BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25702_g2_i1 len=975 path=[19665:0-974]

Length=975
                                                                      Score     E

ref|XP_009774056.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    303   8e-95   
ref|XP_009623019.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    301   2e-94   
ref|XP_011094427.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    301   6e-94   
gb|AEZ00898.1|  putative beta-14-mannan synthase                        289   3e-93   
ref|XP_004249461.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    298   8e-93   
emb|CDP15350.1|  unnamed protein product                                297   1e-92   
ref|XP_006339112.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    296   3e-92   
ref|XP_009601859.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    296   3e-92   
ref|XP_006492171.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    294   1e-91   
gb|KDO40534.1|  hypothetical protein CISIN_1g009761mg                   294   1e-91   
ref|XP_006436686.1|  hypothetical protein CICLE_v10031284mg             294   1e-91   
ref|XP_009771587.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    294   2e-91   
ref|XP_006341174.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    294   3e-91   
gb|KCW89263.1|  hypothetical protein EUGRSUZ_A01558                     290   3e-91   
ref|XP_010325940.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    292   5e-91   
gb|KDP42759.1|  hypothetical protein JCGZ_23699                         293   6e-91   
ref|XP_010325939.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    292   8e-91   
gb|EYU41550.1|  hypothetical protein MIMGU_mgv1a004346mg                292   1e-90   
gb|KDP45030.1|  hypothetical protein JCGZ_01530                         292   1e-90   
gb|AGE09561.1|  CSLA9-like protein                                      291   2e-90   
gb|KCW89261.1|  hypothetical protein EUGRSUZ_A01558                     291   3e-90   
ref|XP_010050059.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    291   3e-90   
ref|XP_009390016.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    291   3e-90   
ref|XP_010912225.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    290   4e-90   
ref|XP_010940677.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    290   5e-90   
ref|XP_002311972.2|  4-mannan synthase family protein                   290   6e-90   Populus trichocarpa [western balsam poplar]
ref|XP_010912224.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    290   6e-90   
ref|XP_007027600.1|  Nucleotide-diphospho-sugar transferases supe...    290   1e-89   
ref|XP_011024272.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    289   2e-89   
ref|XP_010110184.1|  hypothetical protein L484_016805                   289   3e-89   
gb|AFZ78578.1|  cellulose synthase-like protein                         288   5e-89   
ref|XP_002283672.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    287   7e-89   Vitis vinifera
ref|XP_002530892.1|  transferase, transferring glycosyl groups, p...    284   8e-89   Ricinus communis
ref|XP_011010407.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    286   2e-88   
ref|XP_002528577.1|  conserved hypothetical protein                     285   3e-88   Ricinus communis
ref|XP_008804385.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    286   3e-88   
ref|XP_002315357.1|  4-mannan synthase family protein                   285   8e-88   Populus trichocarpa [western balsam poplar]
ref|XP_007010197.1|  Nucleotide-diphospho-sugar transferases supe...    285   8e-88   
ref|XP_009404378.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    285   8e-88   
ref|XP_006606290.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    281   1e-87   
ref|XP_007220072.1|  hypothetical protein PRUPE_ppa024741mg             284   1e-87   
emb|CBI40224.3|  unnamed protein product                                281   1e-87   
ref|XP_002437311.1|  hypothetical protein SORBIDRAFT_10g024640          281   1e-87   Sorghum bicolor [broomcorn]
ref|XP_007219015.1|  hypothetical protein PRUPE_ppa004315mg             283   2e-87   
ref|XP_004307031.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    281   4e-87   
ref|XP_008232025.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    282   5e-87   
ref|XP_006606289.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    281   5e-87   
ref|XP_003556282.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    282   8e-87   
gb|KHN00923.1|  Glucomannan 4-beta-mannosyltransferase 9                281   9e-87   
ref|XP_009361452.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    280   1e-86   
ref|XP_002269110.2|  PREDICTED: glucomannan 4-beta-mannosyltransf...    281   1e-86   Vitis vinifera
ref|XP_007143832.1|  hypothetical protein PHAVU_007G105400g             281   1e-86   
ref|XP_009335111.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    281   2e-86   
ref|XP_009401015.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    281   2e-86   
ref|XP_006398833.1|  hypothetical protein EUTSA_v10013220mg             280   8e-86   
ref|XP_008456578.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    279   1e-85   
gb|KFK24842.1|  hypothetical protein AALP_AA8G031700                    279   2e-85   
emb|CBI30236.3|  unnamed protein product                                279   2e-85   
ref|XP_009130779.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    278   3e-85   
emb|CDY11268.1|  BnaA03g01040D                                          278   4e-85   
ref|XP_008363207.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    274   4e-85   
ref|XP_003535494.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    277   5e-85   
gb|KHN37850.1|  Glucomannan 4-beta-mannosyltransferase 9                276   7e-85   
ref|XP_010694523.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    276   9e-85   
ref|XP_004151323.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    275   1e-84   
ref|XP_011018871.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    276   1e-84   
ref|XP_004494136.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    276   1e-84   
gb|KEH24115.1|  cellulose synthase-like protein A1                      276   1e-84   
ref|XP_006589371.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    275   2e-84   
ref|XP_008363208.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    275   2e-84   
emb|CDO99850.1|  unnamed protein product                                273   2e-84   
emb|CDX80885.1|  BnaC03g01390D                                          275   5e-84   
ref|XP_007162846.1|  hypothetical protein PHAVU_001G185800g             275   6e-84   
ref|XP_008232088.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    273   9e-84   
ref|NP_195996.1|  glucomannan 4-beta-mannosyltransferase 9              274   1e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003554414.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    274   1e-83   
ref|XP_003521436.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    274   1e-83   
gb|ABR16486.1|  unknown                                                 269   1e-83   Picea sitchensis
ref|XP_004965827.1|  PREDICTED: probable mannan synthase 9-like         274   1e-83   
ref|XP_010067160.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    271   3e-83   
ref|XP_002873112.1|  ATCSLA09                                           273   3e-83   
ref|XP_010452272.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    273   4e-83   
ref|XP_010490868.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    272   4e-83   
gb|KHG19821.1|  Glucomannan 4-beta-mannosyltransferase 9 -like pr...    272   6e-83   
ref|XP_009379774.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    272   6e-83   
dbj|BAE98718.1|  hypothetical protein                                   272   6e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010543471.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    271   1e-82   
gb|AFW73370.1|  hypothetical protein ZEAMMB73_956340                    264   1e-82   
ref|XP_009122674.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    271   2e-82   
ref|XP_006381326.1|  hypothetical protein POPTR_0006s11810g             271   2e-82   
emb|CDX70286.1|  BnaA10g26350D                                          271   2e-82   
ref|XP_010423663.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    270   3e-82   
gb|ABG34547.1|  cellulose synthase-like A1                              270   4e-82   Pinus taeda
ref|XP_009421122.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    269   7e-82   
ref|XP_010558212.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    269   7e-82   
ref|XP_009353016.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    267   2e-81   
ref|XP_009353014.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    267   5e-81   
ref|XP_008359466.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    267   7e-81   
gb|AES60635.2|  cellulose synthase-like protein A1                      266   1e-80   
ref|XP_009403735.1|  PREDICTED: probable mannan synthase 9 isofor...    266   1e-80   
ref|XP_004496174.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    266   1e-80   
gb|AFW87395.1|  hypothetical protein ZEAMMB73_638072                    264   2e-80   
ref|XP_009403734.1|  PREDICTED: probable mannan synthase 9 isofor...    266   2e-80   
gb|KGN63048.1|  hypothetical protein Csa_2G386160                       269   3e-80   
ref|XP_008241312.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    265   3e-80   
ref|XP_008659807.1|  PREDICTED: probable mannan synthase 9              265   3e-80   
gb|ABG34548.1|  cellulose synthase-like A2                              265   3e-80   Pinus taeda
ref|XP_007203625.1|  hypothetical protein PRUPE_ppa004037mg             265   4e-80   
gb|KEH43412.1|  cellulose synthase-like protein A1                      264   5e-80   
ref|XP_009603325.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    264   6e-80   
ref|XP_009760346.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    264   8e-80   
ref|XP_003560565.2|  PREDICTED: probable mannan synthase 9              263   9e-80   
ref|XP_006287469.1|  hypothetical protein CARUB_v10000681mg             263   2e-79   
ref|XP_006851749.1|  hypothetical protein AMTR_s00040p00223350          263   2e-79   
ref|XP_009365313.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    262   4e-79   
gb|AFW73371.1|  hypothetical protein ZEAMMB73_956340                    270   5e-79   
ref|XP_010243535.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    261   7e-79   
ref|XP_010112526.1|  hypothetical protein L484_012804                   261   1e-78   
ref|XP_008647195.1|  PREDICTED: uncharacterized protein LOC103628848    268   4e-78   
gb|KCW48370.1|  hypothetical protein EUGRSUZ_K02079                     251   1e-77   
gb|AFW66233.1|  hypothetical protein ZEAMMB73_021965                    248   4e-77   
ref|XP_004143300.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    256   1e-76   
gb|ACR38199.1|  unknown                                                 249   1e-76   Zea mays [maize]
sp|Q67VS7.1|CSLA9_ORYSJ  RecName: Full=Probable mannan synthase 9...    255   1e-76   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010089159.1|  hypothetical protein L484_003290                   255   2e-76   
ref|XP_004164074.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    255   2e-76   
emb|CDY10358.1|  BnaCnng02590D                                          253   8e-76   
ref|XP_006656269.1|  PREDICTED: probable mannan synthase 9-like         253   1e-75   
ref|XP_009793132.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    252   1e-75   
ref|XP_006345855.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    251   2e-75   
ref|XP_009793131.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    252   3e-75   
ref|XP_009603536.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    251   3e-75   
ref|XP_008462529.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    252   3e-75   
ref|XP_010038980.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    252   3e-75   
ref|XP_009603535.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    251   6e-75   
ref|XP_009793130.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    251   9e-75   
ref|XP_006484970.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    251   1e-74   
ref|XP_003571119.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    250   1e-74   
gb|EPS66478.1|  hypothetical protein M569_08299                         241   1e-74   
ref|XP_007145259.1|  hypothetical protein PHAVU_007G223800g             250   1e-74   
ref|XP_004239715.2|  PREDICTED: glucomannan 4-beta-mannosyltransf...    249   3e-74   
gb|KDO45609.1|  hypothetical protein CISIN_1g040333mg                   249   3e-74   
ref|XP_009337395.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    249   5e-74   
ref|XP_006424348.1|  hypothetical protein CICLE_v10028164mg             249   6e-74   
ref|NP_001131007.1|  uncharacterized protein LOC100192112               248   8e-74   Zea mays [maize]
ref|XP_008385455.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    248   1e-73   
emb|CDP06989.1|  unnamed protein product                                248   1e-73   
gb|EMS67675.1|  hypothetical protein TRIUR3_27071                       248   1e-73   
ref|XP_004303037.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    248   1e-73   
ref|XP_004951606.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    248   1e-73   
gb|ACF33171.1|  mannan synthase                                         248   1e-73   Coffea canephora [robusta coffee]
ref|XP_008363527.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    246   2e-73   
dbj|BAK03076.1|  predicted protein                                      246   3e-73   
ref|XP_006360487.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    246   4e-73   
ref|XP_008360269.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    247   4e-73   
emb|CDP15609.1|  unnamed protein product                                245   5e-73   
ref|XP_003551076.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    246   8e-73   
ref|XP_002453460.1|  hypothetical protein SORBIDRAFT_04g006260          244   1e-72   Sorghum bicolor [broomcorn]
emb|CBI17089.3|  unnamed protein product                                241   2e-72   
gb|EPS65139.1|  hypothetical protein M569_09640                         232   3e-72   
gb|KDP34366.1|  hypothetical protein JCGZ_11249                         244   3e-72   
gb|KEH42113.1|  cellulose synthase-like protein A1                      243   8e-72   
ref|XP_009364844.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    243   9e-72   
ref|XP_004137864.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    243   1e-71   
ref|XP_010525611.1|  PREDICTED: probable mannan synthase 3 isofor...    238   1e-71   
ref|XP_002269677.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    241   3e-71   Vitis vinifera
emb|CAN82595.1|  hypothetical protein VITISV_013708                     241   3e-71   Vitis vinifera
ref|XP_006384673.1|  glycosyl transferase family 2 family protein       241   4e-71   
ref|XP_008442792.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    241   4e-71   
ref|XP_011005673.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    241   5e-71   
ref|XP_004143299.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    240   9e-71   
ref|XP_004170553.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    240   9e-71   
ref|XP_011044347.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    240   1e-70   
gb|AFZ78579.1|  cellulose synthase-like protein                         240   1e-70   
ref|XP_010683891.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    239   1e-70   
ref|XP_010525610.1|  PREDICTED: probable mannan synthase 3 isofor...    239   2e-70   
ref|XP_002527445.1|  transferase, transferring glycosyl groups, p...    239   2e-70   Ricinus communis
ref|XP_010525608.1|  PREDICTED: probable mannan synthase 3 isofor...    239   3e-70   
ref|XP_006430317.1|  hypothetical protein CICLE_v10011455mg             239   3e-70   
ref|XP_006481909.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    238   5e-70   
ref|XP_010031452.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    238   6e-70   
ref|XP_010521855.1|  PREDICTED: probable mannan synthase 3              238   8e-70   
ref|XP_009115523.1|  PREDICTED: probable mannan synthase 3              238   1e-69   
emb|CDY44151.1|  BnaA09g31010D                                          238   1e-69   
gb|KEH42109.1|  cellulose synthase-like protein A1                      237   1e-69   
ref|XP_010498857.1|  PREDICTED: probable mannan synthase 3              237   2e-69   
emb|CDY04707.1|  BnaC05g18820D                                          237   2e-69   
ref|XP_010477641.1|  PREDICTED: probable mannan synthase 3              237   2e-69   
gb|KEH42110.1|  cellulose synthase-like protein A1                      236   3e-69   
ref|XP_004497598.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    236   4e-69   
gb|EEE56486.1|  hypothetical protein OsJ_05716                          235   4e-69   Oryza sativa Japonica Group [Japonica rice]
gb|EAY84833.1|  hypothetical protein OsI_06199                          235   6e-69   Oryza sativa Indica Group [Indian rice]
ref|NP_001046164.1|  Os02g0192500                                       235   7e-69   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009126562.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    235   8e-69   
ref|XP_004160102.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    230   1e-68   
ref|NP_001031084.1|  putative mannan synthase 3                         233   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003538146.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    234   1e-68   
ref|XP_002312893.1|  glycosyl transferase family 2 family protein       234   2e-68   Populus trichocarpa [western balsam poplar]
gb|KHN38673.1|  Glucomannan 4-beta-mannosyltransferase 2                234   2e-68   
gb|EYU36101.1|  hypothetical protein MIMGU_mgv1a0044822mg               230   3e-68   
ref|XP_006307154.1|  hypothetical protein CARUB_v10008745mg             234   3e-68   
gb|EYU36982.1|  hypothetical protein MIMGU_mgv1a004240mg                234   3e-68   
ref|NP_850952.1|  putative mannan synthase 3                            234   4e-68   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197666.1|  glucomannan 4-beta-mannosyltransferase 2              233   5e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011089999.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    233   5e-68   
ref|XP_009120642.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    233   5e-68   
ref|XP_002874083.1|  hypothetical protein ARALYDRAFT_489123             233   7e-68   
ref|XP_002890585.1|  hypothetical protein ARALYDRAFT_889889             233   7e-68   
ref|XP_006646997.1|  PREDICTED: LOW QUALITY PROTEIN: glucomannan ...    232   8e-68   
ref|XP_007015961.1|  Cellulose synthase-like A02 isoform 1              232   9e-68   
ref|XP_003539806.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    232   1e-67   
ref|XP_008458630.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    231   2e-67   
gb|KGN46914.1|  hypothetical protein Csa_6G150530                       231   2e-67   
ref|XP_007208459.1|  hypothetical protein PRUPE_ppa003918mg             231   3e-67   
ref|XP_004145779.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    231   3e-67   
ref|XP_006400777.1|  hypothetical protein EUTSA_v10013221mg             231   3e-67   
ref|XP_007208460.1|  hypothetical protein PRUPE_ppa003918mg             231   4e-67   
ref|XP_008227108.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    231   4e-67   
ref|XP_006347222.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    230   6e-67   
ref|XP_004241301.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    230   7e-67   
ref|XP_010911245.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    223   7e-67   
ref|XP_004250002.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    229   9e-67   
ref|XP_006416081.1|  hypothetical protein EUTSA_v10007266mg             230   1e-66   
ref|XP_009629011.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    229   1e-66   
ref|XP_009597672.1|  PREDICTED: mannan synthase 1-like isoform X2       229   1e-66   
ref|XP_009765562.1|  PREDICTED: mannan synthase 1-like isoform X2       229   1e-66   
ref|XP_009765561.1|  PREDICTED: mannan synthase 1-like isoform X1       229   2e-66   
ref|XP_006354365.1|  PREDICTED: mannan synthase 1-like                  229   2e-66   
ref|XP_010690012.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    229   2e-66   
ref|XP_009597671.1|  PREDICTED: mannan synthase 1-like isoform X1       229   2e-66   
ref|XP_010454539.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    228   3e-66   
ref|XP_010421063.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    228   3e-66   
ref|XP_004294040.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    229   3e-66   
ref|XP_010554515.1|  PREDICTED: probable mannan synthase 7 isofor...    226   3e-66   
gb|EMT23763.1|  hypothetical protein F775_17087                         233   3e-66   
ref|XP_010493365.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    228   3e-66   
ref|XP_004246627.1|  PREDICTED: mannan synthase 1-like                  228   3e-66   
gb|KFK39910.1|  hypothetical protein AALP_AA3G305000                    228   3e-66   
ref|XP_010937167.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    229   3e-66   
ref|XP_006287471.1|  hypothetical protein CARUB_v10000683mg             228   3e-66   
gb|KHF98868.1|  Glucomannan 4-beta-mannosyltransferase 2 -like pr...    228   4e-66   
ref|XP_010554516.1|  PREDICTED: probable mannan synthase 7 isofor...    227   4e-66   
gb|KHG21024.1|  Glucomannan 4-beta-mannosyltransferase 2 -like pr...    228   5e-66   
ref|XP_002963530.1|  glycosyltransferase family 2 protein               227   1e-65   
ref|XP_002981551.1|  family 2 glycosyltransferase                       227   1e-65   
gb|AAC98005.1|  Similar to gi|2245014 glucosyltransferase homolog...    224   1e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008783951.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    226   1e-65   
ref|XP_008800552.1|  PREDICTED: mannan synthase 1-like                  226   2e-65   
ref|XP_010554514.1|  PREDICTED: probable mannan synthase 7 isofor...    227   2e-65   
ref|XP_010535659.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    226   3e-65   
ref|XP_011088835.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    225   4e-65   
ref|XP_010520406.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    224   9e-65   
ref|XP_010096071.1|  hypothetical protein L484_000910                   224   1e-64   
ref|XP_004506130.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    223   3e-64   
gb|ACE60600.1|  mannan synthase                                         223   3e-64   Coffea canephora [robusta coffee]
ref|XP_011094610.1|  PREDICTED: mannan synthase 1-like                  223   4e-64   
gb|EYU38560.1|  hypothetical protein MIMGU_mgv1a017694mg                222   5e-64   
ref|XP_001764061.1|  cellulose synthase-like A1, glycosyltransfer...    222   7e-64   
ref|XP_007132379.1|  hypothetical protein PHAVU_011G089900g             222   8e-64   
gb|EMT24748.1|  hypothetical protein F775_52670                         221   1e-63   
emb|CDP06773.1|  unnamed protein product                                221   2e-63   
ref|XP_004251009.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    221   2e-63   
ref|XP_010278246.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    221   2e-63   
ref|XP_008783921.1|  PREDICTED: probable mannan synthase 3 isofor...    222   2e-63   
ref|XP_008783930.1|  PREDICTED: probable mannan synthase 3 isofor...    222   2e-63   
ref|XP_009769755.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    221   2e-63   
ref|XP_010935702.1|  PREDICTED: mannan synthase 1-like isoform X1       220   3e-63   
gb|ACV71015.1|  UPA15                                                   219   5e-63   Capsicum annuum
ref|XP_001759209.1|  cellulose synthase-like A3, glycosyltransfer...    220   6e-63   
ref|XP_006349077.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    219   7e-63   
ref|XP_003606275.1|  Glucomannan 4-beta-mannosyltransferase             218   8e-63   
gb|ABD79100.1|  cellulose synthase-like A2                              219   1e-62   Physcomitrella patens
ref|XP_009794211.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    218   2e-62   
ref|XP_009590983.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    218   2e-62   
ref|XP_003535285.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    218   2e-62   
gb|KHN45690.1|  Glucomannan 4-beta-mannosyltransferase 9                218   2e-62   
gb|AAQ62571.1|  glycosyltransferase 5                                   218   2e-62   Ipomoea trifida
emb|CAN74410.1|  hypothetical protein VITISV_013215                     218   3e-62   Vitis vinifera
ref|XP_002277171.1|  PREDICTED: mannan synthase 1-like                  217   4e-62   Vitis vinifera
ref|XP_010937166.1|  PREDICTED: probable mannan synthase 11             218   4e-62   
ref|XP_003606273.1|  Glucomannan 4-beta-mannosyltransferase             217   5e-62   
gb|KHN48194.1|  Glucomannan 4-beta-mannosyltransferase 9                216   8e-62   
ref|XP_004493996.1|  PREDICTED: mannan synthase 1-like                  216   1e-61   
ref|XP_003542549.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    216   1e-61   
gb|ACE60601.1|  mannan synthase                                         215   2e-61   
gb|KEH24032.1|  cellulose synthase-like protein A1                      215   3e-61   
gb|AED99880.1|  glycosyltransferase                                     213   4e-61   
ref|XP_001759264.1|  cellulose synthase-like A2, glycosyltransfer...    214   8e-61   
gb|AAQ62570.1|  glycosyltransferase 1                                   214   9e-61   
ref|XP_010937165.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    214   1e-60   
ref|XP_008787118.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    212   2e-60   
gb|AAQ62572.1|  glycosyltransferase 10                                  213   2e-60   
sp|Q6UDF0.1|CSLA1_CYATE  RecName: Full=Mannan synthase 1; AltName...    212   5e-60   
ref|XP_009410399.1|  PREDICTED: probable mannan synthase 11 isofo...    212   5e-60   
ref|XP_009410398.1|  PREDICTED: probable mannan synthase 11 isofo...    212   7e-60   
ref|XP_003553558.1|  PREDICTED: mannan synthase 1-like                  211   7e-60   
ref|XP_006400151.1|  hypothetical protein EUTSA_v100135781mg            201   9e-60   
ref|XP_010516765.1|  PREDICTED: probable mannan synthase 7 isofor...    209   2e-59   
ref|XP_010937163.1|  PREDICTED: probable mannan synthase 11 isofo...    204   2e-59   
gb|KHN09524.1|  Mannan synthase 1                                       209   2e-59   
ref|XP_003520655.1|  PREDICTED: mannan synthase 1-like                  209   5e-59   
ref|XP_010516764.1|  PREDICTED: probable mannan synthase 7 isofor...    209   6e-59   
ref|XP_010509580.1|  PREDICTED: probable mannan synthase 7              209   7e-59   
gb|KDO49989.1|  hypothetical protein CISIN_1g044519mg                   209   8e-59   
ref|XP_008787126.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    207   9e-59   
ref|XP_010937357.1|  PREDICTED: probable mannan synthase 9              206   1e-58   
ref|XP_010937162.1|  PREDICTED: probable mannan synthase 11 isofo...    204   2e-58   
ref|XP_010505088.1|  PREDICTED: probable mannan synthase 7              208   2e-58   
emb|CDX79614.1|  BnaC03g19500D                                          207   4e-58   
ref|XP_009133031.1|  PREDICTED: probable mannan synthase 7              207   4e-58   
ref|XP_009410012.1|  PREDICTED: probable mannan synthase 9 isofor...    207   5e-58   
ref|XP_008802588.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    207   6e-58   
ref|XP_009410011.1|  PREDICTED: probable mannan synthase 9 isofor...    207   7e-58   
ref|XP_010540229.1|  PREDICTED: probable mannan synthase 3 isofor...    205   7e-58   
ref|XP_008783968.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    205   1e-57   
ref|XP_008780571.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    203   1e-57   
ref|XP_006290419.1|  hypothetical protein CARUB_v10019203mg             205   1e-57   
ref|XP_010540228.1|  PREDICTED: probable mannan synthase 11 isofo...    205   1e-57   
ref|XP_010540227.1|  PREDICTED: probable mannan synthase 11 isofo...    205   2e-57   
ref|XP_010937164.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    206   2e-57   
ref|XP_008783962.1|  PREDICTED: probable mannan synthase 9 isofor...    205   2e-57   
ref|XP_009419094.1|  PREDICTED: probable mannan synthase 4              205   2e-57   
ref|XP_008780566.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    204   3e-57   
gb|AFV79650.1|  mannan synthase                                         204   5e-57   
ref|XP_008780554.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    204   6e-57   
ref|XP_002878056.1|  hypothetical protein ARALYDRAFT_907034             202   2e-56   
emb|CDX69464.1|  BnaA10g18130D                                          200   2e-56   
gb|ADW77641.1|  putative mannan synthase                                202   2e-56   
ref|XP_010926632.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    199   3e-56   
ref|XP_009121507.1|  PREDICTED: probable mannan synthase 11             201   4e-56   
ref|XP_010453775.1|  PREDICTED: probable mannan synthase 11             201   5e-56   
ref|XP_006403035.1|  hypothetical protein EUTSA_v10005891mg             201   5e-56   
ref|XP_010492500.1|  PREDICTED: probable mannan synthase 11             200   6e-56   
ref|XP_008787138.1|  PREDICTED: probable mannan synthase 11             200   6e-56   
ref|XP_010554517.1|  PREDICTED: probable mannan synthase 11             201   7e-56   
ref|XP_010516195.1|  PREDICTED: probable mannan synthase 14 isofo...    198   7e-56   
ref|XP_007027601.1|  Nucleotide-diphospho-sugar transferases supe...    199   1e-55   
ref|XP_010427404.1|  PREDICTED: probable mannan synthase 14             199   2e-55   
ref|XP_010420302.1|  PREDICTED: probable mannan synthase 11             199   2e-55   
dbj|BAJ89328.1|  predicted protein                                      191   2e-55   
ref|XP_010504474.1|  PREDICTED: probable mannan synthase 14             199   3e-55   
ref|XP_004973516.1|  PREDICTED: probable mannan synthase 11-like        199   4e-55   
ref|XP_011010406.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    199   5e-55   
emb|CDY26505.1|  BnaC09g41630D                                          198   6e-55   
ref|XP_010516194.1|  PREDICTED: probable mannan synthase 14 isofo...    198   8e-55   
ref|XP_010917051.1|  PREDICTED: probable mannan synthase 4 isofor...    199   9e-55   
ref|XP_010917052.1|  PREDICTED: probable mannan synthase 4 isofor...    199   1e-54   
ref|XP_002863134.1|  predicted protein                                  197   1e-54   
ref|XP_009116294.1|  PREDICTED: probable mannan synthase 14             197   1e-54   
ref|XP_010460178.1|  PREDICTED: probable mannan synthase 10             198   1e-54   
ref|XP_008671633.1|  PREDICTED: mannan synthase 1-like                  189   1e-54   
emb|CDX72181.1|  BnaC08g26930D                                          197   2e-54   
gb|KFK34844.1|  hypothetical protein AALP_AA5G200500                    196   2e-54   
ref|XP_006287553.1|  hypothetical protein CARUB_v10000762mg             196   2e-54   
ref|XP_009139629.1|  PREDICTED: probable mannan synthase 15 isofo...    194   2e-54   
gb|EMS62877.1|  hypothetical protein TRIUR3_33379                       195   3e-54   
emb|CAN74357.1|  hypothetical protein VITISV_042153                     196   3e-54   
emb|CDY35710.1|  BnaC02g09760D                                          196   3e-54   
dbj|BAK04119.1|  predicted protein                                      193   3e-54   
ref|XP_009382953.1|  PREDICTED: probable mannan synthase 11             196   4e-54   
ref|XP_008806011.1|  PREDICTED: probable mannan synthase 4              197   4e-54   
gb|AFW76791.1|  hypothetical protein ZEAMMB73_274552                    189   5e-54   
emb|CDY54604.1|  BnaA05g28600D                                          195   6e-54   
ref|XP_006307167.1|  hypothetical protein CARUB_v10008757mg             196   6e-54   
emb|CDY26949.1|  BnaC09g36340D                                          195   7e-54   
ref|XP_009385870.1|  PREDICTED: mannan synthase 1-like                  195   8e-54   
ref|XP_010477728.1|  PREDICTED: probable mannan synthase 10             196   8e-54   
emb|CDY09164.1|  BnaA02g05900D                                          194   1e-53   
ref|XP_010498927.1|  PREDICTED: probable mannan synthase 10             195   1e-53   
emb|CAB87854.1|  putative protein                                       194   1e-53   
ref|NP_191159.2|  cellulose synthase like A14                           194   1e-53   
ref|XP_010939804.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    189   1e-53   
ref|XP_009139627.1|  PREDICTED: probable mannan synthase 15 isofo...    194   1e-53   
gb|AAO42815.1|  At3g56000                                               194   2e-53   
ref|XP_009139628.1|  PREDICTED: probable mannan synthase 15 isofo...    194   2e-53   
ref|XP_006410731.1|  hypothetical protein EUTSA_v10016754mg             191   2e-53   
ref|XP_003572230.2|  PREDICTED: probable mannan synthase 11 isofo...    195   2e-53   
ref|XP_004497599.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    194   3e-53   
gb|EMT15170.1|  hypothetical protein F775_14200                         193   3e-53   
emb|CDX88785.1|  BnaA03g08640D                                          193   3e-53   
emb|CDX71011.1|  BnaC03g10950D                                          193   4e-53   
ref|XP_006660158.1|  PREDICTED: LOW QUALITY PROTEIN: probable man...    194   4e-53   
ref|XP_009131529.1|  PREDICTED: probable mannan synthase 11             192   5e-53   
emb|CDY68733.1|  BnaUnng03000D                                          186   5e-53   
ref|NP_193077.2|  putative mannan synthase 15                           193   5e-53   
ref|XP_008676306.1|  PREDICTED: mannan synthase 1-like                  184   6e-53   
ref|XP_002459874.1|  hypothetical protein SORBIDRAFT_02g012870          192   7e-53   
dbj|BAC43295.1|  putative glucosyltransferase                           188   8e-53   
ref|XP_002893324.1|  hypothetical protein ARALYDRAFT_313253             192   1e-52   
ref|XP_002436757.1|  hypothetical protein SORBIDRAFT_10g008206          183   1e-52   
gb|KFK36462.1|  hypothetical protein AALP_AA4G127800                    191   2e-52   
emb|CDX92340.1|  BnaA10g13790D                                          195   2e-52   
ref|NP_001136470.1|  uncharacterized protein LOC100216582               187   3e-52   
ref|XP_009103139.1|  PREDICTED: probable mannan synthase 10             191   3e-52   
emb|CDM86569.1|  unnamed protein product                                191   4e-52   
emb|CDY01129.1|  BnaA04g06900D                                          191   4e-52   
gb|EEC80274.1|  hypothetical protein OsI_22257                          191   4e-52   
gb|AAF87149.1|AC002423_14  T23E23.23                                    191   5e-52   
gb|EMT01783.1|  hypothetical protein F775_21241                         191   5e-52   
ref|XP_008673321.1|  PREDICTED: hypothetical protein isoform X1         188   5e-52   
gb|EEE65380.1|  hypothetical protein OsJ_20691                          191   5e-52   
sp|Q67X45.1|CSLA3_ORYSJ  RecName: Full=Probable mannan synthase 3...    191   6e-52   
ref|XP_010440588.1|  PREDICTED: probable mannan synthase 15 isofo...    189   7e-52   
ref|XP_010440586.1|  PREDICTED: probable mannan synthase 15 isofo...    189   7e-52   
ref|NP_173818.1|  cellulose synthase-like A10                           190   7e-52   
emb|CDX70677.1|  BnaC03g07610D                                          188   7e-52   
ref|XP_008649262.1|  PREDICTED: probable mannan synthase 3 isofor...    190   7e-52   
ref|XP_006416032.1|  hypothetical protein EUTSA_v10007269mg             190   8e-52   
ref|XP_002879565.1|  hypothetical protein ARALYDRAFT_482526             190   1e-51   
ref|XP_010435268.1|  PREDICTED: probable mannan synthase 15 isofo...    187   1e-51   
ref|XP_010450209.1|  PREDICTED: probable mannan synthase 15 isofo...    187   1e-51   
ref|XP_010435267.1|  PREDICTED: probable mannan synthase 15 isofo...    187   2e-51   
ref|XP_002445548.1|  hypothetical protein SORBIDRAFT_07g021300          189   2e-51   
gb|AFW62286.1|  hypothetical protein ZEAMMB73_786937                    186   3e-51   
ref|XP_010440585.1|  PREDICTED: probable mannan synthase 15 isofo...    188   3e-51   
ref|XP_010440584.1|  PREDICTED: probable mannan synthase 15 isofo...    188   3e-51   
ref|NP_001183100.1|  hypothetical protein                               188   3e-51   
gb|EEE68748.1|  hypothetical protein OsJ_27439                          187   4e-51   
ref|NP_565813.1|  putative mannan synthase 7                            188   5e-51   
ref|XP_006283494.1|  hypothetical protein CARUB_v10004546mg             188   5e-51   
ref|XP_010435266.1|  PREDICTED: probable mannan synthase 15 isofo...    187   6e-51   
ref|XP_010450208.1|  PREDICTED: probable mannan synthase 15 isofo...    187   8e-51   
ref|XP_004959258.1|  PREDICTED: mannan synthase 1-like                  187   8e-51   
ref|XP_010450207.1|  PREDICTED: probable mannan synthase 15 isofo...    187   8e-51   
sp|Q6YWK8.1|CSLAB_ORYSJ  RecName: Full=Probable mannan synthase 1...    187   9e-51   
ref|XP_008664730.1|  PREDICTED: uncharacterized protein LOC100216...    187   1e-50   
gb|EEC83623.1|  hypothetical protein OsI_29346                          188   2e-50   
gb|KFK25839.1|  hypothetical protein AALP_AA8G168900                    186   2e-50   
gb|EMT17077.1|  hypothetical protein F775_09797                         186   3e-50   
ref|XP_002873761.1|  hypothetical protein ARALYDRAFT_488470             184   3e-50   
ref|XP_008677729.1|  PREDICTED: uncharacterized protein LOC100501...    186   3e-50   
ref|XP_006656810.1|  PREDICTED: probable mannan synthase 3-like         184   3e-50   
ref|XP_010462862.1|  PREDICTED: probable mannan synthase 3              185   5e-50   
ref|XP_003578707.1|  PREDICTED: mannan synthase 1-like                  185   6e-50   
gb|AAM61171.1|  putative glucosyltransferase                            185   7e-50   
emb|CDY40448.1|  BnaA04g20690D                                          185   8e-50   
ref|XP_004966838.1|  PREDICTED: probable mannan synthase 3-like         185   9e-50   
emb|CDY40295.1|  BnaA07g09050D                                          184   1e-49   
ref|XP_010227824.1|  PREDICTED: probable mannan synthase 3 isofor...    182   3e-49   
gb|KFK44470.1|  hypothetical protein AALP_AA1G260600                    183   3e-49   
ref|NP_197123.3|  cellulose synthase like A11                           181   4e-49   
gb|EMT02496.1|  hypothetical protein F775_10659                         179   5e-49   
ref|XP_009769757.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    182   5e-49   
ref|XP_009141504.1|  PREDICTED: probable mannan synthase 7              182   5e-49   
gb|EYU29872.1|  hypothetical protein MIMGU_mgv1a023425mg                182   5e-49   
emb|CAB10434.1|  cellulose synthase like protein                        178   6e-49   
gb|EAZ45755.1|  hypothetical protein OsJ_30439                          179   7e-49   
ref|XP_009390887.1|  PREDICTED: probable mannan synthase 11             182   7e-49   
ref|XP_010227823.1|  PREDICTED: probable mannan synthase 3 isofor...    181   1e-48   
ref|XP_003560885.1|  PREDICTED: probable mannan synthase 3 isofor...    181   1e-48   
ref|XP_006661580.1|  PREDICTED: mannan synthase 1-like                  180   2e-48   
ref|XP_008649263.1|  PREDICTED: probable mannan synthase 3 isofor...    181   2e-48   
gb|EEC85104.1|  hypothetical protein OsI_32487                          181   2e-48   
ref|NP_193392.3|  cellulose synthase-like A01                           178   2e-48   
ref|XP_009403159.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    181   2e-48   
tpg|DAA57949.1|  TPA: hypothetical protein ZEAMMB73_988025              177   3e-48   
gb|EMS50576.1|  hypothetical protein TRIUR3_00182                       179   4e-48   
ref|XP_002870144.1|  hypothetical protein ARALYDRAFT_915064             180   5e-48   
gb|EMS57245.1|  hypothetical protein TRIUR3_28392                       177   1e-47   
ref|XP_010234713.1|  PREDICTED: probable mannan synthase 4              178   1e-47   
ref|XP_011088832.1|  PREDICTED: probable mannan synthase 11             178   2e-47   
ref|XP_009136796.1|  PREDICTED: probable mannan synthase 1              178   2e-47   
sp|Q84W54.1|CSLA1_ARATH  RecName: Full=Probable mannan synthase 1...    178   2e-47   
emb|CDX90506.1|  BnaA03g42750D                                          177   5e-47   
gb|ABF94194.1|  glycosyl transferase family 2 protein, putative, ...    176   5e-47   
ref|XP_010440127.1|  PREDICTED: probable mannan synthase 1              177   7e-47   
ref|XP_006282581.1|  hypothetical protein CARUB_v10004510mg             176   8e-47   
sp|Q8S7W0.1|CSLA4_ORYSJ  RecName: Full=Probable mannan synthase 4...    176   1e-46   
ref|XP_010449754.1|  PREDICTED: probable mannan synthase 1              176   1e-46   
ref|XP_010434799.1|  PREDICTED: probable mannan synthase 1 isofor...    176   1e-46   
ref|XP_006414326.1|  hypothetical protein EUTSA_v10024828mg             176   1e-46   
ref|XP_010434800.1|  PREDICTED: probable mannan synthase 1 isofor...    176   1e-46   
ref|XP_003590384.1|  Glucomannan 4-beta-mannosyltransferase             174   2e-46   
tpg|DAA01745.1|  TPA: cellulose synthase-like A4                        176   2e-46   
gb|EMS51579.1|  hypothetical protein TRIUR3_28386                       176   2e-46   
ref|XP_006651080.1|  PREDICTED: probable mannan synthase 4-like         175   2e-46   
ref|NP_001064564.1|  Os10g0406400                                       168   3e-46   
ref|NP_001130786.1|  hypothetical protein                               170   3e-46   
ref|XP_009380154.1|  PREDICTED: probable mannan synthase 4              175   4e-46   
gb|KFK26523.1|  hypothetical protein AALP_AA8G260200                    174   1e-45   
gb|EYU36983.1|  hypothetical protein MIMGU_mgv1a004073mg                173   2e-45   
emb|CBI32777.3|  unnamed protein product                                171   2e-45   
ref|XP_006428366.1|  hypothetical protein CICLE_v10013685mg             171   2e-45   
ref|XP_002468429.1|  hypothetical protein SORBIDRAFT_01g045850          172   2e-45   
emb|CDY32098.1|  BnaC04g44680D                                          172   5e-45   
dbj|BAK08066.1|  predicted protein                                      171   7e-45   
gb|AFW73394.1|  hypothetical protein ZEAMMB73_786146                    167   8e-45   
ref|XP_008658026.1|  PREDICTED: hypothetical protein isoform X1         170   1e-44   
gb|EEC66918.1|  hypothetical protein OsI_33517                          168   2e-44   
ref|XP_004983152.1|  PREDICTED: probable mannan synthase 2-like         171   2e-44   
ref|NP_001049100.2|  Os03g0169500                                       171   2e-44   
gb|EEE50933.1|  hypothetical protein OsJ_31468                          168   2e-44   
gb|EMS51475.1|  hypothetical protein TRIUR3_09357                       169   3e-44   
gb|AAK98678.1|AC021893_12  Putative glucosyltransferase                 168   4e-44   
gb|EMT22485.1|  hypothetical protein F775_13089                         168   4e-44   
tpg|DAA01755.1|  TPA: cellulose synthase-like A2                        169   5e-44   
dbj|BAK05964.1|  predicted protein                                      168   7e-44   
dbj|BAK06422.1|  predicted protein                                      168   7e-44   
ref|XP_006662343.1|  PREDICTED: probable mannan synthase 2-like         167   7e-44   
ref|XP_008350148.1|  PREDICTED: probable mannan synthase 9              157   8e-44   



