  + E  ++   NLKGV+L  EDVA AAL+LA D
Sbjct  186   FGIRVNCLSPYALATPLAKKFLELDDEGV-ENAMSYMANLKGVTLKAEDVANAALFLASD  244

Query  352   ESKYVSGVNLIIDGGYSTTN  293
             E++YVSG NL IDGG+   N
Sbjct  245   EARYVSGQNLFIDGGFGIVN  264



>ref|XP_002323405.1| putative short-chain alcohol dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEF05166.1| putative short-chain alcohol dehydrogenase family protein [Populus 
trichocarpa]
Length=276

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/259 (48%), Positives = 171/259 (66%), Gaps = 0/259 (0%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             +RL+GKVA+ITG A+GIG  TA++F+HHG KV+IADI D+ G+SV + +GP  + ++ CD
Sbjct  12    RRLQGKVALITGGASGIGECTAKVFSHHGAKVVIADIQDELGHSVVEALGPSNSTYVRCD  71

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V  E+ ++NAVD  +S YGKLDIM +NAG A      I++  + +   V   NV G F  
Sbjct  72    VTEEAQIKNAVDKAISTYGKLDIMLNNAGIADDSKARIIDNEMADFERVLKINVTGVFLG  131

Query  694   AKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSN  515
              KHAARVMIPA+ G+II +AS S+      SH Y  SK A++GL ++   E+G++GIR N
Sbjct  132   IKHAARVMIPARSGTIISTASVSSLLGAAASHAYCCSKHAVLGLTRNAAAELGQFGIRVN  191

Query  514   CVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVS  335
             C+S   + T L    +   D +  E  +    NLKGV+L TEDVA AALYLA DE++Y+S
Sbjct  192   CLSPYALATPLARKFIGVDDDEALEIAMNSFANLKGVTLKTEDVANAALYLASDEARYIS  251

Query  334   GVNLIIDGGYSTTNIGFQV  278
             G NL IDGG+S  N  FQ+
Sbjct  252   GHNLFIDGGFSVQNPTFQM  270



>ref|XP_003553613.1| PREDICTED: secoisolariciresinol dehydrogenase [Glycine max]
 gb|KHN02191.1| Momilactone A synthase [Glycine soja]
Length=280

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 133/270 (49%), Positives = 184/270 (68%), Gaps = 1/270 (0%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             MA+  K LEGKVAIITG A+GIGA TA+LF  HG KVIIAD+ D+ G    + +G     
Sbjct  7     MASIAKMLEGKVAIITGGASGIGAATAKLFVQHGAKVIIADVQDELGQFHCKTLGTTNIH  66

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             ++HCDV  +S V+N V+  VS+YGKLDIM++NAG +G  + SI  ++ E    VF  NV 
Sbjct  67    YVHCDVTSDSDVKNVVEFAVSKYGKLDIMYNNAGISGDSNRSITTSDNEGFKNVFGVNVY  126

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             G+F  AKHAARVMIPAK+G I+F++S ++   G T+H Y  SK A+VGL K+LCVE+G++
Sbjct  127   GAFLGAKHAARVMIPAKRGVILFTSSVASLLGGETTHAYAVSKHAVVGLMKNLCVELGEH  186

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
             GIR NCV    I T + ++     ++K  +E++ +   LKG  L  ED+A+AA+YL  DE
Sbjct  187   GIRVNCVCPGGIPTPM-LNNALKMNKKETQEVLCKVAVLKGTVLEAEDIAKAAVYLCSDE  245

Query  349   SKYVSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             +K+VSGVN ++DGGYS TN  F  A+  ++
Sbjct  246   AKFVSGVNFVLDGGYSITNNSFTSALNALI  275



>dbj|BAA89230.1| wts2L [Citrullus lanatus]
Length=273

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 129/255 (51%), Positives = 177/255 (69%), Gaps = 2/255 (1%)
 Frame = -1

Query  1057  LKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHC  878
             L+RL+GKVAIITG A+GIG +  R+F  +G KVIIADI D+ G  +A E+G + + +IHC
Sbjct  10    LRRLDGKVAIITGGASGIGTSAVRIFHENGAKVIIADIQDEIGQKIADELGDDVS-YIHC  68

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV  E  V N VD  V R+GKLDIM+SNAG      + IL+    +++ V   NV+G+F+
Sbjct  69    DVSKEDDVSNLVDAAVHRHGKLDIMYSNAGVLDRSFSGILDVTKSDLDKVLGVNVMGAFW  128

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AKHAARVMIP K G I+F++SA+T   G++SH Y ASKCA++GL ++L  E+G++GIR 
Sbjct  129   GAKHAARVMIPEKNGCILFTSSATTNIAGLSSHPYAASKCAVLGLVRNLAAELGQHGIRV  188

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             NCV+  ++ T +  S  P Q   L E +V    NLKG  L  +D+A+AALYLA D++ YV
Sbjct  189   NCVAPFVVATGIAGSRDPMQAEAL-ETMVTTWANLKGRVLKADDIAKAALYLASDDANYV  247

Query  337   SGVNLIIDGGYSTTN  293
             SG+NL++DGGYS  N
Sbjct  248   SGLNLVVDGGYSVVN  262



>ref|XP_009374964.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=270

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 134/263 (51%), Positives = 174/263 (66%), Gaps = 4/263 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             ++ A+ +RLEGKVA+ITG A+GIG +TAR+F+ HG KV+IAD+ D  G SV +++    A
Sbjct  6     LVTAAARRLEGKVALITGGASGIGESTARVFSKHGAKVVIADVQDDLGESVCRDLNSSSA  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              F+HCDV  E  ++NAV T  S+YGKLDIMF+NAG  G+   +IL+        V   N+
Sbjct  66    SFVHCDVTKEEDIENAVKTATSKYGKLDIMFNNAGIIGTPKPNILDNGKAEFEQVIRVNL  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             VG+F   KHAARVMIPA +GSII +AS  +   GI SH YT+SK  +VGL K+  VE+G+
Sbjct  126   VGAFLGIKHAARVMIPAGQGSIINTASVCSTMGGIASHAYTSSKHGVVGLMKNAAVELGQ  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             YGIR NCVS  ++ T L       +D    + +     NLKG  L  EDVAEAALYL  D
Sbjct  186   YGIRVNCVSPYLVATPLAKHFFNLED----DGVHGVYSNLKGKVLRPEDVAEAALYLGSD  241

Query  352   ESKYVSGVNLIIDGGYSTTNIGF  284
             ESKYVSG NL++DGG+S  N  F
Sbjct  242   ESKYVSGHNLLVDGGFSIVNPRF  264



>gb|AHH81853.1| short-chain alcohol dehydrogenase [Perilla frutescens]
Length=277

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 128/259 (49%), Positives = 174/259 (67%), Gaps = 1/259 (0%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             +RLEGKVA+ITG A GIG +TA+LF+ HG KV I D+ D+ G+SV ++IGP  + +IHCD
Sbjct  12    RRLEGKVALITGGAAGIGESTAKLFSKHGAKVAIVDVHDELGHSVIKQIGPSNSTYIHCD  71

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V  E  V+NAVD TVS YGKLDIMF+NAG A      I++    +   V   NV G F  
Sbjct  72    VTNEDDVRNAVDKTVSTYGKLDIMFNNAGIADQPKLRIVDNEKHDFERVLAVNVTGVFQG  131

Query  694   AKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSN  515
              KHAARVMIPA+ G+II +AS ++   G  +H YT SK A+VGL ++  +E+G+YGIR N
Sbjct  132   MKHAARVMIPARGGAIISTASIASGMGGAATHAYTCSKHAVVGLTRNSAIELGQYGIRVN  191

Query  514   CVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVS  335
             C+S   + + L    +  +D +L E ++ +  NLKG +L  +D+A AAL+LA D++KYVS
Sbjct  192   CMSPYALASDLSRKYLGIEDEEL-ERMMNDKANLKGTTLKADDIANAALFLASDDAKYVS  250

Query  334   GVNLIIDGGYSTTNIGFQV  278
             G NL IDGG++  N   QV
Sbjct  251   GQNLFIDGGFTIFNSAMQV  269



>ref|XP_006651946.1| PREDICTED: zerumbone synthase-like [Oryza brachyantha]
Length=297

 Score =   213 bits (541),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 136/285 (48%), Positives = 178/285 (62%), Gaps = 19/285 (7%)
 Frame = -1

Query  1111  CRLLTAAS*RRQLIMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKN  932
             CRL       R L+ A   KRLEGKVA++TG A+GIG    RLF  HG KV IADI D+ 
Sbjct  20    CRL------PRSLLAA---KRLEGKVALVTGGASGIGEAIVRLFREHGAKVCIADIKDEA  70

Query  931   GNSVAQEIG-PEYALFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILE  755
             G  +   +G  ++ALF+HCDV +E  V  AVD T  ++G LDI+ +NAG  G++ T I  
Sbjct  71    GQKLWDSLGGDQHALFLHCDVTVEEEVSRAVDATAEKFGTLDIIVNNAGITGNKITDIRN  130

Query  754   ANLENINLVFDTNVVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCA  575
              +      V D N+VG F   KHAARVMIP K+GSII  AS ++   G+  H YTASK A
Sbjct  131   VDFAEFRKVIDINLVGVFHGMKHAARVMIPNKRGSIISLASVASVMGGLGPHAYTASKHA  190

Query  574   IVGLCKSLCVEMGKYGIRSNCVSAAIILTKLGMSIMPTQDRK-------LAEEIVAEAPN  416
             +VGL K++  E+GK+GIR NCVS   + T L M  +P  +RK       LA   V    N
Sbjct  191   VVGLTKNVAAELGKHGIRVNCVSPYAVPTALSMPYLPEDERKDDALKGFLA--FVGGEAN  248

Query  415   LKGVSLTTEDVAEAALYLAGDESKYVSGVNLIIDGGYSTTNIGFQ  281
             LKGV L  +DVAEA LYLA DE++YVS +NL++DGG+++ N+  +
Sbjct  249   LKGVDLLPKDVAEAVLYLASDEARYVSALNLMVDGGFTSVNLNLR  293



>ref|XP_010104811.1| Momilactone A synthase [Morus notabilis]
 gb|EXC01952.1| Momilactone A synthase [Morus notabilis]
Length=272

 Score =   211 bits (538),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 133/265 (50%), Positives = 174/265 (66%), Gaps = 1/265 (0%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             +++A  +RLEGKVA+ITG A+GIG  TA++FAHHG K+IIADI D  G+S+ Q I     
Sbjct  6     LLSAVSRRLEGKVAVITGGASGIGECTAKVFAHHGAKLIIADIQDALGHSLCQSIDETNC  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              ++HCDV  E+HV+NAVD  V  YGKLDI+F+NAGT+      IL+    +   V   N 
Sbjct  66    KYVHCDVTDETHVKNAVDKAVKAYGKLDIIFNNAGTSDKSYLRILKDQKNDFERVMSVNA  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
              G F   KHA+RVMIPA+ GSII +AS  +   G  SH YTASK A++GL KS  VE+G+
Sbjct  126   TGVFLGIKHASRVMIPARSGSIISTASVCSYIGGAASHAYTASKHAVLGLTKSAAVELGQ  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             YGIR NC+S   + T L    +  +   + E + + A NLK V+L  EDVA AALYLA D
Sbjct  186   YGIRVNCLSPYGVATPLVEKFLGRKKGDI-ENLFSSAANLKNVTLEAEDVANAALYLASD  244

Query  352   ESKYVSGVNLIIDGGYSTTNIGFQV  278
             E++Y+SG NL +DGGYS  N  F +
Sbjct  245   EARYISGHNLFVDGGYSIANPSFNM  269



>dbj|BAE72096.1| Lactuca sativa short-chain dehydrogenase/reductase 1
Length=270

 Score =   211 bits (538),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 135/263 (51%), Positives = 172/263 (65%), Gaps = 1/263 (0%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             M +  KRLEGKVA+ITGAA+GIG  TA+LFA HG KV+IADI D+ G +V + IG   ++
Sbjct  1     MTSITKRLEGKVALITGAASGIGECTAKLFAEHGAKVVIADIQDQLGQAVCEAIGTSNSI  60

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             ++HCDV  E  ++NAVDT V+ YGKLDIMF+NAG        I++    N   V + NV 
Sbjct  61    YVHCDVTNEEDIKNAVDTAVTTYGKLDIMFNNAGVVDPIKARIIDNEKTNFERVLNVNVT  120

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             G F C KHAARVM+P + G+II S+S S+   GI SH Y  SK AI GL K+L VE+G++
Sbjct  121   GVFLCMKHAARVMVPQRSGTIISSSSLSSHLGGIASHAYCCSKHAIAGLTKNLAVELGQF  180

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
             GIR NC+SA  I T L   I   +     E  +    NLKGV+L T+D A AAL+L  DE
Sbjct  181   GIRVNCLSAYGIATPLTKKITGLEKEAF-ESAMNLTANLKGVTLKTDDAAYAALFLVSDE  239

Query  349   SKYVSGVNLIIDGGYSTTNIGFQ  281
             +KY+SG NL+IDGG S  N  F 
Sbjct  240   AKYISGQNLLIDGGLSYANTSFN  262



>emb|CBI28276.3| unnamed protein product [Vitis vinifera]
Length=340

 Score =   213 bits (543),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 129/269 (48%), Positives = 185/269 (69%), Gaps = 6/269 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             +++A  +RLEGKVA+ITG A GIG+ TA+LF+ HG KV+IADI D+ G+ + +++GP  A
Sbjct  41    LLSAVARRLEGKVALITGGAGGIGSCTAKLFSQHGAKVLIADIQDEKGHLICRDLGPSSA  100

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              FIHCDV  E  V NA+D  V+++GKLDIMF+NAG  G +  +IL+ +          NV
Sbjct  101   SFIHCDVTKELDVSNAIDEAVAKHGKLDIMFNNAGILGPKIINILDNDAAEFENTMRVNV  160

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             +G+F   KHAARVM+PA +G +I SAS  +   GI +H+Y +SK AI+GL ++  VE+GK
Sbjct  161   LGAFLGTKHAARVMVPAGRGCVINSASVCSVVGGICTHSYVSSKHAILGLTRNTAVELGK  220

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +GIR NCVS  ++ T +    + ++D    E++ +   NLKGV+L  +DVAEA LYL  D
Sbjct  221   FGIRVNCVSPYVVPTPMSRKFLNSEDDDPLEDVYS---NLKGVALMPQDVAEAVLYLGSD  277

Query  352   ESKYVSGVNLIIDGGYSTTNIGFQVAVEK  266
             +SKYVSG NL+IDGG + +   F +A++K
Sbjct  278   DSKYVSGNNLVIDGGVTRS---FSLALKK  303



>ref|XP_002272549.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=269

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 126/257 (49%), Positives = 178/257 (69%), Gaps = 3/257 (1%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             +++A  +RLEGKVA+ITG A GIG+ TA+LF+ HG KV+IADI D+ G+ + +++GP  A
Sbjct  6     LLSAVARRLEGKVALITGGAGGIGSCTAKLFSQHGAKVLIADIQDEKGHLICRDLGPSSA  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              FIHCDV  E  V NA+D  V+++GKLDIMF+NAG  G +  +IL+ +          NV
Sbjct  66    SFIHCDVTKELDVSNAIDEAVAKHGKLDIMFNNAGILGPKIINILDNDAAEFENTMRVNV  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             +G+F   KHAARVM+PA +G +I SAS  +   GI +H+Y +SK AI+GL ++  VE+GK
Sbjct  126   LGAFLGTKHAARVMVPAGRGCVINSASVCSVVGGICTHSYVSSKHAILGLTRNTAVELGK  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +GIR NCVS  ++ T +    + ++D    E++ +   NLKGV+L  +DVAEA LYL  D
Sbjct  186   FGIRVNCVSPYVVPTPMSRKFLNSEDDDPLEDVYS---NLKGVALMPQDVAEAVLYLGSD  242

