BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25676_g3_i1 len=1015 path=[4113:0-93 4207:94-250 4364:251-281
4395:282-330 4444:331-342 4456:343-894 3627:895-934 3627:935-974
3627:975-1014]

Length=1015
                                                                      Score     E

ref|XP_006345303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    386   1e-127   
ref|XP_004236867.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    385   2e-127   
emb|CDP04865.1|  unnamed protein product                                384   2e-126   
ref|XP_009629151.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    383   2e-126   
ref|XP_002267930.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    377   5e-124   Vitis vinifera
ref|XP_009607692.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    376   1e-123   
ref|XP_002513132.1|  Aspartic proteinase nepenthesin-1 precursor,...    369   4e-121   Ricinus communis
ref|XP_004253208.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    368   2e-120   
ref|XP_009770623.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    365   3e-119   
ref|XP_011022942.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    364   6e-119   
ref|XP_002309912.2|  hypothetical protein POPTR_0007s04120g             363   1e-118   Populus trichocarpa [western balsam poplar]
ref|XP_009760593.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    362   3e-118   
ref|XP_006360843.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    362   4e-118   
ref|XP_011007544.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    361   1e-117   
ref|XP_011031192.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    360   2e-117   
ref|XP_002306246.2|  hypothetical protein POPTR_0005s06390g             360   4e-117   Populus trichocarpa [western balsam poplar]
ref|XP_008445900.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    358   7e-117   
ref|XP_004147103.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    357   4e-116   
ref|XP_011089579.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    356   6e-116   
ref|XP_006437655.1|  hypothetical protein CICLE_v10031332mg             354   4e-115   
ref|XP_006484478.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    354   5e-115   
gb|KDO69941.1|  hypothetical protein CISIN_1g011042mg                   354   5e-115   
gb|EYU40681.1|  hypothetical protein MIMGU_mgv1a005122mg                354   8e-115   
ref|XP_004497254.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    351   5e-114   
gb|AES60038.2|  aspartic protease in GUARD CELL-like protein            350   6e-114   
ref|XP_007043208.1|  Aspartic proteinase nepenthesin-1, putative        350   8e-114   
gb|KDP40474.1|  hypothetical protein JCGZ_24473                         349   2e-113   
ref|XP_010248951.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    348   6e-113   
ref|XP_003536757.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    348   6e-113   
ref|XP_007142740.1|  hypothetical protein PHAVU_007G013000g             347   1e-112   
ref|XP_003555824.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    347   2e-112   
ref|XP_010908909.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    346   3e-112   
ref|XP_010103590.1|  Aspartic proteinase nepenthesin-2                  347   6e-112   
ref|XP_004297710.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    345   1e-111   
ref|XP_006406427.1|  hypothetical protein EUTSA_v10020671mg             344   2e-111   
ref|XP_010031370.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    344   3e-111   
gb|KEH44446.1|  aspartic protease in GUARD CELL-like protein            344   4e-111   
ref|XP_009145693.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    342   1e-110   
emb|CBI35367.3|  unnamed protein product                                343   2e-110   
ref|XP_007153018.1|  hypothetical protein PHAVU_003G000900g             340   5e-110   
ref|XP_008465249.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    341   5e-110   
ref|NP_188636.2|  protein ASPARTIC PROTEASE IN GUARD CELL 2             340   5e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004150193.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    340   6e-110   
ref|XP_002885351.1|  pepsin A                                           340   6e-110   
ref|XP_010508355.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    340   8e-110   
ref|XP_010487964.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    338   3e-109   
ref|XP_010466176.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    338   6e-109   
ref|XP_006297584.1|  hypothetical protein CARUB_v10013606mg             338   8e-109   
gb|KFK39328.1|  hypothetical protein AALP_AA3G230300                    337   9e-109   
ref|XP_004498097.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    338   9e-109   
ref|XP_008791252.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    333   3e-107   
ref|XP_010279486.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    328   5e-105   
ref|XP_009385987.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    327   1e-104   
ref|XP_003589787.1|  Aspartic proteinase nepenthesin-2                  325   2e-104   
ref|XP_007227097.1|  hypothetical protein PRUPE_ppa025647mg             326   1e-103   
ref|XP_008340423.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    324   1e-102   
ref|XP_006847790.1|  hypothetical protein AMTR_s00029p00016750          323   1e-102   
ref|XP_008668690.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    318   3e-101   
emb|CAJ86229.1|  H0402C08.5                                             318   3e-101   Oryza sativa [red rice]
gb|EAZ32412.1|  hypothetical protein OsJ_16623                          318   3e-101   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009351765.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    319   1e-100   
ref|XP_008359997.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    317   3e-100   
ref|XP_004498098.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    313   3e-99    
ref|XP_010935575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    313   4e-99    
ref|XP_002448772.1|  hypothetical protein SORBIDRAFT_06g032900          313   4e-99    Sorghum bicolor [broomcorn]
ref|XP_008802841.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    310   5e-98    
ref|XP_008221090.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    311   1e-97    
ref|XP_010688619.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    306   7e-96    
ref|XP_004960076.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    298   1e-93    
ref|XP_008668689.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    296   1e-92    
ref|XP_006653026.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    296   1e-92    
ref|NP_001054261.2|  Os04g0677100                                       295   1e-92    Oryza sativa Japonica Group [Japonica rice]
tpg|DAA35351.1|  TPA: hypothetical protein ZEAMMB73_696016              295   1e-91    
gb|ABK24255.1|  unknown                                                 287   4e-89    Picea sitchensis
gb|ABR17396.1|  unknown                                                 279   1e-87    Picea sitchensis
emb|CAE05761.2|  OSJNBa0064G10.12                                       282   1e-87    Oryza sativa Japonica Group [Japonica rice]
gb|ABK24480.1|  unknown                                                 282   6e-87    Picea sitchensis
gb|ABR17085.1|  unknown                                                 273   2e-83    Picea sitchensis
dbj|BAJ97639.1|  predicted protein                                      271   8e-83    
gb|EPS61272.1|  hypothetical protein M569_13524                         269   5e-82    
gb|ABR16474.1|  unknown                                                 270   7e-82    Picea sitchensis
gb|ABK24467.1|  unknown                                                 269   8e-82    Picea sitchensis
ref|XP_006843768.1|  hypothetical protein AMTR_s00007p00241440          268   2e-81    
ref|XP_009775618.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    267   3e-81    
ref|XP_011093028.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    266   4e-81    
ref|XP_004299230.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    266   4e-81    
ref|XP_004229990.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    266   5e-81    
ref|XP_009613969.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    266   6e-81    
ref|XP_010542095.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    258   1e-80    
ref|XP_006339720.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    265   1e-80    
emb|CDX89133.1|  BnaA04g00530D                                          265   2e-80    
emb|CDY43952.1|  BnaC04g21580D                                          264   3e-80    
gb|KDP28482.1|  hypothetical protein JCGZ_14253                         264   4e-80    
ref|XP_009138753.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    263   5e-80    
ref|XP_008244017.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    264   6e-80    
gb|KDP29378.1|  hypothetical protein JCGZ_18299                         262   1e-79    
ref|XP_002315953.1|  aspartyl protease family protein                   261   3e-79    Populus trichocarpa [western balsam poplar]
ref|XP_006402438.1|  hypothetical protein EUTSA_v10005923mg             261   3e-79    
ref|XP_006374138.1|  hypothetical protein POPTR_0015s02540g             262   3e-79    
ref|XP_011004863.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    262   4e-79    
ref|XP_002511962.1|  Aspartic proteinase nepenthesin-1 precursor,...    261   4e-79    Ricinus communis
ref|XP_009356391.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    261   6e-79    
ref|XP_006298983.1|  hypothetical protein CARUB_v10015108mg             261   6e-79    
ref|XP_010465949.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    261   6e-79    
ref|XP_011093892.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    261   6e-79    
gb|KFK39179.1|  hypothetical protein AALP_AA3G210500                    261   8e-79    
ref|XP_007209939.1|  hypothetical protein PRUPE_ppa004726mg             261   8e-79    
ref|XP_011038277.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    261   1e-78    
ref|XP_010053832.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    260   1e-78    
ref|XP_010506935.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    260   1e-78    
gb|KFK35370.1|  hypothetical protein AALP_AA5G276300                    259   2e-78    
ref|XP_010266550.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    259   2e-78    
ref|XP_008446567.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    259   2e-78    
ref|XP_006484425.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    259   3e-78    
ref|XP_004139658.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    258   3e-78    
emb|CDX67868.1|  BnaA07g19080D                                          258   5e-78    
ref|XP_008389306.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    258   5e-78    
ref|XP_010544842.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    259   6e-78    
emb|CDY69364.1|  BnaCnng63170D                                          258   6e-78    
ref|XP_009112699.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    258   9e-78    
gb|EYU40714.1|  hypothetical protein MIMGU_mgv1a019320mg                257   9e-78    
ref|XP_010487776.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    258   1e-77    
ref|XP_006406598.1|  hypothetical protein EUTSA_v10020568mg             258   1e-77    
ref|XP_006437718.1|  hypothetical protein CICLE_v10031364mg             257   1e-77    
ref|XP_009336599.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    257   1e-77    
ref|XP_002263964.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    257   2e-77    Vitis vinifera
ref|XP_002885261.1|  aspartyl protease family protein                   257   2e-77    
gb|EYU32252.1|  hypothetical protein MIMGU_mgv1a005685mg                256   3e-77    
ref|XP_002878415.1|  aspartyl protease family protein                   256   3e-77    
ref|XP_004135107.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    256   3e-77    
gb|KDP20100.1|  hypothetical protein JCGZ_05869                         256   3e-77    
ref|XP_007225636.1|  hypothetical protein PRUPE_ppa003917mg             258   3e-77    
ref|NP_188478.1|  protein ASPARTIC PROTEASE IN GUARD CELL 1             256   3e-77    Arabidopsis thaliana [mouse-ear cress]
emb|CDP08669.1|  unnamed protein product                                256   4e-77    
ref|XP_008243190.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    258   4e-77    
gb|AAL87345.1|  putative chloroplast nucleoid DNA-binding protein       256   5e-77    Arabidopsis thaliana [mouse-ear cress]
emb|CDY25371.1|  BnaA05g19130D                                          253   5e-77    
gb|EYU38885.1|  hypothetical protein MIMGU_mgv1a026932mg                255   5e-77    
emb|CDX92240.1|  BnaA05g21670D                                          256   6e-77    
ref|XP_002529147.1|  Aspartic proteinase nepenthesin-1 precursor,...    255   7e-77    Ricinus communis
ref|XP_002320868.1|  aspartyl protease family protein                   255   7e-77    Populus trichocarpa [western balsam poplar]
ref|NP_191741.1|  aspartyl protease                                     255   8e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004298296.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    255   8e-77    
emb|CDP20336.1|  unnamed protein product                                255   8e-77    
ref|XP_004172253.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    255   1e-76    
emb|CDY24567.1|  BnaC05g32510D                                          252   1e-76    
ref|XP_010512555.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    254   1e-76    
ref|XP_009608744.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    254   1e-76    
ref|XP_007051537.1|  Eukaryotic aspartyl protease family protein ...    254   2e-76    
ref|XP_007046283.1|  Eukaryotic aspartyl protease family protein        254   2e-76    
ref|XP_010469025.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    254   3e-76    
ref|XP_010665756.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    254   3e-76    
ref|XP_004171805.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    251   3e-76    
ref|XP_011023172.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    254   3e-76    
ref|XP_006852628.1|  hypothetical protein AMTR_s00021p00234660          254   3e-76    
ref|XP_004238952.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    253   3e-76    
ref|XP_008437888.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    253   3e-76    
ref|XP_010527532.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    253   4e-76    
gb|EYU40867.1|  hypothetical protein MIMGU_mgv1a023461mg                253   5e-76    
ref|XP_002302634.2|  aspartyl protease family protein                   253   6e-76    Populus trichocarpa [western balsam poplar]
gb|EPS66029.1|  hypothetical protein M569_08742                         252   1e-75    
ref|XP_006491285.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    252   1e-75    
ref|XP_006444833.1|  hypothetical protein CICLE_v10019938mg             252   1e-75    
ref|XP_009104352.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    252   1e-75    
ref|XP_007217966.1|  hypothetical protein PRUPE_ppa005289mg             251   1e-75    
emb|CDM80984.1|  unnamed protein product                                253   1e-75    
ref|XP_004133810.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    251   1e-75    
ref|XP_007153356.1|  hypothetical protein PHAVU_003G028600g             252   2e-75    
ref|XP_002281973.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    252   2e-75    Vitis vinifera
ref|XP_009337317.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    252   2e-75    
emb|CDY24483.1|  BnaC05g34710D                                          252   2e-75    
ref|NP_171637.1|  aspartyl protease family protein                      251   2e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008461984.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    252   2e-75    
gb|KGN56421.1|  Aspartic proteinase nepenthesin-1                       252   3e-75    
ref|XP_007051536.1|  Eukaryotic aspartyl protease family protein ...    253   3e-75    
ref|XP_009109887.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    251   4e-75    
ref|XP_011008360.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    251   4e-75    
ref|XP_009600181.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    250   4e-75    
ref|XP_008457107.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    251   4e-75    
dbj|BAK07248.1|  predicted protein                                      251   5e-75    
ref|XP_002523337.1|  Aspartic proteinase nepenthesin-1 precursor,...    250   5e-75    Ricinus communis
ref|XP_010413342.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    251   5e-75    
ref|XP_010036867.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    251   6e-75    
ref|XP_009346910.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    250   7e-75    
ref|XP_010926497.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    251   7e-75    
ref|XP_009145889.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    250   8e-75    
ref|XP_004157423.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    250   1e-74    
ref|XP_008374731.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    249   1e-74    
emb|CDY24395.1|  BnaCnng04620D                                          249   1e-74    
ref|XP_009336767.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    249   1e-74    
emb|CDY25081.1|  BnaC06g18230D                                          249   1e-74    
ref|XP_010044282.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    249   2e-74    
ref|XP_006418409.1|  hypothetical protein EUTSA_v10009389mg             249   2e-74    
gb|AAM66061.1|  chloroplast nucleoid DNA binding protein, putative      249   2e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010556596.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    248   2e-74    
ref|XP_009337150.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    249   2e-74    
ref|XP_004248083.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    248   2e-74    
ref|NP_001041979.1|  Os01g0140100                                       249   3e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010457141.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    249   3e-74    
ref|XP_010474721.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    248   3e-74    
gb|KEH24641.1|  eukaryotic aspartyl protease family protein             248   4e-74    
ref|XP_009800603.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    248   5e-74    
ref|XP_006307379.1|  hypothetical protein CARUB_v10009005mg             248   5e-74    
ref|XP_002961719.1|  hypothetical protein SELMODRAFT_64161              244   6e-74    
ref|XP_010695864.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    248   6e-74    
ref|XP_006362137.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    247   7e-74    
ref|XP_002892074.1|  aspartyl protease family protein                   247   8e-74    
ref|XP_003529886.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    247   9e-74    
ref|XP_009398943.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    248   9e-74    
tpg|DAA53545.1|  TPA: hypothetical protein ZEAMMB73_483039              248   1e-73    
ref|XP_009135580.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    248   1e-73    
ref|XP_004137465.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    247   1e-73    
emb|CDX82342.1|  BnaA03g34790D                                          247   1e-73    
ref|XP_002964789.1|  hypothetical protein SELMODRAFT_82470              244   1e-73    
emb|CDX75968.1|  BnaC03g40510D                                          247   1e-73    
ref|XP_008343434.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    246   2e-73    
ref|XP_010095748.1|  Aspartic proteinase nepenthesin-1                  246   2e-73    
ref|XP_003520035.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    246   2e-73    
gb|EAY72467.1|  hypothetical protein OsI_00323                          246   2e-73    Oryza sativa Indica Group [Indian rice]
emb|CDY15187.1|  BnaC05g00660D                                          246   2e-73    
ref|XP_009800816.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    246   2e-73    
ref|XP_008351846.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    246   3e-73    
ref|XP_006362549.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    246   3e-73    
ref|XP_004968151.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    246   5e-73    
ref|XP_008367576.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    245   7e-73    
ref|XP_002457394.1|  hypothetical protein SORBIDRAFT_03g006630          246   7e-73    Sorghum bicolor [broomcorn]
ref|XP_010551288.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    246   8e-73    
ref|XP_008376086.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    245   9e-73    
ref|XP_010480432.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    244   9e-73    
ref|XP_008351878.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    244   1e-72    
ref|XP_010477900.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    244   1e-72    
emb|CDX90023.1|  BnaA10g00590D                                          244   1e-72    
ref|XP_009119684.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    244   1e-72    
ref|XP_007036465.1|  Eukaryotic aspartyl protease family protein        244   1e-72    
ref|XP_007147317.1|  hypothetical protein PHAVU_006G113700g             246   1e-72    
ref|XP_009609715.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    244   1e-72    
ref|XP_003517994.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    244   2e-72    
ref|XP_001757102.1|  predicted protein                                  242   2e-72    
ref|XP_004241622.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    244   2e-72    
ref|XP_007135265.1|  hypothetical protein PHAVU_010G114700g             243   2e-72    
ref|XP_004494825.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    243   2e-72    
ref|XP_004512945.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    244   3e-72    
ref|XP_010916474.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    244   3e-72    
ref|XP_003565317.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    244   3e-72    
ref|XP_010265215.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    243   5e-72    
ref|XP_007152794.1|  hypothetical protein PHAVU_004G160200g             243   5e-72    
ref|XP_006485768.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    243   6e-72    
gb|KFK42512.1|  hypothetical protein AALP_AA1G003500                    242   7e-72    
ref|XP_003520873.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    241   8e-72    
ref|XP_002979394.1|  hypothetical protein SELMODRAFT_53966              238   1e-71    
ref|XP_004497116.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    241   1e-71    
ref|XP_003554768.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    241   2e-71    
gb|KEH44258.1|  aspartic protease in GUARD CELL-like protein            241   2e-71    
ref|XP_010460347.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    241   2e-71    
ref|XP_008782298.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    242   2e-71    
gb|KDO64536.1|  hypothetical protein CISIN_1g011045mg                   241   2e-71    
ref|XP_006440937.1|  hypothetical protein CICLE_v10019848mg             241   2e-71    
ref|XP_009798772.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    240   3e-71    
ref|XP_010499100.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    240   4e-71    
ref|XP_006354732.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    241   4e-71    
ref|XP_003534178.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    240   5e-71    
ref|XP_002971459.1|  hypothetical protein SELMODRAFT_64134              236   6e-71    
gb|AGV54447.1|  aspartic proteinase nepenthesin-1 precursor             239   6e-71    
ref|XP_002990366.1|  hypothetical protein SELMODRAFT_43971              238   1e-70    
ref|XP_002986620.1|  hypothetical protein SELMODRAFT_124369             238   1e-70    
emb|CDP20730.1|  unnamed protein product                                239   1e-70    
ref|XP_002965292.1|  hypothetical protein SELMODRAFT_83230              237   1e-70    
ref|XP_002890686.1|  aspartyl protease family protein                   239   1e-70    
ref|XP_002966033.1|  hypothetical protein SELMODRAFT_64135              235   2e-70    
ref|XP_002275164.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    238   3e-70    Vitis vinifera
ref|XP_011077177.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    238   3e-70    
ref|XP_009380958.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    239   3e-70    
ref|NP_173922.1|  aspartyl protease family protein                      238   4e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002970504.1|  hypothetical protein SELMODRAFT_93504              237   6e-70    
ref|XP_008799310.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    238   7e-70    
ref|XP_010677970.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    237   1e-69    
ref|XP_002978584.1|  hypothetical protein SELMODRAFT_54048              234   1e-69    
ref|XP_009616228.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    236   1e-69    
ref|XP_008351877.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    236   1e-69    
ref|XP_009762361.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    235   3e-69    
ref|XP_010092769.1|  Aspartic proteinase nepenthesin-1                  236   3e-69    
ref|XP_008799615.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    236   4e-69    
gb|KFK44545.1|  hypothetical protein AALP_AA1G270600                    235   6e-69    
ref|NP_001168599.1|  uncharacterized protein LOC100382383               229   1e-68    
ref|XP_001759252.1|  predicted protein                                  231   1e-68    
ref|XP_010105777.1|  Aspartic proteinase nepenthesin-1                  233   2e-68    
ref|XP_010533981.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    233   3e-68    
ref|XP_010549135.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    233   3e-68    
ref|XP_006306517.1|  hypothetical protein CARUB_v10012516mg             232   5e-68    
ref|XP_003580821.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    232   5e-68    
gb|AGV54495.1|  aspartic proteinase nepenthesin-1-like protein          232   5e-68    
tpg|DAA58835.1|  TPA: hypothetical protein ZEAMMB73_701358              232   6e-68    
ref|XP_009394177.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    232   6e-68    
ref|XP_004969076.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    229   6e-67    
ref|XP_011072934.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    229   1e-66    
ref|XP_004306664.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    228   2e-66    
ref|XP_006415880.1|  hypothetical protein EUTSA_v10009899mg             228   3e-66    
ref|XP_001784204.1|  predicted protein                                  224   3e-66    
gb|KEH27070.1|  aspartic protease in GUARD CELL-like protein            228   4e-66    
ref|XP_004235788.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    227   7e-66    
ref|XP_003569303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    227   8e-66    
ref|XP_010924503.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    227   8e-66    
ref|XP_009409187.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    227   1e-65    
ref|XP_010918360.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    226   2e-65    
ref|XP_006341626.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    225   2e-65    
ref|XP_002455897.1|  hypothetical protein SORBIDRAFT_03g026970          225   3e-65    
ref|XP_008791253.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    225   4e-65    
dbj|BAJ86414.1|  predicted protein                                      224   6e-65    
ref|XP_010551158.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    223   2e-64    
gb|KCW86348.1|  hypothetical protein EUGRSUZ_B03036                     221   1e-63    
ref|XP_009103072.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    219   4e-63    
ref|XP_008453384.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    219   4e-63    
emb|CDM83204.1|  unnamed protein product                                219   6e-63    
ref|NP_001183392.1|  uncharacterized protein LOC100501808               214   1e-62    
gb|KCW48530.1|  hypothetical protein EUGRSUZ_K02206                     217   3e-62    
gb|AFK45956.1|  unknown                                                 209   4e-62    
ref|XP_007226774.1|  hypothetical protein PRUPE_ppa018129mg             214   2e-61    
ref|NP_001043485.1|  Os01g0598600                                       215   2e-61    
gb|ABK24493.1|  unknown                                                 213   7e-61    
emb|CDY03848.1|  BnaC07g10730D                                          213   7e-61    
ref|XP_008453383.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    213   8e-61    
ref|XP_004138237.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    214   1e-60    
gb|EYU19035.1|  hypothetical protein MIMGU_mgv1a021892mg                212   2e-60    
gb|KGN63809.1|  hypothetical protein Csa_1G022480                       212   3e-60    
ref|XP_004965901.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    212   4e-60    
ref|XP_004170576.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    212   5e-60    
dbj|BAD12875.1|  putative chloroplast nucleoid DNA-binding protei...    209   3e-59    
gb|EAY87322.1|  hypothetical protein OsI_08726                          208   5e-59    
ref|XP_004138238.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    209   5e-59    
ref|XP_008795461.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    205   5e-59    
ref|XP_004170575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    208   9e-59    
ref|XP_004138341.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    204   1e-58    
gb|AET05305.2|  eukaryotic aspartyl protease family protein             205   4e-58    
ref|XP_008223730.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    206   5e-58    
gb|KGN63808.1|  hypothetical protein Csa_1G021980                       202   5e-58    
gb|ABR16115.1|  unknown                                                 205   9e-58    
ref|XP_003630829.1|  Aspartic proteinase nepenthesin-2                  205   2e-57    
ref|XP_010928895.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    204   2e-57    
gb|AAT38006.1|  unknow protein                                          204   3e-57    
ref|NP_001056485.1|  Os05g0590000                                       204   3e-57    
gb|EAY99240.1|  hypothetical protein OsI_21202                          203   5e-57    
ref|NP_001168472.1|  hypothetical protein                               202   7e-57    
ref|XP_006649000.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    200   1e-56    
ref|XP_010928894.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    201   3e-56    
ref|XP_008648080.1|  PREDICTED: uncharacterized protein LOC100382...    201   3e-56    
ref|XP_010065986.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    199   1e-55    
gb|ABP93696.1|  unknown protein isoform 1                               196   1e-55    
gb|KGN55408.1|  hypothetical protein Csa_4G651750                       197   2e-55    
ref|XP_011080092.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    199   3e-55    
ref|XP_004961034.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    198   6e-55    
ref|XP_004150866.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    197   8e-55    
ref|XP_009411894.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    196   8e-55    
emb|CDO98452.1|  unnamed protein product                                196   9e-55    
ref|XP_010068511.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    195   1e-54    
ref|XP_002454360.1|  hypothetical protein SORBIDRAFT_04g029400          196   1e-54    
ref|XP_010066088.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    196   3e-54    
gb|KCW63888.1|  hypothetical protein EUGRSUZ_G01561                     195   3e-54    
ref|XP_008652856.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    195   4e-54    
ref|XP_009391894.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    194   7e-54    
ref|XP_002460431.1|  hypothetical protein SORBIDRAFT_02g028000          194   1e-53    
tpg|DAA61984.1|  TPA: hypothetical protein ZEAMMB73_915310              195   2e-53    
ref|XP_002454377.1|  hypothetical protein SORBIDRAFT_04g029680          194   2e-53    
gb|KCW63890.1|  hypothetical protein EUGRSUZ_G01565                     192   2e-53    
ref|XP_008452815.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    193   2e-53    
ref|XP_006287706.1|  hypothetical protein CARUB_v10000913mg             193   3e-53    
ref|XP_010491757.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    193   3e-53    
ref|XP_006828037.1|  hypothetical protein AMTR_s00008p00256490          192   3e-53    
gb|EYU29201.1|  hypothetical protein MIMGU_mgv1a005225mg                193   4e-53    
ref|XP_010066094.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    192   4e-53    
ref|XP_006364268.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    192   5e-53    
ref|XP_010913225.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    192   6e-53    
ref|XP_010491756.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    191   7e-53    
ref|XP_004245197.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    192   7e-53    
dbj|BAJ94237.1|  predicted protein                                      192   7e-53    
emb|CDY51131.1|  BnaA07g37140D                                          191   9e-53    
ref|XP_009390629.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    191   1e-52    
ref|XP_010692959.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    192   1e-52    
ref|XP_010258628.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    192   1e-52    
emb|CDO98456.1|  unnamed protein product                                191   1e-52    
gb|ACN85242.1|  aspartic proteinase nepenthesin-1 precursor             192   2e-52    
dbj|BAJ92731.1|  predicted protein                                      191   2e-52    
ref|XP_010491755.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    190   3e-52    
gb|ACN85225.1|  aspartic proteinase nepenthesin-1 precursor             191   3e-52    
ref|XP_006660750.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    190   4e-52    
emb|CAB96832.1|  nucleoid DNA-binding protein cnd41-like protein        189   4e-52    
ref|XP_009409855.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    190   4e-52    
ref|XP_006294147.1|  hypothetical protein CARUB_v10023140mg             190   4e-52    
gb|ACN85278.1|  aspartic proteinase nepenthesin-1 precursor             191   5e-52    
gb|ACN85295.1|  aspartic proteinase nepenthesin-1 precursor             190   5e-52    
ref|NP_196638.2|  aspartyl protease family protein                      189   7e-52    
ref|XP_006287637.1|  hypothetical protein CARUB_v10000848mg             189   7e-52    
ref|XP_010491758.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    189   8e-52    
ref|XP_003546907.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    189   8e-52    
ref|XP_002324933.2|  hypothetical protein POPTR_0018s03000g             189   1e-51    
ref|XP_009783584.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    189   1e-51    
dbj|BAC22609.1|  41 kD chloroplast nucleoid DNA binding protein (...    189   1e-51    
gb|ACN85339.1|  aspartic proteinase nepenthesin-1 precursor             189   1e-51    
gb|ACN85177.1|  aspartic proteinase nepenthesin-1 precursor             189   1e-51    
gb|ACN85284.1|  aspartic proteinase nepenthesin-1 precursor             189   1e-51    
ref|XP_009390623.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    188   2e-51    
gb|KCW63736.1|  hypothetical protein EUGRSUZ_G01384                     188   2e-51    
ref|NP_196637.1|  aspartyl protease family protein                      188   2e-51    
ref|XP_002452641.1|  hypothetical protein SORBIDRAFT_04g029670          188   2e-51    
ref|XP_010453111.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    188   2e-51    
ref|XP_003551807.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    188   2e-51    
dbj|BAJ97731.1|  predicted protein                                      188   2e-51    
ref|NP_001058055.1|  Os06g0610800                                       189   3e-51    
gb|KCW63886.1|  hypothetical protein EUGRSUZ_G01558                     187   3e-51    
dbj|BAJ90582.1|  predicted protein                                      187   3e-51    
gb|KHG10166.1|  Asparticase nepenthesin-2                               187   4e-51    
gb|EYU22027.1|  hypothetical protein MIMGU_mgv1a005281mg                187   4e-51    
gb|AAN60226.1|  unknown                                                 187   5e-51    
gb|ACN85210.1|  aspartic proteinase nepenthesin-1 precursor             188   5e-51    
ref|XP_008379443.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    187   5e-51    
ref|XP_004973076.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    186   6e-51    
ref|XP_002873476.1|  hypothetical protein ARALYDRAFT_325615             187   6e-51    
ref|XP_010422809.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    187   6e-51    
ref|XP_010108293.1|  Aspartic proteinase nepenthesin-2                  189   7e-51    
ref|XP_008679060.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    186   7e-51    
ref|XP_002285593.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    186   9e-51    
ref|XP_004953760.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    186   1e-50    
ref|XP_004953759.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    186   1e-50    
ref|XP_007011665.1|  Eukaryotic aspartyl protease family protein,...    186   1e-50    
ref|XP_009591885.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    187   1e-50    
sp|Q766C2.1|NEP2_NEPGR  RecName: Full=Aspartic proteinase nepenth...    185   1e-50    
ref|XP_007011662.1|  Eukaryotic aspartyl protease family protein,...    186   1e-50    
ref|XP_008806169.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    184   1e-50    
ref|XP_010906670.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    186   2e-50    
gb|EMT32054.1|  Aspartic proteinase nepenthesin-2                       185   2e-50    
gb|ACN85252.1|  aspartic proteinase nepenthesin-1 precursor             186   2e-50    
ref|XP_006483510.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    186   2e-50    
gb|ACN85264.1|  aspartic proteinase nepenthesin-1 precursor             186   2e-50    
gb|KDO67374.1|  hypothetical protein CISIN_1g011556mg                   186   2e-50    
ref|XP_010068417.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    187   2e-50    
emb|CDP11359.1|  unnamed protein product                                186   2e-50    
gb|KDP33485.1|  hypothetical protein JCGZ_07056                         186   2e-50    
ref|XP_007223364.1|  hypothetical protein PRUPE_ppa005616mg             184   3e-50    
emb|CDP18857.1|  unnamed protein product                                184   3e-50    
ref|XP_010419657.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    184   4e-50    
gb|AFV26025.1|  aspartic proteinase nepenthesin 2                       184   5e-50    
ref|XP_008776818.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    182   5e-50    
ref|XP_004959561.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    184   5e-50    
ref|XP_009390624.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    183   6e-50    
ref|XP_010108295.1|  Aspartic proteinase nepenthesin-2                  183   6e-50    
ref|XP_010907568.1|  PREDICTED: aspartic proteinase nepenthesin-2       183   6e-50    
ref|XP_006450237.1|  hypothetical protein CICLE_v10008143mg             184   6e-50    
ref|XP_002468182.1|  hypothetical protein SORBIDRAFT_01g041210          184   7e-50    
ref|XP_008777368.1|  PREDICTED: aspartic proteinase nepenthesin-2       183   8e-50    
ref|XP_008791340.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    183   2e-49    
ref|XP_007146522.1|  hypothetical protein PHAVU_006G048000g             183   2e-49    
ref|XP_004957153.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    183   2e-49    
ref|XP_008777073.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    182   2e-49    
ref|XP_006483511.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    183   2e-49    
ref|XP_003532146.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    183   2e-49    
ref|XP_008386743.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    182   2e-49    
ref|XP_010259084.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    182   3e-49    
ref|XP_002437273.1|  hypothetical protein SORBIDRAFT_10g023970          183   3e-49    
ref|XP_007225640.1|  hypothetical protein PRUPE_ppa004762mg             182   3e-49    
gb|KDO67377.1|  hypothetical protein CISIN_1g011600mg                   182   3e-49    
ref|XP_009625615.1|  PREDICTED: aspartic proteinase nepenthesin-1       182   3e-49    
ref|XP_003563633.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    183   3e-49    
ref|XP_009359072.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    182   4e-49    
ref|XP_002454359.1|  hypothetical protein SORBIDRAFT_04g029390          182   4e-49    
ref|XP_002272802.1|  PREDICTED: aspartic proteinase nepenthesin-1       181   5e-49    
ref|XP_010913303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    181   5e-49    
ref|XP_007226285.1|  hypothetical protein PRUPE_ppa019577mg             181   5e-49    
ref|XP_009401063.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    182   5e-49    
ref|XP_010256103.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    181   6e-49    
gb|EYU25643.1|  hypothetical protein MIMGU_mgv1a027134mg                180   9e-49    
gb|ABK25248.1|  unknown                                                 178   1e-48    
ref|XP_009410092.1|  PREDICTED: aspartic proteinase nepenthesin-2...    180   1e-48    
ref|XP_010429875.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    181   1e-48    
ref|XP_006289171.1|  hypothetical protein CARUB_v10002609mg             181   1e-48    
ref|XP_002458414.1|  hypothetical protein SORBIDRAFT_03g033075          180   1e-48    
ref|XP_011082009.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    181   1e-48    
ref|XP_002283470.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    181   1e-48    
gb|AHA84134.1|  aspartic proteinase nepenthesin-1                       181   2e-48    
gb|AFV26024.1|  aspartic proteinase nepenthesin 1                       179   2e-48    
ref|XP_009391129.1|  PREDICTED: aspartic proteinase nepenthesin-2...    180   2e-48    
ref|XP_009801916.1|  PREDICTED: aspartic proteinase nepenthesin-1       179   3e-48    
ref|XP_002309515.1|  nucleoid DNA-binding family protein                179   3e-48    
dbj|BAF98915.1|  aspartic proteinase nepenthesin I                      179   3e-48    
gb|KDP33482.1|  hypothetical protein JCGZ_07053                         179   4e-48    
ref|XP_004966942.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    179   5e-48    
gb|KEH33910.1|  eukaryotic aspartyl protease family protein             179   5e-48    
ref|XP_004966945.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    178   5e-48    
ref|XP_010422811.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    179   6e-48    
emb|CDX87358.1|  BnaA07g35150D                                          177   6e-48    
ref|XP_004965303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    178   6e-48    
ref|XP_008675097.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    178   9e-48    
ref|XP_003567056.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    177   9e-48    
gb|KEH35638.1|  aspartic proteinase nepenthesin                         177   1e-47    
gb|ACN29145.1|  unknown                                                 176   1e-47    
gb|KDO36875.1|  hypothetical protein CISIN_1g037264mg                   172   1e-47    
ref|XP_011019522.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    177   1e-47    
gb|ACN85307.1|  aspartic proteinase nepenthesin-1 precursor             179   2e-47    
ref|XP_011019525.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    177   2e-47    
ref|XP_008377499.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    178   2e-47    
dbj|BAJ99659.1|  predicted protein                                      177   2e-47    
dbj|BAJ89995.1|  predicted protein                                      177   2e-47    



>ref|XP_006345303.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=477

 Score =   386 bits (991),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 193/316 (61%), Positives = 242/316 (77%), Gaps = 2/316 (1%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIGVG+P + QY+ ID GS+++WVQCQPC  C+ Q DPVFDP+ S+SF+
Sbjct  129  GMEQGSGEYFVRIGVGSPVRQQYMVIDAGSDIVWVQCQPCTHCYHQSDPVFDPSLSASFS  188

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             VPCSS++C+RI + GC  GRC Y ++Y DGSY  GTM  ET+TFG TV+RDV +GC  +
Sbjct  189  GVPCSSSLCDRIDNSGCHAGRCKYQVMYGDGSYTKGTMALETLTFGRTVIRDVAIGCGHS  248

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAE-SSGSLEFGREIIPVGA  409
            N GM  GA GLLGL GGSM+ + Q+ GQTGG FSYCL S  +  S+GSLEFGRE++P GA
Sbjct  249  NHGMFIGAAGLLGLGGGSMSLVGQLGGQTGGAFSYCLVSRGSTGSTGSLEFGREVLPAGA  308

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
             WVPL+R+ RAP+ YYIG+SGLGVG  ++PI ED FRLTE+G+GGV+MD GT+VTRLP+ 
Sbjct  309  AWVPLIRNPRAPSFYYIGMSGLGVGGARVPIPEDAFRLTEEGDGGVVMDTGTAVTRLPQE  368

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY   R  +  Q +++PRAP+ S  DTCYDLNG  TV+VPTISFF  GG I TL A+N L
Sbjct  369  AYVAFRDAFAAQTSSLPRAPAMSIFDTCYDLNGFVTVRVPTISFFLMGGPILTLPARNFL  428

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+++G FCFAFAPS
Sbjct  429  IPVDRKGTFCFAFAPS  444



>ref|XP_004236867.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
lycopersicum]
Length=479

 Score =   385 bits (990),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 188/315 (60%), Positives = 240/315 (76%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VR+GVG+PP+ QY+ +D+GS+++WVQCQPC  C+ Q DPVFDP+ S SF 
Sbjct  132  GMDQGSGEYFVRVGVGSPPKNQYMVLDSGSDIVWVQCQPCTQCYHQSDPVFDPSLSVSFT  191

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C S++C+R+ + GC  GRC Y ++Y DGSY  GTM  ET+TFG T+V+DV +GC  +
Sbjct  192  GVSCGSSVCDRVENSGCHSGRCKYEVMYGDGSYTKGTMAIETLTFGHTMVKDVAIGCGHS  251

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N GM T A GLLGL GGSM+ + Q+ GQTGG FSYCL S   +S+GSLEFGR ++PVGA 
Sbjct  252  NSGMFTAAAGLLGLGGGSMSLVGQLGGQTGGAFSYCLVSRGTDSTGSLEFGRGVLPVGAA  311

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPL+R+   P+ YYIGLSGLGVG  ++PISEDVF++TE G+GGV+MD GT+VTRLP  A
Sbjct  312  WVPLIRNPLTPSFYYIGLSGLGVGGARVPISEDVFKITELGDGGVVMDTGTAVTRLPSEA  371

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y   R  ++ + A++PRAP+ S  DTCYDL+G  TV+VPT+SFF +GGQI TL A+N LI
Sbjct  372  YVAFREAFVAETASLPRAPAVSIFDTCYDLDGFVTVRVPTVSFFLSGGQILTLPARNFLI  431

Query  45   PVNKRGIFCFAFAPS  1
            PVN +G FCFAFAPS
Sbjct  432  PVNDKGTFCFAFAPS  446



>emb|CDP04865.1| unnamed protein product [Coffea canephora]
Length=523

 Score =   384 bits (987),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 192/315 (61%), Positives = 242/315 (77%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIGVG+PP+ QY+ +D+GS+++WVQCQPC  C+ Q DPVFDP+ S+SFA
Sbjct  176  GMEQGSGEYFVRIGVGSPPRNQYMVVDSGSDIVWVQCQPCNLCYHQSDPVFDPSLSASFA  235

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C S+IC+R+ + GC  GRC Y ++Y DGSY  GT+  ET++FGGT V++V +GC   
Sbjct  236  GVSCGSSICDRVENSGCHSGRCKYEVMYGDGSYTKGTLALETLSFGGTTVQNVAIGCGHR  295

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+GM  GA GLLGL GGSM+ + Q+ GQTGG F+YCL S    SSGSLEFGR  +PVGA 
Sbjct  296  NRGMFIGAAGLLGLGGGSMSLVGQLGGQTGGAFTYCLVSRGTSSSGSLEFGRGALPVGAA  355

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPLLR+ RAP+ YYIGLSGLGVG ++LPI EDVFRL+E G+GGV+MD GT+VTRLP  A
Sbjct  356  WVPLLRNPRAPSFYYIGLSGLGVGGMQLPIPEDVFRLSELGDGGVVMDSGTAVTRLPTAA  415

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y   R  ++T+ A++PRA + S  DTCYDLNG  TV+VPT+SFF +GG I TL A+N LI
Sbjct  416  YVAFRDAFLTETASLPRASAVSIFDTCYDLNGFVTVRVPTVSFFLSGGPILTLPARNFLI  475

Query  45   PVNKRGIFCFAFAPS  1
            PV++RG FCFAFAPS
Sbjct  476  PVDERGTFCFAFAPS  490



>ref|XP_009629151.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Nicotiana 
tomentosiformis]
Length=491

 Score =   383 bits (984),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 186/315 (59%), Positives = 239/315 (76%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VRIGVG+P + QY+ ID+GS+++WVQCQPC  C+ Q DPVFDP+ S SFA
Sbjct  144  GMDQGSGEYFVRIGVGSPARNQYMVIDSGSDIVWVQCQPCTQCYHQSDPVFDPSLSGSFA  203

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C S++C+R+ + GC  GRC Y ++Y DGSY  GT+  ET+TFG  +V++V +GC  +
Sbjct  204  GVSCGSSVCDRVENSGCHAGRCKYEVLYGDGSYTRGTIAIETLTFGHNMVKNVAIGCGHS  263

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N GM T A GLLGL GGSM+ + Q+ GQTGG FSYCL S   ES+GSLEFGR ++PVGA 
Sbjct  264  NSGMFTAAAGLLGLGGGSMSLVGQLGGQTGGAFSYCLVSRGTESTGSLEFGRRVLPVGAA  323

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPL+R+  AP+ YYIGL+GLG+G+ ++PISE+VF++TE G+GGV+MD GT+VTR P V 
Sbjct  324  WVPLIRNPLAPSFYYIGLTGLGIGDAQVPISEEVFKITELGDGGVVMDTGTAVTRFPAVV  383

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y   R  ++ + A++PRAP+ S  DTCYDLNG  TV+VPT+SFF  GGQI TL A+N LI
Sbjct  384  YVAFRDAFLAETASLPRAPAISIFDTCYDLNGFVTVRVPTVSFFLMGGQILTLPARNFLI  443

Query  45   PVNKRGIFCFAFAPS  1
            PVN +G FCFAFAPS
Sbjct  444  PVNDKGTFCFAFAPS  458



>ref|XP_002267930.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Vitis vinifera]
Length=479

 Score =   377 bits (967),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 188/315 (60%), Positives = 238/315 (76%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIGVG+PP+ QY+ ID+GS+++WVQCQPC  C+ Q DPVFDP  S+SF 
Sbjct  132  GMEQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCTQCYHQSDPVFDPADSASFT  191

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V CSS++C+R+ + GC  GRC Y + Y DGSY  GT+  ET+TFG T+VR V +GC   
Sbjct  192  GVSCSSSVCDRLENAGCHAGRCRYEVSYGDGSYTKGTLALETLTFGRTMVRSVAIGCGHR  251

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+GM  GA GLLGL GGSM+F+ Q+ GQTGG FSYCL S   +SSGSL FGRE +P GA 
Sbjct  252  NRGMFVGAAGLLGLGGGSMSFVGQLGGQTGGAFSYCLVSRGTDSSGSLVFGREALPAGAA  311

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPL+R+ RAP+ YYIGL+GLGVG I++PISE+VFRLTE G+GGV+MD GT+VTRLP +A
Sbjct  312  WVPLVRNPRAPSFYYIGLAGLGVGGIRVPISEEVFRLTELGDGGVVMDTGTAVTRLPTLA  371

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y+  R  ++ Q A +PRA   +  DTCYDL G  +V+VPT+SF+F+GG I TL A+N LI
Sbjct  372  YQAFRDAFLAQTANLPRATGVAIFDTCYDLLGFVSVRVPTVSFYFSGGPILTLPARNFLI  431

Query  45   PVNKRGIFCFAFAPS  1
            P++  G FCFAFAPS
Sbjct  432  PMDDAGTFCFAFAPS  446



>ref|XP_009607692.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
Length=489

 Score =   376 bits (966),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 194/315 (62%), Positives = 240/315 (76%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIGVG+P + QY+ ID GS+++WVQCQPC  C+ Q DPVFDP+ S+SF+
Sbjct  142  GMEQGSGEYFVRIGVGSPVREQYMVIDAGSDIVWVQCQPCTHCYHQSDPVFDPSLSASFS  201

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             VPC+S++C R+ + GC  GRC Y ++Y DGSY  GT+  ET+TFG TVVRDV +GC  +
Sbjct  202  GVPCTSSLCERVDNSGCHAGRCKYEVMYGDGSYTKGTVALETLTFGRTVVRDVAIGCGHS  261

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N GM  GA GLLGL GGSM+ M Q+ GQTGG FSYCL S    S+GSLEFGREI+P+GA 
Sbjct  262  NGGMFIGAAGLLGLGGGSMSLMGQLGGQTGGAFSYCLVSRGTGSTGSLEFGREILPMGAA  321

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPL+R+ +AP+ YYIGLSGLGVG  ++ ISEDVFRLTE G+GGV+MD GT+VTRLP   
Sbjct  322  WVPLIRNPQAPSFYYIGLSGLGVGGARVAISEDVFRLTEVGDGGVVMDTGTAVTRLPTAV  381

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            YE  R  ++ Q A++PRAP+ S  DTCYDLN   TV+VPT+SFF  GG I TL A+N LI
Sbjct  382  YEAFRNAFIAQTASLPRAPAMSIFDTCYDLNEFVTVRVPTVSFFLMGGPILTLPARNFLI  441

Query  45   PVNKRGIFCFAFAPS  1
            PV++RG FCFAFAPS
Sbjct  442  PVDERGTFCFAFAPS  456



>ref|XP_002513132.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF49635.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=481

 Score =   369 bits (948),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 186/315 (59%), Positives = 234/315 (74%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY +RIGVG+PP+ QY+ ID+GS+++WVQCQPC  C+ Q DPVFDP  S+SF 
Sbjct  134  GMNQGSGEYFIRIGVGSPPREQYVVIDSGSDIVWVQCQPCTQCYHQTDPVFDPADSASFM  193

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             VPCSS++C RI + GC  G C Y ++Y DGSY  GT+  ET+TFG TVVR+V +GC   
Sbjct  194  GVPCSSSVCERIENAGCHAGGCRYEVMYGDGSYTKGTLALETLTFGRTVVRNVAIGCGHR  253

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+GM  GA GLLGL GGSM+ + Q+ GQTGG FSYCL S   +S+GSLEFGR  +PVGA 
Sbjct  254  NRGMFVGAAGLLGLGGGSMSLVGQLGGQTGGAFSYCLVSRGTDSAGSLEFGRGAMPVGAA  313

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            W+PL+R+ RAP+ YYI LSG+GVG +K+PISEDVF+L E GNGGV+MD GT+VTR+P VA
Sbjct  314  WIPLIRNPRAPSFYYIRLSGVGVGGMKVPISEDVFQLNEMGNGGVVMDTGTAVTRIPTVA  373

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y   R  ++ Q   +PRA   S  DTCY+LNG  +V+VPT+SF+F GG I TL A+N LI
Sbjct  374  YVAFRDAFIGQTGNLPRASGVSIFDTCYNLNGFVSVRVPTVSFYFAGGPILTLPARNFLI  433

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFA S
Sbjct  434  PVDDVGTFCFAFAAS  448



>ref|XP_004253208.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
lycopersicum]
Length=486

 Score =   368 bits (944),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 193/317 (61%), Positives = 240/317 (76%), Gaps = 3/317 (1%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIGVG+P + QY+ ID GS+++WVQCQPC  C+ Q DPVFDP+ S+SF 
Sbjct  137  GMEQGSGEYFVRIGVGSPVRQQYMVIDAGSDIVWVQCQPCTHCYHQSDPVFDPSLSASFT  196

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             VPCSS++CNRI + GC  GRC Y ++Y DGSY  GTM  ET+TFG TV+RDV +GC  +
Sbjct  197  GVPCSSSLCNRIDNSGCHAGRCKYQVMYGDGSYTKGTMALETLTFGRTVIRDVAIGCGHS  256

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASW--HAESSGSLEFGREIIPVG  412
            N GM  GA GLLGL GGSM+ + Q+ GQTGG FSYCL S   +  S+GSLEFGRE++P G
Sbjct  257  NHGMFIGAAGLLGLGGGSMSLVGQLGGQTGGAFSYCLVSRGTNTGSTGSLEFGREVLPAG  316

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPK  232
            A WVPL+R+ RAP+ YYIG+ GLGVG +++PI ED FRLTE+G+GGV+MD GT+VTRLP 
Sbjct  317  AAWVPLIRNPRAPSFYYIGMLGLGVGGVRVPIPEDAFRLTEEGDGGVVMDTGTAVTRLPH  376

Query  231  VAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNI  52
             AY   R  ++ Q +++PRAP+ S  DTCYDLNG  TV+VPTISFF  GG I TL A+N 
Sbjct  377  EAYVAFRDAFVAQTSSLPRAPAMSIFDTCYDLNGFVTVRVPTISFFLMGGPILTLPARNF  436

Query  51   LIPVNKRGIFCFAFAPS  1
            LIPV+ +G FCFAFAPS
Sbjct  437  LIPVDTKGTFCFAFAPS  453



>ref|XP_009770623.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=512

 Score =   365 bits (938),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 194/315 (62%), Positives = 240/315 (76%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIGVG+P + QY+ ID GS+++WVQCQPC  C+ Q DPVFDP+ S+SF+
Sbjct  165  GMEQGSGEYFVRIGVGSPVREQYMVIDAGSDIVWVQCQPCTQCYHQSDPVFDPSLSASFS  224

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             VPC+S++C ++ + GC  GRC Y ++Y DGSY  GTM  ET+TFG TVVRDV +GC   
Sbjct  225  GVPCTSSLCEQVENSGCHAGRCKYEVMYGDGSYTKGTMALETLTFGRTVVRDVAIGCGHH  284

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N GM  GA GLLGL GGSM+ + Q+ GQTGG FSYCL S    S+GSLEFGREI+P+GA 
Sbjct  285  NGGMFIGAAGLLGLGGGSMSLLGQLGGQTGGAFSYCLVSRGTGSTGSLEFGREILPMGAA  344

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPL+R+ RAP+ YYIGLSGLGVG  ++ ISED+FRLTE G+GGV+MD GT+VTRLP   
Sbjct  345  WVPLIRNPRAPSFYYIGLSGLGVGGARVAISEDIFRLTEVGDGGVVMDTGTAVTRLPTAV  404

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            YE  R  ++ Q A++PRAP+ S  DTCYDLNG  TV+VPT+SFF  GG I TL A+N LI
Sbjct  405  YEAFRNAFIAQTASLPRAPAMSIFDTCYDLNGFVTVRVPTVSFFLMGGPILTLPARNFLI  464

Query  45   PVNKRGIFCFAFAPS  1
            PV++RG FCFAFAPS
Sbjct  465  PVDERGTFCFAFAPS  479



>ref|XP_011022942.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Populus 
euphratica]
Length=502

 Score =   364 bits (935),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 181/315 (57%), Positives = 230/315 (73%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIG+G+PP+ QY+ ID+GS+++WVQC+PC  C+ Q DP+FDP  S+SF 
Sbjct  155  GMNQGSGEYFVRIGLGSPPRSQYMVIDSGSDIVWVQCKPCTQCYHQTDPLFDPADSASFM  214

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V CSS +C+R+ + GC  GRC Y + Y DGSY  GT+  ET+TFG TVVR+V +GC  +
Sbjct  215  GVSCSSAVCDRVENAGCNSGRCRYEVSYGDGSYTKGTLALETLTFGRTVVRNVAIGCGHS  274

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+GM  GA GLLGL GGSM+FM Q+ GQTG  FSYCL S    ++G LEFG E +PVGA 
Sbjct  275  NRGMFVGAAGLLGLGGGSMSFMGQLSGQTGNAFSYCLVSRGTSTNGFLEFGSEAMPVGAA  334

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            W+PL+R+ RAP+ YYI L GLGVG  ++PISEDVF+L E G+GGV+MD GT+VTR P VA
Sbjct  335  WIPLVRNPRAPSFYYIRLLGLGVGGTRVPISEDVFQLNELGSGGVVMDTGTAVTRFPTVA  394

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            YE  R  ++ Q   +PRA   S  DTCY+L G  +V+VPT+SF+F+GG I TL A N LI
Sbjct  395  YEAFRNAFIEQTQNLPRASGVSIFDTCYNLFGFLSVRVPTVSFYFSGGPILTLPANNFLI  454

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAPS
Sbjct  455  PVDDAGTFCFAFAPS  469



>ref|XP_002309912.2| hypothetical protein POPTR_0007s04120g [Populus trichocarpa]
 gb|EEE90362.2| hypothetical protein POPTR_0007s04120g [Populus trichocarpa]
Length=501

 Score =   363 bits (933),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 179/315 (57%), Positives = 231/315 (73%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIG+G+PP+ QY+ ID+GS+++WVQC+PC  C+ Q DP+FDP  S+SF 
Sbjct  154  GMNQGSGEYFVRIGLGSPPRSQYMVIDSGSDIVWVQCKPCTQCYHQTDPLFDPADSASFM  213

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V CSS +C+R+ + GC  GRC Y + Y DGSY  GT+  ET+TFG TVVR+V +GC  +
Sbjct  214  GVSCSSAVCDRVENAGCNSGRCRYEVSYGDGSYTKGTLALETLTFGRTVVRNVAIGCGHS  273

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+GM  GA GLLGL GGSM+FM Q+ GQTG  FSYCL S    ++G LEFG E +PVGA 
Sbjct  274  NRGMFVGAAGLLGLGGGSMSFMGQLSGQTGNAFSYCLVSRGTNTNGFLEFGSEAMPVGAA  333

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            W+PL+R+ RAP+ YYI L GLGVG+ ++P+SEDVF+L E G+GGV+MD GT+VTR P VA
Sbjct  334  WIPLVRNPRAPSFYYIRLLGLGVGDTRVPVSEDVFQLNELGSGGVVMDTGTAVTRFPTVA  393

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            YE  R  ++ Q   +PRA   S  DTCY+L G  +V+VPT+SF+F+GG I T+ A N LI
Sbjct  394  YEAFRNAFIEQTQNLPRASGVSIFDTCYNLFGFLSVRVPTVSFYFSGGPILTIPANNFLI  453

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAPS
Sbjct  454  PVDDAGTFCFAFAPS  468



>ref|XP_009760593.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=494

 Score =   362 bits (930),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 186/315 (59%), Positives = 237/315 (75%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VRIGVG+P + QY+ ID+GS+++WVQCQPC  C+ Q DPVFDP+ S SFA
Sbjct  147  GMDQGSGEYFVRIGVGSPARNQYMVIDSGSDIVWVQCQPCTQCYHQSDPVFDPSLSGSFA  206

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C S++CNR+ + GC  GRC Y ++Y DGSY  GT+  ET+TFG ++V++V +GC  +
Sbjct  207  GVSCGSSVCNRVENSGCHAGRCKYEVLYGDGSYTRGTIAIETLTFGHSMVKNVAIGCGHS  266

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N GM T A GLLGL GGSM+ + Q+ GQTGG FSYCL S   ES+GSLEFGR ++PVGA 
Sbjct  267  NSGMFTAAAGLLGLGGGSMSLVGQLGGQTGGAFSYCLVSRGTESTGSLEFGRGVLPVGAA  326

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPL+R+   P+ YYIGL+GLG+G  ++PISEDVF++TE G+GGV+MD GT+VTR P   
Sbjct  327  WVPLIRNPLGPSFYYIGLTGLGIGGARIPISEDVFKITELGDGGVVMDTGTAVTRFPAAV  386

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y   R  ++ + A++PRAP+ S  DTCYDLNG  TV+VPT+SFF  GGQI TL A+N LI
Sbjct  387  YVAFRDAFVAETASLPRAPAISIFDTCYDLNGFVTVRVPTVSFFLMGGQILTLPARNFLI  446

Query  45   PVNKRGIFCFAFAPS  1
            PVN +G FCFAFAPS
Sbjct  447  PVNDKGTFCFAFAPS  461



>ref|XP_006360843.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=479

 Score =   362 bits (928),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 187/315 (59%), Positives = 239/315 (76%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VRIGVG+P + QY+ +D+GS+++WVQCQPC  C+ Q DPVFDP+ S SF 
Sbjct  132  GMDQGSGEYFVRIGVGSPAKNQYMVLDSGSDIVWVQCQPCTQCYHQSDPVFDPSLSVSFT  191

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             VPC S++C+R+ + GC  GRC Y ++Y DGSY  GTM  ET+TFG T+V++V +GC   
Sbjct  192  GVPCGSSVCDRVENSGCHSGRCKYEVMYGDGSYTKGTMAIETLTFGHTMVKNVAIGCGHR  251

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N GM T A GLLGL GGSM+ + Q+ GQTGG FSYCL S   +S+GSLEFGR ++PVGA 
Sbjct  252  NSGMFTAAAGLLGLGGGSMSLVGQLGGQTGGAFSYCLVSRGTDSTGSLEFGRGVLPVGAA  311

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPL+R+   P+ YYIGLSGLGVG +++PISEDVF++TE G+GGV+MD GT+VTRLP  A
Sbjct  312  WVPLIRNPLTPSFYYIGLSGLGVGGVRVPISEDVFKITELGDGGVVMDTGTAVTRLPSEA  371

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y   R  ++ +  ++PRAP+ S  DTCYDL+G  TV+VPT+SFF +GGQI TL A+N LI
Sbjct  372  YVAFRDAFIVETVSLPRAPAVSIFDTCYDLDGFVTVRVPTVSFFLSGGQILTLPARNFLI  431

Query  45   PVNKRGIFCFAFAPS  1
            PVN +G FCFAFAPS
Sbjct  432  PVNDKGTFCFAFAPS  446



>ref|XP_011007544.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Populus 
euphratica]
Length=501

 Score =   361 bits (927),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/315 (57%), Positives = 229/315 (73%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VRIGVG+PP+ QY+ ID+GS+++WVQC+PC  C+ Q DP+FDP  S+SF 
Sbjct  154  GMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCKPCTQCYHQTDPLFDPADSASFM  213

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V CSS +C+++ + GC  GRC Y + Y DGS   GT+  ET+T G TVV++V +GC   
Sbjct  214  GVSCSSAVCDQVENAGCNSGRCRYEVSYGDGSSTKGTLALETLTLGRTVVQNVAIGCGHM  273