>ref|XP_009774056.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
sylvestris]
Length=526

 Score =   303 bits (775),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 160/168 (95%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KV+AHIVTF+FYC++LPATVLVPEV+VPKWGAVYIPS+ITLLNAVGTPRS HL++FWILF
Sbjct  360  KVVAHIVTFVFYCIVLPATVLVPEVEVPKWGAVYIPSIITLLNAVGTPRSFHLIIFWILF  419

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDA K+K A++A FKKPRFR GDR+H+LE
Sbjct  420  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAFKIKSAIKA-FKKPRFRFGDRLHLLE  478

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            LATGAYLF CGCYD+AFGKNHYFLYLF+Q+ AFFI GFG++GTF+PNS
Sbjct  479  LATGAYLFFCGCYDIAFGKNHYFLYLFIQAFAFFIIGFGHVGTFVPNS  526



>ref|XP_009623019.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
tomentosiformis]
Length=526

 Score =   301 bits (772),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 159/168 (95%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KVIAHIVTF+FYC++LPATVLVPEV+VPKWGAVYIPS+ITLLNAVGTPRS HL++FWILF
Sbjct  360  KVIAHIVTFVFYCIVLPATVLVPEVEVPKWGAVYIPSIITLLNAVGTPRSFHLIIFWILF  419

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDA K+K A++A FKKPRFR GDR+H+LE
Sbjct  420  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAFKIKSAMKA-FKKPRFRFGDRLHLLE  478

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            LATGAYLF CGCYD+AFGKNHYFLYLF+Q+ AF I GFG++GTF+PNS
Sbjct  479  LATGAYLFFCGCYDIAFGKNHYFLYLFIQAFAFLIMGFGHVGTFVPNS  526



>ref|XP_011094427.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Sesamum 
indicum]
Length=532

 Score =   301 bits (770),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 159/167 (95%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEVQ+PKWGAVY+PS+ITLLNAVGTPRSLHLLVFWILF
Sbjct  367  KIVAHIVTFVFYCVVLPATVLVPEVQIPKWGAVYVPSIITLLNAVGTPRSLHLLVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDA KLK AL+A F++PRFR+G+R+H+LE
Sbjct  427  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAHKLKSALKA-FRRPRFRLGERIHLLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            LATG YLF CGCYD+ FGKNHYF+YLF+Q+ AFFI GFGYIGTF+P+
Sbjct  486  LATGGYLFFCGCYDIVFGKNHYFIYLFLQATAFFIMGFGYIGTFVPS  532



>gb|AEZ00898.1| putative beta-14-mannan synthase, partial [Elaeis guineensis]
Length=243

 Score =   289 bits (740),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 155/168 (92%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVT +FYC+++PATVLVPEV++PKWGAVYIPS+ITLLNAVGTPRSLHLLVFWILF
Sbjct  77   KIVAHIVTSVFYCMVIPATVLVPEVEIPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILF  136

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEW+VTEKLGDA K K A +A  +KPR RIGDR+H+LE
Sbjct  137  ENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGDASKTKVAAKAA-RKPRIRIGDRLHLLE  195

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF CGCYDVAFGKNHYF+YLF+Q+IAFFI GFGY+GTF+ +S
Sbjct  196  LGVGAYLFFCGCYDVAFGKNHYFIYLFLQAIAFFIVGFGYVGTFVSHS  243



>ref|XP_004249461.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Solanum 
lycopersicum]
Length=533

 Score =   298 bits (762),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 158/168 (94%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KV+AHIVTF+FYCV+LPATVLVPEV+VPKWGAVYIPS+IT+LNAVGTPRSLHL++FWILF
Sbjct  367  KVVAHIVTFVFYCVVLPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSLHLIIFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGD  K+K A++A  KKPRFR GDR+ +LE
Sbjct  427  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDVLKMKSAIKAV-KKPRFRFGDRLLLLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            LATGAYLF CGCYDVAFGKNHYFLYLF+Q+ AFFI GFG+IGTF+PNS
Sbjct  486  LATGAYLFFCGCYDVAFGKNHYFLYLFLQAFAFFIIGFGHIGTFVPNS  533



>emb|CDP15350.1| unnamed protein product [Coffea canephora]
Length=533

 Score =   297 bits (760),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 157/168 (93%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH++TF+FYCVLLP+TVLVPEVQVPKWGAVYIP VITLLNAVGTPRSLHL+VFWILF
Sbjct  367  KIIAHLITFVFYCVLLPSTVLVPEVQVPKWGAVYIPCVITLLNAVGTPRSLHLMVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATF+GLLE+ RVNEW+VTEKLGDA K K A++A  +KPRFR G+R+H+LE
Sbjct  427  ENVMSLHRTKATFVGLLESSRVNEWVVTEKLGDALKNKSAVKA-IRKPRFRFGERLHLLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L TGAYLF CGCYDVAFGKNHY+LYLF Q+IAFFIAGFGYIGTF+PNS
Sbjct  486  LGTGAYLFFCGCYDVAFGKNHYYLYLFTQAIAFFIAGFGYIGTFVPNS  533



>ref|XP_006339112.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
tuberosum]
Length=533

 Score =   296 bits (758),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 157/168 (93%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KV+AHIVTF+FYCV+LPATVLVPEV+VPKWGAVYIPS+IT+LNAVGTPRS HL++FWILF
Sbjct  367  KVVAHIVTFVFYCVVLPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLIIFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGD  K+K A +A  KKPRFR+GDR+ +LE
Sbjct  427  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDVLKMKSASKAV-KKPRFRVGDRLLLLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            LATGAYLF CGCYDVAFGKNHYFLYLF+Q+ AFFI GFG+IGTF+PNS
Sbjct  486  LATGAYLFFCGCYDVAFGKNHYFLYLFIQAFAFFIIGFGHIGTFVPNS  533



>ref|XP_009601859.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
tomentosiformis]
Length=533

 Score =   296 bits (758),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 156/168 (93%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KVIAHIVTF+FY V+LPATVLVPEV+VPKWGAVYIP++ITLLNAVGTPRSLHLLVFWILF
Sbjct  367  KVIAHIVTFVFYVVVLPATVLVPEVEVPKWGAVYIPAIITLLNAVGTPRSLHLLVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDA KLK A +A F+K R R+GDR+H+LE
Sbjct  427  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDALKLKSAAKA-FRKHRMRLGDRIHLLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            LA GAYLF CGCYD+AFG NHYFLYLF+Q+ AFFI GFGY+GTF+PNS
Sbjct  486  LAAGAYLFFCGCYDIAFGNNHYFLYLFIQAFAFFIVGFGYVGTFVPNS  533



>ref|XP_006492171.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Citrus 
sinensis]
Length=526

 Score =   294 bits (753),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 155/169 (92%), Gaps = 4/169 (2%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KV+AHIVTF+FYCVLLPATVL PEV+VPKWGAVYIPS+ITLLNAVGTPRSLHLLVFWILF
Sbjct  361  KVVAHIVTFVFYCVLLPATVLFPEVEVPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILF  420

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRA-TFKKPRFRIGDRVHVL  358
            ENVMSLHRTKATFIGLLEAGRVNEW+VTEKLGD   +K  L   T KKPR RIG+RVHVL
Sbjct  421  ENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGD---VKSKLGGKTLKKPRIRIGERVHVL  477

Query  359  ELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            EL  GAYLF+CGCYDVAFGKNHYF+YLF+QSIAFF+AG GY+GTF+PNS
Sbjct  478  ELGVGAYLFLCGCYDVAFGKNHYFIYLFLQSIAFFVAGVGYVGTFVPNS  526



>gb|KDO40534.1| hypothetical protein CISIN_1g009761mg [Citrus sinensis]
Length=526

 Score =   294 bits (753),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 155/169 (92%), Gaps = 4/169 (2%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KV+AHIVTF+FYCVLLPATVL PEV+VPKWGAVYIPS+ITLLNAVGTPRSLHLLVFWILF
Sbjct  361  KVVAHIVTFVFYCVLLPATVLFPEVEVPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILF  420

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRA-TFKKPRFRIGDRVHVL  358
            ENVMSLHRTKATFIGLLEAGRVNEW+VTEKLGD   +K  L   T KKPR RIG+RVHVL
Sbjct  421  ENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGD---VKSKLGGKTLKKPRIRIGERVHVL  477

Query  359  ELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            EL  GAYLF+CGCYDVAFGKNHYF+YLF+QSIAFF+AG GY+GTF+PNS
Sbjct  478  ELGVGAYLFLCGCYDVAFGKNHYFIYLFLQSIAFFVAGVGYVGTFVPNS  526



>ref|XP_006436686.1| hypothetical protein CICLE_v10031284mg [Citrus clementina]
 gb|ESR49926.1| hypothetical protein CICLE_v10031284mg [Citrus clementina]
Length=508

 Score =   294 bits (752),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 155/169 (92%), Gaps = 4/169 (2%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KV+AHIVTF+FYCVLLPATVL PEV+VPKWGAVYIPS+ITLLNAVGTPRSLHLLVFWILF
Sbjct  343  KVVAHIVTFVFYCVLLPATVLFPEVEVPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILF  402

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRA-TFKKPRFRIGDRVHVL  358
            ENVMSLHRTKATFIGLLEAGRVNEW+VTEKLGD   +K  L   T KKPR RIG+RVHVL
Sbjct  403  ENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGD---VKSKLGGKTLKKPRIRIGERVHVL  459

Query  359  ELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            EL  GAYLF+CGCYDVAFGKNHYF+YLF+QSIAFF+AG GY+GTF+PNS
Sbjct  460  ELGVGAYLFLCGCYDVAFGKNHYFIYLFLQSIAFFVAGVGYVGTFVPNS  508



>ref|XP_009771587.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
sylvestris]
Length=533

 Score =   294 bits (752),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 155/168 (92%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KV+AHIVTF+FY V+LPATVLVPEV+VPKWGAVYIP++ITLLNAVGTPRSLHLLVFWILF
Sbjct  367  KVVAHIVTFVFYVVVLPATVLVPEVEVPKWGAVYIPAIITLLNAVGTPRSLHLLVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLE GRVNEWIVTEKLGDA KLK A +A F+K R R+GDR+H+LE
Sbjct  427  ENVMSLHRTKATFIGLLEVGRVNEWIVTEKLGDALKLKSAAKA-FRKHRMRLGDRIHLLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            LA GAYLF CGCYD+AFG NHYFLYLF+Q+ AFFI GFGY+GTF+PNS
Sbjct  486  LAAGAYLFFCGCYDIAFGNNHYFLYLFIQAFAFFIVGFGYVGTFVPNS  533



>ref|XP_006341174.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
tuberosum]
Length=533

 Score =   294 bits (752),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 154/168 (92%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KV+AHIVTF+FY V+LPATVLVPEV+VPKWGAVYIP++ITLLNAVGTPRSLHLLVFWILF
Sbjct  367  KVVAHIVTFVFYVVVLPATVLVPEVEVPKWGAVYIPAIITLLNAVGTPRSLHLLVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDA KLK A +A FKK R R+GDR+H+LE
Sbjct  427  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDALKLKSATKA-FKKHRMRLGDRIHLLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
             A GAYLF CGCYD+AFG NHYFLYLF+QS AF I GFGY+GTF+PNS
Sbjct  486  FAAGAYLFFCGCYDIAFGTNHYFLYLFIQSFAFLIVGFGYVGTFIPNS  533



>gb|KCW89263.1| hypothetical protein EUGRSUZ_A01558 [Eucalyptus grandis]
Length=425

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 153/168 (91%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATV VPEV VPKWGAVYIPS+IT+LNAVGTPRSLHL+VFWILF
Sbjct  259  KIVAHIVTFIFYCVVLPATVFVPEVTVPKWGAVYIPSIITVLNAVGTPRSLHLVVFWILF  318

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS HRTKATFIGLLEAGRVNEWIVTEKLGDA K+K + +   KKP+FR GDR+HVLE
Sbjct  319  ENVMSFHRTKATFIGLLEAGRVNEWIVTEKLGDALKVKASNKVP-KKPKFRFGDRLHVLE  377

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF CGCYD+AFG+NHYF+YLF Q+IAFFI GFGYIGTF+PNS
Sbjct  378  LGVGAYLFFCGCYDIAFGRNHYFMYLFAQAIAFFIMGFGYIGTFVPNS  425



>ref|XP_010325940.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Solanum lycopersicum]
Length=496

 Score =   292 bits (747),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 154/168 (92%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KV+AHIVTF+FY V+LPATVLVPEV+VPKWGAVYIP++ITLLNAVGTPRSLHLLVFWILF
Sbjct  330  KVVAHIVTFVFYVVVLPATVLVPEVEVPKWGAVYIPAIITLLNAVGTPRSLHLLVFWILF  389

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDA KLK A +A FKK R R+GDR+H+LE
Sbjct  390  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDALKLKSATKA-FKKHRMRLGDRIHLLE  448

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
             A GAYLF CGCYD+AFG NHYFLYLF+Q+ AF I GFGY+GTF+PNS
Sbjct  449  FAAGAYLFFCGCYDIAFGTNHYFLYLFIQAFAFLIVGFGYVGTFVPNS  496



>gb|KDP42759.1| hypothetical protein JCGZ_23699 [Jatropha curcas]
Length=532

 Score =   293 bits (749),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 156/168 (93%), Gaps = 2/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEV+VPKWGAVYIPS+ITLLNAVGTPRSLHLLVFWILF
Sbjct  367  KIVAHIVTFIFYCVVLPATVLVPEVEVPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEA RVNEWIVTEKLGDA K K A++A  KKPRF+ G+R+H+LE
Sbjct  427  ENVMSLHRTKATFIGLLEASRVNEWIVTEKLGDAVKSK-AVKAP-KKPRFKFGERLHLLE  484

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L TGAYLF CGCYDVAFGKNHYFLYLF Q+IAFFI GFGY+GTF+P S
Sbjct  485  LGTGAYLFFCGCYDVAFGKNHYFLYLFAQAIAFFIIGFGYVGTFVPQS  532



>ref|XP_010325939.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Solanum lycopersicum]
Length=533

 Score =   292 bits (748),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 154/168 (92%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KV+AHIVTF+FY V+LPATVLVPEV+VPKWGAVYIP++ITLLNAVGTPRSLHLLVFWILF
Sbjct  367  KVVAHIVTFVFYVVVLPATVLVPEVEVPKWGAVYIPAIITLLNAVGTPRSLHLLVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDA KLK A +A FKK R R+GDR+H+LE
Sbjct  427  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDALKLKSATKA-FKKHRMRLGDRIHLLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
             A GAYLF CGCYD+AFG NHYFLYLF+Q+ AF I GFGY+GTF+PNS
Sbjct  486  FAAGAYLFFCGCYDIAFGTNHYFLYLFIQAFAFLIVGFGYVGTFVPNS  533



>gb|EYU41550.1| hypothetical protein MIMGU_mgv1a004346mg [Erythranthe guttata]
Length=532

 Score =   292 bits (747),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/167 (83%), Positives = 157/167 (94%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEV +PKWGA+YIPS+IT+LNAVGTPRSLHLLVFWILF
Sbjct  367  KIVAHIVTFVFYCVVLPATVLVPEVYIPKWGAIYIPSIITILNAVGTPRSLHLLVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDA KLK AL+A FKKPRF+IG+RVH LE
Sbjct  427  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAFKLKSALKA-FKKPRFKIGERVHFLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            +ATGAYLF CGCYDV FGKNHY++ L++Q+IAFFI GF YIGTF+P+
Sbjct  486  VATGAYLFFCGCYDVVFGKNHYYICLYVQAIAFFIMGFSYIGTFVPS  532



>gb|KDP45030.1| hypothetical protein JCGZ_01530 [Jatropha curcas]
Length=533

 Score =   292 bits (747),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 154/168 (92%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEVQVPKWG+VYIPS ITLLNAVGTPRSLHLL+FW+LF
Sbjct  367  KIVAHIVTFLFYCVVLPATVLVPEVQVPKWGSVYIPSTITLLNAVGTPRSLHLLIFWVLF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGL+EAGRVNEW+VTEKLGDA K K + +A  KKPR RIG+R+H+LE
Sbjct  427  ENVMSLHRTKATFIGLVEAGRVNEWVVTEKLGDALKSKGSAKAP-KKPRIRIGERIHLLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF CGCYD AFGKN YF+YLF+QSIAFF+AG GY+GTF+PNS
Sbjct  486  LGVGAYLFFCGCYDFAFGKNSYFIYLFLQSIAFFVAGIGYVGTFVPNS  533



>gb|AGE09561.1| CSLA9-like protein [Eucalyptus cladocalyx]
Length=532

 Score =   291 bits (746),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 153/168 (91%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATV VPEV VPKWGAVYIPS+IT+LNAVGTPRSLHL+VFWILF
Sbjct  366  KIVAHIVTFIFYCVVLPATVFVPEVTVPKWGAVYIPSIITVLNAVGTPRSLHLVVFWILF  425

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS HRTKATFIGLLEAGRVNEWIVTEKLGDA K+K + +   KKP+FR GDR+HVLE
Sbjct  426  ENVMSFHRTKATFIGLLEAGRVNEWIVTEKLGDALKVKASSKVP-KKPKFRFGDRLHVLE  484

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF CGCYD+AFG+NHYF+YLF Q+IAFFI GFGYIGTF+PNS
Sbjct  485  LGVGAYLFFCGCYDIAFGRNHYFMYLFAQAIAFFIMGFGYIGTFVPNS  532



>gb|KCW89261.1| hypothetical protein EUGRSUZ_A01558 [Eucalyptus grandis]
Length=532

 Score =   291 bits (745),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 153/168 (91%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATV VPEV VPKWGAVYIPS+IT+LNAVGTPRSLHL+VFWILF
Sbjct  366  KIVAHIVTFIFYCVVLPATVFVPEVTVPKWGAVYIPSIITVLNAVGTPRSLHLVVFWILF  425

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS HRTKATFIGLLEAGRVNEWIVTEKLGDA K+K + +   KKP+FR GDR+HVLE
Sbjct  426  ENVMSFHRTKATFIGLLEAGRVNEWIVTEKLGDALKVKASNKVP-KKPKFRFGDRLHVLE  484

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF CGCYD+AFG+NHYF+YLF Q+IAFFI GFGYIGTF+PNS
Sbjct  485  LGVGAYLFFCGCYDIAFGRNHYFMYLFAQAIAFFIMGFGYIGTFVPNS  532



>ref|XP_010050059.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Eucalyptus 
grandis]
 gb|KCW89262.1| hypothetical protein EUGRSUZ_A01558 [Eucalyptus grandis]
Length=533

 Score =   291 bits (745),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 153/168 (91%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATV VPEV VPKWGAVYIPS+IT+LNAVGTPRSLHL+VFWILF
Sbjct  367  KIVAHIVTFIFYCVVLPATVFVPEVTVPKWGAVYIPSIITVLNAVGTPRSLHLVVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS HRTKATFIGLLEAGRVNEWIVTEKLGDA K+K + +   KKP+FR GDR+HVLE
Sbjct  427  ENVMSFHRTKATFIGLLEAGRVNEWIVTEKLGDALKVKASNKVP-KKPKFRFGDRLHVLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF CGCYD+AFG+NHYF+YLF Q+IAFFI GFGYIGTF+PNS
Sbjct  486  LGVGAYLFFCGCYDIAFGRNHYFMYLFAQAIAFFIMGFGYIGTFVPNS  533



>ref|XP_009390016.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   291 bits (744),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KV+AHIVTF+FYC+++PATVLVPEV++PKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF
Sbjct  367  KVVAHIVTFVFYCIVIPATVLVPEVEIPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLE GR NEWIVTEKLGD  K+K A +A  K PR RIGDR+H+LE
Sbjct  427  ENVMSLHRTKATFIGLLEGGRANEWIVTEKLGDTMKVKMATKAVKKPPRTRIGDRLHLLE  486

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L TGA+LF CGCYDVAFGKNHYF+YLF+Q+IAFF+ GFG++GTF+P+
Sbjct  487  LGTGAFLFFCGCYDVAFGKNHYFIYLFLQAIAFFVVGFGHVGTFVPS  533



>ref|XP_010912225.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Elaeis guineensis]
Length=500

 Score =   290 bits (741),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 155/168 (92%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYC+++PATVLVPEVQ+PKWGAVYIPS+ITLLNAVGTPRSLHLLVFWILF
Sbjct  334  KIVAHIVTFVFYCLVIPATVLVPEVQIPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILF  393

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLE GRVNEW+VTEKLGDA K+K A +A  +KPR RIGDR+H+LE
Sbjct  394  ENVMSLHRTKATFIGLLEVGRVNEWVVTEKLGDALKMKMAAKAA-RKPRIRIGDRLHLLE  452

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF CGCYDVAFGKNH+F+YLF+Q+ AFFI GFGY+GTF+ +S
Sbjct  453  LGVGAYLFFCGCYDVAFGKNHFFIYLFLQATAFFIVGFGYVGTFVSHS  500



>ref|XP_010940677.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Elaeis 
guineensis]
Length=533

 Score =   290 bits (743),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 155/168 (92%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVT +FYC+++PATVLVPEV++PKWGAVYIPS+ITLLNAVGTPRSLHLLVFWILF
Sbjct  367  KIVAHIVTSVFYCMVIPATVLVPEVEIPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEW+VTEKLGDA K K A +A  +KPR RIGDR+H+LE
Sbjct  427  ENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGDASKTKVAAKAA-RKPRIRIGDRLHLLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF CGCYDVAFGKNHYF+YLF+Q+IAFFI GFGY+GTF+ +S
Sbjct  486  LGVGAYLFFCGCYDVAFGKNHYFIYLFLQAIAFFIVGFGYVGTFVSHS  533



>ref|XP_002311972.2| 4-mannan synthase family protein [Populus trichocarpa]
 gb|EEE89339.2| 4-mannan synthase family protein [Populus trichocarpa]
Length=530

 Score =   290 bits (742),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 155/168 (92%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEV VPKWGAVYIPSV+TLLNAVGTPRSLHL+VFWILF
Sbjct  364  KIVAHIVTFLFYCVVLPATVLVPEVTVPKWGAVYIPSVVTLLNAVGTPRSLHLMVFWILF  423

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEW+VTEKLGDA K K   +AT KKPR RIG+R+H+LE
Sbjct  424  ENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGDALKAKLPAKAT-KKPRIRIGERLHLLE  482

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF CGCYD AFGKN Y+++LF+QSIAFFIAGFGYIGTF+P+S
Sbjct  483  LCAGAYLFFCGCYDFAFGKNRYYIFLFLQSIAFFIAGFGYIGTFVPHS  530



>ref|XP_010912224.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Elaeis guineensis]
Length=533

 Score =   290 bits (742),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 155/168 (92%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYC+++PATVLVPEVQ+PKWGAVYIPS+ITLLNAVGTPRSLHLLVFWILF
Sbjct  367  KIVAHIVTFVFYCLVIPATVLVPEVQIPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLE GRVNEW+VTEKLGDA K+K A +A  +KPR RIGDR+H+LE
Sbjct  427  ENVMSLHRTKATFIGLLEVGRVNEWVVTEKLGDALKMKMAAKAA-RKPRIRIGDRLHLLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF CGCYDVAFGKNH+F+YLF+Q+ AFFI GFGY+GTF+ +S
Sbjct  486  LGVGAYLFFCGCYDVAFGKNHFFIYLFLQATAFFIVGFGYVGTFVSHS  533



>ref|XP_007027600.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY08102.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
1 [Theobroma cacao]
Length=533

 Score =   290 bits (741),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 153/168 (91%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEV+VPKWGAVYIP++IT+LNAVGTPRSLHLLVFWILF
Sbjct  367  KLVAHIVTFIFYCVVLPATVLVPEVEVPKWGAVYIPTIITILNAVGTPRSLHLLVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDA K K   +A  +KPRFR G+R+H+LE
Sbjct  427  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDALKAKAGTKAP-RKPRFRFGERLHLLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF CGCYDV FGKNHYF+YLF Q+IAFFI GFGY+GT +PNS
Sbjct  486  LCVGAYLFFCGCYDVVFGKNHYFIYLFAQAIAFFIMGFGYVGTIVPNS  533



>ref|XP_011024272.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Populus 
euphratica]
Length=530

 Score =   289 bits (739),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 154/168 (92%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LP+TVLVPEV VPKWGAVYIPS++TLLNAVGTPRSLHL+VFWILF
Sbjct  364  KIVAHIVTFVFYCVVLPSTVLVPEVSVPKWGAVYIPSIVTLLNAVGTPRSLHLMVFWILF  423

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLE GRVNEW+VTEKLGDA K K   +AT KKPR RIG+R+H+LE
Sbjct  424  ENVMSLHRTKATFIGLLEVGRVNEWVVTEKLGDALKAKLPAKAT-KKPRIRIGERLHLLE  482

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF CGCYD AFGKN Y+++LF+QSIAFFIAGFGYIGTF+PNS
Sbjct  483  LCAGAYLFFCGCYDFAFGKNRYYIFLFLQSIAFFIAGFGYIGTFVPNS  530



>ref|XP_010110184.1| hypothetical protein L484_016805 [Morus notabilis]
 gb|EXC25422.1| hypothetical protein L484_016805 [Morus notabilis]
Length=541

 Score =   289 bits (739),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 154/168 (92%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVL PEV+VPKWGAVYIPSVITLLNAVGTPRS HLL+FWILF
Sbjct  375  KIVAHIVTFVFYCVVLPATVLAPEVEVPKWGAVYIPSVITLLNAVGTPRSFHLLIFWILF  434

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEWIVT+KLGDA K K   + +FKKPRFRIG+R+H+LE
Sbjct  435  ENVMSLHRTKATFIGLLEAGRVNEWIVTDKLGDALKTKAGAK-SFKKPRFRIGERLHLLE  493

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF CGCYD++FGKN YF+YLF+QS AFFIAG GY+GTF+P++
Sbjct  494  LTVGAYLFFCGCYDLSFGKNRYFIYLFLQSFAFFIAGVGYVGTFVPSA  541



>gb|AFZ78578.1| cellulose synthase-like protein [Populus tomentosa]
Length=530

 Score =   288 bits (736),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 153/168 (91%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVL PEV VPKWGAVYIPSV+TLLNAVGTPRSLHL+VFWILF
Sbjct  364  KIVAHIVTFLFYCVVLPATVLFPEVTVPKWGAVYIPSVVTLLNAVGTPRSLHLMVFWILF  423

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEW+VTEKLGDA K K   +AT KKPR RIG+R+H+LE
Sbjct  424  ENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGDALKAKLPAKAT-KKPRIRIGERLHLLE  482

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF CGCYD AFGKN Y+++LF+QSIAFFIAGFGYIGTF+P S
Sbjct  483  LCAGAYLFFCGCYDFAFGKNRYYIFLFLQSIAFFIAGFGYIGTFVPRS  530



>ref|XP_002283672.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Vitis vinifera]
Length=533

 Score =   287 bits (735),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 157/168 (93%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVP+V+VP+WGAVYIP++IT+LNAVGTPRSLHL+VFWILF
Sbjct  367  KLVAHIVTFVFYCVVLPATVLVPDVEVPRWGAVYIPTIITILNAVGTPRSLHLMVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLE GRVNEW+VTEKLGDA K+K A +A  KKPRF+IG+R+H+LE
Sbjct  427  ENVMSLHRTKATFIGLLEGGRVNEWVVTEKLGDALKVKAATKAP-KKPRFKIGERLHLLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GA+LF CGCYDVAFG+NHYF+YL++Q+IAFFI GFGY+GTF+P S
Sbjct  486  LGVGAFLFFCGCYDVAFGRNHYFIYLYVQAIAFFIVGFGYVGTFVPKS  533



>ref|XP_002530892.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
 gb|EEF31498.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
Length=425

 Score =   284 bits (726),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 151/167 (90%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEV+VPKWG+VYIPS +T+LNAVGTPRSLHLLVFW+LF
Sbjct  259  KIVAHIVTFLFYCVVLPATVLVPEVEVPKWGSVYIPSTVTILNAVGTPRSLHLLVFWVLF  318