Query  352   ESKYVSGVNLIIDGGYS  302
             +SKYVSG NL+IDGG +
Sbjct  243   DSKYVSGNNLVIDGGVT  259



>ref|XP_011006659.1| PREDICTED: momilactone A synthase-like [Populus euphratica]
Length=275

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 127/262 (48%), Positives = 178/262 (68%), Gaps = 4/262 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             +++   +RLEGKVA+ITG A GIG +TAR F  HG KV+IAD  D+  +SV +++  E A
Sbjct  6     LLSTVARRLEGKVALITGGARGIGESTARHFFKHGAKVVIADTQDELAHSVCKDLNSESA  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              FIHCD+  E+ V+NAV+T +SR+GKLD+MF+NAG  G   T++++ ++     V   N+
Sbjct  66    SFIHCDITKETDVENAVNTAISRHGKLDVMFNNAGIVGVVKTNMVDVSMSEFEEVIRVNL  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             VG F   KHAARVM PA++GSII ++S      G  SH YT+SK  ++GL ++  VE+G+
Sbjct  126   VGPFLGTKHAARVMKPARQGSIITTSSVCGILGGFASHAYTSSKHGVLGLMRNTAVELGQ  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +GIR NCVS   + T++  + +   D    +EI +   NLKG  LT EDVAEAALYLA D
Sbjct  186   FGIRVNCVSPYTVATEMSRNFLKMTD----DEIRSGYSNLKGAILTPEDVAEAALYLASD  241

Query  352   ESKYVSGVNLIIDGGYSTTNIG  287
             +S+YVSG NL++DGGY+  N G
Sbjct  242   DSRYVSGHNLVVDGGYTIVNNG  263



>ref|XP_010049792.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=270

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 128/263 (49%), Positives = 175/263 (67%), Gaps = 4/263 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             +++ + +RLEGKVA+ITG A GIG +TARLF+ HG +VIIADI D  G SV +++GPE A
Sbjct  6     LLSQAARRLEGKVAVITGGAGGIGESTARLFSKHGARVIIADIRDDLGKSVCKDLGPETA  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              F+HCDV  ES ++NA+ T V ++GKLDIM +NA        SIL+ +  +   V   N+
Sbjct  66    SFVHCDVSSESDIKNAIATAVDKHGKLDIMVNNAAIGDPSKASILDNDKADFEKVVSVNL  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
              G F   KHAAR MIP+++GSII   S  ++  G+ SH YT+SK A++GL +++  E+G+
Sbjct  126   TGVFLGTKHAARAMIPSQRGSIINLGSVCSSVGGVASHAYTSSKHAVLGLTRNVAAELGR  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             YG+R NC+S   ILT L  +I    +    +  V    N+ GV+L  EDVAEAALYL  D
Sbjct  186   YGVRINCLSPYFILTPLTKAIFQIDE----DAGVRVYSNMDGVTLRQEDVAEAALYLGSD  241

Query  352   ESKYVSGVNLIIDGGYSTTNIGF  284
             ESKYVSG NL +DGG++T N  F
Sbjct  242   ESKYVSGHNLAVDGGFTTINPAF  264



>ref|XP_010691689.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
Length=269

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 136/263 (52%), Positives = 172/263 (65%), Gaps = 5/263 (2%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
               A+ +RLEGKVA+ITG A+GIGA TA+LF  HG KV+IA+I D  G SV + + P  A 
Sbjct  7     FTAAARRLEGKVALITGGASGIGACTAKLFTKHGAKVMIAEIQDDLGLSVCKSLDPSVAS  66

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRD-TSILEANLENINLVFDTNV  713
             +IHCDV  E HVQNAVD+TV++Y KLDIMF+NAG AGS    +IL+    +      TN+
Sbjct  67    YIHCDVTNEDHVQNAVDSTVAKYKKLDIMFNNAGIAGSHPKPNILDITQSDFEETVKTNL  126

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             +G F   KHAARVMIPA++GSII +AS  +   G+  H YT+SK  ++GL +S  VE G+
Sbjct  127   IGPFLGTKHAARVMIPARQGSIITTASVCSIIGGVAPHAYTSSKHGVLGLTRSTTVEFGQ  186

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             YGIR NCVS   + T L    +   D    E I     NLKG     EDVA AAL+LA D
Sbjct  187   YGIRVNCVSPHAVPTPLFNKFLQLDD----EGISKIYSNLKGTWCKVEDVANAALFLASD  242

Query  352   ESKYVSGVNLIIDGGYSTTNIGF  284
             +SKYVSG NL +DGG++  N GF
Sbjct  243   DSKYVSGHNLTVDGGFTIMNSGF  265



>ref|XP_010061228.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Eucalyptus grandis]
 gb|KCW68145.1| hypothetical protein EUGRSUZ_F01817 [Eucalyptus grandis]
Length=277

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 133/265 (50%), Positives = 177/265 (67%), Gaps = 1/265 (0%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
              ++A+ KRLEGKVA+ITG A+GIG  TAR+FAHHG KV+IAD++D  G+SV   +  + A
Sbjct  6     FISAATKRLEGKVALITGGASGIGEITARVFAHHGAKVVIADVNDSLGHSVRDSLSRDTA  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              F+HCDV  ES ++ AV   VS YGKLDIMF+NAG  G  +T I++ +  +   V   NV
Sbjct  66    SFVHCDVTDESQIKAAVAEAVSTYGKLDIMFNNAGITGPNETRIIDNDKADFERVLAVNV  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
              G F   KHAA+ MIP ++G II +AS S+   G+TSH YT +K A++GL ++  VE+G+
Sbjct  126   TGVFLGMKHAAQAMIPVRRGCIINTASISSGLAGMTSHAYTCAKHAVLGLTRNAAVELGQ  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +GIR NC+S     T L          +L   I A A NLKGV+L  EDVA AAL+LAGD
Sbjct  186   FGIRVNCLSPNACATPLATGFFGMSPAELEAAIDAVA-NLKGVTLKVEDVANAALFLAGD  244

Query  352   ESKYVSGVNLIIDGGYSTTNIGFQV  278
             E++YVSG NL IDGG+S  N  F++
Sbjct  245   EARYVSGHNLSIDGGFSVVNSSFRL  269



>gb|ACU18273.1| unknown [Glycine max]
Length=269

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 133/259 (51%), Positives = 173/259 (67%), Gaps = 6/259 (2%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             +RLEGKVA+I+G A+GIG  TARLF+ HG  V+IADI D  G S+ + +  E A ++HCD
Sbjct  12    RRLEGKVALISGGASGIGEATARLFSKHGAHVVIADIQDDLGLSLCKHL--ESASYVHCD  69

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V  E+ VQNAV+T +S+YG LDIMF+NAG      TSIL+ +  +   V   N+VG F  
Sbjct  70    VTNENDVQNAVNTAISKYGNLDIMFNNAGIIDEIKTSILDNSKFDFERVISVNLVGPFLG  129

Query  694   AKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSN  515
              KHAARVMIPAK+GSII +AS +    G  SH YT+SK A++GL K+  VE+G++GIR N
Sbjct  130   TKHAARVMIPAKRGSIINTASVAGTFSGGASHAYTSSKHALIGLMKNTAVELGQFGIRVN  189

Query  514   CVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVS  335
             C+S  ++ T L        + +  E       NLK V L   DVAEAALYLAGDESKYVS
Sbjct  190   CLSPYVVATPLTKKCFNLDEDRNGEIY----SNLKSVHLVPNDVAEAALYLAGDESKYVS  245

Query  334   GVNLIIDGGYSTTNIGFQV  278
             G N ++DGG++  N+GF V
Sbjct  246   GPNFVLDGGFTNLNVGFFV  264



>gb|ABS87381.1| short-chain dehydrogenase/reductase protein [Lactuca sativa]
Length=271

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 128/264 (48%), Positives = 179/264 (68%), Gaps = 1/264 (0%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             M+   KRLEGKVA+ITGAA+GIG   A+LFA HG KVIIAD+ D+ G +V++ IG   ++
Sbjct  1     MSIPAKRLEGKVALITGAASGIGECCAKLFAAHGAKVIIADVQDQLGQAVSEAIGSSNSM  60

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             +IHCD+  E  V+N +DT V+ YGKLDIMF+NAG A +    I++   ++I  V   NV+
Sbjct  61    YIHCDITNEEEVKNTIDTAVATYGKLDIMFNNAGIADAFKPRIMDNEKKDIERVLGVNVI  120

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             G+F C KHAARVM+P K GSII ++S ++   G+ SH Y+ SK A+VGL ++L VE+  +
Sbjct  121   GTFLCMKHAARVMVPQKSGSIITTSSLTSHLGGMASHAYSCSKHALVGLTRNLAVELAPF  180

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
             GIR NCVS   I T +    +  + R++ E ++    NLKGV+   +DVA AALYLA DE
Sbjct  181   GIRVNCVSPFGIATPMTADFIGLE-REVFENMINGVANLKGVTHKPDDVAYAALYLASDE  239

Query  349   SKYVSGVNLIIDGGYSTTNIGFQV  278
             +KYV+  N+++DGG S  N  F +
Sbjct  240   AKYVTAQNMLVDGGLSYCNNSFNM  263



>ref|XP_009340877.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=263

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 132/257 (51%), Positives = 167/257 (65%), Gaps = 4/257 (2%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             K LEGKVA+ITG A+GIG +TAR+F+ HG KV+IAD+ D  G SV +++    A F+HCD
Sbjct  5     KWLEGKVALITGGASGIGESTARVFSKHGAKVVIADVQDDLGESVFRDLNSSSASFVHCD  64

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V  E  ++NAV T  S+YGKLDIMF+NAG  G+   +IL+ +      V   N+VGSF  
Sbjct  65    VTKEEDIENAVKTATSKYGKLDIMFNNAGIGGTPKPNILDNDKAEFEQVLSVNLVGSFLG  124

Query  694   AKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSN  515
              KHAARVMIPA +GSII +AS  +   G   H YT+SK  +VGL K+  VE+G+YGIR N
Sbjct  125   IKHAARVMIPAGQGSIINTASVCSTIGGGAPHAYTSSKHGVVGLMKNAAVELGQYGIRVN  184

Query  514   CVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVS  335
             CVS  ++ T L        D    + +     NLKG  L  EDVAEAALYL  DESKYVS
Sbjct  185   CVSPYLVATPLAKDFFNLDD----DGVHGVYSNLKGKVLRPEDVAEAALYLGSDESKYVS  240

Query  334   GVNLIIDGGYSTTNIGF  284
             G NL++DGG+S  N  F
Sbjct  241   GHNLLVDGGFSIVNPRF  257



>ref|XP_002526345.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF36016.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=286

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 129/266 (48%), Positives = 179/266 (67%), Gaps = 8/266 (3%)
 Frame = -1

Query  1066  AASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA--  893
             +++  RLEGKVA+ITG A+GIGA TA+LF  +G KV++AD+ D+ G S+ Q++G E    
Sbjct  8     SSTANRLEGKVALITGGASGIGAGTAKLFVKNGAKVVVADVQDELGRSLCQQLGSETEDI  67

Query  892   -LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTN  716
               ++HCDV  +S ++ AVD  VS+YGKLDIMFSNA  +G  D +IL  + ++ N VF+ N
Sbjct  68    ISYVHCDVSSDSDMREAVDLAVSKYGKLDIMFSNAAISGGLDNTILGTDNDDFNRVFEVN  127

Query  715   VVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMG  536
             V G F  AKHAARVMIPAKKGSI+F++S + A    + H Y  SK A+ GL ++LC E+G
Sbjct  128   VFGGFLAAKHAARVMIPAKKGSILFTSSNAAATCVCSPHPYVTSKHAVNGLAQNLCAELG  187

Query  535   KYGIRSNCVS-----AAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAA  371
             +YGIR NC S        +L   G++          ++ ++ A  LKG  L  +D+AEAA
Sbjct  188   RYGIRVNCASPFGVVTPFLLQYYGLTEANDTMTNKIQQAISSAAILKGEILEVKDIAEAA  247

Query  370   LYLAGDESKYVSGVNLIIDGGYSTTN  293
             +YLA DESK+VSG+NL++DGGYS  N
Sbjct  248   VYLASDESKFVSGINLVVDGGYSVAN  273



>ref|XP_008798880.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Phoenix dactylifera]
Length=269

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 133/260 (51%), Positives = 176/260 (68%), Gaps = 5/260 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             + +A +KRLEGKVA+ITG A+GIG  TARLF+ HG KV++ADI D+ G SV   IG   A
Sbjct  1     MTSALVKRLEGKVAVITGGASGIGECTARLFSQHGAKVVVADIQDERGRSVCDTIG---A  57

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              F+HCDV  ES VQ A+DT V+ +GKLDIMF+NAG   +    I +  L + + V D  V
Sbjct  58    TFVHCDVTKESDVQKAIDTAVTGHGKLDIMFNNAGIIDA-GKPITDTALSDFHKVIDVIV  116

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
              G+F   KHAARVM+PA +GSII +AS ++   G+ +H YTA+K A+ GL +S  VE+G+
Sbjct  117   TGAFLGTKHAARVMVPAGRGSIISTASVASVIGGVGTHAYTAAKHAVAGLTRSAAVELGR  176

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +G+R NCVS   + T+L +      D K+ EE +++   L+G  L  EDVA A LYLA D
Sbjct  177   FGVRVNCVSPYAVATRLAVEFARI-DEKVFEEAMSKFATLQGTLLKPEDVAMAVLYLASD  235

Query  352   ESKYVSGVNLIIDGGYSTTN  293
             ESKYVSG NL++DGGYS  N
Sbjct  236   ESKYVSGHNLMVDGGYSIVN  255



>ref|XP_011091814.1| PREDICTED: xanthoxin dehydrogenase [Sesamum indicum]
 ref|XP_011091815.1| PREDICTED: xanthoxin dehydrogenase [Sesamum indicum]
 ref|XP_011091816.1| PREDICTED: xanthoxin dehydrogenase [Sesamum indicum]
Length=280

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 133/267 (50%), Positives = 176/267 (66%), Gaps = 10/267 (4%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-FIHC  878
             +RL G+VA++TG A GIG +  R+F   G KV IADI D  G  + + +G    + F HC
Sbjct  14    QRLLGRVALVTGGAAGIGESIVRVFHKQGAKVCIADIQDDLGQRICESLGGGLDISFCHC  73

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV IE  V+NAVD TV RYG LDIM +NAGTAG     I E  L     +FD NV G F 
Sbjct  74    DVTIEDDVKNAVDVTVDRYGTLDIMVNNAGTAGPPRPDIREVELSLFEQIFDVNVKGVFI  133

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
               KHAAR+MIPAKKGSII  AS ++A  GI  H YT SK A+VGL KS+  E+GK+GIR 
Sbjct  134   GMKHAARIMIPAKKGSIISLASVASAVGGIGGHAYTGSKHAVVGLTKSVAAELGKHGIRV  193

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIV------AEA-PNLKGVSLTTEDVAEAALYLA  359
             NCVS   + T + ++ +P ++R   E+++      AEA  NL+G+ LTTEDVA A L+LA
Sbjct  194   NCVSPYAVATPMALAHLPEEER--TEDVLTGFRRFAEANANLQGIELTTEDVANAVLFLA  251

Query  358   GDESKYVSGVNLIIDGGYSTTNIGFQV  278
              DE++Y+SG NL++DGG++++N   +V
Sbjct  252   SDEARYISGDNLMVDGGFASSNHSLRV  278