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            NQGM  GA GLLGL GGSM+F+ Q+  + G  FSYCL S    S+G LEFG E +PVGA 
Sbjct  274  NQGMFVGAAGLLGLGGGSMSFVGQLSSERGNAFSYCLVSRVTNSNGFLEFGSEAMPVGAA  333

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            W+PL+R+  +P+ YYIGLSGLGVG++K+PISED+F+LTE GNGGV+MD GT+VTR P VA
Sbjct  334  WIPLIRNPHSPSYYYIGLSGLGVGDMKVPISEDIFQLTELGNGGVVMDTGTAVTRFPTVA  393

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            YE  R  ++ Q   +PRA   S  DTCY+L G  +V+VPT+SF+F+GG I TL A N LI
Sbjct  394  YEAFRDAFIDQTGNLPRASGVSIFDTCYNLFGFLSVRVPTVSFYFSGGPILTLPANNFLI  453

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAPS
Sbjct  454  PVDDAGTFCFAFAPS  468



>ref|XP_011031192.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Populus 
euphratica]
Length=501

 Score =   360 bits (925),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 179/315 (57%), Positives = 229/315 (73%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VRIGVG+PP+ QY+ ID+GS+++WVQC+PC  C+ Q DP+FDP  S+SF 
Sbjct  154  GMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCKPCTQCYHQTDPLFDPADSASFM  213

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V CSS +C+++ + GC  GRC Y + Y DGS   GT+  ET+T G TVV++V +GC   
Sbjct  214  GVSCSSAVCDQVENAGCNSGRCRYEVSYGDGSSTKGTLALETLTLGRTVVQNVAIGCGHM  273

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            NQGM  GA GLLGL GGSM+F+ Q+  + G  FSYCL S    S+G LEFG E +PVGA 
Sbjct  274  NQGMFVGAAGLLGLGGGSMSFVGQLSRERGNAFSYCLVSRVTNSNGFLEFGSEAMPVGAA  333

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            W+PL+R+  +P+ YYIGLSGLGVG++K+PISED+F+LTE GNGGV+MD GT+VTR P VA
Sbjct  334  WIPLIRNPHSPSYYYIGLSGLGVGDMKVPISEDIFQLTELGNGGVVMDTGTAVTRFPTVA  393

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            YE  R  ++ Q   +PRA   S  DTCY+L G  +V+VPT+SF+F+GG I TL A N LI
Sbjct  394  YEAFRDAFIDQTGNLPRASGVSIFDTCYNLFGFLSVRVPTVSFYFSGGPILTLPANNFLI  453

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAPS
Sbjct  454  PVDDAGTFCFAFAPS  468



>ref|XP_002306246.2| hypothetical protein POPTR_0005s06390g [Populus trichocarpa]
 gb|EEE93242.2| hypothetical protein POPTR_0005s06390g [Populus trichocarpa]
Length=502

 Score =   360 bits (924),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 179/315 (57%), Positives = 228/315 (72%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VRIGVG+PP+ QY+ ID+GS+++WVQC+PC  C+ Q DP+FDP  S+SF 
Sbjct  155  GMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCKPCTQCYHQTDPLFDPADSASFM  214

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V CSS +C+++ + GC  GRC Y + Y DGS   GT+  ET+T G TVV++V +GC   
Sbjct  215  GVSCSSAVCDQVDNAGCNSGRCRYEVSYGDGSSTKGTLALETLTLGRTVVQNVAIGCGHM  274

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            NQGM  GA GLLGL GGSM+F+ Q+  + G  FSYCL S    S+G LEFG E +PVGA 
Sbjct  275  NQGMFVGAAGLLGLGGGSMSFVGQLSRERGNAFSYCLVSRVTNSNGFLEFGSEAMPVGAA  334

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            W+PL+R+  +P+ YYIGLSGLGVG++K+PISED+F LTE GNGGV+MD GT+VTR P VA
Sbjct  335  WIPLIRNPHSPSYYYIGLSGLGVGDMKVPISEDIFELTELGNGGVVMDTGTAVTRFPTVA  394

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            YE  R  ++ Q   +PRA   S  DTCY+L G  +V+VPT+SF+F+GG I TL A N LI
Sbjct  395  YEAFRDAFIDQTGNLPRASGVSIFDTCYNLFGFLSVRVPTVSFYFSGGPILTLPANNFLI  454

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAPS
Sbjct  455  PVDDAGTFCFAFAPS  469



>ref|XP_008445900.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
melo]
Length=481

 Score =   358 bits (920),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 180/315 (57%), Positives = 228/315 (72%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIGVG+PP+ QY+ ID+GS+++WVQC+PC  C+ Q DPVFDP  SSSFA
Sbjct  134  GMEEGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCKPCSRCYQQSDPVFDPADSSSFA  193

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C S +C+R+ + GC  GRC Y + Y DGSY  GT+  ET+T G  ++RDV +GC  T
Sbjct  194  GVSCGSDVCDRLENTGCNAGRCRYEVSYGDGSYTKGTLALETLTVGQVMIRDVAIGCGHT  253

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            NQGM  GA GLLGL GGSM+F+ Q+ GQTGG FSYCL S    S+G+LEFGR  +PVGA 
Sbjct  254  NQGMFIGAAGLLGLGGGSMSFIGQLGGQTGGAFSYCLVSRGTGSTGTLEFGRGALPVGAT  313

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            W+ L+R+ RAP+ YYIGL+G+GVG +++ I E+ F+LTE G  GV+MD GT+VTRLP  A
Sbjct  314  WISLIRNPRAPSFYYIGLAGIGVGGVRVSIPEETFQLTEFGTNGVVMDTGTAVTRLPTSA  373

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y  LR  +  Q + +PRAP  S  DTCYDLNG  +V+VPT+SF+F+ G   TL AKN LI
Sbjct  374  YVALRDSFTAQTSNLPRAPGVSIFDTCYDLNGFESVRVPTVSFYFSDGPALTLPAKNFLI  433

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FC AFAPS
Sbjct  434  PVDGGGTFCLAFAPS  448



>ref|XP_004147103.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
sativus]
 ref|XP_004166359.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
sativus]
 gb|KGN51568.1| hypothetical protein Csa_5G579060 [Cucumis sativus]
Length=482

 Score =   357 bits (915),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 176/315 (56%), Positives = 227/315 (72%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIGVG+PP+ QY+ ID+GS+++WVQC+PC  C+ Q DPVFDP  SSSFA
Sbjct  135  GMEAGSGEYFVRIGVGSPPRNQYMVIDSGSDIVWVQCKPCSRCYQQSDPVFDPADSSSFA  194

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C S +C+R+ + GC  GRC Y + Y DGSY  GT+  ET+T G  ++RDV +GC  T
Sbjct  195  GVSCGSDVCDRLENTGCNAGRCRYEVSYGDGSYTKGTLALETLTVGQVMIRDVAIGCGHT  254

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            NQGM  GA GLLGL GGSM+F+ Q+ GQTGG FSYCL S    S+G+LEFGR  +PVGA 
Sbjct  255  NQGMFIGAAGLLGLGGGSMSFIGQLGGQTGGAFSYCLVSRGTGSTGALEFGRGALPVGAT  314

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            W+ L+R+ RAP+ YYIGL+G+GVG +++ + E+ F+LTE G  GV+MD GT+VTR P  A
Sbjct  315  WISLIRNPRAPSFYYIGLAGIGVGGVRVSVPEETFQLTEYGTNGVVMDTGTAVTRFPTAA  374

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y   R  +  Q + +PRAP  S  DTCYDLNG  +V+VPT+SF+F+ G + TL A+N LI
Sbjct  375  YVAFRDSFTAQTSNLPRAPGVSIFDTCYDLNGFESVRVPTVSFYFSDGPVLTLPARNFLI  434

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FC AFAPS
Sbjct  435  PVDGGGTFCLAFAPS  449



>ref|XP_011089579.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 2 [Sesamum indicum]
Length=479

 Score =   356 bits (914),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 190/315 (60%), Positives = 231/315 (73%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VRIGVG+P + QY+ ID+GS+++WVQCQPC  C+ Q DPVFDP  S+SF+
Sbjct  132  GMDQGSGEYFVRIGVGSPARSQYMVIDSGSDIVWVQCQPCSQCYHQSDPVFDPAESASFS  191

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V CSS++C R+ + GC  GRC Y + Y DGSY  GT+  ET+T G TVV++V +GC   
Sbjct  192  GVSCSSSVCERVENSGCHAGRCKYEVSYGDGSYTKGTLALETLTIGHTVVQNVAIGCGHM  251

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+GM  GA GLLGL GGSM+ + Q+ GQ G  FSYCL S    S GSLEFGR ++PVGA 
Sbjct  252  NRGMFIGAAGLLGLGGGSMSLVGQLGGQAGEAFSYCLESRGTGSFGSLEFGRSVLPVGAA  311

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPLLR+ RA + YYIGLSGLGVG  ++PISED FRLTE G GGV+MD GT+VTRLP  A
Sbjct  312  WVPLLRNPRAQSFYYIGLSGLGVGGTRVPISEDTFRLTEYGEGGVVMDTGTAVTRLPTAA  371

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y   R  +M + A +PRAP  S  DTCYDLNG  TV+VPT+SFF +GG I TL A+N LI
Sbjct  372  YVAFRDTFMAETANLPRAPGVSIFDTCYDLNGFVTVRVPTVSFFLSGGPILTLPARNFLI  431

Query  45   PVNKRGIFCFAFAPS  1
            PV++RG FCFAFAPS
Sbjct  432  PVDERGTFCFAFAPS  446



>ref|XP_006437655.1| hypothetical protein CICLE_v10031332mg [Citrus clementina]
 gb|ESR50895.1| hypothetical protein CICLE_v10031332mg [Citrus clementina]
Length=495

 Score =   354 bits (909),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 186/315 (59%), Positives = 234/315 (74%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VRIGVG+PP+ QY+ ID+GS+++WVQCQPC  C+ Q DPVFDP  S+SF+
Sbjct  148  GMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCSQCYKQSDPVFDPADSASFS  207

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V CSS +C+R+ + GC  GRC Y + Y DGSY  GT+  ET+T G TVV++V +GC   
Sbjct  208  GVSCSSAVCDRLENAGCHAGRCRYEVSYGDGSYTKGTLALETLTIGRTVVKNVAIGCGHK  267

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            NQGM  GA GLLGL GGSM+ + Q+ GQTGG FSYCL S    SSGSL FGRE +PVGA 
Sbjct  268  NQGMFVGAAGLLGLGGGSMSLVGQLGGQTGGAFSYCLVSRGTGSSGSLVFGREALPVGAA  327

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPL+R+ RAP+ YY+GLSGLGVG +++PISED+FRLT+ G+ GV+MD GT+VTRLP  A
Sbjct  328  WVPLVRNPRAPSFYYVGLSGLGVGGMRIPISEDLFRLTQMGDDGVVMDTGTAVTRLPTPA  387

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            YE  R  ++ Q   +PRA   S  DTCY+L+G  +V+VPT+SF+F+GG + TL A N LI
Sbjct  388  YEAFRDAFVAQTGNLPRASGVSIFDTCYNLSGFVSVRVPTVSFYFSGGPVLTLPASNFLI  447

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAPS
Sbjct  448  PVDDAGTFCFAFAPS  462



>ref|XP_006484478.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Citrus 
sinensis]
Length=495

 Score =   354 bits (909),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 186/315 (59%), Positives = 234/315 (74%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VRIGVG+PP+ QY+ ID+GS+++WVQCQPC  C+ Q DPVFDP  S+SF+
Sbjct  148  GMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCSQCYKQSDPVFDPADSASFS  207

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V CSS +C+R+ + GC  GRC Y + Y DGSY  GT+  ET+T G TVV++V +GC   
Sbjct  208  GVSCSSAVCDRLENAGCHAGRCRYEVSYGDGSYTKGTLALETLTIGRTVVKNVAIGCGHK  267

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            NQGM  GA GLLGL GGSM+ + Q+ GQTGG FSYCL S    SSGSL FGRE +PVGA 
Sbjct  268  NQGMFVGAAGLLGLGGGSMSLVGQLGGQTGGAFSYCLVSRGTGSSGSLVFGREALPVGAA  327

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPL+R+ RAP+ YY+GLSGLGVG +++PISED+FRLT+ G+ GV+MD GT+VTRLP  A
Sbjct  328  WVPLVRNPRAPSFYYVGLSGLGVGGMRIPISEDLFRLTQMGDDGVVMDTGTAVTRLPTPA  387

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            YE  R  ++ Q   +PRA   S  DTCY+L+G  +V+VPT+SF+F+GG + TL A N LI
Sbjct  388  YEAFRDAFVAQAGNLPRASGVSIFDTCYNLSGFVSVRVPTVSFYFSGGPVLTLPASNFLI  447

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAPS
Sbjct  448  PVDDAGTFCFAFAPS  462



>gb|KDO69941.1| hypothetical protein CISIN_1g011042mg [Citrus sinensis]
Length=495

 Score =   354 bits (909),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 186/315 (59%), Positives = 234/315 (74%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VRIGVG+PP+ QY+ ID+GS+++WVQCQPC  C+ Q DPVFDP  S+SF+
Sbjct  148  GMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCSQCYKQSDPVFDPADSASFS  207

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V CSS +C+R+ + GC  GRC Y + Y DGSY  GT+  ET+T G TVV++V +GC   
Sbjct  208  GVSCSSAVCDRLENAGCHAGRCRYEVSYGDGSYTKGTLALETLTIGRTVVKNVAIGCGHK  267

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            NQGM  GA GLLGL GGSM+ + Q+ GQTGG FSYCL S    SSGSL FGRE +PVGA 
Sbjct  268  NQGMFVGAAGLLGLGGGSMSLVGQLGGQTGGAFSYCLVSRGTGSSGSLVFGREALPVGAA  327

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPL+R+ RAP+ YY+GLSGLGVG +++PISED+FRLT+ G+ GV+MD GT+VTRLP  A
Sbjct  328  WVPLVRNPRAPSFYYVGLSGLGVGGMRIPISEDLFRLTQMGDDGVVMDTGTAVTRLPTPA  387

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            YE  R  ++ Q   +PRA   S  DTCY+L+G  +V+VPT+SF+F+GG + TL A N LI
Sbjct  388  YEAFRDAFVAQTGNLPRASGVSIFDTCYNLSGFVSVRVPTVSFYFSGGPVLTLPASNFLI  447

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAPS
Sbjct  448  PVDDAGTFCFAFAPS  462



>gb|EYU40681.1| hypothetical protein MIMGU_mgv1a005122mg [Erythranthe guttata]
Length=496

 Score =   354 bits (908),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 187/315 (59%), Positives = 230/315 (73%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VRIGVG+P + QY+ ID+GS+++WVQCQPC  C+ Q DPVFDP  S+SF 
Sbjct  149  GMDQGSGEYFVRIGVGSPARSQYMVIDSGSDIVWVQCQPCSQCYHQSDPVFDPADSASFT  208

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V CSS++C+R+ + GC  GRC Y + Y DGSY  GT+  ET+T G T V++V +GC   
Sbjct  209  GVSCSSSVCDRVENSGCHAGRCKYEVSYGDGSYTKGTLAMETLTIGHTTVQNVAIGCGHM  268

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+GM  GA GLLGL GGSM+ + Q+ GQTGG +SYCL S    S GSLEFGR ++P GA 
Sbjct  269  NRGMFIGAAGLLGLGGGSMSLVGQLGGQTGGAYSYCLVSRGTSSYGSLEFGRAVLPAGAA  328

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPLLR+ RAP+ YY+GLSGLGVG  ++PISE  FRLTE G GGV+MD GT+VTRLP  A
Sbjct  329  WVPLLRNPRAPSFYYVGLSGLGVGGTRVPISETTFRLTELGGGGVVMDTGTAVTRLPAAA  388

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y   R  +M + A +PRA   S  DTCYDLNG  TV+VPT+SFF +GG I TL A+N LI
Sbjct  389  YVAFRDTFMAETANLPRAAGVSIFDTCYDLNGFVTVRVPTVSFFLSGGPILTLPARNFLI  448

Query  45   PVNKRGIFCFAFAPS  1
            PV++RG FCFAFAPS
Sbjct  449  PVDERGTFCFAFAPS  463



>ref|XP_004497254.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cicer 
arietinum]
Length=486

 Score =   351 bits (901),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 188/315 (60%), Positives = 232/315 (74%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIGVG+PP+ QY+ ID+GS+++WVQCQPC  C+ Q DPVF+P  SSS++
Sbjct  139  GMEQGSGEYFVRIGVGSPPKNQYVVIDSGSDIIWVQCQPCTQCYRQSDPVFNPGDSSSYS  198

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C ST+C+R+ + GC  GRC Y + Y DGSY  GT+  ET+TFG TV+R+V +GC   
Sbjct  199  GVSCGSTVCSRVENAGCHEGRCHYEVSYGDGSYTKGTLALETVTFGRTVIRNVAIGCGHR  258

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            NQGM  GA GLLGL GG M+F+ Q+  QTGG FSYCL S   ESSGSLEFGRE +PVGA 
Sbjct  259  NQGMFVGAAGLLGLGGGPMSFVGQLGSQTGGAFSYCLVSRGIESSGSLEFGRESVPVGAS  318

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WV L+ + RAP+ YY+GLSGLGVG +++PISEDVFRL E G GGV+MD GT+VTRLP  A
Sbjct  319  WVSLIHNPRAPSFYYVGLSGLGVGGVRVPISEDVFRLNELGEGGVVMDTGTAVTRLPTAA  378

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y+  R  ++ Q   +PR+   S  DTCYDL G  +V+VPTISF+F GG I TL A+N LI
Sbjct  379  YDAFRDAFIGQTTNLPRSSDVSIFDTCYDLYGFVSVRVPTISFYFLGGPILTLPARNFLI  438

Query  45   PVNKRGIFCFAFAPS  1
            PVN  G FCFAFAPS
Sbjct  439  PVNDVGTFCFAFAPS  453



>gb|AES60038.2| aspartic protease in GUARD CELL-like protein [Medicago truncatula]
Length=469

 Score =   350 bits (899),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 174/316 (55%), Positives = 226/316 (72%), Gaps = 2/316 (1%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIG+G+P  YQY+ ID+GS+++W+QC+PC  C+ Q DP+F+P  S+SF 
Sbjct  121  GTEEGSGEYFVRIGIGSPAIYQYMVIDSGSDIVWIQCEPCDQCYNQTDPIFNPATSASFI  180

Query  762  IVPCSSTICNRIH--LGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             V CSS +CN++   + C +GRC Y + Y DGSY  GT+  ETIT G TV++D  +GC  
Sbjct  181  GVACSSNVCNQLDDDVACRKGRCGYQVAYGDGSYTKGTLALETITIGRTVIQDTAIGCGH  240

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+GM  GA GLLGL GG M+F+ Q+  QTGG F YCL S    SSGSLEFGR+ +PVGA
Sbjct  241  WNEGMFVGAAGLLGLGGGPMSFVGQLGAQTGGAFGYCLVSRGTGSSGSLEFGRQAMPVGA  300

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            +WVPL+ +   P+ YY+ LSGL VG I++PISE +F+LT+ G GGV+MD GT++TRLP V
Sbjct  301  MWVPLIHNPFYPSFYYVSLSGLAVGGIRVPISEQIFQLTDIGTGGVVMDTGTAITRLPTV  360

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY   R  ++ Q   +PRAP  S  DTCYDLNG  TV+VPT+SF+F+GGQI T  A+N L
Sbjct  361  AYNAFRDAFIAQTTNLPRAPGVSIFDTCYDLNGFVTVRVPTVSFYFSGGQILTFPARNFL  420

Query  48   IPVNKRGIFCFAFAPS  1
            IP +  G FCFAFAPS
Sbjct  421  IPADDVGTFCFAFAPS  436



>ref|XP_007043208.1| Aspartic proteinase nepenthesin-1, putative [Theobroma cacao]
 gb|EOX99039.1| Aspartic proteinase nepenthesin-1, putative [Theobroma cacao]
Length=481

 Score =   350 bits (899),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 183/315 (58%), Positives = 237/315 (75%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VRIGVG+PP+ QY+ ID+GS+++WVQCQPC  C+ Q DPVFDP  S+S++
Sbjct  134  GMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCNQCYRQSDPVFDPANSASYS  193

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C+S++C+RI + GC  GRC Y ++Y DGSY  GT+  ET+TFG TVV++V +GC   
Sbjct  194  GVSCTSSVCDRIENSGCHAGRCRYEVMYGDGSYTKGTLALETLTFGRTVVKNVAIGCGHI  253

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+GM  GA GLLG+ GGSM+ + Q+ GQTGG FSYCL S  +++SGSL FGR  +PVGA 
Sbjct  254  NRGMFIGAAGLLGVGGGSMSLVGQLGGQTGGAFSYCLVSRGSDASGSLVFGRGAMPVGAA  313

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPLLR+ RAP+ YY+GLSGLGVG I++P+SED FRL+E G GGV+MD GT+VTR P +A
Sbjct  314  WVPLLRNPRAPSFYYVGLSGLGVGGIRVPVSEDTFRLSELGYGGVVMDTGTAVTRFPTLA  373

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y   R  ++ Q A +PRA   S  DTCY+L+G  +V+VPT+SF+F+GG I TL A+N LI
Sbjct  374  YNAFRDAFVAQTANLPRASGVSIFDTCYNLSGFVSVRVPTVSFYFSGGPILTLPARNFLI  433

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFA S
Sbjct  434  PVDDVGTFCFAFASS  448



>gb|KDP40474.1| hypothetical protein JCGZ_24473 [Jatropha curcas]
Length=469

 Score =   349 bits (896),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 186/315 (59%), Positives = 232/315 (74%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIGVG+PP+ QY+ ID+GS+++WVQCQPC  C+ Q DPVFDP  S+SF 
Sbjct  122  GMNQGSGEYFVRIGVGSPPRDQYVVIDSGSDIVWVQCQPCTQCYHQTDPVFDPANSASFI  181

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V CSS +C+R+ +  C  GRC Y ++Y DGSY  GT+  ET+TFG  VVR+V +GC   
Sbjct  182  GVSCSSAVCDRVENADCHAGRCRYEVMYGDGSYTKGTLALETLTFGRAVVRNVAIGCGHR  241

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+GM  GA GLLGL GG+M+ + Q+ GQTGG FSYCL S   +S+GSLEFGR  +PVGA 
Sbjct  242  NRGMFVGAAGLLGLGGGTMSLVGQLGGQTGGTFSYCLVSRGTDSTGSLEFGRGAMPVGAA  301

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            W+PL+R+ RA + YYIGLSGLGVG  K+ ISEDVF+L E GNGGV+MD GT+VTRLP VA
Sbjct  302  WIPLIRNPRASSFYYIGLSGLGVGGEKVDISEDVFQLNEMGNGGVVMDTGTAVTRLPTVA  361

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            YE  R  ++ Q   +PRA   S  DTCY+L G  +V+VPT+SF+FTGG I TL A+N LI
Sbjct  362  YEAFRDAFIGQTGNLPRASGVSIFDTCYNLFGFVSVRVPTVSFYFTGGPILTLPARNFLI  421

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAPS
Sbjct  422  PVDDVGTFCFAFAPS  436



>ref|XP_010248951.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=475

 Score =   348 bits (893),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 179/316 (57%), Positives = 229/316 (72%), Gaps = 2/316 (1%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIGVG+PP+ QY+ +D+GS+++WVQCQPC  C+ Q DPVFDP  S++FA
Sbjct  128  GMEQGSGEYFVRIGVGSPPRNQYMVLDSGSDIVWVQCQPCSQCYRQLDPVFDPAASATFA  187

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V CSST+C R+ + GC  GRC Y + Y DGSY  GT+  ET+TFG TVV++V +GC   
Sbjct  188  GVACSSTVCGRLENAGCRAGRCHYEVSYGDGSYTKGTLALETLTFGRTVVQNVAIGCGHR  247

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+GM  GA GLLGL GGSM+F+ Q+ GQTGG F YCL S   +S GS+ FGR  +PVGA 
Sbjct  248  NRGMFVGAAGLLGLGGGSMSFVGQLGGQTGGAFGYCLVSRGTDSFGSVAFGRGEMPVGAA  307

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTE-QGNGGVIMDIGTSVTRLPKV  229
            WVPLLR+ RAP+ Y++GL+GLGV  I +P+ EDVF  +   G GG I+D GT+VTRLP+ 
Sbjct  308  WVPLLRNPRAPSFYFVGLAGLGVAGIPVPLPEDVFGPSSGYGEGGAIIDTGTAVTRLPRA  367

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AYE LR  ++   A +PRA   S  DTCYDL+G  TV+VPT+SF+ +GG I TL A+N L
Sbjct  368  AYEALRDSFIAGTAGLPRASGVSIFDTCYDLSGFQTVRVPTVSFYLSGGPILTLPARNFL  427

Query  48   IPVNKRGIFCFAFAPS  1
            IPV++ G FCFAFA S
Sbjct  428  IPVDEVGTFCFAFAAS  443



>ref|XP_003536757.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=475

 Score =   348 bits (893),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 185/315 (59%), Positives = 234/315 (74%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIGVG+PP+ QY+ +D+GS+++WVQC+PC  C+ Q DPVF+P  SSSF+
Sbjct  128  GMEQGSGEYFVRIGVGSPPRNQYVVMDSGSDIIWVQCEPCTQCYHQSDPVFNPADSSSFS  187

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C+ST+C+ + +  C  GRC Y + Y DGSY  GT+  ETITFG T++R+V +GC   
Sbjct  188  GVSCASTVCSHVDNAACHEGRCRYEVSYGDGSYTKGTLALETITFGRTLIRNVAIGCGHH  247

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            NQGM  GA GLLGL GG M+F+ Q+ GQTGG FSYCL S   ESSG LEFGRE +PVGA 
Sbjct  248  NQGMFVGAAGLLGLGGGPMSFVGQLGGQTGGAFSYCLVSRGIESSGLLEFGREAMPVGAA  307

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPL+ + RA + YYIGLSGLGVG +++ ISEDVF+L+E G+GGV+MD GT+VTRLP VA
Sbjct  308  WVPLIHNPRAQSFYYIGLSGLGVGGLRVSISEDVFKLSELGDGGVVMDTGTAVTRLPTVA  367

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            YE  R  ++ Q   +PRA   S  DTCYDL G  +V+VPT+SF+F+GG I TL A+N LI
Sbjct  368  YEAFRDGFIAQTTNLPRASGVSIFDTCYDLFGFVSVRVPTVSFYFSGGPILTLPARNFLI  427

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAPS
Sbjct  428  PVDDVGTFCFAFAPS  442



>ref|XP_007142740.1| hypothetical protein PHAVU_007G013000g [Phaseolus vulgaris]
 gb|ESW14734.1| hypothetical protein PHAVU_007G013000g [Phaseolus vulgaris]
Length=475

 Score =   347 bits (891),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 182/315 (58%), Positives = 234/315 (74%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIGVG+PP+ QY+ ID+GS+++WVQC+PC  C+ Q DPVF+P  SSS+A
Sbjct  128  GMEQGSGEYFVRIGVGSPPRNQYVVIDSGSDIIWVQCEPCTQCYRQSDPVFNPADSSSYA  187

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C+ST+C+ + + GC  GRC Y + Y DGSY  GT+  ET+TFG T++R+V +GC   
Sbjct  188  GVSCASTVCSHVDNAGCHEGRCRYEVSYGDGSYTKGTLALETLTFGRTLIRNVAIGCGHR  247

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            NQGM  GA GLLGL GG M+F+ Q+ GQTG  FSYCL S   +SSG LEFGRE +PVGA 
Sbjct  248  NQGMFVGAAGLLGLGGGPMSFVGQLGGQTGEAFSYCLVSRGTQSSGILEFGREAMPVGAA  307

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPL+ ++RA + YY+GL GLGVG +++PISEDVF+L+E G+GGV+MD GT+VTRLP  A
Sbjct  308  WVPLIHNLRAQSFYYVGLLGLGVGGLRIPISEDVFKLSEMGDGGVVMDTGTAVTRLPTAA  367

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            YE  R  ++ Q   +PRA   S  DTCYDL G  +V+VPT+SF+F+GG I TL A+N LI
Sbjct  368  YEAFRDGFIAQTTNLPRASGASIFDTCYDLFGFVSVRVPTVSFYFSGGPILTLPARNFLI  427

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAPS
Sbjct  428  PVDDVGTFCFAFAPS  442



>ref|XP_003555824.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=473

 Score =   347 bits (889),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 181/315 (57%), Positives = 233/315 (74%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIGVG+PP+ QY+ ID+GS+++WVQC+PC  C+ Q DPVF+P  SSS+A
Sbjct  126  GMEQGSGEYFVRIGVGSPPRNQYVVIDSGSDIIWVQCEPCTQCYHQSDPVFNPADSSSYA  185

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C+ST+C+ + + GC  GRC Y + Y DGSY  GT+  ET+TFG T++R+V +GC   
Sbjct  186  GVSCASTVCSHVDNAGCHEGRCRYEVSYGDGSYTKGTLALETLTFGRTLIRNVAIGCGHH  245

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            NQGM  GA GLLGL  G M+F+ Q+ GQ GG FSYCL S   +SSG L+FGRE +PVGA 
Sbjct  246  NQGMFVGAAGLLGLGSGPMSFVGQLGGQAGGTFSYCLVSRGIQSSGLLQFGREAVPVGAA  305

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPL+ + RA + YY+GLSGLGVG +++PISEDVF+L+E G+GGV+MD GT+VTRLP  A
Sbjct  306  WVPLIHNPRAQSFYYVGLSGLGVGGLRVPISEDVFKLSELGDGGVVMDTGTAVTRLPTAA  365

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            YE  R  ++ Q   +PRA   S  DTCYDL G  +V+VPT+SF+F+GG I TL A+N LI
Sbjct  366  YEAFRDAFIAQTTNLPRASGVSIFDTCYDLFGFVSVRVPTVSFYFSGGPILTLPARNFLI  425

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAPS
Sbjct  426  PVDDVGSFCFAFAPS  440



>ref|XP_010908909.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=448

 Score =   346 bits (887),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 177/317 (56%), Positives = 225/317 (71%), Gaps = 3/317 (1%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VR+GVG+PP+ QY+ ID+GS++ WVQCQPC  C+ Q DPVFDP +S+SF 
Sbjct  99   GLEEGSGEYFVRVGVGSPPREQYMVIDSGSDITWVQCQPCSQCYHQADPVFDPAQSASFY  158

Query  762  IVPCSSTICNRIHLG--CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             + C S +C  +     C  G C Y + Y DGSY  G M  E +TFG T VR+V +GC  
Sbjct  159  SIGCDSAVCGLLDRAASCQAGWCRYEVSYGDGSYTKGAMAMEMLTFGPTEVRNVAIGCGH  218

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGR-EIIPVG  412
             N+G+  GA GLLGL GG M+FM Q+ GQTGG FSYCLAS   E  GSL FGR   +P+G
Sbjct  219  HNRGLFVGAAGLLGLGGGPMSFMGQLGGQTGGAFSYCLASRGMEMPGSLVFGRGAAVPIG  278

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPK  232
            A WV L+ + RAP+ YYIGL+GLGVG I+LP+ E+VFRL+E G+GGVIMD GT+VTRLP 
Sbjct  279  ATWVQLISNPRAPSFYYIGLAGLGVGGIRLPVPEEVFRLSEMGDGGVIMDTGTAVTRLPM  338

Query  231  VAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNI  52
            +AYE +R  ++     +PRAP+ S  DTCYDL+G GTVQVPT+SF+F+ G + TL A+N 
Sbjct  339  LAYEAMRNGFVQGTMGLPRAPTTSIFDTCYDLSGFGTVQVPTVSFYFSSGTVLTLPARNY  398

Query  51   LIPVNKRGIFCFAFAPS  1
            +IPV+  G FC AFAPS
Sbjct  399  MIPVDGLGTFCLAFAPS  415



>ref|XP_010103590.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
 gb|EXB96367.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
Length=521

 Score =   347 bits (890),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 184/315 (58%), Positives = 228/315 (72%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VRIGVG+P + QY+ ID+GS+++WVQCQPC  C+ Q DPVFDP  S+S+ 
Sbjct  174  GMDQGSGEYFVRIGVGSPARSQYMVIDSGSDIVWVQCQPCSQCYHQTDPVFDPADSASYE  233

Query  762  IVPCSSTICNRIH-LGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V CSS +C+R+   GC  GRC Y + Y DGSY  G +  ET+T G  V++DV +GC   
Sbjct  234  FVSCSSAVCDRLEDAGCNAGRCRYEVSYGDGSYTRGNLALETLTIGRAVIKDVAIGCGHM  293

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+GM  GA GLLGL GGS++F+ Q+ GQTGG FSYCL S    SSGSL FGR  +PVGA 
Sbjct  294  NRGMFVGAAGLLGLGGGSLSFVGQLGGQTGGAFSYCLVSLGTGSSGSLVFGRGALPVGAA  353

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPL+R+ RAP+ YYIGL GLG+G  ++PISED+FRLTE G+GGV+MD GT+VTRLP  A
Sbjct  354  WVPLIRNPRAPSFYYIGLVGLGIGGTRVPISEDMFRLTELGDGGVVMDTGTAVTRLPTAA  413

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            YE  R  ++ Q A +PRAP  S  DTCYDL G  +V+VPTISF+ + G I TL A+N LI
Sbjct  414  YEAFRDAFLQQTANLPRAPEVSIFDTCYDLYGFVSVRVPTISFYLSSGPILTLPARNFLI  473

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAPS
Sbjct  474  PVDDVGTFCFAFAPS  488



>ref|XP_004297710.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Fragaria 
vesca subsp. vesca]
Length=477

 Score =   345 bits (885),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 182/318 (57%), Positives = 237/318 (75%), Gaps = 4/318 (1%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY VRIGVG+P + QY+ ID+GS+++WVQCQPC  C+ Q DP+FDP+RS+S++
Sbjct  127  GMAQGSGEYFVRIGVGSPARSQYVVIDSGSDIVWVQCQPCSQCYHQSDPIFDPSRSASYS  186

Query  762  IVPCSSTICNRIH--LGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             V C+ST+C+R+    GC  GRCSY   Y DGSY  GT+  ET+TFG  ++R+V +GC  
Sbjct  187  GVSCTSTVCDRLQNSAGCHAGRCSYEASYGDGSYTQGTLAFETLTFGRALIRNVAIGCGH  246

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASW-HAESSGSLEFGREIIPVG  412
             N+GM  GA GLLG+ GG M+F+ Q+ GQTGG FSYCL S   A ++G+LEFGR  +PVG
Sbjct  247  MNRGMFVGAAGLLGIGGGPMSFVGQLGGQTGGAFSYCLVSRGDASTAGTLEFGRAAMPVG  306

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPK  232
            A WVPL+R+ RAP+ YY+GL+GLGVG +++PISEDVFR TE G GGV+MD GT+VTR P 
Sbjct  307  AAWVPLIRNQRAPSFYYVGLAGLGVGGMRVPISEDVFRQTELGYGGVVMDTGTAVTRFPT  366

Query  231  VAYETLRYIYMTQIATIPR-APSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
            +AYE  R  ++ Q A++PR +   S  DTCYDLNG  +V+VPT+SF+FTGG I TL A+N
Sbjct  367  LAYEAFRDTFVEQTASLPRVSGGVSIFDTCYDLNGFVSVRVPTVSFYFTGGPILTLPARN  426

Query  54   ILIPVNKRGIFCFAFAPS  1
             LIPV+ +G FC AFAPS
Sbjct  427  FLIPVDDKGTFCLAFAPS  444



>ref|XP_006406427.1| hypothetical protein EUTSA_v10020671mg [Eutrema salsugineum]
 gb|ESQ47880.1| hypothetical protein EUTSA_v10020671mg [Eutrema salsugineum]
Length=468

 Score =   344 bits (883),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 181/315 (57%), Positives = 232/315 (74%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VRIGVG+PP+ QY+ ID+GS+++WVQCQPCK C+ Q DPVFDP +S S+ 
Sbjct  121  GMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQSDPVFDPAKSGSYT  180

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C S++C+RI + GC  G C Y ++Y DGSY  GT+  ET+TFG TVVR+V MGC   
Sbjct  181  GVSCGSSVCDRIENSGCNSGGCRYEVMYGDGSYTKGTLALETLTFGRTVVRNVAMGCGHR  240

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+GM  GA GLLG+ GGSM+F+ Q+ GQTGG F YCL S   ES+GSL FGRE +PVGA 
Sbjct  241  NRGMFIGAAGLLGIGGGSMSFVGQLTGQTGGAFGYCLVSRGTESTGSLVFGREALPVGAS  300

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPL+R+ RAP+ YY+GL GLGVG +++P+ + VF LTE G+GGV+MD GT+VTRLP  A
Sbjct  301  WVPLVRNPRAPSFYYVGLMGLGVGGVRIPLPDAVFDLTETGDGGVVMDTGTAVTRLPTAA  360

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y   R  + +Q A +PRA   S  DTCYDL+G  +V+VPT+SF+FT G + TL A+N L+
Sbjct  361  YAAFRDGFKSQTANLPRASGVSIFDTCYDLSGFVSVRVPTVSFYFTEGPVLTLPARNFLM  420

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G +CFAFA S
Sbjct  421  PVDDSGTYCFAFAAS  435



>ref|XP_010031370.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Eucalyptus 
grandis]
Length=496

 Score =   344 bits (883),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 182/315 (58%), Positives = 229/315 (73%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VRIGVG+P + QY+ ID+GS+++WVQCQPC  C+ Q DPVFDP+ S+SF+
Sbjct  151  GMDQGSGEYFVRIGVGSPARSQYMVIDSGSDIVWVQCQPCNQCYRQSDPVFDPSASASFS  210

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             VPC ST+C+R+ + GC  GRC Y + Y DGSY  GTM  ET+TFG  VV +V +GC   
Sbjct  211  GVPCGSTVCDRLENAGCRSGRCHYEVSYGDGSYTKGTMALETLTFGRYVVGNVAIGCGHM  270

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+GM  GA GLLGL GGSM+ + Q+ G TGG FSYCL +    ++GSLEFGR  +PVGAV
Sbjct  271  NRGMFIGAAGLLGLGGGSMSLVGQLSGDTGGAFSYCLVTRGKAAAGSLEFGRRAMPVGAV  330

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPL+ + +A + YYIGL+GLGVG +++PISED FRL E GNGGV+MD GT+VTR P  A
Sbjct  331  WVPLIHNPQAASFYYIGLAGLGVGGVRVPISEDTFRLDELGNGGVVMDTGTAVTRFPAPA  390

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y   R  ++ Q   +PRA   S  DTCY+LNG  TV+VPT+SF+F+GG + TL A N LI
Sbjct  391  YTAFRDAFLAQTTNLPRATGVSIFDTCYNLNGFVTVRVPTVSFYFSGGPMLTLPATNFLI  450

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAPS
Sbjct  451  PVDDAGTFCFAFAPS  465



>gb|KEH44446.1| aspartic protease in GUARD CELL-like protein [Medicago truncatula]
Length=486

 Score =   344 bits (882),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 189/315 (60%), Positives = 231/315 (73%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIGVG+PP+ QY+ +D+GS+++WVQCQPC  C+ Q DPVF+P  SSS+A
Sbjct  139  GMEQGSGEYFVRIGVGSPPKNQYVVVDSGSDIIWVQCQPCTQCYHQSDPVFNPEDSSSYA  198

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C ST+C+R+ + GC  GRC Y + Y DGSY  GT+  ETIT GGTV+R+V +GC   
Sbjct  199  GVSCGSTVCSRVENAGCHEGRCRYEVSYGDGSYTKGTLALETITLGGTVIRNVAIGCGHR  258

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            NQGM  GA GLLGL  G M+F+ Q+ GQTGG FSYCL S   ESSGSLEFGRE +PVGA 
Sbjct  259  NQGMFVGAAGLLGLGSGPMSFVGQLGGQTGGTFSYCLVSRGTESSGSLEFGRESVPVGAS  318

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WV L+ + RAP+ YYIGLSGLGVG +++PISED+FRL E G GGV+MD GT+VTRLP  A
Sbjct  319  WVSLIHNPRAPSFYYIGLSGLGVGGLRVPISEDIFRLNELGEGGVVMDTGTAVTRLPAAA  378

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y   R  ++ Q   +P+    S  DTCYDLNG  TV+VPTISF+F GG I TL A+N LI
Sbjct  379  YNAFRDAFVAQTTNLPKTSGVSIFDTCYDLNGFVTVRVPTISFYFLGGPILTLPARNFLI  438

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAPS
Sbjct  439  PVDSVGTFCFAFAPS  453



>ref|XP_009145693.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Brassica 
rapa]
Length=467

 Score =   342 bits (877),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 179/315 (57%), Positives = 231/315 (73%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VRIGVG+PP+ QY+ ID+GS+++WVQCQPCK C+ Q DPVFDP +S S+ 
Sbjct  120  GMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQSDPVFDPAKSGSYT  179

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C S++C+RI + GC  G C Y ++Y DGSY  GT+  ET+TFG TV+R+V MGC   
Sbjct  180  GVSCGSSVCDRIENSGCHSGGCRYEVMYGDGSYTKGTLALETLTFGRTVIRNVAMGCGHR  239

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+GM  GA GLLG+ GGSM+F+ Q+ GQTGG F YCL S   +S+GSL FGRE +PVGA 
Sbjct  240  NRGMFVGAAGLLGIGGGSMSFVGQLTGQTGGAFGYCLVSRGTDSTGSLVFGREALPVGAS  299

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPL+R+ RAP+ YY+GL GLGVG +++ + +DVF LTE G+GGV+MD GT+VTRLP  A
Sbjct  300  WVPLVRNPRAPSFYYVGLKGLGVGGVRIALPDDVFDLTETGDGGVVMDTGTAVTRLPTAA  359

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y   R  +  Q A +PRA   S  DTCYDL+G  +V+VPT+SF+FT G + TL A+N L+
Sbjct  360  YAAFRDGFKAQTANLPRASGVSIFDTCYDLSGFVSVRVPTVSFYFTEGPVLTLPARNFLM  419

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G +CFAFA S
Sbjct  420  PVDDSGTYCFAFAAS  434



>emb|CBI35367.3| unnamed protein product [Vitis vinifera]
Length=521

 Score =   343 bits (881),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 177/315 (56%), Positives = 225/315 (71%), Gaps = 20/315 (6%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIGVG+PP+ QY+ ID+GS+++WVQCQPC  C+ Q DPVFDP  S+SF 
Sbjct  193  GMEQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCTQCYHQSDPVFDPADSASFT  252

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V CSS++C+R+ + GC  GRC Y + Y DGSY  GT+  ET+TFG T+VR V +GC   
Sbjct  253  GVSCSSSVCDRLENAGCHAGRCRYEVSYGDGSYTKGTLALETLTFGRTMVRSVAIGCGHR  312

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+GM  GA GLLGL GGSM+F+ Q+ GQTGG FSYCL S                   A 
Sbjct  313  NRGMFVGAAGLLGLGGGSMSFVGQLGGQTGGAFSYCLVS-------------------AA  353

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPL+R+ RAP+ YYIGL+GLGVG I++PISE+VFRLTE G+GGV+MD GT+VTRLP +A
Sbjct  354  WVPLVRNPRAPSFYYIGLAGLGVGGIRVPISEEVFRLTELGDGGVVMDTGTAVTRLPTLA  413

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y+  R  ++ Q A +PRA   +  DTCYDL G  +V+VPT+SF+F+GG I TL A+N LI
Sbjct  414  YQAFRDAFLAQTANLPRATGVAIFDTCYDLLGFVSVRVPTVSFYFSGGPILTLPARNFLI  473

Query  45   PVNKRGIFCFAFAPS  1
            P++  G FCFAFAPS
Sbjct  474  PMDDAGTFCFAFAPS  488



>ref|XP_007153018.1| hypothetical protein PHAVU_003G000900g [Phaseolus vulgaris]
 gb|ESW25012.1| hypothetical protein PHAVU_003G000900g [Phaseolus vulgaris]
Length=464

 Score =   340 bits (873),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 178/315 (57%), Positives = 231/315 (73%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIG+G+P  YQY+ ID+GS+++WVQCQPC  C+ Q DP+F+P  S+SFA
Sbjct  117  GMEEGSGEYFVRIGIGSPATYQYMVIDSGSDIVWVQCQPCDLCYNQSDPIFNPALSASFA  176

Query  762  IVPCSSTICNRIH-LGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             VPCSS++C+++   GC +GRC Y + Y DGSY  GT+  ETIT G T++R+  +GC   
Sbjct  177  GVPCSSSVCDQLDDAGCHQGRCRYEVAYGDGSYTRGTLALETITLGRTLIRNTAIGCGTW  236

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            NQGM  GA GLLGL  G M+F+ Q+ GQTGG F+YCL S  + +SGSL+FGR+ +P+GA 
Sbjct  237  NQGMFVGAAGLLGLGAGPMSFVGQLGGQTGGAFAYCLLSRGSAASGSLQFGRQALPLGAA  296

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPL+ +   P+ YY+GLSGLGVG  +L ISEDVFR+T+ G+GG +MD GT+VTRLP  A
Sbjct  297  WVPLIPNPFFPSFYYVGLSGLGVGGSRLNISEDVFRVTDLGDGGTVMDTGTAVTRLPTPA  356

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y T R  ++ Q   +PRAP  S  DTCYDLNG  TV+VPT+SF+F+GGQI TL A+N LI
Sbjct  357  YRTFRDAFLAQTTNLPRAPGLSIFDTCYDLNGFVTVRVPTVSFYFSGGQILTLPARNFLI  416

Query  45   PVNKRGIFCFAFAPS  1
            P +  G FCFAFA S
Sbjct  417  PADDVGTFCFAFAAS  431



>ref|XP_008465249.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Cucumis 
melo]
Length=477

 Score =   341 bits (874),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 178/315 (57%), Positives = 234/315 (74%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIGVG+PP+ QY+ ID+GS+++WVQCQPC  C+ Q DPVFDP  S+++A
Sbjct  130  GTEQGSGEYFVRIGVGSPPRSQYVVIDSGSDIVWVQCQPCSECYQQSDPVFDPAGSATYA  189

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             + C S++C+R+ + GC  GRC Y + Y DGSY  GT+  ET+TFG  ++R++ +GC   
Sbjct  190  GISCDSSVCDRLDNAGCNDGRCRYEVSYGDGSYTRGTLALETLTFGRILIRNIAIGCGHM  249

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+GM  GA GLLGL GG+M+F+ Q+ GQTGG FSYCL S   ES+G+LEFGR  +PVGA 
Sbjct  250  NRGMFIGAAGLLGLGGGAMSFVGQLGGQTGGAFSYCLVSRGTESTGTLEFGRGAMPVGAA  309

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPL+R+ RAP+ YY+GLSGLGVG I++PI E +F LT+ G GGV+MD GT+VTRLP  A
Sbjct  310  WVPLIRNPRAPSFYYVGLSGLGVGGIRVPIPEQIFELTDLGYGGVVMDTGTAVTRLPAPA  369

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            YE  R  ++ Q A +PR+   S  DTCY+LNG  +V+VPT+SF+F+GG I TL A+N LI
Sbjct  370  YEAFRDTFIGQTANLPRSDRVSIFDTCYNLNGFVSVRVPTVSFYFSGGPILTLPARNFLI  429

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFA S
Sbjct  430  PVDGEGTFCFAFAAS  444



>ref|NP_188636.2| protein ASPARTIC PROTEASE IN GUARD CELL 2 [Arabidopsis thaliana]
 sp|Q9LHE3.1|ASPG2_ARATH RecName: Full=Protein ASPARTIC PROTEASE IN GUARD CELL 2; Short=AtASPG2; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB03167.1| nucleoid chloroplast DNA-binding protein-like [Arabidopsis thaliana]
 gb|AAO41867.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76319.1| protein aspartic protease in guard cell 2 [Arabidopsis thaliana]
Length=470

 Score =   340 bits (873),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 179/315 (57%), Positives = 231/315 (73%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VRIGVG+PP+ QY+ ID+GS+++WVQCQPCK C+ Q DPVFDP +S S+ 
Sbjct  123  GMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQSDPVFDPAKSGSYT  182

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C S++C+RI + GC  G C Y ++Y DGSY  GT+  ET+TF  TVVR+V MGC   
Sbjct  183  GVSCGSSVCDRIENSGCHSGGCRYEVMYGDGSYTKGTLALETLTFAKTVVRNVAMGCGHR  242

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+GM  GA GLLG+ GGSM+F+ Q+ GQTGG F YCL S   +S+GSL FGRE +PVGA 
Sbjct  243  NRGMFIGAAGLLGIGGGSMSFVGQLSGQTGGAFGYCLVSRGTDSTGSLVFGREALPVGAS  302

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPL+R+ RAP+ YY+GL GLGVG +++P+ + VF LTE G+GGV+MD GT+VTRLP  A
Sbjct  303  WVPLVRNPRAPSFYYVGLKGLGVGGVRIPLPDGVFDLTETGDGGVVMDTGTAVTRLPTAA  362

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y   R  + +Q A +PRA   S  DTCYDL+G  +V+VPT+SF+FT G + TL A+N L+
Sbjct  363  YVAFRDGFKSQTANLPRASGVSIFDTCYDLSGFVSVRVPTVSFYFTEGPVLTLPARNFLM  422

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G +CFAFA S
Sbjct  423  PVDDSGTYCFAFAAS  437



>ref|XP_004150193.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
sativus]
 ref|XP_004170426.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
sativus]
Length=476

 Score =   340 bits (873),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 178/315 (57%), Positives = 234/315 (74%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIGVG+PP+ QY+ ID+GS+++WVQCQPC  C+ Q DPVFDP  S+++A
Sbjct  129  GTEQGSGEYFVRIGVGSPPRSQYVVIDSGSDIVWVQCQPCSECYQQSDPVFDPAGSATYA  188

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             + C S++C+R+ + GC  GRC Y + Y DGSY  GT+  ET+TFG  ++R++ +GC   
Sbjct  189  GISCDSSVCDRLDNAGCNDGRCRYEVSYGDGSYTRGTLALETLTFGRVLIRNIAIGCGHM  248

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+GM  GA GLLGL GG+M+F+ Q+ GQTGG FSYCL S   ES+G+LEFGR  +PVGA 
Sbjct  249  NRGMFIGAAGLLGLGGGAMSFVGQLGGQTGGAFSYCLVSRGTESTGTLEFGRGAMPVGAA  308

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPL+R+ RAP+ YY+GLSGLGVG I++PI E +F LT+ G GGV+MD GT+VTRLP  A
Sbjct  309  WVPLIRNPRAPSFYYVGLSGLGVGGIRVPIPEQIFELTDLGYGGVVMDTGTAVTRLPAPA  368

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            YE  R  ++ Q A +PR+   S  DTCY+LNG  +V+VPT+SF+F+GG I TL A+N LI
Sbjct  369  YEAFRDTFIGQTANLPRSDRVSIFDTCYNLNGFVSVRVPTVSFYFSGGPILTLPARNFLI  428

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFA S
Sbjct  429  PVDGEGTFCFAFAAS  443



>ref|XP_002885351.1| pepsin A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61610.1| pepsin A [Arabidopsis lyrata subsp. lyrata]
Length=471

 Score =   340 bits (873),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 179/315 (57%), Positives = 231/315 (73%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VRIGVG+PP+ QY+ ID+GS+++WVQCQPCK C+ Q DPVFDP +S S+ 
Sbjct  124  GMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQSDPVFDPAKSGSYT  183

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C S++C+RI + GC  G C Y ++Y DGSY  GT+  ET+TF  TVVR+V MGC   
Sbjct  184  GVSCGSSVCDRIENSGCHSGGCRYEVMYGDGSYTKGTLALETLTFAKTVVRNVAMGCGHR  243

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+GM  GA GLLG+ GGSM+F+ Q+ GQTGG F YCL S   +S+GSL FGRE +PVGA 
Sbjct  244  NRGMFIGAAGLLGIGGGSMSFVGQLSGQTGGAFGYCLVSRGTDSTGSLVFGREALPVGAS  303

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPL+R+ RAP+ YY+GL GLGVG +++P+ + VF LTE G+GGV+MD GT+VTRLP  A
Sbjct  304  WVPLVRNPRAPSFYYVGLKGLGVGGVRIPLPDGVFDLTETGDGGVVMDTGTAVTRLPTGA  363

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y   R  + +Q A +PRA   S  DTCYDL+G  +V+VPT+SF+FT G + TL A+N L+
Sbjct  364  YAAFRDGFKSQTANLPRASGVSIFDTCYDLSGFVSVRVPTVSFYFTEGPVLTLPARNFLM  423

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G +CFAFA S
Sbjct  424  PVDDSGTYCFAFAAS  438



>ref|XP_010508355.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=471

 Score =   340 bits (872),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 178/315 (57%), Positives = 231/315 (73%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VRIGVG+PP+ QY+ ID+GS+++WVQCQPCK C+ Q DPVFDP +S S+ 
Sbjct  124  GMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQSDPVFDPAKSGSYT  183

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C S++C+R+ + GC    C Y ++Y DGSY  GT+  ET+TF  TVVR+V MGC   
Sbjct  184  GVSCGSSVCDRVGNSGCHSDGCRYEVMYGDGSYTKGTLALETLTFAKTVVRNVAMGCGHR  243

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+GM  GA GLLG+ GGSM+F+ Q+ GQTGG F YCL S   +S+GSL FGRE +PVGA 
Sbjct  244  NRGMFIGAAGLLGIGGGSMSFVGQLTGQTGGAFGYCLVSRGTDSTGSLVFGREALPVGAS  303

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPL+R+ +AP+ YY+GL GLGVG I++P+ + VF LTE G+GGV+MD GT+VTRLP VA
Sbjct  304  WVPLIRNPQAPSFYYVGLKGLGVGGIRVPLPDGVFDLTETGDGGVVMDTGTAVTRLPTVA  363

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y   R  + +Q A +PRA   S  DTCYDL+G  +V+VPT+SF+FT G + TL A+N L+
Sbjct  364  YAAFRDGFKSQTANLPRASGVSIFDTCYDLSGFVSVRVPTVSFYFTEGPVLTLPARNFLM  423

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G +CFAFA S
Sbjct  424  PVDDTGTYCFAFAAS  438



>ref|XP_010487964.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=470

 Score =   338 bits (868),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 176/315 (56%), Positives = 231/315 (73%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VRIGVG+PP+ QY+ ID+GS+++WVQCQPCK C+ Q DPVFDP +S S+ 
Sbjct  123  GMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQSDPVFDPAKSGSYT  182

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C S++C+R+ + GC    C Y ++Y DGSY  GT+  ET+TF  TVVR+V MGC   
Sbjct  183  GVSCGSSVCDRVGNSGCHSDGCRYEVMYGDGSYTKGTLALETLTFAKTVVRNVAMGCGHR  242

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+GM  GA GLLG+ GGSM+F+ Q+ GQTGG F YCL S   +S+GSL FGRE +PVGA 
Sbjct  243  NRGMFIGAAGLLGIGGGSMSFVGQLTGQTGGAFGYCLVSRGTDSTGSLVFGREALPVGAS  302

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPL+R+ +AP+ YY+GL GLGVG +++P+ + VF LTE G+GGV+MD GT+VTRLP VA
Sbjct  303  WVPLIRNPQAPSFYYVGLKGLGVGGVRVPLPDGVFDLTETGDGGVVMDTGTAVTRLPTVA  362

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y   R ++ +Q A +PRA   S  DTCYDL+G  +V+VPT+S +FT G + TL A+N L+
Sbjct  363  YAAFRDVFKSQTANLPRASGVSIFDTCYDLSGFVSVRVPTVSLYFTEGPVLTLPARNFLM  422

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G +CFAFA S
Sbjct  423  PVDDTGTYCFAFAAS  437



>ref|XP_010466176.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Camelina 
sativa]
Length=470

 Score =   338 bits (866),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 177/315 (56%), Positives = 231/315 (73%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VRIGVG+PP+ QY+ ID+GS+++WVQCQPCK C+ Q DPVFDP +S S+ 
Sbjct  123  GMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQSDPVFDPAKSGSYT  182

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C S++C+R+ + GC    C Y ++Y DGSY  GT+  ET+TF  TVVR+V MGC   
Sbjct  183  GVSCGSSVCDRVGISGCHSDGCRYEVMYGDGSYTKGTLALETLTFSKTVVRNVAMGCGHR  242

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+GM  GA GLLG+ GGSM+F+ Q+ GQTGG F YCL S   +S+GSL FGRE +PVGA 
Sbjct  243  NRGMFIGAAGLLGIGGGSMSFVGQLTGQTGGAFGYCLVSRGTDSTGSLVFGREALPVGAS  302

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPL+R+ +AP+ YY+GL GLGVG +++P+ + VF LTE G+GGV+MD GT+VTRLP VA
Sbjct  303  WVPLIRNPQAPSFYYVGLKGLGVGGVRVPLPDGVFDLTETGDGGVVMDTGTAVTRLPTVA  362

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y   R  + +Q A +PRA   S  DTCYDL+G  +V+VPT+SF+FT G + TL A+N L+
Sbjct  363  YAAFRDGFKSQTANLPRASGVSIFDTCYDLSGFVSVRVPTVSFYFTEGPVLTLPARNFLM  422

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G +CFAFA S
Sbjct  423  PVDDTGTYCFAFAAS  437



>ref|XP_006297584.1| hypothetical protein CARUB_v10013606mg [Capsella rubella]
 gb|EOA30482.1| hypothetical protein CARUB_v10013606mg [Capsella rubella]
Length=475

 Score =   338 bits (866),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 176/315 (56%), Positives = 230/315 (73%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VRIGVG+PP+ QY+ ID+GS+++WVQCQPCK C+ Q DPVFDP +S S+ 
Sbjct  128  GMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQSDPVFDPAKSGSYT  187

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C S++C+R+ + GC    C Y ++Y DGSY  GT+  ET+TF  TVVR+V MGC   
Sbjct  188  GVSCGSSVCDRVGNSGCHSDGCRYEVMYGDGSYTKGTLALETLTFAKTVVRNVAMGCGHR  247

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+GM  GA GLLG+ GGSM+F+ Q+ GQTGG F YCL S   +S+GSL FGRE +PVGA 
Sbjct  248  NRGMFIGAAGLLGIGGGSMSFVGQLSGQTGGAFGYCLVSRGTDSTGSLVFGREALPVGAS  307

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPL+R+ +AP+ YY+GL GLGVG +++P+ + VF LTE G+GGV+MD GT+VTRLP  A
Sbjct  308  WVPLIRNPQAPSFYYVGLKGLGVGGVRIPLPDGVFDLTESGDGGVVMDTGTAVTRLPTAA  367