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGLLEAGRVNEW+VTEKLGDA K K   +A  +KPR RIG+R+H+LE
Sbjct  319  ENVMSLHRTKATLIGLLEAGRVNEWVVTEKLGDALKTKSTAKAP-RKPRIRIGERLHLLE  377

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L  GAYLFICGCYD  FGKN YF+YLF+QSIAFFI+G GY+GTF+PN
Sbjct  378  LGVGAYLFICGCYDFTFGKNRYFIYLFLQSIAFFISGIGYVGTFVPN  424



>ref|XP_011010407.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Populus euphratica]
Length=530

 Score =   286 bits (732),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEV VPKWGAVYIPSV+TLLNAVGTPRSLHL+VFWILF
Sbjct  364  KIVAHIVTFLFYCVVLPATVLVPEVTVPKWGAVYIPSVVTLLNAVGTPRSLHLMVFWILF  423

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLE GRVNEW+VTEK+GDA K K   +AT KKPR RIG+R+H+LE
Sbjct  424  ENVMSLHRTKATFIGLLEGGRVNEWVVTEKIGDALKAKLPAKAT-KKPRIRIGERLHLLE  482

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
               GAYLF CGCYD AFGKN Y+++LF+QSIAFFIAGFGYIGTF+P+S
Sbjct  483  FCAGAYLFFCGCYDFAFGKNRYYIFLFLQSIAFFIAGFGYIGTFVPHS  530



>ref|XP_002528577.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33785.1| conserved hypothetical protein [Ricinus communis]
Length=498

 Score =   285 bits (729),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 154/168 (92%), Gaps = 2/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEV VPKWGAVYIPS++TLLNAVGTPRSLHL+VFWILF
Sbjct  333  KIVAHIVTFVFYCVVLPATVLVPEVAVPKWGAVYIPSIVTLLNAVGTPRSLHLMVFWILF  392

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDA  LK       KKPRF+ GDR+H+LE
Sbjct  393  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDA--LKAKPAKAPKKPRFKFGDRLHLLE  450

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L TGAYLF CGCYDVAFGKNHYFLYLF+Q+IAFFI GFGYIGTF+PNS
Sbjct  451  LGTGAYLFFCGCYDVAFGKNHYFLYLFVQAIAFFIMGFGYIGTFVPNS  498



>ref|XP_008804385.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Phoenix 
dactylifera]
Length=533

 Score =   286 bits (731),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 154/168 (92%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYC+++PATVLVPEV++PKWGAVYIPS+ITLLNAVGTPRSLHLLVFWILF
Sbjct  367  KIVAHIVTFVFYCLVIPATVLVPEVEIPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGLLEAGRVNEW+VTEKLGDA K+K A ++  +KPR RIGDR+H+LE
Sbjct  427  ENVMSLHRTKATLIGLLEAGRVNEWVVTEKLGDALKMKMATKSA-RKPRIRIGDRLHLLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G+YLF CGCYDVA GKNHYF+YLF+Q+ AFFI GFGY+GTF+ +S
Sbjct  486  LGVGSYLFFCGCYDVALGKNHYFIYLFVQAAAFFIVGFGYVGTFVSHS  533



>ref|XP_002315357.1| 4-mannan synthase family protein [Populus trichocarpa]
 gb|EEF01528.1| 4-mannan synthase family protein [Populus trichocarpa]
Length=530

 Score =   285 bits (728),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LP+TVLVPEV VPKWGAVYIPS++TLLNAVGTPRSLHL+VFWILF
Sbjct  364  KIVAHIVTFVFYCVVLPSTVLVPEVSVPKWGAVYIPSIVTLLNAVGTPRSLHLMVFWILF  423

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLE GRVNEW+VTEKLGDA K K   +AT KKPR RI +R+H+LE
Sbjct  424  ENVMSLHRTKATFIGLLEIGRVNEWVVTEKLGDALKGKLPAKAT-KKPRIRIRERLHLLE  482

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF CGCYD AFGKN Y+++LF+QSIAFFIAGFGYIGTF+PNS
Sbjct  483  LCAGAYLFFCGCYDFAFGKNRYYIFLFLQSIAFFIAGFGYIGTFVPNS  530



>ref|XP_007010197.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma 
cacao]
 gb|EOY19007.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma 
cacao]
Length=535

 Score =   285 bits (728),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 154/168 (92%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AH+VTF+FYCV+LPATV VPEV+VPKWGAVYIPS++TLLNAVGTPRSLHLL+FWILF
Sbjct  369  KIVAHLVTFIFYCVVLPATVFVPEVEVPKWGAVYIPSIVTLLNAVGTPRSLHLLIFWILF  428

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEW+VTEKLGDA K K   +A  +KPR +IG+R+H+LE
Sbjct  429  ENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGDALKTKLGGKAP-RKPRIQIGERIHLLE  487

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            LA GAYLF CGCYD+AFGKN YF++LF+QSIAFFIAG GY+GTF+P S
Sbjct  488  LAVGAYLFFCGCYDLAFGKNRYFIFLFLQSIAFFIAGVGYVGTFVPTS  535



>ref|XP_009404378.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   285 bits (728),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 152/166 (92%), Gaps = 1/166 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KV+AHIVTF+FYCV++PA VLVPEV++P+WGA+YIPS+I LLNAVGTPRSLHLLVFWILF
Sbjct  367  KVVAHIVTFVFYCVVIPAAVLVPEVEIPRWGAIYIPSIIALLNAVGTPRSLHLLVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGLLEAGRVNEW+VTEKLGD  K K A++A  +KP  RIGDR+H+LE
Sbjct  427  ENVMSLHRTKATLIGLLEAGRVNEWVVTEKLGDTVKAKMAVKAA-RKPPIRIGDRLHLLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLP  499
            L TGAYLF CGCYDVAFGKNHYFLYLF+Q+IAFF+ GFGY+GTF+P
Sbjct  486  LWTGAYLFFCGCYDVAFGKNHYFLYLFLQAIAFFVVGFGYVGTFVP  531



>ref|XP_006606290.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X3 [Glycine max]
 ref|XP_006606291.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X4 [Glycine max]
Length=436

 Score =   281 bits (720),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AH+VTF+FYCV++PATVLVPEV+VPKWGAVYIPS+ITLLNAVGTPRS+HLLVFWILF
Sbjct  270  KIVAHVVTFVFYCVIMPATVLVPEVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWILF  329

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS+HRTKAT  GLLEAGRVNEW+VTEKLGDA K K   +A  +KPR RIG+R+H LE
Sbjct  330  ENVMSMHRTKATLTGLLEAGRVNEWVVTEKLGDALKTKSGGKAA-RKPRIRIGERLHFLE  388

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF C CYD+ +GKNHYF+YLF+QS+AFF+AG GY+GTF+PNS
Sbjct  389  LLVGAYLFFCACYDLKYGKNHYFIYLFLQSMAFFVAGVGYVGTFVPNS  436



>ref|XP_007220072.1| hypothetical protein PRUPE_ppa024741mg [Prunus persica]
 gb|EMJ21271.1| hypothetical protein PRUPE_ppa024741mg [Prunus persica]
Length=517

 Score =   284 bits (726),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KV+AHIVTF+FYCV+LPATVLVPEVQVP WGAVYIPS ITLLNAVGTPRSLHLL+FWILF
Sbjct  351  KVVAHIVTFVFYCVILPATVLVPEVQVPIWGAVYIPSTITLLNAVGTPRSLHLLIFWILF  410

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGL EAGRVNEW+VTEKLGDA K K   +A  +KPR RIG+R+HVLE
Sbjct  411  ENVMSLHRTKATFIGLFEAGRVNEWVVTEKLGDALKKKLGAKAP-RKPRLRIGERLHVLE  469

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G YLF CGCYD+AFGKN YF+YLF+QS+AFFIAG GY+GTF+PNS
Sbjct  470  LIVGFYLFFCGCYDLAFGKNGYFIYLFIQSVAFFIAGVGYVGTFVPNS  517



>emb|CBI40224.3| unnamed protein product [Vitis vinifera]
Length=449

 Score =   281 bits (720),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+ PATV  PEV+VP WGAVYIPS ITLLNAVGTPRSLHLLVFWILF
Sbjct  283  KIVAHIVTFLFYCVVFPATVFFPEVEVPMWGAVYIPSTITLLNAVGTPRSLHLLVFWILF  342

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATF+GLLE GRVNEW+VTEKLGDA K+K + + T KKPR RIG+R+H+LE
Sbjct  343  ENVMSLHRTKATFMGLLEVGRVNEWVVTEKLGDALKMKSSTK-TSKKPRIRIGERMHLLE  401

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF CGCYDV +GKN +F+YLF QS+AFFIAGFGY+GTF+PNS
Sbjct  402  LGVGAYLFFCGCYDVTYGKNGFFIYLFFQSMAFFIAGFGYVGTFVPNS  449



>ref|XP_002437311.1| hypothetical protein SORBIDRAFT_10g024640 [Sorghum bicolor]
 gb|EER88678.1| hypothetical protein SORBIDRAFT_10g024640 [Sorghum bicolor]
Length=429

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 154/168 (92%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAHIVTF+FYC+++PATVLVPEV++PKWG+VYIP++I+LLNAVGTPRS+HL+VFWILF
Sbjct  263  KIIAHIVTFVFYCIVIPATVLVPEVEIPKWGSVYIPTIISLLNAVGTPRSVHLIVFWILF  322

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEW+VTEKLGDA ++K   +A  KKPR +IGDR+H+LE
Sbjct  323  ENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGDALRMKMPAKAC-KKPRIKIGDRLHILE  381

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L   AYLF CGCYD+AFG NHY+++LF+QSIAFFI G GY+GTF+P+S
Sbjct  382  LGVAAYLFFCGCYDIAFGNNHYYIFLFLQSIAFFIVGIGYVGTFVPHS  429



>ref|XP_007219015.1| hypothetical protein PRUPE_ppa004315mg [Prunus persica]
 gb|EMJ20214.1| hypothetical protein PRUPE_ppa004315mg [Prunus persica]
Length=517

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEVQVP WGAVYIPS ITLLNAVGTPRSLHLL+FWILF
Sbjct  351  KIVAHIVTFVFYCVILPATVLVPEVQVPIWGAVYIPSTITLLNAVGTPRSLHLLIFWILF  410

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGL EAGRVNEW+VTEKLGDA K K   +A  +KPR RIG+R+HVLE
Sbjct  411  ENVMSLHRTKATFIGLFEAGRVNEWVVTEKLGDALKKKLGAKAP-RKPRLRIGERLHVLE  469

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G YLF CGCYD+AFGKN YF+YLF+QS+AFFIAG GY+GTF+PNS
Sbjct  470  LIVGFYLFFCGCYDLAFGKNGYFIYLFIQSVAFFIAGVGYVGTFVPNS  517



>ref|XP_004307031.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Fragaria 
vesca subsp. vesca]
Length=483

 Score =   281 bits (720),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 153/168 (91%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEVQVP WGAVYIPS ITLLNAVGTPRSLHLL+FWILF
Sbjct  317  KIVAHIVTFVFYCVILPATVLVPEVQVPIWGAVYIPSTITLLNAVGTPRSLHLLIFWILF  376

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGL EAGRV+EW+VTEKLGDA K K A++A  +KPR RIG+R+H+LE
Sbjct  377  ENVMSLHRTKATFIGLFEAGRVDEWVVTEKLGDALKTKSAVKA-HRKPRVRIGERLHLLE  435

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G YLF CGCYD+A+GKN +F+YLF+QSIAFFIAG GY+GTF+P+S
Sbjct  436  LIVGLYLFFCGCYDLAYGKNRFFIYLFLQSIAFFIAGVGYVGTFVPSS  483



>ref|XP_008232025.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Prunus 
mume]
Length=517

 Score =   282 bits (722),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEVQVP WGAVYIPS ITLLNAVGTPRSLHLL+FWILF
Sbjct  351  KIVAHIVTFVFYCVILPATVLVPEVQVPIWGAVYIPSTITLLNAVGTPRSLHLLIFWILF  410

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGL EAGRVNEW+VTEKLGDA K K   +A  +KPR RIG+R+H+LE
Sbjct  411  ENVMSLHRTKATFIGLFEAGRVNEWVVTEKLGDALKKKLGAKAP-RKPRLRIGERLHMLE  469

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G YLF CGCYD+AFGKN YF+YLF+QS+AFFIAG GY+GTF+PNS
Sbjct  470  LIVGFYLFFCGCYDLAFGKNGYFIYLFIQSVAFFIAGVGYVGTFVPNS  517



>ref|XP_006606289.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Glycine max]
Length=472

 Score =   281 bits (718),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AH+VTF+FYCV++PATVLVPEV+VPKWGAVYIPS+ITLLNAVGTPRS+HLLVFWILF
Sbjct  306  KIVAHVVTFVFYCVIMPATVLVPEVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWILF  365

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS+HRTKAT  GLLEAGRVNEW+VTEKLGDA K K   +A  +KPR RIG+R+H LE
Sbjct  366  ENVMSMHRTKATLTGLLEAGRVNEWVVTEKLGDALKTKSGGKAA-RKPRIRIGERLHFLE  424

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF C CYD+ +GKNHYF+YLF+QS+AFF+AG GY+GTF+PNS
Sbjct  425  LLVGAYLFFCACYDLKYGKNHYFIYLFLQSMAFFVAGVGYVGTFVPNS  472



>ref|XP_003556282.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoformX1 
[Glycine max]
Length=529

 Score =   282 bits (721),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AH+VTF+FYCV++PATVLVPEV+VPKWGAVYIPS+ITLLNAVGTPRS+HLLVFWILF
Sbjct  363  KIVAHVVTFVFYCVIMPATVLVPEVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWILF  422

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS+HRTKAT  GLLEAGRVNEW+VTEKLGDA K K   +A  +KPR RIG+R+H LE
Sbjct  423  ENVMSMHRTKATLTGLLEAGRVNEWVVTEKLGDALKTKSGGKAA-RKPRIRIGERLHFLE  481

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF C CYD+ +GKNHYF+YLF+QS+AFF+AG GY+GTF+PNS
Sbjct  482  LLVGAYLFFCACYDLKYGKNHYFIYLFLQSMAFFVAGVGYVGTFVPNS  529



>gb|KHN00923.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=517

 Score =   281 bits (720),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AH+VTF+FYCV++PATVLVPEV+VPKWGAVYIPS+ITLLNAVGTPRS+HLLVFWILF
Sbjct  351  KIVAHVVTFVFYCVIMPATVLVPEVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWILF  410

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS+HRTKAT  GLLEAGRVNEW+VTEKLGDA K K   +A  +KPR RIG+R+H LE
Sbjct  411  ENVMSMHRTKATLTGLLEAGRVNEWVVTEKLGDALKTKSGGKAA-RKPRIRIGERLHFLE  469

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF C CYD+ +GKNHYF+YLF+QS+AFF+AG GY+GTF+PNS
Sbjct  470  LLVGAYLFFCACYDLKYGKNHYFIYLFLQSMAFFVAGVGYVGTFVPNS  517



>ref|XP_009361452.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Pyrus 
x bretschneideri]
Length=483

 Score =   280 bits (717),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 152/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYC++LPATVLVPEVQVP WGAVYIPS+ITLLNAVGTPRSLHL++FWILF
Sbjct  317  KIVAHIVTFVFYCIILPATVLVPEVQVPIWGAVYIPSIITLLNAVGTPRSLHLMIFWILF  376

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGL EAGRVNEW+VTEKLGDA K K   +A  ++PR RIG+R+H+LE
Sbjct  377  ENVMSLHRTKATFIGLFEAGRVNEWVVTEKLGDALKTKSGGKAA-RRPRSRIGERLHMLE  435

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G YLF CGCYD+AFGKN YF++LF+QSIAFFIAG GY+GTF+PNS
Sbjct  436  LIVGFYLFFCGCYDLAFGKNGYFIFLFIQSIAFFIAGVGYVGTFVPNS  483



>ref|XP_002269110.2| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Vitis vinifera]
 emb|CAN62185.1| hypothetical protein VITISV_019367 [Vitis vinifera]
Length=529

 Score =   281 bits (720),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+ PATV  PEV+VP WGAVYIPS ITLLNAVGTPRSLHLLVFWILF
Sbjct  363  KIVAHIVTFLFYCVVFPATVFFPEVEVPMWGAVYIPSTITLLNAVGTPRSLHLLVFWILF  422

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATF+GLLE GRVNEW+VTEKLGDA K+K + + T KKPR RIG+R+H+LE
Sbjct  423  ENVMSLHRTKATFMGLLEVGRVNEWVVTEKLGDALKMKSSTK-TSKKPRIRIGERMHLLE  481

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF CGCYDV +GKN +F+YLF QS+AFFIAGFGY+GTF+PNS
Sbjct  482  LGVGAYLFFCGCYDVTYGKNGFFIYLFFQSMAFFIAGFGYVGTFVPNS  529



>ref|XP_007143832.1| hypothetical protein PHAVU_007G105400g [Phaseolus vulgaris]
 gb|ESW15826.1| hypothetical protein PHAVU_007G105400g [Phaseolus vulgaris]
Length=530

 Score =   281 bits (720),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AH+VTF+FYCV++PATVLVPEV+VPKWGAVYIPS+ITLLNAVGTPRS+HLLVFWILF
Sbjct  364  KIVAHVVTFVFYCVVMPATVLVPEVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWILF  423

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS+HRTKAT  GLLEAGRVNEW+VTEKLGDA K K   +A  +KPR +IG+R+H LE
Sbjct  424  ENVMSMHRTKATLTGLLEAGRVNEWVVTEKLGDALKTKSGGKAV-RKPRIKIGERLHFLE  482

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF CGCYD+ +GKNHYF+YLF+QSIAFF+ G GY+GTF+PNS
Sbjct  483  LLVGAYLFFCGCYDLTYGKNHYFIYLFLQSIAFFVVGVGYVGTFVPNS  530



>ref|XP_009335111.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Pyrus 
x bretschneideri]
 ref|XP_009335114.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Pyrus 
x bretschneideri]
Length=517

 Score =   281 bits (718),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 152/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYC++LPATVLVPEVQVP WGAVYIPS+ITLLNAVGTPRSLHL++FWILF
Sbjct  351  KIVAHIVTFVFYCIILPATVLVPEVQVPIWGAVYIPSIITLLNAVGTPRSLHLMIFWILF  410

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGL EAGRVNEW+VTEKLGDA K K   +A  ++PR RIG+R+H+LE
Sbjct  411  ENVMSLHRTKATFIGLFEAGRVNEWVVTEKLGDALKTKSGGKAA-RRPRSRIGERLHMLE  469

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G YLF CGCYD+AFGKN YF++LF+QSIAFFIAG GY+GTF+PNS
Sbjct  470  LIVGFYLFFCGCYDLAFGKNGYFIFLFIQSIAFFIAGVGYVGTFVPNS  517



>ref|XP_009401015.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009401017.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   281 bits (719),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV++PATVLVPEV+VP WG VYIPS ITLLNAVGTPRSLHLLVFWILF
Sbjct  367  KIVAHIVTFVFYCVVIPATVLVPEVEVPNWGLVYIPSTITLLNAVGTPRSLHLLVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHR KAT IGLLEAGRVNEW+VTEKLGD  K K A +A  +KPR RIGDR+H+LE
Sbjct  427  ENVMSLHRAKATLIGLLEAGRVNEWVVTEKLGDVMKTKVAAKAA-RKPRIRIGDRLHLLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L TGAYLF CGCYD++FGKNHY+LYLF+Q+I FF+ GFGY+GTF+P +
Sbjct  486  LFTGAYLFFCGCYDLSFGKNHYYLYLFLQAITFFVVGFGYVGTFVPQT  533



>ref|XP_006398833.1| hypothetical protein EUTSA_v10013220mg [Eutrema salsugineum]
 dbj|BAJ34228.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ40286.1| hypothetical protein EUTSA_v10013220mg [Eutrema salsugineum]
Length=532

 Score =   280 bits (715),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 148/168 (88%), Gaps = 2/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEV VPKWGAVYIPSVITLLNAVGTPRSLHL+VFWILF
Sbjct  367  KLVAHIVTFIFYCVILPATVLVPEVSVPKWGAVYIPSVITLLNAVGTPRSLHLMVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLE GRVNEWIVTEKLGD  K K A + T KK RFR GDR+HVLE
Sbjct  427  ENVMSLHRTKATFIGLLEGGRVNEWIVTEKLGD-LKAKSATK-TPKKLRFRFGDRIHVLE  484

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G YLF  GCYD  FGKNHY+LYLF Q+IAFFIAGFG IGTF+PNS
Sbjct  485  LGVGMYLFFVGCYDAFFGKNHYYLYLFAQAIAFFIAGFGQIGTFVPNS  532



>ref|XP_008456578.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
melo]
Length=518

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 149/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEV VPKWGAVYIPS ITLLNAVGTPRS HL++FWILF
Sbjct  352  KIVAHIVTFVFYCVILPATVLVPEVSVPKWGAVYIPSTITLLNAVGTPRSFHLIIFWILF  411

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEW+VTEKLGDA K K   +A  +KPRFR+G+R+H+LE
Sbjct  412  ENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGDALKTKLGSKAP-RKPRFRLGERLHILE  470

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF CG YD+ FGKN YF+YLF+QS AFFIAG GY+GT +PNS
Sbjct  471  LCVGAYLFFCGWYDLNFGKNQYFIYLFLQSFAFFIAGVGYVGTMVPNS  518



>gb|KFK24842.1| hypothetical protein AALP_AA8G031700 [Arabis alpina]
Length=533

 Score =   279 bits (713),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEV VPKWGAVYIPSVITLLNAVGTPRSLHL+VFWILF
Sbjct  367  KLVAHIVTFIFYCVILPATVLVPEVTVPKWGAVYIPSVITLLNAVGTPRSLHLMVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLE GRVNEWIVTEKLGD  K K A +A  K  RFR GDR+HVLE
Sbjct  427  ENVMSLHRTKATFIGLLEGGRVNEWIVTEKLGD-LKAKSASKAPKKIIRFRFGDRIHVLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G YLF  GCYD  FGKNHY+LYLF QSIAFFIAGFG IGT +PNS
Sbjct  486  LGVGMYLFFVGCYDAFFGKNHYYLYLFAQSIAFFIAGFGQIGTIVPNS  533



>emb|CBI30236.3| unnamed protein product [Vitis vinifera]
Length=540

 Score =   279 bits (713),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 153/167 (92%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVP+V+VP+WGAVYIP++IT+LNAVGTPRSLHL+VFWILF
Sbjct  367  KLVAHIVTFVFYCVVLPATVLVPDVEVPRWGAVYIPTIITILNAVGTPRSLHLMVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLE GRVNEW+VTEKLGDA K+K A +A  KKPRF+IG+R+H+LE
Sbjct  427  ENVMSLHRTKATFIGLLEGGRVNEWVVTEKLGDALKVKAATKAP-KKPRFKIGERLHLLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L  GA+LF CGCYDVAFG+NHYF+YL++Q+IAFFI GFGY+ T   N
Sbjct  486  LGVGAFLFFCGCYDVAFGRNHYFIYLYVQAIAFFIVGFGYVATLSHN  532



>ref|XP_009130779.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Brassica 
rapa]
Length=532

 Score =   278 bits (711),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 147/168 (88%), Gaps = 2/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEV VPKWGAVYIPS+ITLLNAVGTPRSLHL+VFWILF
Sbjct  367  KIVAHIVTFIFYCVILPATVLVPEVTVPKWGAVYIPSIITLLNAVGTPRSLHLMVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLE GRVNEWIVTEKLGD  K K A + T KK RFR GDR+HVLE
Sbjct  427  ENVMSLHRTKATFIGLLEGGRVNEWIVTEKLGD-LKAKSATK-TLKKLRFRFGDRIHVLE  484

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G YLF  GCYDV FGKNHY+LYLF Q+IAFFIAG G IGT +PNS
Sbjct  485  LGVGMYLFFVGCYDVFFGKNHYYLYLFAQAIAFFIAGLGQIGTIVPNS  532



>emb|CDY11268.1| BnaA03g01040D [Brassica napus]
Length=532

 Score =   278 bits (710),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 147/168 (88%), Gaps = 2/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEV VPKWGAVYIPS+ITLLNAVGTPRSLHL+VFWILF
Sbjct  367  KIVAHIVTFIFYCVVLPATVLVPEVTVPKWGAVYIPSIITLLNAVGTPRSLHLMVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLE GRVNEWIVTEKLGD  K K A + T KK RFR GDR+HVLE
Sbjct  427  ENVMSLHRTKATFIGLLEGGRVNEWIVTEKLGD-LKAKSATK-TLKKLRFRFGDRIHVLE  484

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G YLF  GCYDV FGKNHY+LYLF Q+IAFFIAG G IGT +PNS
Sbjct  485  LGVGMYLFFVGCYDVFFGKNHYYLYLFAQAIAFFIAGLGQIGTIVPNS  532



>ref|XP_008363207.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Malus domestica]
Length=425

 Score =   274 bits (701),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AH+VTF+FYC++LPATV VPE+QVP WGAVYIPS ITLLNAVGTPRSLHLL+FWILF
Sbjct  259  KIVAHVVTFVFYCIILPATVFVPEIQVPIWGAVYIPSTITLLNAVGTPRSLHLLIFWILF  318

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGL EAGRVNEW+VTEKLGDA K K   +A+ +KPR RIG+R+H+LE
Sbjct  319  ENVMSLHRTKATLIGLFEAGRVNEWVVTEKLGDALKTKSGAKAS-RKPRIRIGERLHMLE  377

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L  G YLF CGCYD++FGKN YF+ LF+QSIAFFIAG GY+GTF+PN
Sbjct  378  LIVGFYLFFCGCYDLSFGKNGYFIXLFIQSIAFFIAGVGYVGTFVPN  424



>ref|XP_003535494.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Glycine max]
Length=529

 Score =   277 bits (709),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 149/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AH+VTF+FYCV++PATVL PEV+VPKWGAVYIPS+ITLLNAVGTPRS+HLLVFWILF
Sbjct  363  KIVAHVVTFVFYCVIMPATVLFPEVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWILF  422

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS+HRTKAT  GLLEAGRVNEW+VTEKLGDA K K   +A  +K R RIG+R+H LE
Sbjct  423  ENVMSMHRTKATLTGLLEAGRVNEWVVTEKLGDALKTKSGGKAA-RKSRIRIGERLHFLE  481

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF C CYD+ +GKNHYF+YLF+QS+AFF+AG GY+GTF+PNS
Sbjct  482  LLVGAYLFFCACYDLKYGKNHYFIYLFLQSMAFFVAGVGYVGTFVPNS  529



>gb|KHN37850.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=517

 Score =   276 bits (707),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 149/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AH+VTF+FYCV++PATVL PEV+VPKWGAVYIPS+ITLLNAVGTPRS+HLLVFWILF
Sbjct  351  KIVAHVVTFVFYCVIMPATVLFPEVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWILF  410

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS+HRTKAT  GLLEAGRVNEW+VTEKLGDA K K   +A  +K R RIG+R+H LE
Sbjct  411  ENVMSMHRTKATLTGLLEAGRVNEWVVTEKLGDALKTKSGGKAA-RKSRIRIGERLHFLE  469

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF C CYD+ +GKNHYF+YLF+QS+AFF+AG GY+GTF+PNS
Sbjct  470  LLVGAYLFFCACYDLKYGKNHYFIYLFLQSMAFFVAGVGYVGTFVPNS  517



>ref|XP_010694523.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Beta 
vulgaris subsp. vulgaris]
Length=526

 Score =   276 bits (707),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AH+VTF+FYCV+LP TVLVPEV+VPKWGA+YIP +ITLLNAVGTPRSLHL+VFWILF
Sbjct  360  KIVAHVVTFIFYCVVLPTTVLVPEVEVPKWGAIYIPMIITLLNAVGTPRSLHLVVFWILF  419

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEW+VTEKLGDA K K   + +FKKPR RI D++++LE
Sbjct  420  ENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGDALKNKFDTK-SFKKPRSRIIDKIYMLE  478

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF CGCYD+A GKNHYF+YLF+QS AFFIAGFGY+G  +P S
Sbjct  479  LVVGAYLFFCGCYDIALGKNHYFIYLFLQSFAFFIAGFGYVGIIVPTS  526



>ref|XP_004151323.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 ref|XP_004165881.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
Length=483

 Score =   275 bits (703),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEV VPKWGAVYIPS ITLLNAVGTPRS HL++FWILF
Sbjct  317  KIVAHIVTFVFYCVILPATVLVPEVSVPKWGAVYIPSTITLLNAVGTPRSFHLIIFWILF  376

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEW+VTEKLGDA K K   +A  +KPRFR+G+R+H+LE
Sbjct  377  ENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGDALKTKLGSKAP-RKPRFRMGERLHMLE  435

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G YLF CG YD+ FGKN YF+YLF+QS AFFIAG GY+GT +PNS
Sbjct  436  LCVGGYLFFCGWYDLNFGKNGYFIYLFLQSFAFFIAGVGYVGTLVPNS  483



>ref|XP_011018871.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Populus 
euphratica]
Length=532

 Score =   276 bits (707),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 150/168 (89%), Gaps = 2/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AH+VTF+FYCV+LPATVLVPEV+VPKWGAVYIPS+IT+LNAVGTPRSLHLLVFWILF
Sbjct  367  KIVAHLVTFIFYCVVLPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSLHLLVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDA  LK       KKPRFR G+R+H+LE
Sbjct  427  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDA--LKSKANKASKKPRFRFGERLHLLE  484

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L TGAYLF CGCYDV FGKNHYF+YL+ Q+IAFFI G G +GTF+P S
Sbjct  485  LGTGAYLFFCGCYDVVFGKNHYFIYLYAQAIAFFIVGLGCVGTFVPRS  532



>ref|XP_004494136.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cicer 
arietinum]
Length=533

 Score =   276 bits (707),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KVIAHI TF+FYC++LPATVLVPEV VPKWGAVYIPS+ITLLNAVGTPRSLHLLVFWI+F
Sbjct  367  KVIAHINTFVFYCIVLPATVLVPEVSVPKWGAVYIPSLITLLNAVGTPRSLHLLVFWIMF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHR KAT IGLLEA RVNEWIVTEKLGDA K K   +A  KKPRF+I DR+H+LE
Sbjct  427  ENVMSLHRAKATIIGLLEASRVNEWIVTEKLGDAVKTKVRTKA-LKKPRFKIQDRIHLLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G YL ICGCYDV FGKNH++++LF+Q++AFFI  FGY+GTF+PNS
Sbjct  486  LGVGMYLVICGCYDVMFGKNHFYIFLFIQAMAFFIMAFGYVGTFVPNS  533



>gb|KEH24115.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=531

 Score =   276 bits (706),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 146/167 (87%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KVIAHI TF+FYC++LPATVLVPEV VPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF
Sbjct  366  KVIAHINTFVFYCIVLPATVLVPEVAVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  425

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHR KAT IGLLEA RVNEWIVTEKLGDA K K   +A  KKPRFRI DR+H+LE
Sbjct  426  ENVMSLHRAKATVIGLLEASRVNEWIVTEKLGDALKAKAGTKA-LKKPRFRIEDRIHLLE  484

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L  G YLF  GCYDV FGKNH+F++LF+Q+IAFFI  FGY+GTF+PN
Sbjct  485  LGVGMYLFFIGCYDVMFGKNHFFIFLFIQAIAFFIMAFGYVGTFVPN  531



>ref|XP_006589371.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Glycine max]
Length=502

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 149/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AH+VTF+FYCV++PATVL PEV+VPKWGAVYIPS+ITLLNAVGTPRS+HLLVFWILF
Sbjct  336  KIVAHVVTFVFYCVIMPATVLFPEVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWILF  395

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS+HRTKAT  GLLEAGRVNEW+VTEKLGDA K K   +A  +K R RIG+R+H LE
Sbjct  396  ENVMSMHRTKATLTGLLEAGRVNEWVVTEKLGDALKTKSGGKAA-RKSRIRIGERLHFLE  454

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF C CYD+ +GKNHYF+YLF+QS+AFF+AG GY+GTF+PNS
Sbjct  455  LLVGAYLFFCACYDLKYGKNHYFIYLFLQSMAFFVAGVGYVGTFVPNS  502



>ref|XP_008363208.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Malus domestica]
Length=483

 Score =   275 bits (702),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AH+VTF+FYC++LPATV VPE+QVP WGAVYIPS ITLLNAVGTPRSLHLL+FWILF
Sbjct  317  KIVAHVVTFVFYCIILPATVFVPEIQVPIWGAVYIPSTITLLNAVGTPRSLHLLIFWILF  376

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGL EAGRVNEW+VTEKLGDA K K   +A+ +KPR RIG+R+H+LE
Sbjct  377  ENVMSLHRTKATLIGLFEAGRVNEWVVTEKLGDALKTKSGAKAS-RKPRIRIGERLHMLE  435

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L  G YLF CGCYD++FGKN YF+ LF+QSIAFFIAG GY+GTF+PN
Sbjct  436  LIVGFYLFFCGCYDLSFGKNGYFIXLFIQSIAFFIAGVGYVGTFVPN  482



>emb|CDO99850.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AH+VTF+FYCV+LPAT+++PEVQVP WGAVYIPSVITLLNAVGTPRS HL++FWILF
Sbjct  283  KIVAHMVTFIFYCVVLPATIVIPEVQVPVWGAVYIPSVITLLNAVGTPRSFHLVIFWILF  342

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLG   + K   +   KKPRFR+GDR+H+LE
Sbjct  343  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGHVLQTKLGSKVP-KKPRFRMGDRLHLLE  401

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G YLF CGCYDVAFGK+H+F+YLF+QS AFF AGFGY+GTF+P+S
Sbjct  402  LFVGFYLFFCGCYDVAFGKSHFFIYLFLQSTAFFTAGFGYVGTFVPSS  449



>emb|CDX80885.1| BnaC03g01390D [Brassica napus]
Length=525

 Score =   275 bits (702),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 146/168 (87%), Gaps = 2/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATV VPEV VPKWGAVYIPS+ITLLNAVGTPRSLHL+VFWILF
Sbjct  360  KIVAHIVTFIFYCVILPATVFVPEVTVPKWGAVYIPSIITLLNAVGTPRSLHLMVFWILF  419

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLE GRVNEWIVTEKLGD  K K A + T KK RFR GDR+HVLE
Sbjct  420  ENVMSLHRTKATFIGLLEGGRVNEWIVTEKLGD-LKAKSATK-TSKKLRFRFGDRIHVLE  477