>ref|XP_010061227.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Eucalyptus grandis]
Length=307

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 133/265 (50%), Positives = 177/265 (67%), Gaps = 1/265 (0%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
              ++A+ KRLEGKVA+ITG A+GIG  TAR+FAHHG KV+IAD++D  G+SV   +  + A
Sbjct  36    FISAATKRLEGKVALITGGASGIGEITARVFAHHGAKVVIADVNDSLGHSVRDSLSRDTA  95

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              F+HCDV  ES ++ AV   VS YGKLDIMF+NAG  G  +T I++ +  +   V   NV
Sbjct  96    SFVHCDVTDESQIKAAVAEAVSTYGKLDIMFNNAGITGPNETRIIDNDKADFERVLAVNV  155

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
              G F   KHAA+ MIP ++G II +AS S+   G+TSH YT +K A++GL ++  VE+G+
Sbjct  156   TGVFLGMKHAAQAMIPVRRGCIINTASISSGLAGMTSHAYTCAKHAVLGLTRNAAVELGQ  215

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +GIR NC+S     T L          +L   I A A NLKGV+L  EDVA AAL+LAGD
Sbjct  216   FGIRVNCLSPNACATPLATGFFGMSPAELEAAIDAVA-NLKGVTLKVEDVANAALFLAGD  274

Query  352   ESKYVSGVNLIIDGGYSTTNIGFQV  278
             E++YVSG NL IDGG+S  N  F++
Sbjct  275   EARYVSGHNLSIDGGFSVVNSSFRL  299



>ref|XP_008229660.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Prunus mume]
Length=270

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 173/263 (66%), Gaps = 4/263 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             ++AA+ +RLEGKVA+ITG A+GIG +TARLF+ HG +V+IAD+ D    SV +++     
Sbjct  6     LLAAAARRLEGKVALITGGASGIGESTARLFSKHGARVVIADVQDDLAESVCRDLSSSST  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              F+HCDV  E  V+NAV T   +YGKLDIMF+NAGT G    +IL+ +      V   N+
Sbjct  66    SFVHCDVTKEEDVENAVKTATRKYGKLDIMFNNAGTGGIAKPNILDNDKAEFEQVIRVNL  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             VG+F   KHAARVMIPA +GSII +AS  +   G +SH YT+SK  IVGL ++  VE+G+
Sbjct  126   VGAFLGIKHAARVMIPAGQGSIINTASVCSTIGGGSSHAYTSSKHGIVGLVRNTAVELGQ  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +GIR NCVS  I+ T L  +     D    + +     NLKG  L  ED+A+AALYL  D
Sbjct  186   HGIRVNCVSPYIVATPLAKNFFKLDD----DGVHGAYSNLKGAVLKAEDIAQAALYLGSD  241

Query  352   ESKYVSGVNLIIDGGYSTTNIGF  284
             ESKYVSG NL++DGG++  N  F
Sbjct  242   ESKYVSGHNLVVDGGFTIVNPRF  264



>ref|XP_008442887.1| PREDICTED: tropinone reductase-like 1 [Cucumis melo]
Length=273

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 129/255 (51%), Positives = 174/255 (68%), Gaps = 2/255 (1%)
 Frame = -1

Query  1057  LKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHC  878
             L+RLEGKVAIITG A+GIGA+  R+F  +G KV IADI D+ G  ++ E+G E   +IHC
Sbjct  10    LRRLEGKVAIITGGASGIGASAVRIFHENGAKVTIADIQDEAGQKISDELG-EDVNYIHC  68

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV  E  V N VD  V R+GKLDIM+SNAG      + IL+    +++ V   NV+G+F+
Sbjct  69    DVSKEEDVSNVVDAAVYRHGKLDIMYSNAGVIDRSFSGILDVTKSDLDKVLGVNVMGAFW  128

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
              AKHAARVMIP K G I+F+ SA+T   G++SH Y +SKCA++GL ++L  E+G++GIR 
Sbjct  129   GAKHAARVMIPQKNGCILFTTSATTNIAGLSSHPYASSKCAVLGLVRNLSAELGQHGIRV  188

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             NCV+  ++ T +     P Q   L E +V    NLKG  L  +D+A AALYLA D++KYV
Sbjct  189   NCVAPFVVATGIAGPRNPMQAEAL-ETMVTSWANLKGCVLKADDIANAALYLASDDAKYV  247

Query  337   SGVNLIIDGGYSTTN  293
             SG+NL++DGGYS  N
Sbjct  248   SGLNLVVDGGYSVVN  262



>ref|XP_010104809.1| Momilactone A synthase [Morus notabilis]
 gb|EXC01950.1| Momilactone A synthase [Morus notabilis]
Length=277

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 129/259 (50%), Positives = 172/259 (66%), Gaps = 0/259 (0%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             ++A  +RLEGKVA+ITG A+GIG  TA++FAHHG K++IADI D  G SV + IG     
Sbjct  7     LSAVPRRLEGKVALITGGASGIGECTAKVFAHHGAKLVIADIQDDLGYSVVESIGQTSCK  66

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             ++HCDV  ESHV+NAVD  V  YGKLDIM +NAG A      I++    +   V   NV 
Sbjct  67    YVHCDVTDESHVKNAVDEAVKTYGKLDIMLNNAGIADENKARIIDNEKADFERVMSVNVT  126

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             G F   KHAARVMIPA++GSII +AS  +   G +SH YTASK A++GL ++  VE+G++
Sbjct  127   GVFLGIKHAARVMIPARRGSIITTASMCSHIGGGSSHAYTASKHAVLGLARNAAVELGQF  186

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
             GIR NC+S   +LT +      + ++++ E       NLK V+L  EDVA AALYLA DE
Sbjct  187   GIRVNCLSPFPLLTPMTSKYFGSTNQEVLENTFKSWGNLKHVTLKAEDVANAALYLASDE  246

Query  349   SKYVSGVNLIIDGGYSTTN  293
             + Y+SG +L+IDGG+S  N
Sbjct  247   ANYISGHSLLIDGGFSIVN  265



>gb|KEH24173.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=274

 Score =   209 bits (531),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 132/263 (50%), Positives = 169/263 (64%), Gaps = 1/263 (0%)
 Frame = -1

Query  1066  AASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALF  887
             AA   RLEGKVA+ITG A+ IG  TA +F   G KV+IADI D+ G+SVAQ IG     +
Sbjct  7     AAVNGRLEGKVALITGGASRIGKRTAEIFVQKGAKVVIADIQDELGHSVAQTIGSSTCTY  66

Query  886   IHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVG  707
             +HCDV  ES ++N VDTTV  YGKLDIMF+NAG  G  ++ I++ +  +   V   NV G
Sbjct  67    VHCDVTDESQIKNVVDTTVQTYGKLDIMFNNAGIGGPNNSRIIDNDKADFERVLSINVTG  126

Query  706   SFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYG  527
              F   KHAA+ MIPA+ GSII + S S+   G  SH Y ++K A+VGL K+  VE+GK+G
Sbjct  127   VFLGIKHAAQAMIPARTGSIISTTSISSYVGGAASHAYCSAKHAVVGLTKNAAVELGKFG  186

Query  526   IRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDES  347
             IR NCVS   + T L    +   D +L E  +    NLKGV L T+DV  AALY A D+S
Sbjct  187   IRVNCVSPYALATPLATQFVGCNDGEL-ETTMNTLANLKGVILKTDDVVNAALYFASDDS  245

Query  346   KYVSGVNLIIDGGYSTTNIGFQV  278
             +YVSG NL+IDGG+S  N  F +
Sbjct  246   RYVSGHNLLIDGGFSIVNPSFHM  268



>ref|XP_003554452.1| PREDICTED: secoisolariciresinol dehydrogenase [Glycine max]
Length=275

 Score =   209 bits (531),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 131/259 (51%), Positives = 168/259 (65%), Gaps = 1/259 (0%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             KRLEGKVA+ITG A+GIG  TA +FA  G KV+IADI D+ G+SVAQ IGP    ++HCD
Sbjct  10    KRLEGKVALITGGASGIGKRTAEVFAQQGAKVVIADIQDELGHSVAQSIGPSTCCYVHCD  69

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V  E+ ++NAV   V  YGKLDIMF+NAG        I++ +  +   V   NV G F  
Sbjct  70    VTDENQIKNAVQKAVDAYGKLDIMFNNAGIVDPNKNRIIDNDKADFERVLSVNVTGVFLG  129

Query  694   AKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSN  515
              KHAA+ MIPA+ GSII +AS S+   G  SH Y  +K A+VGL K+  VE+G++GIR N
Sbjct  130   MKHAAQAMIPARSGSIISTASISSYVGGAASHAYCCAKHAVVGLTKNAAVELGQFGIRVN  189

Query  514   CVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVS  335
             C+S   + T L    +   D +L E I+    NLKGV+L  EDVA AALY A D+S+YVS
Sbjct  190   CLSPYALATPLATKFVGANDEEL-ETIMNSLANLKGVTLKAEDVANAALYFASDDSRYVS  248

Query  334   GVNLIIDGGYSTTNIGFQV  278
             G NL+IDGG+S  N  F +
Sbjct  249   GQNLLIDGGFSIVNPSFHM  267



>ref|XP_004981321.1| PREDICTED: zerumbone synthase-like [Setaria italica]
Length=282

 Score =   209 bits (532),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 129/262 (49%), Positives = 169/262 (65%), Gaps = 10/262 (4%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGP-EYALFIHC  878
             KRLEGKVA++TG A+GIG T  RLF +HG KV IADI D+ G  +   +G  +  +F+HC
Sbjct  15    KRLEGKVALVTGGASGIGETIVRLFKNHGAKVCIADIQDEAGQKLRDALGGGDDVMFVHC  74

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV +E  V  AVD    R+G LD+M +NAG  GS+ T I   +   +  VFD NV G F 
Sbjct  75    DVTVEEDVSAAVDAVAQRFGALDVMVNNAGITGSKVTDIRNVDFAEVRKVFDINVHGVFM  134

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
               KHAARVMIP K+GSI+  AS ++   G+  H YTASK A+ GL KS+  E+G++G+R 
Sbjct  135   GMKHAARVMIPRKRGSIVSLASVASVIGGMGPHAYTASKHAVAGLTKSVAGELGRHGVRV  194

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAE-------APNLKGVSLTTEDVAEAALYLA  359
             NCVS   + T L M  +P   R  A++ V +       A NLKGV L  EDVAEA LYLA
Sbjct  195   NCVSPYAVPTALSMPHLPKGAR--ADDAVKDFLAFAGGAANLKGVDLMPEDVAEAVLYLA  252

Query  358   GDESKYVSGVNLIIDGGYSTTN  293
              DE+KYVS +NL++DGG+++ N
Sbjct  253   SDEAKYVSALNLVVDGGFTSVN  274



>gb|KDP34949.1| hypothetical protein JCGZ_09237 [Jatropha curcas]
Length=270

 Score =   208 bits (530),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 124/265 (47%), Positives = 172/265 (65%), Gaps = 4/265 (2%)
 Frame = -1

Query  1078  QLIMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPE  899
               ++  + +RLEGKVA+ITG A  IGA+  R F  HG KVII DI D  G S+++E+G +
Sbjct  4     NFLLPFNARRLEGKVALITGGATSIGASIVRTFCKHGAKVIIVDIQDDLGQSLSKELGTD  63

Query  898   YALFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDT  719
              A+F+HCDV IES ++NAVDT +  + KLDIM +NA     R  SI++ ++ +   V   
Sbjct  64    KAIFVHCDVTIESDIENAVDTAIFIFKKLDIMVNNAAIGDPRKPSIVDNDIADFERVVKV  123

Query  718   NVVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEM  539
             N++G F   KHAARVMIPA++GSII   S  ++  G+ SH YT++K  +VGL K+   E+
Sbjct  124   NLIGVFLGTKHAARVMIPARQGSIITLGSVCSSVGGVASHAYTSTKHGVVGLAKNAAAEL  183

Query  538   GKYGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLA  359
             G++GIR NC+S   I T L M+    ++   +        NL+GV LT EDVA+AA+YL 
Sbjct  184   GRFGIRVNCLSPYFIETPLSMNFFKMKEDGKS----GVYSNLEGVKLTEEDVAQAAIYLG  239

Query  358   GDESKYVSGVNLIIDGGYSTTNIGF  284
              DESKYVSG NL +DGG++T N  F
Sbjct  240   SDESKYVSGHNLALDGGFTTINPAF  264



>ref|XP_007132475.1| hypothetical protein PHAVU_011G097200g [Phaseolus vulgaris]
 gb|ESW04469.1| hypothetical protein PHAVU_011G097200g [Phaseolus vulgaris]
Length=268

 Score =   208 bits (530),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 133/263 (51%), Positives = 175/263 (67%), Gaps = 6/263 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             + +A  +RLEGKVA+ITG A+GIG  TARLFA HG KV+IADI D+ G+SV ++I  + +
Sbjct  7     VSSAVARRLEGKVALITGGASGIGECTARLFAKHGAKVVIADIQDELGHSVCKDI--DSS  64

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              ++HCDV  E HV+ AV+T VSR+GKLDIM +NAG  G  + +I+     +   V  TN+
Sbjct  65    FYVHCDVTKEEHVERAVNTAVSRFGKLDIMHNNAGIIGVWNPNIIHNKKSDFEEVIRTNL  124

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             VG F   KHAARVM P+++GSII +AS      G+ SH YT SK  IVGL ++  VE+G 
Sbjct  125   VGVFLGMKHAARVMAPSRRGSIIATASTCGRIGGMASHAYTCSKHGIVGLVRNAAVELGP  184

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
              GIR NCVS   + T +  S + T D    E I A   NLKGV+L  +DVAEA +YL  D
Sbjct  185   LGIRVNCVSPYAVPTPMSKSFLNTDD----EGIAALYSNLKGVTLKPQDVAEAVVYLGSD  240

Query  352   ESKYVSGVNLIIDGGYSTTNIGF  284
             ESKYVSG +L++DGG++  N G 
Sbjct  241   ESKYVSGHDLVVDGGFTVVNAGM  263



>ref|XP_006384780.1| alcohol dehydroge family protein [Populus trichocarpa]
 gb|ERP62577.1| alcohol dehydroge family protein [Populus trichocarpa]
Length=275

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 126/262 (48%), Positives = 179/262 (68%), Gaps = 4/262 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             +++   +RLEGKVA+ITG A GIG +TAR F  HG KV+IAD  D+  +SV +++  E A
Sbjct  6     LLSTVARRLEGKVALITGGARGIGESTARHFFKHGAKVVIADTQDELAHSVCKDLNSESA  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              FIHCDV  E+ V+NAV+T +SR+GKLD+MF+NAG  G   T++++ ++     V   N+
Sbjct  66    SFIHCDVTKETDVENAVNTAISRHGKLDVMFNNAGIVGVVKTNMVDVSMSEFEEVIRVNL  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             VG+F   KHAARVM PA++GSII ++S      G  SH YT+SK  ++GL ++  VE+G+
Sbjct  126   VGAFLGTKHAARVMKPARQGSIITTSSVCGILGGFASHAYTSSKHGVLGLMRNAAVELGQ  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +GIR NCVS   + T++  + +   D    +EI +   NLKG  LT EDVAEAALYLA +
Sbjct  186   FGIRVNCVSPYTVATEMSRNFLKMTD----DEIRSGYSNLKGAILTPEDVAEAALYLASE  241

Query  352   ESKYVSGVNLIIDGGYSTTNIG  287
             +S+YVSG NL++DGG++  N G
Sbjct  242   DSRYVSGHNLVVDGGHTIVNNG  263



>ref|XP_010104807.1| Momilactone A synthase [Morus notabilis]
 gb|EXC01948.1| Momilactone A synthase [Morus notabilis]
Length=276