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y   R  + +Q A +PRA   S  DTCYDL+G  +V+VPT+SF+FT G + TL A+N L+
Sbjct  368  YAAFRDGFKSQTANLPRASGVSIFDTCYDLSGFVSVRVPTVSFYFTEGPVLTLPARNFLM  427

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G +CFAFA S
Sbjct  428  PVDDSGTYCFAFAAS  442



>gb|KFK39328.1| hypothetical protein AALP_AA3G230300 [Arabis alpina]
Length=460

 Score =   337 bits (864),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 178/315 (57%), Positives = 229/315 (73%), Gaps = 1/315 (0%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VRIGVG+PP+ QY+ ID+GS+++WVQCQPCK C+ Q DPVFDP +S S+ 
Sbjct  113  GMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQSDPVFDPAKSGSYT  172

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C S++C+RI + GC  G C Y ++Y DGSY  GT+  ET+TFG TVVR+V MGC   
Sbjct  173  GVSCGSSVCDRIENSGCHSGGCRYEVMYGDGSYTKGTLALETLTFGRTVVRNVAMGCGHR  232

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+GM  GA GLLGL GGSM+F+ Q+  QTGG F YCL S   ES+GSL FGRE +PVGA 
Sbjct  233  NRGMFIGAAGLLGLGGGSMSFVGQLTAQTGGAFGYCLVSRGTESTGSLVFGREALPVGAS  292

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPL+R+ RAP+ YY+GL GLGVG +++P+    F LT+ G+GGV+MD GT+VTRLP  A
Sbjct  293  WVPLVRNPRAPSFYYVGLKGLGVGGVRIPLPGSAFDLTQTGDGGVVMDTGTAVTRLPTAA  352

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y   R  + +Q A +PRA   S  DTCYDL+G  +V+VPT+SF+F+ G + TL A+N L+
Sbjct  353  YAAFRDGFKSQTANLPRASGVSIFDTCYDLSGFVSVRVPTVSFYFSEGPVLTLPARNFLM  412

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G +CFAFA S
Sbjct  413  PVDDSGTYCFAFAAS  427



>ref|XP_004498097.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Cicer arietinum]
Length=478

 Score =   338 bits (866),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 170/316 (54%), Positives = 224/316 (71%), Gaps = 2/316 (1%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIG+G+P  YQY+ ID+GS+++W+QCQPC  C+ Q DP+F+P  S+SF 
Sbjct  130  GSEEGSGEYFVRIGIGSPAIYQYMVIDSGSDIVWIQCQPCHQCYNQSDPIFNPATSASFI  189

Query  762  IVPCSSTICNRIHLG--CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             V CSS++C+++  G  C +GRC Y + Y DGSY  GT+  ETIT G T++++  +GC  
Sbjct  190  GVSCSSSVCDQLDDGVACRQGRCGYQVDYGDGSYTKGTLALETITIGRTLIQETAIGCGH  249

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+GM  GA GLLGL GG M+F+ Q+  QT   F YCL S   ESSGSLEFG + +P+GA
Sbjct  250  WNEGMFVGAAGLLGLGGGPMSFVGQLGAQTDRAFGYCLLSRGTESSGSLEFGHKAMPIGA  309

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
             WVPL+ +   PT YYI LSGL VG I++PISE +F +T+ G GGV+MD GT+VTR P +
Sbjct  310  TWVPLIHNPFFPTFYYISLSGLAVGGIQVPISEQIFSVTDLGIGGVVMDTGTAVTRFPTI  369

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY + R  ++ Q   +PRA   S  DTCYDLNG  TV++PT+SF+F+GGQI TL A+NIL
Sbjct  370  AYNSFRDAFLAQTTNLPRANGVSIFDTCYDLNGFVTVRIPTVSFYFSGGQILTLPARNIL  429

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+  G FCFAFA S
Sbjct  430  IPVDDVGSFCFAFAAS  445



>ref|XP_008791252.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Phoenix 
dactylifera]
Length=469

 Score =   333 bits (854),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 173/317 (55%), Positives = 221/317 (70%), Gaps = 3/317 (1%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VR+GVG+PP+ QY+ ID+GS++ WVQCQPC  C+ Q  PVFDP +S++F 
Sbjct  120  GLEEGSGEYFVRVGVGSPPREQYMVIDSGSDITWVQCQPCSQCYHQAGPVFDPAQSTTFY  179

Query  762  IVPCSSTICNRIHLG--CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             V C ST+C  +     C  G C Y + Y DGSY  GTM  E +TFG T VR+V +GC  
Sbjct  180  NVGCDSTVCGLLDRAARCQAGWCRYEVSYRDGSYTKGTMALEMLTFGQTEVRNVAIGCGH  239

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGR-EIIPVG  412
             N+G+  GA GLLGL  G M+FMAQ+ GQTGG F YCLAS   E  GS+ FGR  ++P  
Sbjct  240  RNRGLFVGAAGLLGLGRGPMSFMAQLGGQTGGAFLYCLASRGMEMPGSIVFGRGAVVPTS  299

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPK  232
            A+WVPL+R+  AP+ YYI L GLGVG I+LP+ E+VFRL+  G+GGVIMD GT+VTRLP 
Sbjct  300  AMWVPLMRNPWAPSLYYIRLVGLGVGGIRLPVPEEVFRLSAMGDGGVIMDTGTAVTRLPV  359

Query  231  VAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNI  52
            +AYE +R  ++     +P AP+ S  DTCYDL+G  TVQVPT+SF+F GG + TL A+N 
Sbjct  360  LAYEAVRNAFVQGTMGLPWAPATSIFDTCYDLSGFRTVQVPTVSFYFAGGTVLTLPARNY  419

Query  51   LIPVNKRGIFCFAFAPS  1
            +IPV+  G FC AFAPS
Sbjct  420  MIPVDGMGTFCLAFAPS  436



>ref|XP_010279486.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=483

 Score =   328 bits (841),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 186/320 (58%), Positives = 234/320 (73%), Gaps = 6/320 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VRIGVG+PP+ QY+ ID+GS+++WVQCQPC  C+ Q DPVFDP  S++FA
Sbjct  131  GVDQGSGEYFVRIGVGSPPRNQYMVIDSGSDIVWVQCQPCNQCYRQLDPVFDPADSATFA  190

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V CSST+C  + + GC  GRC Y + Y DGSY  GT+  ET+TFG TVVR+V +GC   
Sbjct  191  GVACSSTVCGLLENAGCRAGRCRYEVSYGDGSYTKGTLALETLTFGRTVVRNVAIGCGHR  250

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWH--AESSGSLEFGREIIPVG  412
            N+GM  GA GLLGL GGSM+F+ Q+ GQTGG F YCL S    + S GSL FG   +PVG
Sbjct  251  NRGMFVGAAGLLGLGGGSMSFVGQLGGQTGGAFGYCLVSRGTGSGSYGSLVFGLGAMPVG  310

Query  411  -AVWVPLLRSIRAPTTYYIGLSGLGVGN--IKLPISEDVFRLTEQGNGGVIMDIGTSVTR  241
             A WV LLR+ RAP+ YY+GL+GLGVG   + LP +EDVFRL+E G+GGV++D GT+VTR
Sbjct  311  GAAWVRLLRNPRAPSFYYVGLAGLGVGGVPVSLPEAEDVFRLSEYGDGGVVLDTGTAVTR  370

Query  240  LPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAA  61
            LP  AY+ LR  +++  A +PRAP  S  DTCY+L G  TV+VPT+SF+F+GG I TL A
Sbjct  371  LPGPAYQALRDTFISGTAGLPRAPGVSIFDTCYNLLGFETVRVPTVSFYFSGGPILTLPA  430

Query  60   KNILIPVNKRGIFCFAFAPS  1
            +N LIPV++ G FCFAFAPS
Sbjct  431  RNFLIPVDEVGTFCFAFAPS  450



>ref|XP_009385987.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Musa acuminata 
subsp. malaccensis]
Length=464

 Score =   327 bits (837),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 174/322 (54%), Positives = 224/322 (70%), Gaps = 8/322 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VR+GVG PP+ QYL +D+GS+++W+QC+PC  C+ Q +PVFDP  S+SFA
Sbjct  110  GLEEGSGEYFVRVGVGVPPRDQYLVVDSGSDIVWIQCRPCSQCYAQSEPVFDPAESASFA  169

Query  762  IVPCSSTICNRI------HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTM  601
             V C S IC  +        GC  G C Y + Y DGS   GT+  ET+TFG + VRDV +
Sbjct  170  GVACGSPICGLLLSGASAAAGCHAGDCRYAVSYGDGSSTKGTLALETLTFGTSAVRDVAI  229

Query  600  GCSQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAES-SGSLEFGR-E  427
            GC  +N+G+  GA G+LGL  G M+F+ Q+ GQ GG FSYCL S  +++ +GSL FGR  
Sbjct  230  GCGHSNRGLFVGAAGVLGLGWGPMSFVGQLGGQAGGAFSYCLVSRGSDAPTGSLVFGRTA  289

Query  426  IIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSV  247
             +PVGAVWVPLLR++RAP+ YY+ L GLGVG ++LP+ EDVF+LTE+G GGV+MD GT+V
Sbjct  290  AVPVGAVWVPLLRNLRAPSFYYVRLLGLGVGGVRLPVLEDVFQLTEEGEGGVVMDTGTAV  349

Query  246  TRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTL  67
            TRLP  AY  LR  +    A +PRAP  S  DTCY L G  +V+VPT+SF+F GG I TL
Sbjct  350  TRLPDAAYAALRDAFGAATAGLPRAPGVSIFDTCYSLFGYQSVRVPTVSFYFAGGTILTL  409

Query  66   AAKNILIPVNKRGIFCFAFAPS  1
             A+N LIPV+    FCFAFAPS
Sbjct  410  PARNFLIPVDDMATFCFAFAPS  431



>ref|XP_003589787.1| Aspartic proteinase nepenthesin-2 [Medicago truncatula]
Length=456

 Score =   325 bits (834),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 165/316 (52%), Positives = 216/316 (68%), Gaps = 15/316 (5%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIG+G+P  YQY+ ID+GS+++W+QC+PC  C+ Q DP+F+P  S+SF 
Sbjct  121  GTEEGSGEYFVRIGIGSPAIYQYMVIDSGSDIVWIQCEPCDQCYNQTDPIFNPATSASFI  180

Query  762  IVPCSSTICNRIH--LGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             V CSS +CN++   + C +GRC Y + Y DGSY  GT+  ETIT G TV++D  +GC  
Sbjct  181  GVACSSNVCNQLDDDVACRKGRCGYQVAYGDGSYTKGTLALETITIGRTVIQDTAIGCGH  240

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+GM  GA GLLGL GG M+F+ Q+  QTGG F YCL S               +PVGA
Sbjct  241  WNEGMFVGAAGLLGLGGGPMSFVGQLGAQTGGAFGYCLVS-------------RAMPVGA  287

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            +WVPL+ +   P+ YY+ LSGL VG I++PISE +F+LT+ G GGV+MD GT++TRLP V
Sbjct  288  MWVPLIHNPFYPSFYYVSLSGLAVGGIRVPISEQIFQLTDIGTGGVVMDTGTAITRLPTV  347

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY   R  ++ Q   +PRAP  S  DTCYDLNG  TV+VPT+SF+F+GGQI T  A+N L
Sbjct  348  AYNAFRDAFIAQTTNLPRAPGVSIFDTCYDLNGFVTVRVPTVSFYFSGGQILTFPARNFL  407

Query  48   IPVNKRGIFCFAFAPS  1
            IP +  G FCFAFAPS
Sbjct  408  IPADDVGTFCFAFAPS  423



>ref|XP_007227097.1| hypothetical protein PRUPE_ppa025647mg [Prunus persica]
 gb|EMJ28296.1| hypothetical protein PRUPE_ppa025647mg [Prunus persica]
Length=524

 Score =   326 bits (835),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 176/318 (55%), Positives = 230/318 (72%), Gaps = 7/318 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIGVG+PP+ QY+ ID+GS+++WVQCQPC  C+ Q DP+FDP  S+S+ 
Sbjct  177  GMEQGSGEYFVRIGVGSPPRSQYIVIDSGSDIVWVQCQPCSQCYHQSDPIFDPAHSASYM  236

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V CSS++C  + + GC  GRC Y   Y DGSY  GT+  ET+T G T++++V +GC   
Sbjct  237  GVSCSSSVCGHLQNPGCHAGRCRYEASYGDGSYTEGTLALETLTLGSTLIQNVAIGCGHM  296

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+GM  GA GLLGL GG M+F+ Q+ GQTGG F+YCL S    S GS+EFGRE +PVGA 
Sbjct  297  NRGMFVGAAGLLGLGGGPMSFVGQLAGQTGGAFTYCLVSRARRSGGSIEFGREAMPVGAA  356

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
            WVPL+R+ RAP+ Y++GL+GLGVG +++PISED+F  +E   GGV+MD GT+VTR P VA
Sbjct  357  WVPLIRNPRAPSFYFVGLAGLGVGGMRVPISEDIFGQSE---GGVVMDTGTAVTRFPTVA  413

Query  225  YETLRYIYMTQIATIPRAPS-FSQLDTCYDLNGLGTVQVPTISFFFT--GGQIWTLAAKN  55
            YE  R  ++ Q + +PR  S  S  DTCYDLNG  +V+VPT+SF+F+  GG I TL A N
Sbjct  414  YEAFRDAFVQQTSNLPRLSSGVSIFDTCYDLNGFVSVRVPTVSFYFSGAGGPILTLPASN  473

Query  54   ILIPVNKRGIFCFAFAPS  1
             LIPV+ +G FCFAFAPS
Sbjct  474  FLIPVDDKGSFCFAFAPS  491



>ref|XP_008340423.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Malus domestica]
Length=547

 Score =   324 bits (831),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 176/328 (54%), Positives = 230/328 (70%), Gaps = 14/328 (4%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIGVG+PP+ QY+ ID+GS+++WVQCQPC  C+ Q DP+FDP RS+S++
Sbjct  187  GMEQGSGEYFVRIGVGSPPRNQYMVIDSGSDIVWVQCQPCTECYHQSDPIFDPARSASYS  246

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C+S++C R+   GC  GRC Y   Y DGSY  GT+  ET+T G  ++R+V +GC   
Sbjct  247  GVSCASSLCGRLQNPGCHSGRCRYEASYGDGSYTQGTLALETLTLGRALIRNVAIGCGHM  306

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSG------------SL  442
            N+GM  GA GLLGL GG M+F+ Q+ G TGG F+YCL S    SS             SL
Sbjct  307  NRGMFVGAAGLLGLGGGPMSFVGQLAGLTGGAFTYCLVSRGGRSSATSTNVAGGGGGGSL  366

Query  441  EFGREIIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMD  262
            EFGR  +PVGA WVPL+R+ +AP+ Y++GL+GLGVG +++PIS DVF  TE G GGV+MD
Sbjct  367  EFGRGAMPVGASWVPLIRNPQAPSFYFVGLAGLGVGGMRVPISGDVFGQTELGYGGVVMD  426

Query  261  IGTSVTRLPKVAYETLRYIYMTQIATIPR-APSFSQLDTCYDLNGLGTVQVPTISFFFTG  85
             GT+VTR P +AYE  R  ++ Q A++PR +   S  DTCYDLNG  +V+VPT+SF+F+G
Sbjct  427  TGTAVTRFPTLAYEAFRDTFLQQTASLPRLSTGVSIFDTCYDLNGFVSVRVPTVSFYFSG  486

Query  84   GQIWTLAAKNILIPVNKRGIFCFAFAPS  1
            G I TL A N LIPV+ +G FCFAFAPS
Sbjct  487  GPILTLPASNFLIPVDDKGTFCFAFAPS  514



>ref|XP_006847790.1| hypothetical protein AMTR_s00029p00016750 [Amborella trichopoda]
 gb|ERN09371.1| hypothetical protein AMTR_s00029p00016750 [Amborella trichopoda]
Length=524

 Score =   323 bits (828),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 168/317 (53%), Positives = 221/317 (70%), Gaps = 4/317 (1%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIGVG+P + Q++ IDTGS+++WVQC+PC  C+ Q DPVFDP  S +FA
Sbjct  176  GMEQGSGEYFVRIGVGSPARDQFMVIDTGSDIVWVQCRPCLQCYQQADPVFDPAASETFA  235

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C+S++C+R+ + GC  GRC Y + Y DGSY  GT+  ET+TF  T VR+V MGC   
Sbjct  236  GVSCTSSVCSRLENSGCGAGRCRYEVSYGDGSYTKGTLALETLTFQATTVRNVAMGCGHK  295

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAE--SSGSLEFGREIIPVG  412
            N G+  GA GLLGL GGSM+F  Q+ GQ GG F YCL S  A   S+G L FG+  +P+G
Sbjct  296  NHGLFIGAAGLLGLGGGSMSFNGQLGGQMGGAFGYCLVSRGATGGSTGELVFGKGAMPLG  355

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPK  232
            AV  P+LR +RAPT Y++GL+GL VG+ +LP+S+++F  ++   G +I+D GT+VTRLP 
Sbjct  356  AVQAPMLRDLRAPTFYFVGLAGLAVGSWQLPLSKNIFGQSDSVKG-MILDSGTAVTRLPT  414

Query  231  VAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNI  52
            VAYE LR  +++    +PRAP+ S  DTCYDL GL  V VPT+SF+F GG I TL A N 
Sbjct  415  VAYEALRDAFVSATQALPRAPAQSIFDTCYDLRGLEMVTVPTVSFYFAGGPILTLPAGNY  474

Query  51   LIPVNKRGIFCFAFAPS  1
            +IPV+  G FC A APS
Sbjct  475  MIPVDDGGTFCLALAPS  491



>ref|XP_008668690.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Zea mays]
 tpg|DAA35354.1| TPA: hypothetical protein ZEAMMB73_186928 [Zea mays]
Length=464

 Score =   318 bits (814),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 167/317 (53%), Positives = 221/317 (70%), Gaps = 7/317 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VR+G+G+PP  QYL +D+GS+++WVQC+PC  C+ Q DP+FDP  S++F+
Sbjct  119  GLDEGSGEYFVRVGIGSPPTEQYLVVDSGSDVIWVQCKPCLECYAQADPLFDPATSATFS  178

Query  762  IVPCSSTICNRIHL-GC-TRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             VPC S +C  +   GC   G C Y + Y DGSY  G +  ET+T GGT V  V +GC  
Sbjct  179  AVPCGSAVCRTLRTSGCGDSGGCDYEVSYGDGSYTKGALALETLTLGGTAVEGVAIGCGH  238

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGR-EIIPVG  412
             N+G+  GA GLLGL  G M+ + Q+ G  GG FSYCLAS  A   GSL  GR E +P G
Sbjct  239  RNRGLFVGAAGLLGLGWGPMSLVGQLGGAAGGAFSYCLASRGA---GSLVLGRSEAVPEG  295

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPK  232
            AVWVPL+R+ +AP+ YY+GLSG+GVG+ +LP+ ED+F+LTE G GGV+MD GT+VTRLP+
Sbjct  296  AVWVPLVRNPQAPSFYYVGLSGIGVGDERLPLQEDLFQLTEDGAGGVVMDTGTAVTRLPQ  355

Query  231  VAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNI  52
             AY  LR  ++  +  +PRAP  S LDTCYDL+G  +V+VPT+SF+F G    TL A+N+
Sbjct  356  EAYAALRDAFVAAVGALPRAPGVSLLDTCYDLSGYTSVRVPTVSFYFDGAATLTLPARNL  415

Query  51   LIPVNKRGIFCFAFAPS  1
            L+ V+  GI+C AFAPS
Sbjct  416  LLEVDG-GIYCLAFAPS  431



>emb|CAJ86229.1| H0402C08.5 [Oryza sativa Indica Group]
 gb|EAY96049.1| hypothetical protein OsI_17922 [Oryza sativa Indica Group]
Length=473

 Score =   318 bits (815),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 164/320 (51%), Positives = 220/320 (69%), Gaps = 7/320 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VR+GVG+PP  QYL +D+GS+++WVQC+PC+ C+ Q DP+FDP  SSSF+
Sbjct  122  GVDDGSGEYFVRVGVGSPPTDQYLVVDSGSDVIWVQCRPCEQCYAQTDPLFDPAASSSFS  181

Query  762  IVPCSSTICNRIHLGCTRG-----RCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMG  598
             V C S IC  +      G     +C Y + Y DGSY  G +  ET+T GGT V+ V +G
Sbjct  182  GVSCGSAICRTLSGTGCGGGGDAGKCDYSVTYGDGSYTKGELALETLTLGGTAVQGVAIG  241

Query  597  CSQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGR-EII  421
            C   N G+  GA GLLGL  G+M+ + Q+ G  GGVFSYCLAS  A  +GSL  GR E +
Sbjct  242  CGHRNSGLFVGAAGLLGLGWGAMSLIGQLGGAAGGVFSYCLASRGAGGAGSLVLGRTEAV  301

Query  420  PVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTR  241
            PVGAVWVPL+R+ +A + YY+GL+G+GVG  +LP+ + +F+LTE G GGV+MD GT+VTR
Sbjct  302  PVGAVWVPLVRNNQASSFYYVGLTGIGVGGERLPLQDGLFQLTEDGAGGVVMDTGTAVTR  361

Query  240  LPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAA  61
            LP+ AY  LR  +   +  +PR+P+ S LDTCYDL+G  +V+VPT+SF+F  G + TL A
Sbjct  362  LPREAYAALRGAFDGAMGALPRSPAVSLLDTCYDLSGYASVRVPTVSFYFDQGAVLTLPA  421

Query  60   KNILIPVNKRGIFCFAFAPS  1
            +N+L+ V    +FC AFAPS
Sbjct  422  RNLLVEVGG-AVFCLAFAPS  440



>gb|EAZ32412.1| hypothetical protein OsJ_16623 [Oryza sativa Japonica Group]
Length=473

 Score =   318 bits (815),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 164/320 (51%), Positives = 220/320 (69%), Gaps = 7/320 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VR+GVG+PP  QYL +D+GS+++WVQC+PC+ C+ Q DP+FDP  SSSF+
Sbjct  122  GVDDGSGEYFVRVGVGSPPTDQYLVVDSGSDVIWVQCRPCEQCYAQTDPLFDPAASSSFS  181

Query  762  IVPCSSTICNRIHLGCTRG-----RCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMG  598
             V C S IC  +      G     +C Y + Y DGSY  G +  ET+T GGT V+ V +G
Sbjct  182  GVSCGSAICRTLSGTGCGGGGDAGKCDYSVTYGDGSYTKGELALETLTLGGTAVQGVAIG  241

Query  597  CSQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGR-EII  421
            C   N G+  GA GLLGL  G+M+ + Q+ G  GGVFSYCLAS  A  +GSL  GR E +
Sbjct  242  CGHRNSGLFVGAAGLLGLGWGAMSLVGQLGGAAGGVFSYCLASRGAGGAGSLVLGRTEAV  301

Query  420  PVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTR  241
            PVGAVWVPL+R+ +A + YY+GL+G+GVG  +LP+ + +F+LTE G GGV+MD GT+VTR
Sbjct  302  PVGAVWVPLVRNNQASSFYYVGLTGIGVGGERLPLQDSLFQLTEDGAGGVVMDTGTAVTR  361

Query  240  LPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAA  61
            LP+ AY  LR  +   +  +PR+P+ S LDTCYDL+G  +V+VPT+SF+F  G + TL A
Sbjct  362  LPREAYAALRGAFDGAMGALPRSPAVSLLDTCYDLSGYASVRVPTVSFYFDQGAVLTLPA  421

Query  60   KNILIPVNKRGIFCFAFAPS  1
            +N+L+ V    +FC AFAPS
Sbjct  422  RNLLVEVGG-AVFCLAFAPS  440



>ref|XP_009351765.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Pyrus x 
bretschneideri]
Length=548

 Score =   319 bits (818),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 177/328 (54%), Positives = 229/328 (70%), Gaps = 14/328 (4%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIGVG+PP+ QY+ ID+GS+++WVQCQPC  C+ Q DP+FDP RS+S++
Sbjct  188  GMEQGSGEYFVRIGVGSPPRNQYMVIDSGSDIVWVQCQPCTECYHQSDPIFDPARSASYS  247

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C S++C R+ + GC  GRC Y   Y DGSY  GT+  ET+T G  +VR+V +GC   
Sbjct  248  GVSCDSSLCGRLQNPGCHSGRCRYEASYGDGSYTQGTLALETLTLGRALVRNVAIGCGHM  307

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS------------GSL  442
            N+GM  GA GLLGL GG+M+F+ Q+ G TGG F+YC  S    SS            GSL
Sbjct  308  NRGMFVGAAGLLGLGGGAMSFVGQLAGLTGGAFTYCWVSRGGRSSTTSTNVAGGGGGGSL  367

Query  441  EFGREIIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMD  262
            EFGR  +PVGA WVPL+R+ +AP+ Y +GL+GLGVG +++PIS DVF  TE G GGV+MD
Sbjct  368  EFGRGAMPVGASWVPLIRNPQAPSFYLVGLAGLGVGGMRVPISGDVFGQTEMGYGGVVMD  427

Query  261  IGTSVTRLPKVAYETLRYIYMTQIATIPRAPS-FSQLDTCYDLNGLGTVQVPTISFFFTG  85
             GT+VTR P +AYE  R  ++ Q A++PR  S  S  D CYDLNG  +V+VPT+SF+F+G
Sbjct  428  TGTAVTRFPTLAYEAFRDTFLQQTASLPRLSSGVSIFDQCYDLNGFVSVRVPTVSFYFSG  487

Query  84   GQIWTLAAKNILIPVNKRGIFCFAFAPS  1
            G I TL A N LIPV+ +G FCFAFAPS
Sbjct  488  GPILTLPASNFLIPVDDKGTFCFAFAPS  515



>ref|XP_008359997.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 2-like [Malus domestica]
Length=539

 Score =   317 bits (813),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 180/328 (55%), Positives = 234/328 (71%), Gaps = 14/328 (4%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIGVG+PP+ QY+ ID+GS+++WVQCQPC  C+ Q DP+FDP RS+S++
Sbjct  179  GMEQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCTHCYHQSDPIFDPARSASYS  238

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C+S++C R+   GC  GRC Y   Y DGSY  GT+  ET+T G  ++R+V +GC   
Sbjct  239  SVSCASSLCGRLQNPGCHSGRCLYEASYGDGSYTQGTLALETLTLGRALLRNVAIGCGHM  298

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS------------GSL  442
            N+GM  GA GLLGL GG+M+F+ Q+ G TGG F+YCL S    SS            GSL
Sbjct  299  NRGMFVGAAGLLGLGGGAMSFVGQLAGLTGGAFTYCLVSRGGRSSTTSTNAAGGGGGGSL  358

Query  441  EFGREIIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMD  262
            EFGR  +PVGA WVPL+R+ RAP+ Y++GL+GLGVG +++PIS DVFR TE G GGV+MD
Sbjct  359  EFGRGAMPVGAAWVPLIRNPRAPSLYFVGLAGLGVGGMRVPISGDVFRQTEMGYGGVVMD  418

Query  261  IGTSVTRLPKVAYETLRYIYMTQIATIPRAPS-FSQLDTCYDLNGLGTVQVPTISFFFTG  85
             GT+VTR P +AYE  R  ++ Q A++PR  S  S  DTCYDLNG  +V+VPT+SF+F+G
Sbjct  419  TGTAVTRFPTLAYEAFRDTFLQQTASLPRLSSGVSIFDTCYDLNGFVSVRVPTVSFYFSG  478

Query  84   GQIWTLAAKNILIPVNKRGIFCFAFAPS  1
            G I TL A N LIPV+++G FCFAFAPS
Sbjct  479  GPILTLPASNFLIPVDEKGTFCFAFAPS  506



>ref|XP_004498098.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Cicer arietinum]
Length=465

 Score =   313 bits (801),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 161/316 (51%), Positives = 214/316 (68%), Gaps = 15/316 (5%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIG+G+P  YQY+ ID+GS+++W+QCQPC  C+ Q DP+F+P  S+SF 
Sbjct  130  GSEEGSGEYFVRIGIGSPAIYQYMVIDSGSDIVWIQCQPCHQCYNQSDPIFNPATSASFI  189

Query  762  IVPCSSTICNRIHLG--CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             V CSS++C+++  G  C +GRC Y + Y DGSY  GT+  ETIT G T++++  +GC  
Sbjct  190  GVSCSSSVCDQLDDGVACRQGRCGYQVDYGDGSYTKGTLALETITIGRTLIQETAIGCGH  249

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+GM  GA GLLGL GG M+F+ Q+  QT   F YCL S               +P+GA
Sbjct  250  WNEGMFVGAAGLLGLGGGPMSFVGQLGAQTDRAFGYCLLS-------------RAMPIGA  296

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
             WVPL+ +   PT YYI LSGL VG I++PISE +F +T+ G GGV+MD GT+VTR P +
Sbjct  297  TWVPLIHNPFFPTFYYISLSGLAVGGIQVPISEQIFSVTDLGIGGVVMDTGTAVTRFPTI  356

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY + R  ++ Q   +PRA   S  DTCYDLNG  TV++PT+SF+F+GGQI TL A+NIL
Sbjct  357  AYNSFRDAFLAQTTNLPRANGVSIFDTCYDLNGFVTVRIPTVSFYFSGGQILTLPARNIL  416

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+  G FCFAFA S
Sbjct  417  IPVDDVGSFCFAFAAS  432



>ref|XP_010935575.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=467

 Score =   313 bits (801),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 178/321 (55%), Positives = 228/321 (71%), Gaps = 7/321 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VRIG+G+PP+ Q++ ID+GS+++WVQCQPC  C+ Q DPVFDP  S+SFA
Sbjct  114  GLDEGSGEYFVRIGLGSPPKEQFMVIDSGSDIVWVQCQPCTQCYAQSDPVFDPADSASFA  173

Query  762  IVPCSSTICNRIHLGCTR------GRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTM  601
             + C+S IC+    G         GRC Y + Y DGSY  GT+  ET+TFG T VR+V +
Sbjct  174  GISCNSPICDIAGAGAGSASCGGSGRCLYEVSYGDGSYTKGTLALETLTFGATAVRNVAI  233

Query  600  GCSQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGRE-I  424
            GC   N+G+ TGA GLLGL  G M+F+ Q+ GQ GG FSYCL S  + S+GSL FGR   
Sbjct  234  GCGHRNRGLFTGAAGLLGLGWGPMSFVGQLGGQVGGAFSYCLVSRGSASTGSLVFGRSSA  293

Query  423  IPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVT  244
            +PVGAVWVPLLR+ RAP+ YY+GLSGLGVG ++LP+ E++F+L E G+GGV+MD GT+VT
Sbjct  294  VPVGAVWVPLLRNPRAPSFYYVGLSGLGVGGVRLPLGEELFQLNEDGDGGVVMDTGTAVT  353

Query  243  RLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLA  64
            RLP  AY  LR  +      +PR    S  DTCYDL G  +V+VPT+SF+F+GG I TL 
Sbjct  354  RLPGEAYGALRDAFAEGAVGLPRGAGVSIFDTCYDLGGYESVRVPTVSFYFSGGTILTLP  413

Query  63   AKNILIPVNKRGIFCFAFAPS  1
            A+N+LIPV++ G FCFAFAPS
Sbjct  414  AQNLLIPVDESGTFCFAFAPS  434



>ref|XP_002448772.1| hypothetical protein SORBIDRAFT_06g032900 [Sorghum bicolor]
 gb|EES13100.1| hypothetical protein SORBIDRAFT_06g032900 [Sorghum bicolor]
Length=471

 Score =   313 bits (801),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 165/323 (51%), Positives = 223/323 (69%), Gaps = 10/323 (3%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VR+G+G+PP  QYL +D+GS+++WVQC+PC  C+ Q DP+FDP  S++F+
Sbjct  117  GLDEGSGEYFVRVGIGSPPTEQYLVVDSGSDVIWVQCKPCLECYAQADPLFDPASSATFS  176

Query  762  IVPCSSTICNRIHL-GC-TRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             V C S IC  +   GC   G C Y + Y DGSY  GT+  ET+T GGT V  V +GC  
Sbjct  177  AVSCGSAICRTLRTSGCGDSGGCEYEVSYGDGSYTKGTLALETLTLGGTAVEGVAIGCGH  236

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASW------HAESSGSLEFGR-  430
             N+G+  GA GLLGL  G M+ + Q+ G  GG FSYCLAS        A+++GSL  GR 
Sbjct  237  RNRGLFVGAAGLLGLGWGPMSLVGQLGGAAGGAFSYCLASRGGSGSGAADAAGSLVLGRS  296

Query  429  EIIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTS  250
            E +P GAVWVPL+R+ +AP+ YY+G+SG+GVG+ +LP+ + +F+LTE G GGV+MD GT+
Sbjct  297  EAVPEGAVWVPLVRNPQAPSFYYVGVSGIGVGDERLPLQDGLFQLTEDGGGGVVMDTGTA  356

Query  249  VTRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWT  70
            VTRLP+ AY  LR  ++  +  +PRAP  S LDTCYDL+G  +V+VPT+SF+F G    T
Sbjct  357  VTRLPQEAYAALRDAFVGAVGALPRAPGVSLLDTCYDLSGYTSVRVPTVSFYFDGAATLT  416

Query  69   LAAKNILIPVNKRGIFCFAFAPS  1
            L A+N+L+ V+  GI+C AFAPS
Sbjct  417  LPARNLLLEVDG-GIYCLAFAPS  438



>ref|XP_008802841.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Phoenix 
dactylifera]
Length=470

 Score =   310 bits (793),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 178/320 (56%), Positives = 226/320 (71%), Gaps = 6/320 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VRIGVG+PP+ Q++ ID+GS+++WVQC+PC  C+ Q DPVFDP  S+SFA
Sbjct  118  GLDEGSGEYFVRIGVGSPPKEQFMVIDSGSDIVWVQCRPCTQCYAQSDPVFDPADSTSFA  177

Query  762  IVPCSSTICNRIHLGCTR-----GRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMG  598
             + C S IC+    G +      G C Y + Y DGSY  GT+  ET+TFG T V++V +G
Sbjct  178  GISCKSPICDIARAGASASCGGAGLCLYEVSYGDGSYTKGTLALETLTFGPTAVQNVAIG  237

Query  597  CSQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGRE-II  421
            C   N+G+ TGA GLLGL  G M+F+ Q+ GQ GG FSYCL S  + S+GSL FGR   +
Sbjct  238  CGHRNRGLFTGAAGLLGLGWGPMSFVGQLGGQVGGAFSYCLVSRGSGSTGSLLFGRSSAV  297

Query  420  PVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTR  241
            PVGAVWVPLLRS RAP+ YY+GLSGLGVG ++LP+ E++F+L E G GGV+MD GT+VTR
Sbjct  298  PVGAVWVPLLRSPRAPSFYYVGLSGLGVGGVRLPLGEELFKLNEDGEGGVVMDTGTAVTR  357

Query  240  LPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAA  61
            LP  AYE LR  ++     +PR    S  DTCYDL G  +V+VPT+SF+F+GG I TL A
Sbjct  358  LPGEAYEALRDAFVEGAVGLPRGSGVSIFDTCYDLAGYESVRVPTVSFYFSGGTILTLPA  417

Query  60   KNILIPVNKRGIFCFAFAPS  1
            +N LIPV+  G FCFAFAPS
Sbjct  418  RNFLIPVDDSGTFCFAFAPS  437



>ref|XP_008221090.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Prunus 
mume]
Length=542

 Score =   311 bits (796),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 177/337 (53%), Positives = 229/337 (68%), Gaps = 26/337 (8%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY VRIGVG+PP+ QY+ ID+GS+++WVQCQPC  C+ Q DP+FDP  S+S+ 
Sbjct  176  GMEQGSGEYFVRIGVGSPPRSQYIVIDSGSDIVWVQCQPCSQCYHQSDPIFDPAHSASYM  235

Query  762  IVPCSSTICNRI-HLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V CSS++C  + + GC  GRC Y   Y DGSY  GT+  ET+T G T++++V +GC   
Sbjct  236  GVSCSSSVCGHLQNPGCHAGRCRYEASYGDGSYTEGTLALETLTLGSTLIQNVAIGCGHM  295

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAES----------------  454
            N+GM  GA GLLGL GG M+F+ Q+ GQTGG F+YCL S    S                
Sbjct  296  NRGMFVGAAGLLGLGGGPMSFVGQLAGQTGGAFTYCLVSRGRRSGTASDTDDAAAASELG  355

Query  453  ---SGSLEFGREIIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQG  283
                GS+EFGRE +PVGA WVPL+R+ RAP+ Y++GL+GLGVG +++PISED+F    Q 
Sbjct  356  SGGGGSIEFGREAMPVGAAWVPLIRNPRAPSFYFVGLAGLGVGGMRVPISEDIF---GQS  412

Query  282  NGGVIMDIGTSVTRLPKVAYETLRYIYMTQIATIPRAPS-FSQLDTCYDLNGLGTVQVPT  106
             GGV+MD GT+VTR P VAYE  R  ++ Q A +PR  S  S  DTCYDLNG  +V+VPT
Sbjct  413  EGGVVMDTGTAVTRFPTVAYEAFRDSFVQQTANLPRLSSGVSIFDTCYDLNGFVSVRVPT  472

Query  105  ISFFFT--GGQIWTLAAKNILIPVNKRGIFCFAFAPS  1
            +SF+F+  GG I TL A N LIPV+ +G FCFAFAPS
Sbjct  473  VSFYFSGAGGPILTLPASNFLIPVDDKGSFCFAFAPS  509



>ref|XP_010688619.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Beta vulgaris 
subsp. vulgaris]
Length=544

 Score =   306 bits (785),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 183/316 (58%), Positives = 233/316 (74%), Gaps = 2/316 (1%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY +RIGVG+P + QY+ ID+GS+++WVQCQPCK C+ Q DPVF+P  S S++
Sbjct  196  GMDQGSGEYFIRIGVGSPQRKQYMVIDSGSDIVWVQCQPCKQCYKQTDPVFNPAESGSYS  255

Query  762  IVPCSSTICNRI-HLGCTRG-RCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             V CSS++CNR+ + GC+   RC Y ++Y DGSY  G +  ET+T GGTV+R+V MGC  
Sbjct  256  AVSCSSSVCNRVENSGCSHSERCKYEVLYSDGSYTKGNLAFETLTVGGTVIRNVAMGCGH  315

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
            +NQGM  GA GLLGL GGSM+F+ Q+ GQ GG FSYCL S  + SSGSL FGRE +PVGA
Sbjct  316  SNQGMFVGAAGLLGLGGGSMSFVGQLGGQAGGAFSYCLVSRGSGSSGSLVFGREAMPVGA  375

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
             W+ L+ S RAP+ YYIGL GLGVG +++PI   VF  TE G+GGV+MD GT+VTRLP  
Sbjct  376  AWINLVHSPRAPSFYYIGLMGLGVGGVRVPIPAGVFSFTESGDGGVVMDTGTAVTRLPNS  435

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY+  R  ++TQ A +PRA   S  DTCY+L G G+V+VPT+SF+FT G I TL A+N L
Sbjct  436  AYQPFRDSFITQTANLPRASGVSIFDTCYNLAGFGSVRVPTVSFYFTDGPILTLPARNFL  495

Query  48   IPVNKRGIFCFAFAPS  1
            IPV++ G FCFAFAPS
Sbjct  496  IPVDQSGTFCFAFAPS  511



>ref|XP_004960076.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Setaria 
italica]
Length=468

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 165/320 (52%), Positives = 216/320 (68%), Gaps = 7/320 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VR+GVG+PP  QYL +D+GS+++WVQC+PC  C+ Q DP+FDP  S++F+
Sbjct  117  GLDEGSGEYFVRVGVGSPPTEQYLVVDSGSDVIWVQCKPCSQCYAQADPLFDPASSTTFS  176

Query  762  IVPCSSTICNRIHL-GC-TRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             V C S IC  +   GC    RC Y + Y DGSY  G +  ET+T GGT V  V +GC  
Sbjct  177  AVSCGSAICRMLSSSGCGDSDRCQYEVSYGDGSYTNGVLALETLTVGGTAVEGVAIGCGH  236

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAES---SGSLEFGR-EII  421
             N G+  GA GLLGL  G M+ + Q+ G  GG FSYCLAS    S   +GSL  GR E +
Sbjct  237  RNHGLFVGAAGLLGLGWGPMSLVGQLGGAAGGAFSYCLASRGPGSNADAGSLVLGRSEAV  296

Query  420  PVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTR  241
            P GAVWVPL+R+ +AP+ YY+GLSG+GVG+ +LP+   +F+LT+ G GGV+MD GT+VTR
Sbjct  297  PEGAVWVPLVRNPQAPSFYYVGLSGIGVGDERLPLQAGLFQLTDDGAGGVVMDTGTAVTR  356

Query  240  LPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAA  61
            LP  AY  LR  +   +  +PRAP  S LDTCYDL+G  +V+VPT+SF+F  G   TL A
Sbjct  357  LPAEAYAALRDAFAAAVGALPRAPGVSLLDTCYDLSGYTSVRVPTVSFYFDEGATLTLPA  416

Query  60   KNILIPVNKRGIFCFAFAPS  1
            +N+L+ V+  GI+C AFAPS
Sbjct  417  RNLLVEVDG-GIYCLAFAPS  435



>ref|XP_008668689.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Zea 
mays]
Length=461

 Score =   296 bits (757),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 163/329 (50%), Positives = 216/329 (66%), Gaps = 16/329 (5%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY+VR+ VG+PP  QYL +D+GS++MWVQC+PC  C+ Q DP+FDP  S++F+
Sbjct  100  GLDEGSGEYLVRVSVGSPPTEQYLVVDSGSDVMWVQCKPCLECYVQADPLFDPATSATFS  159

Query  762  IVPCSSTICNRIHL-GCTRGR---CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGC  595
             V C S IC  +    C  G    C Y + Y DGSY  G +  ET+T GGT V  V +GC
Sbjct  160  GVSCGSAICRILPTSACGDGELGGCEYEVSYADGSYTKGALALETLTLGGTAVEGVVIGC  219

Query  594  SQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGS-------LEF  436
               N+G+  GA GL+GL  G M+ + Q+ G+ GG FSYCLAS     SG+       L  
Sbjct  220  GHRNRGLFVGAAGLMGLGWGPMSLVGQLGGEVGGAFSYCLASRGGYGSGAADDDAGWLVL  279

Query  435  GR-EIIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDI  259
            GR E +P GAVWVPL+R+ RAP+ YY+GLSG+ VG+ +LP+   +F+LTE G G V+MD 
Sbjct  280  GRSEAVPEGAVWVPLVRNPRAPSFYYVGLSGIEVGDERLPLQAGLFQLTEDGAGDVVMDT  339

Query  258  GTSVTRLPKVAYETLRYIYMTQIA-TIPRAP--SFSQLDTCYDLNGLGTVQVPTISFFFT  88
            GT+VTRLP+ AY  LR  ++  +A  +PRA   S S LDTCYDL+G  +V+VPT+SF F 
Sbjct  340  GTTVTRLPQEAYAALRDAFVGALAGAVPRAQGVSSSVLDTCYDLSGYASVRVPTVSFCFD  399

Query  87   GGQIWTLAAKNILIPVNKRGIFCFAFAPS  1
            G     LAA+N+L+ V+  GI+C AFAPS
Sbjct  400  GDARLILAARNVLLEVDM-GIYCLAFAPS  427



>ref|XP_006653026.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Oryza 
brachyantha]
Length=477

 Score =   296 bits (758),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 162/320 (51%), Positives = 217/320 (68%), Gaps = 7/320 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY VR+GVG+PP  QYL +D+GS+++WVQC+PC  C+ Q DP+FDP  SSSF+
Sbjct  126  GLGEGSGEYFVRVGVGSPPTDQYLVVDSGSDVIWVQCRPCDQCYAQTDPLFDPATSSSFS  185

Query  762  IVPCSSTICNRI-HLGCTRG-RCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             V C S IC  +   GC    +C Y + Y DGSY  G +  ET+TFGGT V+ V +GC  
Sbjct  186  GVACGSAICRMLPRTGCDDAEKCDYEVSYGDGSYTKGELALETLTFGGTAVQGVAIGCGH  245

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLAS---WHAESSGSLEFGR-EII  421
             N G+  GA GLLGL  G M+ +AQ+ G  GG FSYCLAS        +GSL  GR E +
Sbjct  246  RNSGLFVGAAGLLGLGWGPMSIVAQLAGAAGGAFSYCLASRGTGSGAGAGSLVLGRNEAV  305

Query  420  PVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTR  241
            P GAVWVPL+R+ +A + YY+ L+G+GVG  +LP+ + +F+LTE G+GGV+MD GT+VTR
Sbjct  306  PTGAVWVPLVRNNKASSFYYVALAGIGVGGERLPLQDGLFQLTEDGDGGVVMDTGTAVTR  365

Query  240  LPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAA  61
            LP+ AY  LR  +   +  +PRA + S LDTCYDL+G  +V+VPT+SF+F  G + TL A
Sbjct  366  LPQEAYSALRDAFAGAMGDLPRAAAVSLLDTCYDLSGYTSVRVPTVSFYFDQGAVLTLPA  425

Query  60   KNILIPVNKRGIFCFAFAPS  1
            +N+L+ V   G++C AFAPS
Sbjct  426  RNLLVEVGG-GVYCLAFAPS  444



>ref|NP_001054261.2| Os04g0677100 [Oryza sativa Japonica Group]
 dbj|BAF16175.2| Os04g0677100 [Oryza sativa Japonica Group]
Length=464

 Score =   295 bits (756),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 157/320 (49%), Positives = 210/320 (66%), Gaps = 16/320 (5%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VR+GVG+PP  QYL +D+GS+++WVQC+PC+ C+ Q DP+FDP  SSSF+
Sbjct  122  GVDDGSGEYFVRVGVGSPPTDQYLVVDSGSDVIWVQCRPCEQCYAQTDPLFDPAASSSFS  181

Query  762  IVPCSSTICNRIHLGCTRG-----RCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMG  598
             V C S IC  +      G     +C Y + Y DGSY  G +  ET+T GGT V+ V +G
Sbjct  182  GVSCGSAICRTLSGTGCGGGGDAGKCDYSVTYGDGSYTKGELALETLTLGGTAVQGVAIG  241

Query  597  CSQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGR-EII  421
            C   N G+  GA GLLGL  G+M+ + Q+ G  GGVFSYCLAS  A  +GSL  GR E +
Sbjct  242  CGHRNSGLFVGAAGLLGLGWGAMSLVGQLGGAAGGVFSYCLASRGAGGAGSLVLGRTEAV  301

Query  420  PVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTR  241
            P         R  RA + YY+GL+G+GVG  +LP+ + +F+LTE G GGV+MD GT+VTR
Sbjct  302  P---------RGRRASSFYYVGLTGIGVGGERLPLQDSLFQLTEDGAGGVVMDTGTAVTR  352

Query  240  LPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAA  61
            LP+ AY  LR  +   +  +PR+P+ S LDTCYDL+G  +V+VPT+SF+F  G + TL A
Sbjct  353  LPREAYAALRGAFDGAMGALPRSPAVSLLDTCYDLSGYASVRVPTVSFYFDQGAVLTLPA  412

Query  60   KNILIPVNKRGIFCFAFAPS  1
            +N+L+ V    +FC AFAPS
Sbjct  413  RNLLVEVGG-AVFCLAFAPS  431



>tpg|DAA35351.1| TPA: hypothetical protein ZEAMMB73_696016 [Zea mays]
Length=524

 Score =   295 bits (755),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 163/329 (50%), Positives = 216/329 (66%), Gaps = 16/329 (5%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY+VR+ VG+PP  QYL +D+GS++MWVQC+PC  C+ Q DP+FDP  S++F+
Sbjct  163  GLDEGSGEYLVRVSVGSPPTEQYLVVDSGSDVMWVQCKPCLECYVQADPLFDPATSATFS  222

Query  762  IVPCSSTICNRIHL-GCTRGR---CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGC  595
             V C S IC  +    C  G    C Y + Y DGSY  G +  ET+T GGT V  V +GC
Sbjct  223  GVSCGSAICRILPTSACGDGELGGCEYEVSYADGSYTKGALALETLTLGGTAVEGVVIGC  282

Query  594  SQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGS-------LEF  436
               N+G+  GA GL+GL  G M+ + Q+ G+ GG FSYCLAS     SG+       L  
Sbjct  283  GHRNRGLFVGAAGLMGLGWGPMSLVGQLGGEVGGAFSYCLASRGGYGSGAADDDAGWLVL  342

Query  435  GR-EIIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDI  259
            GR E +P GAVWVPL+R+ RAP+ YY+GLSG+ VG+ +LP+   +F+LTE G G V+MD 
Sbjct  343  GRSEAVPEGAVWVPLVRNPRAPSFYYVGLSGIEVGDERLPLQAGLFQLTEDGAGDVVMDT  402

Query  258  GTSVTRLPKVAYETLRYIYMTQIA-TIPRAP--SFSQLDTCYDLNGLGTVQVPTISFFFT  88
            GT+VTRLP+ AY  LR  ++  +A  +PRA   S S LDTCYDL+G  +V+VPT+SF F 
Sbjct  403  GTTVTRLPQEAYAALRDAFVGALAGAVPRAQGVSSSVLDTCYDLSGYASVRVPTVSFCFD  462

Query  87   GGQIWTLAAKNILIPVNKRGIFCFAFAPS  1
            G     LAA+N+L+ V+  GI+C AFAPS
Sbjct  463  GDARLILAARNVLLEVDM-GIYCLAFAPS  490



>gb|ABK24255.1| unknown [Picea sitchensis]
 gb|ABR16185.1| unknown [Picea sitchensis]
Length=485

 Score =   287 bits (735),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 147/316 (47%), Positives = 205/316 (65%), Gaps = 2/316 (1%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY  RIGVG P + Q + +DTGS++ W+QC+PC  C+ Q DP+++P  SSS+ 
Sbjct  137  GMDQGSGEYFSRIGVGAPRRDQLMVLDTGSDVTWIQCEPCSDCYQQSDPIYNPALSSSYK  196

Query  762  IVPCSSTICNRIHL-GCTR-GRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
            +V C + +C ++ + GC+R G C Y + Y DGSY  G    ET+T GG  +++V +GC  
Sbjct  197  LVGCQANLCQQLDVSGCSRNGSCLYQVSYGDGSYTQGNFATETLTLGGAPLQNVAIGCGH  256

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  GA GLLGL GGS++F +Q+  + G +FSYCL    +ESS +L+FGR  +P GA
Sbjct  257  DNEGLFVGAAGLLGLGGGSLSFPSQLTDENGKIFSYCLVDRDSESSSTLQFGRAAVPNGA  316

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V  P+L++ R  T YY+ LSG+ VG   L IS+ VF +   GNGGVI+D GT+VTRL   
Sbjct  317  VLAPMLKNSRLDTFYYVSLSGISVGGKMLSISDSVFGIDASGNGGVIVDSGTAVTRLQTA  376

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY++LR  +      +P     S  DTCYDL+   +V VPT+ F F+GG   +L AKN L
Sbjct  377  AYDSLRDAFRAGTKNLPSTDGVSLFDTCYDLSSKESVDVPTVVFHFSGGGSMSLPAKNYL  436

Query  48   IPVNKRGIFCFAFAPS  1
            +PV+  G FCFAFAP+
Sbjct  437  VPVDSMGTFCFAFAPT  452



>gb|ABR17396.1| unknown [Picea sitchensis]
Length=350

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 143/313 (46%), Positives = 206/313 (66%), Gaps = 3/313 (1%)
 Frame = -2

Query  930  GIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFAIVPC  751
            G  EY  RIG+GTP + QY+ +DTGS+++W+QC+PC+ C+ Q DP+F+P+ S SF+ V C
Sbjct  4    GSGEYFTRIGIGTPTREQYMVLDTGSDVVWIQCEPCRECYSQADPIFNPSSSVSFSTVGC  63

Query  750  SSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQTNQGM  574
             S +C+++    C  G C Y + Y DGSY +G+   ET+TFG T +++V +GC   N G+
Sbjct  64   DSAVCSQLDANDCHGGGCLYEVSYGDGSYTVGSYATETLTFGTTSIQNVAIGCGHDNVGL  123

Query  573  VTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAVWVPL  394
              GA GLLGL  GS++F AQ+  QTG  FSYCL    +ESSG+LEFG E +P+G+++ PL
Sbjct  124  FVGAAGLLGLGAGSLSFPAQLGTQTGRAFSYCLVDRDSESSGTLEFGPESVPIGSIFTPL  183

Query  393  LRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTE-QGNGGVIMDIGTSVTRLPKVAYE  220
            + +   PT YY+ +  + VG + L  +  + FR+ E  G GG+I+D GT+VTRL   AY+
Sbjct  184  VANPFLPTFYYLSMVAISVGGVILDSVPSEAFRIDETTGRGGIIIDSGTAVTRLQTSAYD  243

Query  219  TLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILIPV  40
             LR  ++     +PRA   S  DTCYDL+ L +V +P + F F+ G  + L AKN LIP+
Sbjct  244  ALRDAFIAGTQHLPRADGISIFDTCYDLSALQSVSIPAVGFHFSNGAGFILPAKNCLIPM  303

Query  39   NKRGIFCFAFAPS  1
            +  G FCFAFAP+
Sbjct  304  DSMGTFCFAFAPA  316



>emb|CAE05761.2| OSJNBa0064G10.12 [Oryza sativa Japonica Group]
Length=451

 Score =   282 bits (722),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 151/319 (47%), Positives = 203/319 (64%), Gaps = 27/319 (8%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VR+GVG+PP  QYL +D+GS+++WVQC+PC+ C+ Q DP+FDP  SSSF+
Sbjct  122  GVDDGSGEYFVRVGVGSPPTDQYLVVDSGSDVIWVQCRPCEQCYAQTDPLFDPAASSSFS  181

Query  762  IVPCSSTICNRIHLGCTRG-----RCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMG  598
             V C S IC  +      G     +C Y + Y DGSY  G +  ET+T GGT V+ V +G
Sbjct  182  GVSCGSAICRTLSGTGCGGGGDAGKCDYSVTYGDGSYTKGELALETLTLGGTAVQGVAIG  241

Query  597  CSQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIP  418
            C   N G+  GA GLLGL  G+M+ + Q+ G  GGVFSYCLAS  A  +GSL        
Sbjct  242  CGHRNSGLFVGAAGLLGLGWGAMSLVGQLGGAAGGVFSYCLASRGAGGAGSL--------  293

Query  417  VGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRL  238
                         A + YY+GL+G+GVG  +LP+ + +F+LTE G GGV+MD GT+VTRL
Sbjct  294  -------------ASSFYYVGLTGIGVGGERLPLQDSLFQLTEDGAGGVVMDTGTAVTRL  340

Query  237  PKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAK  58
            P+ AY  LR  +   +  +PR+P+ S LDTCYDL+G  +V+VPT+SF+F  G + TL A+
Sbjct  341  PREAYAALRGAFDGAMGALPRSPAVSLLDTCYDLSGYASVRVPTVSFYFDQGAVLTLPAR  400

Query  57   NILIPVNKRGIFCFAFAPS  1
            N+L+ V    +FC AFAPS
Sbjct  401  NLLVEVGG-AVFCLAFAPS  418



>gb|ABK24480.1| unknown [Picea sitchensis]
Length=496

 Score =   282 bits (721),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 144/317 (45%), Positives = 208/317 (66%), Gaps = 3/317 (1%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY  RIG+GTP + QY+ +DTGS+++W+QC+PC+ C+ Q DP+F+P+ S SF+
Sbjct  146  GMEQGSGEYFTRIGIGTPTREQYMVLDTGSDVVWIQCEPCRECYSQADPIFNPSSSVSFS  205

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C S +C+++    C  G C Y + Y DGSY +G+   ET+TFG T +++V +GC   
Sbjct  206  TVGCDSAVCSQLDANDCHGGGCLYEVSYGDGSYTVGSYATETLTFGTTSIQNVAIGCGHD  265

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N G+  GA GLLGL  GS++F AQ+  QTG  FSYCL    +ESSG+LEFG E +P+G++
Sbjct  266  NVGLFVGAAGLLGLGAGSLSFPAQLGTQTGRAFSYCLVDRDSESSGTLEFGPESVPIGSI  325

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTE-QGNGGVIMDIGTSVTRLPK  232
            + PL+ +   PT YY+ +  + VG + L  +  + FR+ E  G GG+I+D GT+VTRL  
Sbjct  326  FTPLVANPFLPTFYYLSMVAISVGGVILDSVPSEAFRIDETTGRGGIIIDSGTAVTRLQT  385

Query  231  VAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNI  52
             AY+ LR  ++     +PRA   S  DTCYDL+ L +V +P + F F+ G  + L AKN 
Sbjct  386  SAYDALRDAFIAGTQHLPRADGISIFDTCYDLSALQSVSIPAVGFHFSNGAGFILPAKNC  445

Query  51   LIPVNKRGIFCFAFAPS  1
            LIP++  G FCFAFAP+
Sbjct  446  LIPMDSMGTFCFAFAPA  462



>gb|ABR17085.1| unknown [Picea sitchensis]
Length=498

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 146/317 (46%), Positives = 204/317 (64%), Gaps = 3/317 (1%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G + G  EY  RIGVGTP + QY+ +DTGS++ W+QC+PC+ C+ Q DP+F+P+ S+SF+
Sbjct  149  GMEQGSGEYFTRIGVGTPTREQYMVLDTGSDVAWIQCEPCRECYSQADPIFNPSYSASFS  208

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C S +C+++    C  G C Y   Y DGSY+ G+   ET+TFG T V +V +GC   
Sbjct  209  TVGCDSAVCSQLDAYDCHSGGCLYEASYGDGSYSTGSFATETLTFGTTSVANVAIGCGHK  268

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N G+  GA GLLGL  G+++F  QI  QTG  FSYCL    ++SSG L+FG + +PVG++
Sbjct  269  NVGLFIGAAGLLGLGAGALSFPNQIGTQTGHTFSYCLVDRESDSSGPLQFGPKSVPVGSI  328

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTE-QGNGGVIMDIGTSVTRLPK  232
            + PL ++   PT YY+ ++ + VG   L  I  +VFR+ E  G+GG I+D GT VTRL  
Sbjct  329  FTPLEKNPHLPTFYYLSVTAISVGGALLDSIPPEVFRIDETSGHGGFIIDSGTVVTRLVT  388