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G YLF  GCYDV FGKNHY+LYLF Q+IAFFIAG G IGT +PNS
Sbjct  478  LGVGMYLFFVGCYDVFFGKNHYYLYLFAQAIAFFIAGLGQIGTIVPNS  525



>ref|XP_007162846.1| hypothetical protein PHAVU_001G185800g [Phaseolus vulgaris]
 gb|ESW34840.1| hypothetical protein PHAVU_001G185800g [Phaseolus vulgaris]
Length=533

 Score =   275 bits (702),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KV+AHI TF+FYC++LPATVLVPEV VPKWGAVYIPSVIT+LNAVGTPRSLHLLVFWILF
Sbjct  367  KVVAHINTFVFYCIVLPATVLVPEVVVPKWGAVYIPSVITILNAVGTPRSLHLLVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGLLEA RVNEW+VTEKLGDA K K   +A  KKPRF+IGDR+H+LE
Sbjct  427  ENVMSLHRTKATIIGLLEASRVNEWVVTEKLGDALKAKAGGKAP-KKPRFKIGDRIHLLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L    YLF CGCYDV FGKNHYF++LF+Q++AFFI  FGY+GT +P S
Sbjct  486  LGVAFYLFFCGCYDVMFGKNHYFIFLFIQALAFFIMAFGYVGTIVPQS  533



>ref|XP_008232088.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Prunus 
mume]
Length=477

 Score =   273 bits (697),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 147/168 (88%), Gaps = 6/168 (4%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FY V+LPATVLVPEV VP WGAVYIPS ITLLNAVGTPRSLHLL+FWILF
Sbjct  316  KIVAHIVTFVFYSVILPATVLVPEVHVPMWGAVYIPSTITLLNAVGTPRSLHLLIFWILF  375

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGL EAGRVNEW+VTEKLGD+ K  P      +KPR RIG+R+H+LE
Sbjct  376  ENVMSLHRTKATFIGLFEAGRVNEWVVTEKLGDSLKKDP------RKPRLRIGERLHMLE  429

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G Y+F CGCYD+AF KN YF+YLF+QS+AFFIAGFGY+GTF+PNS
Sbjct  430  LIVGFYVFFCGCYDLAFVKNGYFIYLFIQSVAFFIAGFGYVGTFVPNS  477



>ref|NP_195996.1| glucomannan 4-beta-mannosyltransferase 9 [Arabidopsis thaliana]
 sp|Q9LZR3.1|CSLA9_ARATH RecName: Full=Glucomannan 4-beta-mannosyltransferase 9; AltName: 
Full=Cellulose synthase-like protein A9; Short=AtCslA9; 
AltName: Full=Glucomannan synthase; AltName: Full=Mannan synthase 
9; AltName: Full=Protein RESISTANT TO AGROBACTERIUM TRANSFORMATION 
4 [Arabidopsis thaliana]
 emb|CAB82941.1| putative protein [Arabidopsis thaliana]
 dbj|BAB08601.1| glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAL31192.1| AT5g03760/F17C15_180 [Arabidopsis thaliana]
 gb|AAN31089.1| At5g03760/F17C15_180 [Arabidopsis thaliana]
 gb|AED90651.1| glucomannan 4-beta-mannosyltransferase 9 [Arabidopsis thaliana]
 gb|AHL38649.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=533

 Score =   274 bits (701),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEV VPKWGAVYIPSVITLLNAVGTPRSLHL+VFWILF
Sbjct  367  KLVAHIVTFIFYCVILPATVLVPEVTVPKWGAVYIPSVITLLNAVGTPRSLHLMVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLE GRVNEWIVTEKLGD  K K A + + K  RFR GDR+HVLE
Sbjct  427  ENVMSLHRTKATFIGLLEGGRVNEWIVTEKLGD-VKAKSATKTSKKVIRFRFGDRIHVLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L  G YL   GCYD  FGKNHY+LYLF Q+IAFFIAGFG IGT +PN
Sbjct  486  LGVGMYLLFVGCYDAFFGKNHYYLYLFAQAIAFFIAGFGQIGTIVPN  532



>ref|XP_003554414.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Glycine 
max]
 gb|KHN02265.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=533

 Score =   274 bits (700),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KV+AHI TF+FYC++LPATVLVPEV VPKWGAVYIPS+IT+LNAVGTPRSLHL+VFWILF
Sbjct  367  KVVAHINTFVFYCIVLPATVLVPEVVVPKWGAVYIPSIITILNAVGTPRSLHLMVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGLLEA RVNEW+VTEKLGDA K K   +A  KKPRFRIGDR+H+LE
Sbjct  427  ENVMSLHRTKATIIGLLEASRVNEWVVTEKLGDALKTKAGGKAP-KKPRFRIGDRIHLLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L    YLF CGCYD+ FGKNH+F++LF+QS+AF I  FGY+GT +PNS
Sbjct  486  LGVAFYLFFCGCYDIMFGKNHFFIFLFIQSLAFLIMAFGYVGTIVPNS  533



>ref|XP_003521436.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Glycine 
max]
 gb|KHN18723.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=533

 Score =   274 bits (700),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KV+AHI TF+FYC++LPATVLVPEV VPKWGAVYIPS+IT+LNAVGTPRSLHL+VFWILF
Sbjct  367  KVVAHINTFVFYCIVLPATVLVPEVVVPKWGAVYIPSIITILNAVGTPRSLHLMVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGLLEA RVNEW+VTEKLGDA K K   +A  KKPRFRIGDR+H+LE
Sbjct  427  ENVMSLHRTKATIIGLLEASRVNEWVVTEKLGDALKAKAGGKAP-KKPRFRIGDRIHLLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L    YLF CGCYDV FGKNH+F++LF+QS AF I  FGY+GT +PNS
Sbjct  486  LGVAFYLFFCGCYDVMFGKNHFFIFLFIQSFAFLIMAFGYVGTIVPNS  533



>gb|ABR16486.1| unknown [Picea sitchensis]
Length=385

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 145/168 (86%), Gaps = 2/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF FYCV++PATVLVPEVQVPKWGAVYIPS+ITLLNAV TP+SLHLLVFWILF
Sbjct  220  KIVAHIVTFAFYCVVIPATVLVPEVQVPKWGAVYIPSIITLLNAVSTPKSLHLLVFWILF  279

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGLLEAGRVNEW+VTEKLGDA K K       KK R RIG+R+HVLE
Sbjct  280  ENVMSLHRTKATIIGLLEAGRVNEWVVTEKLGDAMKHKSG--KQMKKSRSRIGERLHVLE  337

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G YLF C  YD+AFGKNH+++YL++Q+ AFF+ GFGYIGTF+P S
Sbjct  338  LLAGVYLFFCASYDLAFGKNHFYIYLYLQAAAFFVMGFGYIGTFIPTS  385



>ref|XP_004965827.1| PREDICTED: probable mannan synthase 9-like [Setaria italica]
Length=538

 Score =   274 bits (700),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAHIVTF+FYC+++PATVLVPEV++P+WG+VYIP++ITLLNAVGTPRS+HL+VFWILF
Sbjct  372  KIIAHIVTFVFYCIVIPATVLVPEVEIPRWGSVYIPTIITLLNAVGTPRSVHLIVFWILF  431

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVM+LHR KATFIGLLEAGRVNEW+VTEKLGDA ++K   +  FKKPR RI DR+H+LE
Sbjct  432  ENVMALHRMKATFIGLLEAGRVNEWVVTEKLGDALRMKMPGKG-FKKPRMRIVDRLHILE  490

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF CGCYDV  G NHY+++LF+QSIAFFI G GY+GTF+P+S
Sbjct  491  LCVGAYLFFCGCYDVTVGNNHYYIFLFLQSIAFFIVGLGYVGTFVPHS  538



>ref|XP_010067160.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Eucalyptus 
grandis]
 gb|KCW65234.1| hypothetical protein EUGRSUZ_G02715 [Eucalyptus grandis]
Length=482

 Score =   271 bits (694),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 148/168 (88%), Gaps = 2/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AH+VTF+FYC+++PATVLVPEV+VPKWGAVYIP  +TLLN+VGTPRSLHLLVFW+LF
Sbjct  317  KIVAHVVTFVFYCIVMPATVLVPEVEVPKWGAVYIPCTVTLLNSVGTPRSLHLLVFWVLF  376

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVM+LHRTKATFIGLLEAGRVNEW+VT+KLGDA K KP      ++ R  IG RVHV+E
Sbjct  377  ENVMALHRTKATFIGLLEAGRVNEWVVTQKLGDALKTKPG--KAHRRLRIWIGQRVHVVE  434

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF+CGCYD+A GKN YFLYLF+QS AFF+AG GY+GTF+P+S
Sbjct  435  LCVGAYLFVCGCYDLAHGKNRYFLYLFLQSFAFFVAGIGYVGTFIPSS  482



>ref|XP_002873112.1| ATCSLA09 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49371.1| ATCSLA09 [Arabidopsis lyrata subsp. lyrata]
Length=534

 Score =   273 bits (697),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 143/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEV VPKWGAVYIPSVITLLNAVGTPRSLHL+VFWILF
Sbjct  368  KLVAHIVTFIFYCVILPATVLVPEVSVPKWGAVYIPSVITLLNAVGTPRSLHLMVFWILF  427

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLE GRVNEWIVTEKLGD  K K A +   K  RFR GDR+HVLE
Sbjct  428  ENVMSLHRTKATFIGLLEGGRVNEWIVTEKLGD-VKAKSATKTPKKVLRFRFGDRIHVLE  486

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L  G YL   GCYD  FGKNHY+LYLF Q+IAFFIAGFG IGT +PN
Sbjct  487  LGVGMYLLFVGCYDAFFGKNHYYLYLFAQAIAFFIAGFGQIGTIVPN  533



>ref|XP_010452272.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Camelina 
sativa]
Length=534

 Score =   273 bits (697),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 143/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEV VPKWGAVYIPSVITLLNAVGTPRSLHL+VFWILF
Sbjct  368  KLVAHIVTFIFYCVILPATVLVPEVSVPKWGAVYIPSVITLLNAVGTPRSLHLMVFWILF  427

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLE GRVNEWIVTEKLGD  K K A +   K  RFR GDR+HVLE
Sbjct  428  ENVMSLHRTKATFIGLLEGGRVNEWIVTEKLGD-LKAKSASKTPKKLLRFRFGDRIHVLE  486

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L  G YL   GCYD  FGKNHY+LYLF Q+IAFFIAGFG IGT +PN
Sbjct  487  LGVGMYLLFVGCYDAFFGKNHYYLYLFAQAIAFFIAGFGQIGTIVPN  533



>ref|XP_010490868.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Camelina 
sativa]
Length=534

 Score =   272 bits (696),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEV VPKWGAVYIPSVITLLNAVGTPRSLHL+VFWILF
Sbjct  368  KLVAHIVTFIFYCVILPATVLVPEVSVPKWGAVYIPSVITLLNAVGTPRSLHLMVFWILF  427

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLE GRVNEWIVTEKLGD  K K + +   K  RFR GDR+HVLE
Sbjct  428  ENVMSLHRTKATFIGLLEGGRVNEWIVTEKLGD-LKAKSSGKTPKKLLRFRFGDRIHVLE  486

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L  G YL   GCYDV FGKNHY+LYLF Q+IAFFIAGFG IGT +PN
Sbjct  487  LGVGMYLLFVGCYDVFFGKNHYYLYLFAQAIAFFIAGFGQIGTIVPN  533



>gb|KHG19821.1| Glucomannan 4-beta-mannosyltransferase 9 -like protein [Gossypium 
arboreum]
Length=529

 Score =   272 bits (695),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEV+VPKWGAVYIPS+IT+LNAVGTPRS HLLVFWILF
Sbjct  363  KLVAHIVTFIFYCVVLPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLLVFWILF  422

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDA K K A     +KPRFR G+R+HVLE
Sbjct  423  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAFKSK-AAAKAPRKPRFRFGERLHVLE  481

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF CGCYDV FGKNHYF+YLF Q+IAFFI GFGY+GT +PNS
Sbjct  482  LCVGAYLFFCGCYDVVFGKNHYFIYLFAQAIAFFIMGFGYVGTIVPNS  529



>ref|XP_009379774.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   272 bits (695),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 153/168 (91%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KV+AHIVTF+FYC+++PATVLVPEV++PKWGAVYIPS+ITLLNAVGTPRSLHLLVFWILF
Sbjct  367  KVVAHIVTFVFYCIVIPATVLVPEVEIPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEW+VTEKLGD  K K       +K R RIGDR+H+LE
Sbjct  427  ENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGDTKKPK-MAAKAARKLRIRIGDRLHLLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L TGAYLF+CGCYDVAFG +H+F+YLF+Q++AFFI GFGY+GTF+P++
Sbjct  486  LWTGAYLFVCGCYDVAFGNSHFFIYLFLQAMAFFIVGFGYVGTFVPST  533



>dbj|BAE98718.1| hypothetical protein [Arabidopsis thaliana]
Length=533

 Score =   272 bits (695),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 143/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEV VPKWGA YIPSVITLLNAVGTPRSLHL+VFWILF
Sbjct  367  KLVAHIVTFIFYCVILPATVLVPEVTVPKWGAFYIPSVITLLNAVGTPRSLHLMVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLE GRVNEWIVTEKLGD  K K A + + K  RFR GDR+HVLE
Sbjct  427  ENVMSLHRTKATFIGLLEGGRVNEWIVTEKLGD-VKAKSATKTSKKVIRFRFGDRIHVLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L  G YL   GCYD  FGKNHY+LYLF Q+IAFFIAGFG IGT +PN
Sbjct  486  LGVGMYLLFVGCYDAFFGKNHYYLYLFAQAIAFFIAGFGQIGTIVPN  532



>ref|XP_010543471.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Tarenaya 
hassleriana]
Length=533

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 149/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATV+VPEV VPKWGAVYIPS+ITLLNAVGTPRSLHL+VFWILF
Sbjct  367  KIVAHIVTFVFYCVVLPATVMVPEVTVPKWGAVYIPSIITLLNAVGTPRSLHLMVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGL+ AGRVNEWIVTEKLGDA K K A +A  +KPRFR G+R+HVLE
Sbjct  427  ENVMSLHRTKATFIGLIGAGRVNEWIVTEKLGDAIKAKSASKAP-RKPRFRFGERMHVLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G YL + G YD++FGKNHY+LYLF Q+ AFF+ GFG +GTF+P++
Sbjct  486  LGVGMYLLLVGVYDLSFGKNHYYLYLFAQAFAFFVMGFGQVGTFVPHA  533



>gb|AFW73370.1| hypothetical protein ZEAMMB73_956340 [Zea mays]
Length=295

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 144/168 (86%), Gaps = 6/168 (4%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AH VTF+FYC+++P TVLVPEVQVPKWG+VYIP+VITLL+AV TPRS HL+VFW LF
Sbjct  133  KIVAHAVTFVFYCIVIPTTVLVPEVQVPKWGSVYIPTVITLLSAVATPRSAHLVVFWTLF  192

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLK-PALRATFKKPRFRIGDRVHVL  358
            ENVMSLHRTKATFIGLLEAGRVNEW+VTEKLGDA + K P      KKPR RIGDR+HVL
Sbjct  193  ENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGDALRTKVPG-----KKPRMRIGDRLHVL  247

Query  359  ELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            EL   AYL  CGCYD+AFG N Y+++LF+QSIAFFI G GY+GTF+P+
Sbjct  248  ELGVAAYLLFCGCYDIAFGNNRYYIFLFLQSIAFFIVGIGYVGTFVPH  295



>ref|XP_009122674.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Brassica 
rapa]
Length=532

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 145/167 (87%), Gaps = 2/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEV VPKWGAVYIPS+ITLLNAVGTPRSLHL+VFWILF
Sbjct  367  KIVAHIVTFIFYCVVLPATVLVPEVIVPKWGAVYIPSIITLLNAVGTPRSLHLMVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLE GRVNEWIVTEKLGD  K K A +A  KK RFR GDR+HVLE
Sbjct  427  ENVMSLHRTKATFIGLLEGGRVNEWIVTEKLGD-LKAKSATKAP-KKLRFRFGDRIHVLE  484

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L  G YLF  GCYD  FGKNHY+LYLF Q+IAFFIAG G IGT +PN
Sbjct  485  LGVGMYLFSIGCYDALFGKNHYYLYLFAQAIAFFIAGCGQIGTVVPN  531



>ref|XP_006381326.1| hypothetical protein POPTR_0006s11810g [Populus trichocarpa]
 gb|ERP59123.1| hypothetical protein POPTR_0006s11810g [Populus trichocarpa]
Length=532

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 148/168 (88%), Gaps = 2/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AH+VTF+FYCV+LPATVLVPEV+VPKWGAVYIPS+IT+LNAVGTPRSLHLLVFWILF
Sbjct  367  KIVAHLVTFIFYCVVLPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSLHLLVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDA K         KKPRFR G+R+H+LE
Sbjct  427  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDALKS--KANKAAKKPRFRFGERLHLLE  484

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L TGAYLF CGCYDV FGKNHYF+YL+ Q+IAFFI G G +GT +P S
Sbjct  485  LGTGAYLFFCGCYDVVFGKNHYFIYLYAQAIAFFIVGLGCVGTIVPRS  532



>emb|CDX70286.1| BnaA10g26350D [Brassica napus]
Length=532

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 145/167 (87%), Gaps = 2/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEV VPKWGAVYIPS+ITLLNAVGTPRSLHL+VFWILF
Sbjct  367  KIVAHIVTFIFYCVVLPATVLVPEVIVPKWGAVYIPSIITLLNAVGTPRSLHLMVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLE GRVNEWIVTEKLGD  K K A +A  KK RFR GDR+HVLE
Sbjct  427  ENVMSLHRTKATFIGLLEGGRVNEWIVTEKLGD-LKAKSATKAP-KKLRFRFGDRIHVLE  484

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L  G YLF  GCYD  FGKNHY+LYLF Q+IAFFIAG G IGT +PN
Sbjct  485  LGVGMYLFSIGCYDALFGKNHYYLYLFAQAIAFFIAGCGQIGTVVPN  531



>ref|XP_010423663.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Camelina 
sativa]
Length=534

 Score =   270 bits (691),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 142/167 (85%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEV VPKWGAVYIPSVITLLNAVGTPRSLHL+VFWILF
Sbjct  368  KLVAHIVTFIFYCVILPATVLVPEVSVPKWGAVYIPSVITLLNAVGTPRSLHLMVFWILF  427

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLE GRVNEWIVTEKLGD  K K A +   K  RFR GDR+HVLE
Sbjct  428  ENVMSLHRTKATFIGLLEGGRVNEWIVTEKLGD-LKAKSASKTPKKLLRFRFGDRIHVLE  486

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L  G YL   GCYD   GKNHY+LYLF Q+IAFFIAGFG IGT +PN
Sbjct  487  LGVGIYLLFVGCYDAFLGKNHYYLYLFAQAIAFFIAGFGQIGTIVPN  533



>gb|ABG34547.1| cellulose synthase-like A1 [Pinus taeda]
Length=530

 Score =   270 bits (690),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 146/168 (87%), Gaps = 2/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF FYCV++PATVLVPEVQVPKWGAVYIPS+ITLLNAV TP+SLHLLVFWILF
Sbjct  365  KIVAHIVTFTFYCVVIPATVLVPEVQVPKWGAVYIPSIITLLNAVSTPKSLHLLVFWILF  424

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEW+VTEKLGDA K K       KK R RIG+R+HVLE
Sbjct  425  ENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGDAMKHKSG--KQIKKSRSRIGERLHVLE  482

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G YLF C  YD+AFG+NH+++YL++Q+ AFF+ GFGYIGTF+P S
Sbjct  483  LFAGVYLFFCASYDLAFGRNHFYIYLYLQAAAFFVMGFGYIGTFVPTS  530



>ref|XP_009421122.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   269 bits (688),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV++PATVLVPEVQVPKWG VYIPS+ITLLNAVGTPRSLHLLVFWILF
Sbjct  367  KIVAHIVTFIFYCVVIPATVLVPEVQVPKWGLVYIPSIITLLNAVGTPRSLHLLVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEW+VTEKLGD  K K A     K PR RIG+R+H+LE
Sbjct  427  ENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGDGMKTK-AGAKAAKIPRIRIGERLHLLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L TGAYL  CGCYD+AFGKN+Y+LYLF Q++AFFI GFGY+GTF+P+
Sbjct  486  LLTGAYLVFCGCYDLAFGKNYYYLYLFFQAVAFFIVGFGYVGTFVPH  532



>ref|XP_010558212.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Tarenaya 
hassleriana]
Length=526

 Score =   269 bits (688),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEV VPKWGAVYIPS+ITLLNA+GTPRSLHLLVFWI+F
Sbjct  360  KIVAHIVTFIFYCVVLPATVLVPEVTVPKWGAVYIPSIITLLNAIGTPRSLHLLVFWIMF  419

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDA K K       KKPRFR G+R+HVLE
Sbjct  420  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDALKSK-VKSPHPKKPRFRFGERIHVLE  478

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            +  G YLFI GC DV  GKN Y+LYLF QS AFF+ GFG +GTF+P+S
Sbjct  479  VGVGMYLFIVGCCDVMLGKNRYYLYLFGQSFAFFVMGFGLVGTFVPHS  526



>ref|XP_009353016.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Pyrus x bretschneideri]
Length=497

 Score =   267 bits (682),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAHI  F+FYC++LP+TV+VPEV+VPKWG +YIPS+IT+LNAVGTPRS+HLLVFWILF
Sbjct  330  KIIAHINAFVFYCIVLPSTVMVPEVEVPKWGGIYIPSMITILNAVGTPRSIHLLVFWILF  389

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGLLEA RVNEWIVTEKLGDA +   A     +K RFRIG+R+HVLE
Sbjct  390  ENVMSLHRTKATIIGLLEASRVNEWIVTEKLGDALRTLKAATKLPRKSRFRIGERLHVLE  449

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            LA G YLF CGCYD  FGKN++F++L++Q+ AFFI GFGY+GTF+PNS
Sbjct  450  LAVGLYLFFCGCYDFVFGKNYFFMFLYIQATAFFIIGFGYVGTFVPNS  497



>ref|XP_009353014.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Pyrus x bretschneideri]
Length=534

 Score =   267 bits (683),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAHI  F+FYC++LP+TV+VPEV+VPKWG +YIPS+IT+LNAVGTPRS+HLLVFWILF
Sbjct  367  KIIAHINAFVFYCIVLPSTVMVPEVEVPKWGGIYIPSMITILNAVGTPRSIHLLVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGLLEA RVNEWIVTEKLGDA +   A     +K RFRIG+R+HVLE
Sbjct  427  ENVMSLHRTKATIIGLLEASRVNEWIVTEKLGDALRTLKAATKLPRKSRFRIGERLHVLE  486

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            LA G YLF CGCYD  FGKN++F++L++Q+ AFFI GFGY+GTF+PNS
Sbjct  487  LAVGLYLFFCGCYDFVFGKNYFFMFLYIQATAFFIIGFGYVGTFVPNS  534



>ref|XP_008359466.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Malus 
domestica]
Length=534

 Score =   267 bits (682),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAHI  F+FYC++LPATVLVPEV VPKWG +YIPS+ITLLNAVGTPRS+HLLVFWILF
Sbjct  367  KIIAHINAFVFYCIVLPATVLVPEVVVPKWGGIYIPSLITLLNAVGTPRSIHLLVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            EN+MSLHRTKAT IGLLEA RVNEWIVTEKLGDA K         +KPRFRIG+R+H+LE
Sbjct  427  ENIMSLHRTKATIIGLLEASRVNEWIVTEKLGDALKTLKVATKLPRKPRFRIGERLHLLE  486

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            LA G YLF CGCYD  FGKN+++L+L++Q+ AFFI GFGY+GTF+PNS
Sbjct  487  LAVGLYLFFCGCYDFIFGKNYFYLFLYIQATAFFIIGFGYVGTFVPNS  534



>gb|AES60635.2| cellulose synthase-like protein A1 [Medicago truncatula]
Length=523

 Score =   266 bits (679),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHI TF+FYC++LPATV+VPEV VPKWGAVYIPS+ITLLNAVGTPRS HLLVFWILF
Sbjct  357  KIVAHINTFVFYCIVLPATVMVPEVVVPKWGAVYIPSIITLLNAVGTPRSFHLLVFWILF  416

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            EN MSLHRTKAT IGLLEA RVNEWIVTEKLGDA K K + +   KK RFRIGDR+H+LE
Sbjct  417  ENTMSLHRTKATIIGLLEASRVNEWIVTEKLGDAFKGKASGKG-LKKLRFRIGDRIHMLE  475

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G YL +CGCYD+ +GKNH+F++L++Q+ AFFI  FGY+GTF+PNS
Sbjct  476  LVVGFYLLLCGCYDLMYGKNHFFIFLYIQAFAFFIMAFGYVGTFVPNS  523



>ref|XP_009403735.1| PREDICTED: probable mannan synthase 9 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=528

 Score =   266 bits (679),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++ HIVTF+FYC+++PATV VPEV++P WG VY+PSVIT+LN+VGTPRSLHLLVFW+LF
Sbjct  362  KIVGHIVTFIFYCLVIPATVFVPEVEIPMWGLVYLPSVITMLNSVGTPRSLHLLVFWVLF  421

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT  GLL+ GRVNEW+VTEKLGD  K K   +A  KKPR RIGDR+H +E
Sbjct  422  ENVMSLHRTKATLSGLLDLGRVNEWVVTEKLGDIMKTKLPTKAA-KKPRVRIGDRLHKME  480

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L TGAYLF C CYD+ +GKNHYFLYLF+QSI FFI GFGY+GT++P S
Sbjct  481  LFTGAYLFFCACYDLKYGKNHYFLYLFLQSITFFIVGFGYVGTYIPQS  528



>ref|XP_004496174.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cicer 
arietinum]
Length=529

 Score =   266 bits (679),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LPATVLVPEV+VPKWGAVYIP +ITLLNAVGTPRSLHLL+ WILF
Sbjct  363  KIIAHVVTFTFYCVILPATVLVPEVEVPKWGAVYIPCIITLLNAVGTPRSLHLLILWILF  422

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS+HRTKAT IGLLE GRVNEW+VTEKLGD  K K   +A  +KPR R+  R+H LE
Sbjct  423  ENVMSMHRTKATLIGLLEVGRVNEWVVTEKLGDVLKTKSGGKAA-RKPRIRLDGRLHFLE  481

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G YLF  GCYDVAFGKNH F+YLFMQSIAFF+ G GY+G F+P+S
Sbjct  482  LGVGVYLFFIGCYDVAFGKNHCFIYLFMQSIAFFVVGVGYVGIFVPSS  529



>gb|AFW87395.1| hypothetical protein ZEAMMB73_638072, partial [Zea mays]
Length=479

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 142/166 (86%), Gaps = 4/166 (2%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AH VTF+FYC+++P TVLVPEVQVPKWG+VYIP+VITLL+AV TPRS HL+VFW LF
Sbjct  318  KIVAHAVTFVFYCIVIPTTVLVPEVQVPKWGSVYIPTVITLLSAVATPRSAHLVVFWTLF  377

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEW+VTEKLGDA + K       KKPR RIGDR+HVLE
Sbjct  378  ENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGDALRTK----VPGKKPRMRIGDRLHVLE  433

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLP  499
            L   AYL  CGCYD+AFG N Y+++LF+QSIAFFI G GY+GTF+P
Sbjct  434  LGVAAYLLFCGCYDIAFGNNRYYIFLFLQSIAFFIVGIGYVGTFVP  479



>ref|XP_009403734.1| PREDICTED: probable mannan synthase 9 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=555

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++ HIVTF+FYC+++PATV VPEV++P WG VY+PSVIT+LN+VGTPRSLHLLVFW+LF
Sbjct  389  KIVGHIVTFIFYCLVIPATVFVPEVEIPMWGLVYLPSVITMLNSVGTPRSLHLLVFWVLF  448

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT  GLL+ GRVNEW+VTEKLGD  K K   +A  KKPR RIGDR+H +E
Sbjct  449  ENVMSLHRTKATLSGLLDLGRVNEWVVTEKLGDIMKTKLPTKAA-KKPRVRIGDRLHKME  507

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L TGAYLF C CYD+ +GKNHYFLYLF+QSI FFI GFGY+GT++P S
Sbjct  508  LFTGAYLFFCACYDLKYGKNHYFLYLFLQSITFFIVGFGYVGTYIPQS  555



>gb|KGN63048.1| hypothetical protein Csa_2G386160 [Cucumis sativus]
Length=706

 Score =   269 bits (688),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEV VPKWGAVYIPS ITLLNAVGTPRS HL++FWILF
Sbjct  317  KIVAHIVTFVFYCVILPATVLVPEVSVPKWGAVYIPSTITLLNAVGTPRSFHLIIFWILF  376

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEW+VTEKLGDA K K   +A  +KPRFR+G+R+H+LE
Sbjct  377  ENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGDALKTKLGSKAP-RKPRFRMGERLHMLE  435

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTF  493
            L  G YLF CG YD+ FGKN YF+YLF+QS AFFIAG GY+GT 
Sbjct  436  LCVGGYLFFCGWYDLNFGKNGYFIYLFLQSFAFFIAGVGYVGTL  479



>ref|XP_008241312.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Prunus mume]
Length=534

 Score =   265 bits (677),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAHI  F+FYC++LPATVLVPEV VPKWG +YIPS+ITLLNAVGTPRSLHLLVFWILF
Sbjct  367  KIIAHINAFVFYCIVLPATVLVPEVVVPKWGGIYIPSIITLLNAVGTPRSLHLLVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGLLEA RVNEWIVTEKLGDA K         +KPR RIG+R+H+LE
Sbjct  427  ENVMSLHRTKATIIGLLEASRVNEWIVTEKLGDALKTLTVAAKLPRKPRIRIGERLHLLE  486

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            LA G YLF CG YD AFGKN+++L+L++Q++AF+I GFGY+GTF+PNS
Sbjct  487  LAVGCYLFFCGTYDFAFGKNYFYLFLYIQAMAFYIIGFGYVGTFVPNS  534



>ref|XP_008659807.1| PREDICTED: probable mannan synthase 9 [Zea mays]
Length=526

 Score =   265 bits (676),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 143/167 (86%), Gaps = 4/167 (2%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AH VTF+FYC+++P TVLVPEVQVPKWG+VYIP+VITLL+AV TPRS HL+VFW LF
Sbjct  364  KIVAHAVTFVFYCIVIPTTVLVPEVQVPKWGSVYIPTVITLLSAVATPRSAHLVVFWTLF  423

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEW+VTEKLGDA + K       KKPR RIGDR+HVLE
Sbjct  424  ENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGDALRTK----VPGKKPRMRIGDRLHVLE  479

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L   AYL  CGCYD+AFG N Y+++LF+QSIAFFI G GY+GTF+P+
Sbjct  480  LGVAAYLLFCGCYDIAFGNNRYYIFLFLQSIAFFIVGIGYVGTFVPH  526



>gb|ABG34548.1| cellulose synthase-like A2 [Pinus taeda]
Length=534

 Score =   265 bits (677),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 144/166 (87%), Gaps = 2/166 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV++P TVLVPEVQ+PKWGAVYIPS ITLLNAV TPRSLHLLVFWILF
Sbjct  369  KIVAHIVTFVFYCVVIPTTVLVPEVQLPKWGAVYIPSTITLLNAVSTPRSLHLLVFWILF  428

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGL EAGRVNEW+VTEKLGDA K K A     K+ + RIG+R+HVLE
Sbjct  429  ENVMSLHRTKATIIGLFEAGRVNEWVVTEKLGDALKHKTA--KQMKRSQSRIGERIHVLE  486

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLP  499
            + TG YLF C  YD+AFGKNH+++YLF+Q+ AFFI GFGYIGTF+P
Sbjct  487  VLTGVYLFFCASYDLAFGKNHFYIYLFLQAGAFFIMGFGYIGTFVP  532



>ref|XP_007203625.1| hypothetical protein PRUPE_ppa004037mg [Prunus persica]
 gb|EMJ04824.1| hypothetical protein PRUPE_ppa004037mg [Prunus persica]
Length=534

 Score =   265 bits (677),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAHI  F+FYC++LPATVLVPEV VPKWG +YIPS+ITLLNAVGTPRSLHLLVFWILF
Sbjct  367  KIIAHINAFVFYCIVLPATVLVPEVVVPKWGGIYIPSIITLLNAVGTPRSLHLLVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGLLEA RVNEWIVTEKLGDA K         +KPR RIG+R+H+LE
Sbjct  427  ENVMSLHRTKATIIGLLEASRVNEWIVTEKLGDALKTLTVAAKLPRKPRIRIGERLHLLE  486

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            LA G YLF CG YD AFGKN+ FL+L++Q++AF+I GFGY+GTF+PNS
Sbjct  487  LAVGCYLFFCGTYDFAFGKNYVFLFLYIQAMAFYIIGFGYVGTFVPNS  534



>gb|KEH43412.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=530

 Score =   264 bits (675),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LPATVLVPEV+VPKWGAVYIP +ITLLNAVGTPRS HL++ WILF
Sbjct  364  KIIAHVVTFTFYCVILPATVLVPEVEVPKWGAVYIPCIITLLNAVGTPRSFHLVILWILF  423

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS+HRTKAT IGL EAGRVNEW+VTEKLGDA K+K   +A  +KPR  I  R+H LE
Sbjct  424  ENVMSMHRTKATLIGLFEAGRVNEWVVTEKLGDALKIKSGGKAA-RKPRITIDGRIHFLE  482

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF+CGCYD+AFGKN  ++YLF+QSIAFF+ G GY+G ++P S
Sbjct  483  LGVGAYLFLCGCYDLAFGKNQCYIYLFLQSIAFFVVGVGYVGIYVPRS  530



>ref|XP_009603325.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
tomentosiformis]
Length=530

 Score =   264 bits (675),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 148/170 (87%), Gaps = 3/170 (2%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV++PAT+L+PEVQVP WGAVYIPS ITLLNAVGTPRSLHLLVFWILF
Sbjct  362  KIVAHIVTFVFYCVVMPATILIPEVQVPIWGAVYIPSTITLLNAVGTPRSLHLLVFWILF  421

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDR--VHV  355
            ENVMSLHRT+ATFIGL EAGRVNEW+VTEKLGDA K K + +A+ KK RFRIG+R  +H 
Sbjct  422  ENVMSLHRTRATFIGLFEAGRVNEWVVTEKLGDALKTKMSSKAS-KKDRFRIGERYKLHF  480