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 126/254 (50%), Positives = 178/254 (70%), Gaps = 0/254 (0%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             +RL+GKVAIITG A GIGA+  ++F  +G K++IADI D  G ++A+++G E   +IHCD
Sbjct  11    RRLQGKVAIITGGARGIGASAVKVFHENGAKIVIADIQDAEGQALAKKLGSEDVYYIHCD  70

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V  E  +QN +DTTV++YGKLDIM++NAG       SIL+A   +++LV   N+VG+F  
Sbjct  71    VSNEDDIQNLIDTTVAKYGKLDIMYNNAGVLDKPFGSILDATKSDLDLVIRVNLVGAFLG  130

Query  694   AKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSN  515
             AKHA+RVMIP   G I+F++SA T+  G+ +HTYTASK A++GL K+L  E+G+YGIR N
Sbjct  131   AKHASRVMIPQGNGCILFTSSACTSIAGLGTHTYTASKYAVLGLAKNLAGEVGQYGIRVN  190

Query  514   CVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVS  335
             CVS   ++T +          +  E+ ++   NLKG  L  EDVA+AAL+LA DE+ YVS
Sbjct  191   CVSPFGVVTHMATGGNEGVKVEELEQQISALGNLKGHVLKAEDVAKAALFLASDEAHYVS  250

Query  334   GVNLIIDGGYSTTN  293
             G+NL++DGG+S  N
Sbjct  251   GLNLMVDGGFSIVN  264



>ref|XP_007206370.1| hypothetical protein PRUPE_ppa017863mg [Prunus persica]
 gb|EMJ07569.1| hypothetical protein PRUPE_ppa017863mg [Prunus persica]
Length=270

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 131/263 (50%), Positives = 173/263 (66%), Gaps = 4/263 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             ++AA+ +RLEGKVA+ITG A+GIG +TARLF+ HG KV+IAD+ D    S+ +++     
Sbjct  6     LLAAAARRLEGKVALITGGASGIGESTARLFSKHGAKVVIADVQDNLAESICRDLSSSST  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              F+HCDV  E  V+NAV T  S+YGKLDIMF+NAG AG   T+IL+ +      V   N+
Sbjct  66    SFVHCDVTKEEDVENAVKTATSKYGKLDIMFNNAGIAGIAKTNILDNDKAEFEQVIGVNL  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             VG F   KHAARVMIPA +GSII +ASA +   G  SH YT+SK  ++GL ++  +E+G+
Sbjct  126   VGVFLGIKHAARVMIPAGQGSIINTASACSTIGGCASHAYTSSKHGVLGLMRNTAIELGQ  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +GIR NCVS  I+ T L        D    + +     NLKG  L  ED+AEAALYL  D
Sbjct  186   HGIRVNCVSPYIVATPLAKDFFKLDD----DGVHGVYSNLKGGVLKAEDIAEAALYLGSD  241

Query  352   ESKYVSGVNLIIDGGYSTTNIGF  284
             ESKYVSG NL++DGG++  N  F
Sbjct  242   ESKYVSGHNLLVDGGFTIVNARF  264



>ref|XP_010059374.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=321

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 176/265 (66%), Gaps = 1/265 (0%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
              ++A+ KRLEGKVA+ITG A+GIG  TAR+FAHHG KV+IAD++D  G+SV   +G + A
Sbjct  50    FISAATKRLEGKVALITGGASGIGEITARVFAHHGAKVVIADVNDSLGHSVCDSLGRDTA  109

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              F+HC+V  ES  + AV   VS +GKLDIMF+NAG  G   T I++ +  +   V   NV
Sbjct  110   SFVHCNVTDESQTKAAVAEAVSTFGKLDIMFNNAGIGGLNKTRIIDNDKADFERVLAVNV  169

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
              G F   KHAA+ MIPA++G II +AS S+   G  SH YT +K A++GL ++  VE+G+
Sbjct  170   TGVFLGVKHAAQAMIPARRGCIINTASISSGLGGAASHAYTCAKHAVLGLTRNAAVELGQ  229

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +GIR NC+S    +T L    +     +L E  +    NLKGV+L  EDVA AAL+LAGD
Sbjct  230   FGIRVNCLSPYACVTPLATEFVGVGPAEL-EAAMGALANLKGVTLKAEDVANAALFLAGD  288

Query  352   ESKYVSGVNLIIDGGYSTTNIGFQV  278
             E++YVSG NL IDGG+S  N  F++
Sbjct  289   EARYVSGHNLFIDGGFSVVNPSFRM  313



>ref|XP_010101928.1| Momilactone A synthase [Morus notabilis]
 gb|EXB90576.1| Momilactone A synthase [Morus notabilis]
Length=285

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 139/255 (55%), Positives = 184/255 (72%), Gaps = 4/255 (2%)
 Frame = -1

Query  1051  RLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCDV  872
             RLEGKVAIITG A+GIGA+TARLF  +G KVIIADI D+ G S A+++G E A F+HCDV
Sbjct  25    RLEGKVAIITGGASGIGASTARLFHANGAKVIIADIQDELGRSTAEKLG-ENAYFVHCDV  83

Query  871   RIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFCA  692
               E  V++ VD  V+R+GKLDIM++NAG        ILE+   +++ V   NVVG+F  A
Sbjct  84    SKEDDVRDLVDAAVARHGKLDIMYNNAGVLDKPLAGILESTKSDLDKVVSVNVVGAFLGA  143

Query  691   KHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSNC  512
             KHAARVMIP +KG I+F+ASA T+  G++SH YTASK AI GL ++L  E+G++G+R NC
Sbjct  144   KHAARVMIPRRKGCILFTASACTSIAGLSSHPYTASKYAIWGLARNLAAEVGEFGVRVNC  203

Query  511   VSAAIILTKLGMSIMPTQDRKLA--EEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             VS   +L+  GM+ +     ++A  EE+V+E  NLKG  L  EDVA AAL+LA DE+ YV
Sbjct  204   VSPYAVLST-GMTPISGGAAEVAQMEEMVSEIGNLKGHILKAEDVAMAALFLASDEAHYV  262

Query  337   SGVNLIIDGGYSTTN  293
             SG+NL++DGG+S  N
Sbjct  263   SGLNLLVDGGFSVVN  277



>ref|XP_007207105.1| hypothetical protein PRUPE_ppa020955mg [Prunus persica]
 gb|EMJ08304.1| hypothetical protein PRUPE_ppa020955mg [Prunus persica]
Length=270

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 172/263 (65%), Gaps = 4/263 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             ++AA+ +RLEGKVA+ITG A+GIG +TARLF+ HG +V+IAD+ D    SV +++     
Sbjct  6     LLAAAARRLEGKVALITGGASGIGESTARLFSKHGARVVIADVQDGLAESVCRDLSSSSI  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              F+HCDV  E  V+NAV T   +YGKLDIMF+NAGT G    +IL+ +      V   N+
Sbjct  66    SFVHCDVTKEEDVENAVKTATRKYGKLDIMFNNAGTGGVAKPNILDNDKAEFEQVIRVNL  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             +G+F   KHAARVMIPA +GSII +AS  +   G +SH YT+SK  IVGL ++  VE+G+
Sbjct  126   IGAFLGIKHAARVMIPAGQGSIINTASVCSTIGGGSSHAYTSSKHGIVGLMRNTAVELGQ  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +GIR NCVS  I+ T L  +     D      +     NLKG  L  ED+AEAALYL  D
Sbjct  186   HGIRVNCVSPYIVATPLAKNFFKLDDNG----VHGAYSNLKGGVLKVEDIAEAALYLGSD  241

Query  352   ESKYVSGVNLIIDGGYSTTNIGF  284
             ESKYVSG NL++DGG++  N  F
Sbjct  242   ESKYVSGHNLLVDGGFTIVNPRF  264



>ref|XP_007152489.1| hypothetical protein PHAVU_004G135000g [Phaseolus vulgaris]
 gb|ESW24483.1| hypothetical protein PHAVU_004G135000g [Phaseolus vulgaris]
Length=270

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 133/266 (50%), Positives = 175/266 (66%), Gaps = 6/266 (2%)
 Frame = -1

Query  1081  RQLIMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGP  902
             +QL + A  +RL+GKVA+ITG A GIG   A+LF  HG KV+IADI D+ G ++  EIG 
Sbjct  5     QQLPLLA--QRLDGKVALITGGARGIGEFMAKLFCKHGAKVVIADIRDQLGQALQHEIGT  62

Query  901   EYALFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFD  722
             E A ++HCDV  E+ V+NAV+ TVS+YGKLDIM +NA  +     +IL+ ++ +   V  
Sbjct  63    ECATYVHCDVSKETDVENAVNITVSKYGKLDIMVNNAAISDDAKPNILDNDVTDFERVVR  122

Query  721   TNVVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVE  542
              N+VG F   KHAARVMIPAK+GSII   S S++  G+ SH YT+SK AIVGL K+   E
Sbjct  123   VNLVGPFLGTKHAARVMIPAKRGSIIIVGSVSSSVGGVASHAYTSSKHAIVGLAKNTAAE  182

Query  541   MGKYGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYL  362
             +G++GIR N +S   I  +L        D   +        NLKGV+L  EDVA+AALYL
Sbjct  183   LGQFGIRVNSLSCYCIHNELAKDFFKLDDEGFSNIY----SNLKGVTLKEEDVAQAALYL  238

Query  361   AGDESKYVSGVNLIIDGGYSTTNIGF  284
             A DESKY+SG NL +DGG++T N  F
Sbjct  239   ASDESKYISGHNLAVDGGFTTINPSF  264



>sp|F1SWA0.1|ZERSY_ZINZE RecName: Full=Zerumbone synthase [Zingiber zerumbet]
 dbj|BAK09296.1| short-chain dehydrogenase/reductase1 [Zingiber zerumbet]
Length=267

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 129/266 (48%), Positives = 169/266 (64%), Gaps = 10/266 (4%)
 Frame = -1

Query  1051  RLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPE-YALFIHCD  875
             RLEGKVA++TG A+GIG + ARLF  HG K+ I D+ D+ G  V+Q +G + +A + HCD
Sbjct  2     RLEGKVALVTGGASGIGESIARLFIEHGAKICIVDVQDELGQQVSQRLGGDPHACYFHCD  61

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V +E  V+ AVD T  +YG +DIM +NAG  G +   I +A+      VFD NV G F  
Sbjct  62    VTVEDDVRRAVDFTAEKYGTIDIMVNNAGITGDKVIDIRDADFNEFKKVFDINVNGVFLG  121

Query  694   AKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSN  515
              KHAAR+MIP  KGSI+  AS S+   G   H YT +K A+VGL KS+  E+G++GIR N
Sbjct  122   MKHAARIMIPKMKGSIVSLASVSSVIAGAGPHGYTGAKHAVVGLTKSVAAELGRHGIRVN  181

Query  514   CVSAAIILTKLGMSIMPTQDRKLAEE-------IVAEAPNLKGVSLTTEDVAEAALYLAG  356
             CVS   + T+L M  +P  + ++ E+        V    NLKGV L   DVAEA LYLA 
Sbjct  182   CVSPYAVPTRLSMPYLP--ESEMQEDALRGFLTFVRSNANLKGVDLMPNDVAEAVLYLAT  239

Query  355   DESKYVSGVNLIIDGGYSTTNIGFQV  278
             +ESKYVSG+NL+IDGG+S  N   QV
Sbjct  240   EESKYVSGLNLVIDGGFSIANHTLQV  265



>ref|XP_009411944.1| PREDICTED: momilactone A synthase-like [Musa acuminata subsp. 
malaccensis]
Length=275

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 131/264 (50%), Positives = 171/264 (65%), Gaps = 2/264 (1%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             + A  K+LEGKVA+ITG A+GIG  TA+LF  HG KV++AD+ D+ G +V   +GP  A 
Sbjct  7     LPADAKKLEGKVALITGGASGIGECTAKLFCRHGAKVVVADVQDELGTAVCSGLGPA-AS  65

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             FIHCDV  E  V  AVD  V+++G+LDIMF+NAG  G+   +IL+    +   V   N+V
Sbjct  66    FIHCDVTSEDDVSAAVDHAVAKFGRLDIMFNNAGITGAACHNILQCEKSDFERVVGVNLV  125

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             G F   KHAARVMIPA+KGSII ++S +       +H YT SK A+VGL K+   E+G++
Sbjct  126   GPFLGTKHAARVMIPARKGSIITTSSLAGVIGAAAAHAYTCSKHAVVGLTKNAAAELGQF  185

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
             G+R NCVS A   T L M  +  +       + A A NLKGVSL TEDVA+A LYLA D+
Sbjct  186   GVRVNCVSPAAAATPLAMRYVGLEGEAFDMAMTAVA-NLKGVSLGTEDVADAVLYLASDD  244

Query  349   SKYVSGVNLIIDGGYSTTNIGFQV  278
             SKYVSG NL++DGG S     F +
Sbjct  245   SKYVSGHNLVLDGGCSVAYPSFNL  268



>gb|KHN21175.1| Momilactone A synthase [Glycine soja]
Length=304

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 128/261 (49%), Positives = 171/261 (66%), Gaps = 10/261 (4%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             +++A+ +RLEGKVAIITG A        RLF+ HG  V+IADI D  G S+ + +  E A
Sbjct  6     LVSATGRRLEGKVAIITGGAEATA----RLFSKHGAHVVIADIQDDLGLSICKHL--ESA  59

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              ++HCDV  E+ V+N V+TTVS++GKLDIMF+NAG  G   TSIL+        V + N+
Sbjct  60    SYVHCDVTNETDVENCVNTTVSKHGKLDIMFNNAGITGVNKTSILDNTKSEFEEVINVNL  119

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             VG F   KHAARVMIPA++GSI+ +AS   +  G+ SH YT+SK A+VGL K+  VE+G 
Sbjct  120   VGVFLGTKHAARVMIPARRGSIVNTASVCGSIGGVASHAYTSSKHAVVGLTKNTAVELGA  179

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +G+R NCVS  ++ T L  +     D    + +     NLKG  L   DVAEAALYLA D
Sbjct  180   FGVRVNCVSPYVVATPLAKNFFKLDD----DGVQGIYSNLKGTDLVPNDVAEAALYLASD  235

Query  352   ESKYVSGVNLIIDGGYSTTNI  290
             ESKYVSG NL++DGG++  N+
Sbjct  236   ESKYVSGHNLVVDGGFTVVNM  256



>gb|KDP26161.1| hypothetical protein JCGZ_22863 [Jatropha curcas]
Length=270

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 128/269 (48%), Positives = 178/269 (66%), Gaps = 6/269 (2%)
 Frame = -1

Query  1063  ASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPE--YAL  890
             A L+RLEGKVA+ITGAA+GIG  TARLF+ HG +V+IADI D+ G+SV +EI  +  Y  
Sbjct  6     AGLRRLEGKVALITGAASGIGECTARLFSKHGAQVVIADIQDELGHSVRKEIDRDGKYCS  65

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             F+HCDV  E  V+NAV++ VS+YG+LDIMF+NAG  G+   +IL+        +   N+V
Sbjct  66    FVHCDVTKEEDVENAVNSAVSKYGELDIMFNNAGIVGAVKPNILDNEKAEFEKIISVNLV  125

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             G+F   KHAARVMIP +KGSI+ +AS ++   G+  H YT+SK  +VGL ++  VE+G++
Sbjct  126   GAFLGTKHAARVMIPNRKGSIMTTASVASTIGGLAPHAYTSSKHGVVGLMRNTAVELGQH  185