Query  231  VAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNI  52
             AY+ +R  ++     +PR  + S  DTCYDL+GL  V VPT+ F F+ G    L AKN 
Sbjct  389  SAYDAVRDAFVAGTGQLPRTDAVSIFDTCYDLSGLQFVSVPTVGFHFSNGASLILPAKNY  448

Query  51   LIPVNKRGIFCFAFAPS  1
            LIP++  G FCFAFAP+
Sbjct  449  LIPMDTVGTFCFAFAPA  465



>dbj|BAJ97639.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=479

 Score =   271 bits (692),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 161/323 (50%), Positives = 217/323 (67%), Gaps = 10/323 (3%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY VR+GVG+PP  QYL +D+GS+++W+QC+PC  C+ Q DP+FDP  S+SF 
Sbjct  125  GISEGSGEYFVRVGVGSPPTEQYLVVDSGSDVIWIQCRPCAECYQQADPLFDPAASASFT  184

Query  762  IVPCSSTICNRIHLGCT----RGRCSYGIVYIDGSYNMGTMVQETITFG-GTVVRDVTMG  598
             VPC S +C  +  G +     G C Y + Y DGSY  G +  ET+TFG  T V+ V +G
Sbjct  185  AVPCDSGVCRTLPGGSSGCADSGACRYQVSYGDGSYTQGVLAMETLTFGDSTPVQGVAIG  244

Query  597  CSQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAES-SGSLEFGRE-I  424
            C   N+G+  GA GLLGL  G M+ + Q+ G  GG FSYCLAS  A++ +GSL FGR+  
Sbjct  245  CGHRNRGLFVGAAGLLGLGWGPMSLVGQLGGAAGGAFSYCLASRGADAGAGSLVFGRDDA  304

Query  423  IPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVT  244
            +PVGAVWVPLLR+ + P+ YY+GL+GLGVG  +LP+ + +F LTE G GGV+MD GT+VT
Sbjct  305  MPVGAVWVPLLRNAQQPSFYYVGLTGLGVGGERLPLQDGLFDLTEDGGGGVVMDTGTAVT  364

Query  243  RLPKVAYETLRYIYMTQI-ATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFF-TGGQIWT  70
            RLP  AY  LR  + + I   +PRAP  S LDTCYDL+G  +V+VPT++ +F   G   T
Sbjct  365  RLPPDAYAALRDAFASTIGGDLPRAPGVSLLDTCYDLSGYASVRVPTVALYFGRDGAALT  424

Query  69   LAAKNILIPVNKRGIFCFAFAPS  1
            L A+N+L+ +   G++C AFA S
Sbjct  425  LPARNLLVEMGG-GVYCLAFAAS  446



>gb|EPS61272.1| hypothetical protein M569_13524, partial [Genlisea aurea]
Length=489

 Score =   269 bits (687),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 199/316 (63%), Gaps = 6/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G PP+  YL +DTGS++ WVQC PC  C+ Q DP+FDP+ SSSF+
Sbjct  145  GTSQGSGEYFCRVGIGNPPKPTYLVLDTGSDVNWVQCAPCSDCYQQADPIFDPSLSSSFS  204

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + C +  C  + +  C    C Y + Y DGSY +G  V E ITF G+  V DV +GC  
Sbjct  205  RLTCETQQCRSLDVSECRNNTCLYEVSYGDGSYTVGDFVMERITFDGSDKVDDVALGCGH  264

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
            TNQG+  GA GL+GL GG+++F +QI   +   FSYCL    +ESS +L+F   + P  +
Sbjct  265  TNQGLFVGAAGLIGLGGGALSFPSQIKASS---FSYCLVDRDSESSSTLDFDSPL-PSDS  320

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V  PL+R+ +  T YY+ LSG+ VG   LPI  + F LT+ G GGVI+D GT+VTRL   
Sbjct  321  VAAPLVRNPKISTYYYVDLSGISVGGQSLPIPPETFALTDSGTGGVIIDSGTAVTRLQSD  380

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY ++R  +    A +P A + S  DTCYDL+   +V+VPT+SF F+ G+   L AKN +
Sbjct  381  AYSSMRDAFKKGTADLPPANAVSLFDTCYDLSSRKSVEVPTVSFHFSNGKEVKLPAKNYM  440

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+  G FCFAFAP+
Sbjct  441  IPVDSSGTFCFAFAPT  456



>gb|ABR16474.1| unknown [Picea sitchensis]
Length=538

 Score =   270 bits (690),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 146/317 (46%), Positives = 202/317 (64%), Gaps = 3/317 (1%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTP + QY+ +DTGS+++W+QC+PC  C+ Q DP+F+P+ S+SF+
Sbjct  189  GMAQGSGEYFTRIGVGTPMREQYMVLDTGSDVVWIQCEPCSKCYSQVDPIFNPSLSASFS  248

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             + C+S +C+ +    C  G C Y + Y DGSY +G+   E +TFG T VR+V +GC   
Sbjct  249  TLGCNSAVCSYLDAYNCHGGGCLYKVSYGDGSYTIGSFATEMLTFGTTSVRNVAIGCGHD  308

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N G+  GA GLLGL  G ++F +Q+  QTG  FSYCL    +ESSG+LEFG E +P+G++
Sbjct  309  NAGLFVGAAGLLGLGAGLLSFPSQLGTQTGRAFSYCLVDRFSESSGTLEFGPESVPLGSI  368

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTE-QGNGGVIMDIGTSVTRLPK  232
              PLL +   PT YY+ L  + VG   L  +  DVFR+ E  G GG I+D GT+VTRL  
Sbjct  369  LTPLLTNPSLPTFYYVPLISISVGGALLDSVPPDVFRIDETSGRGGFIVDSGTAVTRLQT  428

Query  231  VAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNI  52
              Y+ +R  ++     +P+A   S  DTCYDL+GL  V VPT+ F F+ G    L AKN 
Sbjct  429  PVYDAVRDAFVAGTRQLPKAEGVSIFDTCYDLSGLPLVNVPTVVFHFSNGASLILPAKNY  488

Query  51   LIPVNKRGIFCFAFAPS  1
            +IP++  G FCFAFAP+
Sbjct  489  MIPMDFMGTFCFAFAPA  505



>gb|ABK24467.1| unknown [Picea sitchensis]
Length=497

 Score =   269 bits (687),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 148/316 (47%), Positives = 197/316 (62%), Gaps = 4/316 (1%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTPP+Y Y+ +DTGS++MW+QC PC  C+ Q DP+F+P  SS++ 
Sbjct  145  GLAQGSGEYFTRLGVGTPPRYTYMVLDTGSDIMWIQCLPCAKCYGQTDPLFNPAASSTYR  204

Query  762  IVPCSSTICNRIHL-GCTRGR-CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             VPC++ +C ++ + GC   R C Y + Y DGS+ +G    ET+TF G V+R V +GC  
Sbjct  205  KVPCATPLCKKLDISGCRNKRYCEYQVSYGDGSFTVGDFSTETLTFRGQVIRRVALGCGH  264

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAE-SSGSLEFGREIIPVG  412
             N+G+  GA GLLGL  GS++F +Q   Q    FSYCL    A  ++ SL FG+  IP  
Sbjct  265  DNEGLFIGAAGLLGLGRGSLSFPSQTGAQFSKRFSYCLVDRSASGTASSLIFGKAAIPKS  324

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKL-PISEDVFRLTEQGNGGVIMDIGTSVTRLP  235
            A++ PLL + +  T YY+ L G+ VG  +L  I   VFR+   GNGGVI+D GTSVTRL 
Sbjct  325  AIFTPLLSNPKLDTFYYVELVGISVGGRRLTSIPASVFRMDATGNGGVIIDSGTSVTRLV  384

Query  234  KVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
              AY T+R  +      +  A  FS  DTCYDL+GL TV+VPT+ F F GG   +L A N
Sbjct  385  DSAYSTMRDAFRVGTGNLKSAGGFSLFDTCYDLSGLKTVKVPTLVFHFQGGAHISLPATN  444

Query  54   ILIPVNKRGIFCFAFA  7
             LIPV+    FCFAFA
Sbjct  445  YLIPVDSSATFCFAFA  460



>ref|XP_006843768.1| hypothetical protein AMTR_s00007p00241440 [Amborella trichopoda]
 gb|ERN05443.1| hypothetical protein AMTR_s00007p00241440 [Amborella trichopoda]
Length=496

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 143/317 (45%), Positives = 193/317 (61%), Gaps = 8/317 (3%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G P   QY+ +DTGS++ WVQC+PC  C+ Q DPVF+PT SSS+ 
Sbjct  152  GMQQGSGEYFSRVGIGQPAHEQYMVLDTGSDVSWVQCEPCSDCYDQADPVFNPTSSSSYR  211

Query  762  IVPCSSTICNRIHLGCTRGR--CSYGIVYIDGSYNMGTMVQETITFGGTV-VRDVTMGCS  592
             V C S++C  + +   R    C Y + Y DGSY +G    ET+T G +  VR++ +GC 
Sbjct  212  AVGCDSSVCRSLDVSACRNNSTCMYQVSYGDGSYTVGDFATETLTLGQSAPVRNIALGCG  271

Query  591  QTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVG  412
              N+G+   A GLLGL  G+++F +Q+   T   FSYCL    + SS +L+FG +  P G
Sbjct  272  HDNEGLFVAAAGLLGLGQGALSFPSQLGSHT---FSYCLVDRDSSSSSTLQFGGD--PAG  326

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPK  232
             V  PL+ + R  T YYIGLSG+GVG   L I    F++ E G+GG I+D GT++TRL  
Sbjct  327  TVTAPLMHNRRMNTFYYIGLSGIGVGGSVLSIPPSSFQMDEGGDGGTIVDSGTAITRLQS  386

Query  231  VAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNI  52
             AY TLR  ++     +PR    S  DTCYDL+G  +V VPT+S  F  GQ   L AKN 
Sbjct  387  QAYTTLRDAFVKGAQALPRTSGVSLFDTCYDLSGRASVDVPTVSLHFPEGQALVLPAKNY  446

Query  51   LIPVNKRGIFCFAFAPS  1
            L+PV+  G FCFAFAP+
Sbjct  447  LVPVDSTGTFCFAFAPT  463



>ref|XP_009775618.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=491

 Score =   267 bits (683),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 147/315 (47%), Positives = 196/315 (62%), Gaps = 4/315 (1%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTPP+Y Y+ +DTGS+++W+QC PCK C+ Q DPVFDPT+SSSF 
Sbjct  142  GLAQGSGEYFTRLGVGTPPKYAYMVLDTGSDVVWIQCSPCKKCYTQSDPVFDPTKSSSFL  201

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C S +C R+   GC R +C Y + Y DGS+ +G    ET+TF  T V +V +GC   
Sbjct  202  GVSCGSPLCRRLDSPGCNRKKCLYQVSYGDGSFTVGDFSTETLTFRKTRVNNVALGCGHD  261

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGS-LEFGREIIPVGA  409
            N+G+  GA GLLGL  G ++F  Q   + G  FSYCL    A S  S + FG   +   A
Sbjct  262  NEGLFVGAAGLLGLGRGRLSFPTQAGRRFGRKFSYCLVDRSASSRPSYIVFGESTVSRTA  321

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLPK  232
            V+ PL+ + +  T YY+ L+G+ VG  ++P I   +F+L   G+GGVI+D GTSVTRL +
Sbjct  322  VFTPLVTNPKLDTFYYVELTGISVGGTRVPSIRPSLFKLDAAGDGGVIVDSGTSVTRLTR  381

Query  231  VAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNI  52
             AY  LR  +    A + RAP FS  DTC+DL+G   V+VPT+   F G  + +L A N 
Sbjct  382  PAYVALRDAFRIGAANLKRAPDFSLFDTCFDLSGKTEVKVPTVVLHFKGADV-SLPASNY  440

Query  51   LIPVNKRGIFCFAFA  7
            LIPV+  G FCFAFA
Sbjct  441  LIPVDSDGTFCFAFA  455



>ref|XP_011093028.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Sesamum 
indicum]
Length=476

 Score =   266 bits (680),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 199/316 (63%), Gaps = 5/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIG+GTPP+Y Y+ +DTGS+++WVQC PC+ C+ Q DPVFDP  S+SF 
Sbjct  126  GLAQGSGEYFTRIGIGTPPKYVYMVLDTGSDVVWVQCSPCRKCYSQTDPVFDPKASTSFL  185

Query  762  IVPCSSTICNRIHL-GC-TRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             V C S +C R+   GC  R +C Y + Y DGS+ +G    ET+TF  T V +V +GC  
Sbjct  186  GVSCGSPLCRRLDSPGCNNRQKCLYQVSYGDGSFTVGEFSTETLTFRRTKVSNVALGCGH  245

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPVG  412
             N+G+  GA GLLGL  G ++F  Q   + GG FSYCL    A S   S+ FG   +   
Sbjct  246  DNEGLFVGAAGLLGLGRGKLSFPTQAGSRFGGKFSYCLVDRSASSKPSSMVFGESAVSRN  305

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLP  235
            AV+ PLL + +  T YY+GL+G+ VG +++P I+  +F++ + G+GGVI+D GTSVTRL 
Sbjct  306  AVFTPLLTNPKLDTFYYVGLNGISVGGVRVPGITPSLFKMDQMGSGGVIVDSGTSVTRLT  365

Query  234  KVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
            + AY  LR  +    + + RAP FS  DTC+DL+G   V+VPT+   F G  + +L A N
Sbjct  366  RPAYVALRDAFRAGASNLKRAPDFSLFDTCFDLSGKTEVKVPTVVLHFGGADV-SLPASN  424

Query  54   ILIPVNKRGIFCFAFA  7
             LIPV+  G FCFAFA
Sbjct  425  YLIPVDSEGKFCFAFA  440



>ref|XP_004299230.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Fragaria 
vesca subsp. vesca]
Length=492

 Score =   266 bits (681),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 140/316 (44%), Positives = 199/316 (63%), Gaps = 6/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G  LG  EY  R+GVG+P +  Y+ +DTGS++ W+QCQPC  C+ Q DP+F+PT SS+F 
Sbjct  148  GISLGSGEYFTRVGVGSPAKQFYMVLDTGSDVNWLQCQPCSDCYQQSDPIFNPTGSSTFR  207

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + C +  C  + +  C   +C Y + Y DGSY +G  V ET++FG +  ++D+ +GC  
Sbjct  208  QLTCDAPQCPALRVSACRNNKCLYQVAYGDGSYTVGDFVTETVSFGNSGAIKDIALGCGH  267

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  GA GLLGL GG ++  +Q+   T    SYCL    + SS +LEF     P  +
Sbjct  268  DNEGLFVGAAGLLGLGGGRLSLPSQVKAST---ISYCLVDRDSSSSSTLEFN-SAAPGDS  323

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V  PLL+S +  T YY+GL+GL VG   + I   +F++ E GNGG+I+D GT++TRL   
Sbjct  324  VIAPLLKSRKVDTFYYVGLTGLSVGGRPVSIPPSLFQMDESGNGGIIVDSGTAITRLQTA  383

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY+ LR  +      +P A +F+  DTCYDL+G  +V+VPT+SF F GG+   L AKN L
Sbjct  384  AYDALRDQFKRLTPDLPAAGNFALFDTCYDLSGRTSVRVPTVSFLFAGGKSLALPAKNYL  443

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+  G FCFAFAP+
Sbjct  444  IPVDNSGTFCFAFAPT  459



>ref|XP_004229990.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
lycopersicum]
Length=500

 Score =   266 bits (681),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 147/315 (47%), Positives = 195/315 (62%), Gaps = 4/315 (1%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTP +Y Y+ +DTGS+++W+QC PCK C+ Q DPVFDP++SSSF 
Sbjct  151  GLSQGSGEYFTRIGVGTPSKYVYMVLDTGSDVVWIQCSPCKKCYTQSDPVFDPSKSSSFL  210

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C S +C R+  G C R +C Y + Y DGS+ +G    ET+TF GT V +V +GC   
Sbjct  211  GVACGSPLCRRLDSGSCNRKKCLYQVSYGDGSFTVGDFSTETLTFRGTRVNNVALGCGHD  270

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGS-LEFGREIIPVGA  409
            N+G+  GA GLLGL  G ++F  Q   + G  FSYCL    A S  S L FG   +   A
Sbjct  271  NEGLFVGAAGLLGLGRGRLSFPTQAGRRFGRKFSYCLVDRSASSKPSYLVFGESAVSRTA  330

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLPK  232
            V+ PL+++ +  T YY+ L+G  VG  ++P I   +F+L   G+GGVI+D GTSVTRL +
Sbjct  331  VFTPLVKNPKLDTFYYVELTGFSVGGARVPAIRPSLFKLDAAGDGGVIVDSGTSVTRLTR  390

Query  231  VAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNI  52
             AY  LR  +      + RAP FS  DTC+DL+G   V+VPT+   F G  + +L A N 
Sbjct  391  PAYVALRDAFRMGAKDLKRAPDFSLFDTCFDLSGKTEVKVPTVVMHFRGADV-SLPASNY  449

Query  51   LIPVNKRGIFCFAFA  7
            LIPV+  G FCFAFA
Sbjct  450  LIPVDSDGTFCFAFA  464



>ref|XP_009613969.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
Length=510

 Score =   266 bits (681),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 146/315 (46%), Positives = 197/315 (63%), Gaps = 4/315 (1%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTPP+Y Y+ +DTGS+++W+QC PCK C+ Q DPVFDPT+S+SF 
Sbjct  161  GLAQGSGEYFTRLGVGTPPKYAYMVLDTGSDVVWIQCSPCKKCYTQSDPVFDPTKSTSFL  220

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C S +C R+   GC R +C Y + Y DGS+ +G    ET+TF  T V +V +GC   
Sbjct  221  GVSCGSPLCRRLDSPGCNRKKCLYQVSYGDGSFTVGDFSTETLTFRKTRVNNVALGCGHD  280

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGS-LEFGREIIPVGA  409
            N+G+  GA GLLGL  G ++F  Q   + G  FSYCL    A S  S + FG   +   A
Sbjct  281  NEGLFVGAAGLLGLGRGRLSFPTQAGRRFGRKFSYCLVDRSASSRPSYIVFGESAVSRTA  340

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLPK  232
            V+ PL+ + +  T YY+ L+G+ VG  ++P I   +F+L   G+GGVI+D GTSVTRL +
Sbjct  341  VFTPLVNNPKLDTFYYVELTGISVGGTRVPSIRPSLFKLDAAGDGGVIVDSGTSVTRLTR  400

Query  231  VAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNI  52
             AY  LR  +    A + RAP FS  DTC+DL+G   V+VPT+   F G ++ +L A N 
Sbjct  401  PAYVALRDSFRMGAANLKRAPDFSLFDTCFDLSGKTEVKVPTVVLHFKGAEV-SLPASNY  459

Query  51   LIPVNKRGIFCFAFA  7
            LIPV+  G FCFAFA
Sbjct  460  LIPVDSDGTFCFAFA  474



>ref|XP_010542095.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2, partial 
[Tarenaya hassleriana]
Length=272

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 142/239 (59%), Positives = 176/239 (74%), Gaps = 0/239 (0%)
 Frame = -2

Query  717  CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQTNQGMVTgaggllglag  538
            C  G C Y ++Y DGSY  GT+  ET+TFG TVVR+V MGC   N+GM  GA GLLGL G
Sbjct  1    CHSGGCRYEVMYGDGSYTKGTLALETLTFGHTVVRNVAMGCGHRNRGMFVGAAGLLGLGG  60

Query  537  GSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAVWVPLLRSIRAPTTYYI  358
            GSM+F+ Q+ GQTGG FSYCL S   +S GSL FGRE +PVGA WVPLLR+ RAP+ YYI
Sbjct  61   GSMSFVGQLSGQTGGAFSYCLVSRGTDSPGSLVFGREALPVGAAWVPLLRNPRAPSFYYI  120

Query  357  GLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVAYETLRYIYMTQIATIP  178
            GL+GLGVG +++P+ EDVF+LTE G+GGV+MD GT+VTR P  AY   R  + +Q   +P
Sbjct  121  GLTGLGVGGVRVPLPEDVFQLTETGDGGVVMDTGTAVTRFPTSAYSAFRSAFTSQTGNLP  180

Query  177  RAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILIPVNKRGIFCFAFAPS  1
            RA   S  DTCYDL+G  +V+VPT+SF+FT G + TL A+N LIPV+  G +CFAFAPS
Sbjct  181  RASGVSIFDTCYDLSGFVSVRVPTVSFYFTEGPVLTLPARNFLIPVDDAGTYCFAFAPS  239



>ref|XP_006339720.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=480

 Score =   265 bits (677),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 146/315 (46%), Positives = 195/315 (62%), Gaps = 4/315 (1%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTPP+Y Y+ +DTGS+++W+QC PCK C+ Q DPVFDP++SSSF 
Sbjct  131  GLSQGSGEYFTRIGVGTPPKYVYMVLDTGSDVVWIQCSPCKKCYTQSDPVFDPSKSSSFL  190

Query  762  IVPCSSTICNRIH-LGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C S +C R+    C R +C Y + Y DGS+ +G    ET+TF GT V ++ +GC   
Sbjct  191  GVACGSPLCRRLDSASCNRKKCLYQVSYGDGSFTVGDFSTETLTFRGTRVNNMALGCGHD  250

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGS-LEFGREIIPVGA  409
            N+G+  GA GLLGL  G ++F  Q   + G  FSYCL    A S  S L FG   +   A
Sbjct  251  NEGLFVGAAGLLGLGRGRLSFPTQAGRRFGRKFSYCLVDRSASSRPSYLVFGESAVSRTA  310

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLPK  232
            V+ PL+ + +  T YY+ L+G+ VG  ++P I   +F+L   G+GGVI+D GTSVTRL +
Sbjct  311  VFTPLVNNPKLDTFYYVELTGISVGGARVPAIRPSLFKLDAAGDGGVIVDSGTSVTRLTR  370

Query  231  VAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNI  52
             AY  LR  +      + RAP FS  DTC+DL+G   V+VPT+   F G  + +L A N 
Sbjct  371  PAYVALRDSFRMGARDLKRAPDFSLFDTCFDLSGKTEVKVPTVVMHFRGADV-SLPASNY  429

Query  51   LIPVNKRGIFCFAFA  7
            LIPV+  G FCFAFA
Sbjct  430  LIPVDSDGTFCFAFA  444



>emb|CDX89133.1| BnaA04g00530D [Brassica napus]
Length=483

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 146/323 (45%), Positives = 202/323 (63%), Gaps = 12/323 (4%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY +R+GVGTP +  Y+ +DTGS+++W+QC PCK C+ Q D +FDP++S +FA
Sbjct  127  GLSQGSGEYFMRLGVGTPAKNMYMVLDTGSDVVWLQCAPCKVCYNQSDAIFDPSKSKTFA  186

Query  762  IVPCSSTICNRIHLG--CTR---GRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMG  598
             VPC S +C R+     C R    RC Y + Y DGS+ +G +  ET+TF G  V  V +G
Sbjct  187  AVPCGSRLCRRLDDSSECFRQRSKRCLYQVSYGDGSFTVGDLSTETLTFKGARVDHVAVG  246

Query  597  CSQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGS-----LEFG  433
            C   N+G+  GA GLLGL  G ++F +Q   +  G FSYCL    +  S S     + FG
Sbjct  247  CGHDNEGLFVGAAGLLGLGRGGLSFPSQTKNRYNGKFSYCLVDRTSSGSASKPPSTIVFG  306

Query  432  REIIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIG  256
             + +P  +V+ PLL + +  T YY+ L G+ VG  ++  +SE  F+L   GNGGVI+D G
Sbjct  307  NDAVPKTSVFTPLLTNPKLDTFYYLQLLGISVGGSRVRGVSESQFKLDATGNGGVIIDSG  366

Query  255  TSVTRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQI  76
            TSVTRL + AY  LR  +      + RAPS+S  DTC+DL+G+ TV+VPT+ F F GG++
Sbjct  367  TSVTRLTQSAYVALRDAFRLGAKRLKRAPSYSLFDTCFDLSGMSTVKVPTVVFHFGGGEV  426

Query  75   WTLAAKNILIPVNKRGIFCFAFA  7
             +L A N LIPVN +G FCFAFA
Sbjct  427  -SLPASNYLIPVNTQGRFCFAFA  448



>emb|CDY43952.1| BnaC04g21580D [Brassica napus]
Length=483

 Score =   264 bits (675),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 146/323 (45%), Positives = 200/323 (62%), Gaps = 12/323 (4%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY +R+GVGTP    Y+ +DTGS+++W+QC PCK C+ Q D +FDP++S +FA
Sbjct  127  GLSQGSGEYFMRLGVGTPATNMYMVLDTGSDVVWLQCAPCKVCYNQSDAIFDPSKSKTFA  186

Query  762  IVPCSSTICNRIH--LGCTR---GRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMG  598
             VPC S +C R+     C R    RC Y + Y DGS+ +G    ET+TF G  V  V +G
Sbjct  187  TVPCGSRLCRRLDDSTECFRQRSKRCLYQVSYGDGSFTVGDFSTETLTFKGARVDHVAVG  246

Query  597  CSQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGS-----LEFG  433
            C   N+G+  GA GLLGL  G ++F +Q   +  G FSYCL    +  S S     + FG
Sbjct  247  CGHDNEGLFVGAAGLLGLGRGGLSFPSQTKNRYSGKFSYCLVDRTSSGSASKPPSTIAFG  306

Query  432  REIIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIG  256
             + +P  +V+ PLL + +  T YY+ L G+ VG  ++  +SE  F+L   GNGGVI+D G
Sbjct  307  NDAVPKTSVFTPLLTNPKLDTFYYLQLLGISVGGSRVRGVSESQFKLDATGNGGVIIDSG  366

Query  255  TSVTRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQI  76
            TSVTRL + AY  LR  +      + RAPS+S  DTC+DL+G+ TV+VPT+ F F GG++
Sbjct  367  TSVTRLTQSAYVALRDAFRLAAKRLKRAPSYSLFDTCFDLSGMSTVKVPTVVFHFGGGEV  426

Query  75   WTLAAKNILIPVNKRGIFCFAFA  7
             +L A N LIPVN +G FCFAFA
Sbjct  427  -SLPASNYLIPVNTQGRFCFAFA  448



>gb|KDP28482.1| hypothetical protein JCGZ_14253 [Jatropha curcas]
Length=478

 Score =   264 bits (674),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 148/317 (47%), Positives = 195/317 (62%), Gaps = 6/317 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTPP+Y Y+ +DTGS+++W+QC PC  C+ Q DPVFDP +S SFA
Sbjct  127  GLAQGSGEYFTRIGVGTPPRYVYMVLDTGSDIVWIQCAPCNKCYSQSDPVFDPRKSRSFA  186

Query  762  IVPCSSTICNRIHL-GCTRGR--CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCS  592
             +PC S +CNR+   GC   +  C Y + Y DGS+  G    ET+TF  T VR V +GC 
Sbjct  187  GIPCGSPLCNRLDSPGCNTQKRTCMYQVSYGDGSFTYGDFSTETLTFRRTKVRRVAIGCG  246

Query  591  QTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPV  415
              NQG+  GA GLLGL  G ++F +Q   Q    FSYCL    A S   S+ FG   I  
Sbjct  247  HDNQGLFVGAAGLLGLGRGRLSFPSQTGAQFNRKFSYCLVDRSASSKPSSVVFGDSAISR  306

Query  414  GAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRL  238
             A + PL+ + +  T YY+ L G+ VG  ++P I+  +F+L + GNGGVI+D GTSVTRL
Sbjct  307  TARFTPLISNPKLDTFYYVELLGISVGGTRVPGITASLFKLDQTGNGGVIIDSGTSVTRL  366

Query  237  PKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAK  58
             + AY  LR  +    + + RAP FS  DTC+DL+G   V+VPT++  F G  + +L A 
Sbjct  367  TRPAYVALRNAFRVGASNLKRAPEFSLFDTCFDLSGKTEVKVPTVALHFRGADV-SLPAS  425

Query  57   NILIPVNKRGIFCFAFA  7
            N LIPV+  G FCFAFA
Sbjct  426  NYLIPVDSDGSFCFAFA  442



>ref|XP_009138753.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=483

 Score =   263 bits (673),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 146/323 (45%), Positives = 201/323 (62%), Gaps = 12/323 (4%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY +R+GVGTP    Y+ +DTGS+++W+QC PCK C+ Q D +FDP++S +FA
Sbjct  127  GLSQGSGEYFMRLGVGTPATNMYMVLDTGSDVVWLQCAPCKVCYNQSDAIFDPSKSKTFA  186

Query  762  IVPCSSTICNRIHLG--CTR---GRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMG  598
             VPC S +C R+     C R    RC Y + Y DGS+ +G +  ET+TF G  V  V +G
Sbjct  187  AVPCGSRLCRRLDDSSECFRQRSKRCLYQVSYGDGSFTVGDLSTETLTFKGARVDHVAVG  246

Query  597  CSQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGS-----LEFG  433
            C   N+G+  GA GLLGL  G ++F +Q   +  G FSYCL    +  S S     + FG
Sbjct  247  CGHDNEGLFVGAAGLLGLGRGGLSFPSQTKNRYNGKFSYCLVDRTSSGSASKPPSTIVFG  306

Query  432  REIIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIG  256
             + +P  +V+ PLL + +  T YY+ L G+ VG  ++  +SE  F+L   GNGGVI+D G
Sbjct  307  NDAVPKTSVFTPLLTNPKLDTFYYLQLLGISVGGSRVRGVSESQFKLDATGNGGVIIDSG  366

Query  255  TSVTRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQI  76
            TSVTRL + AY  LR  +      + RAPS+S  DTC+DL+G+ TV+VPT+ F F GG++
Sbjct  367  TSVTRLTQSAYVALRDAFRLGAKRLKRAPSYSLFDTCFDLSGMSTVKVPTVVFHFGGGEV  426

Query  75   WTLAAKNILIPVNKRGIFCFAFA  7
             +L A N LIPVN +G FCFAFA
Sbjct  427  -SLPASNYLIPVNTQGRFCFAFA  448



>ref|XP_008244017.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Prunus 
mume]
Length=494

 Score =   264 bits (674),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 141/316 (45%), Positives = 195/316 (62%), Gaps = 6/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTP +  Y+ +DTGS++ W+QC+PC  C+ Q DPVF+PT SS++ 
Sbjct  150  GVSQGSGEYFTRIGVGTPAKSLYMVLDTGSDINWLQCEPCSDCYQQTDPVFNPTGSSTYH  209

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             V C S  C+ +H+  C   +C Y + Y DGSY +G  V ET++FG +  + +V +GC  
Sbjct  210  PVTCDSAQCHSLHVSACRADKCLYQVSYGDGSYTVGDFVTETVSFGNSGAIHNVGLGCGH  269

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  GA GLLGL GG+++  +Q    +   FSYCL +  + +S +LEF     P  +
Sbjct  270  DNEGLFVGAAGLLGLGGGALSLPSQFKATS---FSYCLVNRDSSTSSTLEFN-SAPPSDS  325

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V  PLL+  R  T YY+GL G  VG   + +   VF + E GNGG+I+D GT++TRL   
Sbjct  326  VTAPLLKDSRVETFYYVGLKGFSVGGQPVSVPPSVFEVDESGNGGIIVDSGTAITRLQTE  385

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY +LR  +      +P A  F+  DTCYDL+    VQVPT+SF F GG+  +L AKN L
Sbjct  386  AYNSLRDAFKRLTRDLPSASGFALFDTCYDLSSRSRVQVPTVSFLFAGGKSLSLPAKNYL  445

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+  G FCFAFAP+
Sbjct  446  IPVDSAGTFCFAFAPT  461



>gb|KDP29378.1| hypothetical protein JCGZ_18299 [Jatropha curcas]
Length=484

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 142/315 (45%), Positives = 194/315 (62%), Gaps = 5/315 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G PP   YL +DTGS++ W+QC PC  C+ Q DP+F+P  S+S++
Sbjct  141  GTSQGSGEYFSRVGIGKPPSSVYLVLDTGSDVNWLQCAPCADCYQQADPIFEPASSTSYS  200

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             + C S  C  + +  C  G C Y + Y DGSY +G  V ETIT G   V +V +GC   
Sbjct  201  PLTCDSKECKSLDVSECRNGSCLYEVSYGDGSYTVGDYVTETITLGSASVENVAIGCGHN  260

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+G+  GA GLLGL GGS++F +QI   +   FSYCL    ++S+ +LEF   I+P  AV
Sbjct  261  NEGLFVGAAGLLGLGGGSLSFPSQINATS---FSYCLVDRDSDSASTLEFNSPILP-SAV  316

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
              PLLR+    T YYIG++GL VG   L I E  F++ E GNGG+I+D GT++TRL    
Sbjct  317  TAPLLRNHELDTFYYIGMTGLSVGGELLSIPESAFKIDESGNGGIIVDSGTAITRLQTDV  376

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y +LR  ++     +P   S +  DTCYDL+   +V+VP +SF F  G++  L AKN LI
Sbjct  377  YNSLRDAFVKGTEGLPSTNSVALFDTCYDLSSKYSVEVPALSFHFPDGKVLPLPAKNYLI  436

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAP+
Sbjct  437  PVDSDGTFCFAFAPT  451



>ref|XP_002315953.1| aspartyl protease family protein [Populus trichocarpa]
 gb|EEF02124.1| aspartyl protease family protein [Populus trichocarpa]
Length=484

 Score =   261 bits (668),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 141/315 (45%), Positives = 193/315 (61%), Gaps = 5/315 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G PP   YL +DTGS++ WVQC PC  C+ Q DP+F+P  S+SF+
Sbjct  141  GTSQGSGEYFSRVGIGKPPSQAYLILDTGSDVNWVQCAPCADCYQQADPIFEPASSASFS  200

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             + C++  C  + +  C    C Y + Y DGSY +G  V ETIT G   V +V +GC   
Sbjct  201  TLSCNTRQCRSLDVSECRNDTCLYEVSYGDGSYTVGDFVTETITLGSAPVDNVAIGCGHN  260

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+G+  GA GLLGL GGS++F +QI   +   FSYCL    +ES+ +LEF    +P  AV
Sbjct  261  NEGLFVGAAGLLGLGGGSLSFPSQINATS---FSYCLVDRDSESASTLEFN-STLPPNAV  316

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
              PLLR+    T YY+GL+GL VG   + I E  F++ E GNGGVI+D GT++TRL    
Sbjct  317  SAPLLRNHHLDTFYYVGLTGLSVGGELVSIPESAFQIDESGNGGVIVDSGTAITRLQTDV  376

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y +LR  ++ +   +P     +  DTCYDL+  G V+VPT+SF F  G+   L AKN L+
Sbjct  377  YNSLRDAFVKRTRDLPSTNGIALFDTCYDLSSKGNVEVPTVSFHFPDGKELPLPAKNYLV  436

Query  45   PVNKRGIFCFAFAPS  1
            P++  G FCFAFAP+
Sbjct  437  PLDSEGTFCFAFAPT  451



>ref|XP_006402438.1| hypothetical protein EUTSA_v10005923mg [Eutrema salsugineum]
 dbj|BAJ34045.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ43891.1| hypothetical protein EUTSA_v10005923mg [Eutrema salsugineum]
Length=484

 Score =   261 bits (668),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 147/323 (46%), Positives = 200/323 (62%), Gaps = 12/323 (4%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY +R+GVGTP    Y+ +DTGS+++W+QC PCK C+ Q DPVF+P +S +FA
Sbjct  128  GLSQGSGEYFMRLGVGTPATNMYMVLDTGSDVVWLQCSPCKVCYNQSDPVFNPAKSKTFA  187

Query  762  IVPCSSTICNRIHLG--CTRGR---CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMG  598
             VPC S +C R+     C   R   C Y + Y DGS+ +G    ET+TF G  V  V +G
Sbjct  188  TVPCGSRLCRRLDDSSECVSRRSKACLYQVSYGDGSFTVGDFSTETLTFHGARVDHVALG  247

Query  597  CSQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLAS-----WHAESSGSLEFG  433
            C   N+G+  GA GLLGL  G ++F +Q   +  G FSYCL         ++   ++ FG
Sbjct  248  CGHDNEGLFVGAAGLLGLGRGGLSFPSQTKNRYNGKFSYCLVDRTSSGSSSKPPSTIVFG  307

Query  432  REIIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIG  256
               +P  AV+ PLL + +  T YY+ L G+ VG  ++P +SE  F+L   GNGGVI+D G
Sbjct  308  NGAVPKTAVFTPLLTNPKLDTFYYLQLLGISVGGSRVPGVSESQFKLDATGNGGVIIDSG  367

Query  255  TSVTRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQI  76
            TSVTRL + AY  LR  +      + RAPS+S  DTC+DL+G+ TV+VPT+ F FTGG++
Sbjct  368  TSVTRLTQSAYVALRDAFRLGATRLKRAPSYSLFDTCFDLSGMTTVKVPTVVFHFTGGEV  427

Query  75   WTLAAKNILIPVNKRGIFCFAFA  7
             +L A N LIPVN +G FCFAFA
Sbjct  428  -SLPASNYLIPVNNQGRFCFAFA  449



>ref|XP_006374138.1| hypothetical protein POPTR_0015s02540g [Populus trichocarpa]
 gb|ABK94105.1| unknown [Populus trichocarpa]
 gb|ERP51935.1| hypothetical protein POPTR_0015s02540g [Populus trichocarpa]
Length=499

 Score =   262 bits (669),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 136/316 (43%), Positives = 195/316 (62%), Gaps = 5/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVG P +  Y+ +DTGS++ W+QCQPC  C+ Q DP+FDPT SS++A
Sbjct  153  GTSQGSGEYFTRVGVGNPARQFYMVLDTGSDINWLQCQPCTDCYQQTDPIFDPTASSTYA  212

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             V C S  C+ + +  C  G+C Y + Y DGSY  G    E+++FG +  V++V +GC  
Sbjct  213  PVTCQSQQCSSLEMSSCRSGQCLYQVNYGDGSYTFGDFATESVSFGNSGSVKNVALGCGH  272

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  GA GLLGL GG ++   Q+   +   FSYCL +  +  S +L+F    + V +
Sbjct  273  DNEGLFVGAAGLLGLGGGPLSLTNQLKATS---FSYCLVNRDSAGSSTLDFNSAQLGVDS  329

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V  PL+++ +  T YY+GLSG+ VG   + I E  FRL E GNGG+I+D GT++TRL   
Sbjct  330  VTAPLMKNRKIDTFYYVGLSGMSVGGQMVSIPESTFRLDESGNGGIIVDCGTAITRLQTQ  389

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY  LR  ++     +    + +  DTCYDL+G  +V+VPT+SF F  G+ W L A N L
Sbjct  390  AYNPLRDAFVRMTQNLKLTSAVALFDTCYDLSGQASVRVPTVSFHFADGKSWNLPAANYL  449

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+  G +CFAFAP+
Sbjct  450  IPVDSAGTYCFAFAPT  465



>ref|XP_011004863.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Populus 
euphratica]
Length=501

 Score =   262 bits (669),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 137/316 (43%), Positives = 196/316 (62%), Gaps = 5/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVG P +  Y+ +DTGS++ W+QCQPC  C+ Q DP+FDPT SS++A
Sbjct  155  GTSQGSGEYFTRVGVGNPARQFYMVLDTGSDINWLQCQPCTDCYQQIDPIFDPTASSTYA  214

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             V C S  C+ + +  C  G+C Y + Y DGSY  G    E+++FG +  VR+V +GC  
Sbjct  215  PVTCQSQQCSSLEMSSCRSGQCLYQVNYGDGSYTFGDFATESVSFGNSGSVRNVALGCGH  274

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  GA GLLGL GG ++   Q+   +   FSYCL +  +  S +L+F    + V +
Sbjct  275  DNEGLFVGAAGLLGLGGGPLSLTNQLKATS---FSYCLVNRDSAGSSTLDFNSVQLGVDS  331

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V  PL+++ +  T YY+GLSG+ VG   + I E  FRL E GNGG+I+D GT++TRL   
Sbjct  332  VTAPLMKNRKIDTFYYVGLSGMSVGGQMVSIPESAFRLDESGNGGIIVDCGTAITRLQTQ  391

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY  LR  ++     +  A + +  DTCYDL+G  +V+VPT+SF F  G+ W L A N +
Sbjct  392  AYNPLRDAFVRMTQNLKVAGAVALFDTCYDLSGQASVRVPTVSFHFADGKSWNLPAANYM  451

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+  G +CFAFAP+
Sbjct  452  IPVDSAGTYCFAFAPT  467



>ref|XP_002511962.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF50631.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=495

 Score =   261 bits (668),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 139/317 (44%), Positives = 200/317 (63%), Gaps = 8/317 (3%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVG P +  Y+ +DTGS++ W+QCQPC  C+ Q DP+F P  SSS++
Sbjct  151  GTSQGSGEYFTRVGVGNPAKSYYMVLDTGSDINWIQCQPCSDCYQQSDPIFTPAASSSYS  210

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + C S  CN + +  C  G+C Y + Y DGS+  G  V ET++FGG+  V  + +GC  
Sbjct  211  PLTCDSQQCNSLQMSSCRNGQCRYQVNYGDGSFTFGDFVTETMSFGGSGTVNSIALGCGH  270

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVG-  412
             N+G+  GA GLLGL GG ++  +Q+   +   FSYCL +  + +S +L+F     PVG 
Sbjct  271  DNEGLFVGAAGLLGLGGGPLSLTSQLKATS---FSYCLVNRDSAASSTLDFNSA--PVGD  325

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPK  232
            +V  PLL+S +  T YY+GLSG+ VG   L I ++VF+L + G+GGVI+D GT++TRL  
Sbjct  326  SVIAPLLKSSKIDTFYYVGLSGMSVGGELLRIPQEVFKLDDSGDGGVIVDCGTAITRLQS  385

Query  231  VAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNI  52
             AY +LR  +++    +      +  DTCYDL+G  +V+VPT+SF F GG+ W L A N 
Sbjct  386  EAYNSLRDSFVSMSRHLRSTSGVALFDTCYDLSGQSSVKVPTVSFHFDGGKSWDLPAANY  445

Query  51   LIPVNKRGIFCFAFAPS  1
            LIPV+  G +CFAFAP+
Sbjct  446  LIPVDSAGTYCFAFAPT  462



>ref|XP_009356391.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=491

 Score =   261 bits (667),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 139/315 (44%), Positives = 194/315 (62%), Gaps = 5/315 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G PP   Y+ +DTGS++ WVQC PC  C+ Q DP+F+P  S+SF+
Sbjct  148  GTSQGSGEYFSRVGIGKPPSQAYVVLDTGSDVSWVQCAPCADCYQQADPIFEPASSTSFS  207

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             + C S  C  + +  C    C Y + Y DGSY +G  V ETI+FGG   +++ +GC  T
Sbjct  208  PLSCESQQCKSLDVFDCRNETCLYEVAYGDGSYTVGDFVTETISFGGVSAKEIAIGCGHT  267

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+G+  GA GLLGL GGS++F +Q+   +   FSYCL    ++S+ +L+F   + P  AV
Sbjct  268  NEGLFVGAAGLLGLGGGSLSFPSQLNATS---FSYCLVDRDSDSASTLDFNSPLSP-NAV  323

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
              PL R+ +  T +Y+GL+GL VG   LPI E  F++ E GNGG+I+D GT+VTRL    
Sbjct  324  TAPLRRNPQLDTFHYVGLTGLSVGGELLPIPESAFQIDESGNGGIIIDSGTAVTRLQTDT  383

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y  LR  +M     +P     +  D CYDL+   +V+VPT+SF F  G++  L AKN LI
Sbjct  384  YNVLRDAFMKGTKDLPFTKGAALCDACYDLSSKRSVEVPTLSFHFADGKVLPLPAKNFLI  443

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAP+
Sbjct  444  PVDSDGTFCFAFAPT  458



>ref|XP_006298983.1| hypothetical protein CARUB_v10015108mg [Capsella rubella]
 gb|EOA31881.1| hypothetical protein CARUB_v10015108mg [Capsella rubella]
Length=501

 Score =   261 bits (667),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 141/317 (44%), Positives = 196/317 (62%), Gaps = 6/317 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTP +  YL +DTGS++ W+QCQPC  C+ Q DPVF PT SS++ 
Sbjct  155  GASQGSGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCQPCSDCYQQSDPVFSPTSSSTYK  214

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + C++  C+ +    C   +C Y + Y DGS+ +G    +T+TFG +  ++DV +GC  
Sbjct  215  SLTCAAPQCSLLETSACRSNKCLYQVSYGDGSFTVGEFATDTVTFGQSGTLKDVALGCGH  274

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+ TGA GLLGL GG+++   Q+   +   FSYCL    +  S SL+F    +  G 
Sbjct  275  DNEGLFTGAAGLLGLGGGALSMTKQMKATS---FSYCLVDRDSGKSSSLDFNSVQLGSGD  331

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
               PLLR+ +  T YY+GLSG  VG  K+ I + +F ++  G GGVI+D GT+VTRL   
Sbjct  332  ATAPLLRNQKIDTFYYVGLSGFSVGGQKVTIPDSIFEVSTSGTGGVILDCGTAVTRLQTE  391

Query  228  AYETLRYIYMTQIATIPR-APSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNI  52
            AY +LR  ++   A + +   S S  DTCYD + L TV+VPT++F FTGG+   L AKN 
Sbjct  392  AYNSLRDAFIRLTANLKKGTSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKSLDLPAKNY  451

Query  51   LIPVNKRGIFCFAFAPS  1
            LIPV+  G FCFAFAP+
Sbjct  452  LIPVDDSGTFCFAFAPT  468



>ref|XP_010465949.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=502

 Score =   261 bits (667),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 142/317 (45%), Positives = 195/317 (62%), Gaps = 6/317 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTP +  YL +DTGS++ W+QCQPC  C+ Q DPVF+PT SS++ 
Sbjct  156  GASQGSGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCQPCSDCYQQSDPVFNPTSSSTYK  215

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + CS+  C+ +    C   +C Y + Y DGS+ +G    +T+TFG +  + DV +GC  
Sbjct  216  SLTCSAPQCSLLETSACRSNKCLYQVSYGDGSFTVGEFATDTVTFGESGKLNDVALGCGH  275

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+ TGA GLLGL GG ++   Q+   +   FSYCL    +  S SL+F    +  G 
Sbjct  276  DNEGLFTGAAGLLGLGGGVLSITNQMKATS---FSYCLVDRDSAKSSSLDFNSVQLGSGD  332

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
               PLLR+ +  T YY+GLSG  VG  K+ IS+ +F +   G+GGVI+D GT+VTRL   
Sbjct  333  ATAPLLRNQKIDTFYYLGLSGFSVGGQKVMISDSIFAVDASGSGGVILDCGTAVTRLQTE  392

Query  228  AYETLRYIYMTQIATIPR-APSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNI  52
            AY +LR  ++     + +   S S  DTCYD + L TV+VPT++F FTGG+   L AKN 
Sbjct  393  AYNSLRDAFLRLTTNLKKGTSSISLFDTCYDFSSLSTVKVPTVTFHFTGGKSLDLPAKNY  452

Query  51   LIPVNKRGIFCFAFAPS  1
            LIPV+  G FCFAFAP+
Sbjct  453  LIPVDDSGTFCFAFAPT  469



>ref|XP_011093892.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Sesamum 
indicum]
Length=478

 Score =   261 bits (666),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 144/316 (46%), Positives = 198/316 (63%), Gaps = 5/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTP +Y Y+ +DTGS+++WVQC PC+ C+ Q DPVFDP +S+SF 
Sbjct  128  GLAQGSGEYFTRLGVGTPAKYVYMVLDTGSDVVWVQCSPCRRCYTQSDPVFDPRKSTSFL  187

Query  762  IVPCSSTICNRIHL-GC-TRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             V C S +C R+   GC  R +C Y + Y DGS+ +G    ET+TF GT V+++ +GC  
Sbjct  188  GVSCGSPLCRRLDSPGCNNRKKCLYQVSYGDGSFTVGEFSTETLTFRGTRVKNIALGCGH  247

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPVG  412
             N+G+  GA GLLGL  G ++F  Q   + G  FSYC+    A S   S+ FG   +   
Sbjct  248  DNEGLFVGAAGLLGLGRGKLSFPTQAGRRFGRKFSYCVVDRSASSKPSSILFGEAAVSRR  307

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLP  235
            AV+ PLL + +  T YY+GL+G+ VG +++P I+  +F+L   GNGGVI+D GTSVTRL 
Sbjct  308  AVFTPLLTNPKLDTFYYVGLNGISVGGVRVPGITASLFKLDAAGNGGVIVDSGTSVTRLT  367

Query  234  KVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
            + AY  LR  +    + +  AP FS  DTC+DL+G   V+VPT+   F G  + +L A N
Sbjct  368  RPAYVALRNAFRVGASNLKPAPDFSLFDTCFDLSGKTEVKVPTVVLHFAGADV-SLPASN  426

Query  54   ILIPVNKRGIFCFAFA  7
             LIPV+  G FCFAFA
Sbjct  427  YLIPVDSDGKFCFAFA  442



>gb|KFK39179.1| hypothetical protein AALP_AA3G210500 [Arabis alpina]
Length=499

 Score =   261 bits (667),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 139/317 (44%), Positives = 196/317 (62%), Gaps = 6/317 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTP +  ++ +DTGS++ W+QCQPC  C+ Q DP+FDPT SS+F 
Sbjct  153  GAGQGSGEYFSRIGVGTPAKEMFMVLDTGSDINWIQCQPCSDCYQQSDPIFDPTSSSTFK  212

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + CS+  C+ + +  C   +C Y + Y DGS+ +GT   +T+TFG +  + +V +GC  
Sbjct  213  SLTCSAPQCSSLEVSACRSDKCLYQVSYGDGSFTVGTYATDTVTFGNSGKISNVALGCGH  272

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+ TGA GLLGL GG+++   QI   +   FSYCL    +  S SL+F    +  G 
Sbjct  273  DNEGLFTGAAGLLGLGGGALSMTNQIKATS---FSYCLVDRDSGKSSSLDFNSVQVGAGD  329

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
               PLLR+ +  T YY+GLSG  VG  ++ I   VF +   G GGVI+D GT++TRL   
Sbjct  330  ATAPLLRNSKIDTFYYVGLSGFSVGGQEVKIPSSVFEVDASGTGGVILDCGTAITRLKTE  389

Query  228  AYETLRYIYMTQIATIPR-APSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNI  52
            AY +LR  ++   + + +   S S  DTCYD + L TV+VPT++F FTGG+   L AKN 
Sbjct  390  AYNSLRDSFVKLTSNLKKGTSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKSLDLPAKNY  449

Query  51   LIPVNKRGIFCFAFAPS  1
            LIP++  G FCFAFAP+
Sbjct  450  LIPIDDAGTFCFAFAPT  466



>ref|XP_007209939.1| hypothetical protein PRUPE_ppa004726mg [Prunus persica]
 gb|EMJ11138.1| hypothetical protein PRUPE_ppa004726mg [Prunus persica]
Length=494

 Score =   261 bits (666),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 140/316 (44%), Positives = 194/316 (61%), Gaps = 6/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTP +  Y+ +DTGS++ W+QC+PC  C+ Q DPVF+PT SS++ 
Sbjct  150  GVSQGSGEYFTRIGVGTPAKSLYMVLDTGSDINWLQCEPCSDCYQQTDPVFNPTGSSTYR  209

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             V C S  C+ +H+  C   +C Y + Y DGSY +G  V ET++FG +  + +V +GC  
Sbjct  210  PVTCDSAQCHSLHVSACRADKCLYQVSYGDGSYTVGDFVTETVSFGNSGAIHNVGLGCGH  269

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  GA GLLGL GG+++  +Q    +   FSYCL +  + +S +LEF     P  +
Sbjct  270  DNEGLFVGAAGLLGLGGGALSLPSQFKATS---FSYCLVNRDSSTSSTLEFN-SAPPSDS  325

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V  PLL+  R  T YY+GL G  VG   + +   VF + E GNGG+I+D GT++TRL   
Sbjct  326  VTAPLLKDSRVETFYYVGLKGFSVGGQPVSVPPSVFEVDESGNGGIIVDSGTAITRLQTE  385

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY +LR  +      +P A  F+  DTCYDL+    VQVPT+SF F  G+  +L AKN L
Sbjct  386  AYNSLRDAFKRLTRDLPSASGFALFDTCYDLSSRSRVQVPTVSFLFADGKSLSLPAKNYL  445

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+  G FCFAFAP+
Sbjct  446  IPVDSAGTFCFAFAPT  461



>ref|XP_011038277.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Populus 
euphratica]
Length=505

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 147/317 (46%), Positives = 195/317 (62%), Gaps = 6/317 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTP +Y Y+ +DTGS+++W+QC PCK C+ Q DPVFDPT+S SFA
Sbjct  154  GLAQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWIQCAPCKKCYSQTDPVFDPTKSRSFA  213

Query  762  IVPCSSTICNRIHL-GCTRGR--CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCS  592
             +PC S +C R+   GC+  +  C Y + Y DGS+ +G    ET+TF GT V  V +GC 
Sbjct  214  SIPCGSPLCRRLDYPGCSTKKQICLYQVSYGDGSFTVGEFSTETLTFRGTRVGRVVLGCG  273

Query  591  QTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPV  415
              N+G+  GA GLLGL  G ++F +QI  +    FSYCL    A S   S+ FG   I  
Sbjct  274  HDNEGLFVGAAGLLGLGRGRLSFPSQIGRRFNSKFSYCLVDRSASSRPSSIVFGDSAISR  333

Query  414  GAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRL  238
             A + PLL + +  T YY+ L G+ VG  ++  IS  +F+L   GNGGVI+D GTSVTRL
Sbjct  334  TARFTPLLSNPKLDTFYYLELLGISVGGTRVSGISASLFKLDSTGNGGVIIDSGTSVTRL  393

Query  237  PKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAK  58
             + AY  LR  +    + + RAP FS  DTC+DL+G   V+VPT+   F G  + +L A 
Sbjct  394  TRAAYVALRDAFRVGASNLKRAPEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAS  452

Query  57   NILIPVNKRGIFCFAFA  7
            N LIPV+  G FCFAFA
Sbjct  453  NYLIPVDNSGSFCFAFA  469



>ref|XP_010053832.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Eucalyptus 
grandis]
 gb|KCW78191.1| hypothetical protein EUGRSUZ_D02381 [Eucalyptus grandis]
Length=485

 Score =   260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 144/316 (46%), Positives = 196/316 (62%), Gaps = 5/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTPP+Y Y+ +DTGS+++W+QC PC+ C+ Q DPVFDP++S+SFA
Sbjct  135  GLAQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWIQCAPCRKCYSQTDPVFDPSKSTSFA  194

Query  762  IVPCSSTICNRIHL-GCT-RGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             +PCSS +C R+   GC  R RC Y + Y DGS+ +G    ET+TF  T V  V +GC  
Sbjct  195  AIPCSSPLCRRLDSPGCNQRRRCQYQVAYGDGSFTLGEFSSETLTFRRTRVGRVALGCGH  254

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPVG  412
             N+G+  GA GLLGL  G ++F AQ   +    FSYCL    A S   S+ FG   +   
Sbjct  255  DNEGLFIGAAGLLGLGRGRLSFPAQAGRRFNNKFSYCLVDRSASSRPSSVIFGDNALSRP  314

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLP  235
            A +  LL + +  T YY+ L G+ VG  ++  I+  +F+L   GNGG+I+D GTSVTRL 
Sbjct  315  ARFTKLLTNPKLDTFYYVELLGMSVGGARVRGITASLFKLDAAGNGGLIVDSGTSVTRLT  374

Query  234  KVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
            + AY  LR  +    + + RAP FS  DTC+DL+G   V+VPT+   F G  + +L A N
Sbjct  375  RPAYNALRDAFRAGASGLKRAPDFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPASN  433

Query  54   ILIPVNKRGIFCFAFA  7
             LIPV+ +G FCFAFA
Sbjct  434  YLIPVDSQGTFCFAFA  449



>ref|XP_010506935.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Camelina 
sativa]
Length=501

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 141/317 (44%), Positives = 195/317 (62%), Gaps = 6/317 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTP +  YL +DTGS++ W+QC+PC  C+ Q DPVF+PT SS++ 
Sbjct  155  GASQGSGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPCSDCYQQSDPVFNPTSSSTYK  214

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + CS+  C+ +    C   +C Y + Y DGS+ +G    +T+TFG +  + DV +GC  
Sbjct  215  SLTCSAPQCSLLETSACRSNKCLYQVSYGDGSFTVGEFATDTVTFGESGKINDVALGCGH  274

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+ TGA GLLGL GG ++   Q+   +   FSYCL    +  S SL+F    +  G 
Sbjct  275  DNEGLFTGAAGLLGLGGGVLSITNQMKATS---FSYCLVDRDSAKSSSLDFNSVQLGSGD  331

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
               PLLR+ +  T YY+GLSG  VG  K+ IS+ +F +   G+GGVI+D GT+VTRL   
Sbjct  332  ATAPLLRNQKIDTFYYLGLSGFSVGGQKVMISDSIFAVDASGSGGVILDCGTAVTRLQTE  391

Query  228  AYETLRYIYMTQIATIPR-APSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNI  52
            AY +LR  ++     + +   S S  DTCYD + L TV+VPT++F FTGG+   L AKN 
Sbjct  392  AYNSLRDAFLRLTTKLKKGTSSISLFDTCYDFSSLSTVKVPTVTFHFTGGKSLDLPAKNY  451

Query  51   LIPVNKRGIFCFAFAPS  1
            LIPV+  G FCFAFAP+
Sbjct  452  LIPVDDSGTFCFAFAPT  468



>gb|KFK35370.1| hypothetical protein AALP_AA5G276300 [Arabis alpina]
Length=485

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 145/323 (45%), Positives = 199/323 (62%), Gaps = 12/323 (4%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY +R+GVGTP    Y+ +DTGS+++W+QC PCK C+ Q DP+FDP +S S+A
Sbjct  129  GLSQGSGEYFMRLGVGTPATNAYMVLDTGSDVVWLQCSPCKVCYNQSDPIFDPKKSKSYA  188

Query  762  IVPCSSTICNRIHLG--CTRGR---CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMG  598
             V C S +C R+     C   R   C Y + Y DGS+ +G    ET++F G  V  V +G
Sbjct  189  TVACGSRLCRRLDDSSECITRRSKTCLYQVSYGDGSFTVGDFSTETLSFQGARVDHVALG  248