Query  356  LELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            +E+  G YL  CG YD +FGKN +++YLF+QS+AFF+ GFGYIG F+PNS
Sbjct  481  MEIFVGLYLLFCGWYDYSFGKNRFYIYLFLQSMAFFVGGFGYIGVFVPNS  530



>ref|XP_009760346.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
sylvestris]
Length=530

 Score =   264 bits (674),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 148/170 (87%), Gaps = 3/170 (2%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV++PATVL+PEVQVP WGAVYIPS ITLLNAVGTPRSLHLLVFWILF
Sbjct  362  KIVAHIVTFIFYCVVMPATVLIPEVQVPIWGAVYIPSTITLLNAVGTPRSLHLLVFWILF  421

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDR--VHV  355
            ENVMSLHRT+ATFIGL E GRVNEWIVTEKLGDA K K + +A+ KK RFRIG+R  +H 
Sbjct  422  ENVMSLHRTRATFIGLFEVGRVNEWIVTEKLGDALKTKMSSKAS-KKDRFRIGERYKLHF  480

Query  356  LELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            +E+  G YL +CG YD +FGKN +++YLF+QS+AFF+AGF YIG F+PNS
Sbjct  481  MEIFVGLYLLLCGWYDYSFGKNRFYIYLFLQSMAFFVAGFSYIGVFVPNS  530



>ref|XP_003560565.2| PREDICTED: probable mannan synthase 9 [Brachypodium distachyon]
Length=488

 Score =   263 bits (671),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 145/167 (87%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+I H+VTF+F C+++PATVLVPEV++PKWG +YIPS+ITLLNAVGTPRS+HLLVFW LF
Sbjct  323  KIIGHVVTFVFCCLVIPATVLVPEVEIPKWGYIYIPSIITLLNAVGTPRSVHLLVFWTLF  382

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLE GRVNEW+VTEKLGDA K+K   +   KK R RIG+R+H+LE
Sbjct  383  ENVMSLHRTKATFIGLLEIGRVNEWVVTEKLGDALKMKTPSKVP-KKLRMRIGERLHLLE  441

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L   AYLF CGCYD++FG NHYF++LFMQSI FF+ G GY+GTF+P+
Sbjct  442  LGVAAYLFFCGCYDISFGNNHYFIFLFMQSITFFVVGVGYVGTFVPH  488



>ref|XP_006287469.1| hypothetical protein CARUB_v10000681mg [Capsella rubella]
 gb|EOA20367.1| hypothetical protein CARUB_v10000681mg [Capsella rubella]
Length=533

 Score =   263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 138/167 (83%), Gaps = 2/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEV VPKWGAVYIPSVITLLNAVGTPRSLHL+VFWILF
Sbjct  368  KIVAHIVTFIFYCVVLPATVLVPEVSVPKWGAVYIPSVITLLNAVGTPRSLHLMVFWILF  427

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLE GRVNEWIVTEKLGD               RFR GDR+HVLE
Sbjct  428  ENVMSLHRTKATFIGLLEGGRVNEWIVTEKLGDLKAKSAKAPKKIL--RFRFGDRIHVLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L  G YL   GCYD  FGKNHY++YLF Q+IAFFIAGFG IGT +PN
Sbjct  486  LGVGMYLLFVGCYDAFFGKNHYYIYLFAQAIAFFIAGFGQIGTIVPN  532



>ref|XP_006851749.1| hypothetical protein AMTR_s00040p00223350 [Amborella trichopoda]
 gb|ERN13216.1| hypothetical protein AMTR_s00040p00223350 [Amborella trichopoda]
Length=533

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV++PATVLVPEV++PKWGAVYIPS IT+LNA+ +PRSLHL+VFWILF
Sbjct  367  KIVAHIVTFVFYCVVIPATVLVPEVEIPKWGAVYIPSTITILNALSSPRSLHLVVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGL EA RVNEW+VTEKLGDA K K   ++  KK   RIG ++H+LE
Sbjct  427  ENVMSLHRTKATFIGLAEARRVNEWVVTEKLGDALKGKAGGKSV-KKFWIRIGGKLHLLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYLF C CYD+AFGKNHYF+YL++Q++AFFI GFGYIGTF+P+S
Sbjct  486  LGVGAYLFFCACYDLAFGKNHYFIYLYLQAMAFFIMGFGYIGTFVPHS  533



>ref|XP_009365313.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Pyrus 
x bretschneideri]
Length=534

 Score =   262 bits (670),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAHI  F+FYC++LPATVLVPEV VPKWG +YIPS+ITLLNAVGTPRS+HLLVFWILF
Sbjct  367  KIIAHINAFVFYCIVLPATVLVPEVVVPKWGGIYIPSLITLLNAVGTPRSIHLLVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGLLEA RVNEWIVTEKLGDA K         +K RFRIG+R+H+LE
Sbjct  427  ENVMSLHRTKATIIGLLEASRVNEWIVTEKLGDALKTLKVATKLPRKSRFRIGERLHLLE  486

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            LA G YL  CGCYD  FGKN+++L+L++Q+ AFFI GFGY+GTF+PNS
Sbjct  487  LAVGLYLIFCGCYDFIFGKNYFYLFLYIQATAFFIIGFGYVGTFVPNS  534



>gb|AFW73371.1| hypothetical protein ZEAMMB73_956340 [Zea mays]
Length=918

 Score =   270 bits (689),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 144/168 (86%), Gaps = 6/168 (4%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AH VTF+FYC+++P TVLVPEVQVPKWG+VYIP+VITLL+AV TPRS HL+VFW LF
Sbjct  756  KIVAHAVTFVFYCIVIPTTVLVPEVQVPKWGSVYIPTVITLLSAVATPRSAHLVVFWTLF  815

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLK-PALRATFKKPRFRIGDRVHVL  358
            ENVMSLHRTKATFIGLLEAGRVNEW+VTEKLGDA + K P      KKPR RIGDR+HVL
Sbjct  816  ENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGDALRTKVPG-----KKPRMRIGDRLHVL  870

Query  359  ELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            EL   AYL  CGCYD+AFG N Y+++LF+QSIAFFI G GY+GTF+P+
Sbjct  871  ELGVAAYLLFCGCYDIAFGNNRYYIFLFLQSIAFFIVGIGYVGTFVPH  918



>ref|XP_010243535.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Nelumbo 
nucifera]
Length=533

 Score =   261 bits (668),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV++P TVLVPEV+VPKWG+VYIPS+IT+LN+VGT RSLHLLVFWILF
Sbjct  367  KIVAHIVTFVFYCVVMPLTVLVPEVEVPKWGSVYIPSIITILNSVGTLRSLHLLVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLEAGRVNEW+VTEKLGDA K+K A     KKPR RIG+R+H+LE
Sbjct  427  ENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGDALKVK-AASKAAKKPRVRIGERLHLLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G +LF   CYD+A+GKNHYFLYL++QS+AFFI GFGY+GTF+PNS
Sbjct  486  LGVGMFLFFIACYDLAYGKNHYFLYLYLQSLAFFIVGFGYVGTFVPNS  533



>ref|XP_010112526.1| hypothetical protein L484_012804 [Morus notabilis]
 gb|EXC33914.1| hypothetical protein L484_012804 [Morus notabilis]
Length=574

 Score =   261 bits (668),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 147/167 (88%), Gaps = 2/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHI+TF+FYCV+LPATVLVPEV VPKWGAVYIPS+ITLLNAVGTPRSLHLLVFWILF
Sbjct  409  KIVAHIITFVFYCVVLPATVLVPEVHVPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILF  468

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGLLEA RVNEW+VTEKLGDA K         KKPRF+IG+R+H+LE
Sbjct  469  ENVMSLHRTKATIIGLLEASRVNEWVVTEKLGDALKG--KAAKAPKKPRFKIGERLHLLE  526

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L  G YLF CG YDV FGKNH+F+YLF+Q+IAFFI GFGY+GTF+PN
Sbjct  527  LGVGVYLFFCGWYDVLFGKNHFFIYLFVQAIAFFIMGFGYVGTFVPN  573



>ref|XP_008647195.1| PREDICTED: uncharacterized protein LOC103628848 [Zea mays]
Length=949

 Score =   268 bits (684),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 144/168 (86%), Gaps = 6/168 (4%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AH VTF+FYC+++P TVLVPEVQVPKWG+VYIP+VITLL+AV TPRS HL+VFW LF
Sbjct  787  KIVAHAVTFVFYCIVIPTTVLVPEVQVPKWGSVYIPTVITLLSAVATPRSAHLVVFWTLF  846

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLK-PALRATFKKPRFRIGDRVHVL  358
            ENVMSLHRTKATFIGLLEAGRVNEW+VTEKLGDA + K P      KKPR RIGDR+HVL
Sbjct  847  ENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGDALRTKVPG-----KKPRMRIGDRLHVL  901

Query  359  ELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            EL   AYL  CGCYD+AFG N Y+++LF+QSIAFFI G GY+GTF+P+
Sbjct  902  ELGVAAYLLFCGCYDIAFGNNRYYIFLFLQSIAFFIVGIGYVGTFVPH  949



>gb|KCW48370.1| hypothetical protein EUGRSUZ_K02079 [Eucalyptus grandis]
Length=296

 Score =   251 bits (641),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 139/167 (83%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYC++LPATVL PEV VPKW ++YIPS+IT LNA+ TPRSLHL+VFWILF
Sbjct  130  KIVAHIVTFLFYCIVLPATVLTPEVAVPKWASIYIPSIITALNALSTPRSLHLMVFWILF  189

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGLLE  RVNEWIVTEKLGDA K K A+ +  ++ R R  +R H LE
Sbjct  190  ENVMSLHRTKATIIGLLEGNRVNEWIVTEKLGDALKNK-AITSFAERTRLRFTERFHFLE  248

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            +  G YL  CGCYDVAFGKNHYFL+L++Q++AFFI GFGY+G F+P 
Sbjct  249  IGVGVYLCFCGCYDVAFGKNHYFLFLYVQAVAFFIMGFGYVGIFVPK  295



>gb|AFW66233.1| hypothetical protein ZEAMMB73_021965 [Zea mays]
Length=245

 Score =   248 bits (632),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAHI+TF FYCV++PAT+ VPEV++PKWG VYIPS ITLLN+VGTPRS HLL FW+ F
Sbjct  78   KIIAHIITFSFYCVIIPATIFVPEVRIPKWGCVYIPSAITLLNSVGTPRSFHLLFFWVAF  137

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGLLEAGR NEW+VT KLG A K+K A +A  +K   RI +R+HV E
Sbjct  138  ENVMSLHRTKATLIGLLEAGRANEWVVTAKLGSAMKMKSANKAGLRKQFMRIWERLHVTE  197

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L   A+LF CG YD+A+G++H+F+YLF QS+AFFI G GY+GT +P S
Sbjct  198  LGVAAFLFSCGWYDLAYGRDHFFIYLFFQSVAFFIVGVGYVGTIVPQS  245



>ref|XP_004143300.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 gb|KGN48231.1| hypothetical protein Csa_6G450360 [Cucumis sativus]
Length=537

 Score =   256 bits (653),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KV+AHI TF+FYC++LPATVLVPEV+VPKWG+VYIPS+ITLLNAVGTPRSLHLLV+WILF
Sbjct  371  KVVAHINTFVFYCIVLPATVLVPEVEVPKWGSVYIPSIITLLNAVGTPRSLHLLVYWILF  430

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVM++HRTK T IGLLEA RVNEWIVTEKLGDA K K A + T KKPRF IG+RV + E
Sbjct  431  ENVMAMHRTKGTIIGLLEASRVNEWIVTEKLGDASKPKLAAK-TPKKPRFWIGERVLMWE  489

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGT  490
            L  GAYLFICG YD+ FGKN YF++LF+Q+IAF I GFG++GT
Sbjct  490  LGVGAYLFICGIYDIFFGKNQYFIFLFLQAIAFCIVGFGFVGT  532



>gb|ACR38199.1| unknown [Zea mays]
 gb|AFW66232.1| hypothetical protein ZEAMMB73_021965 [Zea mays]
Length=300

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAHI+TF FYCV++PAT+ VPEV++PKWG VYIPS ITLLN+VGTPRS HLL FW+ F
Sbjct  133  KIIAHIITFSFYCVIIPATIFVPEVRIPKWGCVYIPSAITLLNSVGTPRSFHLLFFWVAF  192

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGLLEAGR NEW+VT KLG A K+K A +A  +K   RI +R+HV E
Sbjct  193  ENVMSLHRTKATLIGLLEAGRANEWVVTAKLGSAMKMKSANKAGLRKQFMRIWERLHVTE  252

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L   A+LF CG YD+A+G++H+F+YLF QS+AFFI G GY+GT +P S
Sbjct  253  LGVAAFLFSCGWYDLAYGRDHFFIYLFFQSVAFFIVGVGYVGTIVPQS  300



>sp|Q67VS7.1|CSLA9_ORYSJ RecName: Full=Probable mannan synthase 9; AltName: Full=Cellulose 
synthase-like protein A9; AltName: Full=OsCslA9 [Oryza 
sativa Japonica Group]
 gb|AAL25128.1|AF432499_1 cellulose synthase-like protein OsCslA9 [Oryza sativa]
 dbj|BAD37742.1| putative glycosyltransferase 1 [Oryza sativa Japonica Group]
 gb|EEC81007.1| hypothetical protein OsI_23768 [Oryza sativa Indica Group]
 gb|EEE66045.1| hypothetical protein OsJ_22033 [Oryza sativa Japonica Group]
Length=527

 Score =   255 bits (652),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 145/167 (87%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+I HIVTF+FYC+++PATVL+PEV++P+WG VY+PS++T+LN++GTPRSLHLL+FW+LF
Sbjct  362  KIIGHIVTFVFYCLVVPATVLIPEVEIPRWGYVYLPSIVTILNSIGTPRSLHLLIFWVLF  421

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGLLE GRVNEW+VTEKLGDA KLK   +A F++PR RIGDRV+ LE
Sbjct  422  ENVMSLHRTKATLIGLLETGRVNEWVVTEKLGDALKLKLPGKA-FRRPRMRIGDRVNALE  480

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L   AYL  CGCYD+A+GK +Y L+LF+QSI FFI G GY+GT +P+
Sbjct  481  LGFSAYLSFCGCYDIAYGKGYYSLFLFLQSITFFIIGVGYVGTIVPH  527



>ref|XP_010089159.1| hypothetical protein L484_003290 [Morus notabilis]
 gb|EXB37420.1| hypothetical protein L484_003290 [Morus notabilis]
Length=541

 Score =   255 bits (652),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 142/175 (81%), Gaps = 8/175 (5%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF+FYCV+LP T+LVPEV VP WGAVYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHMVTFIFYCVVLPLTILVPEVHVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRAT--------FKKPRFRI  337
            ENVMSLHRTKATFIGLLEAGR NEW+VTEKLGD  K K    A         FKKPRF+ 
Sbjct  427  ENVMSLHRTKATFIGLLEAGRANEWVVTEKLGDTLKKKAESDAANKKTPFKLFKKPRFKF  486

Query  338  GDRVHVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            GDR+H+LEL  G +LF+CGCYD   GKN+YF+YLF+Q+  F I GFGY+GT +P+
Sbjct  487  GDRLHLLELGFGVFLFLCGCYDFVHGKNNYFVYLFLQTFTFLICGFGYVGTIIPS  541



>ref|XP_004164074.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
Length=537

 Score =   255 bits (651),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KV+AHI TF+FYC++LPATVLVPEV+VPKWG+VYIPS+ITLLNAVGTPRS+HLLV+WILF
Sbjct  371  KVVAHINTFVFYCIVLPATVLVPEVEVPKWGSVYIPSIITLLNAVGTPRSIHLLVYWILF  430

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVM++HRTK T IGLLEA RVNEWIVTEKLGDA K K A + T KKPRF IG+RV + E
Sbjct  431  ENVMAMHRTKGTIIGLLEASRVNEWIVTEKLGDASKPKLAAK-TPKKPRFWIGERVLMWE  489

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGT  490
            L  GAYLFICG YD+ FGKN YF++LF+Q+IAF I GFG++GT
Sbjct  490  LGVGAYLFICGIYDIFFGKNQYFIFLFLQAIAFCIVGFGFVGT  532



>emb|CDY10358.1| BnaCnng02590D [Brassica napus]
Length=532

 Score =   253 bits (647),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 144/167 (86%), Gaps = 2/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYCV+LPATVLVPEV VPKWGAVYIPS+ITLLNAVGTPRSLHL+VFWILF
Sbjct  367  KIVAHIVTFIFYCVVLPATVLVPEVTVPKWGAVYIPSIITLLNAVGTPRSLHLMVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGLLE GRVNEWIVTEKLGD  K K A +A  KK RFR GDR+HVLE
Sbjct  427  ENVMSLHRTKATFIGLLEGGRVNEWIVTEKLGD-LKAKSATKAP-KKLRFRFGDRIHVLE  484

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L  G YLF  GCYD  FGKNHY+LYLF Q+ AFFIAG G IGT +PN
Sbjct  485  LGVGMYLFSIGCYDALFGKNHYYLYLFAQAFAFFIAGCGQIGTVVPN  531



>ref|XP_006656269.1| PREDICTED: probable mannan synthase 9-like [Oryza brachyantha]
Length=520

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 145/167 (87%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+I HIVTF+FYC+++PATVL+PEV++P+WG VY+PS++T+LN++GTPRSLHLL+FW+LF
Sbjct  355  KIIGHIVTFVFYCLVVPATVLIPEVEIPRWGYVYLPSIVTILNSIGTPRSLHLLIFWVLF  414

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGLLE GRVNEW+VTEKLGDA K+K   +A F++PR R+GDR++ LE
Sbjct  415  ENVMSLHRTKATLIGLLETGRVNEWVVTEKLGDALKIKLPGKA-FRRPRMRMGDRLNALE  473

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L   AYL  CGCYD+AFGK +Y L+LF+QSI FFI G GY+GT +P+
Sbjct  474  LGFSAYLCFCGCYDIAFGKGYYSLFLFLQSITFFIIGVGYVGTIVPH  520



>ref|XP_009793132.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X3 [Nicotiana sylvestris]
Length=494

 Score =   252 bits (643),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAHIVTF+ YCV++PATV VPEVQVPKWGA+YIPS IT+LN +G+PRS++L+V+WILF
Sbjct  328  KIIAHIVTFVLYCVVMPATVFVPEVQVPKWGAIYIPSAITILNVLGSPRSMYLVVYWILF  387

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATF+GL E+GRVNEWIVTEKLGDA K K + + T +K RFR+G+RVH+LE
Sbjct  388  ENVMSLHRTKATFVGLFESGRVNEWIVTEKLGDALKTKVSSK-TSRKLRFRVGERVHLLE  446

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G YL+ CG YD +FGK+ + +YLF+Q+ AFF+ GFGY+G F+PNS
Sbjct  447  LFVGLYLWFCGWYDFSFGKSRFHVYLFLQAAAFFVVGFGYVGVFVPNS  494



>ref|XP_006345855.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
tuberosum]
Length=486

 Score =   251 bits (642),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 143/171 (84%), Gaps = 4/171 (2%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAHIVTF+FYCV++P TVL+PEVQVP WGAVYIPS ITLLNAVGTPRS +LL+FWILF
Sbjct  317  KIIAHIVTFIFYCVIMPTTVLIPEVQVPIWGAVYIPSTITLLNAVGTPRSFYLLIFWILF  376

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGD---RVH  352
            ENVMSLHRT+ATFIGL E G+VNEW+VTEKLGD  K K +++ + KK RFRIG+   +VH
Sbjct  377  ENVMSLHRTRATFIGLFEVGKVNEWVVTEKLGDGIKAKTSMKVS-KKSRFRIGEWYNKVH  435

Query  353  VLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
              E+  G YL +CG YD +FGKN +++YLF+Q +AF +AGFGYIG F+PNS
Sbjct  436  FAEVFVGLYLMLCGWYDYSFGKNRFYIYLFLQGMAFLVAGFGYIGVFVPNS  486



>ref|XP_009793131.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Nicotiana sylvestris]
Length=531

 Score =   252 bits (644),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAHIVTF+ YCV++PATV VPEVQVPKWGA+YIPS IT+LN +G+PRS++L+V+WILF
Sbjct  365  KIIAHIVTFVLYCVVMPATVFVPEVQVPKWGAIYIPSAITILNVLGSPRSMYLVVYWILF  424

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATF+GL E+GRVNEWIVTEKLGDA K K + + T +K RFR+G+RVH+LE
Sbjct  425  ENVMSLHRTKATFVGLFESGRVNEWIVTEKLGDALKTKVSSK-TSRKLRFRVGERVHLLE  483

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G YL+ CG YD +FGK+ + +YLF+Q+ AFF+ GFGY+G F+PNS
Sbjct  484  LFVGLYLWFCGWYDFSFGKSRFHVYLFLQAAAFFVVGFGYVGVFVPNS  531



>ref|XP_009603536.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Nicotiana tomentosiformis]
Length=494

 Score =   251 bits (640),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF+ YCV++PATV VPEVQVPKWGA+YIPS ITLLN +G+ RS++L+V+WILF
Sbjct  328  KIIAHVVTFVLYCVVMPATVFVPEVQVPKWGAIYIPSAITLLNVLGSTRSMYLVVYWILF  387

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATF+GL E+GRVNEWIVTEKLGDA K K   +A+ +K RFR+G+RVHVLE
Sbjct  388  ENVMSLHRTKATFVGLFESGRVNEWIVTEKLGDALKTKMGSKAS-RKLRFRVGERVHVLE  446

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G +L  CG YD +FGK+ +++YLF+Q+ AFF+ GFGYIG F+PNS
Sbjct  447  LFVGLHLLFCGWYDFSFGKSRFYVYLFLQAAAFFVVGFGYIGVFVPNS  494



>ref|XP_008462529.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
melo]
Length=536

 Score =   252 bits (643),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 142/163 (87%), Gaps = 1/163 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KV+AHI TF+FYC++LPATVLVPEV+VPKWG+VYIPS+ITLLNAVGTPRSLHLLV+WILF
Sbjct  370  KVVAHINTFVFYCLVLPATVLVPEVEVPKWGSVYIPSIITLLNAVGTPRSLHLLVYWILF  429

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVM++HRTK T IGLLEA RVNEWIVTEKLGDA K K A + T KK RF IG+RV + E
Sbjct  430  ENVMAMHRTKGTIIGLLEASRVNEWIVTEKLGDASKPKLAAK-TPKKTRFWIGERVLMWE  488

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGT  490
            L  GAYLFICG YD+ FGKN YF++LF+Q+IAF I GFG++GT
Sbjct  489  LGVGAYLFICGIYDIFFGKNQYFIFLFLQAIAFCIVGFGFVGT  531



>ref|XP_010038980.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Eucalyptus 
grandis]
Length=533

 Score =   252 bits (643),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 139/167 (83%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+FYC++LPATVL PEV VPKW ++YIPS+IT LNA+ TPRSLHL+VFWILF
Sbjct  367  KIVAHIVTFLFYCIVLPATVLTPEVAVPKWASIYIPSIITALNALSTPRSLHLMVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGLLE  RVNEWIVTEKLGDA K K A+ +  ++ R R  +R H LE
Sbjct  427  ENVMSLHRTKATIIGLLEGNRVNEWIVTEKLGDALKNK-AITSFAERTRLRFTERFHFLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            +  G YL  CGCYDVAFGKNHYFL+L++Q++AFFI GFGY+G F+P 
Sbjct  486  IGVGVYLCFCGCYDVAFGKNHYFLFLYVQAVAFFIMGFGYVGIFVPK  532



>ref|XP_009603535.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Nicotiana tomentosiformis]
Length=531

 Score =   251 bits (641),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF+ YCV++PATV VPEVQVPKWGA+YIPS ITLLN +G+ RS++L+V+WILF
Sbjct  365  KIIAHVVTFVLYCVVMPATVFVPEVQVPKWGAIYIPSAITLLNVLGSTRSMYLVVYWILF  424

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATF+GL E+GRVNEWIVTEKLGDA K K   +A+ +K RFR+G+RVHVLE
Sbjct  425  ENVMSLHRTKATFVGLFESGRVNEWIVTEKLGDALKTKMGSKAS-RKLRFRVGERVHVLE  483

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G +L  CG YD +FGK+ +++YLF+Q+ AFF+ GFGYIG F+PNS
Sbjct  484  LFVGLHLLFCGWYDFSFGKSRFYVYLFLQAAAFFVVGFGYIGVFVPNS  531



>ref|XP_009793130.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Nicotiana sylvestris]
Length=553

 Score =   251 bits (641),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAHIVTF+ YCV++PATV VPEVQVPKWGA+YIPS IT+LN +G+PRS++L+V+WILF
Sbjct  387  KIIAHIVTFVLYCVVMPATVFVPEVQVPKWGAIYIPSAITILNVLGSPRSMYLVVYWILF  446

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATF+GL E+GRVNEWIVTEKLGDA K K + + T +K RFR+G+RVH+LE
Sbjct  447  ENVMSLHRTKATFVGLFESGRVNEWIVTEKLGDALKTKVSSK-TSRKLRFRVGERVHLLE  505

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G YL+ CG YD +FGK+ + +YLF+Q+ AFF+ GFGY+G F+PNS
Sbjct  506  LFVGLYLWFCGWYDFSFGKSRFHVYLFLQAAAFFVVGFGYVGVFVPNS  553



>ref|XP_006484970.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Citrus 
sinensis]
Length=537

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 137/169 (81%), Gaps = 6/169 (4%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LP T+LVPEVQVP WGAVYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHMVTFSFYCVVLPLTILVPEVQVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATF------KKPRFRIGD  343
            ENVMSLHRTKATFIGLLEAGR NEW+VTEKLGDA K K A           KKP+ +  D
Sbjct  427  ENVMSLHRTKATFIGLLEAGRANEWVVTEKLGDALKNKAADAKNKTNTKAPKKPKIKFAD  486

Query  344  RVHVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGT  490
            R+H LEL  G +LF CGCYD   GKN+YF+YLF+Q+I F IAGFGYIGT
Sbjct  487  RMHTLELGFGVFLFFCGCYDFVHGKNNYFIYLFLQTITFLIAGFGYIGT  535



>ref|XP_003571119.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 1 [Brachypodium 
distachyon]
Length=518

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF FYC+++P T+ VPEV +PKWG VYIP++ITLLN+VGTPRS HLL FWILF
Sbjct  351  KIVAHIVTFTFYCIIIPTTIFVPEVHIPKWGCVYIPTIITLLNSVGTPRSFHLLFFWILF  410

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGLLEAGRVNEW+VTEKLG+A K+K A +A+ +K   RI DR++V E
Sbjct  411  ENVMSLHRTKATLIGLLEAGRVNEWVVTEKLGNAMKMKSASKASARKSFMRIWDRLNVPE  470

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GA+LF  G YDVAFGK+++F+YLF QS+AFFI G GY+GT +P S
Sbjct  471  LGVGAFLFSIGWYDVAFGKDNFFIYLFFQSMAFFIVGVGYVGTIVPQS  518



>gb|EPS66478.1| hypothetical protein M569_08299, partial [Genlisea aurea]
Length=230

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 132/166 (80%), Gaps = 0/166 (0%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF FYC++ PATVLVP+VQ+PKW +VYIP  IT+LN+VGTPRSLHLLVFWILF
Sbjct  65   KIVAHIVTFFFYCIVFPATVLVPQVQIPKWASVYIPFTITILNSVGTPRSLHLLVFWILF  124

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHR KAT IGL  A RVNEWIVTEKLGD  K KP  +A +    F +  R + LE
Sbjct  125  ENVMSLHRAKATIIGLFGARRVNEWIVTEKLGDVRKSKPVKKAFYTSMSFNLFRRFYSLE  184

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLP  499
            +ATG YL  CGCYD  +G NHY++YLF+Q+ AF I GFGY+GTF+P
Sbjct  185  VATGVYLSFCGCYDFIYGNNHYYIYLFLQAAAFLIVGFGYVGTFVP  230



>ref|XP_007145259.1| hypothetical protein PHAVU_007G223800g [Phaseolus vulgaris]
 gb|ESW17253.1| hypothetical protein PHAVU_007G223800g [Phaseolus vulgaris]
Length=523

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 140/168 (83%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KV+AH+ TF+FYC++LPATV+VPEV VPKWGAVYIPS+ITLLNAVGTPRSLHLLVFWILF
Sbjct  357  KVVAHLNTFVFYCIVLPATVVVPEVAVPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILF  416

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            EN MSLHRTKAT IGLLEA RVNEWIVTEKLG             KK RFRIGDR+H+LE
Sbjct  417  ENTMSLHRTKATIIGLLEASRVNEWIVTEKLG-DALKGKGGGKAAKKIRFRIGDRIHMLE  475

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G YLF CGCYDV FGKN ++++L++QSIAFFI  FGY+GT +PNS
Sbjct  476  LLVGFYLFFCGCYDVMFGKNRFYIFLYIQSIAFFIMAFGYVGTIVPNS  523



>ref|XP_004239715.2| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
lycopersicum]
Length=526

 Score =   249 bits (636),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 143/171 (84%), Gaps = 4/171 (2%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF+FYCV++P TVL+PEVQVP WGAVYIPS ITLLNAVGTPRS +LL+FWILF
Sbjct  357  KIIAHMVTFIFYCVIIPTTVLIPEVQVPIWGAVYIPSTITLLNAVGTPRSFYLLIFWILF  416

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGD---RVH  352
            ENVMSLHRT+ATFIGL E GRVNEW+VTEKLGD  K K + + + ++ RFRIG+   +VH
Sbjct  417  ENVMSLHRTRATFIGLFEVGRVNEWVVTEKLGDGIKAKTSTKGS-RRSRFRIGEWYNKVH  475

Query  353  VLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
             +E+  G YL +CG YD +FGKN +++YLF+Q +AF +AGFGYIG F+PNS
Sbjct  476  FVEVFVGLYLMLCGWYDYSFGKNRFYIYLFLQGVAFLVAGFGYIGVFVPNS  526



>gb|KDO45609.1| hypothetical protein CISIN_1g040333mg [Citrus sinensis]
Length=513

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 137/169 (81%), Gaps = 6/169 (4%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LP T+LVPEVQVP WGAVYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  343  KIIAHMVTFSFYCVVLPLTILVPEVQVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILF  402

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATF------KKPRFRIGD  343
            ENVMSLHRTKATFIGLLEAGR NEW+VTEKLGDA K K A           KKP+ +  +
Sbjct  403  ENVMSLHRTKATFIGLLEAGRANEWVVTEKLGDALKNKAADAKNKTNTKAPKKPKIKFAE  462

Query  344  RVHVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGT  490
            R+H LEL  G +LF CGCYD   GKN+YF+YLF+Q+I F IAGFGYIGT
Sbjct  463  RMHTLELGFGVFLFFCGCYDFVHGKNNYFIYLFLQTITFLIAGFGYIGT  511



>ref|XP_009337395.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Pyrus 
x bretschneideri]
Length=549

 Score =   249 bits (636),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 143/184 (78%), Gaps = 17/184 (9%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LP T+LVPEV VP WGAVYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHMVTFFFYCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLG----------------DACKLKPALRAT  313
            ENVMSLHRTKAT IGLLE  R NEW+VTEKLG                DA K KPA +  
Sbjct  427  ENVMSLHRTKATLIGLLETARSNEWVVTEKLGDIVKNKAAEAAKNKTADANKTKPASK-L  485

Query  314  FKKPRFRIGDRVHVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTF  493
            FKKPRF+ G+R+H+LEL  G +LFICGCYD   GKN+YF+YLF+Q+I F I GFGY+GT 
Sbjct  486  FKKPRFKFGNRLHLLELGFGVFLFICGCYDFVHGKNNYFIYLFLQTITFLICGFGYVGTI  545

Query  494  LPNS  505
            +P+S
Sbjct  546  IPSS  549



>ref|XP_006424348.1| hypothetical protein CICLE_v10028164mg [Citrus clementina]
 gb|ESR37588.1| hypothetical protein CICLE_v10028164mg [Citrus clementina]
Length=537

 Score =   249 bits (635),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 137/169 (81%), Gaps = 6/169 (4%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LP T+LVPEVQVP WGAVYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHMVTFSFYCVVLPLTILVPEVQVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATF------KKPRFRIGD  343
            ENVMSLHRTKATFIGLLEAGR NEW+VTEKLGDA K K A           KKP+ +  +
Sbjct  427  ENVMSLHRTKATFIGLLEAGRANEWVVTEKLGDALKNKAADAKNKTNTKAPKKPKIKFAE  486

Query  344  RVHVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGT  490
            R+H LEL  G +LF CGCYD   GKN+YF+YLF+Q+I F IAGFGYIGT
Sbjct  487  RMHTLELGFGVFLFFCGCYDFVHGKNNYFIYLFLQTITFLIAGFGYIGT  535



>ref|NP_001131007.1| uncharacterized protein LOC100192112 [Zea mays]
 gb|ACF79431.1| unknown [Zea mays]
 gb|ACG40011.1| CSLA1 - cellulose synthase-like family A; mannan synthase [Zea 
mays]
 gb|AFW66229.1| CSLA1-cellulose synthase-like family isoform 1 [Zea mays]
 gb|AFW66230.1| CSLA1-cellulose synthase-like family isoform 2 [Zea mays]
Length=514

 Score =   248 bits (632),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAHI+TF FYCV++PAT+ VPEV++PKWG VYIPS ITLLN+VGTPRS HLL FW+ F
Sbjct  347  KIIAHIITFSFYCVIIPATIFVPEVRIPKWGCVYIPSAITLLNSVGTPRSFHLLFFWVAF  406

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGLLEAGR NEW+VT KLG A K+K A +A  +K   RI +R+HV E
Sbjct  407  ENVMSLHRTKATLIGLLEAGRANEWVVTAKLGSAMKMKSANKAGLRKQFMRIWERLHVTE  466

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L   A+LF CG YD+A+G++H+F+YLF QS+AFFI G GY+GT +P S
Sbjct  467  LGVAAFLFSCGWYDLAYGRDHFFIYLFFQSVAFFIVGVGYVGTIVPQS  514



>ref|XP_008385455.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Malus domestica]
Length=549

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 143/184 (78%), Gaps = 17/184 (9%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LP T+LVPEV VP WGAVYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHMVTFFFYCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLG----------------DACKLKPALRAT  313
            ENVMSLHRTKAT IGLLE  R NEW+VTEKLG                DA K KPA +  
Sbjct  427  ENVMSLHRTKATLIGLLETARSNEWVVTEKLGDIVKNKAAEAAKNKTADANKTKPASK-L  485

Query  314  FKKPRFRIGDRVHVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTF  493
            FK+PRF+ G+R+H+LEL  G +LFICGCYD   GKN+YF+YLF+Q+I F I GFGY+GT 
Sbjct  486  FKRPRFKFGNRLHLLELGFGVFLFICGCYDFVHGKNNYFIYLFLQTITFLICGFGYVGTI  545

Query  494  LPNS  505
            +P+S
Sbjct  546  IPSS  549



>emb|CDP06989.1| unnamed protein product [Coffea canephora]
Length=537

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 139/169 (82%), Gaps = 1/169 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KVIAH+VTF FYCV+LP T+LVPEV+VPKWGA+YIP +IT LN+VGTPRS+HLL +WILF
Sbjct  369  KVIAHMVTFFFYCVVLPLTILVPEVEVPKWGAIYIPCIITALNSVGTPRSIHLLFYWILF  428

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKP-ALRATFKKPRFRIGDRVHVL  358
            ENVMSLHRTKATFIGLLEA R NEW+VTEKLGDA K K   ++A  KK   +IGDR+H+ 
Sbjct  429  ENVMSLHRTKATFIGLLEAKRANEWVVTEKLGDALKNKSNVVKAKPKKIGLKIGDRIHLT  488

Query  359  ELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            EL    +LF CGCYD  +GKN+YF+YLF+Q I F IAGFGYIGT +P S
Sbjct  489  ELGFAVFLFFCGCYDFLYGKNNYFIYLFLQVITFTIAGFGYIGTIVPTS  537



>gb|EMS67675.1| hypothetical protein TRIUR3_27071 [Triticum urartu]
Length=522

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 139/165 (84%), Gaps = 1/165 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KV+AHIVTF+FYC+++PATVLVPEV+VPKWG VYIP++ITLL+ VGTPRS+HL++FW LF
Sbjct  357  KVVAHIVTFVFYCLVIPATVLVPEVEVPKWGCVYIPAIITLLSVVGTPRSVHLVIFWALF  416

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHR KATFIGLLEA  VNEW+VTEKLGD  K K   +A  KK R  IG+R+H+ E
Sbjct  417  ENVMSLHRAKATFIGLLEAHTVNEWVVTEKLGDTVKTKMPSKA-LKKLRMGIGERLHLWE  475

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFL  496
            L   AYLFICGCY ++FG NHYF++L MQSIAFFI G GY+GTF+
Sbjct  476  LGVAAYLFICGCYSISFGNNHYFIFLLMQSIAFFIVGVGYVGTFV  520



>ref|XP_004303037.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Fragaria 
vesca subsp. vesca]
Length=533

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 137/168 (82%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAHI  F FYC++LPAT+LVPEV VPKWG VYIP++ITLLN+VGTPRS+HL+VFWILF
Sbjct  367  KIIAHIFAFFFYCIVLPATILVPEVTVPKWGGVYIPTIITLLNSVGTPRSIHLVVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IG+LE  RVNEWIVTEKLGD  K K   +A  KK R  IGDR+H LE
Sbjct  427  ENVMSLHRTKATIIGILEFSRVNEWIVTEKLGDFLKNKVGAKAP-KKFRLNIGDRLHFLE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            LA G YLF C CYD  FGK++YF++ + QS+AFFI GFGY+GT +P S
Sbjct  486  LAVGCYLFFCACYDFVFGKDNYFIFFYTQSLAFFIMGFGYVGTIVPTS  533



>ref|XP_004951606.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 1-like [Setaria 
italica]
Length=521

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAHI+TF FYC+++PAT+ VPEV++PKWG VYIPS ITLLN+VGTPRS HLL FW+ F
Sbjct  354  KIIAHIITFSFYCLIIPATIFVPEVRIPKWGCVYIPSAITLLNSVGTPRSFHLLFFWVAF  413

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGLLEAGR NEW+VT KLG A K+K A +   KK   RI +R+H+ E
Sbjct  414  ENVMSLHRTKATLIGLLEAGRANEWVVTAKLGSAMKMKSANKGGLKKQFMRIWERLHITE  473

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G +LF CG YD+A+G++H+++YLF QSIAFFI GFGY+GT +P S
Sbjct  474  LGVGTFLFSCGWYDLAYGRDHFYIYLFFQSIAFFIIGFGYVGTIVPQS  521



>gb|ACF33171.1| mannan synthase [Coffea canephora]
Length=537

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 139/169 (82%), Gaps = 1/169 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KVIAH+VTF FYCV+LP T+LVPEV+VPKWGA+YIP +IT LN+VGTPRS+HLL +WILF
Sbjct  369  KVIAHMVTFFFYCVVLPLTILVPEVEVPKWGAIYIPCIITALNSVGTPRSIHLLFYWILF  428

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKP-ALRATFKKPRFRIGDRVHVL  358
            ENVMSLHRTKATFIGLLEA R NEW+VTEKLGDA K K   ++A  KK   +IGDR+H+ 
Sbjct  429  ENVMSLHRTKATFIGLLEAKRANEWVVTEKLGDALKNKSNVVKAKPKKIGLKIGDRIHLT  488

Query  359  ELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            EL    +LF CGCYD  +GKN+YF+YLF+Q I F IAGFGYIGT +P S
Sbjct  489  ELGFAVFLFFCGCYDFLYGKNNYFIYLFLQVITFTIAGFGYIGTIVPTS  537



>ref|XP_008363527.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Malus 
domestica]
Length=499

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 143/184 (78%), Gaps = 17/184 (9%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LP T+LVPEV VP WGAVYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  317  KIIAHMVTFFFYCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILF  376

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLG----------------DACKLKPALRAT  313
            ENVMSLHRTKAT IGLLE  R NEW+VTEKLG                DA K KPA +  
Sbjct  377  ENVMSLHRTKATLIGLLETARSNEWVVTEKLGDIVKNKAAEAAKNKVADANKTKPASK-L  435

Query  314  FKKPRFRIGDRVHVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTF  493
            FK+PRF+ G+R+H+LEL  G +LF+CGCYD   GKN+YF+YLF+Q+I F I GFGY+GT 
Sbjct  436  FKRPRFKFGNRLHLLELGFGVFLFMCGCYDFVHGKNNYFVYLFLQTITFLICGFGYVGTI  495

Query  494  LPNS  505
            +P+S
Sbjct  496  IPSS  499



>dbj|BAK03076.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=518

 Score =   246 bits (629),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF FYC+++P T+ VPEV +PKWG VYIP++ITLLN+VGTPRS HLL FWILF
Sbjct  351  KIVAHIVTFTFYCIIIPTTIFVPEVHIPKWGCVYIPTIITLLNSVGTPRSFHLLFFWILF  410

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGLLEAGR NEW+VTEKLG A K+K A +A+ +K   R+ +R++V E
Sbjct  411  ENVMSLHRTKATLIGLLEAGRANEWVVTEKLGSAMKMKSANKASARKSFMRMWERLNVPE  470

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GA+LF CG YDVAFGK+++F+YLF QS+AFF+ G GY+GT +P S
Sbjct  471  LGVGAFLFSCGWYDVAFGKDNFFIYLFFQSMAFFVVGVGYVGTIVPPS  518



>ref|XP_006360487.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
tuberosum]
Length=530

 Score =   246 bits (629),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF+ YCV++PAT+ +PEVQVP+WG +YIP+ ITLLN +G+ RS+ L+V+WILF
Sbjct  364  KIIAHVVTFILYCVVIPATIFIPEVQVPRWGTIYIPTAITLLNILGSARSMQLVVYWILF  423

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKATFIGL E+GRVNEWIVTEKLGDA K K   +A  KK +FR+G+RVHVLE
Sbjct  424  ENVMSLHRTKATFIGLFESGRVNEWIVTEKLGDALKTKKGSKA-LKKLQFRVGERVHVLE  482

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G YL  CG YD +FG+N +++YL +Q++AFF+ GFGY+G F+PNS
Sbjct  483  LFVGLYLLFCGWYDYSFGRNRFYVYLLLQAMAFFVVGFGYVGVFVPNS  530



>ref|XP_008360269.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Malus 
domestica]
Length=549

 Score =   247 bits (630),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 143/184 (78%), Gaps = 17/184 (9%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LP T+LVPEV VP WGAVYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHMVTFFFYCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLG----------------DACKLKPALRAT  313
            ENVMSLHRTKAT IGLLE  R NEW+VTEKLG                DA K KPA +  
Sbjct  427  ENVMSLHRTKATLIGLLETARSNEWVVTEKLGDIVKNKAAEAAKNKVADANKTKPASK-L  485

Query  314  FKKPRFRIGDRVHVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTF  493
            FK+PRF+ G+R+H+LEL  G +LF+CGCYD   GKN+YF+YLF+Q+I F I GFGY+GT 
Sbjct  486  FKRPRFKFGNRLHLLELGFGVFLFMCGCYDFVHGKNNYFVYLFLQTITFLICGFGYVGTI  545

Query  494  LPNS  505
            +P+S
Sbjct  546  IPSS  549



>emb|CDP15609.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   245 bits (625),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 139/168 (83%), Gaps = 2/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++ HIV F+FYCV+LPAT ++PEVQVP WGAV IP VITLLNA+GTPRS HL++FWILF
Sbjct  325  KIVIHIVMFIFYCVVLPATTVIPEVQVPIWGAVCIP-VITLLNALGTPRSFHLVIFWILF  383

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTK TFIGLLE GRVNEWIVTEKLG   + K   +   KKPRFR+G+R+ VLE
Sbjct  384  ENVMSLHRTKGTFIGLLEVGRVNEWIVTEKLGRVLQTKSGSKVP-KKPRFRMGNRLQVLE  442

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G YLF CGCYDVAFGK+  F+YLF+QS AFF+ GFG++GTF+P S
Sbjct  443  LFVGFYLFFCGCYDVAFGKSGLFIYLFLQSTAFFVVGFGHVGTFVPTS  490



>ref|XP_003551076.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Glycine 
max]
 gb|KHN21460.1| Glucomannan 4-beta-mannosyltransferase 2 [Glycine soja]
Length=533

 Score =   246 bits (627),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 137/165 (83%), Gaps = 2/165 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LP T+LVPEV+VP WGAVYIPS+IT LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHMVTFFFYCVVLPLTILVPEVRVPIWGAVYIPSIITTLNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAC--KLKPALRATFKKPRFRIGDRVHV  355
            EN MSLHRTKATFIGLLEAGR NEW+VTEKLGD+   K K  +    +K RF+ G+R+H+
Sbjct  427  ENAMSLHRTKATFIGLLEAGRANEWVVTEKLGDSVNNKNKSNVTKAIRKSRFKFGERLHL  486

Query  356  LELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGT  490
            LEL   A+LF+CGCYD   GKN+YFLYLF+Q+I F I GFGY+GT
Sbjct  487  LELGFAAFLFLCGCYDYVHGKNNYFLYLFLQTITFSIVGFGYVGT  531



>ref|XP_002453460.1| hypothetical protein SORBIDRAFT_04g006260 [Sorghum bicolor]
 gb|EES06436.1| hypothetical protein SORBIDRAFT_04g006260 [Sorghum bicolor]
Length=521

 Score =   244 bits (624),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAHI+TF FYC+++PAT+ VPEV++PKWG VYIPS ITL+N+VGTPRS HLL FW+ F
Sbjct  354  KIIAHIITFSFYCLVIPATIFVPEVRIPKWGCVYIPSAITLMNSVGTPRSFHLLFFWVAF  413

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGLLEAGR NEW+VT KLG A K+K A +A  +K   RI +R+HV E
Sbjct  414  ENVMSLHRTKATLIGLLEAGRANEWVVTAKLGSAMKMKAANKAGLRKQFMRIWERLHVTE  473

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L   A+LF CG YD A+G++H+F+YLF QS+AFFI G GY+GT +P S
Sbjct  474  LGVAAFLFSCGWYDFAYGRDHFFIYLFFQSVAFFIVGIGYVGTIVPQS  521



>emb|CBI17089.3| unnamed protein product [Vitis vinifera]
Length=429

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AH+VTF  YCV+LP T+L+PEV++P WG VYIPS+IT LNAVGTPRS+HLL +WILF
Sbjct  263  KIVAHMVTFCLYCVVLPLTILIPEVEIPIWGIVYIPSIITTLNAVGTPRSIHLLFYWILF  322

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS HRTKAT IGLLEAGR NEW+VTEKLGD  K K   +A  K+PRF+IGDR++ +E
Sbjct  323  ENVMSFHRTKATLIGLLEAGRANEWVVTEKLGDTLKNKANTKAAAKRPRFKIGDRINTME  382

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L   A+LF C CYD  +GK ++++YLF+Q+I +FI G GY+GT +P+
Sbjct  383  LGFSAFLFFCACYDFLYGKYYFYVYLFLQTITYFIVGIGYVGTIVPS  429



>gb|EPS65139.1| hypothetical protein M569_09640, partial [Genlisea aurea]
Length=155

 Score =   232 bits (592),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 128/158 (81%), Gaps = 3/158 (2%)
 Frame = +2

Query  26   FMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILFENVMSLHR  205
            F FYC++LPATVLVPEVQVPKW A+YIPS+IT+LN V TPRSLHLL+FWILFENVMSLHR
Sbjct  1    FFFYCIVLPATVLVPEVQVPKWAAIYIPSIITILNGVATPRSLHLLIFWILFENVMSLHR  60

Query  206  TKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLELATGAYLF  385
            +KAT IGLLE GRVNEWIVT+KLGDA K K    A  +  RFR   R+H+LE+ TG YL 
Sbjct  61   SKATLIGLLEGGRVNEWIVTKKLGDALKSKSNPIAFKRTSRFR---RLHLLEITTGGYLM  117

Query  386  ICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLP  499
            +CGCYDV  G N YF+YLF Q+ AFFI G G++GTF+P
Sbjct  118  LCGCYDVVSGNNRYFIYLFAQAAAFFIVGSGHVGTFIP  155



>gb|KDP34366.1| hypothetical protein JCGZ_11249 [Jatropha curcas]
Length=538

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 139/172 (81%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LP T+LVPEV+VP WGAVYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHMVTFWFYCVVLPLTILVPEVKVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKP----RFRIGDRV  349
            ENVMSLHRTKAT IGLLEAGR NEW+VTEKLG+  +     +    KP    RF+ GDR+
Sbjct  427  ENVMSLHRTKATLIGLLEAGRANEWVVTEKLGNTLQKNAEAKKNNLKPPRKLRFKFGDRL  486

Query  350  HVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            + LEL   A+LF+CGCYD   GKN+YF+YLF+Q+I FFI G GY+GT +P+S
Sbjct  487  NTLELGFAAFLFLCGCYDFVNGKNNYFVYLFLQTITFFITGIGYVGTIIPSS  538



>gb|KEH42113.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=523

 Score =   243 bits (619),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 136/168 (81%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++ HI TF+FYCVLLPATV+VPE+ VPKWG VY+PS+ITLL AVGTPRS +L++FW+LF
Sbjct  357  KIVVHIHTFVFYCVLLPATVMVPEIVVPKWGTVYVPSIITLLKAVGTPRSFYLVIFWVLF  416

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            EN ++LHRTKAT IGLLE  RVNEWIVTEKLGDA K K   +   KKPR +I DR+H+ E
Sbjct  417  ENTIALHRTKATIIGLLETSRVNEWIVTEKLGDALKSKVGGKG-IKKPRLKIADRIHMKE  475

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G YL  CGCYD  +GKN++F++L+MQ+ AF I  FGY+GTF+PNS
Sbjct  476  LCVGFYLLFCGCYDFMYGKNYFFIFLYMQATAFLIVAFGYVGTFVPNS  523



>ref|XP_009364844.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Pyrus 
x bretschneideri]
Length=549

 Score =   243 bits (621),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 142/184 (77%), Gaps = 17/184 (9%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LP T+LVPEV VP WGAVYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHMVTFFFYCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKL----------------KPALRAT  313
            ENVMSLHRTKAT IGLLE  R NEW+VTEKLGD  K                 KPA +  
Sbjct  427  ENVMSLHRTKATLIGLLETARSNEWVVTEKLGDIVKNKAAEAAKNKAADANKTKPASK-L  485

Query  314  FKKPRFRIGDRVHVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTF  493
            FK+PRF+ G+R+H+LEL  G +LFICGCYD   GKN+YF+YLF+Q+I F I GFGY+GT 
Sbjct  486  FKRPRFKFGNRLHLLELGFGVFLFICGCYDFVHGKNNYFVYLFLQTITFLICGFGYVGTI  545

Query  494  LPNS  505
            +P+S
Sbjct  546  IPSS  549



>ref|XP_004137864.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 ref|XP_004170538.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 gb|KGN59050.1| hypothetical protein Csa_3G748790 [Cucumis sativus]
Length=532

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 138/167 (83%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAHI  F+F+C+ LPATV+VPEV++P WG VYIP+  T++NA+GTP+S HL +FWI+F
Sbjct  367  KIIAHINNFLFFCIALPATVVVPEVEIPTWGGVYIPTATTIINAIGTPKSFHLTIFWIMF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHR KAT IGLLE  R NEW+VTEKLGD  K K A +AT KKP FRIGDR+H+ E
Sbjct  427  ENVMSLHRAKATIIGLLEGSRANEWVVTEKLGDILKGKTASKAT-KKPIFRIGDRIHITE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L  GAYLF CGCY++ +G+N++F++L +Q+I+FFI GFGYIGT +P+
Sbjct  486  LGVGAYLFFCGCYNMLYGENYFFVFLLVQAISFFIVGFGYIGTIVPS  532



>ref|XP_010525611.1| PREDICTED: probable mannan synthase 3 isoform X3 [Tarenaya hassleriana]
Length=396

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 136/166 (82%), Gaps = 1/166 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++ HI TF+FYC++LP +V   E+++PKW +VYIP+ ITLLNAV TPRSLHLLVFWILF
Sbjct  231  KIVVHIFTFVFYCLILPTSVFFSEIEIPKWASVYIPTTITLLNAVATPRSLHLLVFWILF  290

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS+HRTKAT IGLL+AGRVNEW+VTEKLGD  K+K   +   K+ R   G+R+H  E
Sbjct  291  ENVMSMHRTKATLIGLLDAGRVNEWVVTEKLGDTLKMKLISKVPTKR-RSEFGERIHWRE  349

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLP  499
            L  G Y+F+CGCYD AFGK  +++YLF+QS+AFF+AGFGY+GTF+P
Sbjct  350  LVAGLYIFLCGCYDFAFGKTFFYVYLFLQSVAFFVAGFGYVGTFVP  395



>ref|XP_002269677.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Vitis vinifera]
Length=533

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AH+VTF  YCV+LP T+L+PEV++P WG VYIPS+IT LNAVGTPRS+HLL +WILF
Sbjct  367  KIVAHMVTFCLYCVVLPLTILIPEVEIPIWGIVYIPSIITTLNAVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS HRTKAT IGLLEAGR NEW+VTEKLGD  K K   +A  K+PRF+IGDR++ +E
Sbjct  427  ENVMSFHRTKATLIGLLEAGRANEWVVTEKLGDTLKNKANTKAAAKRPRFKIGDRINTME  486

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L   A+LF C CYD  +GK ++++YLF+Q+I +FI G GY+GT +P+
Sbjct  487  LGFSAFLFFCACYDFLYGKYYFYVYLFLQTITYFIVGIGYVGTIVPS  533



>emb|CAN82595.1| hypothetical protein VITISV_013708 [Vitis vinifera]
Length=534

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AH+VTF  YCV+LP T+L+PEV++P WG VYIPS+IT LNAVGTPRS+HLL +WILF
Sbjct  368  KIVAHMVTFCLYCVVLPLTILIPEVEIPIWGIVYIPSIITTLNAVGTPRSIHLLFYWILF  427

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS HRTKAT IGLLEAGR NEW+VTEKLGD  K K   +A  K+PRF+IGDR++ +E
Sbjct  428  ENVMSFHRTKATLIGLLEAGRANEWVVTEKLGDTLKNKANTKAAAKRPRFKIGDRINTME  487

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L   A+LF C CYD  +GK ++++YLF+Q+I +FI G GY+GT +P+
Sbjct  488  LGFSAFLFFCACYDFLYGKYYFYVYLFLQTITYFIVGIGYVGTIVPS  534



>ref|XP_006384673.1| glycosyl transferase family 2 family protein [Populus trichocarpa]
 gb|ERP62470.1| glycosyl transferase family 2 family protein [Populus trichocarpa]
Length=540

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 140/172 (81%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LP T+LVPEV+VP WGAVYIPSVIT+LN+VGTPRS+HLL +WILF
Sbjct  369  KIIAHMVTFCFYCVVLPLTILVPEVKVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILF  428

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAC-KLKPALRATFKKP---RFRIGDRV  349
            ENVMSLHRTKA  IGLLEAGRVNEW+VTEKLG+   K   A +A  K P   RF+  DR+
Sbjct  429  ENVMSLHRTKAALIGLLEAGRVNEWVVTEKLGNTLQKAADARKANTKAPRKFRFKFTDRI  488

Query  350  HVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            + LEL   A+LF+CGCYD   GKN+YF+YL++Q++ FFI G GY+GT +P+S
Sbjct  489  NTLELGFAAFLFLCGCYDFVNGKNNYFIYLWLQTVTFFITGIGYVGTIIPSS  540



>ref|XP_008442792.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
melo]
Length=532

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 138/167 (83%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAHI  F+F+C+ LPATV+VPEV +P+WG VYIP+  T++NA+GTP+S HL +FWI+F
Sbjct  367  KIIAHINNFLFFCIALPATVVVPEVAIPRWGGVYIPTATTIINAIGTPKSFHLTIFWIMF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHR KAT IGLLE  R NEW+VTEKLGD  K K A +AT KKP FRIG+R+H+ E
Sbjct  427  ENVMSLHRAKATLIGLLEGSRANEWVVTEKLGDILKGKTASKAT-KKPMFRIGERIHITE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L  GAYLF CGCY++ +G+N++F++L +Q+I+FFI GFGY+GT +P+
Sbjct  486  LGVGAYLFFCGCYNMLYGENYFFVFLLVQAISFFIVGFGYVGTIVPS  532



>ref|XP_011005673.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Populus 
euphratica]
Length=540

 Score =   241 bits (615),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 141/172 (82%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LP T+LVPEV+VP WGAVYIPSVIT+LN+VGTPRS+HLL +WILF
Sbjct  369  KIIAHMVTFCFYCVVLPLTILVPEVKVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILF  428

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAC-KLKPALRATFKKP---RFRIGDRV  349
            ENVMSLHRTKAT IGLLEAGRVNEW+VTEKLG+   K   A +A  K P   RF+  DR+
Sbjct  429  ENVMSLHRTKATLIGLLEAGRVNEWVVTEKLGNTVQKAADARKANTKAPRKFRFKFTDRL  488

Query  350  HVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            + LEL   A+LF+CGC+D   GKN+YF+YL++Q++ FFI G GY+GT +P+S
Sbjct  489  NTLELGFAAFLFLCGCFDFVNGKNNYFIYLWLQTVTFFITGIGYVGTIIPSS  540



>ref|XP_004143299.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 gb|KGN48230.1| hypothetical protein Csa_6G450350 [Cucumis sativus]
Length=537

 Score =   240 bits (613),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 138/169 (82%), Gaps = 2/169 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KV+AHI TF+FYC++LPATVLV +V+VPKWG VYIP++ITLLN+VGTPRS HLLV+WILF
Sbjct  369  KVVAHINTFIFYCLVLPATVLVQDVEVPKWGYVYIPAIITLLNSVGTPRSFHLLVYWILF  428

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRAT--FKKPRFRIGDRVHV  355
            ENVM++HRTK T IGLLEA RVNEWIVTEKLGDA K K     T     PR RIG+RV +
Sbjct  429  ENVMAMHRTKGTIIGLLEASRVNEWIVTEKLGDASKPKSTDLRTPLIATPRLRIGERVLM  488

Query  356  LELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
             EL  G YL +CG YD+ FGKN ++++LF+Q+I FFI GFGY+GT++P+
Sbjct  489  WELGVGMYLLLCGVYDIFFGKNQFYIFLFLQAITFFIVGFGYVGTYVPS  537



>ref|XP_004170553.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
Length=537

 Score =   240 bits (613),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 138/169 (82%), Gaps = 2/169 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KV+AHI TF+FYC++LPATVLV +V+VPKWG VYIP++ITLLN+VGTPRS HLLV+WILF
Sbjct  369  KVVAHINTFIFYCLVLPATVLVQDVEVPKWGYVYIPAIITLLNSVGTPRSFHLLVYWILF  428

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRAT--FKKPRFRIGDRVHV  355
            ENVM++HRTK T IGLLEA RVNEWIVTEKLGDA K K     T     PR RIG+RV +
Sbjct  429  ENVMAMHRTKGTIIGLLEASRVNEWIVTEKLGDASKPKSTDLRTPLIATPRLRIGERVLM  488

Query  356  LELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
             EL  G YL +CG YD+ FGKN ++++LF+Q+I FFI GFGY+GT++P+
Sbjct  489  WELGVGMYLLLCGVYDIFFGKNQFYIFLFLQAITFFIVGFGYVGTYVPS  537



>ref|XP_011044347.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Populus 
euphratica]
Length=537

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 139/169 (82%), Gaps = 4/169 (2%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LP T+LVPEV+VP WGAVYIPSVIT+LN+VGTPRS+HLL +WILF
Sbjct  369  KIIAHMVTFSFYCVVLPLTILVPEVKVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILF  428

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAC-KLKPALRATFKKP---RFRIGDRV  349
            ENVMSLHRTKATFIGLLEAGR NEW+VTEKLG+   K   A ++  K P   RF+  DR+
Sbjct  429  ENVMSLHRTKATFIGLLEAGRANEWVVTEKLGNTLQKAAEAKKSNLKAPRKFRFKFTDRL  488

Query  350  HVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFL  496
            + LEL   A+LF+CGCYD A GKN+YF+YL++Q++ FFI G GY+GT +
Sbjct  489  NTLELGFSAFLFLCGCYDFANGKNNYFIYLWLQTVTFFITGIGYVGTII  537



>gb|AFZ78579.1| cellulose synthase-like protein [Populus tomentosa]
Length=540

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 140/172 (81%), Gaps = 4/172 (2%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LP T+LVPEV+VP WGAVYIPSVIT+LN+VGTPRS+HLL +WILF
Sbjct  369  KIIAHMVTFCFYCVVLPLTILVPEVKVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILF  428

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAC-KLKPALRATFKKP---RFRIGDRV  349
            ENVMSLHRTKAT IGLLEAGRVNEW+VTEKLG+   K   A +A  K P   RF+  +R+
Sbjct  429  ENVMSLHRTKATLIGLLEAGRVNEWVVTEKLGNTLQKAADARKANTKAPRKFRFKFTERL  488

Query  350  HVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            + LEL   A+LF+CGCYD   GKN+YF+YL++Q++ FFI G GY+GT  P+S
Sbjct  489  NTLELGFAAFLFLCGCYDFVNGKNNYFIYLWLQTVTFFITGIGYVGTIFPSS  540



>ref|XP_010683891.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Beta vulgaris 
subsp. vulgaris]
Length=533

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KVIAH+VTF FYC++LPATVL PEV VPKWGAVYIPS+ITLLNAVGTPRSLHLLVFWILF
Sbjct  367  KVIAHVVTFAFYCIVLPATVLAPEVVVPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGL+E  RVNEW+VTEKLGDA K K A + + KKPRFR G+R+H+LE
Sbjct  427  ENVMSLHRTKATLIGLMEGVRVNEWVVTEKLGDALKFKSAAKGS-KKPRFRFGERLHILE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  GAYL  CG Y++ FGKNH+F+YLF Q+ AFF+AGFG++GTF+P S
Sbjct  486  LGVGAYLLFCGWYNLLFGKNHFFIYLFFQAFAFFVAGFGFVGTFVPGS  533



>ref|XP_010525610.1| PREDICTED: probable mannan synthase 3 isoform X2 [Tarenaya hassleriana]
Length=532

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 136/166 (82%), Gaps = 1/166 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++ HI TF+FYC++LP +V   E+++PKW +VYIP+ ITLLNAV TPRSLHLLVFWILF
Sbjct  367  KIVVHIFTFVFYCLILPTSVFFSEIEIPKWASVYIPTTITLLNAVATPRSLHLLVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS+HRTKAT IGLL+AGRVNEW+VTEKLGD  K+K   +   K+ R   G+R+H  E
Sbjct  427  ENVMSMHRTKATLIGLLDAGRVNEWVVTEKLGDTLKMKLISKVPTKR-RSEFGERIHWRE  485

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLP  499
            L  G Y+F+CGCYD AFGK  +++YLF+QS+AFF+AGFGY+GTF+P
Sbjct  486  LVAGLYIFLCGCYDFAFGKTFFYVYLFLQSVAFFVAGFGYVGTFVP  531



>ref|XP_002527445.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
 gb|EEF34937.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
Length=535

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 137/169 (81%), Gaps = 4/169 (2%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LP T+LVPEV+VP WGAVYIPSVIT+LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHMVTFWFYCVVLPLTILVPEVKVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACK----LKPALRATFKKPRFRIGDRV  349
            ENVMSLHRTKAT IGLLEAGR NEW+VT+K+G+  +     K A    FK+PRF   DR+
Sbjct  427  ENVMSLHRTKATLIGLLEAGRANEWVVTQKIGNTLQKNADAKKAGLKVFKRPRFTFTDRL  486

Query  350  HVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFL  496
            + LEL   A+LF+CGCYD   GKN+YF+YLF+Q+I FFI G GY+GT +
Sbjct  487  NTLELGFAAFLFLCGCYDFVHGKNNYFVYLFLQTITFFITGVGYVGTII  535



>ref|XP_010525608.1| PREDICTED: probable mannan synthase 3 isoform X1 [Tarenaya hassleriana]
 ref|XP_010525609.1| PREDICTED: probable mannan synthase 3 isoform X1 [Tarenaya hassleriana]
Length=546

 Score =   239 bits (610),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 136/166 (82%), Gaps = 1/166 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++ HI TF+FYC++LP +V   E+++PKW +VYIP+ ITLLNAV TPRSLHLLVFWILF
Sbjct  381  KIVVHIFTFVFYCLILPTSVFFSEIEIPKWASVYIPTTITLLNAVATPRSLHLLVFWILF  440

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS+HRTKAT IGLL+AGRVNEW+VTEKLGD  K+K   +   K+ R   G+R+H  E
Sbjct  441  ENVMSMHRTKATLIGLLDAGRVNEWVVTEKLGDTLKMKLISKVPTKR-RSEFGERIHWRE  499

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLP  499
            L  G Y+F+CGCYD AFGK  +++YLF+QS+AFF+AGFGY+GTF+P
Sbjct  500  LVAGLYIFLCGCYDFAFGKTFFYVYLFLQSVAFFVAGFGYVGTFVP  545



>ref|XP_006430317.1| hypothetical protein CICLE_v10011455mg [Citrus clementina]
 gb|ESR43557.1| hypothetical protein CICLE_v10011455mg [Citrus clementina]
Length=533

 Score =   239 bits (609),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 139/173 (80%), Gaps = 11/173 (6%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAHI+TF+ YCV+LPATV++PEVQVPKW AVYIP+VIT+LNAVGTPRS+HLLVFWILF
Sbjct  367  KIIAHIITFVLYCVVLPATVVIPEVQVPKWAAVYIPTVITILNAVGTPRSIHLLVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTE-----KLGDACKLKPALRATFKKPRFRIGDR  346
            ENVMSLHRT ATFIGLLE  RVNEWIVTE         A    P LR      RF  GDR
Sbjct  427  ENVMSLHRTMATFIGLLEGVRVNEWIVTEKLGGALKAKAAAKAPRLR------RFFFGDR  480

Query  347  VHVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            +++LEL  GA+LF CGCYDV FG NHYF+YLF+Q++AFF+ GFGY+G ++P++
Sbjct  481  IYLLELGVGAFLFSCGCYDVLFGNNHYFIYLFVQALAFFVMGFGYVGIYVPHT  533



>ref|XP_006481909.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Citrus 
sinensis]
Length=533

 Score =   238 bits (608),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 139/173 (80%), Gaps = 11/173 (6%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAHI+TF+ YCV+LPATV++PEVQVPKW AVYIP+VIT+LNAVGTPRS+HLLVFWILF
Sbjct  367  KIIAHIITFVLYCVVLPATVVIPEVQVPKWAAVYIPTVITMLNAVGTPRSIHLLVFWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTE-----KLGDACKLKPALRATFKKPRFRIGDR  346
            ENVMSLHRT ATFIGLLE  RVNEWIVTE         A    P +R      RF  GDR
Sbjct  427  ENVMSLHRTMATFIGLLEGVRVNEWIVTEKLGGALKAKAAAKAPRIR------RFFFGDR  480

Query  347  VHVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            +++LEL  GA+LF CGCYDV FG NHYF+YLF+Q++AFF+ GFGY+G ++P++
Sbjct  481  IYLLELGVGAFLFSCGCYDVLFGNNHYFIYLFVQALAFFVMGFGYVGIYVPHT  533



>ref|XP_010031452.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Eucalyptus 
grandis]
 gb|KCW50751.1| hypothetical protein EUGRSUZ_J00420 [Eucalyptus grandis]
Length=527

 Score =   238 bits (607),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 135/164 (82%), Gaps = 6/164 (4%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LP T+ VPEV VP WGAVYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHMVTFFFYCVVLPLTIWVPEVHVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKP-ALRATFKKPRFRIGDRVHVL  358
            ENVMS+HRTKATFIGLLEAGR NEW+VTEKLGD  K K   LR TF        DR+H+L
Sbjct  427  ENVMSMHRTKATFIGLLEAGRANEWVVTEKLGDTLKNKSKKLRFTFN-----FADRLHLL  481

Query  359  ELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGT  490
            EL  G +LF+ GCYD  +GKN+YF+YL++Q+I FFIAGFGYIGT
Sbjct  482  ELGFGVFLFVTGCYDFLYGKNNYFVYLWLQTITFFIAGFGYIGT  525



>ref|XP_010521855.1| PREDICTED: probable mannan synthase 3 [Tarenaya hassleriana]
Length=564

 Score =   238 bits (608),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 134/167 (80%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+I H  TF FYCV+LP +VL PE++VPKW  VY+P+ ITLLNA  TPRSLHLLV WILF
Sbjct  398  KIIVHTFTFFFYCVILPTSVLFPEIEVPKWATVYVPATITLLNAAATPRSLHLLVCWILF  457