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
             GIR NC+S  ++ T L        D  + +       NLK   L  EDVA+AALYL  D+
Sbjct  186   GIRVNCISPYVVNTPLARDFFKLDDHGVYDVY----SNLKEAVLEPEDVAQAALYLGSDD  241

Query  349   SKYVSGVNLIIDGGYSTTNIGFQVAVEKV  263
             SKY+SG N+IIDGG++  N  F +  + +
Sbjct  242   SKYISGHNMIIDGGFTIVNPAFSIFPQSI  270



>ref|XP_002272838.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=269

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 129/251 (51%), Positives = 170/251 (68%), Gaps = 7/251 (3%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             +RLEGKVA+ITG A GIG+ TA+LF  HG KV+IADI  + G+S+ +++GP  A F+HCD
Sbjct  12    RRLEGKVAVITGGAGGIGSCTAKLFCQHGAKVLIADIQYEKGHSICKDLGPTSASFVHCD  71

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V  E  V NA+D  +S+YGKLDIMF+NAG  G    +IL+ + +        NV+G+F  
Sbjct  72    VTKELDVGNAIDKAISKYGKLDIMFNNAGILGPYRPNILDNDADEFENTMRVNVLGTFLG  131

Query  694   AKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSN  515
              KHAARVM PA +GSII +AS  +   G+ +H+YT+SK AI+GL ++  VE+GK+GIR N
Sbjct  132   TKHAARVMAPAGRGSIINTASVCSVVGGVATHSYTSSKHAILGLTRNTAVELGKFGIRVN  191

Query  514   CVSAAIILTKLGMSIMPTQDRKLAEE--IVAEAPNLKGVSLTTEDVAEAALYLAGDESKY  341
             CVS  ++ T L    M      L E+   V    NLKGVSL  EDVAEA LY+  D+SKY
Sbjct  192   CVSPYLVPTSLSRKFM-----NLGEDDPFVKVYSNLKGVSLEVEDVAEAVLYMGSDDSKY  246

Query  340   VSGVNLIIDGG  308
             VSG NL++DGG
Sbjct  247   VSGHNLVLDGG  257



>ref|XP_010059365.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
 gb|KCW90499.1| hypothetical protein EUGRSUZ_A02618 [Eucalyptus grandis]
Length=277

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 131/265 (49%), Positives = 175/265 (66%), Gaps = 1/265 (0%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
              ++A+ KRLEGKVA+ITG A+GIG  TAR+FAHHG KV+IAD++D  G+S+   +  + A
Sbjct  6     FISAAAKRLEGKVALITGGASGIGEITARVFAHHGAKVVIADVNDSLGHSIRDSLSRDNA  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              F+HCDV  ES V+ AV   VS YGKLDIMF+NAG  G   + I++ +  +   V   NV
Sbjct  66    SFVHCDVTDESQVKAAVAEAVSTYGKLDIMFNNAGITGPNKSRIVDNDKADFERVLAVNV  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
              G F   KHAA+ MIP ++G II +AS S+   GITSH YT +K A++GL ++  VE+G+
Sbjct  126   TGVFLGMKHAAQAMIPVRRGCIINTASISSGLAGITSHAYTCAKHAVLGLTRNAAVELGQ  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +GIR NC+S     T L          +L E  +    NLKGV+L  EDVA AAL+LAGD
Sbjct  186   FGIRVNCLSPNACATPLATKFFGMGPAEL-EAAIDAVTNLKGVTLKVEDVANAALFLAGD  244

Query  352   ESKYVSGVNLIIDGGYSTTNIGFQV  278
             E++YVSG NL IDGG+S  N  F++
Sbjct  245   EARYVSGHNLFIDGGFSVVNSSFRL  269



>gb|KCW83006.1| hypothetical protein EUGRSUZ_C04389, partial [Eucalyptus grandis]
Length=265

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 131/263 (50%), Positives = 169/263 (64%), Gaps = 4/263 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             ++    +RLEGKVA+ITG A GIG +TARLF  HG KVIIADI D  G  V +++G E A
Sbjct  6     LLPQEARRLEGKVAVITGGAGGIGESTARLFLKHGAKVIIADIRDDLGKLVCKDLGAETA  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              F+HCDV IES V+NA+ T V ++GKLDIM +NA  +     +IL+ +  +   V   N+
Sbjct  66    SFVHCDVSIESDVENAIATAVDKFGKLDIMVNNAAISDPPKANILDNDKADFERVISVNL  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
              G F   KHAAR MIP++ GSII   S S++  G+ SH YT+SK A+VGL +++  E+G+
Sbjct  126   TGVFLGTKHAARAMIPSRSGSIINVGSVSSSVGGVASHAYTSSKHAVVGLTRNVAAELGR  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             YGIR NCVS   ILT L        +       V    NL GVSL  EDVA+AA+YL  D
Sbjct  186   YGIRVNCVSPYFILTPLTKEFFKVDE----SSGVRVYSNLDGVSLQEEDVAKAAVYLGSD  241

Query  352   ESKYVSGVNLIIDGGYSTTNIGF  284
             ESKYVSG NL +DGG++T N  F
Sbjct  242   ESKYVSGQNLAVDGGFTTINPAF  264



>ref|XP_007152499.1| hypothetical protein PHAVU_004G135300g [Phaseolus vulgaris]
 gb|ESW24493.1| hypothetical protein PHAVU_004G135300g [Phaseolus vulgaris]
Length=270

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 133/266 (50%), Positives = 175/266 (66%), Gaps = 6/266 (2%)
 Frame = -1

Query  1081  RQLIMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGP  902
             +QL + A  +RL+GKVA+ITG A GIG   A+LF  HG KV+IADI D+ G ++  EIG 
Sbjct  5     QQLPLLA--QRLDGKVALITGGARGIGEFMAKLFCKHGAKVVIADIRDQLGQALQHEIGT  62

Query  901   EYALFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFD  722
             E A ++HCDV  E+ V+NAV+ TVS+YGKLDIM +NA  +     +IL+ ++ +   V  
Sbjct  63    ECATYVHCDVSKETDVENAVNITVSKYGKLDIMVNNAAISDDAKPNILDNDVTDFERVVR  122

Query  721   TNVVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVE  542
              N+VG F   KHAARVMIPAK+GSII   S S++  G+ SH YT+SK AIVGL K+   E
Sbjct  123   VNLVGPFLGTKHAARVMIPAKRGSIIIVGSVSSSVGGVASHAYTSSKHAIVGLAKNTAAE  182

Query  541   MGKYGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYL  362
             +G++GIR N +S   I  +L        D   +        NLKGV+L  EDVA+AALYL
Sbjct  183   LGQFGIRVNSLSCYCIHNELAKDFFKLDDEGFSNIY----SNLKGVTLKEEDVAQAALYL  238

Query  361   AGDESKYVSGVNLIIDGGYSTTNIGF  284
             A DESKY+SG NL +DGG++T N  F
Sbjct  239   ASDESKYISGHNLAVDGGFTTINPSF  264



>ref|XP_010050120.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=270

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 131/263 (50%), Positives = 169/263 (64%), Gaps = 4/263 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             ++    +RLEGKVA+ITG A GIG +TARLF  HG KVIIADI D  G  V +++G E A
Sbjct  6     LLPQEARRLEGKVAVITGGAGGIGESTARLFLKHGAKVIIADIRDDLGKLVCKDLGAETA  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              F+HCDV IES V+NA+ T V ++GKLDIM +NA  +     +IL+ +  +   V   N+
Sbjct  66    SFVHCDVSIESDVENAIATAVDKFGKLDIMVNNAAISDPPKANILDNDKADFERVISVNL  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
              G F   KHAAR MIP++ GSII   S S++  G+ SH YT+SK A+VGL +++  E+G+
Sbjct  126   TGVFLGTKHAARAMIPSRSGSIINVGSVSSSVGGVASHAYTSSKHAVVGLTRNVAAELGR  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             YGIR NCVS   ILT L        +       V    NL GVSL  EDVA+AA+YL  D
Sbjct  186   YGIRVNCVSPYFILTPLTKEFFKVDE----SSGVRVYSNLDGVSLQEEDVAKAAVYLGSD  241

Query  352   ESKYVSGVNLIIDGGYSTTNIGF  284
             ESKYVSG NL +DGG++T N  F
Sbjct  242   ESKYVSGQNLAVDGGFTTINPAF  264



>ref|XP_007043248.1| Short chain alcohol dehydrogenase [Theobroma cacao]
 gb|EOX99079.1| Short chain alcohol dehydrogenase [Theobroma cacao]
Length=271

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 133/262 (51%), Positives = 172/262 (66%), Gaps = 4/262 (2%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             +  + +RLEGKVA+ITG A+GIG   ARLF  HG KVIIADI D+ G SV ++IG   A 
Sbjct  7     LPPAARRLEGKVALITGGASGIGECIARLFCEHGAKVIIADIQDELGQSVCKDIGLAVAS  66

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             F+HCD+  ES V+ AV+T +S +GKLDIM +NA        SI+E N+ +   V   N+ 
Sbjct  67    FVHCDIVKESDVEIAVNTAISLHGKLDIMVNNAAVIDDAKPSIVENNVADFERVISVNLT  126

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             G F   KHAARVMIPA+KGSII   S S++  G+ SH YT+SK AI+GL K++  E+G++
Sbjct  127   GVFLGTKHAARVMIPARKGSIISLGSVSSSVGGVASHAYTSSKHAILGLTKNVAAELGRF  186

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
             GIR NC+S+  I T+  M+          +E      NLKGV L  EDVA+AALYL  DE
Sbjct  187   GIRVNCLSSYFIATRSAMNFFKLD----GDERPRVYSNLKGVVLQQEDVADAALYLGSDE  242

Query  349   SKYVSGVNLIIDGGYSTTNIGF  284
             SKYVSG NL +DGG++T N  F
Sbjct  243   SKYVSGHNLAVDGGFTTINPAF  264



>ref|XP_007027886.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY08388.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=276

 Score =   206 bits (525),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 123/260 (47%), Positives = 173/260 (67%), Gaps = 1/260 (0%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             +++A  +RLEGKVA+ITG A+GIG  TA++FAHHG KV+IADI D+ G+SV + +GP   
Sbjct  6     LISAVTRRLEGKVALITGGASGIGKCTAKVFAHHGAKVVIADIQDELGHSVCEAVGPSNC  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              ++HC+V  E  ++NAVD  V+ +GKLDIMF+NAG        I++    +   V   NV
Sbjct  66    SYVHCNVTDEDQIKNAVDKAVATHGKLDIMFNNAGITDPIKARIIDNEKSDFERVLSVNV  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
              G F   KHAARVM+PA+ GSII +AS S+      +H Y ASK A++GL ++  VE+G+
Sbjct  126   TGVFLGIKHAARVMVPARSGSIISTASVSSTVGAAATHAYCASKHAVLGLTRNAAVELGQ  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +GIR NC+S   + T L   ++   D +L E+ +    NLKGV+L  ED+A AALYLA +
Sbjct  186   FGIRVNCLSPFALATPLATEVLGINDEEL-EKGMGLVANLKGVTLKAEDIANAALYLASE  244

Query  352   ESKYVSGVNLIIDGGYSTTN  293
             E +YVSG NL +DGG++  N
Sbjct  245   EGRYVSGHNLFVDGGFTIFN  264



>ref|XP_010040326.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
 gb|KCW45304.1| hypothetical protein EUGRSUZ_L01033 [Eucalyptus grandis]
Length=270

 Score =   206 bits (525),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 126/263 (48%), Positives = 172/263 (65%), Gaps = 4/263 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             +++ + +RLEGKVA+ITG A GIG +TARLF+ HG +VIIADI D  G SV +++GPE A
Sbjct  6     LLSRAARRLEGKVAVITGGAGGIGESTARLFSKHGARVIIADIRDDLGESVCKDLGPETA  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              F+HCDV  ES V+ A++T V ++GKLDIM +NA T      +IL+ +  +   V   N+
Sbjct  66    SFVHCDVSSESDVEKAINTAVDKHGKLDIMVNNAATGEPVKANILDNDKADFERVVSVNL  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
              G F   KHAAR MIP+++GSII   S S++  G+  H YT+SK  +VGL +++  E+G+
Sbjct  126   TGVFLGTKHAARAMIPSRRGSIINVGSVSSSVGGVAPHAYTSSKHGVVGLTRNVAAELGR  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             YGIR NC+S   IL+ L           +    V    NL GVSL  EDVAEA+L+L  D
Sbjct  186   YGIRVNCLSPYFILSPLSREFFNV----VRNGRVGVYSNLDGVSLQKEDVAEASLFLGSD  241

Query  352   ESKYVSGVNLIIDGGYSTTNIGF  284
             ESKY+SG NL +DGG++T N  F
Sbjct  242   ESKYISGHNLAVDGGFTTINPAF  264



>ref|XP_009340879.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=273

 Score =   206 bits (525),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 131/255 (51%), Positives = 166/255 (65%), Gaps = 4/255 (2%)
 Frame = -1

Query  1048  LEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCDVR  869
             LEGKVA+ITG A+GIG +TAR+F+ HG KV+IAD+ D  G SV  ++      F+HCDV 
Sbjct  17    LEGKVALITGGASGIGESTARVFSKHGAKVVIADVQDDLGESVCTDLNSSSVSFVHCDVT  76

Query  868   IESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFCAK  689
              E  ++NAV T  S+YGKLDIMF+NAG  G+   +IL+ +      V   N+VGSF   K
Sbjct  77    KEEDIENAVKTATSKYGKLDIMFNNAGIGGTPKPNILDNDKAEFEQVLSVNLVGSFLGTK  136

Query  688   HAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSNCV  509
             HAARVMIPA +GSII +AS  +   G +SH YT+SK  +VGL K+  VE+G+YGIR NCV
Sbjct  137   HAARVMIPAGQGSIINTASVCSTIGGGSSHAYTSSKHGVVGLMKNAAVELGQYGIRVNCV  196

Query  508   SAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVSGV  329
             S  ++ T L        D    + +     NLKG  L  EDVAEAALYL  DESKYVSG 
Sbjct  197   SPYLVATPLAKDFFNLDD----DGVHGVYSNLKGKVLRPEDVAEAALYLGSDESKYVSGH  252

Query  328   NLIIDGGYSTTNIGF  284
             NL++DGG+S  N  F
Sbjct  253   NLLVDGGFSIVNPMF  267



>ref|XP_006303255.1| hypothetical protein CARUB_v10009938mg [Capsella rubella]
 gb|EOA36153.1| hypothetical protein CARUB_v10009938mg [Capsella rubella]
Length=284

 Score =   207 bits (526),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 130/269 (48%), Positives = 168/269 (62%), Gaps = 10/269 (4%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQ-----EIGPEYAL  890
             +RL GKVA+ITG A GIG + ARLF  HG KV I D+ D  G+ V +     E G E A 
Sbjct  14    QRLLGKVALITGGATGIGESIARLFHKHGAKVCIVDLQDDLGHEVCKTLLSGEPGKETAS  73

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             FIH DVR+E  + NAVD  V ++GKLDI  +NAG  G+    I   +L    ++FD NV 
Sbjct  74    FIHGDVRVEGDISNAVDFAVKQFGKLDIFINNAGLCGAPCPDIRNCSLTEFEMIFDVNVK  133

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             G+F   KHAARVMIP KKGSI+   S      G+  H Y  SK A++GL +S+  E+G++
Sbjct  134   GAFLGMKHAARVMIPEKKGSIVSLCSVGGVMGGVGPHAYVGSKHAVLGLTRSVAAELGQH  193