Query  597  CSQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGS-----LEFG  433
            C   N+G+  GA GLLGL  G ++F +Q   +  G FSYCL    +  S S     + FG
Sbjct  249  CGHDNEGLFVGAAGLLGLGRGGLSFPSQTNNRYNGKFSYCLVDRTSSGSASKPPSTIVFG  308

Query  432  REIIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIG  256
             + +P  +V+ PL+ + +  T YY+ L G+ VG  ++P +SE  F+L   GNGGVI+D G
Sbjct  309  NDAVPKTSVFTPLVTNPKLDTFYYLQLLGISVGGTRVPGVSETQFKLDASGNGGVIIDSG  368

Query  255  TSVTRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQI  76
            TSVTRL + AY  LR  +    + + RAPS+S  DTCYDL G+ TV+VPT+ F F GG++
Sbjct  369  TSVTRLTQSAYVALRDAFRLGASKLKRAPSYSLFDTCYDLIGMTTVKVPTVVFHFGGGEV  428

Query  75   WTLAAKNILIPVNKRGIFCFAFA  7
             +L A N LIPVN +G FCFAFA
Sbjct  429  -SLPASNYLIPVNTQGRFCFAFA  450



>ref|XP_010266550.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=484

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 148/317 (47%), Positives = 200/317 (63%), Gaps = 5/317 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTPP+Y Y+ +DTGS+++W+QC PC+ C+ Q DP+FDP +S SFA
Sbjct  132  GLSQGSGEYFTRIGVGTPPRYVYMVLDTGSDIVWIQCAPCRKCYTQADPMFDPKKSRSFA  191

Query  762  IVPCSSTICNRIHL-GCTRGR-CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             V C S +C R+ + GC++ R C Y + Y DGS+ +G    ET+TF GT V +V +GC  
Sbjct  192  GVSCGSPLCRRLDVSGCSQQRLCLYQVSYGDGSFTVGEFSTETLTFRGTKVGNVALGCGH  251

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAES--SGSLEFGREIIPV  415
             N+G+  GA GLLGL  G ++F +Q   + G  FSYCL    A +    S+ FG   +P 
Sbjct  252  DNEGLFVGAAGLLGLGRGKLSFPSQAGRRFGRKFSYCLVDRQAAAVKPSSVVFGESAVPR  311

Query  414  GAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRL  238
             AV+ P+L + R  T YY+ L G+ VG +++P I+  +F++   GNGGVI+D GTSVTRL
Sbjct  312  SAVFTPMLTNPRLDTFYYVELIGISVGGVRVPGITASLFKMDSAGNGGVIIDSGTSVTRL  371

Query  237  PKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAK  58
             + AY  LR  +      + RA  FS  DTCYDL+G   V+VPT+   F GG   +L A 
Sbjct  372  TRPAYVALRDAFRAGAIQLKRAEGFSLFDTCYDLSGKTVVKVPTVVMHFRGGADLSLPAA  431

Query  57   NILIPVNKRGIFCFAFA  7
            N LIPV+  GIFCFAFA
Sbjct  432  NYLIPVDSNGIFCFAFA  448



>ref|XP_008446567.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Cucumis 
melo]
Length=486

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 139/315 (44%), Positives = 193/315 (61%), Gaps = 5/315 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G PP   Y+ +DTGS++ WVQC PC  C+ Q DP+F+PT S+SF 
Sbjct  143  GASQGSGEYFSRVGIGRPPSPVYMVLDTGSDVSWVQCAPCAECYEQTDPIFEPTSSASFT  202

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             + C +  C  + +  C  G C Y + Y DGSY +G  V ET+T G T +R++ +GC   
Sbjct  203  SLSCETEQCKSLDVSECRNGTCLYEVSYGDGSYTVGDFVTETVTLGSTSLRNIAIGCGHN  262

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+G+  GA GLLGL GGS++F +Q+   +   FSYCL    ++S+ +L+F   I P  AV
Sbjct  263  NEGLFIGAAGLLGLGGGSLSFPSQLNASS---FSYCLVDRDSDSTSTLDFNSPISP-DAV  318

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
              PL R+    T +Y+GL+G+ VG   LPI E  F+++E GNGG+I+D GT+VTRL    
Sbjct  319  TAPLHRNPNLDTFFYLGLTGMSVGGTVLPIPETSFQMSEDGNGGIIVDSGTAVTRLQTTV  378

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y  LR  ++     +  A   +  DTCYDL+   +V+VPT+SF F  G    L AKN LI
Sbjct  379  YNVLRDSFVKSTHDLQSARGVALFDTCYDLSSKSSVEVPTVSFHFANGNELPLPAKNYLI  438

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAP+
Sbjct  439  PVDSEGTFCFAFAPT  453



>ref|XP_006484425.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Citrus 
sinensis]
Length=485

 Score =   259 bits (662),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 138/315 (44%), Positives = 191/315 (61%), Gaps = 5/315 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G PP   Y+ +DTGS++ W+QC PC  C+ Q DP+F+PT SSS++
Sbjct  142  GSSQGSGEYFSRVGIGKPPSQVYMVLDTGSDVNWLQCAPCADCYQQADPIFEPTSSSSYS  201

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             + C++  C  +    C    C Y + Y DGSY +G  V ET+T G   V ++ +GC   
Sbjct  202  PLTCNTKQCQSLDESECRNNTCLYEVSYGDGSYTVGDFVTETVTLGSASVDNIAIGCGHN  261

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+G+  GA GLLGL GG ++F +QI   T   FSYCL    ++S+ +LEF   + P  AV
Sbjct  262  NEGLFVGAAGLLGLGGGLLSFPSQINAST---FSYCLVDRDSDSTSTLEFDSSL-PPNAV  317

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
              PLLR+    T YY+GL+G+ VG   LPISE  F++ E GNGG+I+D GT+VTRL    
Sbjct  318  TAPLLRNHELDTFYYLGLTGISVGGDLLPISETAFKIDESGNGGIIVDSGTAVTRLQTET  377

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y  LR  ++     +      +  DTCYD +   +V+VPT+SF F  G++  L AKN LI
Sbjct  378  YNALRDAFVRGTRALSPTDGVALFDTCYDFSSRSSVEVPTVSFHFPEGKVLPLPAKNFLI  437

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAP+
Sbjct  438  PVDSNGTFCFAFAPT  452



>ref|XP_004139658.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 ref|XP_004154449.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN44550.1| hypothetical protein Csa_7G329350 [Cucumis sativus]
Length=453

 Score =   258 bits (659),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 143/317 (45%), Positives = 195/317 (62%), Gaps = 6/317 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTPP+Y Y+ +DTGS+++W+QC PC+ C+ Q DP+F+P +S SFA
Sbjct  102  GLSQGSGEYFTRLGVGTPPRYLYMVLDTGSDVVWLQCSPCRKCYSQSDPIFNPYKSKSFA  161

Query  762  IVPCSSTICNRIH-LGCT--RGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCS  592
             +PCSS +C R+   GC+  R  C Y + Y DGS+  G    ET+TF G  +  V +GC 
Sbjct  162  GIPCSSPLCRRLDSSGCSTRRHTCLYQVSYGDGSFTTGDFATETLTFRGNKIAKVALGCG  221

Query  591  QTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPV  415
              N+G+  GA GLLGL  G ++F +Q   +    FSYCL    A S   S+ FG   I  
Sbjct  222  HHNEGLFVGAAGLLGLGRGRLSFPSQTGIRFNHKFSYCLVDRSASSKPSSMVFGDAAISR  281

Query  414  GAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRL  238
             A + PL+R+ +  T YY+GL G+ VG +++  +S  +F+L   GNGGVI+D GTSVTRL
Sbjct  282  LARFTPLIRNPKLDTFYYVGLIGISVGGVRVRGVSPSLFKLDSAGNGGVIIDSGTSVTRL  341

Query  237  PKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAK  58
             + AY  LR  +      + R P FS  DTCYDL+G  +V+VPT+   F G  +  L A 
Sbjct  342  TRPAYTALRDAFRVGARHLKRGPEFSLFDTCYDLSGQSSVKVPTVVLHFRGADM-ALPAT  400

Query  57   NILIPVNKRGIFCFAFA  7
            N LIPV++ G FCFAFA
Sbjct  401  NYLIPVDENGSFCFAFA  417



>emb|CDX67868.1| BnaA07g19080D [Brassica napus]
Length=485

 Score =   258 bits (660),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 144/324 (44%), Positives = 199/324 (61%), Gaps = 13/324 (4%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY +R+GVGTP    Y+ +DTGS+++W+QC PCK C+ Q DP+FDP +S +FA
Sbjct  128  GLSQGSGEYFMRLGVGTPATNVYMVLDTGSDVVWLQCSPCKVCYNQSDPMFDPAKSKTFA  187

Query  762  IVPCSSTICNRIHLGCT----RGR--CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTM  601
             VPC S +C R+    +    RG   C Y + Y DGS+ MG    ET+TF G  V  V +
Sbjct  188  TVPCGSPLCRRLDESSSECVNRGSKTCLYQVSYGDGSFTMGDFSTETLTFHGARVDHVAL  247

Query  600  GCSQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGS-----LEF  436
            GC   N+G+  GA GLLGL  G ++F +Q   +    FSYCL    +  S S     + F
Sbjct  248  GCGHDNEGLFVGAAGLLGLGRGGLSFPSQTKNRYNAKFSYCLVDRTSSGSASKPPSTIVF  307

Query  435  GREIIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDI  259
            G + +P  +V+  LL + +  T YY+ L G+ VG  ++P +SE  F+L   G+GGVI+D 
Sbjct  308  GNDAVPETSVFTTLLTNPKLDTFYYLQLLGISVGGSRVPGVSESQFKLDPTGDGGVIIDS  367

Query  258  GTSVTRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQ  79
            GTSVTRL + AY   R  ++     + RAPS+S  DTC+DL+G+ TV+VPT+ F F+GG 
Sbjct  368  GTSVTRLTRPAYVAFRDAFLLGATRLKRAPSYSLFDTCFDLSGMTTVKVPTVVFHFSGGD  427

Query  78   IWTLAAKNILIPVNKRGIFCFAFA  7
            + +L A N LIPVN +G FCFAFA
Sbjct  428  V-SLPASNYLIPVNSQGRFCFAFA  450



>ref|XP_008389306.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Malus domestica]
 ref|XP_008367019.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=488

 Score =   258 bits (660),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 138/315 (44%), Positives = 192/315 (61%), Gaps = 5/315 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G PP   Y+ +DTGS++ WVQC PC  C+ Q DP+F+P  S+SF+
Sbjct  145  GTSQGSGEYFSRVGIGKPPSQAYVVLDTGSDISWVQCAPCADCYQQADPIFEPASSTSFS  204

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             + C S  C  + +  C  G C Y + Y DGSY +G  V ETI+ GG    ++ +GC  T
Sbjct  205  PLSCESQQCKSLDVFECRNGTCLYEVAYGDGSYTVGDFVTETISIGGASAXEIAIGCGHT  264

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+G+  GA GLLGL GGS++F +Q+   +   FSYCL    ++S+ +L+F   + P  AV
Sbjct  265  NEGLFIGAAGLLGLGGGSLSFPSQLNATS---FSYCLVDRDSDSASTLDFNSPLRP-NAV  320

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
              PL R+ +  T YY+G++GL VG   LPI E  F++   GNGG+I+D GT+VTRL    
Sbjct  321  TAPLRRNSQLDTFYYLGVTGLSVGGXLLPIPESAFQIDGSGNGGIIIDSGTAVTRLQTDT  380

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y  LR  +M     +P     +  D CYDL+   +V+VPT+SF F  G++  L AKN LI
Sbjct  381  YNVLRDAFMKGTKDLPVTKGAALFDACYDLSSRKSVEVPTVSFHFADGKVLPLPAKNFLI  440

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAP+
Sbjct  441  PVDSDGTFCFAFAPT  455



>ref|XP_010544842.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Tarenaya 
hassleriana]
Length=510

 Score =   259 bits (661),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 142/316 (45%), Positives = 200/316 (63%), Gaps = 5/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTP  Y Y+ +DTGS+++W+QC PCK C+ Q DP+FDP +S S+A
Sbjct  161  GLSQGSGEYFTRLGVGTPATYAYMVLDTGSDIVWLQCSPCKVCYNQSDPIFDPAKSRSYA  220

Query  762  IVPCSSTICNRIHL-GC-TRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             VPC+S +C R+   GC +R  C Y + Y DGS+ +G +  ET++F G  V  V +GC  
Sbjct  221  TVPCASRLCRRLDSPGCNSRRMCLYQVSYGDGSFTVGDLSTETLSFRGARVDHVAVGCGH  280

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGS-LEFGREIIPVG  412
             N+G+  GA GLLGL  G ++F +Q   +  G FSYCL    + +  S + FG       
Sbjct  281  DNEGLFVGAAGLLGLGRGGLSFPSQTKNRFKGKFSYCLVDRTSSAKPSTIVFGDGAAVNT  340

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLP  235
            AV+ PLL S +  T YY+ L G+ VG  ++  ++  +F+    GNGGVI+D GTSVTRL 
Sbjct  341  AVYTPLLTSPKLDTFYYLELLGISVGGTRVRGVTASLFKTAPAGNGGVIIDSGTSVTRLT  400

Query  234  KVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
            + AY  LR  +    + + RAP++S  DTC+DL+G+ TV+VPT+ F F+GG + +L A N
Sbjct  401  RAAYVALRDAFRAGASRLKRAPAYSLFDTCFDLSGMTTVKVPTVVFHFSGGDV-SLPATN  459

Query  54   ILIPVNKRGIFCFAFA  7
             LIPV+ +G FCFAFA
Sbjct  460  YLIPVDSKGRFCFAFA  475



>emb|CDY69364.1| BnaCnng63170D [Brassica napus]
Length=501

 Score =   258 bits (660),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 143/317 (45%), Positives = 191/317 (60%), Gaps = 6/317 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTP +  ++ +DTGS++ W+QCQPC  C+ Q DPVFDP  SS+F 
Sbjct  155  GASQGSGEYFSRIGVGTPAKEMFMVLDTGSDINWIQCQPCSDCYQQSDPVFDPASSSTFK  214

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + CS+  C  + +  C   +C Y + Y DGS+ +G    +T+TFG    V DV +GC  
Sbjct  215  SLSCSAPQCGSLEVSACRSDKCLYQVSYGDGSFTVGDYATDTVTFGTNGKVNDVALGCGH  274

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+ TGA GLLGL GG+++   QI   +   FSYCL    +  S SL+F       G 
Sbjct  275  DNEGLFTGAAGLLGLGGGALSMTNQIKATS---FSYCLVDRDSGKSSSLDFNSVQAGTGD  331

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
               PLLR+ +  T YY+GLSG  VG  ++ I   VF +   G GGVI+D GT+VTRL   
Sbjct  332  ATAPLLRNSKIDTFYYVGLSGFSVGGQQVSIPSSVFAVDASGAGGVILDCGTAVTRLQTQ  391

Query  228  AYETLRYIYMTQIATIPR-APSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNI  52
            AY +LR  ++   A + +   S S  DTCYD + L TV+VPT++F FTGG+   L AKN 
Sbjct  392  AYNSLRDAFVKLTANLKKGTSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKSIDLPAKNY  451

Query  51   LIPVNKRGIFCFAFAPS  1
            LIPV+  G FCFAFAP+
Sbjct  452  LIPVDDAGTFCFAFAPT  468



>ref|XP_009112699.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
 emb|CDY18523.1| BnaA01g26720D [Brassica napus]
Length=499

 Score =   258 bits (659),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 143/317 (45%), Positives = 191/317 (60%), Gaps = 6/317 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTP +  ++ +DTGS++ W+QCQPC  C+ Q DPVFDP  SS+F 
Sbjct  153  GASQGSGEYFSRIGVGTPAKEMFMVLDTGSDINWIQCQPCSDCYQQSDPVFDPASSSTFK  212

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + CS+  C  + +  C   +C Y + Y DGS+ +G    +T+TFG    V DV +GC  
Sbjct  213  SLSCSAPQCGSLEVSACRSDKCLYQVSYGDGSFTVGDYATDTVTFGTNGKVNDVALGCGH  272

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+ TGA GLLGL GG+++   QI   +   FSYCL    +  S SL+F       G 
Sbjct  273  DNEGLFTGAAGLLGLGGGALSMTNQIKATS---FSYCLVDRDSGKSSSLDFNSVQAGTGD  329

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
               PLLR+ +  T YY+GLSG  VG  ++ I   VF +   G GGVI+D GT+VTRL   
Sbjct  330  ATAPLLRNSKIDTFYYVGLSGFSVGGQQVSIPSSVFAVDASGAGGVILDCGTAVTRLQTQ  389

Query  228  AYETLRYIYMTQIATIPR-APSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNI  52
            AY +LR  ++   A + +   S S  DTCYD + L TV+VPT++F FTGG+   L AKN 
Sbjct  390  AYNSLRDAFVKLTANLKKGTSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKSIDLPAKNY  449

Query  51   LIPVNKRGIFCFAFAPS  1
            LIPV+  G FCFAFAP+
Sbjct  450  LIPVDDAGTFCFAFAPT  466



>gb|EYU40714.1| hypothetical protein MIMGU_mgv1a019320mg [Erythranthe guttata]
Length=469

 Score =   257 bits (657),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 142/316 (45%), Positives = 194/316 (61%), Gaps = 5/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIG+GTPP+Y Y+ +DTGS+++WVQC PC+ C+ Q DPVFDP  S+SF 
Sbjct  119  GLAQGSGEYFTRIGIGTPPKYVYMVLDTGSDVVWVQCSPCRKCYSQSDPVFDPKSSTSFL  178

Query  762  IVPCSSTICNRIHL-GC-TRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             + C S +C R+   GC  R +C Y + Y DGS+ +G    ET+TF  T V +V  GC  
Sbjct  179  GLTCDSPVCRRLDSPGCNNRDKCLYQVSYGDGSFTVGEFSTETLTFRKTKVDNVAFGCGH  238

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPVG  412
             N+G+  GA GLLGL  G ++F  Q   + G  FSYCL    A S   S+ FG   +   
Sbjct  239  DNEGLFVGAAGLLGLGRGKLSFPTQAGSRFGRKFSYCLVDRSASSKPSSMVFGESAVSRN  298

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLP  235
            AV+ PLL + +  T +Y+GL+G+ VG  ++P ++  +F+L   GNGGVI+D GTSVTRL 
Sbjct  299  AVFTPLLTNPKLDTFFYVGLNGVSVGGTRVPGVAASLFKLDPTGNGGVIVDSGTSVTRLT  358

Query  234  KVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
            + AY  LR  +    + + R+  FS  DTC+DL+G   V+VPT+   F G  + +L A N
Sbjct  359  RPAYVALRDAFRIGASNLKRSSDFSLFDTCFDLSGKTEVKVPTVVLHFEGADV-SLPASN  417

Query  54   ILIPVNKRGIFCFAFA  7
             LIPV+  G FCFAFA
Sbjct  418  YLIPVDSEGKFCFAFA  433



>ref|XP_010487776.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=501

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 140/317 (44%), Positives = 195/317 (62%), Gaps = 6/317 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTP +  YL +DTGS++ W+QC+PC  C+ Q DPVF+PT SS++ 
Sbjct  155  GASQGSGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPCSDCYQQSDPVFNPTSSSTYK  214

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + CS+  C+ +    C   +C Y + Y DGS+ +G    +T++FG +  + DV +GC  
Sbjct  215  SLTCSAPQCSLLETSACRSNKCLYQVSYGDGSFTVGEFATDTMSFGESGKLNDVALGCGH  274

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+ TGA GLLGL GG ++   Q+   +   FSYCL    +  S SL+F    +  G 
Sbjct  275  DNEGLFTGAAGLLGLGGGVLSITNQMKATS---FSYCLVDRDSGKSSSLDFNSVQLGSGD  331

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
               PLLR+ +  T YY+GLSG  VG  K+ IS+ +F +   G+GGVI+D GT+VTRL   
Sbjct  332  ATAPLLRNQKIDTFYYLGLSGFSVGGQKVMISDSIFAVDASGSGGVILDCGTAVTRLQTE  391

Query  228  AYETLRYIYMTQIATIPR-APSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNI  52
            AY +LR  ++     + +   S S  DTCYD + L TV+VPT++F FTGG+   L AKN 
Sbjct  392  AYNSLRDAFLRLTTNLKKGTSSISLFDTCYDFSSLSTVKVPTVTFHFTGGKSLDLPAKNY  451

Query  51   LIPVNKRGIFCFAFAPS  1
            LIPV+  G FCFAFAP+
Sbjct  452  LIPVDDSGTFCFAFAPT  468



>ref|XP_006406598.1| hypothetical protein EUTSA_v10020568mg [Eutrema salsugineum]
 dbj|BAJ33681.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48051.1| hypothetical protein EUTSA_v10020568mg [Eutrema salsugineum]
Length=502

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 141/317 (44%), Positives = 191/317 (60%), Gaps = 6/317 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTP +  Y+ +DTGS++ W+QC PC  C+ Q DP+FDPT SS+F 
Sbjct  156  GTSQGSGEYFSRIGVGTPAKEMYVVLDTGSDVNWIQCLPCSECYQQSDPIFDPTSSSTFK  215

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + CS   C  + +  C   +C Y + Y DGS+ +G    +T+TFG +  V DV +GC  
Sbjct  216  SLTCSDPKCASLDVSACRSNKCLYQVSYGDGSFTVGNYATDTVTFGESGKVNDVALGCGH  275

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+ TGA GLLGL GG+++   QI  ++   FSYCL    +  S SL+F    I  G 
Sbjct  276  DNEGLFTGAAGLLGLGGGALSMTNQIKAKS---FSYCLVDRDSAKSSSLDFNSVQIGAGD  332

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
               PLLR+ +  T YY+GLSG  VG  ++ I   +F +   G GGVI+D GT+VTRL   
Sbjct  333  ATAPLLRNSKMDTFYYVGLSGFSVGGQQVSIPSSLFEVDASGAGGVILDCGTAVTRLQTQ  392

Query  228  AYETLRYIYMTQIATIPRAPS-FSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNI  52
            AY +LR  ++       +  S  S  DTCYD + L TV+VPT++F FTGG+   L AKN 
Sbjct  393  AYNSLRDAFVKLTTDFKKGTSPISLFDTCYDFSSLSTVKVPTVTFHFTGGKSLNLPAKNY  452

Query  51   LIPVNKRGIFCFAFAPS  1
            LIP++  G FCFAFAP+
Sbjct  453  LIPIDDAGTFCFAFAPT  469



>ref|XP_006437718.1| hypothetical protein CICLE_v10031364mg [Citrus clementina]
 gb|ESR50958.1| hypothetical protein CICLE_v10031364mg [Citrus clementina]
Length=485

 Score =   257 bits (657),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 138/315 (44%), Positives = 190/315 (60%), Gaps = 5/315 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G PP   Y+ +DTGS++ W+QC PC  C+ Q DP+F+PT SSS++
Sbjct  142  GSSQGSGEYFSRVGIGKPPSQVYMVLDTGSDVNWLQCAPCADCYQQADPIFEPTSSSSYS  201

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             + C++  C  +    C    C Y + Y DGSY +G  V ET+T G   V ++ +GC   
Sbjct  202  PLTCNTKQCQSLDESECRNNTCLYEVSYGDGSYTVGDFVTETVTLGSASVDNIAIGCGHN  261

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+G+  GA GLLGL GG ++F +QI   T   FSYCL    + S+ +LEF   + P  AV
Sbjct  262  NEGLFVGAAGLLGLGGGLLSFPSQINAST---FSYCLVDRDSGSTSTLEFDSSL-PPNAV  317

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
              PLLR+    T YY+GL+G+ VG   LPISE  F++ E GNGG+I+D GT+VTRL    
Sbjct  318  TAPLLRNHELDTFYYLGLTGISVGGDLLPISETAFKIDESGNGGIIVDSGTAVTRLQTET  377

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y  LR  ++     +      +  DTCYD +   +V+VPT+SF F  G++  L AKN LI
Sbjct  378  YNALRDAFVRGTRALSPTDGVALFDTCYDFSSRSSVEVPTVSFHFPEGKVLPLPAKNFLI  437

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAP+
Sbjct  438  PVDSNGTFCFAFAPT  452



>ref|XP_009336599.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=488

 Score =   257 bits (657),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 138/315 (44%), Positives = 191/315 (61%), Gaps = 5/315 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G PP   Y+ +DTGS++ WVQC PC  C+ Q DP+F+P  S+SF+
Sbjct  145  GTSQGSGEYFSRVGIGKPPSQAYVVLDTGSDISWVQCAPCADCYQQADPIFEPASSTSFS  204

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             + C S  C  + +  C  G C Y + Y DGSY +G  V ETI+ GG   +++ +GC  T
Sbjct  205  PLSCESQQCKSLDVFECRNGTCLYEVAYGDGSYTVGDFVTETISIGGASAKEIAIGCGHT  264

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+G+  GA GLLGL GGS++F +Q+   +    SYCL    ++S+ +L+F   + P  AV
Sbjct  265  NEGLFVGAAGLLGLGGGSLSFPSQLNATS---LSYCLVDRDSDSASTLDFNSPLRP-NAV  320

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
              PL R+ +  T YY+GL+GL VG   LPI E  F++   GNGG+I+D GT+VTRL    
Sbjct  321  TAPLRRNSQLDTFYYLGLTGLSVGGSLLPIPESAFQIDGSGNGGIIIDSGTAVTRLQTDT  380

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y  LR  +M     +P     +  D CYDL+    V+VPT+SF F  G++  L AKN LI
Sbjct  381  YNVLRDAFMKGTKDLPFTKGPALFDACYDLSSRKRVEVPTVSFHFADGKVLPLPAKNFLI  440

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAP+
Sbjct  441  PVDSDGTFCFAFAPT  455



>ref|XP_002263964.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Vitis vinifera]
 emb|CAN64659.1| hypothetical protein VITISV_009613 [Vitis vinifera]
Length=489

 Score =   257 bits (656),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 143/316 (45%), Positives = 197/316 (62%), Gaps = 5/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTPP+Y Y+ +DTGS+++W+QC PC+ C+ Q DPVFDP +S SF+
Sbjct  139  GLAQGSGEYFTRLGVGTPPKYVYMVLDTGSDVVWIQCAPCRKCYSQTDPVFDPKKSGSFS  198

Query  762  IVPCSSTICNRIHL-GC-TRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             + C S +C R+   GC +R  C Y + Y DGS+  G    ET+TF GT V  V +GC  
Sbjct  199  SISCRSPLCLRLDSPGCNSRQSCLYQVAYGDGSFTFGEFSTETLTFRGTRVPKVALGCGH  258

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPVG  412
             N+G+  GA GLLGL  G ++F  Q   + G  FSYCL    A S   S+ FG+  +   
Sbjct  259  DNEGLFVGAAGLLGLGRGRLSFPTQTGLRFGRKFSYCLVDRSASSKPSSVVFGQSAVSRT  318

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLP  235
            AV+ PL+ + +  T YY+ L+G+ VG  ++  I+  +F+L   GNGGVI+D GTSVTRL 
Sbjct  319  AVFTPLITNPKLDTFYYLELTGISVGGARVAGITASLFKLDTAGNGGVIIDSGTSVTRLT  378

Query  234  KVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
            + AY +LR  +    A + RAP +S  DTC+DL+G   V+VPT+   F G  + +L A N
Sbjct  379  RRAYVSLRDAFRAGAADLKRAPDYSLFDTCFDLSGKTEVKVPTVVMHFRGADV-SLPATN  437

Query  54   ILIPVNKRGIFCFAFA  7
             LIPV+  G+FCFAFA
Sbjct  438  YLIPVDTNGVFCFAFA  453



>ref|XP_002885261.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61520.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=500

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 138/317 (44%), Positives = 196/317 (62%), Gaps = 6/317 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTP +  YL +DTGS++ W+QC+PC  C+ Q DPVF+PT SS++ 
Sbjct  154  GVSQGSGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPCSDCYQQSDPVFNPTSSSTYK  213

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + CS+  C+ +    C   +C Y + Y DGS+ +G +  +T+TFG +  + DV +GC  
Sbjct  214  SLTCSAPQCSLLETSACRSNKCLYQVSYGDGSFTVGELATDTVTFGNSGKINDVALGCGH  273

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+ TGA GLLGL GG+++   Q+   +   FSYCL    +  S SL+F    +  G 
Sbjct  274  DNEGLFTGAAGLLGLGGGALSITNQMKATS---FSYCLVDRDSGKSSSLDFNSVQLGSGD  330

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
               PLLR+ +  T YY+GLSG  VG  K+ + + +F +   G+GGVI+D GT+VTRL   
Sbjct  331  ATAPLLRNQKIDTFYYVGLSGFSVGGQKVMMPDAIFDVDASGSGGVILDCGTAVTRLQTQ  390

Query  228  AYETLRYIYMTQIATIPR-APSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNI  52
            AY +LR  ++     + +   S S  DTCYD + L +V+VPT++F FTGG+   L AKN 
Sbjct  391  AYNSLRDAFLKLTTNLKKGTSSISLFDTCYDFSSLSSVKVPTVAFHFTGGKSLDLPAKNY  450

Query  51   LIPVNKRGIFCFAFAPS  1
            LIPV+  G FCFAFAP+
Sbjct  451  LIPVDDNGTFCFAFAPT  467



>gb|EYU32252.1| hypothetical protein MIMGU_mgv1a005685mg [Erythranthe guttata]
Length=474

 Score =   256 bits (654),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 143/316 (45%), Positives = 199/316 (63%), Gaps = 5/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTP +Y Y+ +DTGS+++W+QC PC+ C+ Q DPVFDP +S +F+
Sbjct  124  GLAHGSGEYFTRLGVGTPAKYVYMVLDTGSDVVWIQCSPCRKCYTQSDPVFDPKKSKTFS  183

Query  762  IVPCSSTICNRIHL-GC-TRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             V C S +C R+   GC ++ +C Y + Y DGS+ +G    ET+TF    V+++ +GC  
Sbjct  184  GVACGSPLCRRLDSPGCGSQRKCLYQVSYGDGSFTVGDFSTETLTFRRRRVKNIALGCGH  243

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPVG  412
             N+G+  GAGGLLGL  G ++F +Q   + G  FSYCL    A S   SL FG   +   
Sbjct  244  DNEGLFVGAGGLLGLGRGKLSFPSQAGRRFGKKFSYCLVDRSASSKPSSLLFGESAVSRK  303

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLP  235
            AV+ PLL + +  T YY+GL+G+ VG  ++P I+  +F+L   GNGGVI+D GTSVTRL 
Sbjct  304  AVFTPLLTNPKLDTFYYVGLNGMSVGGARVPGITASLFKLDASGNGGVIVDSGTSVTRLN  363

Query  234  KVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
            + AY  LR  +    + + R P FS  DTC+DL+G   V+VPT+   FTG  + +L A N
Sbjct  364  RPAYVALRDAFRAGASNLKRGPDFSLFDTCFDLSGKTEVKVPTVVMHFTGADV-SLPASN  422

Query  54   ILIPVNKRGIFCFAFA  7
             LIPV+  G FCFAFA
Sbjct  423  YLIPVDSNGKFCFAFA  438



>ref|XP_002878415.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54674.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=486

 Score =   256 bits (655),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 144/323 (45%), Positives = 197/323 (61%), Gaps = 12/323 (4%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY +R+GVGTP    Y+ +DTGS+++W+QC PCK C+ Q D +FDP +S +FA
Sbjct  130  GLSQGSGEYFMRLGVGTPATNVYMVLDTGSDVVWLQCSPCKACYNQSDVIFDPKKSKTFA  189

Query  762  IVPCSSTICNRIHLG--CTRGR---CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMG  598
             VPC S +C R+     C   R   C Y + Y DGS+  G    ET+TF G  V  V +G
Sbjct  190  TVPCGSRLCRRLDDSSECVTRRSKTCLYQVSYGDGSFTEGDFSTETLTFHGARVDHVPLG  249

Query  597  CSQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLAS-----WHAESSGSLEFG  433
            C   N+G+  GA GLLGL  G ++F +Q   +  G FSYCL         ++   ++ FG
Sbjct  250  CGHDNEGLFVGAAGLLGLGRGGLSFPSQTKSRYNGKFSYCLVDRTSSGSSSKPPSTIVFG  309

Query  432  REIIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIG  256
             + +P  +V+ PLL + +  T YY+ L G+ VG  ++P +SE  F+L   GNGGVI+D G
Sbjct  310  NDAVPKTSVFTPLLTNPKLDTFYYLQLLGISVGGSRVPGVSESQFKLDATGNGGVIIDSG  369

Query  255  TSVTRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQI  76
            TSVTRL + AY  LR  +      + RAPS+S  DTC+DL+G+ TV+VPT+ F F GG++
Sbjct  370  TSVTRLTQSAYVALRDAFRLGATKLKRAPSYSLFDTCFDLSGMTTVKVPTVVFHFGGGEV  429

Query  75   WTLAAKNILIPVNKRGIFCFAFA  7
             +L A N LIPVN  G FCFAFA
Sbjct  430  -SLPASNYLIPVNTEGRFCFAFA  451



>ref|XP_004135107.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN52057.1| hypothetical protein Csa_5G608450 [Cucumis sativus]
Length=486

 Score =   256 bits (655),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 138/315 (44%), Positives = 191/315 (61%), Gaps = 5/315 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G PP   Y+ +DTGS++ WVQC PC  C+ Q DP+F+PT S+SF 
Sbjct  143  GASQGSGEYFSRVGIGRPPSPVYMVLDTGSDVSWVQCAPCAECYEQTDPIFEPTSSASFT  202

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             + C +  C  + +  C  G C Y + Y DGSY +G  V ET+T G T + ++ +GC   
Sbjct  203  SLSCETEQCKSLDVSECRNGTCLYEVSYGDGSYTVGDFVTETVTLGSTSLGNIAIGCGHN  262

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+G+  GA GLLGL GGS++F +Q+   +   FSYCL    ++S+ +L+F   I P  AV
Sbjct  263  NEGLFIGAAGLLGLGGGSLSFPSQLNASS---FSYCLVDRDSDSTSTLDFNSPITP-DAV  318

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
              PL R+    T +Y+GL+G+ VG   LPI E  F+++E GNGG+I+D GT+VTRL    
Sbjct  319  TAPLHRNPNLDTFFYLGLTGMSVGGAVLPIPETSFQMSEDGNGGIIVDSGTAVTRLQTTV  378

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y  LR  ++     +  A   +  DTCYDL+    V+VPT+SF F  G    L AKN LI
Sbjct  379  YNVLRDAFVKSTHDLQTARGVALFDTCYDLSSKSRVEVPTVSFHFANGNELPLPAKNYLI  438

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAP+
Sbjct  439  PVDSEGTFCFAFAPT  453



>gb|KDP20100.1| hypothetical protein JCGZ_05869 [Jatropha curcas]
Length=493

 Score =   256 bits (655),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 133/316 (42%), Positives = 199/316 (63%), Gaps = 6/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVG P +  Y+ +DTGS++ W+QC+PC  C+ Q DP+F P+ SSS+ 
Sbjct  149  GTSQGSGEYFSRVGVGNPEKSFYMVLDTGSDITWLQCEPCSDCYQQADPIFTPSASSSYR  208

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + C+S  CN + +  C  G+C Y + Y DGS+  G  V ET++FG + VV ++ +GC  
Sbjct  209  PLSCASQQCNSLQMSSCRSGQCLYQVNYGDGSFTFGDFVTETVSFGSSGVVNNIALGCGH  268

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  G+ GLLGL GG ++ ++Q+   +   FSYCL +  +  S +L+F    +   +
Sbjct  269  DNEGLFVGSAGLLGLGGGPLSLVSQLKASS---FSYCLVNRDSSGSSTLDFNSGSVG-DS  324

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V  PL++S +  T YY+GL+G+ +G   L I E +F+L E GNGGVI+D GT++TRL   
Sbjct  325  VIAPLMKSRKIDTFYYVGLTGISIGGHMLSIPESIFQLDESGNGGVIVDCGTAITRLQSQ  384

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY +LR  +++    +      +  DTCYDL+G  +V+VPT+SF F+ GQ W L A N L
Sbjct  385  AYSSLRDAFVSMTQHLKSTSGVALFDTCYDLSGQNSVKVPTVSFHFSQGQSWNLPAMNYL  444

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+  G +CFAFAP+
Sbjct  445  IPVDSDGTYCFAFAPT  460



>ref|XP_007225636.1| hypothetical protein PRUPE_ppa003917mg [Prunus persica]
 gb|EMJ26835.1| hypothetical protein PRUPE_ppa003917mg [Prunus persica]
Length=540

 Score =   258 bits (659),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 136/311 (44%), Positives = 189/311 (61%), Gaps = 5/311 (2%)
 Frame = -2

Query  930  GIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFAIVPC  751
            G  EY  R+G+G PP   Y+ +DTGS++ WVQC PC  C+ Q +P+F+PT S SF+ + C
Sbjct  201  GSGEYFSRVGIGKPPSPAYVVLDTGSDVSWVQCAPCADCYQQAEPIFEPTSSDSFSPLSC  260

Query  750  SSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQTNQGM  574
             +  C  + +  C    C Y + Y DGSY +G  V ETIT GG   +D+ +GC  TN+G+
Sbjct  261  ENQRCKSLDVFECRNDTCLYEVSYGDGSYTVGDFVTETITIGGVAAKDIAIGCGHTNEGL  320

Query  573  VTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAVWVPL  394
              GA GLLGL GG ++F +Q+   +   FSYCL    ++S+ +LEF   + P  AV  PL
Sbjct  321  FIGASGLLGLGGGPLSFPSQLNATS---FSYCLVDRDSDSASTLEFNSPLHP-NAVTAPL  376

Query  393  LRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVAYETL  214
             R+    T YYIGL+GL VG   LPI E  F++ + GNGG+I+D GT+VTRL    Y  L
Sbjct  377  RRNPELDTFYYIGLAGLSVGGELLPIPESAFQIDDSGNGGIIIDSGTAVTRLQTDTYNAL  436

Query  213  RYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILIPVNK  34
            R  ++     +      +  D CYDL+   +V+VPT+SF F  G++  L AKN LIP++ 
Sbjct  437  RDAFVKGTKDLTSTQGAALFDVCYDLSSKKSVEVPTVSFHFADGKVLPLPAKNYLIPIDS  496

Query  33   RGIFCFAFAPS  1
             G FCFAFAP+
Sbjct  497  EGTFCFAFAPT  507



>ref|NP_188478.1| protein ASPARTIC PROTEASE IN GUARD CELL 1 [Arabidopsis thaliana]
 sp|Q9LS40.1|ASPG1_ARATH RecName: Full=Protein ASPARTIC PROTEASE IN GUARD CELL 1; Short=AtASPG1; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01116.1| CND41, chloroplast nucleoid DNA binding protein-like [Arabidopsis 
thaliana]
 gb|AAN13013.1| putative chloroplast nucleoid DNA-binding protein [Arabidopsis 
thaliana]
 gb|AEE76104.1| protein aspartic protease in guard cell 1 [Arabidopsis thaliana]
Length=500

 Score =   256 bits (655),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 138/317 (44%), Positives = 196/317 (62%), Gaps = 6/317 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTP +  YL +DTGS++ W+QC+PC  C+ Q DPVF+PT SS++ 
Sbjct  154  GASQGSGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPCADCYQQSDPVFNPTSSSTYK  213

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + CS+  C+ +    C   +C Y + Y DGS+ +G +  +T+TFG +  + +V +GC  
Sbjct  214  SLTCSAPQCSLLETSACRSNKCLYQVSYGDGSFTVGELATDTVTFGNSGKINNVALGCGH  273

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+ TGA GLLGL GG ++   Q+   +   FSYCL    +  S SL+F    +  G 
Sbjct  274  DNEGLFTGAAGLLGLGGGVLSITNQMKATS---FSYCLVDRDSGKSSSLDFNSVQLGGGD  330

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
               PLLR+ +  T YY+GLSG  VG  K+ + + +F +   G+GGVI+D GT+VTRL   
Sbjct  331  ATAPLLRNKKIDTFYYVGLSGFSVGGEKVVLPDAIFDVDASGSGGVILDCGTAVTRLQTQ  390

Query  228  AYETLRYIYMTQIATIPR-APSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNI  52
            AY +LR  ++     + + + S S  DTCYD + L TV+VPT++F FTGG+   L AKN 
Sbjct  391  AYNSLRDAFLKLTVNLKKGSSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKSLDLPAKNY  450

Query  51   LIPVNKRGIFCFAFAPS  1
            LIPV+  G FCFAFAP+
Sbjct  451  LIPVDDSGTFCFAFAPT  467



>emb|CDP08669.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   256 bits (654),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 143/316 (45%), Positives = 197/316 (62%), Gaps = 5/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+GTPP+Y Y+ +DTGS+++W+QC PCK C+ Q DP+FDP+ SSSFA
Sbjct  137  GLSQGSGEYFTRLGIGTPPKYSYMVLDTGSDVVWIQCSPCKKCYTQADPLFDPSHSSSFA  196

Query  762  IVPCSSTICNRIHL-GC-TRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             V C+S +C R+   GC  R +C Y + Y DGS+  G    ET+TF    V +V +GC  
Sbjct  197  GVACASPLCRRLDSPGCNNRQKCLYQVSYGDGSFTFGEFSTETLTFRRVRVNNVGLGCGH  256

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLAS-WHAESSGSLEFGREIIPVG  412
             N+G+  GA GLLGL  G ++F +Q   + G  FSYCL     +    S+ FG   +   
Sbjct  257  DNEGLFIGAAGLLGLGRGKLSFPSQAGRRFGRKFSYCLVDRSSSSRPSSIVFGESSVSRT  316

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLP  235
            +V+ PLL + +  T YY+GL+G+ VG  ++P I+E  F+L   GNGGVI+D GTSVTRL 
Sbjct  317  SVFTPLLTNPKLDTFYYVGLNGISVGGSRVPGITESHFKLDAAGNGGVIVDSGTSVTRLT  376

Query  234  KVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
            + AY  +R  +    + + RAP FS  DTC+DL+G   V+VPT+   F G  + +L A N
Sbjct  377  RPAYIAMRDAFRAGASNLRRAPDFSLFDTCFDLSGKTEVKVPTVVLHFNGADV-SLPASN  435

Query  54   ILIPVNKRGIFCFAFA  7
             LIPV+  G FCFAFA
Sbjct  436  YLIPVDGNGRFCFAFA  451



>ref|XP_008243190.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Prunus 
mume]
Length=556

 Score =   258 bits (659),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 140/315 (44%), Positives = 190/315 (60%), Gaps = 5/315 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G PP   Y+ +DTGS++ WVQC PC  C+ Q DP+F+PT S SF+
Sbjct  213  GTSQGSGEYFSRVGIGKPPSPAYVVLDTGSDVSWVQCAPCANCYQQADPIFEPTSSDSFS  272

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             V C +  C  + +  C    C Y + Y DGSY +G  V ETIT GG   +D+ +GC  T
Sbjct  273  PVSCENQRCKSLDVFECRNDTCLYEVAYGDGSYTVGDFVTETITIGGVSAKDIAIGCGHT  332

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+G+  GA GLLGL GGS++F +Q+   +   FSYCL    ++S+ +LEF   + P  AV
Sbjct  333  NEGLFIGASGLLGLGGGSLSFPSQLNATS---FSYCLVDRDSDSASTLEFNSPLHP-NAV  388

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
              PL R+    T YYIGL+GL VG   LPI E  F + + GNGG+I+D GT+VTRL    
Sbjct  389  TAPLHRNPELDTFYYIGLTGLSVGGELLPIPESAFLIDDSGNGGIIIDSGTAVTRLQTDT  448

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y  LR  ++     +      +  D CYDL+   +V+VPT+SF F  G++  L AKN LI
Sbjct  449  YNALRDAFVKGTKDLTSTQGAALFDVCYDLSAKKSVEVPTVSFHFADGKVLPLPAKNYLI  508

Query  45   PVNKRGIFCFAFAPS  1
            P++  G FCFAFAP+
Sbjct  509  PIDSEGTFCFAFAPT  523



>gb|AAL87345.1| putative chloroplast nucleoid DNA-binding protein [Arabidopsis 
thaliana]
Length=500

 Score =   256 bits (655),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 138/317 (44%), Positives = 196/317 (62%), Gaps = 6/317 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTP +  YL +DTGS++ W+QC+PC  C+ Q DPVF+PT SS++ 
Sbjct  154  GASQGSGEYFSRIGVGTPAKDMYLVLDTGSDVNWIQCEPCADCYQQSDPVFNPTSSSTYK  213

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + CS+  C+ +    C   +C Y + Y DGS+ +G +  +T+TFG +  + +V +GC  
Sbjct  214  SLTCSAPQCSLLETSACRSNKCLYQVSYGDGSFTVGELATDTVTFGNSGKINNVALGCGH  273

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+ TGA GLLGL GG ++   Q+   +   FSYCL    +  S SL+F    +  G 
Sbjct  274  DNEGLFTGAAGLLGLGGGVLSITNQMKATS---FSYCLVDRDSGKSSSLDFNSVQLGGGD  330

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
               PLLR+ +  T YY+GLSG  VG  K+ + + +F +   G+GGVI+D GT+VTRL   
Sbjct  331  ATAPLLRNKKIDTFYYVGLSGFSVGGEKVVLPDAIFDVDASGSGGVILDCGTAVTRLQTQ  390

Query  228  AYETLRYIYMTQIATIPR-APSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNI  52
            AY +LR  ++     + + + S S  DTCYD + L TV+VPT++F FTGG+   L AKN 
Sbjct  391  AYNSLRDAFLKLTVNLKKGSSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKSLDLPAKNY  450

Query  51   LIPVNKRGIFCFAFAPS  1
            LIPV+  G FCFAFAP+
Sbjct  451  LIPVDDSGTFCFAFAPT  467



>emb|CDY25371.1| BnaA05g19130D [Brassica napus]
Length=397

 Score =   253 bits (646),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 145/314 (46%), Positives = 182/314 (58%), Gaps = 68/314 (22%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VRIGVG+PP+ QY+ ID+GS+++WVQCQPCK C+ Q DPVFDP +S S+ 
Sbjct  119  GMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQSDPVFDPAKSGSYT  178

Query  762  IVPCSSTICNRIHLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQTN  583
             V C                                         GTV+R+V MGC   N
Sbjct  179  GVSC-----------------------------------------GTVIRNVAMGCGHRN  197

Query  582  QGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAVW  403
            +GM  GA GLLG+ GGSM+F+ Q+ GQTGG F YCL S   +S+GSL FGRE +PVGA  
Sbjct  198  RGMFVGAAGLLGIGGGSMSFVGQLTGQTGGAFGYCLVSRGTDSTGSLVFGREALPVGA--  255

Query  402  VPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVAY  223
                                   +I LP  +DVF LTE G+GGV+MD GT+VTRLP  AY
Sbjct  256  -----------------------SIALP--DDVFDLTETGDGGVVMDTGTAVTRLPTAAY  290

Query  222  ETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILIP  43
               R  +  Q A +PRA   S  DTCYDL+G  +V+VPT+SF+FT G + TL A+N L+P
Sbjct  291  AAFRDGFKAQTANLPRASGVSIFDTCYDLSGFVSVRVPTVSFYFTEGPVLTLPARNFLMP  350

Query  42   VNKRGIFCFAFAPS  1
            V+  G +CFAFA S
Sbjct  351  VDDSGTYCFAFAAS  364



>gb|EYU38885.1| hypothetical protein MIMGU_mgv1a026932mg [Erythranthe guttata]
Length=471

 Score =   255 bits (652),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 142/316 (45%), Positives = 193/316 (61%), Gaps = 5/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIG+GTPP+Y Y+ +DTGS+++WVQC PC+ C+ Q DPVFDP  S+SF 
Sbjct  121  GLAQGSGEYFTRIGIGTPPKYVYMVLDTGSDVVWVQCSPCRKCYSQSDPVFDPKSSTSFL  180

Query  762  IVPCSSTICNRIHL-GC-TRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             + C S +C R+   GC  R +C Y + Y DGS+ +G    ET+TF  T V +V  GC  
Sbjct  181  GLTCHSPVCRRLDSPGCNNRDKCLYQVSYGDGSFTVGEFSTETLTFRKTKVDNVAFGCGH  240

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPVG  412
             N+G+  GA GLLGL  G ++F  Q   + G  FSYCL    A S   S+ FG   +   
Sbjct  241  DNEGLFVGAAGLLGLGRGKLSFPTQAGSRFGRKFSYCLVDRSASSKPSSMVFGESAVSRN  300

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLP  235
            AV+ PLL + +  T +Y+GL+G+ VG  ++P I+  +F+L   GNGGVI+D GTSVTRL 
Sbjct  301  AVFTPLLTNPKLDTFFYVGLNGVSVGGTRVPGIAASLFKLDPTGNGGVIVDSGTSVTRLT  360

Query  234  KVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
            + AY  LR  +    + + R+  FS  DTC+DL+G   V+VPT+     G  + +L A N
Sbjct  361  RPAYVALRDAFRIGASNLKRSSEFSLFDTCFDLSGKTEVKVPTVVLHLEGADV-SLPASN  419

Query  54   ILIPVNKRGIFCFAFA  7
             LIPV+  G FCFAFA
Sbjct  420  YLIPVDSEGKFCFAFA  435



>emb|CDX92240.1| BnaA05g21670D [Brassica napus]
Length=491

 Score =   256 bits (653),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 136/317 (43%), Positives = 194/317 (61%), Gaps = 6/317 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTP +  Y+ +DTGS++ W+QC+PC  C+ Q DP+FDP+ SS++ 
Sbjct  145  GASQGSGEYFSRLGVGTPAKEMYMVLDTGSDINWIQCKPCSSCYQQSDPIFDPSSSSTYK  204

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + CS+  C  +    C   +C Y + Y DGS+ +G    +T+TFG +  V +V +GC +
Sbjct  205  SLTCSAPQCASLRASACRSDKCLYQVRYGDGSFTVGEYATDTVTFGSSGKVDNVALGCGR  264

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+ TGA GLLGL GG+++  +QI  ++   FSYCL    +  S SL+F    +  G 
Sbjct  265  DNEGLFTGAAGLLGLGGGALSMTSQIKAKS---FSYCLVDRDSGKSSSLDFNSVQVGAGD  321

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
               P+LR+ +  T YY+G SG  VG  ++ I    F +   G GGVI+D GT+VTRL   
Sbjct  322  ATAPILRNSKIDTFYYVGFSGFSVGGQQVSIPSSAFAVDASGTGGVILDCGTAVTRLQTQ  381

Query  228  AYETLRYIYMTQIATIPR-APSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNI  52
            AY +LR  ++   A + R   S S  DTCYD + L TV+VPT++F FTGG+   L AKN 
Sbjct  382  AYNSLRDAFVKLTANLKRGTSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKTLNLPAKNY  441

Query  51   LIPVNKRGIFCFAFAPS  1
            LIP++  G FCFAFAP+
Sbjct  442  LIPIDDAGTFCFAFAPT  458



>ref|XP_002529147.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF33260.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=479

 Score =   255 bits (652),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 134/315 (43%), Positives = 190/315 (60%), Gaps = 5/315 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G P    Y+ +DTGS++ W+QC PC  C+ Q DP+F+P  S+S++
Sbjct  136  GTSQGSGEYFSRVGIGKPSSPVYMVLDTGSDVNWIQCAPCADCYHQADPIFEPASSTSYS  195

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             + C +  C  + +  C    C Y + Y DGSY +G  V ETIT G   V +V +GC   
Sbjct  196  PLSCDTKQCQSLDVSECRNNTCLYEVSYGDGSYTVGDFVTETITLGSASVDNVAIGCGHN  255

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+G+  GA GLLGL GG ++F +QI   +   FSYCL    ++S+ +LEF   ++P  A+
Sbjct  256  NEGLFIGAAGLLGLGGGKLSFPSQINASS---FSYCLVDRDSDSASTLEFNSALLP-HAI  311

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
              PLLR+    T YY+G++GL VG   L I E +F + E GNGG+I+D GT+VTRL   A
Sbjct  312  TAPLLRNRELDTFYYVGMTGLSVGGELLSIPESMFEMDESGNGGIIIDSGTAVTRLQTAA  371

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y  LR  ++     +P     +  DTCYDL+   +V+VPT++F   GG++  L A N LI
Sbjct  372  YNALRDAFVKGTKDLPVTSEVALFDTCYDLSRKTSVEVPTVTFHLAGGKVLPLPATNYLI  431

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAP+
Sbjct  432  PVDSDGTFCFAFAPT  446



>ref|XP_002320868.1| aspartyl protease family protein [Populus trichocarpa]
 gb|EEE99183.1| aspartyl protease family protein [Populus trichocarpa]
Length=488

 Score =   255 bits (652),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 145/317 (46%), Positives = 193/317 (61%), Gaps = 6/317 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTP +Y Y+ +DTGS+++W+QC PC  C+ Q DPVFDPT+S SFA
Sbjct  137  GLAQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWIQCAPCIKCYSQTDPVFDPTKSRSFA  196

Query  762  IVPCSSTICNRIHL-GCTRGR--CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCS  592
             +PC S +C R+   GC+  +  C Y + Y DGS+ +G    ET+TF GT V  V +GC 
Sbjct  197  NIPCGSPLCRRLDYPGCSTKKQICLYQVSYGDGSFTVGEFSTETLTFRGTRVGRVVLGCG  256

Query  591  QTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPV  415
              N+G+  GA GLLGL  G ++F +QI  +    FSYCL    A S   S+ FG   I  
Sbjct  257  HDNEGLFVGAAGLLGLGRGRLSFPSQIGRRFNSKFSYCLGDRSASSRPSSIVFGDSAISR  316

Query  414  GAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRL  238
               + PLL + +  T YY+ L G+ VG  ++  IS  +F+L   GNGGVI+D GTSVTRL
Sbjct  317  TTRFTPLLSNPKLDTFYYVELLGISVGGTRVSGISASLFKLDSTGNGGVIIDSGTSVTRL  376

Query  237  PKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAK  58
             + AY  LR  ++   + + RAP FS  DTC+DL+G   V+VPT+   F G  +  L A 
Sbjct  377  TRAAYVALRDAFLVGASNLKRAPEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-PLPAS  435

Query  57   NILIPVNKRGIFCFAFA  7
            N LIPV+  G FCFAFA
Sbjct  436  NYLIPVDNSGSFCFAFA  452



>ref|NP_191741.1| aspartyl protease [Arabidopsis thaliana]
 emb|CAB71112.1| putative protein [Arabidopsis thaliana]
 gb|AEE80260.1| aspartyl protease [Arabidopsis thaliana]
Length=483

 Score =   255 bits (652),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 144/323 (45%), Positives = 196/323 (61%), Gaps = 12/323 (4%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY +R+GVGTP    Y+ +DTGS+++W+QC PCK C+ Q D +FDP +S +FA
Sbjct  127  GLSQGSGEYFMRLGVGTPATNVYMVLDTGSDVVWLQCSPCKACYNQTDAIFDPKKSKTFA  186

Query  762  IVPCSSTICNRIHLG--CTRGR---CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMG  598
             VPC S +C R+     C   R   C Y + Y DGS+  G    ET+TF G  V  V +G
Sbjct  187  TVPCGSRLCRRLDDSSECVTRRSKTCLYQVSYGDGSFTEGDFSTETLTFHGARVDHVPLG  246

Query  597  CSQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLAS-----WHAESSGSLEFG  433
            C   N+G+  GA GLLGL  G ++F +Q   +  G FSYCL         ++   ++ FG
Sbjct  247  CGHDNEGLFVGAAGLLGLGRGGLSFPSQTKNRYNGKFSYCLVDRTSSGSSSKPPSTIVFG  306

Query  432  REIIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIG  256
               +P  +V+ PLL + +  T YY+ L G+ VG  ++P +SE  F+L   GNGGVI+D G
Sbjct  307  NAAVPKTSVFTPLLTNPKLDTFYYLQLLGISVGGSRVPGVSESQFKLDATGNGGVIIDSG  366

Query  255  TSVTRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQI  76
            TSVTRL + AY  LR  +      + RAPS+S  DTC+DL+G+ TV+VPT+ F F GG++
Sbjct  367  TSVTRLTQPAYVALRDAFRLGATKLKRAPSYSLFDTCFDLSGMTTVKVPTVVFHFGGGEV  426

Query  75   WTLAAKNILIPVNKRGIFCFAFA  7
             +L A N LIPVN  G FCFAFA
Sbjct  427  -SLPASNYLIPVNTEGRFCFAFA  448



>ref|XP_004298296.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Fragaria 
vesca subsp. vesca]
Length=481

 Score =   255 bits (652),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 135/315 (43%), Positives = 189/315 (60%), Gaps = 5/315 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G PP   Y+ +DTGS++ WVQC PC  C+ Q DP+F+PT S+SFA
Sbjct  138  GTSQGSGEYFSRVGIGRPPSQVYVVLDTGSDVSWVQCAPCADCYQQADPIFEPTSSASFA  197

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             + C +  C  + +  C    C Y + Y DGSY +G  V ETI+ GG  + DV +GC   
Sbjct  198  QLSCDAARCKSLDVFECRNNTCLYEVAYGDGSYTVGDFVTETISIGGESLSDVAIGCGHN  257

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+G+  GA GLLGL GG ++F +Q+   +   FSYCL    ++S+ +LEF    +P  AV
Sbjct  258  NEGLFVGAAGLLGLGGGPLSFPSQLNATS---FSYCLVDRDSDSTSTLEF-NTALPHNAV  313

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
              PL R+ +  T YY+GL+G+ VG   L I  + F + E GNGG+I+D GT+VTRL    
Sbjct  314  TAPLRRNSQLNTFYYVGLTGISVGGDMLKIPANAFEIDESGNGGIIIDSGTAVTRLQTET  373

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y+ LR  ++     +      +  D CYDL+ + +V VP +SF F  G+   L AKN LI
Sbjct  374  YDALRSAFVNMTKGLESTSGVALFDACYDLSKIESVDVPALSFHFEDGKELPLPAKNYLI  433

Query  45   PVNKRGIFCFAFAPS  1
            PV+ +G FCFAFAP+
Sbjct  434  PVDSQGTFCFAFAPT  448



>emb|CDP20336.1| unnamed protein product [Coffea canephora]
Length=484

 Score =   255 bits (652),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 134/316 (42%), Positives = 192/316 (61%), Gaps = 6/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G PP   Y+ +D+GS++ WVQC PC  C+ Q DP+F P  SSSF+
Sbjct  140  GTSQGSGEYFSRVGIGRPPSQVYMVLDSGSDVNWVQCAPCSDCYQQADPIFQPASSSSFS  199