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVM++HRTKATFIGL +AGRVNEW+VTEKLGD  K K    A+  K R R G+R++  E
Sbjct  458  ENVMAMHRTKATFIGLFDAGRVNEWVVTEKLGDTLKAKLICDASPTKRRSRFGERMNWRE  517

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L  G Y+F+CGCYDVAFGK ++++YLF+QSIAFF+AG GY+GT +P+
Sbjct  518  LVAGLYIFLCGCYDVAFGKTYFYVYLFLQSIAFFVAGVGYVGTIVPS  564



>ref|XP_009115523.1| PREDICTED: probable mannan synthase 3 [Brassica rapa]
 ref|XP_009115524.1| PREDICTED: probable mannan synthase 3 [Brassica rapa]
Length=555

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 136/166 (82%), Gaps = 1/166 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++ HI TF+FYC++LPATVL PE+QVPKW  VY+PS ITLLNA+ TPRSLHLLVFWILF
Sbjct  389  KIVVHIFTFVFYCLILPATVLFPELQVPKWATVYVPSTITLLNALATPRSLHLLVFWILF  448

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS+HRTKATFIGLLEAGRVNEW+VTEKLGD  K K   +AT  K   R G R++  E
Sbjct  449  ENVMSMHRTKATFIGLLEAGRVNEWVVTEKLGDTLKSKLITKAT-TKLYTRFGQRINWRE  507

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLP  499
            L  G Y+FICGCYD A+G +++++YLF+Q+ AFF+AG GYIGT +P
Sbjct  508  LVVGLYIFICGCYDFAYGGSYFYVYLFLQACAFFVAGVGYIGTIVP  553



>emb|CDY44151.1| BnaA09g31010D [Brassica napus]
Length=555

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 136/166 (82%), Gaps = 1/166 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++ HI TF+FYC++LPATVL PE+QVPKW  VY+PS ITLLNA+ TPRSLHLLVFWILF
Sbjct  389  KIVVHIFTFVFYCLILPATVLFPELQVPKWATVYVPSTITLLNALATPRSLHLLVFWILF  448

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS+HRTKATFIGLLEAGRVNEW+VTEKLGD  K K   +AT  K   R G R++  E
Sbjct  449  ENVMSMHRTKATFIGLLEAGRVNEWVVTEKLGDTLKSKLIAKAT-TKLYTRFGQRINWRE  507

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLP  499
            L  G Y+FICGCYD A+G +++++YLF+Q+ AFF+AG GYIGT +P
Sbjct  508  LVVGLYIFICGCYDFAYGGSYFYVYLFLQACAFFVAGVGYIGTIVP  553



>gb|KEH42109.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=522

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 137/168 (82%), Gaps = 2/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++ HI TF+ YC++LPATV+VPE+ VPKWG VYIP++ITLLNAV  PRSLHL+VFWILF
Sbjct  357  KIVVHINTFVLYCIVLPATVMVPEIVVPKWGTVYIPTIITLLNAVAAPRSLHLVVFWILF  416

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            EN MSL+R KAT IG+LE  RVNEWIVTEKLG+A  LK       +K +F+IG+R+H+ E
Sbjct  417  ENTMSLNRAKATIIGILETSRVNEWIVTEKLGNA--LKDQDSKGLEKLQFKIGNRIHMSE  474

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G YL  CGCYD+ +GKN+Y+++L+MQ+IAFF+  FGY+GTF+PNS
Sbjct  475  LFVGFYLLFCGCYDLMYGKNYYYIFLYMQAIAFFLLAFGYVGTFVPNS  522



>ref|XP_010498857.1| PREDICTED: probable mannan synthase 3 [Camelina sativa]
 ref|XP_010498858.1| PREDICTED: probable mannan synthase 3 [Camelina sativa]
Length=555

 Score =   237 bits (605),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 136/166 (82%), Gaps = 1/166 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++ HI TF+FYC++LP TVL PE+QVPKW  VY P+ ITLLNA+ TPRS HLLVFWILF
Sbjct  389  KIVVHIFTFVFYCLILPTTVLFPELQVPKWATVYFPTTITLLNAIATPRSFHLLVFWILF  448

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS+HRTKATFIGLLEAGRVNEW+VTEKLGD  K K   +AT  K   R G R++  E
Sbjct  449  ENVMSMHRTKATFIGLLEAGRVNEWVVTEKLGDTLKSKLITKAT-TKLYTRFGQRLNWRE  507

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLP  499
            L  G Y+F+CGCYDVA+G++++++YLF+QS AFF+AG G+IGTF+P
Sbjct  508  LVVGLYIFLCGCYDVAYGRSYFYVYLFLQSCAFFVAGVGFIGTFVP  553



>emb|CDY04707.1| BnaC05g18820D [Brassica napus]
Length=555

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 136/166 (82%), Gaps = 1/166 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++ HI TF+FYC++LPATV+ PE+QVPKW  VY+PS ITLLNA+ TPRSLHLLVFWILF
Sbjct  389  KIVVHIFTFVFYCLILPATVMFPELQVPKWATVYVPSTITLLNALATPRSLHLLVFWILF  448

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS+HRTKATFIGLLEAGRVNEW+VTEKLGD  K K   +AT  K   R G R++  E
Sbjct  449  ENVMSMHRTKATFIGLLEAGRVNEWVVTEKLGDTLKSKLIAKAT-TKLYTRFGQRINWRE  507

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLP  499
            L  G Y+FICGCYD A+G +++++YLF+Q+ AFF+AG GYIGT +P
Sbjct  508  LVVGLYIFICGCYDFAYGGSYFYVYLFLQACAFFVAGVGYIGTIVP  553



>ref|XP_010477641.1| PREDICTED: probable mannan synthase 3 [Camelina sativa]
 ref|XP_010477642.1| PREDICTED: probable mannan synthase 3 [Camelina sativa]
Length=556

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 136/166 (82%), Gaps = 1/166 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++ HI TF+FYC++LP +VL PE+QVPKW  VY P+ ITLLNA+ TPRS HLLVFWILF
Sbjct  390  KIVVHIFTFVFYCLILPTSVLFPELQVPKWATVYFPTTITLLNAIATPRSFHLLVFWILF  449

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS+HRTKATFIGLLEAGRVNEW+VTEKLGD  K K   +AT  K   R G R++  E
Sbjct  450  ENVMSMHRTKATFIGLLEAGRVNEWVVTEKLGDTLKSKLITKAT-TKLYTRFGQRINWRE  508

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLP  499
            L  G Y+F+CGCYDVA+G++++++YLF+QS AFF+AG G+IGTF+P
Sbjct  509  LVVGLYIFLCGCYDVAYGRSYFYVYLFLQSCAFFVAGVGFIGTFVP  554



>gb|KEH42110.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=523

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 136/168 (81%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++ H+ TF+FYC+LLPATV+VPEV VPKWG VY+PS+ITLL AVGTPRS +L++FW+LF
Sbjct  357  KIVVHVHTFVFYCILLPATVMVPEVVVPKWGTVYVPSIITLLKAVGTPRSFYLVIFWVLF  416

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            EN ++LHRTKAT IGLLE  RVNEWIVTEKLGDA K K   +   KK RF+I DR+H+ E
Sbjct  417  ENTIALHRTKATIIGLLETSRVNEWIVTEKLGDALKGKDGGKE-LKKLRFKIVDRIHLSE  475

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L  G YL  CGCYD+  GKN +F++L++Q+IAFFI  FGY+GTF+ NS
Sbjct  476  LFVGFYLLFCGCYDLMHGKNQFFIFLYIQAIAFFILAFGYVGTFVSNS  523



>ref|XP_004497598.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cicer 
arietinum]
Length=523

 Score =   236 bits (601),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 144/170 (85%), Gaps = 5/170 (3%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHI TF+FYC++LPATV+VPEV VPKWGAVYIPS+ITLLNAVGTPRSLHLL+FWILF
Sbjct  357  KIVAHINTFVFYCIVLPATVVVPEVVVPKWGAVYIPSIITLLNAVGTPRSLHLLLFWILF  416

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDA--CKLKPALRATFKKPRFRIGDRVHV  355
            EN MSLHRTKAT IGLLEA RVNEW+VTEKLGDA   K+      TF   RFRI DR+H+
Sbjct  417  ENTMSLHRTKATIIGLLEASRVNEWVVTEKLGDALKGKVGGKGLKTF---RFRIVDRIHM  473

Query  356  LELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            LEL  G YL  CGCYD+ +GKNH+F++L++Q++AFFI  FGY+GTF+PNS
Sbjct  474  LELLVGFYLLFCGCYDLMYGKNHFFIFLYIQALAFFIMAFGYVGTFIPNS  523



>gb|EEE56486.1| hypothetical protein OsJ_05716 [Oryza sativa Japonica Group]
Length=485

 Score =   235 bits (599),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAHIVTF FYC+++PAT+ VPEV++PKWG VYIP++ITLLN+VGTPRS HLL FWILF
Sbjct  318  KIIAHIVTFAFYCLIIPATIFVPEVRIPKWGCVYIPTIITLLNSVGTPRSFHLLFFWILF  377

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGLLEAGR NEW+VTEKLG+A K+K + +++ KK   R+ DR++V E
Sbjct  378  ENVMSLHRTKATLIGLLEAGRANEWVVTEKLGNALKMKSSSKSSAKKSFMRVWDRLNVTE  437

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L   A+LF CG YD+AFGK+H+F+YLF Q  AFFI G GY+GT +P S
Sbjct  438  LGVAAFLFSCGWYDLAFGKDHFFIYLFFQGAAFFIVGIGYVGTIVPQS  485



>gb|EAY84833.1| hypothetical protein OsI_06199 [Oryza sativa Indica Group]
Length=517

 Score =   235 bits (599),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAHIVTF FYC+++PAT+ VPEV++PKWG VYIP++ITLLN+VGTPRS HLL FWILF
Sbjct  350  KIIAHIVTFTFYCLIIPATIFVPEVRIPKWGCVYIPTIITLLNSVGTPRSFHLLFFWILF  409

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGLLEAGR NEW+VTEKLG+A K+K + +++ KK   R+ DR++V E
Sbjct  410  ENVMSLHRTKATLIGLLEAGRANEWVVTEKLGNALKMKSSSKSSAKKSFMRVWDRLNVTE  469

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L   A+LF CG YD+AFGK+H+F+YLF Q  AFFI G GY+GT +P S
Sbjct  470  LGVAAFLFSCGWYDLAFGKDHFFIYLFFQGAAFFIVGIGYVGTIVPQS  517



>ref|NP_001046164.1| Os02g0192500 [Oryza sativa Japonica Group]
 sp|Q7PC76.1|CSLA1_ORYSJ RecName: Full=Glucomannan 4-beta-mannosyltransferase 1; AltName: 
Full=Cellulose synthase-like protein A1; AltName: Full=Glucomannan-synthase 
1; Short=Mannan synthase 1; AltName: Full=OsCslA1; 
AltName: Full=OsCslA9 [Oryza sativa Japonica Group]
 tpg|DAA01743.1| TPA_exp: cellulose synthase-like A1 [Oryza sativa (japonica cultivar-group)]
 dbj|BAD15390.1| putative cellulose synthase-like protein OsCslA9 [Oryza sativa 
Japonica Group]
 dbj|BAD34025.1| putative cellulose synthase-like protein OsCslA9 [Oryza sativa 
Japonica Group]
 dbj|BAF08078.1| Os02g0192500 [Oryza sativa Japonica Group]
 dbj|BAG95675.1| unnamed protein product [Oryza sativa Japonica Group]
Length=521

 Score =   235 bits (599),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAHIVTF FYC+++PAT+ VPEV++PKWG VYIP++ITLLN+VGTPRS HLL FWILF
Sbjct  354  KIIAHIVTFAFYCLIIPATIFVPEVRIPKWGCVYIPTIITLLNSVGTPRSFHLLFFWILF  413

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGLLEAGR NEW+VTEKLG+A K+K + +++ KK   R+ DR++V E
Sbjct  414  ENVMSLHRTKATLIGLLEAGRANEWVVTEKLGNALKMKSSSKSSAKKSFMRVWDRLNVTE  473

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L   A+LF CG YD+AFGK+H+F+YLF Q  AFFI G GY+GT +P S
Sbjct  474  LGVAAFLFSCGWYDLAFGKDHFFIYLFFQGAAFFIVGIGYVGTIVPQS  521



>ref|XP_009126562.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Brassica 
rapa]
Length=534

 Score =   235 bits (599),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 138/168 (82%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KVIAH VTF FYCV+LP T+LVPEV+VP WG+VYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  367  KVIAHWVTFCFYCVVLPLTILVPEVKVPIWGSVYIPSIITVLNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPR-FRIGDRVHVL  358
            ENVMSLHRTKAT IGL EAGR NEW+VT KLG     K   +   K PR F++ DR++ L
Sbjct  427  ENVMSLHRTKATLIGLFEAGRANEWVVTAKLGSGQGAKGNTKGLKKFPRIFKLPDRLNTL  486

Query  359  ELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            EL   A+LF+CGCYD A GKN+YF+YLF+Q+++FFI+G G+IGT++P+
Sbjct  487  ELGFAAFLFVCGCYDYAHGKNNYFIYLFLQTMSFFISGLGWIGTYVPS  534



>ref|XP_004160102.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Cucumis 
sativus]
Length=359

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 137/174 (79%), Gaps = 6/174 (3%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LP T+LVPEV VP WGAVYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  186  KIIAHMVTFFFYCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILF  245

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFK------KPRFRIGD  343
            ENVMSLHRTKAT IGLLEAGR NEW+VTEKLGDA K K A            + R + GD
Sbjct  246  ENVMSLHRTKATLIGLLEAGRANEWVVTEKLGDALKNKAAADKKAGGKIPKVRLRCKFGD  305

Query  344  RVHVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            R++ LEL   A+LF+CGCYD   GKN+YF+YLF+Q+ +F I G GY+GT +P+S
Sbjct  306  RINTLELGFAAFLFLCGCYDFVHGKNNYFIYLFLQTFSFLITGIGYVGTIIPSS  359



>ref|NP_001031084.1| putative mannan synthase 3 [Arabidopsis thaliana]
 gb|AEE30393.1| putative mannan synthase 3 [Arabidopsis thaliana]
Length=484

 Score =   233 bits (595),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 134/166 (81%), Gaps = 1/166 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++ HI TF+FYC++LP TVL PE+QVPKW  VY P+ IT+LNA+ TPRSLHLLVFWILF
Sbjct  318  KIVVHIFTFVFYCLILPTTVLFPELQVPKWATVYFPTTITILNAIATPRSLHLLVFWILF  377

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS+HRTKATFIGLLEAGRVNEW+VTEKLGD  K K   +AT  K   R G R++  E
Sbjct  378  ENVMSMHRTKATFIGLLEAGRVNEWVVTEKLGDTLKSKLIGKAT-TKLYTRFGQRLNWRE  436

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLP  499
            L  G Y+F CGCYD A+G +++++YLF+QS AFF+AG GYIGTF+P
Sbjct  437  LVVGLYIFFCGCYDFAYGGSYFYVYLFLQSCAFFVAGVGYIGTFVP  482



>ref|XP_003538146.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Glycine 
max]
Length=542

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 138/174 (79%), Gaps = 11/174 (6%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV++P T+LVPEV VP WGAVYIPSVIT+LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHMVTFFFYCVVIPLTILVPEVHVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKL-----------GDACKLKPALRATFKKPR  328
            ENVMSLHRTKATFIGLLE GR NEW+VTEKL           GDA K   A++AT KK R
Sbjct  427  ENVMSLHRTKATFIGLLEYGRANEWVVTEKLGDSVNNNKNKSGDAAKKNNAIKATPKKTR  486

Query  329  FRIGDRVHVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGT  490
             +  +R+++LEL   A+LF+CGCYD   GK++YF+YLF+Q++ F I GFGY+GT
Sbjct  487  SKFVERLNLLELGFAAFLFVCGCYDYVHGKHNYFIYLFLQTLTFSIVGFGYVGT  540



>ref|XP_002312893.1| glycosyl transferase family 2 family protein [Populus trichocarpa]
 gb|EEE86848.1| glycosyl transferase family 2 family protein [Populus trichocarpa]
Length=537

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 137/169 (81%), Gaps = 4/169 (2%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LP T+LVPEV+VP WGAVYIPSVIT+LN+VGTPRS+HLL +WILF
Sbjct  369  KIIAHMVTFSFYCVVLPLTILVPEVKVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILF  428

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAC-KLKPALRATFKKP---RFRIGDRV  349
            ENVMSLHRTKATFIGLLEAGR NEW+VTEKLG+   K   A ++  K P   RF+  DR+
Sbjct  429  ENVMSLHRTKATFIGLLEAGRANEWVVTEKLGNTLQKAAEAKKSNPKAPRKFRFKFTDRL  488

Query  350  HVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFL  496
            + LEL   A+LF+CGCYD   GKN YF+YL++Q++ FFI G GY+GT +
Sbjct  489  NTLELGFSAFLFLCGCYDFVNGKNCYFVYLWLQTVTFFITGIGYVGTII  537



>gb|KHN38673.1| Glucomannan 4-beta-mannosyltransferase 2 [Glycine soja]
Length=543

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 138/175 (79%), Gaps = 12/175 (7%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV++P T+LVPEV VP WGAVYIPSVIT+LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHMVTFFFYCVVIPLTILVPEVHVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKL------------GDACKLKPALRATFKKP  325
            ENVMSLHRTKATFIGLLE GR NEW+VTEKL            GDA K   A++AT KK 
Sbjct  427  ENVMSLHRTKATFIGLLEYGRANEWVVTEKLGDSVNNNNKNKSGDAAKKNNAIKATPKKT  486

Query  326  RFRIGDRVHVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGT  490
            R +  +R+++LEL   A+LF+CGCYD   GK++YF+YLF+Q++ F I GFGY+GT
Sbjct  487  RSKFVERLNLLELGFAAFLFVCGCYDYVHGKHNYFIYLFLQTLTFSIVGFGYVGT  541



>gb|EYU36101.1| hypothetical protein MIMGU_mgv1a0044822mg, partial [Erythranthe 
guttata]
Length=406

 Score =   230 bits (587),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 131/168 (78%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+ TF+FYCV+LP T+LVPEV VPKWGA+Y+P +ITLLN+VGTPRS HLL +W+LF
Sbjct  239  KIIAHMFTFVFYCVVLPLTILVPEVYVPKWGAIYLPCIITLLNSVGTPRSFHLLFYWVLF  298

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS HRTKAT IGLLEA RVNEW+VTEKLGD  K K    A  +     IGDRV V E
Sbjct  299  ENVMSFHRTKATIIGLLEAKRVNEWVVTEKLGDTLKNKSKSSAPRRSLSKFIGDRVLVHE  358

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L     LF+ GCYD  +GKN+YF+YLF+Q+I F IAGFGYIGT +P +
Sbjct  359  LGFAVLLFVSGCYDFLYGKNYYFVYLFLQTITFTIAGFGYIGTIVPGN  406



>ref|XP_006307154.1| hypothetical protein CARUB_v10008745mg [Capsella rubella]
 gb|EOA40052.1| hypothetical protein CARUB_v10008745mg [Capsella rubella]
Length=555

 Score =   234 bits (597),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 134/166 (81%), Gaps = 1/166 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++ HI TF+FYC++LP TVL PE+QVPKW  VY P+ IT+LNA+ TPRS HLLVFWILF
Sbjct  389  KIVVHIFTFVFYCLILPTTVLFPELQVPKWATVYFPTTITILNAIATPRSFHLLVFWILF  448

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS+HRTKATFIGLLEAGRVNEW+VTEKLGD  K K   +AT  K   R G R++  E
Sbjct  449  ENVMSMHRTKATFIGLLEAGRVNEWVVTEKLGDTLKSKLIAKAT-TKLYTRFGQRLNWRE  507

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLP  499
            L  G Y+F+CGCYD A+G +++++YLF+QS AFF+AG GYIGTF+P
Sbjct  508  LVVGLYIFLCGCYDFAYGGSYFYVYLFLQSCAFFVAGVGYIGTFVP  553



>gb|EYU36982.1| hypothetical protein MIMGU_mgv1a004240mg [Erythranthe guttata]
Length=538

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 136/169 (80%), Gaps = 2/169 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH  TF FYC++LP T+LVPEV VPKWG++YIP +IT+LN+VGTPRS HLL +W+LF
Sbjct  370  KIIAHFFTFFFYCLILPLTILVPEVYVPKWGSIYIPCIITMLNSVGTPRSFHLLFYWVLF  429

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRAT-FKKPRFR-IGDRVHV  355
            ENVMS HRTKAT IGL EA RVNEW+VTEKLGD  K K   ++  FKK  F+ +GDRV V
Sbjct  430  ENVMSFHRTKATLIGLFEAKRVNEWVVTEKLGDGVKNKSNNKSIGFKKSIFKFLGDRVSV  489

Query  356  LELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
             EL   A+LF+CGCYD  + KN+YF+YLF+Q+I F IAGFGY+GTF+P+
Sbjct  490  HELGFAAFLFVCGCYDFLYWKNNYFIYLFLQTITFTIAGFGYVGTFVPS  538



>ref|NP_850952.1| putative mannan synthase 3 [Arabidopsis thaliana]
 ref|NP_173762.4| putative mannan synthase 3 [Arabidopsis thaliana]
 sp|Q9LQC9.1|CSLA3_ARATH RecName: Full=Probable mannan synthase 3; AltName: Full=Cellulose 
synthase-like protein A3; Short=AtCslA3 [Arabidopsis thaliana]
 gb|AAF79586.1|AC007945_6 F28C11.11 [Arabidopsis thaliana]
 gb|AAM20620.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15522.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30391.1| putative mannan synthase 3 [Arabidopsis thaliana]
 gb|AEE30392.1| putative mannan synthase 3 [Arabidopsis thaliana]
 gb|AHL38929.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=556

 Score =   234 bits (596),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 134/166 (81%), Gaps = 1/166 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++ HI TF+FYC++LP TVL PE+QVPKW  VY P+ IT+LNA+ TPRSLHLLVFWILF
Sbjct  390  KIVVHIFTFVFYCLILPTTVLFPELQVPKWATVYFPTTITILNAIATPRSLHLLVFWILF  449

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS+HRTKATFIGLLEAGRVNEW+VTEKLGD  K K   +AT  K   R G R++  E
Sbjct  450  ENVMSMHRTKATFIGLLEAGRVNEWVVTEKLGDTLKSKLIGKAT-TKLYTRFGQRLNWRE  508

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLP  499
            L  G Y+F CGCYD A+G +++++YLF+QS AFF+AG GYIGTF+P
Sbjct  509  LVVGLYIFFCGCYDFAYGGSYFYVYLFLQSCAFFVAGVGYIGTFVP  554



>ref|NP_197666.1| glucomannan 4-beta-mannosyltransferase 2 [Arabidopsis thaliana]
 sp|Q9FNI7.1|CSLA2_ARATH RecName: Full=Glucomannan 4-beta-mannosyltransferase 2; AltName: 
Full=Cellulose synthase-like protein A2; Short=AtCslA2; 
AltName: Full=Glucomannan synthase; AltName: Full=Mannan synthase 
2 [Arabidopsis thaliana]
 dbj|BAB11680.1| glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAL25573.1| AT5g22740/MDJ22_16 [Arabidopsis thaliana]
 gb|AAL24334.1| glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAM13292.1| glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AED93069.1| glucomannan 4-beta-mannosyltransferase 2 [Arabidopsis thaliana]
 gb|AHL38612.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=534

 Score =   233 bits (594),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 137/168 (82%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH VTF FYCV+LP T+LVPEV+VP WG+VYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHWVTFCFYCVVLPLTILVPEVKVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPR-FRIGDRVHVL  358
            ENVMSLHRTKAT IGL EAGR NEW+VT KLG     K   +   + PR F++ DR++ L
Sbjct  427  ENVMSLHRTKATLIGLFEAGRANEWVVTAKLGSGQSAKGNTKGIKRFPRIFKLPDRLNTL  486

Query  359  ELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            EL   A+LF+CGCYD   GKN+YF+YLF+Q+++FFI+G G+IGT++P+
Sbjct  487  ELGFAAFLFVCGCYDFVHGKNNYFIYLFLQTMSFFISGLGWIGTYVPS  534



>ref|XP_011089999.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Sesamum 
indicum]
Length=536

 Score =   233 bits (594),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 133/170 (78%), Gaps = 2/170 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+ TF FYCV+LP ++LVPEV VPKWGA+YIP +IT LN+VGTPRS HLL +W+LF
Sbjct  367  KLIAHMFTFFFYCVVLPLSILVPEVDVPKWGAIYIPCIITTLNSVGTPRSFHLLFYWVLF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFR--IGDRVHV  355
            ENVMS HRTKATFIGLLEA RVNEW+VTEKLGD  K K   ++   +      +GDR+ +
Sbjct  427  ENVMSFHRTKATFIGLLEAKRVNEWVVTEKLGDTLKNKSHSKSAAPRRSLSKFLGDRIQL  486

Query  356  LELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
             EL    +LFICGCYD  +GKN+YF+YLF+Q I F IAGFGYIGT +P+S
Sbjct  487  QELGFALFLFICGCYDFLYGKNNYFIYLFLQVITFTIAGFGYIGTIVPSS  536



>ref|XP_009120642.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Brassica 
rapa]
Length=534

 Score =   233 bits (594),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 136/168 (81%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            KVIAH VTF FYCV+LP T+LVPEV+VP WG+VYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  367  KVIAHWVTFCFYCVVLPLTILVPEVKVPIWGSVYIPSIITVLNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPR-FRIGDRVHVL  358
            ENVMSLHRTKAT IGL EA R NEW+VT KLG     K       K PR F++ DR++ L
Sbjct  427  ENVMSLHRTKATLIGLFEADRANEWVVTAKLGSGQSAKGNTEGLKKFPRIFKLPDRLNTL  486

Query  359  ELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            EL   A+LF+CGCYD A GKN+YF+YLF+Q+++FFI+G G+IGT++P+
Sbjct  487  ELGFAAFLFVCGCYDYAHGKNNYFIYLFLQTMSFFISGLGWIGTYVPS  534



>ref|XP_002874083.1| hypothetical protein ARALYDRAFT_489123 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50342.1| hypothetical protein ARALYDRAFT_489123 [Arabidopsis lyrata subsp. 
lyrata]
Length=534

 Score =   233 bits (593),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 137/168 (82%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH VTF FYCV+LP T+LVPEV+VP WG+VYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHWVTFCFYCVVLPLTILVPEVKVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPR-FRIGDRVHVL  358
            ENVMSLHRTKAT IGL EAGR NEW+VT KLG     K   +   + PR F++ DR++ L
Sbjct  427  ENVMSLHRTKATLIGLFEAGRANEWVVTAKLGSGQSAKGNTKGLKRFPRIFKLPDRLNTL  486

Query  359  ELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            EL   A+LF+CGCYD   GKN+YF+YLF+Q+++FFI+G G+IGT++P+
Sbjct  487  ELGFAAFLFVCGCYDFVHGKNNYFIYLFLQTMSFFISGLGWIGTYVPS  534



>ref|XP_002890585.1| hypothetical protein ARALYDRAFT_889889 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66844.1| hypothetical protein ARALYDRAFT_889889 [Arabidopsis lyrata subsp. 
lyrata]
Length=554

 Score =   233 bits (594),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 135/167 (81%), Gaps = 3/167 (2%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++ HI TF+FYC++LP TVL PE+QVPKW  VY P+ IT+LNA+ TPRSLHLLVFWILF
Sbjct  390  KIVVHIFTFVFYCLILPTTVLFPELQVPKWATVYFPTTITILNAIATPRSLHLLVFWILF  449

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS+HRTKATFIGLLEAGRVNEW+VTEKLGD   LK  L AT  K   R G R++  E
Sbjct  450  ENVMSMHRTKATFIGLLEAGRVNEWVVTEKLGDT--LKSKLIAT-TKLYTRFGQRINWRE  506

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L  G Y+F CGCYD A+G +++++YLF+QS AFF+AG GYIGTF+P+
Sbjct  507  LVVGLYIFFCGCYDFAYGGSYFYVYLFLQSCAFFVAGVGYIGTFVPS  553



>ref|XP_006646997.1| PREDICTED: LOW QUALITY PROTEIN: glucomannan 4-beta-mannosyltransferase 
1-like [Oryza brachyantha]
Length=520

 Score =   232 bits (592),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF FYC+++PAT+ VPEV++PKWG VYIP++ITLLN+VGTPRS HLL FWILF
Sbjct  353  KIVAHIVTFTFYCLIIPATIFVPEVRIPKWGCVYIPTIITLLNSVGTPRSFHLLFFWILF  412

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGLLEAGR NEW+VT KLG+A K+K + +++FKK   RI DR++V E
Sbjct  413  ENVMSLHRTKATLIGLLEAGRANEWVVTAKLGNALKMKSSNKSSFKKSFMRIWDRLNVTE  472

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L   A+LF CG YD+AFGK+H+F+YLF Q  AFFI G GY+GT +P S
Sbjct  473  LGVAAFLFSCGWYDLAFGKDHFFIYLFFQGAAFFIVGIGYVGTIVPQS  520



>ref|XP_007015961.1| Cellulose synthase-like A02 isoform 1 [Theobroma cacao]
 gb|EOY33580.1| Cellulose synthase-like A02 isoform 1 [Theobroma cacao]
Length=537

 Score =   232 bits (592),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 136/171 (80%), Gaps = 6/171 (4%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LP T+LVPEV+VP WGAVYIPSVIT+LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHMVTFFFYCVVLPLTILVPEVKVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATF------KKPRFRIGD  343
            ENVMSLHRTKATFIGLLEAGR NEW+VTEKLGDA K               +K RF+  D
Sbjct  427  ENVMSLHRTKATFIGLLEAGRANEWVVTEKLGDAVKKAADAAKNKTNAKAPRKFRFKFTD  486

Query  344  RVHVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFL  496
            R++ LEL   A+LFICGCYD   GKN+YF+YLF+Q+I FFI G GY+GT +
Sbjct  487  RLNTLELGFAAFLFICGCYDFVHGKNNYFVYLFLQTITFFITGIGYVGTII  537



>ref|XP_003539806.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Glycine 
max]
 gb|KHN21108.1| Glucomannan 4-beta-mannosyltransferase 2 [Glycine soja]
Length=543

 Score =   232 bits (592),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 137/175 (78%), Gaps = 12/175 (7%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV++P T+LVPEV VP WGAVYIPSVIT+LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHMVTFFFYCVVIPLTILVPEVHVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKL------------GDACKLKPALRATFKKP  325
            ENVMSLHRTKATFIGLLE GR NEW+VTEKL            GDA K   A++AT KK 
Sbjct  427  ENVMSLHRTKATFIGLLEYGRANEWVVTEKLGDSVNNNNKNKSGDAAKKNNAIKATPKKT  486

Query  326  RFRIGDRVHVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGT  490
            R +  +R+++LEL    +LF+CGCYD   GK++YF+YLF+Q++ F I GFGY+GT
Sbjct  487  RSKFVERLNLLELGFAVFLFVCGCYDYVHGKHNYFIYLFLQTLTFSIVGFGYVGT  541



>ref|XP_008458630.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Cucumis 
melo]
Length=539

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 138/174 (79%), Gaps = 6/174 (3%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LP T+LVPEV VP WGAVYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  366  KIIAHMVTFFFYCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILF  425

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKK--PRFRI----GD  343
            ENVMSLHRTKAT IGLLEAGR NEW+VTEKLGDA K K A         P+ R+    GD
Sbjct  426  ENVMSLHRTKATLIGLLEAGRANEWVVTEKLGDALKNKAAADKKAGGKIPKIRLRCKFGD  485

Query  344  RVHVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            R++ LEL   A+LF+CGCYD   GKN+YF+YLF+Q+ +F I G GY+GT +P+S
Sbjct  486  RINTLELGFAAFLFLCGCYDFVHGKNNYFIYLFLQTFSFLITGIGYVGTIIPSS  539



>gb|KGN46914.1| hypothetical protein Csa_6G150530 [Cucumis sativus]
Length=525

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 137/174 (79%), Gaps = 6/174 (3%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LP T+LVPEV VP WGAVYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  352  KIIAHMVTFFFYCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILF  411

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFK------KPRFRIGD  343
            ENVMSLHRTKAT IGLLEAGR NEW+VTEKLGDA K K A            + R + GD
Sbjct  412  ENVMSLHRTKATLIGLLEAGRANEWVVTEKLGDALKNKAAADKKAGGKIPKVRLRCKFGD  471

Query  344  RVHVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            R++ LEL   A+LF+CGCYD   GKN+YF+YLF+Q+ +F I G GY+GT +P+S
Sbjct  472  RINTLELGFAAFLFLCGCYDFVHGKNNYFIYLFLQTFSFLITGIGYVGTIIPSS  525



>ref|XP_007208459.1| hypothetical protein PRUPE_ppa003918mg [Prunus persica]
 gb|EMJ09658.1| hypothetical protein PRUPE_ppa003918mg [Prunus persica]
Length=516

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 141/174 (81%), Gaps = 6/174 (3%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LP T+LVPEV VP WGAVYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  343  KIIAHMVTFFFYCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILF  402

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGD------ACKLKPALRATFKKPRFRIGD  343
            ENVMSLHRTKAT IGLLE GR NEW+VTEKLGD      A   K      FK+P+F+ G+
Sbjct  403  ENVMSLHRTKATLIGLLETGRANEWVVTEKLGDIVKNKAAEAAKKPAPKFFKRPKFKFGN  462

Query  344  RVHVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            R+H+LEL  GA+LF+CGCYD   GKN+YF+YLF+Q+I F I GFGY+GT +P+S
Sbjct  463  RLHLLELGFGAFLFVCGCYDYVHGKNNYFVYLFLQTITFLICGFGYVGTIIPSS  516



>ref|XP_004145779.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Cucumis 
sativus]
Length=539

 Score =   231 bits (589),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 137/174 (79%), Gaps = 6/174 (3%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LP T+LVPEV VP WGAVYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  366  KIIAHMVTFFFYCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILF  425

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFK------KPRFRIGD  343
            ENVMSLHRTKAT IGLLEAGR NEW+VTEKLGDA K K A            + R + GD
Sbjct  426  ENVMSLHRTKATLIGLLEAGRANEWVVTEKLGDALKNKAAADKKAGGKIPKVRLRCKFGD  485