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLA-----EEIVAEAPNLKGVSLTTEDVAEAALY  365
             GIR NCVS   +LTKL M+ +P ++R            A   NLKGV LT +DVA A L+
Sbjct  194   GIRVNCVSPYAVLTKLAMAHLPEEERTEDAFVGFRNFAATNANLKGVDLTVDDVANAVLF  253

Query  364   LAGDESKYVSGVNLIIDGGYSTTNIGFQV  278
             LA DES+Y+SG NL+IDGG++ TN  F+V
Sbjct  254   LASDESRYISGDNLMIDGGFTCTNHSFKV  282



>emb|CDP20942.1| unnamed protein product [Coffea canephora]
Length=279

 Score =   206 bits (525),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 129/259 (50%), Positives = 176/259 (68%), Gaps = 1/259 (0%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             +A+S KRL+GKVAIITG A+GIGA  ARLF  +G KV++ADI D  G ++A E+G   A 
Sbjct  7     VASSSKRLDGKVAIITGGASGIGAAAARLFHSNGAKVVLADIQDNLGQAIANELGKN-AC  65

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             +IHCDV  E  V + +DT +++YG+LDIM++NAG       +ILE +   ++ V   N+V
Sbjct  66    YIHCDVSQEDQVFDLIDTIIAKYGQLDIMYNNAGITEGSKIAILETSKSELDRVIGVNLV  125

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             GSF  AKHAARVMIP ++G I+F+ASAS    G+  H YTA+K AI GL K+L  E+G++
Sbjct  126   GSFLGAKHAARVMIPRRRGCILFTASASVNIAGLGPHAYTATKHAIAGLAKNLSAELGQH  185

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
             GIR NCVS   ++T +       +     +  V    NLKG +LT +DVA+AALYLA DE
Sbjct  186   GIRVNCVSPYAVMTGIAAGNYSEEYIAQMQMFVNAVANLKGKTLTADDVAQAALYLASDE  245

Query  349   SKYVSGVNLIIDGGYSTTN  293
             + YVSG+NL++DGG+S  N
Sbjct  246   AGYVSGLNLVVDGGFSVVN  264



>emb|CBI28275.3| unnamed protein product [Vitis vinifera]
Length=861

 Score =   218 bits (555),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 136/265 (51%), Positives = 178/265 (67%), Gaps = 5/265 (2%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIG-PEYA  893
             ++A+ +RL+GKVA+ITG A+GIG +TARLF+ HG KV+IADI D  G SV +E+  P  A
Sbjct  600   ISAAARRLQGKVALITGGASGIGESTARLFSRHGAKVVIADIQDNLGQSVCKELSSPTSA  659

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              F+HCDV  E  V+NA++  V++YGKLDIMF+NAG  G    +IL+ +      + + NV
Sbjct  660   SFVHCDVTSEKDVENAINVAVAKYGKLDIMFNNAGIVGESKPNILDNDKTEFEKILNVNV  719

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             VG+F   KHAARVMIPA  GSII +AS  +   G+ SH YT+SK A+VGL ++  VE+GK
Sbjct  720   VGAFLGTKHAARVMIPAGNGSIITTASVCSTVGGVASHAYTSSKHAVVGLARNAAVELGK  779

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             YGIR NCVS  +++T L        D   +        NLKG  L  EDVAEAALYLA +
Sbjct  780   YGIRVNCVSPYLVVTPLAKDFFKLDDDGAS----GVYSNLKGKVLNPEDVAEAALYLASE  835

Query  352   ESKYVSGVNLIIDGGYSTTNIGFQV  278
             ESKYVSG NL+IDGG++  N  F +
Sbjct  836   ESKYVSGHNLLIDGGFTIVNPAFGI  860


 Score =   216 bits (551),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 138/267 (52%), Positives = 175/267 (66%), Gaps = 7/267 (3%)
 Frame = -1

Query  1084  RRQLIMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIG  905
             + QL++      L GKVA+ITG A+GIG +TARLF+ HG KV+IADI D  G SV +++ 
Sbjct  276   KSQLLLEG---MLNGKVALITGGASGIGESTARLFSRHGAKVVIADIQDNLGLSVCKDLS  332

Query  904   PEYALFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVF  725
             P  A F+HCDV  E  V+NAV+  V+ +GKLDIMF+NAG AG     IL+ +      V 
Sbjct  333   PTSASFVHCDVTNEKEVENAVNLAVATHGKLDIMFNNAGIAGEAKPHILDNDKTEFERVL  392

Query  724   DTNVVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCV  545
             + NVVG+F   KHAARVMIPA  GSII +AS  +   G  SH YT+SK A+VGL ++  V
Sbjct  393   NVNVVGAFLGTKHAARVMIPAGNGSIITTASVCSTVGGGASHAYTSSKHAVVGLARNAAV  452

Query  544   EMGKYGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALY  365
             E+GKYGIR NCVS  ++ T L   +    D    + +     NLKG  L  EDVAEAALY
Sbjct  453   ELGKYGIRVNCVSPYLVATPLAKDLFKLDD----DGVSGVYSNLKGKVLNAEDVAEAALY  508

Query  364   LAGDESKYVSGVNLIIDGGYSTTNIGF  284
             LAGDESKYVSG NL++DGG++  N  F
Sbjct  509   LAGDESKYVSGHNLLVDGGFTVVNPSF  535


 Score =   206 bits (523),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 126/250 (50%), Positives = 169/250 (68%), Gaps = 3/250 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             +RLEGKVA+ITG A GIG+ TA+LF  HG KV+IADI  + G+S+ +++GP  A F+HCD
Sbjct  12    RRLEGKVAVITGGAGGIGSCTAKLFCQHGAKVLIADIQYEKGHSICKDLGPTSASFVHCD  71

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V  E  V NA+D  +S+YGKLDIMF+NAG  G    +IL+ + +        NV+G+F  
Sbjct  72    VTKELDVGNAIDKAISKYGKLDIMFNNAGILGPYRPNILDNDADEFENTMRVNVLGTFLG  131

Query  694   AKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSN  515
              KHAARVM PA +GSII +AS  +   G+ +H+YT+SK AI+GL ++  VE+GK+GIR N
Sbjct  132   TKHAARVMAPAGRGSIINTASVCSVVGGVATHSYTSSKHAILGLTRNTAVELGKFGIRVN  191

Query  514   CVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVS  335
             CVS  ++ T L    M   +    +  V    NLKGVSL  EDVAEA LY+  D+SKYVS
Sbjct  192   CVSPYLVPTSLSRKFMNLGED---DPFVKVYSNLKGVSLEVEDVAEAVLYMGSDDSKYVS  248

Query  334   GVNLIIDGGY  305
             G NL++DG +
Sbjct  249   GHNLVLDGSF  258



>ref|XP_004981317.1| PREDICTED: zerumbone synthase-like [Setaria italica]
Length=329

 Score =   208 bits (529),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 124/259 (48%), Positives = 159/259 (61%), Gaps = 5/259 (2%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             KRLEGKVA++TG A GIG    RLF  HG K+ IADI D+ G  +   +G +  +F+HCD
Sbjct  63    KRLEGKVALVTGGATGIGEAIVRLFREHGAKICIADIQDEAGQQLRDALGDQDVMFVHCD  122

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V +E  V  AVD    R+G LD+M +NAG  GS+ T I   +   +  VFD NV G F  
Sbjct  123   VTVEDEVSAAVDAVAQRFGSLDVMVNNAGITGSKVTDIRNVDFAEVRKVFDINVHGVFLG  182

Query  694   AKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSN  515
              KHAARVMIP K+GSI+  AS ++   G+  H YTASK A+ GL KS+  E+G++G+R N
Sbjct  183   MKHAARVMIPQKRGSIVSLASVASVIGGMGPHAYTASKHAVAGLTKSVAGELGRHGVRVN  242

Query  514   CVSAAIILTKLGMSIMPTQDR-----KLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
             CVS   + T L M  +P   R     K     V    NLKGV L   DVAEA LYLA DE
Sbjct  243   CVSPYAVPTALSMPHLPQGARADDALKDFLAFVGGEANLKGVDLMPRDVAEAVLYLASDE  302

Query  349   SKYVSGVNLIIDGGYSTTN  293
             ++YVS +NL +DGG++  N
Sbjct  303   ARYVSALNLTVDGGFTAVN  321



>ref|XP_010227919.1| PREDICTED: zerumbone synthase isoform X1 [Brachypodium distachyon]
Length=283

 Score =   206 bits (525),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 126/264 (48%), Positives = 165/264 (63%), Gaps = 12/264 (5%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA---LFI  884
             +RLEGKVA++TG A+GIG    RLF  HG KV IAD+ D+ G  V   +G +     LF+
Sbjct  14    RRLEGKVALVTGGASGIGEAIVRLFRQHGAKVCIADVQDEAGQQVRDSLGDDAGTDVLFV  73

Query  883   HCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGS  704
             HCDV +E  V  AVD    ++G LDIM +NAG  G + T I   +   +  VFD NV G 
Sbjct  74    HCDVTVEEDVSRAVDAAAEKFGTLDIMVNNAGITGDKVTDIRNLDFAEVRKVFDINVHGM  133

Query  703   FFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGI  524
                 KHAARVMIP KKGSI+  AS ++   G+  H YTASK A+VGL KS+ +E+GK+GI
Sbjct  134   LLGMKHAARVMIPGKKGSIVSLASVASVMGGMGPHAYTASKHAVVGLTKSVALELGKHGI  193

Query  523   RSNCVSAAIILTKLGMSIMPTQDRK-------LAEEIVAEAPNLKGVSLTTEDVAEAALY  365
             R NCVS   + T L M  +P  + K       LA   V    NLKGV L  +DVA+A LY
Sbjct  194   RVNCVSPYAVPTALSMPHLPQGEHKGDAVRDFLA--FVGGEANLKGVDLLPKDVAQAVLY  251

Query  364   LAGDESKYVSGVNLIIDGGYSTTN  293
             LA DE++Y+S +NL++DGG+++ N
Sbjct  252   LASDEARYISALNLVVDGGFTSVN  275



>ref|XP_008443590.1| PREDICTED: tropinone reductase-like 1 [Cucumis melo]
Length=277

 Score =   206 bits (524),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 128/267 (48%), Positives = 183/267 (69%), Gaps = 4/267 (1%)
 Frame = -1

Query  1060  SLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIH  881
             SL++LEGKVA+ITG A+GIGA+T R+F  +G KVIIADI D+ G  +A ++G + + +IH
Sbjct  12    SLRKLEGKVAVITGGASGIGASTVRIFHENGAKVIIADIQDEVGQKLADKLGEDVS-YIH  70

Query  880   CDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSF  701
             CDV  E +V   VDTTV R+GKLDIM++NAG    +   IL+    +++ V   NV+G+F
Sbjct  71    CDVTQEDNVAKLVDTTVHRHGKLDIMYNNAGVIDRKLGGILDVTKSDLDKVVGVNVMGAF  130

Query  700   FCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIR  521
             + AKHAARVMIP K G I+F++SA+T   G+++H Y +SKCA++GL ++L VE+GK+ IR
Sbjct  131   WGAKHAARVMIPKKNGCILFTSSATTNIAGLSTHPYASSKCAVLGLVRNLTVELGKHSIR  190

Query  520   SNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKY  341
              NCV+  I+ T +  + +P    K  E +     NLKG  L  +D+A+A LYLA D++ Y
Sbjct  191   VNCVAPFIVATGISGTRVPA---KAIETMATSWANLKGRVLKADDIAKAVLYLASDDANY  247

Query  340   VSGVNLIIDGGYSTTNIGFQVAVEKVL  260
             VSG+NL++DGGYS  N      V + L
Sbjct  248   VSGLNLVVDGGYSVVNPSMLQTVNRFL  274



>ref|XP_006843399.1| hypothetical protein AMTR_s00053p00124300 [Amborella trichopoda]
 gb|ERN05074.1| hypothetical protein AMTR_s00053p00124300 [Amborella trichopoda]
Length=304

 Score =   207 bits (526),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 174/262 (66%), Gaps = 6/262 (2%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             + AS+ RLEGKVA++TG ANGIGA  A  FA HG +V IAD++D  G SV Q IGP  A 
Sbjct  35    LNASVGRLEGKVALVTGGANGIGAAIACHFAAHGARVCIADLEDDAGRSVCQSIGP-LAS  93

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             ++HC+V IES V NAV+ T S +G LDI+ +NAG AG     I +A  ++   V D NV 
Sbjct  94    YVHCNVTIESDVSNAVNATESTHGPLDILVNNAGIAGPPYRDIRDALTDDFQRVIDVNVR  153

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             G F C KHAARVMIP  KG II  AS +    G+ SH Y ASK A+VG+ K+   E+G +
Sbjct  154   GVFLCTKHAARVMIPRNKGCIISIASTAAVRGGLASHAYAASKHAVVGITKNCAAELGAH  213

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRK-----LAEEIVAEAPNLKGVSLTTEDVAEAALY  365
             GI+ NC+S   I T+L M  +P  + +       E  VA+  NLKG +LT +D+A+AA+Y
Sbjct  214   GIKVNCISPHAIATRLSMPYLPENEGEGEAVAAFENFVAKNANLKGPTLTVDDIAQAAVY  273

Query  364   LAGDESKYVSGVNLIIDGGYST  299
             LA DE+KYVSG+NL++DGG+++
Sbjct  274   LASDEAKYVSGLNLVVDGGFTS  295



>ref|XP_003563948.1| PREDICTED: zerumbone synthase isoform X2 [Brachypodium distachyon]
Length=282

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 126/263 (48%), Positives = 164/263 (62%), Gaps = 12/263 (5%)
 Frame = -1

Query  1051  RLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA---LFIH  881
             RLEGKVA++TG A+GIG    RLF  HG KV IAD+ D+ G  V   +G +     LF+H
Sbjct  14    RLEGKVALVTGGASGIGEAIVRLFRQHGAKVCIADVQDEAGQQVRDSLGDDAGTDVLFVH  73

Query  880   CDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSF  701
             CDV +E  V  AVD    ++G LDIM +NAG  G + T I   +   +  VFD NV G  
Sbjct  74    CDVTVEEDVSRAVDAAAEKFGTLDIMVNNAGITGDKVTDIRNLDFAEVRKVFDINVHGML  133

Query  700   FCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIR  521
                KHAARVMIP KKGSI+  AS ++   G+  H YTASK A+VGL KS+ +E+GK+GIR
Sbjct  134   LGMKHAARVMIPGKKGSIVSLASVASVMGGMGPHAYTASKHAVVGLTKSVALELGKHGIR  193

Query  520   SNCVSAAIILTKLGMSIMPTQDRK-------LAEEIVAEAPNLKGVSLTTEDVAEAALYL  362
              NCVS   + T L M  +P  + K       LA   V    NLKGV L  +DVA+A LYL
Sbjct  194   VNCVSPYAVPTALSMPHLPQGEHKGDAVRDFLA--FVGGEANLKGVDLLPKDVAQAVLYL  251

Query  361   AGDESKYVSGVNLIIDGGYSTTN  293
             A DE++Y+S +NL++DGG+++ N
Sbjct  252   ASDEARYISALNLVVDGGFTSVN  274



>dbj|BAE72097.1| Lactuca sativa short-chain dehydrogenase/reductase 2
Length=271

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 131/266 (49%), Positives = 173/266 (65%), Gaps = 5/266 (2%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             MA + +RLEGKVA+ITGAA+GIG   A+LFA HG K++IADI D+ G +V + IG   ++
Sbjct  1     MATTTRRLEGKVALITGAASGIGECAAKLFAEHGAKIVIADIQDQLGQAVCEAIGSSNSI  60

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             +IHCDV  E  V+ AVD  ++ YGKLDIMF NAG        I++    +   V   NV 
Sbjct  61    YIHCDVTNEEDVRKAVDIAIATYGKLDIMFCNAGIIDPNKDHIIDNEKSDFERVLSVNVT  120