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTV-VRDVTMGCSQ  589
             + C +  C  +    C    C Y + Y DGSY +G  V ETITFGG+  V ++ +GC  
Sbjct  200  RLTCEAQQCKSLDESECRNNTCLYQVSYGDGSYTVGDFVTETITFGGSAAVNNIAIGCGH  259

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  GA GL+GL GG ++F +QI  ++   FSYCL    +++S +L+F   ++P  A
Sbjct  260  NNEGLFVGAAGLIGLGGGPLSFPSQIKAKS---FSYCLVDRDSDASSTLDFD-SVVPADA  315

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V  PLL++ +  T YY+ L+G+ V    LP+    F+L + G GGVI+D GT+VTRLP  
Sbjct  316  VTAPLLQNPKLDTFYYLDLTGISVAGELLPVPPSNFKLADNGEGGVIIDSGTAVTRLPTE  375

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
             Y  LR  ++     +P A   +  DTC+ L    +V+VPT+SF F+ G+  +L AKN L
Sbjct  376  TYNALRDAFVKGTKNLPSANGVALFDTCFALGSRKSVEVPTVSFHFSNGKDLSLPAKNYL  435

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+  G FCFAFAP+
Sbjct  436  IPVDSTGTFCFAFAPT  451



>ref|XP_004172253.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1-like [Cucumis sativus]
Length=486

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 138/315 (44%), Positives = 190/315 (60%), Gaps = 5/315 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G PP   Y+ +DTGS++ WVQC PC  C+ Q DP F+PT S+SF 
Sbjct  143  GASQGSGEYFSRVGIGRPPSPVYMVLDTGSDVSWVQCAPCAECYEQTDPXFEPTSSASFT  202

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             + C +  C  + +  C  G C Y + Y DGSY +G  V ET+T G T + ++ +GC   
Sbjct  203  SLSCETEQCKSLDVSECRNGTCLYEVSYGDGSYTVGDFVTETVTLGSTSLGNIAIGCGHN  262

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+G+  GA GLLGL GGS++F +Q+   +   FSYCL    ++S+ +L+F   I P  AV
Sbjct  263  NEGLFIGAAGLLGLGGGSLSFPSQLNASS---FSYCLVDRDSDSTSTLDFNSPITP-DAV  318

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
              PL R+    T +Y+GL+G+ VG   LPI E  F+++E GNGG+I+D GT+VTRL    
Sbjct  319  TAPLHRNPNLDTFFYLGLTGMSVGGAVLPIPETSFQMSEDGNGGIIVDSGTAVTRLQTTV  378

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y  LR  ++     +  A   +  DTCYDL+    V+VPT+SF F  G    L AKN LI
Sbjct  379  YNVLRDAFVKSTHDLQTARGVALFDTCYDLSSKSRVEVPTVSFHFANGNELPLPAKNYLI  438

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAP+
Sbjct  439  PVDSEGTFCFAFAPT  453



>emb|CDY24567.1| BnaC05g32510D [Brassica napus]
Length=395

 Score =   252 bits (643),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 144/314 (46%), Positives = 182/314 (58%), Gaps = 68/314 (22%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G D G  EY VRIGVG+PP+ QY+ ID+GS+++W QCQPCK C+ Q DPVFDP +S S+ 
Sbjct  117  GMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWFQCQPCKLCYKQSDPVFDPAKSGSYT  176

Query  762  IVPCSSTICNRIHLGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQTN  583
             V C                                         GTV+R+V MGC   N
Sbjct  177  GVSC-----------------------------------------GTVIRNVAMGCGHRN  195

Query  582  QGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAVW  403
            +GM  GA GLLG+ GGSM+F+ Q+ GQTGG F YCL S   +S+GSL FGRE +PVGA  
Sbjct  196  RGMFVGAAGLLGIGGGSMSFVGQLTGQTGGAFGYCLVSRGTDSTGSLVFGREALPVGA--  253

Query  402  VPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVAY  223
                                   +I LP  +DVF LTE G+GGV+MD GT+VTRLP  AY
Sbjct  254  -----------------------SIALP--DDVFDLTETGDGGVVMDTGTAVTRLPTAAY  288

Query  222  ETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILIP  43
               R  + +Q A +PRA   S  DTCYDL+G  +V+VPT+SF+FT G + TL A+N L+P
Sbjct  289  AAFRDGFKSQTANLPRASGVSIFDTCYDLSGFVSVRVPTVSFYFTEGPVLTLPARNFLMP  348

Query  42   VNKRGIFCFAFAPS  1
            V+  G +CFAFA S
Sbjct  349  VDDSGTYCFAFAAS  362



>ref|XP_010512555.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=483

 Score =   254 bits (650),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 143/323 (44%), Positives = 199/323 (62%), Gaps = 12/323 (4%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY +R+GVGTP    Y+ +DTGS+++W+QC PCK C+ Q DP+FDP RS ++A
Sbjct  127  GLSQGSGEYFMRLGVGTPATNVYMVLDTGSDVVWLQCSPCKACYNQSDPIFDPKRSKTYA  186

Query  762  IVPCSSTICNRIHLG--CTRGR---CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMG  598
             VPC S +C R+     C   R   C Y + Y DGS+  G    ET+TF G  V  V +G
Sbjct  187  TVPCGSRLCRRLDDSSECVTRRSKTCLYQVSYGDGSFTEGDFATETLTFHGARVDHVPLG  246

Query  597  CSQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLAS-----WHAESSGSLEFG  433
            C   N+G+  GA GLLGL  G ++F +Q   +  G FSYCL         ++   ++ FG
Sbjct  247  CGHDNEGLFVGAAGLLGLGRGGLSFPSQTKSRYNGKFSYCLVDRTSSGSSSKPPSTIVFG  306

Query  432  REIIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIG  256
             + +P  +V+ PLL + +  T YY+ L G+ VG  ++  +SE  F+L   G+GGVI+D G
Sbjct  307  NDAVPKTSVFTPLLTNPKLDTFYYLQLLGISVGGSRVRGVSESQFKLDATGSGGVIIDSG  366

Query  255  TSVTRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQI  76
            TSVTRL + AY  LR  +     ++ RAPS+S  DTC+DL+G+ TV+VPT+ F F GG++
Sbjct  367  TSVTRLTQPAYVALRDAFRLGARSLKRAPSYSLFDTCFDLSGMTTVKVPTVVFHFGGGEV  426

Query  75   WTLAAKNILIPVNKRGIFCFAFA  7
             +L A N LIPVN +G FCFAFA
Sbjct  427  -SLPASNYLIPVNTQGRFCFAFA  448



>ref|XP_009608744.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Nicotiana 
tomentosiformis]
Length=488

 Score =   254 bits (650),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 138/316 (44%), Positives = 195/316 (62%), Gaps = 6/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIG+G PP   Y+ +DTGS++ W+QC PC  C+ Q DP+F+P  SS+F+
Sbjct  144  GTSQGSGEYFSRIGIGHPPNQVYMVLDTGSDVNWIQCAPCADCYQQADPIFEPASSSTFS  203

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTV-VRDVTMGCSQ  589
             + C +  C  + +  C    C Y + Y DGSY +G  V E +TFGG+  V +V +GC  
Sbjct  204  PLTCDTKQCQSLDVSECRNDTCLYEVSYGDGSYTVGDFVTERVTFGGSASVENVAIGCGH  263

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  GA GLLGL GG+++F +QI   +   FSYCL    ++S+ +LEFG  I P  A
Sbjct  264  NNEGLFVGAAGLLGLGGGALSFPSQINASS---FSYCLVDRDSDSTSTLEFGGVISP-DA  319

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V  PL+R+ +  T YY+ L+GL V    L +    F++++ G+GGVI+D GT+VTRL   
Sbjct  320  VTAPLIRNSKLDTFYYLELTGLSVAGNLLSVPPSAFKVSDNGDGGVIIDSGTAVTRLQTD  379

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
             Y TLR  ++     +P   S +  DTCYDL  + +V+VPT+SF F+ G+   L AKN L
Sbjct  380  VYNTLRDEFVKGTRHLPSTNSVALFDTCYDLKSMKSVEVPTVSFHFSNGKELPLPAKNYL  439

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+  G FCFAFAP+
Sbjct  440  IPVDSSGTFCFAFAPT  455



>ref|XP_007051537.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
 gb|EOX95694.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
Length=488

 Score =   254 bits (650),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 144/312 (46%), Positives = 194/312 (62%), Gaps = 5/312 (2%)
 Frame = -2

Query  930  GIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFAIVPC  751
            G  EY  R+GVGTPP+Y Y+ +DTGS+++WVQC PCK C+ Q DP+FDPT+S SF+ +PC
Sbjct  142  GSGEYFTRLGVGTPPRYLYMVLDTGSDVVWVQCSPCKKCYSQSDPIFDPTKSRSFSGIPC  201

Query  750  SSTICNRIH-LGCTRGR-CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQTNQG  577
             S +C  +   GC + R C Y + Y DGS   G    ET+TF  T V  V +GC   N+G
Sbjct  202  GSPLCRSLDSSGCNQRRMCLYQVSYGDGSVTFGDFSTETLTFRRTRVGRVAIGCGHDNEG  261

Query  576  MVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPVGAVWV  400
            +  GA GLLGL  G ++F +Q   +    FSYCL    A S   SL FG   +P  A+  
Sbjct  262  LFVGAAGLLGLGRGRLSFPSQTGRRFNQKFSYCLVDRSASSRPSSLVFGDAAVPRAAMLT  321

Query  399  PLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLPKVAY  223
            PLL + +  T YYI L G+ VG I++P I+  +F++ + GNGGVI+D GTSVTRL + AY
Sbjct  322  PLLTNPKLDTFYYIELLGISVGGIRVPRITPSLFKMDQAGNGGVIIDSGTSVTRLTRPAY  381

Query  222  ETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILIP  43
              +R  +    + +  AP FS  DTC+DL+G  +V+VPT+   F G  + +L A N LIP
Sbjct  382  IAMRDAFRIGASNLKGAPDFSLFDTCFDLSGKTSVKVPTVVLHFRGADV-SLPATNYLIP  440

Query  42   VNKRGIFCFAFA  7
            V+  G FCFAFA
Sbjct  441  VDGSGTFCFAFA  452



>ref|XP_007046283.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
 gb|EOY02115.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
Length=489

 Score =   254 bits (650),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 139/315 (44%), Positives = 192/315 (61%), Gaps = 5/315 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G PP   Y+ +DTGS++ WVQC PC  C+ Q DP+F+P+ SS+++
Sbjct  146  GSSQGSGEYFSRVGIGKPPSQVYMVLDTGSDVNWVQCAPCADCYQQADPIFEPSSSSTYS  205

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             + C +  C  +    C    C Y + Y DGSY +G  V ETIT G   V +V +GC   
Sbjct  206  PLSCETQQCKYLDTSECRNDTCLYEVSYGDGSYTVGDFVTETITLGSASVDNVAIGCGHN  265

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+G+  GA GLLGL GG ++F +Q+   +   FSYCL    ++S+ +LEF    +P  AV
Sbjct  266  NEGLFVGAAGLLGLGGGPLSFSSQLNASS---FSYCLVDRDSDSASTLEFD-SALPPNAV  321

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
              PLLR+ +  T YY+GL+G+ VG   LPI +  F++ E GNGG I+D GT+VTRL    
Sbjct  322  KAPLLRNHQLDTFYYLGLTGISVGGELLPIPQSAFQMDESGNGGTIIDSGTAVTRLQSDT  381

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y+ LR  ++     +P   S +  DTCYDL+   +V VPT+SF F  GQ+  L AKN LI
Sbjct  382  YDILRDAFVKGTKNLPSTDSVALFDTCYDLSKRSSVDVPTVSFHFPEGQVLPLPAKNYLI  441

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAP+
Sbjct  442  PVDSEGTFCFAFAPT  456



>ref|XP_010469025.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=486

 Score =   254 bits (648),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 143/323 (44%), Positives = 199/323 (62%), Gaps = 12/323 (4%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY +R+GVGTP    Y+ +DTGS+++W+QC PCK C+ Q DP+FDP RS ++A
Sbjct  130  GLSQGSGEYFMRLGVGTPATNVYMVLDTGSDVVWLQCSPCKACYNQSDPIFDPKRSKTYA  189

Query  762  IVPCSSTICNRIHLG--CTRGR---CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMG  598
             VPC S +C R+     C   R   C Y + Y DGS+  G    ET+TF G  V  V +G
Sbjct  190  TVPCGSRLCRRLDDSSECVTRRSKTCLYQVSYGDGSFTEGDFATETLTFHGARVDHVPLG  249

Query  597  CSQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLAS-----WHAESSGSLEFG  433
            C   N+G+  GA GLLGL  G ++F +Q   +  G FSYCL         ++   ++ FG
Sbjct  250  CGHDNEGLFVGAAGLLGLGRGGLSFPSQTKTRYNGKFSYCLVDRTSSGSSSKPPSTIVFG  309

Query  432  REIIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIG  256
             + +P  +V+ PLL + +  T YY+ L G+ VG  ++  +SE  F+L   G+GGVI+D G
Sbjct  310  NDAVPKTSVFTPLLTNPKLDTFYYLQLLGISVGGSRVRGVSESQFKLDSTGSGGVIIDSG  369

Query  255  TSVTRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQI  76
            TSVTRL + AY  LR  +     ++ RAPS+S  DTC+DL+G+ TV+VPT+ F F GG++
Sbjct  370  TSVTRLAQPAYVALRDAFRLGARSLKRAPSYSLFDTCFDLSGMTTVKVPTVVFHFGGGEV  429

Query  75   WTLAAKNILIPVNKRGIFCFAFA  7
             +L A N LIPVN +G FCFAFA
Sbjct  430  -SLPASNYLIPVNTQGRFCFAFA  451



>ref|XP_010665756.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Beta 
vulgaris subsp. vulgaris]
Length=484

 Score =   254 bits (648),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 142/317 (45%), Positives = 195/317 (62%), Gaps = 6/317 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTPP+Y Y+ +DTGS+++W+QC PCK C+ Q D +F+P +S S+ 
Sbjct  133  GLSQGSGEYFTRLGVGTPPKYMYMVLDTGSDIVWIQCTPCKKCYDQTDRMFNPVKSGSYR  192

Query  762  IVPCSSTICNRIHL-GCT-RG-RCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCS  592
             +PC S IC R+   GCT RG +C+Y + Y DGS+ MG    ET+TF    V +V +GC 
Sbjct  193  SIPCRSKICQRLDQPGCTLRGNKCAYQVSYGDGSFTMGEFASETMTFRRVRVPNVALGCG  252

Query  591  QTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPV  415
              N+G+  GA GLLGL  G ++F  Q   + G  FSYCL    A S   S+ FG   +  
Sbjct  253  HDNEGLFVGAAGLLGLGRGKLSFPTQTGNRFGRKFSYCLVDRSASSKPSSVVFGSSAVSR  312

Query  414  GAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRL  238
             AV+ PL+ + +  T YY+ L G+ VG  ++P I+ ++F++   GNGGVI+D GTSVTRL
Sbjct  313  TAVFTPLISNPKLDTFYYVELVGISVGGSRVPGITGELFKIDRTGNGGVIVDSGTSVTRL  372

Query  237  PKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAK  58
             + AY  LR  +     ++  AP FS  DTCYDL+G   V+VPT+   + G  +  L A 
Sbjct  373  TRPAYMALRDAFRAGATSLKSAPGFSLFDTCYDLSGKTEVRVPTVVMHYNGADV-ALPAN  431

Query  57   NILIPVNKRGIFCFAFA  7
            N LIPV+  G FCFAFA
Sbjct  432  NYLIPVDTSGRFCFAFA  448



>ref|XP_004171805.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like, partial 
[Cucumis sativus]
Length=384

 Score =   251 bits (640),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 148/316 (47%), Positives = 189/316 (60%), Gaps = 5/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTPP+Y Y+ +DTGS+++W+QC PCK C+ Q DPVF+P +S SFA
Sbjct  34   GLAQGSGEYFTRIGVGTPPKYVYMVLDTGSDIVWLQCAPCKNCYSQTDPVFNPVKSGSFA  93

Query  762  IVPCSSTICNRIHL-GCT-RGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             V C + +C R+   GC  R  C Y + Y DGSY  G  V ET+TF  T V  V +GC  
Sbjct  94   KVLCRTPLCRRLESPGCNQRQTCLYQVSYGDGSYTTGEFVTETLTFRRTKVEQVALGCGH  153

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPVG  412
             N+G+  GA GLLGL  G ++F +Q        FSYCL    A S   S+ FG   +   
Sbjct  154  DNEGLFVGAAGLLGLGRGGLSFPSQAGRTFNQKFSYCLVDRSASSKPSSVVFGNSAVSRT  213

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLP  235
            A + PLL + R  T YY+ L G+ VG   +  I+   F+L   GNGGVI+D GTSVTRL 
Sbjct  214  ARFTPLLTNPRLDTFYYVELLGISVGGTPVSGITASHFKLDRTGNGGVIIDCGTSVTRLN  273

Query  234  KVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
            K AY  LR  +    +++  AP FS  DTCYDL+G  TV+VPT+   F G  + +L A N
Sbjct  274  KPAYIALRDAFRAGASSLKSAPEFSLFDTCYDLSGKTTVKVPTVVLHFRGADV-SLPASN  332

Query  54   ILIPVNKRGIFCFAFA  7
             LIPV+  G FCFAFA
Sbjct  333  YLIPVDGSGRFCFAFA  348



>ref|XP_011023172.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Populus 
euphratica]
Length=492

 Score =   254 bits (649),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 144/317 (45%), Positives = 195/317 (62%), Gaps = 6/317 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTP +Y ++ +DTGS+++W+QC PCK C+ Q DPVF+PT+S SFA
Sbjct  141  GLAQGSGEYFTRLGVGTPARYVFMVLDTGSDIVWIQCAPCKKCYSQTDPVFNPTKSRSFA  200

Query  762  IVPCSSTICNRIHL-GCTRGR--CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCS  592
             +PC S +C R+   GC+  +  C Y + Y DGS+  G    ET+TF GT V  V +GC 
Sbjct  201  NIPCGSPLCRRLDSPGCSTKKQICLYQVSYGDGSFTYGEFSTETLTFRGTRVGRVALGCG  260

Query  591  QTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGS-LEFGREIIPV  415
              N+G+  GA GLLGL  G ++F +QI  +    FSYCL    A S  S + FG   I  
Sbjct  261  HDNEGLFIGAAGLLGLGRGRLSFPSQIGRRFSRKFSYCLVDRSASSKPSYMVFGDSAISR  320

Query  414  GAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRL  238
             A + PL+ + +  T YY+ L G+ VG  ++P I+  +F+L   GNGGVI+D GTSVTRL
Sbjct  321  TARFTPLVSNPKLDTFYYVELLGVSVGGTRVPGITASLFKLDSTGNGGVIIDSGTSVTRL  380

Query  237  PKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAK  58
             + AY  LR  +    + + RAP FS  DTC+DL+G   V+VPT+   F G  + +L A 
Sbjct  381  TRPAYVALRDAFRVGASNLKRAPEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAS  439

Query  57   NILIPVNKRGIFCFAFA  7
            N LIPV+  G FCFAFA
Sbjct  440  NYLIPVDNSGSFCFAFA  456



>ref|XP_006852628.1| hypothetical protein AMTR_s00021p00234660 [Amborella trichopoda]
 gb|ERN14095.1| hypothetical protein AMTR_s00021p00234660 [Amborella trichopoda]
Length=489

 Score =   254 bits (648),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 142/314 (45%), Positives = 197/314 (63%), Gaps = 2/314 (1%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+ VGTPPQ  Y+ +DTGS+L W+QC PC+ C+ Q  P+F+P+ SSS++
Sbjct  140  GLPQGSGEYFARVKVGTPPQPMYMVLDTGSDLAWLQCTPCRHCYRQVGPIFNPSSSSSYS  199

Query  762  IVPCSSTICNRIHL-GCTR-GRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             +PC++ +C R+ +  C R  +C Y + Y DGS+ +G    ET++FG T +  V +GC  
Sbjct  200  TLPCAAPLCRRLEIRACDRRHQCLYQVSYGDGSFTVGDFSTETLSFGRTALPHVALGCGH  259

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  GA GLLGL  GS++  +Q   ++   FSYCL    + S GSL FG    P   
Sbjct  260  DNEGLFIGAAGLLGLGRGSLSLPSQFSQRSIHGFSYCLTDRSSPSPGSLSFGNLPNPSTT  319

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V+  ++++ +  T YY+GL G+ VG  +LPIS  +FRL   GNGGVI+D GTSVTRL   
Sbjct  320  VFTTMIKNPKLDTFYYLGLVGISVGGARLPISSSLFRLDPTGNGGVIVDSGTSVTRLVSS  379

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY+ +R  +      +P A SFS  DTCY+L G   V+VPT+ F F GG   +L A N L
Sbjct  380  AYDVVRDAFRAGATGLPLADSFSLFDTCYNLGGRDVVKVPTMVFHFDGGADLSLPASNYL  439

Query  48   IPVNKRGIFCFAFA  7
            IPVN +G+FCFAFA
Sbjct  440  IPVNNQGVFCFAFA  453



>ref|XP_004238952.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Solanum 
lycopersicum]
Length=482

 Score =   253 bits (647),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 135/316 (43%), Positives = 194/316 (61%), Gaps = 6/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIG+G PP   Y+ +DTGS++ WVQC PC  C+ Q DP+F+P  SS+F+
Sbjct  138  GTSQGSGEYFSRIGIGHPPSQVYMVLDTGSDVNWVQCSPCADCYQQADPIFEPASSSTFS  197

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTV-VRDVTMGCSQ  589
             + C +  C  + +  C    C Y + Y DGSY +G +V E+ITF G+  V +V +GC  
Sbjct  198  PLTCETQQCKSLDVSECRNDTCLYEVSYGDGSYTVGDLVTESITFAGSSSVENVAIGCGH  257

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  GA GLLGL GG+++F +QI   +   FSYCL    ++S+ +LEFG   IP  A
Sbjct  258  NNEGLFVGAAGLLGLGGGALSFPSQINASS---FSYCLVDRDSDSTSTLEFGG-AIPPNA  313

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V  P++++ +  T YY+ L+G+ V    L ++   F++ + G+GGVI+D GT+VTRL   
Sbjct  314  VTAPMIKNSKLDTFYYVDLTGISVAGNMLSVNPSAFKIADNGDGGVIVDSGTAVTRLKTD  373

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
             Y TLR  ++     +P   + +  DTCYDL  + +V+VPT+SF F+ G    L AKN L
Sbjct  374  VYNTLRDEFVKGTRHLPSTNAVALFDTCYDLKSMKSVEVPTVSFHFSNGNELALPAKNYL  433

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+    FCFAFAPS
Sbjct  434  IPVDSSSTFCFAFAPS  449



>ref|XP_008437888.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
melo]
Length=474

 Score =   253 bits (647),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 189/316 (60%), Gaps = 5/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTPP+Y Y+ +DTGS+++W+QC PCK C+ Q DPVF+P +S SFA
Sbjct  124  GLAQGSGEYFTRIGVGTPPKYVYMVLDTGSDIVWLQCAPCKNCYSQTDPVFNPVKSGSFA  183

Query  762  IVPCSSTICNRIHL-GCT-RGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             V C + +C R+   GC  R  C Y + Y DGSY  G  V ET+TF  T V  V +GC  
Sbjct  184  KVLCRTPLCRRLESPGCNQRQTCLYQVSYGDGSYTTGEFVTETLTFRRTKVEQVALGCGH  243

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPVG  412
             N+G+  GA GLLGL  G ++F +Q        FSYCL    A S   S+ FG   +   
Sbjct  244  DNEGLFVGAAGLLGLGRGGLSFPSQAGRTFNQKFSYCLVDRSASSKPSSVVFGNSAVSRT  303

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLP  235
            A + PLL + R  T YY+ L G+ VG   +  IS   F+L   GNGGVI+D GTSVTRL 
Sbjct  304  ARFTPLLTNPRLDTFYYVELLGISVGGTPVSGISSSHFKLDRTGNGGVIIDCGTSVTRLN  363

Query  234  KVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
            K AY  LR  +    +++  AP FS  DTCYDL+G  TV+VPT+   F G  + +L A N
Sbjct  364  KPAYIALRDAFRAGASSLKSAPEFSLFDTCYDLSGKTTVKVPTVVLHFRGADV-SLPASN  422

Query  54   ILIPVNKRGIFCFAFA  7
             LIPV+  G FCFAFA
Sbjct  423  YLIPVDGSGRFCFAFA  438



>ref|XP_010527532.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Tarenaya 
hassleriana]
Length=484

 Score =   253 bits (647),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 137/315 (43%), Positives = 193/315 (61%), Gaps = 5/315 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G PP+  Y+ IDTGS++ W+QC PC  C+ Q DP+FDP  SSS+A
Sbjct  141  GTSQGSGEYFSRVGIGNPPRQVYMVIDTGSDVNWLQCAPCADCYQQADPIFDPLSSSSYA  200

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             + C +  C  + +  C    C Y + Y DGSY +G  V ET+T G   V  + +GC  +
Sbjct  201  PLSCFTPECKALDVSDCRNQSCLYEVSYGDGSYTVGDFVTETLTIGSASVEHIAIGCGHS  260

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+G+  GA GLLGL GG ++  +Q+   +   FSYCL    ++S+ +LEFG  + P   V
Sbjct  261  NEGLFVGAAGLLGLGGGLLSLPSQLNATS---FSYCLVDRDSDSASTLEFGSSL-PPNTV  316

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
              PLLR+ +  T YY+GL+G+ VG   LPI E  F++TE G GG+I+D GT+VTRL    
Sbjct  317  VAPLLRNHQFDTFYYLGLTGISVGGGLLPIPESAFQMTETGTGGIIIDSGTAVTRLQTEI  376

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y +LR  ++     +P     +  DTCYDL+G   V+VPT++  F GG++  L AKN LI
Sbjct  377  YNSLRDSFVKGTPDLPTVSGVALFDTCYDLSGKTKVEVPTVALHFPGGRMLPLPAKNCLI  436

Query  45   PVNKRGIFCFAFAPS  1
            PV+ +G FC AFAP+
Sbjct  437  PVDSKGTFCLAFAPT  451



>gb|EYU40867.1| hypothetical protein MIMGU_mgv1a023461mg [Erythranthe guttata]
Length=479

 Score =   253 bits (646),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 136/316 (43%), Positives = 192/316 (61%), Gaps = 6/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G P    Y+ +DTGS++ WVQC PC  C+ Q DP++DP  SSSF 
Sbjct  135  GTSQGSGEYFCRVGIGHPSTQAYMVLDTGSDVNWVQCAPCADCYQQADPIYDPGLSSSFT  194

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTV-VRDVTMGCSQ  589
             + C +  C  + +  C  G C Y + Y DGSY +G  V ETITFGG+  V +V +GC  
Sbjct  195  PLTCETQQCQSLDVSECRNGTCLYEVSYGDGSYTVGDFVTETITFGGSAAVDNVAIGCGH  254

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  GA GL+GL GG ++F +QI   +   FSYCL    ++S+ +LEF     P  A
Sbjct  255  NNEGLFVGAAGLIGLGGGRLSFPSQINASS---FSYCLVDRDSDSASTLEF-NSAAPPDA  310

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V  PL+R+ +  T YY+ ++G+ V    LPI    F + + G+GGVI+D GT+VTRL   
Sbjct  311  VTAPLVRNSKLDTFYYVDVTGISVAGDLLPIPPSTFEMNDNGSGGVIVDSGTAVTRLQTE  370

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY ++R  +      +P A   +  DTCYDL+   +V+VPT+SF F+ G+  +L AKN +
Sbjct  371  AYNSMRDAFRKGTKELPTAAGVALFDTCYDLSSRKSVEVPTVSFHFSNGKSLSLPAKNYI  430

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+  G FCFAFAP+
Sbjct  431  IPVDSSGTFCFAFAPT  446



>ref|XP_002302634.2| aspartyl protease family protein [Populus trichocarpa]
 gb|EEE81907.2| aspartyl protease family protein [Populus trichocarpa]
Length=490

 Score =   253 bits (646),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 144/317 (45%), Positives = 195/317 (62%), Gaps = 6/317 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTP +Y ++ +DTGS+++W+QC PCK C+ Q DPVF+PT+S SFA
Sbjct  139  GLAQGSGEYFTRLGVGTPARYVFMVLDTGSDVVWIQCAPCKKCYSQTDPVFNPTKSRSFA  198

Query  762  IVPCSSTICNRIHL-GCTRGR--CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCS  592
             +PC S +C R+   GC+  +  C Y + Y DGS+  G    ET+TF GT V  V +GC 
Sbjct  199  NIPCGSPLCRRLDSPGCSTKKHICLYQVSYGDGSFTYGEFSTETLTFRGTRVGRVALGCG  258

Query  591  QTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGS-LEFGREIIPV  415
              N+G+  GA GLLGL  G ++F +QI  +    FSYCL    A S  S + FG   I  
Sbjct  259  HDNEGLFIGAAGLLGLGRGRLSFPSQIGRRFSRKFSYCLVDRSASSKPSYMVFGDSAISR  318

Query  414  GAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRL  238
             A + PL+ + +  T YY+ L G+ VG  ++P I+  +F+L   GNGGVI+D GTSVTRL
Sbjct  319  TARFTPLVSNPKLDTFYYVELLGVSVGGTRVPGITASLFKLDSTGNGGVIIDSGTSVTRL  378

Query  237  PKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAK  58
             + AY  LR  +    + + RAP FS  DTC+DL+G   V+VPT+   F G  + +L A 
Sbjct  379  TRPAYVALRDAFRVGASNLKRAPEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAS  437

Query  57   NILIPVNKRGIFCFAFA  7
            N LIPV+  G FCFAFA
Sbjct  438  NYLIPVDNSGSFCFAFA  454



>gb|EPS66029.1| hypothetical protein M569_08742 [Genlisea aurea]
Length=464

 Score =   252 bits (643),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 143/316 (45%), Positives = 194/316 (61%), Gaps = 5/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIG+GTPP+Y Y+ +DTGS+++W+QC PC  C+ Q DPVFDP  S+SF 
Sbjct  112  GLSQGSGEYFTRIGIGTPPRYVYMVLDTGSDVVWIQCSPCTKCYSQTDPVFDPRASTSFL  171

Query  762  IVPCSSTICNRIHL-GC-TRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             V C+S +C R+   GC  R +C Y + Y DGS+ +G    ET+TF  T V ++ +GC  
Sbjct  172  GVSCASPLCRRLDSPGCNNRQKCLYQVSYGDGSFTVGEFSTETLTFRRTRVDNIALGCGH  231

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAES-SGSLEFGREIIPVG  412
             N+G+  GA GLLGL  G ++F  Q   + G  FSYCL    A +   S+ FG   +   
Sbjct  232  DNEGLFVGAAGLLGLGRGKLSFPTQAGPRFGRKFSYCLVDRSATAMPSSVMFGDSAVSRN  291

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLP  235
            +V+ PLL + +  T YYIGL+G+ VG  ++P ++  +F+L   G GGVI+D GTSVTRL 
Sbjct  292  SVFTPLLTNPKLDTFYYIGLTGISVGGSRVPGVTPSLFKLDSSGAGGVIIDSGTSVTRLT  351

Query  234  KVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
            + AY  LR  +      + RAP FS  DTCYDL+G   V+VPT+   F G  + +L A N
Sbjct  352  RPAYVALRDAFRIGAYHLNRAPDFSLFDTCYDLSGKTEVKVPTVVLHFEGADV-SLPASN  410

Query  54   ILIPVNKRGIFCFAFA  7
             LIPV+  G FCFAFA
Sbjct  411  YLIPVDTSGRFCFAFA  426



>ref|XP_006491285.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Citrus 
sinensis]
 gb|KDO86492.1| hypothetical protein CISIN_1g040810mg [Citrus sinensis]
Length=480

 Score =   252 bits (644),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 142/316 (45%), Positives = 189/316 (60%), Gaps = 5/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTPP+Y Y+ +DTGS+++W+QC PCK C+ Q DPVFDP +S SFA
Sbjct  130  GLAQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWIQCAPCKKCYSQTDPVFDPAKSRSFA  189

Query  762  IVPCSSTICNRIH-LGCT-RGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             VPC S +C ++   GC  R  C Y + Y DGS  +G    ET+TF GT V  V +GC  
Sbjct  190  TVPCRSPLCRKLDSSGCNRRNTCLYQVSYGDGSITVGDFSTETLTFRGTRVARVALGCGH  249

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPVG  412
             N+G+   A GLLGL  G ++F  Q   +    FSYCL      +   S+ FG   +   
Sbjct  250  DNEGLFVAAAGLLGLGRGRLSFPTQTGRRFNRKFSYCLVDRSTSAKPSSMVFGDSAVSRT  309

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLP  235
            A + PLL + +  T YY+ L G+ VG   +  I+  +F+L   GNGGVI+D GTSVTRL 
Sbjct  310  ARFTPLLANPKLDTFYYVELVGISVGGAHVRGITASLFKLDPAGNGGVIIDSGTSVTRLT  369

Query  234  KVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
            + AY  LR  +    +++ RAP FS  DTC+DL+G   V+VPT+   F G  + +L A N
Sbjct  370  RPAYIALRDAFRAGASSLKRAPDFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPATN  428

Query  54   ILIPVNKRGIFCFAFA  7
             LIPV+  G FCFAFA
Sbjct  429  YLIPVDSSGTFCFAFA  444



>ref|XP_006444833.1| hypothetical protein CICLE_v10019938mg [Citrus clementina]
 gb|ESR58073.1| hypothetical protein CICLE_v10019938mg [Citrus clementina]
Length=480

 Score =   252 bits (644),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 142/316 (45%), Positives = 189/316 (60%), Gaps = 5/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTPP+Y Y+ +DTGS+++W+QC PCK C+ Q DPVFDP +S SFA
Sbjct  130  GLAQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWIQCAPCKKCYSQTDPVFDPAKSRSFA  189

Query  762  IVPCSSTICNRIH-LGCT-RGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             VPC S +C ++   GC  R  C Y + Y DGS  +G    ET+TF GT V  V +GC  
Sbjct  190  TVPCRSPLCRKLDSSGCNRRNTCLYQVSYGDGSITVGDFSTETLTFRGTRVARVALGCGH  249

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPVG  412
             N+G+   A GLLGL  G ++F  Q   +    FSYCL      +   S+ FG   +   
Sbjct  250  DNEGLFVAAAGLLGLGRGRLSFPTQTGRRFNRKFSYCLVDRSTSAKPSSMVFGDSAVSRT  309

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLP  235
            A + PLL + +  T YY+ L G+ VG   +  I+  +F+L   GNGGVI+D GTSVTRL 
Sbjct  310  ARFTPLLANPKLDTFYYVELVGISVGGAHVRGITASLFKLDPAGNGGVIIDSGTSVTRLT  369

Query  234  KVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
            + AY  LR  +    +++ RAP FS  DTC+DL+G   V+VPT+   F G  + +L A N
Sbjct  370  RPAYIALRDAFRAGASSLKRAPDFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPATN  428

Query  54   ILIPVNKRGIFCFAFA  7
             LIPV+  G FCFAFA
Sbjct  429  YLIPVDSSGTFCFAFA  444



>ref|XP_009104352.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=485

 Score =   252 bits (644),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 141/324 (44%), Positives = 199/324 (61%), Gaps = 13/324 (4%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY +R+GVGTP    Y+ +DTGS+++W+QC PCK C+ Q DP+F+P +S++FA
Sbjct  128  GLSQGSGEYFMRLGVGTPATNVYMVLDTGSDVVWLQCSPCKVCYNQSDPMFNPAKSTTFA  187

Query  762  IVPCSSTICNRIHLGCT----RGR--CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTM  601
             VPC S +C ++    +    RG   C Y + Y DGS+ MG    ET+TF G  V  V +
Sbjct  188  TVPCGSPLCRKLDESSSECVNRGSKTCLYQVSYGDGSFTMGDFSTETLTFHGARVDHVAL  247

Query  600  GCSQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGS-----LEF  436
            GC   N+G+  GA GLLGL  G ++F +Q   +    FSYCL    +  S S     + F
Sbjct  248  GCGHDNEGLFVGAAGLLGLGRGGLSFPSQTKNRYNAKFSYCLVDRTSSGSASKPPSTIVF  307

Query  435  GREIIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDI  259
            G + +   +V+  LL + +  T YY+ L G+ VG  ++P +SE  F+L   G+GGVI+D 
Sbjct  308  GNDAVQETSVFTTLLTNPKLDTFYYLQLLGISVGGSRVPGVSESQFKLDPTGDGGVIIDS  367

Query  258  GTSVTRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQ  79
            GTSVTRL + AY   R  ++     + RAPS+S  DTC+DL+G+ TV+VPT+ F F+GG 
Sbjct  368  GTSVTRLTRPAYVAFRDAFLLGATRLKRAPSYSLFDTCFDLSGMTTVKVPTVVFHFSGGD  427

Query  78   IWTLAAKNILIPVNKRGIFCFAFA  7
            + +L A N LIPVN +G FCFAFA
Sbjct  428  V-SLPASNYLIPVNSQGRFCFAFA  450



>ref|XP_007217966.1| hypothetical protein PRUPE_ppa005289mg [Prunus persica]
 gb|EMJ19165.1| hypothetical protein PRUPE_ppa005289mg [Prunus persica]
Length=468

 Score =   251 bits (642),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 141/316 (45%), Positives = 193/316 (61%), Gaps = 5/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTPP+Y Y+ +DTGS+++W+QC PCK C+ Q DPVFDP +S +F+
Sbjct  118  GLAQGSGEYFTRLGVGTPPKYVYMVLDTGSDVVWLQCAPCKRCYSQTDPVFDPRKSGTFS  177

Query  762  IVPCSSTICNRIH-LGC-TRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             +PC S +C ++   GC  R  C Y + Y DGS+ +G    ET+TF GT V  V +GC  
Sbjct  178  TIPCGSPLCRKLDSSGCKARKTCLYQVSYGDGSFTVGDFSTETLTFRGTKVGRVALGCGH  237

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPVG  412
             N+G+  GA GLLGL  G ++F  Q   +    FSYCL    A S   S+ FG   +   
Sbjct  238  DNEGLFVGAAGLLGLGRGKLSFPTQTGVRFNKKFSYCLVDRSASSKPSSVVFGDSAVSRT  297

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLP  235
            A + PL+ + +  T YY+ L G+ VG  ++  I+  +F+L   GNGGVI+D GTSVTRL 
Sbjct  298  ARFTPLIANPKLDTFYYVELIGISVGGTRVRGITASLFKLDPAGNGGVILDSGTSVTRLT  357

Query  234  KVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
            +VAY +LR  +    + + RAP FS  DTC+DL+G   V+VPT+   F    + +L A N
Sbjct  358  RVAYNSLRDAFRAGTSGLKRAPEFSLFDTCFDLSGKSEVKVPTVVLHFRNADV-SLPATN  416

Query  54   ILIPVNKRGIFCFAFA  7
             LIPV+  G FCFAFA
Sbjct  417  YLIPVDSSGSFCFAFA  432



>emb|CDM80984.1| unnamed protein product [Triticum aestivum]
Length=503

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 142/312 (46%), Positives = 186/312 (60%), Gaps = 9/312 (3%)
 Frame = -2

Query  930  GIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFAIVPC  751
            G  EY  R+GVG P +  Y+ +DTGS++ W+QCQPC  C+ Q DPV+DP+ S+S+A V C
Sbjct  162  GSGEYFSRVGVGRPARQLYMVLDTGSDVTWLQCQPCADCYTQSDPVYDPSVSASYAAVGC  221

Query  750  SSTICNRIHLGCTR---GRCSYGIVYIDGSYNMGTMVQETITFGGTV-VRDVTMGCSQTN  583
             S  C  +     R   G C Y + Y DGSY +G    ET+T G +  V +V +GC   N
Sbjct  222  DSPRCRDLDAAACRNSTGSCLYEVAYGDGSYTVGDFATETLTLGDSAPVSNVAIGCGHDN  281

Query  582  QGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAVW  403
            +G+  GA GLL L GG ++F +QI   +   FSYCL    + SS +L+FG    P  AV 
Sbjct  282  EGLFVGAAGLLALGGGPLSFPSQISATS---FSYCLVDRDSPSSSTLQFGDSEQP--AVT  336

Query  402  VPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVAY  223
             PLLRS R  T YY+GLSG+ VG   L I    F + + G+GGVI+D GT+VTRL   AY
Sbjct  337  APLLRSPRTNTFYYVGLSGISVGGQALSIPASAFAMDDAGSGGVIVDSGTAVTRLQSGAY  396

Query  222  ETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILIP  43
              LR  ++    ++PRA   S  DTCYDL G  +VQVP ++  F GG    L AKN LIP
Sbjct  397  AALREAFVQGTQSLPRASGISLFDTCYDLAGRSSVQVPAVALRFEGGGELKLPAKNYLIP  456

Query  42   VNKRGIFCFAFA  7
            V+  G +C AFA
Sbjct  457  VDGAGTYCLAFA  468



>ref|XP_004133810.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
Length=471

 Score =   251 bits (642),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 148/316 (47%), Positives = 189/316 (60%), Gaps = 5/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTPP+Y Y+ +DTGS+++W+QC PCK C+ Q DPVF+P +S SFA
Sbjct  121  GLAQGSGEYFTRIGVGTPPKYVYMVLDTGSDIVWLQCAPCKNCYSQTDPVFNPVKSGSFA  180

Query  762  IVPCSSTICNRIHL-GCT-RGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             V C + +C R+   GC  R  C Y + Y DGSY  G  V ET+TF  T V  V +GC  
Sbjct  181  KVLCRTPLCRRLESPGCNQRQTCLYQVSYGDGSYTTGEFVTETLTFRRTKVEQVALGCGH  240

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPVG  412
             N+G+  GA GLLGL  G ++F +Q        FSYCL    A S   S+ FG   +   
Sbjct  241  DNEGLFVGAAGLLGLGRGGLSFPSQAGRTFNQKFSYCLVDRSASSKPSSVVFGNSAVSRT  300

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLP  235
            A + PLL + R  T YY+ L G+ VG   +  I+   F+L   GNGGVI+D GTSVTRL 
Sbjct  301  ARFTPLLTNPRLDTFYYVELLGISVGGTPVSGITASHFKLDRTGNGGVIIDCGTSVTRLN  360

Query  234  KVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
            K AY  LR  +    +++  AP FS  DTCYDL+G  TV+VPT+   F G  + +L A N
Sbjct  361  KPAYIALRDAFRAGASSLKSAPEFSLFDTCYDLSGKTTVKVPTVVLHFRGADV-SLPASN  419

Query  54   ILIPVNKRGIFCFAFA  7
             LIPV+  G FCFAFA
Sbjct  420  YLIPVDGSGRFCFAFA  435



>ref|XP_007153356.1| hypothetical protein PHAVU_003G028600g [Phaseolus vulgaris]
 gb|ESW25350.1| hypothetical protein PHAVU_003G028600g [Phaseolus vulgaris]
Length=483

 Score =   252 bits (643),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 135/315 (43%), Positives = 186/315 (59%), Gaps = 5/315 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY +R+G+G PP   Y+ +DTGS++ W+QC+PC  C+ Q DP+FDP  SSS+A
Sbjct  140  GTSQGSGEYFLRVGIGKPPSQAYVVLDTGSDVSWIQCEPCSECYQQSDPIFDPLSSSSYA  199

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             + C +  C  + L  C  G C Y + Y DGSY +G    ET+T G + V  V +GC   
Sbjct  200  PIHCDAPQCKSLDLSECRNGTCLYEVSYGDGSYTVGEFATETVTLGASAVSGVAIGCGHN  259

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+G+  GA GLLGL GG ++F AQ+   +   FSYCL    +++  +LEF   + P  AV
Sbjct  260  NEGLFVGAAGLLGLGGGKLSFPAQVNATS---FSYCLVDRDSDAVSTLEFDSPM-PRNAV  315

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
              PL+R+    T YY+GL G+ VG   L + E  F +   G GG+I+D GT+VTRL    
Sbjct  316  TAPLMRNPELDTFYYLGLKGISVGGETLQVPESSFAVDATGGGGIIVDSGTAVTRLRSEV  375

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y+ LR  ++     +P+    S  DTCYDL+   +V VPT+S  F  G+   L AKN LI
Sbjct  376  YDALRDAFVRGTKGLPKTNGVSLFDTCYDLSSRNSVDVPTVSLHFPEGRELPLPAKNYLI  435

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAP+
Sbjct  436  PVDSVGTFCFAFAPT  450



>ref|XP_002281973.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Vitis vinifera]
Length=491

 Score =   252 bits (643),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 138/316 (44%), Positives = 195/316 (62%), Gaps = 6/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G+PP++ Y+ +DTGS++ WVQC PC  C+ Q DP+F+P+ SSS+A
Sbjct  147  GASQGSGEYFSRVGIGSPPKHVYMVVDTGSDVNWVQCAPCADCYQQADPIFEPSFSSSYA  206

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTV-VRDVTMGCSQ  589
             + C +  C  + +  C    C Y + Y DGSY +G    ETIT  G+  + +V +GC  
Sbjct  207  PLTCETHQCKSLDVSECRNDSCLYEVSYGDGSYTVGDFATETITLDGSASLNNVAIGCGH  266

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  GA GLLGL GGS++F +QI   +   FSYCL +   +S+ +LEF   I P  +
Sbjct  267  DNEGLFVGAAGLLGLGGGSLSFPSQINASS---FSYCLVNRDTDSASTLEFNSPI-PSHS  322

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V  PLLR+ +  T YY+G++G+GVG   L I    F + E GNGG+I+D GT+VTRL   
Sbjct  323  VTAPLLRNNQLDTFYYLGMTGIGVGGQMLSIPRSSFEVDESGNGGIIVDSGTAVTRLQSD  382

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
             Y +LR  ++     +P     +  DTCYDL+   +V+VPT+SF F  G+   L AKN L
Sbjct  383  VYNSLRDSFVRGTQHLPSTSGVALFDTCYDLSSRSSVEVPTVSFHFPDGKYLALPAKNYL  442

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+  G FCFAFAP+
Sbjct  443  IPVDSAGTFCFAFAPT  458



>ref|XP_009337317.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score =   252 bits (643),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 136/316 (43%), Positives = 195/316 (62%), Gaps = 6/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTP +  Y+ +DTGS++ W+QC PC  C+ Q DPVF+P  SS+++
Sbjct  143  GVSQGSGEYFSRIGVGTPAKSFYMVLDTGSDVNWLQCGPCSDCYQQSDPVFNPAGSSTYS  202

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + C ++ C  + +  C   +C Y + Y DGSY +G  V ET++FG +  +  + +GC  
Sbjct  203  QLTCDASQCQALQVSACRANKCLYQVSYGDGSYTIGDYVTETLSFGNSGSINKIALGCGH  262

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  GA GLLGL GG ++  +Q    T   FSYCL +  + +S +LEF     P  +
Sbjct  263  DNEGLFVGAAGLLGLGGGPLSLTSQFKATT---FSYCLVNRDSSASSTLEFN-SAPPADS  318

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V  PL++S +  T YY+GL+G  VG   + +S  +F + + GNGG+I+D GT++TRL   
Sbjct  319  VTAPLIKSGKVGTFYYVGLTGFSVGGQPVSVSPSLFAVDDSGNGGIIVDSGTAITRLQTQ  378

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY  LR  +      +P A SFS  DTCY+L+    VQVPT+SF F+GG+  +L AKN L
Sbjct  379  AYNALRDAFKRLTRDLPTASSFSLFDTCYNLSSRTKVQVPTVSFQFSGGKSLSLPAKNYL  438

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+  G FCFAFAP+
Sbjct  439  IPVDSAGAFCFAFAPT  454



>emb|CDY24483.1| BnaC05g34710D [Brassica napus]
Length=491

 Score =   252 bits (643),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 134/317 (42%), Positives = 193/317 (61%), Gaps = 6/317 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTP +  Y+ +DTGS++ W+QC+PC  C+ Q DP+FDP+ SS++ 
Sbjct  145  GASQGSGEYFSRLGVGTPAKEMYMVLDTGSDINWIQCKPCSSCYQQSDPIFDPSSSSTYK  204

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + CS+  C  +    C   +C Y + Y DGS+ +G    +T+TFG +  V +V +GC +
Sbjct  205  SLTCSAPQCASLRASACRSDKCLYQVRYGDGSFTVGEYATDTVTFGSSGKVDNVALGCGR  264

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+ TGA GLLGL GG+++  +QI  ++   FSYCL    +  S SL+F    +  G 
Sbjct  265  DNEGLFTGAAGLLGLGGGALSMTSQIKAKS---FSYCLVDRDSGKSSSLDFNSVQVGAGD  321

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
               P+L + +  T YY+G +G  VG  ++ I    F +   G GGVI+D GT+VTRL   
Sbjct  322  ATAPILSNSKIDTFYYVGFTGFSVGGQQVSIPSSAFAVDASGTGGVILDCGTAVTRLQTQ  381

Query  228  AYETLRYIYMTQIATIPR-APSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNI  52
            AY +LR  ++   A + R   S S  DTCYD + L TV+VPT++F FTGG+   L AKN 
Sbjct  382  AYNSLRDAFVKLTANLKRGTSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKTLNLPAKNY  441

Query  51   LIPVNKRGIFCFAFAPS  1
            LIP++  G FCFAFAP+
Sbjct  442  LIPIDDAGTFCFAFAPT  458



>ref|NP_171637.1| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAF97328.1|AC023628_9 Unknown protein [Arabidopsis thaliana]
 gb|AAM91547.1| chloroplast nucleoid DNA binding protein, putative [Arabidopsis 
thaliana]
 gb|AAP31963.1| At1g01300 [Arabidopsis thaliana]
 gb|AEE27268.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=485

 Score =   251 bits (642),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 143/321 (45%), Positives = 196/321 (61%), Gaps = 14/321 (4%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTP +Y Y+ +DTGS+++W+QC PC+ C+ Q DP+FDP +S ++A
Sbjct  134  GLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPIFDPRKSKTYA  193

Query  762  IVPCSSTICNRIH-LGCT--RGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCS  592
             +PCSS  C R+   GC   R  C Y + Y DGS+ +G    ET+TF    V+ V +GC 
Sbjct  194  TIPCSSPHCRRLDSAGCNTRRKTCLYQVSYGDGSFTVGDFSTETLTFRRNRVKGVALGCG  253

Query  591  QTNQGMVTgaggllglagGSMTFMAQIPGQTGG----VFSYCLASWHAESS-GSLEFGRE  427
              N+G+  GA GLLGL  G ++F    PGQTG      FSYCL    A S   S+ FG  
Sbjct  254  HDNEGLFVGAAGLLGLGKGKLSF----PGQTGHRFNQKFSYCLVDRSASSKPSSVVFGNA  309

Query  426  IIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTS  250
             +   A + PLL + +  T YY+GL G+ VG  ++P ++  +F+L + GNGGVI+D GTS
Sbjct  310  AVSRIARFTPLLSNPKLDTFYYVGLLGISVGGTRVPGVTASLFKLDQIGNGGVIIDSGTS  369

Query  249  VTRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWT  70
            VTRL + AY  +R  +     T+ RAP FS  DTC+DL+ +  V+VPT+   F G  + +
Sbjct  370  VTRLIRPAYIAMRDAFRVGAKTLKRAPDFSLFDTCFDLSNMNEVKVPTVVLHFRGADV-S  428

Query  69   LAAKNILIPVNKRGIFCFAFA  7
            L A N LIPV+  G FCFAFA
Sbjct  429  LPATNYLIPVDTNGKFCFAFA  449



>ref|XP_008461984.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
melo]
Length=517

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 141/317 (44%), Positives = 193/317 (61%), Gaps = 6/317 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTPP+Y Y+ +DTGS+++W+QC PC+ C+ Q DP+F+P +S SFA
Sbjct  166  GLAQGSGEYFTRLGVGTPPRYLYMVLDTGSDVVWLQCSPCRKCYSQSDPIFNPYKSKSFA  225

Query  762  IVPCSSTICNRIH-LGCT--RGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCS  592
             +PCSS +C R+   GC+  R  C Y + Y DGS+  G    ET+TF G  +  V +GC 
Sbjct  226  GIPCSSPLCRRLDSSGCSTRRHTCLYQVSYGDGSFTTGDFATETLTFRGNKIAKVALGCG  285

Query  591  QTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPV  415
              N+G+  GA GLLGL  G ++F +Q   +    FSYCL    A S   S+ FG   I  
Sbjct  286  HHNEGLFVGAAGLLGLGRGRLSFPSQTGIRFNRKFSYCLVDRSASSKPSSMVFGDAAISR  345

Query  414  GAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRL  238
             A + PL+R+ +  T YY+ L G+ VG +++  +   +F+L   GNGGVI+D GTSVTRL
Sbjct  346  LARFTPLIRNPKLDTFYYVELIGISVGGVRVRGVYPSLFKLDSAGNGGVIIDSGTSVTRL  405

Query  237  PKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAK  58
             + AY  LR  +      + R P FS  DTCYDL+G  +V+VPT+   F G  +  L A 
Sbjct  406  TRPAYTALRDAFRAGARHLKRGPEFSLFDTCYDLSGQSSVKVPTVVLHFRGADM-PLPAT  464

Query  57   NILIPVNKRGIFCFAFA  7
            N LIPV++ G FCFAFA
Sbjct  465  NYLIPVDENGSFCFAFA  481



>gb|KGN56421.1| Aspartic proteinase nepenthesin-1 [Cucumis sativus]
Length=512

 Score =   252 bits (643),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 148/316 (47%), Positives = 189/316 (60%), Gaps = 5/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTPP+Y Y+ +DTGS+++W+QC PCK C+ Q DPVF+P +S SFA
Sbjct  162  GLAQGSGEYFTRIGVGTPPKYVYMVLDTGSDIVWLQCAPCKNCYSQTDPVFNPVKSGSFA  221

Query  762  IVPCSSTICNRIHL-GCT-RGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             V C + +C R+   GC  R  C Y + Y DGSY  G  V ET+TF  T V  V +GC  
Sbjct  222  KVLCRTPLCRRLESPGCNQRQTCLYQVSYGDGSYTTGEFVTETLTFRRTKVEQVALGCGH  281

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPVG  412
             N+G+  GA GLLGL  G ++F +Q        FSYCL    A S   S+ FG   +   
Sbjct  282  DNEGLFVGAAGLLGLGRGGLSFPSQAGRTFNQKFSYCLVDRSASSKPSSVVFGNSAVSRT  341

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLP  235
            A + PLL + R  T YY+ L G+ VG   +  I+   F+L   GNGGVI+D GTSVTRL 
Sbjct  342  ARFTPLLTNPRLDTFYYVELLGISVGGTPVSGITASHFKLDRTGNGGVIIDCGTSVTRLN  401

Query  234  KVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
            K AY  LR  +    +++  AP FS  DTCYDL+G  TV+VPT+   F G  + +L A N
Sbjct  402  KPAYIALRDAFRAGASSLKSAPEFSLFDTCYDLSGKTTVKVPTVVLHFRGADV-SLPASN  460

Query  54   ILIPVNKRGIFCFAFA  7
             LIPV+  G FCFAFA
Sbjct  461  YLIPVDGSGRFCFAFA  476



>ref|XP_007051536.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
 gb|EOX95693.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
Length=557

 Score =   253 bits (646),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 144/312 (46%), Positives = 194/312 (62%), Gaps = 5/312 (2%)
 Frame = -2

Query  930  GIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFAIVPC  751
            G  EY  R+GVGTPP+Y Y+ +DTGS+++WVQC PCK C+ Q DP+FDPT+S SF+ +PC
Sbjct  142  GSGEYFTRLGVGTPPRYLYMVLDTGSDVVWVQCSPCKKCYSQSDPIFDPTKSRSFSGIPC  201

Query  750  SSTICNRIH-LGCTRGR-CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQTNQG  577
             S +C  +   GC + R C Y + Y DGS   G    ET+TF  T V  V +GC   N+G
Sbjct  202  GSPLCRSLDSSGCNQRRMCLYQVSYGDGSVTFGDFSTETLTFRRTRVGRVAIGCGHDNEG  261

Query  576  MVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPVGAVWV  400
            +  GA GLLGL  G ++F +Q   +    FSYCL    A S   SL FG   +P  A+  
Sbjct  262  LFVGAAGLLGLGRGRLSFPSQTGRRFNQKFSYCLVDRSASSRPSSLVFGDAAVPRAAMLT  321

Query  399  PLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLPKVAY  223
            PLL + +  T YYI L G+ VG I++P I+  +F++ + GNGGVI+D GTSVTRL + AY
Sbjct  322  PLLTNPKLDTFYYIELLGISVGGIRVPRITPSLFKMDQAGNGGVIIDSGTSVTRLTRPAY  381

Query  222  ETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILIP  43
              +R  +    + +  AP FS  DTC+DL+G  +V+VPT+   F G  + +L A N LIP
Sbjct  382  IAMRDAFRIGASNLKGAPDFSLFDTCFDLSGKTSVKVPTVVLHFRGADV-SLPATNYLIP  440

Query  42   VNKRGIFCFAFA  7
            V+  G FCFAFA
Sbjct  441  VDGSGTFCFAFA  452



>ref|XP_009109887.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=482

 Score =   251 bits (640),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 135/315 (43%), Positives = 191/315 (61%), Gaps = 5/315 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G+P +  Y+ +DTGS++ W+QC PC  C+ Q +P+F+PT SSS+A
Sbjct  139  GTTQGSGEYFTRVGIGSPAREVYMVLDTGSDVNWLQCAPCAECYHQTEPIFEPTTSSSYA  198

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             + C +  C  +    C    C Y + Y DGS+  G    ET T G   V +V +GC  +
Sbjct  199  TLSCDAPQCKALEASECRNATCLYEVSYGDGSFTAGDFATETFTIGSASVDNVAVGCGHS  258

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            NQG+  GA GLLGL GG +   +Q+   +   FSYCL    ++SS ++EFG +I P  AV
Sbjct  259  NQGLFVGAAGLLGLGGGLLALPSQLNTTS---FSYCLVDRDSDSSSTVEFGSDI-PNDAV  314

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
              PL+R+ +  T YY+GL+G+ VG   L IS   F + E G GGVI+D GTSVTRL    
Sbjct  315  VAPLMRNHQLDTFYYLGLTGISVGGEMLEISASSFEMDESGGGGVIIDSGTSVTRLQTGV  374