Query  344  RVHVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            R++ LEL   A+LF+CGCYD   GKN+YF+YLF+Q+ +F I G GY+GT +P+S
Sbjct  486  RINTLELGFAAFLFLCGCYDFVHGKNNYFIYLFLQTFSFLITGIGYVGTIIPSS  539



>ref|XP_006400777.1| hypothetical protein EUTSA_v10013221mg [Eutrema salsugineum]
 gb|ESQ42230.1| hypothetical protein EUTSA_v10013221mg [Eutrema salsugineum]
Length=532

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 135/166 (81%), Gaps = 1/166 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH VTF FYCV+LP T+LVPEV+VP WG+VYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHWVTFCFYCVVLPLTILVPEVKVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPR-FRIGDRVHVL  358
            ENVMSLHRTKAT IGL EAGR NEW+VT KLG     K   +   K PR F++ DR++ L
Sbjct  427  ENVMSLHRTKATLIGLFEAGRANEWVVTAKLGSGQSAKGNTKGLKKFPRIFKLPDRLNTL  486

Query  359  ELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFL  496
            EL   A+LF+CGCYD   GKN+YF+YLF+Q+++FFI+G G+IGT++
Sbjct  487  ELGFAAFLFVCGCYDFVHGKNNYFIYLFLQTMSFFISGLGWIGTYV  532



>ref|XP_007208460.1| hypothetical protein PRUPE_ppa003918mg [Prunus persica]
 gb|EMJ09659.1| hypothetical protein PRUPE_ppa003918mg [Prunus persica]
Length=540

 Score =   231 bits (588),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 141/174 (81%), Gaps = 6/174 (3%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LP T+LVPEV VP WGAVYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHMVTFFFYCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGD------ACKLKPALRATFKKPRFRIGD  343
            ENVMSLHRTKAT IGLLE GR NEW+VTEKLGD      A   K      FK+P+F+ G+
Sbjct  427  ENVMSLHRTKATLIGLLETGRANEWVVTEKLGDIVKNKAAEAAKKPAPKFFKRPKFKFGN  486

Query  344  RVHVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            R+H+LEL  GA+LF+CGCYD   GKN+YF+YLF+Q+I F I GFGY+GT +P+S
Sbjct  487  RLHLLELGFGAFLFVCGCYDYVHGKNNYFVYLFLQTITFLICGFGYVGTIIPSS  540



>ref|XP_008227108.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Prunus mume]
Length=540

 Score =   231 bits (588),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 141/174 (81%), Gaps = 6/174 (3%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LP T+LVPEV VP WGAVYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHMVTFFFYCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGD------ACKLKPALRATFKKPRFRIGD  343
            ENVMSLHRTKAT IGLLE GR NEW+VTEKLGD      A   K      FK+P+F+ G+
Sbjct  427  ENVMSLHRTKATLIGLLETGRANEWVVTEKLGDIVKNKAAEAAKKPAPKFFKRPKFKFGN  486

Query  344  RVHVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            R+H+LEL  GA+LF+CGCYD   GKN+YF+YLF+Q+I F I GFGY+GT +P+S
Sbjct  487  RLHLLELGFGAFLFVCGCYDYVHGKNNYFVYLFLQTITFLICGFGYVGTIIPSS  540



>ref|XP_006347222.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Solanum 
tuberosum]
Length=533

 Score =   230 bits (587),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 134/168 (80%), Gaps = 2/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF F+CV+LP ++LVPEV++P WGA+YIP +IT LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHMVTFFFFCVVLPLSLLVPEVEIPTWGAIYIPCIITTLNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRI-GDRVHVL  358
            ENVM+  RTKATFIGLLEA R NEW+VTEKLGDA K K   + T KKPR  + GDR+   
Sbjct  427  ENVMAFQRTKATFIGLLEAKRANEWVVTEKLGDALKNKEKTKQT-KKPRGSLFGDRILPQ  485

Query  359  ELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            EL    +LF CGCYDV +GK+ YFLY+F+Q I F IAGFGYIGT +P+
Sbjct  486  ELGFAVFLFFCGCYDVLYGKSQYFLYIFLQVITFTIAGFGYIGTIVPS  533



>ref|XP_004241301.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Solanum 
lycopersicum]
Length=533

 Score =   230 bits (586),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 134/168 (80%), Gaps = 2/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF F+CV+LP ++LVPEV++P WGA+YIP +IT LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHMVTFFFFCVVLPLSLLVPEVEIPTWGAIYIPCIITTLNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRI-GDRVHVL  358
            ENVM+  RTKATFIGLLEA R NEW+VTEKLGDA K K   + T KKPR  + GDR+   
Sbjct  427  ENVMAFQRTKATFIGLLEAKRANEWVVTEKLGDALKNKEKTKQT-KKPRGSLFGDRILPQ  485

Query  359  ELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            EL    +LF CGCYDV +GK+ YFLY+F+Q I F IAGFGYIGT +P+
Sbjct  486  ELGFAVFLFFCGCYDVLYGKSQYFLYIFLQVITFTIAGFGYIGTIVPS  533



>ref|XP_010911245.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 1-like [Elaeis 
guineensis]
Length=294

 Score =   223 bits (568),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 129/168 (77%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            ++I+H VTF FYCV++P +V  PEV++PKWG +Y+P+ ITLLN+VGTP S HL++FW+LF
Sbjct  127  RIISHFVTFSFYCVVIPLSVFFPEVEIPKWGMIYVPTTITLLNSVGTPSSFHLIIFWVLF  186

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHR KA  IGLLEAGR NEWIVTEKLGD  K K  +  T +K RF+  DR H+LE
Sbjct  187  ENVMSLHRCKAVLIGLLEAGRANEWIVTEKLGDMLKTKSNISVT-QKIRFKFWDRFHLLE  245

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            L    +L IC CYD  + ++++F+Y+F QSI FFI GFGY+GT +P+ 
Sbjct  246  LGLAVFLMICACYDCIYRQDYFFIYIFPQSITFFIMGFGYVGTIIPSQ  293



>ref|XP_004250002.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
lycopersicum]
Length=529

 Score =   229 bits (585),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 135/165 (82%), Gaps = 1/165 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF+ YCV++PAT+ +PEVQVP+WG +YIP+ IT+LN +G+ RS+ L+V+WILF
Sbjct  364  KIIAHVVTFILYCVVIPATIFIPEVQVPRWGTIYIPTAITVLNILGSARSMQLVVYWILF  423

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKA  IGL E+ RVNEWIVTEKLGDA K K   +A  K+ +FR+G+RVHVLE
Sbjct  424  ENVMSLHRTKAMLIGLFESERVNEWIVTEKLGDALKTKKGSKA-LKRLQFRVGERVHVLE  482

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFL  496
            L  G YL  CG YD +FG+N +++YL +Q++AFF+ GFGY+G F+
Sbjct  483  LFVGLYLLFCGWYDYSFGRNKFYVYLLLQAMAFFVVGFGYVGVFV  527



>ref|XP_006416081.1| hypothetical protein EUTSA_v10007266mg [Eutrema salsugineum]
 gb|ESQ34434.1| hypothetical protein EUTSA_v10007266mg [Eutrema salsugineum]
Length=555

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 134/166 (81%), Gaps = 1/166 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++ HI TF+FYC++LP  VL PE+QVPKW  VY+P+ IT+LNA+ TPRSLHLLVFWILF
Sbjct  389  KIVVHIFTFVFYCLILPTIVLFPELQVPKWATVYVPTTITILNALATPRSLHLLVFWILF  448

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS+HRTKATFIGLLEAGRVNEW+VTEKLGD  + K   +AT  K   R G R++  E
Sbjct  449  ENVMSMHRTKATFIGLLEAGRVNEWVVTEKLGDTLRSKLIAKAT-TKLYTRFGQRINWRE  507

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLP  499
            L  G Y+F+CGCYD A+G +++++YLF+Q+ AFF+AG GYIGT +P
Sbjct  508  LVVGLYIFLCGCYDFAYGGSYFYVYLFLQACAFFVAGVGYIGTIVP  553



>ref|XP_009629011.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Nicotiana 
tomentosiformis]
Length=533

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 135/168 (80%), Gaps = 2/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF F+CV+LP ++LVPEV++P W A+YIP +IT+LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHMVTFFFFCVVLPLSLLVPEVEIPVWAAIYIPCIITILNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRI-GDRVHVL  358
            ENVM+ HRTKATFIGLLEA R NEW+VTEKLGDA K K   + T KKPR  + GDR+   
Sbjct  427  ENVMAFHRTKATFIGLLEAKRANEWVVTEKLGDALKNKDKTKQT-KKPRGSLFGDRILPQ  485

Query  359  ELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            EL    +LF CGCYDV +GK+ YFLY+F+Q + F IAGFGYIGT +P+
Sbjct  486  ELGFALFLFFCGCYDVLYGKSQYFLYIFLQVVTFTIAGFGYIGTIVPS  533



>ref|XP_009597672.1| PREDICTED: mannan synthase 1-like isoform X2 [Nicotiana tomentosiformis]
Length=527

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH VTF FYCV++PAT+LVPEV + K  A+Y+P+ IT+LNA  TPRS HLLVFWILF
Sbjct  362  KIIAHWVTFFFYCVVIPATILVPEVHLTKPLAIYLPATITILNAACTPRSFHLLVFWILF  421

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHR+KAT IGLLEA RVNEW+VTEKLG+  K K + +A+ K+PR RIG+R+HVLE
Sbjct  422  ENVMSLHRSKATIIGLLEANRVNEWVVTEKLGNMMKQKYSAKAS-KRPRSRIGERIHVLE  480

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L  G Y+  C  Y++ FG +H+F+YLF+Q+ AFFI G GY+GTF+PN
Sbjct  481  LLMGMYMLYCAIYNMLFGNDHFFIYLFLQAGAFFIVGVGYVGTFVPN  527



>ref|XP_009765562.1| PREDICTED: mannan synthase 1-like isoform X2 [Nicotiana sylvestris]
Length=527

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH VTF FYCV++PAT+LVPEV + K  A+Y+P+ IT+LNA  TPRS HLLVFWILF
Sbjct  362  KIIAHWVTFFFYCVVIPATILVPEVHLTKPLAIYLPATITILNAACTPRSFHLLVFWILF  421

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHR+KAT IGLLEA RVNEW+VTEKLG+  K K + +A+ K+PR RIG+R+HVLE
Sbjct  422  ENVMSLHRSKATIIGLLEANRVNEWVVTEKLGNMMKQKYSAKAS-KRPRSRIGERIHVLE  480

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L  G Y+  C  Y++ FG +H+F+YLF+Q+ AFFI G GY+GTF+PN
Sbjct  481  LLMGMYMLYCAIYNMLFGNDHFFIYLFLQAGAFFIVGVGYVGTFVPN  527



>ref|XP_009765561.1| PREDICTED: mannan synthase 1-like isoform X1 [Nicotiana sylvestris]
Length=556

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH VTF FYCV++PAT+LVPEV + K  A+Y+P+ IT+LNA  TPRS HLLVFWILF
Sbjct  391  KIIAHWVTFFFYCVVIPATILVPEVHLTKPLAIYLPATITILNAACTPRSFHLLVFWILF  450

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHR+KAT IGLLEA RVNEW+VTEKLG+  K K + +A+ K+PR RIG+R+HVLE
Sbjct  451  ENVMSLHRSKATIIGLLEANRVNEWVVTEKLGNMMKQKYSAKAS-KRPRSRIGERIHVLE  509

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L  G Y+  C  Y++ FG +H+F+YLF+Q+ AFFI G GY+GTF+PN
Sbjct  510  LLMGMYMLYCAIYNMLFGNDHFFIYLFLQAGAFFIVGVGYVGTFVPN  556



>ref|XP_006354365.1| PREDICTED: mannan synthase 1-like [Solanum tuberosum]
Length=527

 Score =   229 bits (583),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH VTF FYCV++PAT+LVPEV + K  A+Y+P+ IT+LNA  TPRS HLLVFWILF
Sbjct  362  KIIAHWVTFFFYCVVIPATILVPEVHLTKPLAIYLPATITILNAACTPRSFHLLVFWILF  421

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHR+KA  IGLLEA RVNEW+VTEKLG+  K K + +A+ KKPR RIG+R+HVLE
Sbjct  422  ENVMSLHRSKAAIIGLLEASRVNEWVVTEKLGNTMKQKYSAKAS-KKPRSRIGERIHVLE  480

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L  G Y+  C  Y++ FG +H+F+YLF+Q+ AFFI G GY+GTF+PN
Sbjct  481  LLMGMYMLHCAIYNMLFGNDHFFIYLFLQAGAFFIVGIGYVGTFVPN  527



>ref|XP_010690012.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Beta 
vulgaris subsp. vulgaris]
Length=537

 Score =   229 bits (583),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 134/172 (78%), Gaps = 7/172 (4%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+ AH+VTF FYCV+LP T+LVPEV+VP WG+VYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  366  KITAHMVTFFFYCVILPLTILVPEVEVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILF  425

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKP-------ALRATFKKPRFRIG  340
            ENVMSLHRTKAT IGL EAGR NEW+VTEKLGD+ K K        + +   +K R +I 
Sbjct  426  ENVMSLHRTKATLIGLFEAGRANEWVVTEKLGDSQKAKAHAKEKPGSFKTAVRKLRSKIL  485

Query  341  DRVHVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFL  496
            DR+++LEL  G +LF  GCYD  +GK  Y++Y F+QSI FFI GFGY+GT +
Sbjct  486  DRMNLLELVVGVFLFCIGCYDFMYGKWSYYVYFFLQSITFFIVGFGYVGTII  537



>ref|XP_009597671.1| PREDICTED: mannan synthase 1-like isoform X1 [Nicotiana tomentosiformis]
Length=556

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH VTF FYCV++PAT+LVPEV + K  A+Y+P+ IT+LNA  TPRS HLLVFWILF
Sbjct  391  KIIAHWVTFFFYCVVIPATILVPEVHLTKPLAIYLPATITILNAACTPRSFHLLVFWILF  450

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHR+KAT IGLLEA RVNEW+VTEKLG+  K K + +A+ K+PR RIG+R+HVLE
Sbjct  451  ENVMSLHRSKATIIGLLEANRVNEWVVTEKLGNMMKQKYSAKAS-KRPRSRIGERIHVLE  509

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L  G Y+  C  Y++ FG +H+F+YLF+Q+ AFFI G GY+GTF+PN
Sbjct  510  LLMGMYMLYCAIYNMLFGNDHFFIYLFLQAGAFFIVGVGYVGTFVPN  556



>ref|XP_010454539.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 isoform X2 
[Camelina sativa]
Length=533

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 134/166 (81%), Gaps = 1/166 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH VTF FYCV+LP T+LVPEV VP WG+VYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHWVTFCFYCVVLPLTILVPEVYVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPR-FRIGDRVHVL  358
            ENVMSLHRTKAT IGL EAGR NEW+VT KLG     K   +   + PR F++ DR++ L
Sbjct  427  ENVMSLHRTKATLIGLFEAGRANEWVVTAKLGSGQSAKGNTKGLKRFPRIFKLPDRLNTL  486

Query  359  ELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFL  496
            EL   A+LF+CGCYD   GKN+YF+YLF+Q+++FFI+G G+IGT++
Sbjct  487  ELGFAAFLFVCGCYDFVHGKNNYFIYLFLQTLSFFISGLGWIGTYV  532



>ref|XP_010421063.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Camelina 
sativa]
 ref|XP_010454538.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 isoform X1 
[Camelina sativa]
Length=533

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 134/166 (81%), Gaps = 1/166 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH VTF FYCV+LP T+LVPEV VP WG+VYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHWVTFCFYCVVLPLTILVPEVYVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPR-FRIGDRVHVL  358
            ENVMSLHRTKAT IGL EAGR NEW+VT KLG     K   +   + PR F++ DR++ L
Sbjct  427  ENVMSLHRTKATLIGLFEAGRANEWVVTAKLGSGQSAKGNTKGLKRFPRIFKLPDRLNTL  486

Query  359  ELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFL  496
            EL   A+LF+CGCYD   GKN+YF+YLF+Q+++FFI+G G+IGT++
Sbjct  487  ELGFAAFLFVCGCYDFVHGKNNYFIYLFLQTLSFFISGLGWIGTYV  532



>ref|XP_004294040.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Fragaria 
vesca subsp. vesca]
Length=540

 Score =   229 bits (583),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 137/174 (79%), Gaps = 6/174 (3%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LP T+LVPEV VP WGAVYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHMVTFFFYCVVLPLTILVPEVHVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAC------KLKPALRATFKKPRFRIGD  343
            ENVMSLHRTKAT IGL EAGR NEW+VTEKLGD                 FKKP+F+ G+
Sbjct  427  ENVMSLHRTKATLIGLFEAGRANEWVVTEKLGDTVKKAADAAKNKPAPKFFKKPKFKFGN  486

Query  344  RVHVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            R+H+LEL  G +LF CGCYD   GKN+YF+YLF+Q+I F I GFGY+GT +P+S
Sbjct  487  RLHMLELGFGLFLFFCGCYDYVHGKNNYFVYLFLQTITFLICGFGYVGTIIPSS  540



>ref|XP_010554515.1| PREDICTED: probable mannan synthase 7 isoform X2 [Tarenaya hassleriana]
Length=453

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 129/168 (77%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+++HI+TF FYC++LP TV++PEV+VPKW A Y+PS ITL  A G PRS HLL FW+LF
Sbjct  286  KILSHIITFFFYCIVLPTTVMIPEVEVPKWAAFYLPSTITLFIATGRPRSFHLLAFWVLF  345

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            EN MSL RTKA  +GLLE GRVNEW+VTEKLGD  K K    A  K+P+ R  DRVH+LE
Sbjct  346  ENTMSLLRTKALVMGLLETGRVNEWVVTEKLGDPLKTKLIAEAP-KEPQARFRDRVHLLE  404

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            +  GAYL  CGCYDVA+G N  F+YL +QS+AFF+ GFG++GT +P S
Sbjct  405  VCVGAYLLFCGCYDVAYGNNFLFVYLLLQSMAFFLVGFGFVGTLVPPS  452



>gb|EMT23763.1| hypothetical protein F775_17087 [Aegilops tauschii]
Length=819

 Score =   233 bits (595),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF FYC+++P T+ VPEV +PKWG VYIP++ITLLN+VGTPRS HLL FWILF
Sbjct  414  KIVAHIVTFTFYCIIIPTTIFVPEVHIPKWGCVYIPTIITLLNSVGTPRSFHLLFFWILF  473

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHRTKAT IGLLEAGR NEW+VTEKLG A K+K A +A+ +K   R+ +R++V E
Sbjct  474  ENVMSLHRTKATLIGLLEAGRANEWVVTEKLGSAMKMKSANKASARKSFMRMWERLNVPE  533

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAG  472
            L  GA+LF CG YDVAFGK+++F+YLF QS+AFF+ G
Sbjct  534  LGVGAFLFSCGWYDVAFGKDNFFIYLFFQSMAFFVVG  570



>ref|XP_010493365.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Camelina 
sativa]
 ref|XP_010493366.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Camelina 
sativa]
Length=533

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 134/166 (81%), Gaps = 1/166 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH VTF FYCV+LP T+LVPEV VP WG+VYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHWVTFCFYCVVLPLTILVPEVYVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPR-FRIGDRVHVL  358
            ENVMSLHRTKAT IGL EAGR NEW+VT KLG     K   +   + PR F++ DR++ L
Sbjct  427  ENVMSLHRTKATLIGLFEAGRANEWVVTAKLGSGQSAKGNTKGLKRFPRIFKLPDRLNTL  486

Query  359  ELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFL  496
            EL   A+LF+CGCYD   GKN+YF+YLF+Q+++FFI+G G+IGT++
Sbjct  487  ELGFAAFLFVCGCYDFVHGKNNYFIYLFLQTLSFFISGLGWIGTYV  532



>ref|XP_004246627.1| PREDICTED: mannan synthase 1-like [Solanum lycopersicum]
Length=527

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH VTF FYC+++PAT+LVPEV + K  A+Y+P+ IT+LNA  TPRS HLLVFWILF
Sbjct  362  KIIAHWVTFFFYCIVIPATILVPEVHLTKPLAIYLPATITILNAACTPRSFHLLVFWILF  421

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHR+KA  IGLLEA RVNEW+VTEKLG+  K K + +A+ KKPR RIG+R+HVLE
Sbjct  422  ENVMSLHRSKAAIIGLLEASRVNEWVVTEKLGNTMKQKYSAKAS-KKPRSRIGERIHVLE  480

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L  G Y+  C  Y++ FG +H+F+YLF+Q+ AFFI G GY+GTF+PN
Sbjct  481  LLMGMYMLHCAIYNMLFGNDHFFIYLFLQAGAFFIVGIGYVGTFVPN  527



>gb|KFK39910.1| hypothetical protein AALP_AA3G305000 [Arabis alpina]
Length=537

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 137/169 (81%), Gaps = 2/169 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH VTF FYCV+LP T+LVPEV+VP WG+VYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  369  KIIAHWVTFCFYCVVLPLTILVPEVKVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILF  428

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDA-CKLKPALRATFKKPR-FRIGDRVHV  355
            ENVMSLHRTKAT IGL EAGR NEW+VT KLG      K   +   + PR F++ DR++ 
Sbjct  429  ENVMSLHRTKATLIGLFEAGRANEWVVTAKLGSGQTNAKGNTKGLKRFPRIFKLPDRLNT  488

Query  356  LELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            LEL   A+LF+CGCYD   GKN+YF+YLF+Q+++FFI+G G+IGT++P+
Sbjct  489  LELGFAAFLFVCGCYDFVHGKNNYFIYLFLQTLSFFISGLGWIGTYVPS  537



>ref|XP_010937167.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Elaeis 
guineensis]
Length=581

 Score =   229 bits (584),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 134/168 (80%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AHIVTF+ YCV++PA+VLVPEV +P WG VYIP+ IT+LNA+  PRS+HL+ FWILF
Sbjct  415  KIVAHIVTFVLYCVVIPASVLVPEVSIPTWGVVYIPTTITVLNAIRNPRSIHLMPFWILF  474

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS+HR KAT +GL EAG VNEW+VTEKLGDA K KP  +   +KP  R+ DR+   E
Sbjct  475  ENVMSMHRMKATMVGLFEAGGVNEWVVTEKLGDALKGKPETQ-ILEKPPIRLKDRITFSE  533

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            +    +LF C C DVAFG+N+Y++Y+++Q++AF + GFGY+G+F+PNS
Sbjct  534  IGFAVFLFFCACCDVAFGENYYYVYIYLQALAFLVVGFGYVGSFIPNS  581



>ref|XP_006287471.1| hypothetical protein CARUB_v10000683mg [Capsella rubella]
 gb|EOA20369.1| hypothetical protein CARUB_v10000683mg [Capsella rubella]
Length=533

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 134/166 (81%), Gaps = 1/166 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH VTF FYCV+LP T+LVPEV VP WG+VYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHWVTFCFYCVVLPLTILVPEVYVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPR-FRIGDRVHVL  358
            ENVMSLHRTKAT IGL EAGR NEW+VT KLG     K   +   + PR F++ DR++ L
Sbjct  427  ENVMSLHRTKATLIGLFEAGRANEWVVTAKLGSGQSAKGNTKGLKRFPRIFKLPDRLNTL  486

Query  359  ELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFL  496
            EL   A+LF+CGCYD   GKN+YF+YLF+Q+++FFI+G G+IGT++
Sbjct  487  ELGFAAFLFVCGCYDFVHGKNNYFIYLFLQTLSFFISGLGWIGTYV  532



>gb|KHF98868.1| Glucomannan 4-beta-mannosyltransferase 2 -like protein [Gossypium 
arboreum]
Length=537

 Score =   228 bits (581),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 135/171 (79%), Gaps = 6/171 (4%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LP T+L+PEV VP WGAVYIPSVIT+LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHMVTFCFYCVVLPLTILIPEVWVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATF------KKPRFRIGD  343
            ENVMSLHRTKATFIGLLEAGR NEW+VTEKLGDA K               +K +F+  D
Sbjct  427  ENVMSLHRTKATFIGLLEAGRANEWVVTEKLGDAVKKAADAAKNKNNAKAPRKLKFKFTD  486

Query  344  RVHVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFL  496
            R++ LEL   A+LF+CGCYD   GKN+YF+YLF+Q+I FFI G GY+GT +
Sbjct  487  RLNTLELGFAAFLFLCGCYDFVHGKNNYFVYLFLQTITFFITGIGYVGTII  537



>ref|XP_010554516.1| PREDICTED: probable mannan synthase 7 isoform X3 [Tarenaya hassleriana]
Length=484

 Score =   227 bits (578),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 129/168 (77%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+++HI+TF FYC++LP TV++PEV+VPKW A Y+PS ITL  A G PRS HLL FW+LF
Sbjct  317  KILSHIITFFFYCIVLPTTVMIPEVEVPKWAAFYLPSTITLFIATGRPRSFHLLAFWVLF  376

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            EN MSL RTKA  +GLLE GRVNEW+VTEKLGD  K K    A  K+P+ R  DRVH+LE
Sbjct  377  ENTMSLLRTKALVMGLLETGRVNEWVVTEKLGDPLKTKLIAEAP-KEPQARFRDRVHLLE  435

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            +  GAYL  CGCYDVA+G N  F+YL +QS+AFF+ GFG++GT +P S
Sbjct  436  VCVGAYLLFCGCYDVAYGNNFLFVYLLLQSMAFFLVGFGFVGTLVPPS  483



>gb|KHG21024.1| Glucomannan 4-beta-mannosyltransferase 2 -like protein [Gossypium 
arboreum]
 gb|KHG23680.1| Glucomannan 4-beta-mannosyltransferase 2 -like protein [Gossypium 
arboreum]
Length=537

 Score =   228 bits (580),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 136/172 (79%), Gaps = 8/172 (5%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH+VTF FYCV+LP T+LVPEV+VP WG+VYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  367  KIIAHMVTFFFYCVVLPLTILVPEVKVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILF  426

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGD-------ACKLKPALRATFKKPRFRIG  340
            ENVMSLHRTKAT IGL E GR NEW+VTEKLGD       A K K   +A  K+ R +  
Sbjct  427  ENVMSLHRTKATLIGLFETGRANEWVVTEKLGDVAKKVAEANKNKTNSKA-IKRYRSKFI  485

Query  341  DRVHVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFL  496
            DR++ LEL   A+LF+CGC+D  +GKN+YF+YL++Q+I FFI G GY+GT +
Sbjct  486  DRLNTLELGFSAFLFLCGCFDFMYGKNNYFIYLWLQTITFFITGIGYVGTII  537



>ref|XP_002963530.1| glycosyltransferase family 2 protein [Selaginella moellendorffii]
 gb|EFJ35401.1| glycosyltransferase family 2 protein [Selaginella moellendorffii]
Length=528

 Score =   227 bits (578),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 139/175 (79%), Gaps = 9/175 (5%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AH+VTF+F+CV++P  VLVPEV +PKWG++Y+PS+ITLLN + TP+SL  LVFW+LF
Sbjct  356  KIVAHLVTFIFFCVVVPTCVLVPEVNLPKWGSIYLPSMITLLNCMATPKSLPFLVFWVLF  415

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRV----  349
            ENVMS+HRTKAT  GLL+ GRVNEWIVTEKLGDA K+K A     +KP+ +IG+R     
Sbjct  416  ENVMSMHRTKATITGLLDIGRVNEWIVTEKLGDALKIKFA--KLKQKPKQKIGERQAYIS  473

Query  350  ---HVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
               HV  L  G Y+F C  YD+AFG++ Y++YL++Q++AFFI GFGYIGT++PN+
Sbjct  474  RRFHVFHLIVGLYIFFCASYDLAFGRDRYYIYLYLQAVAFFIMGFGYIGTYVPNT  528



>ref|XP_002981551.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ17366.1| family 2 glycosyltransferase [Selaginella moellendorffii]
Length=529

 Score =   227 bits (578),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 141/176 (80%), Gaps = 10/176 (6%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AH+VTF+F+CV++P  VLVPEV +PKWG++Y+PS+ITLLN + TP+SL  LVFW+LF
Sbjct  356  KIVAHLVTFIFFCVVVPTCVLVPEVNLPKWGSIYLPSMITLLNCMATPKSLPFLVFWVLF  415

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRV----  349
            ENVMS+HRTKATF GLL+ GRVNEWIVTEKLGDA K+K A     +KP+ +IG+R     
Sbjct  416  ENVMSMHRTKATFTGLLDIGRVNEWIVTEKLGDALKIKFA--KLKQKPKQKIGERQAYIS  473

Query  350  ---HVL-ELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
               HV  EL  G Y+F C  YD+AFG++ Y++YL++Q++AFFI GFGYIGT++PN+
Sbjct  474  QRFHVFHELIVGLYIFFCASYDLAFGRDRYYIYLYLQAVAFFIMGFGYIGTYVPNT  529



>gb|AAC98005.1| Similar to gi|2245014 glucosyltransferase homolog from Arabidopsis 
thaliana chromosome 4 contig gb|Z97341. ESTs gb|T20778 
and gb|AA586281 come from this gene [Arabidopsis thaliana]
Length=448

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 134/178 (75%), Gaps = 13/178 (7%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPR-----------  148
            K++ HI TF+FYC++LP TVL PE+QVPKW  VY P+ IT+LNA+ TPR           
Sbjct  270  KIVVHIFTFVFYCLILPTTVLFPELQVPKWATVYFPTTITILNAIATPRMIKSLTYIVYC  329

Query  149  -SLHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKP  325
             SLHLLVFWILFENVMS+HRTKATFIGLLEAGRVNEW+VTEKLGD  K K   +AT  K 
Sbjct  330  RSLHLLVFWILFENVMSMHRTKATFIGLLEAGRVNEWVVTEKLGDTLKSKLIGKAT-TKL  388

Query  326  RFRIGDRVHVLELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLP  499
              R G R++  EL  G Y+F CGCYD A+G +++++YLF+QS AFF+AG GYIGTF+P
Sbjct  389  YTRFGQRLNWRELVVGLYIFFCGCYDFAYGGSYFYVYLFLQSCAFFVAGVGYIGTFVP  446



>ref|XP_008783951.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 1-like [Phoenix 
dactylifera]
Length=493

 Score =   226 bits (575),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 130/167 (78%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            ++++HIVTF+FYCV++P +   PEV++PKWG VY+P+ ITLLN+VGTP S HL++FW+LF
Sbjct  328  RIVSHIVTFLFYCVVIPLSAFFPEVEIPKWGVVYVPTTITLLNSVGTPSSFHLIIFWVLF  387

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMSLHR KA  IGLLEAGR NEW+VTEKLGD  K KP +  T +K RF+  DR H+LE
Sbjct  388  ENVMSLHRCKAVLIGLLEAGRANEWVVTEKLGDMLKTKPNISVT-QKIRFKFWDRFHLLE  446

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            L    +L I  CYD  + +++YF+Y+F QSI FFI GFGY+GT +P+
Sbjct  447  LGLAVFLMISACYDCIYRRDYYFIYIFPQSITFFIMGFGYVGTIIPS  493



>ref|XP_008800552.1| PREDICTED: mannan synthase 1-like [Phoenix dactylifera]
Length=530

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 134/167 (80%), Gaps = 0/167 (0%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K++AH VTF FYCV++PA VLV ++ +PK+ AVYIP+ IT+LNA+ TPRS+HLL+FWILF
Sbjct  364  KIVAHFVTFFFYCVVIPACVLVQDIPLPKFVAVYIPATITILNAISTPRSIHLLIFWILF  423

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            ENVMS+HR KAT IGLLEA RVNEW+VT+KLG A K K     +  K R +IGDR+H+LE
Sbjct  424  ENVMSMHRAKATIIGLLEANRVNEWVVTDKLGSALKQKANTTKSKTKKRPQIGDRIHLLE  483

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPN  502
            +  G++L  C  YD  FG +H+++YLF+Q+ AFFIAGFGY+GTF+P+
Sbjct  484  IFMGSFLLYCAIYDYTFGHDHFYIYLFLQASAFFIAGFGYVGTFVPS  530



>ref|XP_010554514.1| PREDICTED: probable mannan synthase 7 isoform X1 [Tarenaya hassleriana]
Length=565

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 129/168 (77%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+++HI+TF FYC++LP TV++PEV+VPKW A Y+PS ITL  A G PRS HLL FW+LF
Sbjct  398  KILSHIITFFFYCIVLPTTVMIPEVEVPKWAAFYLPSTITLFIATGRPRSFHLLAFWVLF  457

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPRFRIGDRVHVLE  361
            EN MSL RTKA  +GLLE GRVNEW+VTEKLGD  K K    A  K+P+ R  DRVH+LE
Sbjct  458  ENTMSLLRTKALVMGLLETGRVNEWVVTEKLGDPLKTKLIAEAP-KEPQARFRDRVHLLE  516

Query  362  LATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFLPNS  505
            +  GAYL  CGCYDVA+G N  F+YL +QS+AFF+ GFG++GT +P S
Sbjct  517  VCVGAYLLFCGCYDVAYGNNFLFVYLLLQSMAFFLVGFGFVGTLVPPS  564



>ref|XP_010535659.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Tarenaya 
hassleriana]
Length=532

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 133/167 (80%), Gaps = 2/167 (1%)
 Frame = +2

Query  2    KVIAHIVTFMFYCVLLPATVLVPEVQVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILF  181
            K+IAH VTF FYCV+LP T+LVPEV+VP WG+VYIPS+IT+LN+VGTPRS+HLL +WILF
Sbjct  366  KIIAHWVTFCFYCVVLPLTILVPEVEVPMWGSVYIPSIITILNSVGTPRSIHLLFYWILF  425

Query  182  ENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDACKLKPALRATFKKPR--FRIGDRVHV  355
            ENVMSLHRTKAT IGLL+AGR NEW+VT KLG     K +     KK    F++ DR++ 
Sbjct  426  ENVMSLHRTKATLIGLLDAGRANEWVVTAKLGSGVSAKVSNAKGVKKLTRFFKLPDRLNT  485

Query  356  LELATGAYLFICGCYDVAFGKNHYFLYLFMQSIAFFIAGFGYIGTFL  496
            LEL   A+LF+CGCYD   GKN Y++YLF+Q+ +FFI GFG++GT++
Sbjct  486  LELGFAAFLFVCGCYDFVHGKNSYYVYLFLQTASFFITGFGWVGTYV  532



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2133155381984