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             G F   KHAARVM+P + GSII +AS  +   G+  H YT SK A+ GL K+L VE+G++
Sbjct  121   GVFLSMKHAARVMVPTRAGSIISTASVVSNIGGLCPHAYTCSKHAVAGLTKNLAVELGQF  180

Query  529   GIRSNCVSAAIILTK--LGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAG  356
             GIR NC+S   I T    G + +  +D K     VA   NLKGV+LTT+DVA+AA++LA 
Sbjct  181   GIRVNCLSPYAIDTPQATGFTGLKGEDFKNKVNSVA---NLKGVTLTTDDVAKAAVFLAS  237

Query  355   DESKYVSGVNLIIDGGYSTTNIGFQV  278
             DE+KY+SG NL IDGG+S  N  F +
Sbjct  238   DEAKYISGHNLFIDGGFSIVNPSFNM  263



>gb|EMT02624.1| Xanthoxin dehydrogenase [Aegilops tauschii]
Length=285

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 124/260 (48%), Positives = 167/260 (64%), Gaps = 10/260 (4%)
 Frame = -1

Query  1048  LEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEY-ALFIHCDV  872
             LEGKVA++TG A+GIG    RLF  HG KV IAD+ D+ G  +   +G +   LF+HCDV
Sbjct  20    LEGKVALVTGGASGIGEAIVRLFRQHGAKVCIADVQDEAGQQLRDSLGGDPDVLFVHCDV  79

Query  871   RIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFCA  692
              +E  +  AVD T  ++G LDIM +NAG  G + T I   +  ++  VFD NV G     
Sbjct  80    TVEEDISRAVDATAEKFGTLDIMVNNAGITGDKVTDIRNLDFADVKKVFDINVHGMLLGM  139

Query  691   KHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSNC  512
             KHAARVMIP+KKGSI+  AS ++   G+  H YTASK A+VGL KS+ +E+G++GIR NC
Sbjct  140   KHAARVMIPSKKGSIVSLASVASVIGGMGPHAYTASKHAVVGLTKSVALELGRHGIRVNC  199

Query  511   VSAAIILTKLGMSIMPTQDRK-------LAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             VS   + T L M  +P  ++K       LA   V    NLKGV L  +DVAEA LYLA D
Sbjct  200   VSPYAVPTALSMPHLPQGEQKGDAVRDFLA--FVGSEANLKGVDLLPKDVAEAVLYLASD  257

Query  352   ESKYVSGVNLIIDGGYSTTN  293
             E++Y+S +NL++DGG+++ N
Sbjct  258   EARYISALNLVVDGGFTSVN  277



>ref|XP_002523859.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF38585.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=272

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 129/264 (49%), Positives = 175/264 (66%), Gaps = 5/264 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEI-GPEY  896
             +++ +L+RLEGKVA+ITGAA+GIG   ARLF+ HG  ++IAD+ D+ G+SV +E+  P  
Sbjct  6     LLSGALRRLEGKVALITGAASGIGECAARLFSKHGANLVIADVQDELGHSVCRELDSPSS  65

Query  895   ALFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTN  716
               +IHC+V  E  V+NAV+T VS+YGKLDIMF+NAG  G    +IL+ +      +   N
Sbjct  66    VSYIHCNVTREEDVENAVNTAVSKYGKLDIMFNNAGVVGIAKPNILDNDKAEFEKIISVN  125

Query  715   VVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMG  536
             +VG+F   KHAARVMIP +KGSII +AS  +   G+ SH YT+SK  +VGL ++  VE+G
Sbjct  126   LVGAFLGTKHAARVMIPNRKGSIINTASVCSIIGGVASHAYTSSKHGVVGLTRNTAVELG  185

Query  535   KYGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAG  356
             ++GIR NCVS  ++ T L        D    + +      LK   L  EDVAEAALYL  
Sbjct  186   RHGIRVNCVSPYLVATPLAKDFFKLDD----DGVYRVYSVLKEAVLGPEDVAEAALYLGS  241

Query  355   DESKYVSGVNLIIDGGYSTTNIGF  284
             DESKYVSG NL++DGG++  N GF
Sbjct  242   DESKYVSGHNLVVDGGFTKVNPGF  265



>emb|CDP06868.1| unnamed protein product [Coffea canephora]
Length=272

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 127/255 (50%), Positives = 169/255 (66%), Gaps = 4/255 (2%)
 Frame = -1

Query  1057  LKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHC  878
             +KRL+GKVA+ITGAA+GIG + ARLF  HG KV+IADI D     V Q++ P  A  +HC
Sbjct  11    MKRLQGKVALITGAASGIGESAARLFVKHGAKVVIADIQDDLAKKVCQDLDPSSASHVHC  70

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             D   ES ++NAV+TTVS+YGKLDIMF+NAG AGS  ++IL+    +   V   N+VG F 
Sbjct  71    DTTQESDIENAVNTTVSKYGKLDIMFNNAGIAGSGTSNILDDKKSDFERVISVNLVGVFL  130

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
               KHAARVMIP + GSII +AS+ +   G   H Y +SK A+VGL ++  +++G+YGIR 
Sbjct  131   GTKHAARVMIPNRCGSIINTASSCSTLGGGAPHAYVSSKHAVVGLTRNTAIDLGRYGIRV  190

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             NC+S   + T L   ++     ++   +      L G  L  EDVA+AALYLA D+SKYV
Sbjct  191   NCLSPYYVPTPLAADVV----ERIYGGVSKVYKFLDGAELKAEDVADAALYLASDDSKYV  246

Query  337   SGVNLIIDGGYSTTN  293
             SG NL++DGGYS  N
Sbjct  247   SGHNLVVDGGYSIVN  261



>gb|KCW90500.1| hypothetical protein EUGRSUZ_A02619 [Eucalyptus grandis]
Length=283

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 128/260 (49%), Positives = 171/260 (66%), Gaps = 1/260 (0%)
 Frame = -1

Query  1057  LKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHC  878
               RLEGKVA+ITG A+GIG  TAR+FAHHG KV+IAD++D  G+SV   +G + A F+HC
Sbjct  17    FHRLEGKVALITGGASGIGEITARVFAHHGAKVVIADVNDSLGHSVCDSLGRDTASFVHC  76

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             +V  ES  + AV   VS +GKLDIMF+NAG  G   T I++ +  +   V   NV G F 
Sbjct  77    NVTDESQTKAAVAEAVSTFGKLDIMFNNAGIGGLNKTRIIDNDKADFERVLAVNVTGVFL  136

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
               KHAA+ MIPA++G II +AS S+   G  SH YT +K A++GL ++  VE+G++GIR 
Sbjct  137   GVKHAAQAMIPARRGCIINTASISSGLGGAASHAYTCAKHAVLGLTRNAAVELGQFGIRV  196

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYV  338
             NC+S    +T L    +     +L E  +    NLKGV+L  EDVA AAL+LAGDE++YV
Sbjct  197   NCLSPYACVTPLATEFVGVGPAEL-EAAMGALANLKGVTLKAEDVANAALFLAGDEARYV  255

Query  337   SGVNLIIDGGYSTTNIGFQV  278
             SG NL IDGG+S  N  F++
Sbjct  256   SGHNLFIDGGFSVVNPSFRM  275



>ref|XP_010246229.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
Length=274

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 127/266 (48%), Positives = 174/266 (65%), Gaps = 8/266 (3%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             I++A  +RLE KVA++T  A+G+G + A+LF+ HG KV+IADI D+ G+SV +E+GP  A
Sbjct  7     ILSAVARRLEAKVALVTDGASGLGRSCAKLFSQHGAKVVIADIQDELGHSVCKELGPSSA  66

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              FIHCDV  ES V+NAV+  V+R+GKLDIM  NAG  GS   +IL  +  +   V + NV
Sbjct  67    SFIHCDVTNESDVENAVNGAVARHGKLDIMLINAGIIGSPTVNILANDRGDFQQVLNVNV  126

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasas-taafgitSHTYTASKCAIVGLCKSLCVEMG  536
             +G F   KHAARVMI A  G  I + ++  +   G T H YT+SK A++GL ++  VE+G
Sbjct  127   IGPFLGTKHAARVMILANGGGSIINMASICSIIGGATPHAYTSSKHAVLGLTRNTAVELG  186

Query  535   KYGIRSNCVSAAIILTKLGMSIMPTQDRKLAEE--IVAEAPNLKGVSLTTEDVAEAALYL  362
             ++GIR NC+S   + T      +     KL E+  IV    NLKGV+L  EDVAEAALYL
Sbjct  187   RFGIRVNCISPYAVATPQSRKFL-----KLEEDAAIVDAYSNLKGVALKPEDVAEAALYL  241

Query  361   AGDESKYVSGVNLIIDGGYSTTNIGF  284
               ++S YVSG NL++DG ++  N GF
Sbjct  242   GSEDSSYVSGHNLVLDGAFTVLNQGF  267



>ref|XP_008437356.1| PREDICTED: zerumbone synthase-like [Cucumis melo]
Length=280

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 126/262 (48%), Positives = 173/262 (66%), Gaps = 3/262 (1%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEI--GPEYAL-FI  884
             KRL GKVA+ITG A+GIG +T RLF  +G KV++AD+ D  G  + +E+  G  Y + + 
Sbjct  12    KRLAGKVALITGGASGIGESTVRLFVENGAKVVVADVQDDLGAVLCKELDDGTGYNVSYF  71

Query  883   HCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGS  704
             HCDV  ES + NAVD  V +YGKLDIMF+NAG  G    + L  ++ +   VFD NV GS
Sbjct  72    HCDVTDESDISNAVDYAVEKYGKLDIMFNNAGIRGDVGATTLTTDMNDFKKVFDVNVFGS  131

Query  703   FFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGI  524
             F  AKHAARVM PAK G I+F++S ++      +  Y ASK AI+GL K+L VE+G  GI
Sbjct  132   FMGAKHAARVMAPAKTGCILFTSSMASVICSGNAPAYAASKHAIIGLMKTLAVELGPKGI  191

Query  523   RSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESK  344
             R N +S    +T + +     +++K  E  ++ + NL+G  +  EDVA+AALYLA DESK
Sbjct  192   RVNAISPYATVTPMLVPSKNVEEKKAMEAFISLSGNLQGAVMEAEDVAKAALYLASDESK  251

Query  343   YVSGVNLIIDGGYSTTNIGFQV  278
             YVSG+NL++DGG+S TN  F++
Sbjct  252   YVSGLNLVVDGGFSLTNPSFEL  273



>gb|KDP34634.1| hypothetical protein JCGZ_11952 [Jatropha curcas]
Length=270

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 130/269 (48%), Positives = 177/269 (66%), Gaps = 6/269 (2%)
 Frame = -1

Query  1063  ASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPE--YAL  890
             A L+RLEGKVA+ITGAA+GIG  TARLF+ HG +V+IADI D+ G+S+ +EI  +  Y  
Sbjct  6     AGLRRLEGKVALITGAASGIGECTARLFSKHGAQVVIADIQDELGHSLCKEIDRDGKYCS  65

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             F+HCDV  E  V+NA+++ VS+YGKLDIMF+NAG  G    +IL+        +   N+V
Sbjct  66    FVHCDVTKEEDVENALNSAVSKYGKLDIMFNNAGIIGVAKPNILDNEKAEFEKIISVNLV  125

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             G+F   KHAARVMIP +KGSII +AS  +   G+ SH YT+SK  +VGL ++  VE+G++
Sbjct  126   GAFLGTKHAARVMIPNRKGSIITTASICSTIGGVASHAYTSSKHGVVGLMRNTAVELGQH  185

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDE  350
             GIR NCVS  ++ T L        D  + +       NLK   L  EDVA+AALYL  D+
Sbjct  186   GIRVNCVSPYVVNTPLARDFFKLDDNGIYDVY----SNLKEAVLQPEDVAQAALYLGSDD  241

Query  349   SKYVSGVNLIIDGGYSTTNIGFQVAVEKV  263
             SKY+SG N+IIDGG++  N  F +  + +
Sbjct  242   SKYISGHNMIIDGGFTIVNPAFSIFPQSI  270



>ref|XP_007162945.1| hypothetical protein PHAVU_001G193400g [Phaseolus vulgaris]
 gb|ESW34939.1| hypothetical protein PHAVU_001G193400g [Phaseolus vulgaris]
Length=273

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 128/259 (49%), Positives = 168/259 (65%), Gaps = 1/259 (0%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             +RLEGKVA+ITG A+GIG  TA +FA HG KV+IADI D+ G+SVA+ IGP    ++HCD
Sbjct  10    RRLEGKVAVITGGASGIGKRTAEVFAQHGAKVVIADIQDELGHSVAESIGPSTCCYVHCD  69

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V  E  V+NA+   V  YGKLDIMF+NAG A      I++ +  +   V   NV G F  
Sbjct  70    VTDEDQVKNAIHRAVETYGKLDIMFNNAGIADPNKHRIIDNDKADFERVLAVNVTGVFLG  129

Query  694   AKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSN  515
              KHAA+ MIP + GSII +AS S+   G  SH Y  +K A+ GL K+  VE+G++GIR N
Sbjct  130   MKHAAQAMIPGRSGSIISTASISSYVGGAASHAYCCAKHAVAGLTKNAAVELGQFGIRVN  189

Query  514   CVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVS  335
             C+S   + T L  + +   D +L E I+    NLKGV+L  +DVA AALY A D+S+YVS
Sbjct  190   CLSPYALATPLATNFVGANDEQL-ETIMNSLANLKGVTLKADDVANAALYFASDDSRYVS  248

Query  334   GVNLIIDGGYSTTNIGFQV  278
             G NL+IDGG+S  N  F +
Sbjct  249   GHNLLIDGGFSIVNPSFHM  267



>ref|XP_004494228.1| PREDICTED: momilactone A synthase-like [Cicer arietinum]
Length=273

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 127/259 (49%), Positives = 169/259 (65%), Gaps = 1/259 (0%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYALFIHCD  875
             +RLEGKVA+ITG A+GIG  TA +FA  G KV+IADI D+ G+SV + IG     ++HCD
Sbjct  10    RRLEGKVALITGGASGIGKRTAEIFAEQGAKVVIADIQDEVGHSVVESIGASTCFYVHCD  69

Query  874   VRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFFC  695
             V  E+ V+NAVD TV  YGKLDIMF+NAG  G  +  I++ +  +   V   NV G F  
Sbjct  70    VTDENQVKNAVDKTVETYGKLDIMFNNAGIGGPNNARIIDNDKADFERVLSVNVTGVFVG  129

Query  694   AKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRSN  515
              KHAA+ MIPA+ GSII ++S S+   G  SH YT +K A+VGL K+  VE+G++GIR N
Sbjct  130   IKHAAQAMIPARTGSIISTSSVSSYVGGAASHAYTCAKHAVVGLTKNAAVELGQFGIRVN  189

Query  514   CVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESKYVS  335
             C+S     T L    +   D    E +++   NLKGV+  T+DVA AAL+ A D+SKY+S
Sbjct  190   CLSPYGCATPLATQFIGCDDHVF-ENVMSGFANLKGVTFKTDDVANAALFFASDDSKYIS  248

Query  334   GVNLIIDGGYSTTNIGFQV  278
             G NL+IDGG+S  N  F +
Sbjct  249   GHNLLIDGGFSIVNPSFNM  267



>ref|XP_010067756.1| PREDICTED: xanthoxin dehydrogenase [Eucalyptus grandis]
 gb|KCW65948.1| hypothetical protein EUGRSUZ_G03255 [Eucalyptus grandis]
Length=280