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y++LR  ++     + RA   +  DTCYDL+G  T++VP+++F F GG +  L AKN +I
Sbjct  375  YDSLRDAFVKGTTDLERAGEVAMFDTCYDLSGKTTIEVPSVAFHFPGGNMLALPAKNYMI  434

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FC AFAP+
Sbjct  435  PVDSVGTFCLAFAPT  449



>ref|XP_011008360.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Populus 
euphratica]
Length=484

 Score =   251 bits (640),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 140/315 (44%), Positives = 195/315 (62%), Gaps = 5/315 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G PP   YL +DTGS++ WVQC PC  C+ Q DP+F+P+ S+SF+
Sbjct  141  GTSQGSGEYFSRVGIGKPPSQAYLILDTGSDVNWVQCAPCAECYQQADPIFEPSSSASFS  200

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             + C++  C  + +  C    C Y + Y DGSY +G  V ETIT G   V +V +GC  T
Sbjct  201  TLSCNTRQCRSLDVSECRNDTCLYEVSYGDGSYTVGDFVTETITLGSAPVDNVAIGCGHT  260

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+G+  GA GLLGL GGS++F +QI   +   FSYCL    +ES+ +LEF    +P  AV
Sbjct  261  NEGLFVGAAGLLGLGGGSLSFPSQINATS---FSYCLVDRDSESASTLEFN-STLPPNAV  316

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
              PLLR+    T YY+GL+GL VG   + I E  F++ E G+GGVI+D GT++TRL    
Sbjct  317  AAPLLRNHNLDTFYYVGLTGLSVGGELVSIPESAFQIDESGDGGVIVDSGTAITRLQTDV  376

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y +LR  ++ +   +P     +  DTCY+L+  G V+VPT+SF F  G+   L AKN L+
Sbjct  377  YNSLRDAFVKRTRDLPSTNGIALFDTCYNLSSKGNVEVPTVSFHFPDGKELPLPAKNYLV  436

Query  45   PVNKRGIFCFAFAPS  1
            P++  G FCFAFAP+
Sbjct  437  PLDSEGTFCFAFAPT  451



>ref|XP_009600181.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
Length=474

 Score =   250 bits (639),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 139/316 (44%), Positives = 191/316 (60%), Gaps = 5/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIG+GTPP+Y YL +DTGS+++W+QC PC+ C+ Q DPVFDP++SSSF 
Sbjct  124  GLAQGSGEYFTRIGIGTPPKYAYLVLDTGSDVVWIQCLPCRQCYNQSDPVFDPSKSSSFT  183

Query  762  IVPCSSTICNRIHL-GC-TRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             + C S +C R+   GC  + +C Y + Y DGS+ +G    ET+TF  T V D+  GC  
Sbjct  184  GLSCDSPLCRRLDSPGCNNKNKCLYQVSYGDGSFTVGEFSTETLTFRKTRVSDIAFGCGH  243

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGS-LEFGREIIPVG  412
             N+G+  GA GLLGL  G ++F  Q   + G  FSYCL         S L FG   +   
Sbjct  244  DNEGLFIGAAGLLGLGKGKLSFPGQAGSRFGNKFSYCLVDRTGSPKPSYLIFGESAVTRN  303

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLP  235
             ++ PLL + +  T YY+ L+G+ VG  ++P I+ ++F+L   G+GGVI+D GTSVTRL 
Sbjct  304  TIFTPLLTNQKLNTFYYVELTGISVGGTRVPLITSELFKLGANGDGGVIVDSGTSVTRLT  363

Query  234  KVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
            + AY  LR  +      + RAP++S  DTCYDL+G   V+VPT+   F    +  L A N
Sbjct  364  RPAYVALRDAFSLGTKNLKRAPNYSLFDTCYDLSGKTEVKVPTLVLHFKDADV-ALPASN  422

Query  54   ILIPVNKRGIFCFAFA  7
             LIPV+  G FCF FA
Sbjct  423  YLIPVSSEGRFCFGFA  438



>ref|XP_008457107.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
melo]
Length=489

 Score =   251 bits (640),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 139/316 (44%), Positives = 197/316 (62%), Gaps = 6/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVG P +  Y+ +DTGS++ W+QCQPC  C+ Q DP+FDP  SSSFA
Sbjct  145  GTSQGSGEYFSRVGVGQPAKPFYMVLDTGSDINWLQCQPCTDCYQQTDPIFDPRSSSSFA  204

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             +PC S  C  +   GC   +C Y + Y DGS+ +G  V ET+TFG + ++++V +GC  
Sbjct  205  SLPCESQQCQALETSGCRASKCLYQVSYGDGSFTVGEFVTETLTFGNSGMIKNVAVGCGH  264

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  G+ GLLGL GGS++  +Q+   +   FSYCL    + SS  LEF     P  +
Sbjct  265  DNEGLFVGSAGLLGLGGGSLSLTSQMKASS---FSYCLVDRDSSSSSDLEFN-SAAPTDS  320

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V  PLL+S R  T YY+GL+G+ VG   L I  ++F++ + G GG+I+D GT++TRL   
Sbjct  321  VNAPLLKSGRVDTFYYVGLTGMSVGGQLLSIPPNLFQMDDSGYGGIIVDSGTAITRLQTQ  380

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY TLR  ++++   + +   F+  DTCYDL+    V +PT+SF F GG+   L  KN L
Sbjct  381  AYNTLRDAFVSRTPYLKKTNGFALFDTCYDLSSQSRVTIPTVSFEFAGGKSLQLPPKNYL  440

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+  G FCFAFAP+
Sbjct  441  IPVDSVGTFCFAFAPT  456



>dbj|BAK07248.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=500

 Score =   251 bits (641),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 141/312 (45%), Positives = 186/312 (60%), Gaps = 9/312 (3%)
 Frame = -2

Query  930  GIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFAIVPC  751
            G  EY  R+GVG P +  Y+ +DTGS++ W+QCQPC  C+ Q DPV+DP+ S+S+A V C
Sbjct  159  GSGEYFSRVGVGRPARQLYMVLDTGSDVTWLQCQPCADCYAQSDPVYDPSVSTSYATVGC  218

Query  750  SSTICNRIHLGCTR---GRCSYGIVYIDGSYNMGTMVQETITFGGTV-VRDVTMGCSQTN  583
             S  C  +     R   G C Y + Y DGSY +G    ET+T G +  V +V +GC   N
Sbjct  219  DSPRCRDLDAAACRNSTGSCLYEVAYGDGSYTVGDFATETLTLGDSAPVSNVAIGCGHDN  278

Query  582  QGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAVW  403
            +G+  GA GLL L GG ++F +QI   T   FSYCL    + SS +L+FG    P  AV 
Sbjct  279  EGLFVGAAGLLALGGGPLSFPSQISATT---FSYCLVDRDSPSSSTLQFGDSEQP--AVT  333

Query  402  VPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVAY  223
             PL+RS R  T YY+ LSG+ VG   L I    F + + G+GGVI+D GT+VTRL   AY
Sbjct  334  APLIRSPRTNTFYYVALSGISVGGEALSIPSSAFAMDDAGSGGVIVDSGTAVTRLQSGAY  393

Query  222  ETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILIP  43
              LR  ++    ++PRA   S  DTCYDL G  +VQVP ++ +F GG    L AKN LIP
Sbjct  394  GALREAFVQGTQSLPRASGVSLFDTCYDLAGRSSVQVPAVALWFEGGGELKLPAKNYLIP  453

Query  42   VNKRGIFCFAFA  7
            V+  G +C AFA
Sbjct  454  VDAAGTYCLAFA  465



>ref|XP_002523337.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF39053.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=469

 Score =   250 bits (639),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 141/317 (44%), Positives = 191/317 (60%), Gaps = 6/317 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTPP+Y Y+ +DTGS+++W+QC PCK C+ Q DPVFDP +S SFA
Sbjct  118  GLAQGSGEYFTRIGVGTPPRYVYMVLDTGSDIVWIQCAPCKRCYAQSDPVFDPRKSRSFA  177

Query  762  IVPCSSTICNRIHL-GCT--RGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCS  592
             + C S +C+R+   GC   +  C Y + Y DGS+  G    ET+TF  T V  V +GC 
Sbjct  178  SIACRSPLCHRLDSPGCNTQKQTCMYQVSYGDGSFTFGDFSTETLTFRRTRVARVALGCG  237

Query  591  QTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPV  415
              N+G+  GA GLLGL  G ++F +Q   +    FSYCL    A S   S+ FG   +  
Sbjct  238  HDNEGLFVGAAGLLGLGRGRLSFPSQTGRRFNHKFSYCLVDRSASSKPSSMVFGDSAVSR  297

Query  414  GAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRL  238
             A + PL+ + +  T YY+ L G+ VG  ++P I+  +F+L + GNGGVI+D GTSVTRL
Sbjct  298  TARFTPLVSNPKLDTFYYVELLGISVGGTRVPGITASLFKLDQTGNGGVIIDSGTSVTRL  357

Query  237  PKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAK  58
             + AY   R  +    + + RAP FS  DTC+DL+G   V+VPT+   F G  + +L A 
Sbjct  358  TRPAYIAFRDAFRAGASNLKRAPQFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAS  416

Query  57   NILIPVNKRGIFCFAFA  7
            N LIPV+  G FC AFA
Sbjct  417  NYLIPVDTSGNFCLAFA  433



>ref|XP_010413342.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=488

 Score =   251 bits (640),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 141/323 (44%), Positives = 197/323 (61%), Gaps = 12/323 (4%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY +R+GVGTP    Y+ +DTGS+++W+QC PCK C+ Q DP+FDP RS ++A
Sbjct  132  GLSQGSGEYFMRLGVGTPATNVYMVLDTGSDVVWLQCSPCKACYNQSDPIFDPKRSKTYA  191

Query  762  IVPCSSTICNRIHLG--CTRGR---CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMG  598
             VPC S +C R+     C   R   C Y + Y DGS+  G    ET+ F G  V  V +G
Sbjct  192  TVPCGSRLCRRLDDSSECVTRRSKTCLYQVSYGDGSFTEGDFATETLAFHGARVDHVPLG  251

Query  597  CSQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLAS-----WHAESSGSLEFG  433
            C   N+G+  GA GLLGL  G ++F +Q   +  G FSYCL         ++   ++ FG
Sbjct  252  CGHDNEGLFVGAAGLLGLGRGGLSFPSQTKSRYNGKFSYCLVDRTSSGSSSKPPSTIVFG  311

Query  432  REIIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIG  256
             + +P  +V+ PLL + +  T YY+ L G+ VG  ++  +SE  F+L   G+GGVI+D G
Sbjct  312  DDAVPKTSVFTPLLTNPKLDTFYYLQLLGISVGGSRVRGVSESQFKLDATGSGGVIIDSG  371

Query  255  TSVTRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQI  76
            TSVTRL + AY  LR  +     ++ RAP +S  DTC+DL+G+ TV+VPT+ F F GG++
Sbjct  372  TSVTRLTQPAYVALRDAFRLGATSLKRAPPYSLFDTCFDLSGMKTVKVPTVVFHFGGGEV  431

Query  75   WTLAAKNILIPVNKRGIFCFAFA  7
             +L A N LIPVN +G FCFAFA
Sbjct  432  -SLPASNYLIPVNTQGRFCFAFA  453



>ref|XP_010036867.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1-like [Eucalyptus grandis]
Length=496

 Score =   251 bits (640),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 133/316 (42%), Positives = 193/316 (61%), Gaps = 5/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTP +  Y+ +DTGS++ W+QCQPC  C+ Q DPVF P+ SSS+ 
Sbjct  151  GTSQGSGEYFSRIGVGTPAKQFYMVLDTGSDVNWLQCQPCTDCYQQTDPVFTPSSSSSYT  210

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + C S  C  + +  C  G+C Y + Y DGS+ +G  V ET++FG +  V +V +GC  
Sbjct  211  ALTCESPQCGSLEVSACRTGKCLYQVSYGDGSFTVGDFVTETVSFGDSGAVNNVALGCGH  270

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  G+ GLLGL GG ++   Q+   +   FSYCL    +  S +L+F        +
Sbjct  271  DNEGLFMGSAGLLGLGGGPLSLTKQVKASS---FSYCLVDRDSSKSSTLDFNSAAPGAES  327

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V+ PL+++ +  T YY+GL+G+ VG   + I   +F++ E G+GG+I+D GT++TRL   
Sbjct  328  VFAPLVKNGKVDTFYYVGLTGMSVGGKTVSIPPSLFQMDESGDGGIIVDSGTAITRLQTQ  387

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY +LR  ++     +      +  DTCYD + L +VQVPT+SF FTGG+   L AKN L
Sbjct  388  AYNSLRDAFVKLTPDLKSTSGVALFDTCYDFSSLSSVQVPTVSFQFTGGRSLALPAKNYL  447

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+  G FCFAFAP+
Sbjct  448  IPVDSAGTFCFAFAPT  463



>ref|XP_009346910.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score =   250 bits (639),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 136/316 (43%), Positives = 193/316 (61%), Gaps = 6/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTP +  Y+  DTGS++ W+QC PC  C+ Q DPVF+P  SSS++
Sbjct  143  GVSQGSGEYFSRIGVGTPAKSFYMVPDTGSDVNWLQCDPCSDCYQQSDPVFNPAGSSSYS  202

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + C +  C  + +  C   +C Y + Y DGSY +G  V ET++FG +  +  + +GC  
Sbjct  203  QLTCDAPQCQALEVSACRANKCLYQVSYGDGSYTVGDYVTETLSFGNSGSINKIALGCGH  262

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  GA GLLGL GG ++  +Q    +   FSYCL +  + +S +LEF     P  +
Sbjct  263  DNEGLFVGAAGLLGLGGGPLSLTSQFKASS---FSYCLVNRDSSASSTLEFN-SAPPADS  318

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V  PLL+S +  T YY+GL+G  VG   + +   +F + E GNGG+I+D GT++TRL   
Sbjct  319  VTAPLLQSGKVSTFYYVGLTGFSVGGQPVSVPPSLFAVDESGNGGIIVDSGTAITRLQTQ  378

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY +LR  +      +P A SF+  DTCYDL+    VQVPT++F F+GG+  +L AKN L
Sbjct  379  AYNSLRDAFKRYTRDLPTASSFALFDTCYDLSSRTRVQVPTVAFQFSGGKSLSLPAKNYL  438

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+  G FCFAFAP+
Sbjct  439  IPVDSAGTFCFAFAPT  454



>ref|XP_010926497.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1 [Elaeis guineensis]
Length=508

 Score =   251 bits (640),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 140/321 (44%), Positives = 189/321 (59%), Gaps = 10/321 (3%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G P +  Y+ +DTGS++ WVQCQPC  C+ Q DPVF+P+ SSS++
Sbjct  158  GTSQGSGEYFSRVGIGKPAKPLYMVLDTGSDVTWVQCQPCTDCYQQSDPVFEPSASSSYS  217

Query  762  IVPCSSTICNRIHLGCTRGR------CSYGIVYIDGSYNMGTMVQETITFGGTV-VRDVT  604
             +PC S  C+ + +   R        C Y + Y DGSY +G    ET+T G +  V  V 
Sbjct  218  PLPCDSPRCHDLDISACRNSSAGGSSCLYQVSYGDGSYTIGDFATETVTLGDSAPVSGVA  277

Query  603  MGCSQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREI  424
            +GC   N+G+  GA GLL L GG ++F +QI  +T   FSYCL    + +S +LE G   
Sbjct  278  IGCGHDNEGLFVGAAGLLALGGGPLSFPSQISART---FSYCLVDRDSPASSTLELGGGS  334

Query  423  IPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVT  244
                AV  P+LR+ +  T YY+GLSG+ VG   L I    F + E G+GGVI+D GT+VT
Sbjct  335  ASTAAVAAPMLRNRKLDTFYYVGLSGISVGGAMLSIPPSAFAMDESGSGGVIVDSGTAVT  394

Query  243  RLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLA  64
            RL   AYE LR  +    A +P A   S  DTCYDL+   +V VPT++F F  G+   L 
Sbjct  395  RLQAEAYEALRDAFRRGTAGLPAAAGVSLFDTCYDLSSRTSVDVPTVAFHFPEGRELRLP  454

Query  63   AKNILIPVNKRGIFCFAFAPS  1
            AKN LIPV+  G +C AFAP+
Sbjct  455  AKNYLIPVDGVGTYCLAFAPT  475



>ref|XP_009145889.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=492

 Score =   250 bits (639),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 135/318 (42%), Positives = 194/318 (61%), Gaps = 7/318 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTP +  Y+ +DTGS++ W+QC+PC  C+ Q DP+FDP+ SS++ 
Sbjct  145  GASQGSGEYFSRLGVGTPAKEMYMVLDTGSDINWIQCKPCSSCYQQSDPIFDPSSSSTYK  204

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + CS+  C  +    C   +C Y + Y DGS+ +G    +T+TFG +  V +V +GC +
Sbjct  205  SLTCSAPQCASLRASACRSDKCLYQVRYGDGSFTVGEYATDTVTFGSSGKVDNVALGCGR  264

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+ TGA GLLGL GG+++  +QI  ++   FSYCL    +  S SL+F    +  G 
Sbjct  265  DNEGLFTGAAGLLGLGGGALSMTSQIKAKS---FSYCLVDRDSGKSSSLDFNSVQVGAGD  321

Query  408  VWVPLLRSIRAPTTYYIGLSGLGV-GNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPK  232
               P+LR+ +  T YY+G +G  V G  ++ I    F +   G GGVI+D GT+VTRL  
Sbjct  322  ATAPILRNSKIDTFYYVGFTGFSVGGQQQVSIPSSAFAVDASGTGGVILDCGTAVTRLQT  381

Query  231  VAYETLRYIYMTQIATIPR-APSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
             AY +LR  ++   A + R   S S  DTCYD + L TV+VPT++F FTGG+   L AKN
Sbjct  382  QAYNSLRDAFVKLTANLKRGTSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKTLNLPAKN  441

Query  54   ILIPVNKRGIFCFAFAPS  1
             LIP++  G FCFAFAP+
Sbjct  442  YLIPIDDAGTFCFAFAPT  459



>ref|XP_004157423.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
Length=491

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 138/316 (44%), Positives = 195/316 (62%), Gaps = 6/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVG P +  Y+ +DTGS++ W+QCQPC  C+ Q DP+FDP  SSSFA
Sbjct  147  GTSQGSGEYFSRVGVGQPAKPFYMVLDTGSDINWLQCQPCTDCYQQTDPIFDPRSSSSFA  206

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             +PC S  C  +   GC   +C Y + Y DGS+ +G  V ET+TFG + ++ DV +GC  
Sbjct  207  SLPCESQQCQALETSGCRASKCLYQVSYGDGSFTVGEFVTETLTFGNSGMINDVAVGCGH  266

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  G+ GLLGL GG ++  +Q+   +   FSYCL    + SS  LEF     P  +
Sbjct  267  DNEGLFVGSAGLLGLGGGPLSLTSQMKASS---FSYCLVDRDSSSSSDLEFN-SAAPSDS  322

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V  PLL+S +  T YY+GL+G+ VG   L I  ++F++ + G GG+I+D GT++TRL   
Sbjct  323  VNAPLLKSGKVDTFYYVGLTGMSVGGQLLSIPPNLFQMDDSGYGGIIVDSGTAITRLQTQ  382

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY TLR  ++++   + +   F+  DTCYDL+    V +PT+SF F GG+   L  KN L
Sbjct  383  AYNTLRDAFVSRTPYLKKTNGFALFDTCYDLSSQSRVTIPTVSFEFAGGKSLQLPPKNYL  442

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+  G FCFAFAP+
Sbjct  443  IPVDSVGTFCFAFAPT  458



>ref|XP_008374731.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Malus domestica]
Length=487

 Score =   249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 133/316 (42%), Positives = 195/316 (62%), Gaps = 6/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTP +  Y+ +DTGS++ W+QC PC  C+ Q DPVF P  SS+++
Sbjct  143  GVSQGSGEYFSRIGVGTPAKSFYMVLDTGSDVNWLQCNPCSDCYQQSDPVFSPAGSSTYS  202

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + C +  C  +H+  C   +C Y + Y DGSY +G  V ET++FG +  +  + +GC  
Sbjct  203  QLTCDAPQCQALHVSACRANKCLYQVSYGDGSYTVGNYVTETLSFGNSGSINKIALGCGH  262

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  GA GLLGL GG ++  +Q    +   FSYCL +  + +S +LEF     P  +
Sbjct  263  DNEGLFVGAAGLLGLGGGPLSLTSQFKASS---FSYCLVNRDSSASSTLEFN-SAPPADS  318

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V  PL+++ +  T YY+GL+G  VG   + +   +F + + GNGG+I+D GT++TRL   
Sbjct  319  VTAPLVQNGKVDTFYYVGLTGFSVGGQPVSVPPSLFAVDQSGNGGIIVDSGTAITRLQTQ  378

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY +LR  +    + +P A SF+  DTCYDL+    VQVPT++F F+GG+  +L AKN L
Sbjct  379  AYNSLRDAFKRFTSDLPTASSFALFDTCYDLSSRTRVQVPTVAFQFSGGKSLSLPAKNYL  438

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+  G FCFAFAP+
Sbjct  439  IPVDSAGTFCFAFAPT  454



>emb|CDY24395.1| BnaCnng04620D [Brassica napus]
Length=482

 Score =   249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 134/315 (43%), Positives = 190/315 (60%), Gaps = 5/315 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G+P +  Y+ +DTGS++ W+QC PC  C+ Q +P+F+PT SSS+A
Sbjct  139  GTTQGSGEYFTRVGIGSPAREVYMVLDTGSDVNWLQCAPCAQCYHQTEPIFEPTSSSSYA  198

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             + C +  C  +    C    C Y + Y DGSY  G    ET T G   V +V +GC  +
Sbjct  199  TLSCDAPQCKALEASECRNATCLYEVSYGDGSYTAGDFATETFTIGSASVDNVAVGCGHS  258

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            NQG+  GA GLLGL GG +   +Q+   +   FSYCL    ++SS ++EFG +I P  AV
Sbjct  259  NQGLFVGAAGLLGLGGGLLALPSQLNTTS---FSYCLVDRDSDSSSTVEFGSDI-PSDAV  314

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
              PL+R+ +  T YY+GL+G+ VG   L I    F + E G GGVI+D GT+VTRL    
Sbjct  315  VAPLMRNHQLDTFYYLGLAGISVGGEMLEIPASSFEMDESGGGGVIIDSGTAVTRLQTGV  374

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y++LR  ++     + RA   +  DTCYDL+G  T++VP+++F F GG +  L AKN +I
Sbjct  375  YDSLRDAFVKGTTDLERAAGVAMFDTCYDLSGKTTIEVPSVAFHFPGGNMLALPAKNYMI  434

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FC AFAP+
Sbjct  435  PVDTVGTFCLAFAPT  449



>ref|XP_009336767.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=485

 Score =   249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 139/316 (44%), Positives = 191/316 (60%), Gaps = 5/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTPP+Y Y+ +DTGS+++W+QC PC+ C+ Q DP+FDP +S SFA
Sbjct  135  GLSQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWLQCAPCRRCYKQSDPIFDPRKSRSFA  194

Query  762  IVPCSSTICNRIHL-GC-TRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             +PC S +C ++    C ++  C Y + Y DGS+  G    ET+TF GT V  V +GC  
Sbjct  195  TIPCGSPLCRKLDSPSCNSKKTCLYQVSYGDGSFTFGEFSTETLTFRGTKVGRVAIGCGH  254

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPVG  412
             N+G+  GA GLLGL  G ++F A    +    FSYCL    A S   S+ FG   +   
Sbjct  255  DNEGLFVGAAGLLGLGRGKLSFPALTGSRFNRKFSYCLVDRSASSKPSSVVFGDSAVSRT  314

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLP  235
            A + PLL + +  T YY+ L G+ VG  ++P I+  +F+L + GNGGVI+D GTSVTRL 
Sbjct  315  ARFTPLLANPKLDTFYYVELIGISVGGTRVPGITASLFKLDQAGNGGVILDSGTSVTRLT  374

Query  234  KVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
            + AY  LR  +    + + R P FS  DTC+DL+G   V+VPT+   F    + +L A N
Sbjct  375  RPAYNALRDAFRAGTSGLKRGPQFSLFDTCFDLSGRTEVKVPTVVLHFRNADV-SLPATN  433

Query  54   ILIPVNKRGIFCFAFA  7
             LIPV+  G FCFAFA
Sbjct  434  YLIPVDSSGSFCFAFA  449



>emb|CDY25081.1| BnaC06g18230D [Brassica napus]
Length=485

 Score =   249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 140/324 (43%), Positives = 198/324 (61%), Gaps = 13/324 (4%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY +R+GVGTP    Y+ +DTGS+++W+QC PCK C+ Q DP+F+P +S++FA
Sbjct  128  GLSQGSGEYFMRLGVGTPATNVYMVLDTGSDVVWLQCSPCKVCYNQSDPMFNPAKSTTFA  187

Query  762  IVPCSSTICNRIHLGCT----RGR--CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTM  601
             VPC S++C R+    +    RG   C Y + Y DGS+ MG    ET+TF G  V  V +
Sbjct  188  TVPCGSSLCRRLDESSSECVNRGSKTCLYQVSYGDGSFTMGDFSTETLTFHGARVDHVAL  247

Query  600  GCSQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGS-----LEF  436
            GC   N+G+  GA GLLGL  G ++F +Q   +    FSYC     +  S S     + F
Sbjct  248  GCGHDNEGLFVGAAGLLGLGRGGLSFPSQTKNRYNAKFSYCFVDRTSSGSASKPPSTIVF  307

Query  435  GREIIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDI  259
            G + +   +V+  LL + +  T YY+ L G+ VG  ++  +SE  F+L   G+GGVI+D 
Sbjct  308  GNDAVRETSVFTTLLTNPKLDTFYYLQLLGISVGGSRVRGVSESQFKLDPTGDGGVIIDS  367

Query  258  GTSVTRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQ  79
            GTSVTRL + AY   R  ++     + RAPS+S  DTC+DL+G+ TV+VPT+ F F+GG 
Sbjct  368  GTSVTRLTRPAYVAFRDAFLLGATRLKRAPSYSLFDTCFDLSGMTTVKVPTVVFHFSGGD  427

Query  78   IWTLAAKNILIPVNKRGIFCFAFA  7
            + +L A N LIPVN +G FCFAFA
Sbjct  428  V-SLPASNYLIPVNTQGRFCFAFA  450



>ref|XP_010044282.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1 [Eucalyptus grandis]
Length=495

 Score =   249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 136/315 (43%), Positives = 192/315 (61%), Gaps = 5/315 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVG PP   Y+ +DTGS++ WVQC PC  C+ Q DP+F+P  S+SF+
Sbjct  152  GTSQGSGEYFSRLGVGDPPSQVYMVVDTGSDVNWVQCAPCADCYQQADPIFEPASSASFS  211

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             + C +  C  + +  C  G C Y + Y DGSY +G  V E+IT G T +RDV +GC   
Sbjct  212  PLSCDTRQCRSLDVSECRNGSCLYEVSYGDGSYTVGDFVTESITLGSTRLRDVAIGCGHN  271

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+G+  GA GLLGL GGS++F +Q+   +   FSYCL    ++S+ +LEFG  + P  AV
Sbjct  272  NEGLFVGAAGLLGLGGGSLSFPSQLNASS---FSYCLVDRDSDSASTLEFGSPL-PPNAV  327

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
              PL+R+ +  T  Y+GL+G+ VG   L + E  F+L   G GG+I+D GT+VTRL    
Sbjct  328  AAPLIRNPQLDTFLYLGLTGISVGGDPLRLPEGAFQLDPHGGGGIIVDSGTAVTRLRAEV  387

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y  +R  +      +P A  F+  DTCYDL+  G+V+VPT+   F  G+   +A +N +I
Sbjct  388  YGAMRDAFARGTRGLPAAEGFALFDTCYDLSSKGSVEVPTVGLRFGDGRXVGVAGQNYMI  447

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAP+
Sbjct  448  PVHSNGTFCFAFAPT  462



>ref|XP_006418409.1| hypothetical protein EUTSA_v10009389mg [Eutrema salsugineum]
 gb|ESQ36762.1| hypothetical protein EUTSA_v10009389mg [Eutrema salsugineum]
Length=486

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 143/321 (45%), Positives = 197/321 (61%), Gaps = 14/321 (4%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTP +Y Y+ +DTGS+++W+QC PC+ C+ Q DP+FDP +S +++
Sbjct  135  GLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRKCYSQSDPIFDPRKSRTYS  194

Query  762  IVPCSSTICNRIH-LGC-TRGR-CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCS  592
             +PCSS +C R+   GC TR R C Y + Y DGS+ +G    ET+TF    V+ V +GC 
Sbjct  195  TIPCSSPLCRRLDSAGCNTRRRTCLYQVSYGDGSFTVGDFSTETLTFRRNRVKGVALGCG  254

Query  591  QTNQGMVTgaggllglagGSMTFMAQIPGQTGG----VFSYCLASWHAESS-GSLEFGRE  427
              N+G+  GA GLLGL  G ++F    PGQTG      FSYCL    A S   S+ FG  
Sbjct  255  HDNEGLFVGAAGLLGLGKGRLSF----PGQTGHRFNQKFSYCLVDRSASSKPSSVVFGNA  310

Query  426  IIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTS  250
             +   A + PLL + +  T YY+ L G+ VG  ++P ++  +F+L + GNGGVI+D GTS
Sbjct  311  AVSRTARFTPLLSNPKLDTFYYVELLGISVGGTRVPGVTASLFKLDQIGNGGVIIDSGTS  370

Query  249  VTRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWT  70
            VTRL + AY  +R  +     T+ RAP FS  DTC+DL+    V+VPT+   F G  + +
Sbjct  371  VTRLIRPAYIAMRDAFRVGAKTLKRAPDFSLFDTCFDLSNQNEVKVPTVVLHFRGADV-S  429

Query  69   LAAKNILIPVNKRGIFCFAFA  7
            L A N LIPV+  G FCFAFA
Sbjct  430  LPATNYLIPVDSNGKFCFAFA  450



>gb|AAM66061.1| chloroplast nucleoid DNA binding protein, putative [Arabidopsis 
thaliana]
Length=485

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 142/321 (44%), Positives = 196/321 (61%), Gaps = 14/321 (4%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTP +Y Y+ +DTGS+++W+QC PC+ C+ Q DP+FDP +S ++A
Sbjct  134  GLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPIFDPRKSKTYA  193

Query  762  IVPCSSTICNRIH-LGCT--RGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCS  592
             +PCSS  C R+   GC   R  C Y + Y DGS+ +G    ET+TF    V+ V +GC 
Sbjct  194  TIPCSSPHCRRLDSAGCNTRRKTCLYQVSYGDGSFTVGDFSTETLTFRRNRVKGVALGCG  253

Query  591  QTNQGMVTgaggllglagGSMTFMAQIPGQTGG----VFSYCLASWHAESS-GSLEFGRE  427
              N+G+  GA GLLGL  G ++F    PGQTG      FSYCL    A S   S+ FG  
Sbjct  254  HDNEGLFVGAAGLLGLGKGKLSF----PGQTGHRFNQKFSYCLVDRSASSKPSSVVFGNA  309

Query  426  IIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTS  250
             +   A + PLL + +  T YY+GL G+ VG  ++P ++  +F+L + GNGGVI+D GTS
Sbjct  310  AVSRIARFTPLLSNPKLDTFYYVGLLGISVGGTRVPGVTASLFKLDQIGNGGVIIDSGTS  369

Query  249  VTRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWT  70
            VTRL + AY  +R  +     T+ RAP+FS  DTC+DL+ +  V+VPT+   F    + +
Sbjct  370  VTRLIRPAYIAMRDAFRVGAKTLKRAPNFSLFDTCFDLSNMNEVKVPTVVLHFRRADV-S  428

Query  69   LAAKNILIPVNKRGIFCFAFA  7
            L A N LIPV+  G FCFAFA
Sbjct  429  LPATNYLIPVDTNGKFCFAFA  449



>ref|XP_010556596.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Tarenaya 
hassleriana]
Length=467

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 142/317 (45%), Positives = 196/317 (62%), Gaps = 6/317 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTP +Y Y+ +DTGS+++W+QC PC+ C+ Q DP+F P +S ++A
Sbjct  116  GLSQGSGEYFTRIGVGTPARYLYMVLDTGSDIVWLQCAPCRRCYSQSDPIFVPAKSKTYA  175

Query  762  IVPCSSTICNRIHL-GC-TRGR-CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCS  592
             + CSS +C R+   GC TR R C Y + Y DGS+ +G +  ET+TF  + V  V +GC 
Sbjct  176  GISCSSPLCRRLDSPGCNTRRRTCLYQVTYGDGSFTVGDLSTETLTFRRSHVNGVAIGCG  235

Query  591  QTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPV  415
              N+G+  GA GLLGL  G ++F AQ   +  G FSYCL    A S   S+ FG   +  
Sbjct  236  HDNEGLFVGAAGLLGLGRGRLSFPAQTSRRFNGKFSYCLVDRSATSKPSSIVFGDASVSR  295

Query  414  GAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRL  238
             A + P+L + +  T YY+ L G+ VG  ++P +S  +F+L + GNGGVI+D GTSVTRL
Sbjct  296  TARFTPMLLNPKLDTFYYVELLGISVGGTRVPGVSASLFKLAQTGNGGVILDSGTSVTRL  355

Query  237  PKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAK  58
             + AY  +R  +      + RA SFS  DTC+DL+GL  V+VPT+   F G  + +L A 
Sbjct  356  TRPAYIAMRDAFRVGAKNLKRATSFSLFDTCFDLSGLTEVKVPTVVLHFRGADV-SLPAT  414

Query  57   NILIPVNKRGIFCFAFA  7
            N LIPV+  G FCFAFA
Sbjct  415  NYLIPVDTNGKFCFAFA  431



>ref|XP_009337150.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 136/316 (43%), Positives = 193/316 (61%), Gaps = 6/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTP +  Y+ +DTGS++ W+QC PC  C+ Q DPVF+P  SS+++
Sbjct  143  GVSQGSGEYFSRIGVGTPAKSFYMVLDTGSDVNWLQCGPCSDCYQQSDPVFNPAGSSTYS  202

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + C +  C  + +  C   +C Y + Y DGSY +G  V ET++FG +  +  + +GC  
Sbjct  203  QLTCDAPQCQALQVSACRANKCLYQVSYGDGSYTIGDYVTETLSFGNSGSINKIALGCGH  262

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  GA GLLGL GG ++  +Q    T   FSYCL +  + +S +LEF     P  +
Sbjct  263  DNEGLFVGAAGLLGLGGGPLSLTSQFKATT---FSYCLVNRDSSASSTLEFN-SAPPADS  318

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V  PL++S +  T YY+GL+G  VG   + +S  +F +   GNGG+I+D GT++TRL   
Sbjct  319  VTAPLVKSGKVGTFYYVGLTGFSVGGQPVSVSPSLFAVDNSGNGGIIVDSGTAITRLQTQ  378

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY  LR  +      +P A SFS  DTCY+L+    VQVPT+SF F+GG+  +L AKN L
Sbjct  379  AYNALRDAFKRLTRDLPTASSFSLFDTCYNLSSRTKVQVPTVSFQFSGGKSLSLPAKNYL  438

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+  G FCFAFAP+
Sbjct  439  IPVDSAGTFCFAFAPT  454



>ref|XP_004248083.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Solanum 
lycopersicum]
Length=458

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 136/316 (43%), Positives = 191/316 (60%), Gaps = 5/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIG+GTP +Y YL +DTGS+++W+QC PC  C+ Q DPVFDP++SSSF+
Sbjct  107  GLSQGSGEYFTRIGIGTPVKYVYLVLDTGSDIVWIQCLPCSKCYSQSDPVFDPSKSSSFS  166

Query  762  IVPCSSTICNRIH-LGC-TRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             V C S +C R+   GC  R +C Y + Y DGS+ +G    ET+ F  T V +++ GC  
Sbjct  167  TVTCDSPLCRRLDSSGCNNRNKCLYQVSYGDGSFTVGEYSTETLNFRKTSVSNISFGCGH  226

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGS-LEFGREIIPVG  412
             N+G+  GA GLLGL  G ++F  Q   + G  FSYCL      +  S + FG   +   
Sbjct  227  DNEGLFIGAAGLLGLGKGKLSFPGQAGNRFGQKFSYCLVDRIGSAKPSYIVFGESAVTRN  286

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLP  235
             ++ PLL + +  T YY+ L+G+ VG  K+P ++ ++F+L  +GNGGVI+D GTSVTRL 
Sbjct  287  TIFTPLLTNPKLDTFYYVELTGISVGGTKVPAVTPELFKLDAEGNGGVIVDSGTSVTRLT  346

Query  234  KVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
            +  Y  +R  +      + RAP+FS  DTCYDL+G    +VPT+   F G  +  L A N
Sbjct  347  RPGYIAVRDAFRLGAKDLKRAPNFSLFDTCYDLSGKKQAKVPTMVLHFAGADV-ALPAAN  405

Query  54   ILIPVNKRGIFCFAFA  7
             +IPVN  G +CF FA
Sbjct  406  YMIPVNTEGRYCFGFA  421



>ref|NP_001041979.1| Os01g0140100 [Oryza sativa Japonica Group]
 dbj|BAB21205.1| putative aspartic proteinase nepenthesin I [Oryza sativa Japonica 
Group]
 dbj|BAF03893.1| Os01g0140100 [Oryza sativa Japonica Group]
 gb|EAZ10476.1| hypothetical protein OsJ_00309 [Oryza sativa Japonica Group]
 dbj|BAG91200.1| unnamed protein product [Oryza sativa Japonica Group]
Length=504

 Score =   249 bits (636),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 143/318 (45%), Positives = 186/318 (58%), Gaps = 9/318 (3%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G  LG  EY  R+GVG+P +  Y+ +DTGS++ WVQCQPC  C+ Q DPVFDP+ S+S+A
Sbjct  159  GVGLGSGEYFSRVGVGSPARQLYMVLDTGSDVTWVQCQPCADCYQQSDPVFDPSLSTSYA  218

Query  762  IVPCSSTICNRIHLGCTR---GRCSYGIVYIDGSYNMGTMVQETITFGGTV-VRDVTMGC  595
             V C +  C+ +     R   G C Y + Y DGSY +G    ET+T G +  V  V +GC
Sbjct  219  SVACDNPRCHDLDAAACRNSTGACLYEVAYGDGSYTVGDFATETLTLGDSAPVSSVAIGC  278

Query  594  SQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPV  415
               N+G+  GA GLL L GG ++F +QI   T   FSYCL    + SS +L+FG      
Sbjct  279  GHDNEGLFVGAAGLLALGGGPLSFPSQISATT---FSYCLVDRDSPSSSTLQFGDAAD--  333

Query  414  GAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLP  235
              V  PL+RS R  T YY+GLSGL VG   L I    F +   G GGVI+D GT+VTRL 
Sbjct  334  AEVTAPLIRSPRTSTFYYVGLSGLSVGGQILSIPPSAFAMDSTGAGGVIVDSGTAVTRLQ  393

Query  234  KVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
              AY  LR  ++    ++PR    S  DTCYDL+   +V+VP +S  F GG    L AKN
Sbjct  394  SSAYAALRDAFVRGTQSLPRTSGVSLFDTCYDLSDRTSVEVPAVSLRFAGGGELRLPAKN  453

Query  54   ILIPVNKRGIFCFAFAPS  1
             LIPV+  G +C AFAP+
Sbjct  454  YLIPVDGAGTYCLAFAPT  471



>ref|XP_010457141.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=485

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 141/321 (44%), Positives = 195/321 (61%), Gaps = 14/321 (4%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTP +Y Y+ +DTGS+++W+QC PC+ C+ Q DP+FDP +S +++
Sbjct  134  GLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPIFDPRKSRTYS  193

Query  762  IVPCSSTICNRIH-LGCT--RGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCS  592
             +PCSS  C R+   GC   R  C Y + Y DGS+ +G    ET+TF    V+ V +GC 
Sbjct  194  TIPCSSPHCRRLDSAGCNTRRKTCLYQVSYGDGSFTVGDFSTETLTFRRNRVKGVALGCG  253

Query  591  QTNQGMVTgaggllglagGSMTFMAQIPGQTGG----VFSYCLASWHAESS-GSLEFGRE  427
              N+G+  GA GLLGL  G ++F    PGQTG      FSYCL    A S   S+ FG  
Sbjct  254  HENEGLFVGAAGLLGLGKGKLSF----PGQTGHRFNQKFSYCLVDRSASSKPSSVVFGNA  309

Query  426  IIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTS  250
             +   A + PLL + +  T YY+ L G+ VG  ++P ++  +F+L + GNGGVI+D GTS
Sbjct  310  AVSRTARFTPLLSNPKLDTFYYVELLGISVGGTRVPGVAASLFKLDQIGNGGVIIDSGTS  369

Query  249  VTRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWT  70
            VTRL + AY  +R  +     T+ RAP FS  DTC+DL+ +  V+VPT+   F G  + +
Sbjct  370  VTRLIRPAYIAMRDAFRVGARTLKRAPDFSLFDTCFDLSNMNEVKVPTVVLHFRGADV-S  428

Query  69   LAAKNILIPVNKRGIFCFAFA  7
            L A N LIPV+  G FCFAFA
Sbjct  429  LPATNYLIPVDTNGKFCFAFA  449



>ref|XP_010474721.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=484

 Score =   248 bits (634),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 141/321 (44%), Positives = 195/321 (61%), Gaps = 14/321 (4%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTP +Y Y+ +DTGS+++W+QC PC+ C+ Q DP+FDP +S +++
Sbjct  133  GLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPIFDPRKSRTYS  192

Query  762  IVPCSSTICNRIH-LGCT--RGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCS  592
             +PCSS  C R+   GC   R  C Y + Y DGS+ +G    ET+TF    V+ V +GC 
Sbjct  193  TIPCSSPHCRRLDSAGCNTRRKTCLYQVSYGDGSFTVGDFSTETLTFRRNRVKGVALGCG  252

Query  591  QTNQGMVTgaggllglagGSMTFMAQIPGQTGG----VFSYCLASWHAESS-GSLEFGRE  427
              N+G+  GA GLLGL  G ++F    PGQTG      FSYCL    A S   S+ FG  
Sbjct  253  HDNEGLFVGAAGLLGLGKGKLSF----PGQTGHRFNQKFSYCLVDRSASSKPSSVVFGNA  308

Query  426  IIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTS  250
             +   A + PLL + +  T YY+ L G+ VG  ++P ++  +F+L + GNGGVI+D GTS
Sbjct  309  AVSRTARFTPLLSNPKLDTFYYVELLGISVGGTRVPGVAASLFKLDQIGNGGVIIDSGTS  368

Query  249  VTRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWT  70
            VTRL + AY  +R  +     T+ RAP FS  DTC+DL+ +  V+VPT+   F G  + +
Sbjct  369  VTRLIRPAYIAMRDAFRVGARTLKRAPDFSLFDTCFDLSNMNEVKVPTVVLHFRGADV-S  427

Query  69   LAAKNILIPVNKRGIFCFAFA  7
            L A N LIPV+  G FCFAFA
Sbjct  428  LPATNYLIPVDTNGKFCFAFA  448



>gb|KEH24641.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=485

 Score =   248 bits (634),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 142/317 (45%), Positives = 194/317 (61%), Gaps = 6/317 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTP +Y ++ +DTGS+++W+QC PC+ C+ Q DPVFDPT+S S+A
Sbjct  134  GLSQGSGEYFTRIGVGTPARYVFMVLDTGSDVVWLQCAPCRKCYSQADPVFDPTKSRSYA  193

Query  762  IVPCSSTICNRIH-LGC-TRGR-CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCS  592
             +PC + +C R+   GC T+ + C Y + Y DGS+  G    ET+TF  T V  V +GC 
Sbjct  194  GIPCGAPLCRRLDTAGCNTKTKVCQYQVSYGDGSFTFGDFSTETLTFRKTRVARVALGCG  253

Query  591  QTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPV  415
              N+G+  GA GLLGL  G ++F  Q   +    FSYCL    A S   S+ FG   +  
Sbjct  254  HDNEGLFVGAAGLLGLGRGRLSFPVQTGRRFNQKFSYCLVDRSATSKPSSVVFGDSAVSR  313

Query  414  GAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRL  238
             A + PLL++ +  T YY+GL G+ VG   +  +S  +F+L   GNGGVI+D GTSVTRL
Sbjct  314  TARFTPLLKNPKLDTFYYVGLLGISVGGAPVRGVSASLFKLDTAGNGGVIIDSGTSVTRL  373

Query  237  PKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAK  58
             + AY  LR  +      + +AP FS  DTC+DL+GL  V+VPT+   F G  + +L A+
Sbjct  374  TRPAYIALRDAFRLGATHLKKAPEFSLFDTCFDLSGLTEVKVPTLVLHFQGADV-SLPAQ  432

Query  57   NILIPVNKRGIFCFAFA  7
            N LIPV+  G FCFAFA
Sbjct  433  NYLIPVDNSGSFCFAFA  449



>ref|XP_009800603.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Nicotiana 
sylvestris]
Length=488

 Score =   248 bits (633),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 135/316 (43%), Positives = 192/316 (61%), Gaps = 6/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIG+G P    Y+ +DTGS++ W+QC PC  C+ Q DP+F+P  SS+F+
Sbjct  144  GTSQGSGEYFSRIGIGHPQSQVYMVLDTGSDVNWIQCAPCADCYQQADPIFEPASSSTFS  203

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTV-VRDVTMGCSQ  589
             + C +  C  + +  C    C Y + Y DGSY +G  V E +TFGG+  V +V +GC  
Sbjct  204  PLTCETQQCKSLDVSECRNDTCLYEVSYGDGSYTVGDFVTERVTFGGSASVENVAIGCGH  263

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  GA GLLGL GG+++F +QI   +   FSYCL    ++S+ +LEFG  I P  A
Sbjct  264  NNEGLFVGAAGLLGLGGGALSFPSQINASS---FSYCLVDRDSDSTSTLEFGGVISP-DA  319

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            +  PL+R+ +  T YY+ L+GL V    L +    F+++  G+GGVI+D GT+VTRL   
Sbjct  320  ITAPLIRNSKLDTFYYLDLTGLSVAGNLLSVPPSAFKVSNNGDGGVIIDSGTAVTRLQTD  379

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
             Y TLR  ++     +P     +  DTCYDL  + +V+VPT+SF F+ G+   L AKN L
Sbjct  380  VYNTLRDEFVKGTRHLPSTNGVALFDTCYDLKSMKSVEVPTVSFHFSNGKELPLPAKNYL  439

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+  G FCFAFAP+
Sbjct  440  IPVDSSGTFCFAFAPT  455



>ref|XP_006307379.1| hypothetical protein CARUB_v10009005mg [Capsella rubella]
 gb|EOA40277.1| hypothetical protein CARUB_v10009005mg [Capsella rubella]
Length=481

 Score =   248 bits (632),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 141/321 (44%), Positives = 195/321 (61%), Gaps = 14/321 (4%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTP +Y Y+ +DTGS+++W+QC PC+ C+ Q DP+FDP +S +++
Sbjct  130  GLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPIFDPRKSRTYS  189

Query  762  IVPCSSTICNRIH-LGCT--RGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCS  592
             +PCSS  C R+   GC   R  C Y + Y DGS+ +G    ET+TF    V+ V +GC 
Sbjct  190  TIPCSSPQCRRLDSAGCNTRRKTCLYQVSYGDGSFTVGDFSTETLTFRRNRVKGVALGCG  249

Query  591  QTNQGMVTgaggllglagGSMTFMAQIPGQTGG----VFSYCLASWHAESS-GSLEFGRE  427
              N+G+  GA GLLGL  G ++F    PGQTG      FSYCL    A S   S+ FG  
Sbjct  250  HDNEGLFVGAAGLLGLGKGKLSF----PGQTGHRFNQKFSYCLVDRSASSKPSSVVFGNA  305

Query  426  IIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTS  250
             +   A + PLL + +  T YY+ L G+ VG  ++P ++  +F+L + GNGGVI+D GTS
Sbjct  306  AVSRTARFTPLLSNPKLDTFYYVELLGISVGGTRVPGVTASLFKLDQIGNGGVIIDSGTS  365

Query  249  VTRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWT  70
            VTRL + AY  +R  +     T+ RAP FS  DTC+DL+ +  V+VPT+   F G  + +
Sbjct  366  VTRLIRPAYIAMRDAFRVGARTLKRAPDFSLFDTCFDLSNMNEVKVPTVVLHFRGADV-S  424

Query  69   LAAKNILIPVNKRGIFCFAFA  7
            L A N LIPV+  G FCFAFA
Sbjct  425  LPATNYLIPVDTNGKFCFAFA  445



>ref|XP_002961719.1| hypothetical protein SELMODRAFT_64161, partial [Selaginella moellendorffii]
 gb|EFJ36979.1| hypothetical protein SELMODRAFT_64161, partial [Selaginella moellendorffii]
Length=357

 Score =   244 bits (623),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 138/321 (43%), Positives = 185/321 (58%), Gaps = 7/321 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G  LG  EY  R+G+G P +  YLE+DTGS++ W+QC PC  C+ Q DP++DP+ SSS+ 
Sbjct  4    GLSLGSGEYFARMGIGNPQRSYYLELDTGSDVTWIQCAPCSSCYSQVDPIYDPSNSSSYR  63

Query  762  IVPCSSTICNRIHLGCTRGR-CSYGIVYIDGSYNMGTMVQETITFG---GTVVRDVTMGC  595
             V C S +C  +     +G  CSY +VY D S + G +  E+   G    T +R++  GC
Sbjct  64   RVYCGSALCQALDYSACQGMGCSYRVVYGDSSASSGDLGIESFYLGPNSSTAMRNIAFGC  123

Query  594  SQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAE---SSGSLEFGREI  424
              +N G+  G  GLLG+ GG+++F +QI    G  FSYCL   +++    S  L FGR  
Sbjct  124  GHSNSGLFRGEAGLLGMGGGTLSFFSQIAASIGPAFSYCLVDRYSQLQSRSSPLIFGRTA  183

Query  423  IPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVT  244
            IP  A + PLL++ R  T YY  L+G+ VG   LPI    F LT  G GG I+D GTSVT
Sbjct  184  IPFAARFTPLLKNPRINTFYYAVLTGISVGGTPLPIPPAQFALTGNGTGGAILDSGTSVT  243

Query  243  RLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLA  64
            R+   AY  LR  Y      +P AP    LDTC++  GL TVQ+P++   F  G    L 
Sbjct  244  RVVPPAYAVLRDAYRAASRNLPPAPGVYLLDTCFNFQGLPTVQIPSLVLHFDNGVDMVLP  303

Query  63   AKNILIPVNKRGIFCFAFAPS  1
              NILIPV++ G FC AFAPS
Sbjct  304  GGNILIPVDRSGTFCLAFAPS  324



>ref|XP_010695864.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Beta vulgaris 
subsp. vulgaris]
Length=484

 Score =   248 bits (632),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 144/320 (45%), Positives = 191/320 (60%), Gaps = 9/320 (3%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G P +  Y+ IDTGS+L WVQC+PC  C+ Q DP+FDP++S+SF 
Sbjct  135  GISQGSGEYFSRVGIGQPAREIYVIIDTGSDLSWVQCEPCTQCYIQPDPIFDPSQSTSFV  194

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITF-GGTVVRDVTMGCSQ  589
             +PC+ST CN +    C  G C Y + Y DGSY  G  V ETITF GG+ V D  +GC  
Sbjct  195  SLPCNSTTCNALDESECHAGSCIYEVSYGDGSYTTGEFVTETITFDGGSSVGDFAIGCGH  254

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGRE--IIPV  415
             N G  TGA GLLGL GG+++  +QI   +   FSYCL    + S+ SL F     I+P 
Sbjct  255  NNDGFFTGASGLLGLGGGALSLPSQINATS---FSYCLVDRESNSTSSLNFNTNTTILPP  311

Query  414  GAVWV--PLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTR  241
                +  PLL +  A T YY+GL G+ VG  +L +    F++ + G+GGVI+D GT+VTR
Sbjct  312  DPTLITAPLLSNPTAETFYYLGLIGISVGGTELTVPTTAFQIDKDGSGGVIIDTGTAVTR  371

Query  240  LPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAA  61
            L    YE LR  +      +P     +  DTCYDL G  +V+VPT+ F F GG+   L A
Sbjct  372  LETRVYELLRDEFRKGTTHLPTTDEVAIFDTCYDLRGKESVEVPTLEFHFAGGKTLALPA  431

Query  60   KNILIPVNKRGIFCFAFAPS  1
            KN +IPV+  G FC AFAP+
Sbjct  432  KNYVIPVDTEGTFCLAFAPT  451



>ref|XP_006362137.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=461

 Score =   247 bits (630),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 137/316 (43%), Positives = 191/316 (60%), Gaps = 5/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIG+GTP +Y YL +DTGS+++W+QC PC  C+ Q DPVFDP++SSSF+
Sbjct  110  GLSQGSGEYFTRIGIGTPTKYVYLVLDTGSDIVWIQCLPCAKCYSQSDPVFDPSKSSSFS  169

Query  762  IVPCSSTICNRIH-LGC-TRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             V C S +C R+   GC  R +C Y + Y DGS+ +G    ET+ F  T V +++ GC  
Sbjct  170  PVTCDSPLCRRLDSSGCNNRNKCLYQVSYGDGSFTVGEYSTETLNFRKTTVSNISFGCGH  229

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGS-LEFGREIIPVG  412
             N+G+  GA GLLGL  G ++F  Q   + G  FSYCLA     +  S + FG   I   
Sbjct  230  DNEGLFIGAAGLLGLGKGKLSFPGQAGSRFGQKFSYCLADRIGSAKPSYIVFGESAITRN  289

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLP  235
             ++ PLL + +  T YY+ L+G+ VG  K+P ++ ++F+L  +GNGGVI+D GTSVTRL 
Sbjct  290  TIFTPLLTNPKLDTFYYVELTGISVGGTKVPAVTPELFKLDTEGNGGVIVDSGTSVTRLT  349

Query  234  KVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
            +  Y  +R  +      + RAP+FS  DTCYDL+G    +VPT+   F G  +  L A N
Sbjct  350  RPGYIAVRDAFRLGAKDLKRAPNFSLFDTCYDLSGKTQAKVPTLVLHFAGADV-ALPAAN  408

Query  54   ILIPVNKRGIFCFAFA  7
             +IPVN  G +C  FA
Sbjct  409  YMIPVNGEGRYCLGFA  424



>ref|XP_002892074.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68333.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=485

 Score =   247 bits (631),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 141/321 (44%), Positives = 194/321 (60%), Gaps = 14/321 (4%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTP +Y Y+ +DTGS+++W+QC PC+ C+ Q DP+FDP +S ++A
Sbjct  134  GLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPIFDPRKSKTYA  193

Query  762  IVPCSSTICNRIH-LGCT--RGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCS  592
             +PCSS  C R+   GC   R  C Y + Y DGS+ +G    ET+TF    V+ V +GC 
Sbjct  194  TIPCSSPHCRRLDSAGCNTRRKTCLYQVSYGDGSFTVGDFSTETLTFRRNRVKGVALGCG  253

Query  591  QTNQGMVTgaggllglagGSMTFMAQIPGQTGG----VFSYCLASWHAESS-GSLEFGRE  427
              N+G+  GA GLLGL  G ++F    PGQTG      FSYCL    A S   S+ FG  
Sbjct  254  HDNEGLFVGAAGLLGLGKGKLSF----PGQTGHRFNQKFSYCLVDRSASSKPSSVVFGNA  309

Query  426  IIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTS  250
             +   A + PLL + +  T YY+ L G+ VG  ++P ++  +F+L + GNGGVI+D GTS
Sbjct  310  AVSRIARFTPLLSNPKLDTFYYVELLGISVGGTRVPGVAASLFKLDQIGNGGVIIDSGTS  369

Query  249  VTRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWT  70
            VTRL + AY  +R  +      + RAP FS  DTC+DL+ +  V+VPT+   F G  + +
Sbjct  370  VTRLIRPAYIAMRDAFRVGAKALKRAPDFSLFDTCFDLSNMNEVKVPTVVLHFRGADV-S  428

Query  69   LAAKNILIPVNKRGIFCFAFA  7
            L A N LIPV+  G FCFAFA
Sbjct  429  LPATNYLIPVDTNGKFCFAFA  449



>ref|XP_003529886.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=473

 Score =   247 bits (630),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 139/313 (44%), Positives = 189/313 (60%), Gaps = 6/313 (2%)
 Frame = -2

Query  930  GIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFAIVPC  751
            G  EY  R+GVGTPP+Y Y+ +DTGS+++W+QC+PC  C+ Q D +FDP++S SFA +PC
Sbjct  126  GSGEYFTRLGVGTPPKYLYMVLDTGSDVVWLQCKPCTKCYSQTDQIFDPSKSKSFAGIPC  185

Query  750  SSTICNRIHL-GCT--RGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQTNQ  580
             S +C R+   GC+     C Y + Y DGS+  G    ET+TF    V  V +GC   N+
Sbjct  186  YSPLCRRLDSPGCSLKNNLCQYQVSYGDGSFTFGDFSTETLTFRRAAVPRVAIGCGHDNE  245

Query  579  GMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPVGAVW  403
            G+  GA GLLGL  G ++F  Q   +    FSYCL    A +   S+ FG   +   A +
Sbjct  246  GLFVGAAGLLGLGRGGLSFPTQTGTRFNNKFSYCLTDRTASAKPSSIVFGDSAVSRTARF  305

Query  402  VPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
             PL+++ +  T YY+ L G+ VG   +  IS   FRL   GNGGVI+D GTSVTRL + A
Sbjct  306  TPLVKNPKLDTFYYVELLGISVGGAPVRGISASFFRLDSTGNGGVIIDSGTSVTRLTRPA  365

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y +LR  +    + + RAP FS  DTCYDL+GL  V+VPT+   F G  + +L A N L+
Sbjct  366  YVSLRDAFRVGASHLKRAPEFSLFDTCYDLSGLSEVKVPTVVLHFRGADV-SLPAANYLV  424

Query  45   PVNKRGIFCFAFA  7
            PV+  G FCFAFA
Sbjct  425  PVDNSGSFCFAFA  437



>ref|XP_009398943.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=522

 Score =   248 bits (634),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 140/331 (42%), Positives = 191/331 (58%), Gaps = 20/331 (6%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G  +G  EY  R+GVG+PP+  Y+ +DTGS++ WVQC PC  C+ Q DPVFDP+ SSS+ 
Sbjct  162  GASMGSGEYFSRVGVGSPPKPLYMILDTGSDVSWVQCLPCADCYEQSDPVFDPSDSSSYT  221