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 123/267 (46%), Positives = 173/267 (65%), Gaps = 6/267 (2%)
 Frame = -1

Query  1060  SLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL-FI  884
             S +RL GKVA++TG A GIG +  RLF  HG KV IAD+ D  G+ V + +G E+++ ++
Sbjct  12    SCQRLHGKVALVTGGATGIGESIVRLFHKHGAKVCIADVQDNLGHQVLESLGGEHSVSYV  71

Query  883   HCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGS  704
             HCDV +E  V+ AVD TVS++G LD+M +NAGT+G   + I    L +   VFD NV G 
Sbjct  72    HCDVTLEDDVRRAVDGTVSKFGTLDVMVNNAGTSGPPCSDIRNVELSDFEKVFDLNVKGV  131

Query  703   FFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGI  524
             F   KHAAR+MIP K G II  +S  +   G+  H YT SK A+VGL +++  E+GK+GI
Sbjct  132   FIGMKHAARIMIPQKSGVIISISSVCSVIGGLGPHAYTGSKHAVVGLTQNVAAELGKHGI  191

Query  523   RSNCVSAAIILTKLGMSIMPTQDRKLA-----EEIVAEAPNLKGVSLTTEDVAEAALYLA  359
             R NCVS   + T L ++ +P ++R           VA   NL+GV LTT DVA A L+LA
Sbjct  192   RVNCVSPYAVATGLAVAHLPEEERTEDAMVGFRSFVARNANLEGVELTTGDVANAVLFLA  251

Query  358   GDESKYVSGVNLIIDGGYSTTNIGFQV  278
              D+++YVSG+NL++DGG++ +N   +V
Sbjct  252   SDDARYVSGLNLMVDGGFTCSNHTLRV  278



>ref|XP_010070261.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=270

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 132/268 (49%), Positives = 173/268 (65%), Gaps = 6/268 (2%)
 Frame = -1

Query  1078  QLIMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPE  899
             + +++ + +RLEGKVA+ITG A GIG +TARLF+ HG KVIIADI+D  G SV + +GPE
Sbjct  4     RTLLSLAARRLEGKVAVITGGACGIGESTARLFSKHGAKVIIADINDDLGKSVCKNLGPE  63

Query  898   YALFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDT  719
              A F+HCDV  E  V+NAV T V ++GKLDIM +NA        +IL+ +  +   V   
Sbjct  64    TASFVHCDVSSEPDVENAVATAVDKHGKLDIMVNNAAIGDPTKLNILDNDKADFEKVISV  123

Query  718   NVVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEM  539
             N+ G F   KHAAR MIP+++GSII   S S++  G+ SH Y +SK AIVGL ++   E+
Sbjct  124   NLTGVFLGTKHAARAMIPSQRGSIINVGSVSSSVGGVASHAYASSKHAIVGLSRNAAAEL  183

Query  538   GKYGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEA-PNLKGVSLTTEDVAEAALYL  362
             G+YGIR NC+S   I T L   +      KL E        NL GV+L  EDVAEAAL+L
Sbjct  184   GRYGIRVNCLSPYFIRTPLTEEMF-----KLDENPEFRVYSNLDGVTLQEEDVAEAALFL  238

Query  361   AGDESKYVSGVNLIIDGGYSTTNIGFQV  278
               DESKY+SG NL +DGG++T N  F V
Sbjct  239   GSDESKYISGHNLAVDGGFTTINPAFGV  266



>ref|XP_010049793.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
 gb|KCW82605.1| hypothetical protein EUGRSUZ_C03995 [Eucalyptus grandis]
Length=270

 Score =   204 bits (518),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 124/263 (47%), Positives = 171/263 (65%), Gaps = 4/263 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             +++ + +RLEGKVA+ITG A  IG +TARLF+ HG +VIIADI D  G SV +++GPE A
Sbjct  6     LLSRAARRLEGKVAMITGGAGDIGESTARLFSKHGARVIIADIRDDLGESVCKDLGPETA  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              F+HCDV  ES V+ A++T V ++GKLDIM +NA T      +IL+ +  +   V   N+
Sbjct  66    SFVHCDVSSESDVEKAINTAVEKHGKLDIMVNNAATGEPVKANILDNDKADFERVVSVNL  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
              G F   KHAAR MIP+++GSII   S S++  G+  H YT+SK  ++GL +++  E+G+
Sbjct  126   TGVFLGTKHAARAMIPSRRGSIINVGSVSSSVGGVAPHAYTSSKHGVLGLTRNVAAELGR  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             YGIR NC+S   IL+ L           +    V    NL GVSL  EDVAEAA++L  D
Sbjct  186   YGIRVNCLSPYFILSPLTREFFNV----VRNGGVGVYSNLDGVSLQKEDVAEAAVFLGSD  241

Query  352   ESKYVSGVNLIIDGGYSTTNIGF  284
             ESKY+SG NL +DGG++T N  F
Sbjct  242   ESKYISGHNLAVDGGFTTINPAF  264



>ref|XP_010931582.1| PREDICTED: LOW QUALITY PROTEIN: zerumbone synthase-like [Elaeis 
guineensis]
Length=277

 Score =   204 bits (518),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 122/258 (47%), Positives = 163/258 (63%), Gaps = 4/258 (2%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPE-YALFIHC  878
             +RLEGKVA++TG A GIG +  RLF  HG K+ + DI D  G  + + +G + Y  F HC
Sbjct  13    RRLEGKVALVTGGATGIGESIVRLFRKHGAKICVVDIQDNLGQQLCKSLGGDPYVCFFHC  72

Query  877   DVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGSFF  698
             DV IE  V+ AVD T  +YG +DIM +NAG  GS+   I +A+      VFD NV G F 
Sbjct  73    DVTIEDDVRRAVDFTADKYGTIDIMVNNAGITGSKVKDIRDADFNEFKKVFDVNVNGVFL  132

Query  697   CAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGIRS  518
               KHAAR+MIP +KGSII  AS ++   G+  H YT SK A++GL K++  E+GK GIR 
Sbjct  133   GMKHAARIMIPQRKGSIISLASVASTTGGLGPHGYTGSKHAVLGLTKNVAAELGKRGIRV  192

Query  517   NCVSAAIILTKLGMSIMPTQDRKLAE---EIVAEAPNLKGVSLTTEDVAEAALYLAGDES  347
             NCVS     T L M  +P ++R+        V    NLKGV L  +DVA+A LYLA DE+
Sbjct  193   NCVSPYATPTSLSMPHLPEEERQEDAXFLSFVGSHANLKGVDLMVDDVAQAVLYLASDEA  252

Query  346   KYVSGVNLIIDGGYSTTN  293
             +Y+SG+NL++DGG++  N
Sbjct  253   RYISGLNLMVDGGFTCVN  270



>ref|XP_004152436.1| PREDICTED: zerumbone synthase-like [Cucumis sativus]
 ref|XP_004165026.1| PREDICTED: zerumbone synthase-like [Cucumis sativus]
 gb|KGN64239.1| hypothetical protein Csa_1G044880 [Cucumis sativus]
Length=279

 Score =   204 bits (518),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 126/262 (48%), Positives = 173/262 (66%), Gaps = 4/262 (2%)
 Frame = -1

Query  1054  KRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEI---GPEYALFI  884
             KRL GKVA+ITG A+GIG +T RLF  +G KV++AD+ D  G  + +E+   G   + F 
Sbjct  12    KRLAGKVALITGGASGIGESTVRLFVENGAKVVVADVQDDLGAVLCKELDDTGFNVSYF-  70

Query  883   HCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVVGS  704
             HCDV  ES + NAVD  V +YGKLDIMF+NAG  G   ++ L A++ +   VFD NV GS
Sbjct  71    HCDVTDESDISNAVDYAVEKYGKLDIMFNNAGIRGDVGSTTLTADMNDFRKVFDVNVFGS  130

Query  703   FFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKYGI  524
             F  AKHAARVM PAK G I+F++S ++      +  Y ASK AI+GL K+L VE+G  GI
Sbjct  131   FMGAKHAARVMAPAKTGCILFTSSMASVICSGNAPAYAASKHAIIGLMKTLAVELGSQGI  190

Query  523   RSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGDESK  344
             R N +S    +T + +     +++K  E  ++ + NL+G  +  EDVA+AALYL  DESK
Sbjct  191   RVNAISPYATVTPMLVPSRNVEEKKAMEAFISLSGNLQGAVMEAEDVAKAALYLGSDESK  250

Query  343   YVSGVNLIIDGGYSTTNIGFQV  278
             YVSG+NL++DGG+S TN  F++
Sbjct  251   YVSGLNLVVDGGFSLTNPSFEL  272



>gb|KCW83009.1| hypothetical protein EUGRSUZ_C04391, partial [Eucalyptus grandis]
Length=287

 Score =   204 bits (519),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 133/262 (51%), Positives = 171/262 (65%), Gaps = 6/262 (2%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             ++    +RLEGKVA+ITG A GIG +TARLF+ HG KVIIADI D  G SV  ++G E A
Sbjct  6     LLPQEARRLEGKVAVITGGAGGIGESTARLFSKHGAKVIIADIRDDLGKSVCVDLGAETA  65

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              F+HCDV IES V+NA+ T V ++GKLDIM +NA  +     +IL+ +  +   V   N+
Sbjct  66    SFVHCDVSIESDVENAIATAVDKFGKLDIMVNNAAISDPLKANILDNDKADFERVISVNL  125

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
              G F   KHAAR MIP++ GSII   S S++  G+ SH YT+SK AIVGL +++  E+G+
Sbjct  126   TGVFLGTKHAARAMIPSRSGSIINVGSVSSSVGGVASHAYTSSKHAIVGLTRNVASELGR  185

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEI-VAEAPNLKGVSLTTEDVAEAALYLAG  356
             YGIR NC+S   ILT L          K+ E   V    NL GVSL  EDVA+AA+YL  
Sbjct  186   YGIRVNCLSPYFILTPLTKEFF-----KIDENAGVRVYSNLDGVSLQEEDVAKAAVYLGS  240

Query  355   DESKYVSGVNLIIDGGYSTTNI  290
             DESKYVSG NL +D G++T NI
Sbjct  241   DESKYVSGQNLAVDAGFTTINI  262



>ref|XP_010917564.1| PREDICTED: momilactone A synthase-like [Elaeis guineensis]
Length=270

 Score =   203 bits (517),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 123/260 (47%), Positives = 178/260 (68%), Gaps = 1/260 (0%)
 Frame = -1

Query  1072  IMAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA  893
             ++ ++ +RLEGKVA+ITG A+GIG  TA+LF  HG +V+IAD+ D  G ++ + +G   A
Sbjct  1     MLTSAARRLEGKVALITGGASGIGEATAKLFTRHGARVMIADVQDDKGRALCESLGSSVA  60

Query  892   LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNV  713
              ++HCD+  ESHV++AVD  VSR+GKLDIMF+NAG  GS    IL++   +   V   N+
Sbjct  61    SYVHCDMTDESHVRDAVDAAVSRHGKLDIMFNNAGIIGSPCMQILKSEKADFERVVGINL  120

Query  712   VGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGK  533
             VGS+   KHAARVMIPA++GSI+ +AS ++    +T   YT SK A++GL +S  VE+G+
Sbjct  121   VGSYLGTKHAARVMIPARRGSIVMTASVASVDPAMTPVAYTCSKHAVLGLMRSAAVELGQ  180

Query  532   YGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAGD  353
             +G+R NCVS   + T L  +       +L E+ + E   LKGV L  ED+AEA L+L  +
Sbjct  181   FGVRVNCVSPYALATPLAATAFGMGGEEL-EDFMHEHAILKGVRLKAEDIAEAVLFLGSE  239

Query  352   ESKYVSGVNLIIDGGYSTTN  293
             E+KYVSG+NL++DGG++T N
Sbjct  240   EAKYVSGLNLLVDGGFTTAN  259



>gb|KDP42340.1| hypothetical protein JCGZ_02813 [Jatropha curcas]
Length=270

 Score =   203 bits (517),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 128/258 (50%), Positives = 171/258 (66%), Gaps = 6/258 (2%)
 Frame = -1

Query  1066  AASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYA--  893
             A + KRLEGKVA+ITG A+GIG  TARLFA HG KVIIAD+  + G SVA++IG E    
Sbjct  8     APTAKRLEGKVALITGGASGIGECTARLFARHGAKVIIADVQSELGRSVAEKIGSETGQP  67

Query  892   -LFIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTN  716
               ++ C+V +ES V+NAV+T VS +GKLDIMF+NAG AG+    IL    E+   V D N
Sbjct  68    VTYVDCNVTVESDVENAVNTAVSLHGKLDIMFNNAGIAGNNHDKILSTEREDFMRVLDIN  127

Query  715   VVGSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMG  536
             + G    AKHAARVMIP KK   I   ++ ++A     + YTASK A+VGL K+L +E+G
Sbjct  128   IYGGVLGAKHAARVMIPEKK-GCILFTASVSSALYGGPYAYTASKHAVVGLAKNLAIELG  186

Query  535   KYGIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEAPNLKGVSLTTEDVAEAALYLAG  356
             ++GIR NC+S   + T L   +  ++ +   +E  +   NLK V L   D+AEAALYLA 
Sbjct  187   QHGIRVNCISPGAVQTGLAKQLGLSEQQ--VQEWSSALANLKVVKLEVNDIAEAALYLAS  244

Query  355   DESKYVSGVNLIIDGGYS  302
             D+SK+VSG+NL++DG  S
Sbjct  245   DDSKFVSGLNLLVDGAAS  262



>dbj|BAC53872.1| alcohol dehydroge [Phaseolus lunatus]
Length=274

 Score =   203 bits (517),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 136/264 (52%), Positives = 172/264 (65%), Gaps = 8/264 (3%)
 Frame = -1

Query  1069  MAASLKRLEGKVaiitgaangigattARLFAHHGCKVIIADIDDKNGNSVAQEIGPEYAL  890
             ++A++KRLEGKVAIITG A+GIGA TARLF+ HG  V+IADI D  G SV  E+  + A+
Sbjct  7     VSAAVKRLEGKVAIITGGASGIGAATARLFSEHGAHVVIADIQDDLGLSVCNEL--KSAV  64

Query  889   FIHCDVRIESHVQNAVDTTVSRYGKLDIMFSNAGTAGSRDTSILEANLENINLVFDTNVV  710
             ++HCDV  E  V+  V+ TVS+YGKLDIM +NAGT      SI++        V   NVV
Sbjct  65    YVHCDVTKEEDVEKCVNVTVSKYGKLDIMLNNAGTCHELKDSIVDNITSEFERVISVNVV  124

Query  709   GSFFCAKHAARVMIPAKKgsiifsasastaafgitSHTYTASKCAIVGLCKSLCVEMGKY  530
             G F   KHAARVMIPAK+G II ++S +      + H Y  SK  + GL K+  VE+G++
Sbjct  125   GPFLGTKHAARVMIPAKRGCIINTSSIAGCRGTGSPHAYVVSKHGLEGLTKNTAVELGQF  184

Query  529   GIRSNCVSAAIILTKLGMSIMPTQDRKLAEEIVAEA-PNLKGVSLTTEDVAEAALYLAGD  353
             GIR NCVS  ++ T      M  +   L EE V EA  NLKG  L   DVAEAAL+LAGD
Sbjct  185   GIRVNCVSPYLVATP-----MLKKYFNLDEEGVREAYSNLKGSYLVPNDVAEAALFLAGD  239

Query  352   ESKYVSGVNLIIDGGYSTTNIGFQ  281
             ES YVSG +L++DGGY+ TN GF 
Sbjct  240   ESNYVSGHSLLLDGGYTITNAGFS  263



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2749030255886