Query  762  IVPCSSTICNRIHLGCTRG--------------RCSYGIVYIDGSYNMGTMVQETITFGG  625
            ++ C S++C+ + L   R               RC Y ++Y DGSY +G    ET+TFGG
Sbjct  222  LLSCDSSLCHSLALSACRNSTYSSSGPAAAADERCLYQVMYGDGSYTVGDFATETLTFGG  281

Query  624  TV-VRDVTMGCSQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSG  448
            +  V +V MGC   N+G+   A GLLGL GG ++F  QI  ++    +YCL    + +S 
Sbjct  282  SASVSEVAMGCGHDNEGVFDSAAGLLGLGGGPLSFPTQISARS---ITYCLVDRDSNASS  338

Query  447  SLEFGREI-IPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQ-GNGG  274
             L        P   +  PLLR+    T YY+ L+G+ VG   LPI    F + E  G GG
Sbjct  339  ILNISTAASTPSSTLTAPLLRNPLLDTFYYVELTGISVGGKMLPIPPSAFAIDESTGAGG  398

Query  273  VIMDIGTSVTRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFF  94
            VI+D GTSVTRL + AY TLR  +  Q+  +P A      DTCY+L+   +V VP+++F 
Sbjct  399  VIVDSGTSVTRLQEAAYATLRDDFQVQMEALPPAERMIPFDTCYNLSSRASVTVPSVAFH  458

Query  93   FTGGQIWTLAAKNILIPVNKRGIFCFAFAPS  1
            F  G+   L AKN LIPVN  G +C AFAPS
Sbjct  459  FPEGKALLLPAKNYLIPVNDEGTYCLAFAPS  489



>tpg|DAA53545.1| TPA: hypothetical protein ZEAMMB73_483039 [Zea mays]
Length=506

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 139/315 (44%), Positives = 185/315 (59%), Gaps = 8/315 (3%)
 Frame = -2

Query  930  GIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFAIVPC  751
            G  EY  R+G+G+P +  Y+ +DTGS++ WVQCQPC  C+ Q DPVFDP+ S+S+A V C
Sbjct  162  GSGEYFSRVGIGSPARQLYMVLDTGSDVTWVQCQPCADCYQQSDPVFDPSLSASYAAVSC  221

Query  750  SSTICNRIHLGCTR---GRCSYGIVYIDGSYNMGTMVQETITFG-GTVVRDVTMGCSQTN  583
             S  C  +     R   G C Y + Y DGSY +G    ET+T G  T V +V +GC   N
Sbjct  222  DSQRCRDLDTAACRNATGACLYEVAYGDGSYTVGDFATETLTLGDSTPVGNVAIGCGHDN  281

Query  582  QGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAVW  403
            +G+  GA GLL L GG ++F +QI   T   FSYCL    + ++ +L+FG      G V 
Sbjct  282  EGLFVGAAGLLALGGGPLSFPSQISAST---FSYCLVDRDSPAASTLQFGDGAAEAGTVT  338

Query  402  VPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTE-QGNGGVIMDIGTSVTRLPKVA  226
             PL+RS R  T YY+ LSG+ VG   L I    F +    G+GGVI+D GT+VTRL   A
Sbjct  339  APLVRSPRTSTFYYVALSGISVGGQPLSIPASAFAMDATSGSGGVIVDSGTAVTRLQSAA  398

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y  LR  ++    ++PR    S  DTCYDL+   +V+VP +S  F GG    L AKN LI
Sbjct  399  YAALRDAFVQGAPSLPRTSGVSLFDTCYDLSDRTSVEVPAVSLRFEGGGALRLPAKNYLI  458

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G +C AFAP+
Sbjct  459  PVDGAGTYCLAFAPT  473



>ref|XP_009135580.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=499

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 138/318 (43%), Positives = 191/318 (60%), Gaps = 7/318 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTP +  Y+ +DTGS++ W+QC+PC  C+ Q DPVFDP  SS++ 
Sbjct  152  GASQGSGEYFSRIGVGTPAKEMYMVLDTGSDVNWLQCKPCSDCYEQSDPVFDPAESSTYK  211

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + C++  C  + +  C   +C Y + Y DGS+ +G    +T+TFG +  V DV +GC  
Sbjct  212  PLTCAAPQCASLEVSTCRSNKCLYQVSYGDGSFTVGEYATDTVTFGDSGKVNDVALGCGH  271

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  GA GLLGL GG+++   QI   +   FSYCL    + +S SL+F    I  G 
Sbjct  272  DNEGLFMGAAGLLGLGGGALSMTNQINATS---FSYCLVDRDSGNSSSLDFNSVQISDGD  328

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQ-GNGGVIMDIGTSVTRLPK  232
               PLLR+ +  T YY+GLSG  VG  K+ I   VF + +  G+GGVI+D GT+VTRL  
Sbjct  329  ATAPLLRNKKIDTFYYVGLSGFSVGGEKVEIPSSVFEVDDATGDGGVILDCGTAVTRLQT  388

Query  231  VAYETLRYIYMTQIATIPRA-PSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
             AY +LR  ++        A  S S  DTCYD + + +V VP ++F FTGG+   L AKN
Sbjct  389  EAYNSLRDAFVKLAKDFKNATSSISLFDTCYDFSSMSSVNVPAVAFQFTGGKSIDLPAKN  448

Query  54   ILIPVNKRGIFCFAFAPS  1
             LIP++  G FCFAFAP+
Sbjct  449  YLIPIDDAGTFCFAFAPT  466



>ref|XP_004137465.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN64110.1| hypothetical protein Csa_1G042220 [Cucumis sativus]
Length=491

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 138/316 (44%), Positives = 196/316 (62%), Gaps = 6/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVG P +  Y+ +DTGS++ W+QCQPC  C+ Q DP+FDP  SSSFA
Sbjct  147  GTSQGSGEYFSRVGVGQPAKPFYMVLDTGSDINWLQCQPCTDCYQQTDPIFDPRSSSSFA  206

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             +PC S  C  +   GC   +C Y + Y DGS+ +G  V ET+TFG + ++ +V +GC  
Sbjct  207  SLPCESQQCQALETSGCRASKCLYQVSYGDGSFTVGEFVIETLTFGNSGMINNVAVGCGH  266

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  G+ GLLGL GGS++  +Q+   +   FSYCL    + SS  LEF     P  +
Sbjct  267  DNEGLFVGSAGLLGLGGGSLSLTSQMKASS---FSYCLVDRDSSSSSDLEFN-SAAPSDS  322

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V  PLL+S +  T YY+GL+G+ VG   L I  ++F++ + G GG+I+D GT++TRL   
Sbjct  323  VNAPLLKSGKVDTFYYVGLTGMSVGGQLLSIPPNLFQMDDSGYGGIIVDSGTAITRLQTQ  382

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY TLR  ++++   + +   F+  DTCYDL+    V +PT+SF F GG+   L  KN L
Sbjct  383  AYNTLRDAFVSRTPYLKKTNGFALFDTCYDLSSQSRVTIPTVSFEFAGGKSLQLPPKNYL  442

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+  G FCFAFAP+
Sbjct  443  IPVDSVGTFCFAFAPT  458



>emb|CDX82342.1| BnaA03g34790D [Brassica napus]
Length=499

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 138/318 (43%), Positives = 191/318 (60%), Gaps = 7/318 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTP +  Y+ +DTGS++ W+QC+PC  C+ Q DPVFDP  SS++ 
Sbjct  152  GASQGSGEYFSRIGVGTPAKEMYMVLDTGSDVNWLQCKPCSDCYEQSDPVFDPAESSTYK  211

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + C++  C  + +  C   +C Y + Y DGS+ +G    +T+TFG +  V DV +GC  
Sbjct  212  PLTCAAPQCASLEVSTCRSNKCLYQVSYGDGSFTVGEYATDTVTFGDSGKVNDVALGCGH  271

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  GA GLLGL GG+++   QI   +   FSYCL    + +S SL+F    I  G 
Sbjct  272  DNEGLFMGAAGLLGLGGGALSMTNQINATS---FSYCLVDRDSGNSSSLDFNSVQISDGD  328

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQ-GNGGVIMDIGTSVTRLPK  232
               PLLR+ +  T YY+GLSG  VG  K+ I   VF + +  G+GGVI+D GT+VTRL  
Sbjct  329  ATAPLLRNKKIDTFYYVGLSGFSVGGEKVEIPSSVFEVDDATGDGGVILDCGTAVTRLQT  388

Query  231  VAYETLRYIYMTQIATIPRA-PSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
             AY +LR  ++        A  S S  DTCYD + + +V VP ++F FTGG+   L AKN
Sbjct  389  EAYNSLRDAFVKLAKDFKNATSSISLFDTCYDFSSMSSVNVPAVAFQFTGGKSIDLPAKN  448

Query  54   ILIPVNKRGIFCFAFAPS  1
             LIP++  G FCFAFAP+
Sbjct  449  YLIPIDDAGTFCFAFAPT  466



>ref|XP_002964789.1| hypothetical protein SELMODRAFT_82470 [Selaginella moellendorffii]
 gb|EFJ33627.1| hypothetical protein SELMODRAFT_82470 [Selaginella moellendorffii]
Length=390

 Score =   244 bits (623),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 139/329 (42%), Positives = 187/329 (57%), Gaps = 7/329 (2%)
 Frame = -2

Query  966  LQNMW*GLGWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFD  787
            LQ      G  LG  EY  R+G+G+P +  YLE+DTGS++ W+QC PC  C+ Q DP++D
Sbjct  29   LQTAQVSSGLSLGSGEYFARMGIGSPQRSYYLELDTGSDVTWIQCAPCSSCYSQVDPIYD  88

Query  786  PTRSSSFAIVPCSSTICNRIHLGCTRGR-CSYGIVYIDGSYNMGTMVQETITFG---GTV  619
            P+ SSS+  V C S +C  +     +G  CSY +VY D S + G +  E+   G    T 
Sbjct  89   PSNSSSYRRVYCGSALCQALDYSACQGMGCSYRVVYGDSSASSGDLGIESFYLGPNSSTA  148

Query  618  VRDVTMGCSQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAE---SSG  448
            +R++  GC  +N G+  G  GLLG+ GG+++F +QI    G  FSYCL   +++    S 
Sbjct  149  MRNIAFGCGHSNSGLFRGEAGLLGMGGGTLSFFSQIAASIGPAFSYCLVDRYSQLQSRSS  208

Query  447  SLEFGREIIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVI  268
             L FGR  IP  A + PLL++ R  T YY  L+G+ VG   LPI    F LT  G GG I
Sbjct  209  PLIFGRTAIPFAARFTPLLKNPRIDTFYYAILTGISVGGTALPIPPAQFALTGNGTGGAI  268

Query  267  MDIGTSVTRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFT  88
            +D GTSVTR+   AY  LR  Y      +P AP    LDTC++  GL TVQ+P++   F 
Sbjct  269  LDSGTSVTRVVPAAYAVLRDAYRAASRNLPPAPGVYLLDTCFNFQGLPTVQIPSLVLHFD  328

Query  87   GGQIWTLAAKNILIPVNKRGIFCFAFAPS  1
                  L   NILIPV++ G FC AFAPS
Sbjct  329  NDVDMVLPGGNILIPVDRSGTFCLAFAPS  357



>emb|CDX75968.1| BnaC03g40510D [Brassica napus]
Length=503

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 138/317 (44%), Positives = 188/317 (59%), Gaps = 6/317 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTP +  Y+ +DTGS++ W+QC+PC  C+ Q DPVFDP  SS++ 
Sbjct  157  GASQGSGEYFSRIGVGTPAKEMYMVLDTGSDVNWLQCKPCSDCYEQSDPVFDPAESSTYK  216

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + C++  C  + +  C   +C Y + Y DGS+ +G    +T+TFG +  V DV +GC  
Sbjct  217  PLTCAAPQCASLEVSTCRSNKCLYQVSYGDGSFTVGEYATDTVTFGDSGKVNDVALGCGH  276

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  GA GLLGL GG+++   QI   +   FSYCL    + +S SL+F    I  G 
Sbjct  277  DNEGLFMGAAGLLGLGGGALSMTNQINATS---FSYCLVDRDSGNSSSLDFNSVQIGDGD  333

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
               PLL + +  T YY+GLSG  VG  K+ I   VF +   G GGVI+D GT+VTRL   
Sbjct  334  ATAPLLLNKKIDTFYYVGLSGFSVGGEKVEIPSSVFEVDAAGAGGVILDCGTAVTRLQTE  393

Query  228  AYETLRYIYMTQIATIPRA-PSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNI  52
            AY  LR  ++        A  S S  DTCYD + + +V VPT++F FTGG+   L AKN 
Sbjct  394  AYNALRDAFVKLAKDFKNATSSISLFDTCYDFSSMSSVNVPTVAFHFTGGKSIDLPAKNY  453

Query  51   LIPVNKRGIFCFAFAPS  1
            LIP++  G FCFAFAP+
Sbjct  454  LIPIDDAGTFCFAFAPT  470



>ref|XP_008343434.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=486

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 138/316 (44%), Positives = 188/316 (59%), Gaps = 5/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTPP+Y Y+ +DTGS+++W+QC PC+ C+ Q DP+FDP +S SFA
Sbjct  136  GLSQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWLQCAPCRRCYKQSDPIFDPRKSRSFA  195

Query  762  IVPCSSTICNRIHL-GC-TRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             +PC S +C ++    C ++  C Y + Y DGS+  G    ET+TF GT V  V +GC  
Sbjct  196  TIPCGSPLCRKLDSPSCNSKKTCLYQVSYGDGSFTFGEFSTETLTFRGTKVGRVAIGCGH  255

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPVG  412
             N+G+  GA GLLGL  G ++F A         FSYCL    A S   S+ FG   +   
Sbjct  256  DNEGLFVGAAGLLGLGRGKLSFPALTGSLFNRKFSYCLVDRSASSKPSSVVFGDSAVSRT  315

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLP  235
            A + PL+ + +  T YY+ L G  VG  ++P I+  +F+L   GNGGVI+D GTSVTRL 
Sbjct  316  ARFTPLIANPKLDTFYYVELIGXSVGGTRVPGITASLFKLDRAGNGGVILDSGTSVTRLT  375

Query  234  KVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
            + AY  LR  +    + + R P FS  DTC+DL+G   V+VPT+   F    + +L A N
Sbjct  376  RXAYNALRDAFRAGTSGLKRGPQFSLFDTCFDLSGKTEVKVPTVVLHFRNADV-SLPAAN  434

Query  54   ILIPVNKRGIFCFAFA  7
             LIPV+  G FCFAFA
Sbjct  435  YLIPVDSSGSFCFAFA  450



>ref|XP_010095748.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
 gb|EXB62168.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
Length=491

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 141/316 (45%), Positives = 189/316 (60%), Gaps = 5/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTPP+Y Y+ +DTGS+++W+QC PC+ C+ Q DPVFDP++S SFA
Sbjct  141  GLAQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWLQCAPCRKCYTQADPVFDPSKSRSFA  200

Query  762  IVPCSSTICNRIHL-GCT-RGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             + C S +C ++   GC  R  C Y + Y DGS+  G    ET+TF  T +  V +GC  
Sbjct  201  RISCGSPLCRKLDSPGCNQRKMCLYQVSYGDGSFTTGEFSTETLTFRRTRIGRVALGCGH  260

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPVG  412
             N+G+  GA GLLGL  G ++F  Q   +    FSYCLA   A S   S+ FG   +   
Sbjct  261  DNEGLFVGAAGLLGLGRGRLSFPFQTGLRFNRKFSYCLADRSASSKPSSMVFGDSAVSRT  320

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLP  235
            A + PLL + +  T YY+ L  + VG  ++  IS  +F+L + GNGGVI+D GTSVTRL 
Sbjct  321  ARFTPLLTNPKLDTFYYLELLAISVGGSRVRGISASLFKLDQAGNGGVIIDSGTSVTRLT  380

Query  234  KVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
            + AY  LR  +      + RAP FS  DTCYDL+G   V+VPT+   F G  + +  A N
Sbjct  381  RPAYVALRDAFRAGSVNLKRAPEFSLFDTCYDLSGKTEVKVPTVVLHFRGADV-SFPATN  439

Query  54   ILIPVNKRGIFCFAFA  7
             LIPV+  G FCFAFA
Sbjct  440  YLIPVDSSGTFCFAFA  455



>ref|XP_003520035.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=484

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 137/315 (43%), Positives = 189/315 (60%), Gaps = 5/315 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY +R+G+G PP   Y+ +DTGS++ W+QC PC  C+ Q DP+FDP  S+S++
Sbjct  141  GTSQGSGEYFLRVGIGKPPSQAYVVLDTGSDVSWIQCAPCSECYQQSDPIFDPVSSNSYS  200

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             + C +  C  + L  C  G C Y + Y DGSY +G    ET+T G   V +V +GC   
Sbjct  201  PIRCDAPQCKSLDLSECRNGTCLYEVSYGDGSYTVGEFATETVTLGTAAVENVAIGCGHN  260

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+G+  GA GLLGL GG ++F AQ+   +   FSYCL +  +++  +LEF   + P   V
Sbjct  261  NEGLFVGAAGLLGLGGGKLSFPAQVNATS---FSYCLVNRDSDAVSTLEFNSPL-PRNVV  316

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
              PL R+    T YY+GL G+ VG   LPI E +F +   G GG+I+D GT+VTRL    
Sbjct  317  TAPLRRNPELDTFYYLGLKGISVGGEALPIPESIFEVDAIGGGGIIIDSGTAVTRLRSEV  376

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y+ LR  ++     IP+A   S  DTCYDL+   +VQVPT+SF F  G+   L A+N LI
Sbjct  377  YDALRDAFVKGAKGIPKANGVSLFDTCYDLSSRESVQVPTVSFHFPEGRELPLPARNYLI  436

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAP+
Sbjct  437  PVDSVGTFCFAFAPT  451



>gb|EAY72467.1| hypothetical protein OsI_00323 [Oryza sativa Indica Group]
Length=500

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 142/318 (45%), Positives = 186/318 (58%), Gaps = 9/318 (3%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G  LG  EY  R+GVG+P +  Y+ +DTGS++ WVQCQPC  C+ Q DPVFDP+ S+S+A
Sbjct  155  GVGLGSGEYFSRVGVGSPARQLYMVLDTGSDVTWVQCQPCADCYQQSDPVFDPSLSTSYA  214

Query  762  IVPCSSTICNRIHLGCTR---GRCSYGIVYIDGSYNMGTMVQETITFGGTV-VRDVTMGC  595
             V C +  C+ +     R   G C Y + Y DGSY +G    ET+T G +  V  V +GC
Sbjct  215  SVACDNPRCHDLDAAACRNSTGACLYEVAYGDGSYTVGDFATETLTLGDSAPVSSVAIGC  274

Query  594  SQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPV  415
               N+G+  GA GLL L GG ++F +QI   T   FSYCL    + SS +L+FG      
Sbjct  275  GHDNEGLFVGAAGLLALGGGPLSFPSQISATT---FSYCLVDRDSPSSSTLQFGDAAD--  329

Query  414  GAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLP  235
              V  PL+RS R  T YY+GLSG+ VG   L I    F +   G GGVI+D GT+VTRL 
Sbjct  330  AEVTAPLIRSPRTSTFYYVGLSGISVGGQILSIPPSAFAMDGTGAGGVIVDSGTAVTRLQ  389

Query  234  KVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
              AY  LR  ++    ++PR    S  DTCYDL+   +V+VP +S  F GG    L AKN
Sbjct  390  SSAYAALRDAFVRGTQSLPRTSGVSLFDTCYDLSDRTSVEVPAVSLRFAGGGELRLPAKN  449

Query  54   ILIPVNKRGIFCFAFAPS  1
             LIPV+  G +C AFAP+
Sbjct  450  YLIPVDGAGTYCLAFAPT  467



>emb|CDY15187.1| BnaC05g00660D [Brassica napus]
Length=481

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 141/321 (44%), Positives = 197/321 (61%), Gaps = 14/321 (4%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTP +Y Y+ +DTGS+++W+QC PC+ C+ Q DP+FDP +S +++
Sbjct  130  GLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPIFDPRKSRTYS  189

Query  762  IVPCSSTICNRIH-LGC-TRGR-CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCS  592
             +PCSS +C R+   GC TR R C Y + Y DGS+ +G    ET+TF    V+ V +GC 
Sbjct  190  TIPCSSPLCRRLDSAGCNTRRRTCLYQVSYGDGSFTVGDFATETLTFRRNRVKGVAVGCG  249

Query  591  QTNQGMVTgaggllglagGSMTFMAQIPGQTG----GVFSYCLASWHAESS-GSLEFGRE  427
              N+G+  GA GLLGL  G ++F    PGQTG      FSYCL    A S   S+ FG  
Sbjct  250  HDNEGLFVGAAGLLGLGKGRLSF----PGQTGRRFNQKFSYCLVDRSASSKPSSVVFGNA  305

Query  426  IIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTS  250
             +   A + PLL + +  T YY+ L G+ VG  ++P ++  +F+L   GNGGVI+D GTS
Sbjct  306  AVSRTAKFTPLLSNPKLDTFYYVELLGISVGGTRVPGVAASLFKLDPIGNGGVIIDSGTS  365

Query  249  VTRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWT  70
            VTRL + AY  +R  +  +  ++ RAP +S  DTC+DL+    V+VPT+   F G  + +
Sbjct  366  VTRLVRPAYVAMRDAFRVRARSLKRAPDYSLFDTCFDLSHQNEVKVPTVVLHFRGADV-S  424

Query  69   LAAKNILIPVNKRGIFCFAFA  7
            L A N LIPV+  G FCFAFA
Sbjct  425  LPATNYLIPVDTNGKFCFAFA  445



>ref|XP_009800816.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=474

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 139/316 (44%), Positives = 189/316 (60%), Gaps = 5/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIG+GTPP+Y Y+ +DTGS+++W+QC PC+ C+ Q DPVFDPT+SSSF 
Sbjct  124  GLAQGSGEYFTRIGIGTPPKYAYMVLDTGSDVVWIQCLPCRQCYNQSDPVFDPTKSSSFT  183

Query  762  IVPCSSTICNRIHL-GC-TRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             + C S +C R+   GC  R +C Y + Y DGS+ +G    ET+TF  T V D+  GC  
Sbjct  184  GLSCDSPLCRRLDSPGCNNRNKCLYQVSYGDGSFTVGEFSTETLTFRKTRVSDIAFGCGH  243

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGS-LEFGREIIPVG  412
             N+G+  GA GLLGL  G ++F  Q   + G  F YCL         S L FG   +   
Sbjct  244  DNEGLFIGAAGLLGLGKGKLSFPGQAGSRFGNKFLYCLVDRTGSPKPSYLIFGETAVTRN  303

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLP  235
             ++ PLL + +  T YY+ L+G+ VG  ++P I+ ++F+L   GNGGVI+D GTSVTRL 
Sbjct  304  TIFTPLLTNQKLNTFYYVELTGISVGGTRVPGITPELFKLGADGNGGVIVDSGTSVTRLT  363

Query  234  KVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
            + AY  LR  +      + RAP++S  DTCYDL+G   V+VPT+   F    +  L A N
Sbjct  364  QPAYVALRDAFRLGTKNLKRAPNYSLFDTCYDLSGKTEVKVPTLVLHFKDADL-ALPASN  422

Query  54   ILIPVNKRGIFCFAFA  7
             LIPV+    FCF FA
Sbjct  423  YLIPVSSGRRFCFGFA  438



>ref|XP_008351846.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=486

 Score =   246 bits (628),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 138/316 (44%), Positives = 188/316 (59%), Gaps = 5/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTPP+Y Y+ +DTGS+++W+QC PC+ C+ Q DP+FDP +S SFA
Sbjct  136  GLSQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWLQCAPCRRCYKQSDPIFDPRKSRSFA  195

Query  762  IVPCSSTICNRIHL-GC-TRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             +PC S +C ++    C ++  C Y + Y DGS+  G    ET+TF GT V  V +GC  
Sbjct  196  TIPCGSPLCRKLDSPSCNSKKTCLYQVSYGDGSFTFGEFSTETLTFRGTKVGRVAIGCGH  255

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPVG  412
             N+G+  GA GLLGL  G ++F A         FSYCL    A S   S+ FG   +   
Sbjct  256  DNEGLFVGAAGLLGLGRGKLSFPALTGSLFNRKFSYCLVDRSASSKPSSVVFGDSAVSRT  315

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLP  235
            A + PL+ + +  T YY+ L G  VG  ++P I+  +F+L   GNGGVI+D GTSVTRL 
Sbjct  316  ARFTPLIANPKLDTFYYVELIGXSVGGTRVPGITASLFKLDRAGNGGVILDSGTSVTRLT  375

Query  234  KVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
            + AY  LR  +    + + R P FS  DTC+DL+G   V+VPT+   F    + +L A N
Sbjct  376  RSAYNALRDAFRAGTSGLKRGPQFSLFDTCFDLSGKTEVKVPTVVLHFRNADV-SLPAAN  434

Query  54   ILIPVNKRGIFCFAFA  7
             LIPV+  G FCFAFA
Sbjct  435  YLIPVDSSGSFCFAFA  450



>ref|XP_006362549.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
tuberosum]
Length=482

 Score =   246 bits (628),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 133/316 (42%), Positives = 190/316 (60%), Gaps = 6/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIG+G PP   Y+ +DTGS++ WVQC PC  C+ Q DP+F+P  SS+F+
Sbjct  138  GTSQGSGEYFSRIGIGHPPSQVYMVLDTGSDVNWVQCSPCADCYQQADPIFEPASSSTFS  197

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTV-VRDVTMGCSQ  589
             + C +  C  + +  C    C Y + Y DGSY +G  V E+ITF G+  V +V +GC  
Sbjct  198  PLTCETQQCKSLDVSECRNDTCLYEVSYGDGSYTVGDFVTESITFSGSSSVENVAIGCGH  257

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  GA GLLGL GG+++F +QI   +   FSYCL    ++++ +LEFG    P  A
Sbjct  258  NNEGLFVGAAGLLGLGGGALSFPSQINASS---FSYCLVDRDSDTTSTLEFGG-ATPPNA  313

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V  P++++ +  T YY+ L+G+ V    L ++   F + + G+GGVI+D GT+VTRL   
Sbjct  314  VTAPIIKNSKLDTFYYVDLTGISVAGNMLSVNPSDFEIADNGDGGVIVDSGTAVTRLKTD  373

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
             Y TLR  ++     +P     +  DTCYDL  + +V+VPT+SF F+ G    L AKN L
Sbjct  374  VYNTLRDEFVKGTRHLPSTNGVALFDTCYDLKSMKSVEVPTVSFHFSNGNELALPAKNYL  433

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+    FCFAFAPS
Sbjct  434  IPVDSSSTFCFAFAPS  449



>ref|XP_004968151.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Setaria 
italica]
Length=517

 Score =   246 bits (628),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 138/319 (43%), Positives = 187/319 (59%), Gaps = 8/319 (3%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G+P +  Y+ +DTGS++ WVQCQPC  C+ Q DPVFDP+ S+S+A
Sbjct  169  GVGQGSGEYFSRVGIGSPARQLYMVLDTGSDVTWVQCQPCADCYQQSDPVFDPSLSASYA  228

Query  762  IVPCSSTICNRIHLGCTR---GRCSYGIVYIDGSYNMGTMVQETITFGGTV-VRDVTMGC  595
             V C S  C  +     R   G C Y + Y DGSY +G    ET+T G +  V +V +GC
Sbjct  229  AVSCDSPRCRDLDTAACRNATGACLYEVAYGDGSYTVGDFATETLTLGDSQPVSNVAIGC  288

Query  594  SQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPV  415
               N+G+  GA GLL L GG ++F +QI   T   FSYCL    + ++ +L+FG      
Sbjct  289  GHDNEGLFVGAAGLLALGGGPLSFPSQISATT---FSYCLVDRDSPAASTLQFGDGAAEA  345

Query  414  GAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTE-QGNGGVIMDIGTSVTRL  238
              V  PLLRS R  T YY+ ++G+ VG   L I    F +    G+GGVI+D GT+VTRL
Sbjct  346  DTVTAPLLRSPRTSTFYYVAMTGISVGGQALSIPTSAFAMDATSGSGGVIVDSGTAVTRL  405

Query  237  PKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAK  58
               AY  LR  ++    ++PR+   S  DTCYDL+G  +V+VP +S  F GG    L AK
Sbjct  406  QSAAYAALRDAFVRGTPSLPRSSGVSLFDTCYDLSGRTSVEVPAVSLRFEGGGSLRLPAK  465

Query  57   NILIPVNKRGIFCFAFAPS  1
            N LIPV+  G +C AFAP+
Sbjct  466  NYLIPVDGAGTYCLAFAPT  484



>ref|XP_008367576.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=487

 Score =   245 bits (625),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 133/316 (42%), Positives = 191/316 (60%), Gaps = 6/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTP +  Y+ +DTGS++ W+QC PC  C+ Q DP F+P  SS+++
Sbjct  143  GVSQGSGEYFSRIGVGTPAKSFYMVLDTGSDVNWLQCGPCSDCYQQSDPXFNPAGSSTYS  202

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + C +  C  + +  C   +C Y + Y DGSY +G  V ET++FG +  +  + +GC  
Sbjct  203  QLTCDAPQCQALQVSXCRANKCLYQVSYGDGSYTVGDYVTETLSFGSSGSINKIALGCGH  262

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  GA GLLGL GG ++  +Q    T   FSYCL +  + +S +LEF     P  +
Sbjct  263  DNEGLFVGAAGLLGLGGGPLSLTSQFKATT---FSYCLVNRDSSASSTLEF-NSAPPADS  318

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V  PL++S +  T YY+GL+G  VG   + +   +F +   GNGG+I+D GT++TRL   
Sbjct  319  VTAPLVKSXKVGTFYYVGLTGFSVGGXPVSVPPSLFAVDNSGNGGIIVDSGTAITRLQTQ  378

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY  LR  +      +P A SF+  DTCY+L+    VQVPT+SF F+GG+  +L AKN L
Sbjct  379  AYNALRDAFKRLTRDLPTASSFALFDTCYNLSSRTKVQVPTVSFQFSGGKSLSLPAKNYL  438

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+  G FCFAFAP+
Sbjct  439  IPVDSAGTFCFAFAPT  454



>ref|XP_002457394.1| hypothetical protein SORBIDRAFT_03g006630 [Sorghum bicolor]
 gb|EES02514.1| hypothetical protein SORBIDRAFT_03g006630 [Sorghum bicolor]
Length=509

 Score =   246 bits (627),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 138/315 (44%), Positives = 185/315 (59%), Gaps = 8/315 (3%)
 Frame = -2

Query  930  GIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFAIVPC  751
            G  EY  R+G+G+P +  Y+ +DTGS++ WVQCQPC  C+ Q DPVFDP+ S+S+A V C
Sbjct  165  GSGEYFSRVGIGSPARELYMVLDTGSDVTWVQCQPCADCYQQSDPVFDPSLSASYAAVSC  224

Query  750  SSTICNRIHLGCTR---GRCSYGIVYIDGSYNMGTMVQETITFG-GTVVRDVTMGCSQTN  583
             S  C  +     R   G C Y + Y DGSY +G    ET+T G  T V +V +GC   N
Sbjct  225  DSPRCRDLDTAACRNATGACLYEVAYGDGSYTVGDFATETLTLGDSTPVTNVAIGCGHDN  284

Query  582  QGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAVW  403
            +G+  GA GLL L GG ++F +QI   T   FSYCL    + ++ +L+FG +      V 
Sbjct  285  EGLFVGAAGLLALGGGPLSFPSQISAST---FSYCLVDRDSPAASTLQFGADGAEADTVT  341

Query  402  VPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTE-QGNGGVIMDIGTSVTRLPKVA  226
             PL+RS R  T YY+ LSG+ VG   L I    F +    G+GGVI+D GT+VTRL   A
Sbjct  342  APLVRSPRTGTFYYVALSGISVGGQALSIPSSAFAMDATSGSGGVIVDSGTAVTRLQSSA  401

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y  LR  ++    ++PR    S  DTCYDL+   +V+VP +S  F GG    L AKN LI
Sbjct  402  YAALRDAFVRGTPSLPRTSGVSLFDTCYDLSDRTSVEVPAVSLRFEGGGALRLPAKNYLI  461

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G +C AFAP+
Sbjct  462  PVDGAGTYCLAFAPT  476



>ref|XP_010551288.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Tarenaya 
hassleriana]
Length=511

 Score =   246 bits (627),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 138/315 (44%), Positives = 194/315 (62%), Gaps = 5/315 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G PP+  Y+ +DTGS++ W+QC PC  C+ Q DP+FDP  SSS++
Sbjct  168  GTSQGSGEYFSRVGIGNPPRQVYMVLDTGSDVNWLQCSPCADCYQQSDPLFDPLYSSSYS  227

Query  762  IVPCSSTICNRIH-LGCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             + C S+ C  +    C    C Y + Y DGSY +G    ETIT G   V  + +GC  +
Sbjct  228  PLSCHSSECKALDDYECRNQTCLYEVSYGDGSYTVGDFATETITIGSASVEHIAIGCGHS  287

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+G+  GA GLLGL GG ++  +Q+   +   FSYCL    ++SS ++EF   + P  AV
Sbjct  288  NEGLFVGAAGLLGLGGGMLSLPSQLNTTS---FSYCLVDRDSDSSSTVEFDSPL-PPNAV  343

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
              PLLR+ +  T YY+G++G+ VG   LP+ +  FR+ E G GGVI+D GT+VTRL    
Sbjct  344  VAPLLRNPQVDTFYYLGIAGISVGGEFLPVPKSAFRMAESGIGGVIIDSGTAVTRLQTET  403

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y +LR  ++   A +P A   +  DTCYDL+G  TV+VPT++  FTGG++  L AKN LI
Sbjct  404  YNSLRDSFVKGTADLPTASGVALFDTCYDLSGNTTVEVPTVALHFTGGRMLALPAKNYLI  463

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FC AFAP+
Sbjct  464  PVDSAGTFCLAFAPT  478



>ref|XP_008376086.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Malus 
domestica]
Length=487

 Score =   245 bits (625),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 140/316 (44%), Positives = 190/316 (60%), Gaps = 5/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTPP+Y Y+ +DTGS+++W+QC PCK C+ Q DP+FDP +S SFA
Sbjct  137  GLSQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWLQCAPCKRCYTQTDPIFDPRKSGSFA  196

Query  762  IVPCSSTICNRIHL-GC-TRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQ  589
             +PC S +C ++   GC ++  C Y + Y DGS+ +G    ET+TF GT V  V +GC  
Sbjct  197  TIPCGSPLCRKLDSPGCNSKKTCLYQVSYGDGSFTVGEFSTETLTFRGTKVGRVAIGCGH  256

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLAS-WHAESSGSLEFGREIIPVG  412
             N+G+  GA GLLGL  G ++F AQ   Q    FSYCL     +    S+ FG   +   
Sbjct  257  DNEGLFVGAAGLLGLGRGKLSFPAQTGSQFNRKFSYCLVDRSSSSKPSSVLFGDSAVSRT  316

Query  411  AVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLP  235
            A + PLL + +  T YY+ L G+ VG  ++  I+  +F L   GNGGVI+D GTSVTRL 
Sbjct  317  ARFTPLLANPKLDTFYYVELIGISVGGTRVRGITASLFNLDPAGNGGVILDSGTSVTRLT  376

Query  234  KVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKN  55
            + AY  LR  +    + + R P FS  DTC+DL+G   V+VPT+   F    + +L A N
Sbjct  377  RSAYNALRDAFRAGTSGLKRGPEFSLFDTCFDLSGKTEVKVPTVVLHFRNADV-SLPATN  435

Query  54   ILIPVNKRGIFCFAFA  7
             LIPV+  G FCFAFA
Sbjct  436  YLIPVDSSGSFCFAFA  451



>ref|XP_010480432.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=488

 Score =   244 bits (624),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 139/317 (44%), Positives = 193/317 (61%), Gaps = 14/317 (4%)
 Frame = -2

Query  930  GIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFAIVPC  751
            G  EY  R+GVGTP +Y Y+ +DTGS+++W+QC PC+ C+ Q DP+FDP +S +++ +PC
Sbjct  141  GSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPIFDPRKSRTYSTIPC  200

Query  750  SSTICNRIH-LGCT--RGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQTNQ  580
            SS  C R+   GC   R  C Y + Y DGS+ +G    ET+TF    V+ V +GC   N+
Sbjct  201  SSPHCRRLDSAGCNTRRKTCLYQVSYGDGSFTVGDFSTETLTFRRNRVKGVALGCGHDNE  260

Query  579  GMVTgaggllglagGSMTFMAQIPGQTGG----VFSYCLASWHAESS-GSLEFGREIIPV  415
            G+  GA GLLGL  G ++F    PGQTG      FSYCL    A S   S+ FG   +  
Sbjct  261  GLFVGAAGLLGLGKGKLSF----PGQTGHRFNQKFSYCLVDRSASSKPSSVVFGNAAVSR  316

Query  414  GAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRL  238
             A + PLL + +  T YY+ L G+ VG  ++P ++  +F+L + GNGGVI+D GTSVTRL
Sbjct  317  TARFTPLLSNPKLDTFYYVELLGISVGGTRVPGVAASLFKLDQIGNGGVIIDSGTSVTRL  376

Query  237  PKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAK  58
             + AY  +R  +     T+ RAP FS  DTC+DL+ +  V+VPT+   F    + +L A 
Sbjct  377  IRPAYIAMRDAFRVGARTLKRAPDFSLFDTCFDLSNMNEVKVPTVVLHFREADV-SLPAT  435

Query  57   NILIPVNKRGIFCFAFA  7
            N LIPV+  G FCFAFA
Sbjct  436  NYLIPVDTNGKFCFAFA  452



>ref|XP_008351878.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=487

 Score =   244 bits (624),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 133/316 (42%), Positives = 191/316 (60%), Gaps = 6/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTP +  Y+ +DTGS++ W+QC PC  C+ Q DP F+P  SS+++
Sbjct  143  GVSQGSGEYFSRIGVGTPAKSFYMVLDTGSDVNWLQCGPCSDCYQQSDPXFNPAGSSTYS  202

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + C +  C  + +  C   +C Y + Y DGSY +G  V ET++FG +  +  + +GC  
Sbjct  203  QLTCDAPQCQALQVSXCRANKCLYQVSYGDGSYTVGDYVTETLSFGSSGSINKIALGCGH  262

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  GA GLLGL GG ++  +Q    T   FSYCL +  + +S +LEF     P  +
Sbjct  263  DNEGLFVGAAGLLGLGGGPLSLTSQFKATT---FSYCLVNRDSSASSTLEFN-SAPPADS  318

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V  PL++S +  T YY+GL+G  VG   + +   +F +   GNGG+I+D GT++TRL   
Sbjct  319  VTAPLVKSXKVGTFYYVGLTGFSVGGXPVSVPPSLFAVDNSGNGGIIVDSGTAITRLQTQ  378

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY  LR  +      +P A SF+  DTCY+L+    VQVPT+SF F+GG+  +L AKN L
Sbjct  379  AYNALRDAFKRLTRDLPTASSFALFDTCYNLSSRTKVQVPTVSFQFSGGKSLSLPAKNYL  438

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+  G FCFAFAP+
Sbjct  439  IPVDSAGTFCFAFAPT  454



>ref|XP_010477900.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=483

 Score =   244 bits (624),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 128/315 (41%), Positives = 194/315 (62%), Gaps = 5/315 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G P +  Y+ +DTGS++ W+QC PC  C+ Q +P+F+P  SSS+ 
Sbjct  140  GTTQGSGEYFTRVGIGNPAREVYMVLDTGSDVNWLQCAPCADCYHQTEPIFEPASSSSYQ  199

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             + C ++ C  + +  C    C Y + Y DGSY +G    ET+T G T V++V +GC  +
Sbjct  200  PLSCDTSQCKALEVSECRNATCLYEVSYGDGSYTVGDFATETLTIGSTSVQNVAVGCGHS  259

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+G+  GA GLLGL GG +   +Q+   +   FSYCL    ++S+ ++EFG  + P  AV
Sbjct  260  NEGLFVGAAGLLGLGGGLLALPSQLNTTS---FSYCLVDRDSDSASTVEFGTSLQP-DAV  315

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
              PLLR+ +  T YY+GL+G+ VG   L I +  F + E G+GG+I+D GT+VTRL    
Sbjct  316  EAPLLRNHQLDTFYYVGLTGISVGGELLQIPQSSFEMDESGSGGIIIDSGTAVTRLQTGI  375

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y +LR  ++   + + +A   +  DTCY+L+   T++VPT++F F GG++  L AKN +I
Sbjct  376  YNSLRDSFLKGTSDLEKANGVAMFDTCYNLSSKTTIEVPTVAFHFPGGKMLALPAKNYMI  435

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FC AFAP+
Sbjct  436  PVDSMGTFCLAFAPT  450



>emb|CDX90023.1| BnaA10g00590D [Brassica napus]
Length=481

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 141/321 (44%), Positives = 196/321 (61%), Gaps = 14/321 (4%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTP +Y Y+ +DTGS+++W+QC PC+ C+ Q DP+FDP +S +++
Sbjct  130  GLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPIFDPRKSRTYS  189

Query  762  IVPCSSTICNRIH-LGC-TRGR-CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCS  592
             +PCSS +C R+   GC TR R C Y + Y DGS+ +G    ET+TF    V+ V +GC 
Sbjct  190  TIPCSSPLCRRLDSAGCNTRRRTCLYQVSYGDGSFTVGDFATETLTFRRNRVKGVAVGCG  249

Query  591  QTNQGMVTgaggllglagGSMTFMAQIPGQTG----GVFSYCLASWHAESS-GSLEFGRE  427
              N+G+  GA GLLGL  G ++F    PGQTG      FSYCL    A S   S+ FG  
Sbjct  250  HDNEGLFVGAAGLLGLGKGRLSF----PGQTGRRFNQKFSYCLVDRSASSKPSSVVFGNA  305

Query  426  IIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTS  250
             +   A + PLL + +  T YY+ L G+ VG  ++P ++  +F+L   GNGGVI+D GTS
Sbjct  306  AVSRTAKFTPLLSNPKLDTFYYVELLGISVGGTRVPGVAASLFKLDPIGNGGVIIDSGTS  365

Query  249  VTRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWT  70
            VTRL + AY  +R  +     ++ RAP +S  DTC+DL+    V+VPT+   F G  + +
Sbjct  366  VTRLVRPAYIAMRDAFRVGAKSLKRAPDYSLFDTCFDLSHQNEVKVPTVVLHFRGADV-S  424

Query  69   LAAKNILIPVNKRGIFCFAFA  7
            L A N LIPV+  G FCFAFA
Sbjct  425  LPATNYLIPVDTNGKFCFAFA  445



>ref|XP_009119684.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=481

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 141/321 (44%), Positives = 196/321 (61%), Gaps = 14/321 (4%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTP +Y Y+ +DTGS+++W+QC PC+ C+ Q DP+FDP +S +++
Sbjct  130  GLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPIFDPRKSRTYS  189

Query  762  IVPCSSTICNRIH-LGC-TRGR-CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCS  592
             +PCSS +C R+   GC TR R C Y + Y DGS+ +G    ET+TF    V+ V +GC 
Sbjct  190  TIPCSSPLCRRLDSAGCNTRRRTCLYQVSYGDGSFTVGDFATETLTFRRNRVKGVAVGCG  249

Query  591  QTNQGMVTgaggllglagGSMTFMAQIPGQTG----GVFSYCLASWHAESS-GSLEFGRE  427
              N+G+  GA GLLGL  G ++F    PGQTG      FSYCL    A S   S+ FG  
Sbjct  250  HDNEGLFVGAAGLLGLGKGRLSF----PGQTGRRFNQKFSYCLVDRSASSKPSSVVFGNA  305

Query  426  IIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTS  250
             +   A + PLL + +  T YY+ L G+ VG  ++P ++  +F+L   GNGGVI+D GTS
Sbjct  306  AVSRTAKFTPLLSNPKLDTFYYVELLGISVGGTRVPGVAASLFKLDPIGNGGVIIDSGTS  365

Query  249  VTRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWT  70
            VTRL + AY  +R  +     ++ RAP +S  DTC+DL+    V+VPT+   F G  + +
Sbjct  366  VTRLVRPAYIAMRDAFRVGAKSLKRAPDYSLFDTCFDLSHQNEVKVPTVVLHFRGADV-S  424

Query  69   LAAKNILIPVNKRGIFCFAFA  7
            L A N LIPV+  G FCFAFA
Sbjct  425  LPATNYLIPVDTNGKFCFAFA  445



>ref|XP_007036465.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
 gb|EOY20966.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
Length=491

 Score =   244 bits (624),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 135/316 (43%), Positives = 194/316 (61%), Gaps = 7/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVG P +  Y+ +DTGS++ W+QC+PC  C+ Q DP+F+P+ SS+++
Sbjct  148  GTSQGSGEYFSRIGVGNPSKQFYMVLDTGSDITWIQCEPCSDCYQQSDPIFNPSGSSTYS  207

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             V C S  C+ + +  C  G+C Y + Y DGSY +G  V ET++FG +  +  V +GC  
Sbjct  208  PVSCGSRQCSSLEVSACRSGKCLYQVSYGDGSYTVGEFVTETVSFGNSGNINGVALGCGH  267

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  GA GLLGL GG ++  +QI   +   FSYCL +  + SS +L+F   +    +
Sbjct  268  DNEGLFVGAAGLLGLGGGPLSLTSQIKATS---FSYCLVNRDSASSSTLDFNSGLTS-DS  323

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V  PLLR+ +  T YY+GL+G  VG   + +   +F +   G GGVI+D GT+VTRL   
Sbjct  324  VTAPLLRNQKIDTFYYVGLTGFSVGGQPVQLPTGLFDMDASGKGGVIVDCGTAVTRLQTQ  383

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY  LR  ++     +P A   +  DTCYDL+   +V+VPT++F F GGQ   L AKN L
Sbjct  384  AYNALRDAFVKLTHDLPTASGVALFDTCYDLSSRTSVRVPTVAFHF-GGQSLDLPAKNYL  442

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+  G+FCFAFAP+
Sbjct  443  IPVDSSGVFCFAFAPT  458



>ref|XP_007147317.1| hypothetical protein PHAVU_006G113700g [Phaseolus vulgaris]
 gb|ESW19311.1| hypothetical protein PHAVU_006G113700g [Phaseolus vulgaris]
Length=534

 Score =   246 bits (627),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 139/312 (45%), Positives = 190/312 (61%), Gaps = 5/312 (2%)
 Frame = -2

Query  930  GIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFAIVPC  751
            G  EY  RIGVGTP +Y Y+ +DTGS+++W+QC PC+ C+ Q DPVFDPT+S ++A +PC
Sbjct  188  GSGEYFTRIGVGTPAKYVYMVLDTGSDVVWLQCAPCRKCYTQTDPVFDPTKSRTYAGIPC  247

Query  750  SSTICNRIHL-GCTRGR-CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQTNQG  577
             + +C R+   GC + + C Y + Y DGS+  G    ET+TF  T V  V +GC   N+G
Sbjct  248  GAPLCRRLDSPGCNKNKVCQYQVSYGDGSFTFGDFSTETLTFRRTRVTRVALGCGHDNEG  307

Query  576  MVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPVGAVWV  400
            +  GA GLLGL  G ++F  Q   +    FSYCL    A +   S+ FG   +   A + 
Sbjct  308  LFIGAAGLLGLGRGRLSFPVQTGRRFNQKFSYCLVDRSASAKPSSVVFGDSAVSRTARFT  367

Query  399  PLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLPKVAY  223
            PLL++ +  T YY+ L G+ VG   +  +S  +FRL   GNGGVI+D GTSVTRL + AY
Sbjct  368  PLLQNPKLDTFYYVELLGISVGGTPVRGLSASLFRLDSAGNGGVIIDSGTSVTRLTRPAY  427

Query  222  ETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILIP  43
              LR  +    + + RA  FS  DTC+DL+GL  V+VPT+   F G  + +L A N LIP
Sbjct  428  IALRDAFRVGASRLKRASEFSLFDTCFDLSGLTEVKVPTVVLHFRGADV-SLPASNYLIP  486

Query  42   VNKRGIFCFAFA  7
            V+  G FCFAFA
Sbjct  487  VDNSGSFCFAFA  498



>ref|XP_009609715.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Nicotiana 
tomentosiformis]
Length=476

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/318 (39%), Positives = 189/318 (59%), Gaps = 9/318 (3%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G P +  Y+ IDTGS++ W QC+PC  C+ Q DP+F+P+ SS++ 
Sbjct  129  GVSEGSGEYFARVGLGQPLKEFYMVIDTGSDITWFQCEPCSECYQQTDPIFNPSDSSTYT  188

Query  762  IVPCSSTICNRIHLG--CTRGRCSYGIVYIDGSYNMGTMVQETITFG---GTVVRDVTMG  598
             + C S  C+ +HL    + G C Y + Y DGS+ +G    ET++ G   G+   +V +G
Sbjct  189  RLSCESPECSALHLSECSSTGTCLYQVSYGDGSFTVGEFATETVSLGHSGGSSFSNVAIG  248

Query  597  CSQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIP  418
            C   N+G+  G+ GL+ L  GS++  +QI   +   FSYCL    ++SS +LEF     P
Sbjct  249  CGHDNEGLFIGSAGLVALGSGSLSLPSQIKATS---FSYCLVDRDSDSSSTLEF-NSAGP  304

Query  417  VGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRL  238
              ++  PLL++ +  T +Y+GL G+ V    L +  ++F++ + GNGG+I+D GT+VTR 
Sbjct  305  SDSIIAPLLQNSKRSTFFYVGLEGISVAGEMLSVPANIFQVDDNGNGGIIVDSGTAVTRF  364

Query  237  PKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAK  58
             +  Y  LR  ++     +P    F   DTCYDL+G+ T  VPT++F F+GG+  +L  K
Sbjct  365  ERSVYNALRDTFVKYAQDLPADGDFMLFDTCYDLSGMKTASVPTVAFHFSGGKTLSLHPK  424

Query  57   NILIPVNKRGIFCFAFAP  4
            N L+PVN  G FC AFAP
Sbjct  425  NTLVPVNSSGKFCLAFAP  442



>ref|XP_003517994.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=484

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 135/315 (43%), Positives = 188/315 (60%), Gaps = 5/315 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY +R+G+G PP   Y+ +DTGS++ W+QC PC  C+ Q DP+FDP  S+S++
Sbjct  141  GTSQGSGEYFLRVGIGKPPSQAYVVLDTGSDVSWIQCAPCSECYQQSDPIFDPISSNSYS  200

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQT  586
             + C    C  + L  C  G C Y + Y DGSY +G    ET+T G   V +V +GC   
Sbjct  201  PIRCDEPQCKSLDLSECRNGTCLYEVSYGDGSYTVGEFATETVTLGSAAVENVAIGCGHN  260

Query  585  NQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAV  406
            N+G+  GA GLLGL GG ++F AQ+   +   FSYCL +  +++  +LEF   + P  A 
Sbjct  261  NEGLFVGAAGLLGLGGGKLSFPAQVNATS---FSYCLVNRDSDAVSTLEFNSPL-PRNAA  316

Query  405  WVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
              PL+R+    T YY+GL G+ VG   LPI E  F +   G GG+I+D GT+VTRL    
Sbjct  317  TAPLMRNPELDTFYYLGLKGISVGGEALPIPESSFEVDAIGGGGIIIDSGTAVTRLRSEV  376

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y+ LR  ++     IP+A   S  DTCYDL+   +V++PT+SF F  G+   L A+N LI
Sbjct  377  YDALRDAFVKGAKGIPKANGVSLFDTCYDLSSRESVEIPTVSFRFPEGRELPLPARNYLI  436

Query  45   PVNKRGIFCFAFAPS  1
            PV+  G FCFAFAP+
Sbjct  437  PVDSVGTFCFAFAPT  451



>ref|XP_001757102.1| predicted protein [Physcomitrella patens]
 gb|EDQ77961.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 135/322 (42%), Positives = 186/322 (58%), Gaps = 10/322 (3%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G  LG  EY +RI VGTPP+  YL +DTGS+++W+QC PC  C+ Q D +FDP +SS+++
Sbjct  50   GLSLGSGEYFIRISVGTPPRRMYLVMDTGSDILWLQCAPCVNCYHQSDAIFDPYKSSTYS  109

Query  762  IVPCSSTICNRIHLG-CTRGRCSYGIVYIDGSYNMGTMVQETITFGGT------VVRDVT  604
             + CS+  C  + +G C   +C Y + Y DGS+  G    + ++   T      V+  + 
Sbjct  110  TLGCSTRQCLNLDIGTCQANKCLYQVDYGDGSFTTGEFGTDDVSLNSTSGVGQVVLNKIP  169

Query  603  MGCSQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS--GSLEFGR  430
            +GC   N+G   GA GLLGL  G ++F  Q+  Q GG FSYCL     +S+   SL FG 
Sbjct  170  LGCGHDNEGYFVGAAGLLGLGKGPLSFPNQVDPQNGGRFSYCLTDRETDSTEGSSLVFGE  229

Query  429  EIIP-VGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGT  253
              +P  GA + P   ++R PT YY+ ++G+ VG   L I    F+L   GNGGVI+D GT
Sbjct  230  AAVPPAGARFTPQDSNMRVPTFYYLKMTGISVGGTILTIPTSAFQLDSLGNGGVIIDSGT  289

Query  252  SVTRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIW  73
            SVTRL   AY +LR  +    + +     FS  DTCYDL+GL +V VPT++  F GG   
Sbjct  290  SVTRLQNAAYASLRDAFRAGTSDLAPTAGFSLFDTCYDLSGLASVDVPTVTLHFQGGTDL  349

Query  72   TLAAKNILIPVNKRGIFCFAFA  7
             L A N LIPV+    FC AFA
Sbjct  350  KLPASNYLIPVDNSNTFCLAFA  371



>ref|XP_004241622.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
lycopersicum]
Length=495

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/316 (41%), Positives = 194/316 (61%), Gaps = 6/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G P +  Y+ IDTGS++ W+QC+PC  C+ Q DP+F+P+ SS++ 
Sbjct  151  GTSQGSGEYFARLGIGEPAKEFYMVIDTGSDINWLQCEPCDVCYQQTDPIFNPSDSSTYN  210

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             V C+S +C  + L GC    C Y + Y DGS+  G +  ET++FG +    +V +GC  
Sbjct  211  QVSCNSPVCAALELSGCYTDTCMYQVSYGDGSFTEGELATETVSFGDSGSFPNVAIGCGH  270

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+ TG+ GLLGL GGS++  +Q+   +   FSYCL     +SS +LEF     P  +
Sbjct  271  DNEGLFTGSAGLLGLGGGSLSLPSQVKATS---FSYCLVDRDTDSSSTLEF-NSAGPSDS  326

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V+ PLLR+ R  T +YIGL G+ V +  L +   +F++ + G GG+I+D GT+VTRL   
Sbjct  327  VFAPLLRNSRRDTFFYIGLEGISVDDEMLQVPASIFQVDDNGRGGIIVDSGTAVTRLQSS  386

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY  LR  ++     +P A  F   DTC+DL+ + TV VPT++  F+GGQ   L A+N +
Sbjct  387  AYSALRDTFVKYAQNLPSAGEFELFDTCFDLSSMSTVNVPTMALHFSGGQTLPLQAQNTV  446

Query  48   IPVNKRGIFCFAFAPS  1
            +PV+  G +C AFAP+
Sbjct  447  VPVDSSGKYCLAFAPT  462



>ref|XP_007135265.1| hypothetical protein PHAVU_010G114700g [Phaseolus vulgaris]
 gb|ESW07259.1| hypothetical protein PHAVU_010G114700g [Phaseolus vulgaris]
Length=477

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 138/313 (44%), Positives = 188/313 (60%), Gaps = 6/313 (2%)
 Frame = -2

Query  930  GIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFAIVPC  751
            G  EY  R+GVGTPP+Y Y+ +DTGS+++W+QC+PC  C+ Q D +FDP++SSSFA + C
Sbjct  130  GSGEYFTRLGVGTPPKYVYMVLDTGSDVVWLQCKPCAKCYSQTDEIFDPSKSSSFAGISC  189

Query  750  SSTICNRIHL-GCTR--GRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQTNQ  580
            SS +C  +   GC+R    C Y + Y DGS+  G    ET+TF    V  V +GC   N+
Sbjct  190  SSPLCRSLDSPGCSRKSSNCQYQVSYGDGSFTFGDFSMETLTFRRAQVPRVALGCGHDNE  249

Query  579  GMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPVGAVW  403
            G+  GA GLLGL  G ++F  Q   +    FSYCL    A +   S+ FG   +   A +
Sbjct  250  GLFVGAAGLLGLGRGGLSFPTQAGTRFNNKFSYCLTDRTAPAKPSSIVFGDSAVSRTARF  309

Query  402  VPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
             P++ + +  T YY+ L G+ VG   +  IS  +FRL   GNGGVI+D GTSVTRL + A
Sbjct  310  TPIINNPKLDTFYYLELLGISVGGAPVRGISASLFRLDSTGNGGVIIDSGTSVTRLTRPA  369

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y  LR  +    + + RAP FS  DTCYDL+G+  V+VPT+   F G  + +  A N LI
Sbjct  370  YVALRDAFRVGASHLKRAPEFSLFDTCYDLSGISEVKVPTVVMHFRGADV-SFPAANYLI  428

Query  45   PVNKRGIFCFAFA  7
            PV+  G FCFAFA
Sbjct  429  PVDNSGRFCFAFA  441



>ref|XP_004494825.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cicer 
arietinum]
Length=473

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 138/317 (44%), Positives = 188/317 (59%), Gaps = 6/317 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTP +Y ++ +DTGS+++W+QC PC+ C+ Q DP+FDPT+S +FA
Sbjct  122  GLSQGSGEYFTRIGVGTPAKYVFMVLDTGSDVVWLQCAPCRKCYSQQDPIFDPTKSRTFA  181

Query  762  IVPCSSTICNRIH-LGCTRGR--CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCS  592
             +PC + +C R+   GC      C Y + Y DGS+  G    ET+TF  T V  V  GC 
Sbjct  182  GIPCGAPLCRRLDSSGCNNKNKVCQYQVSYGDGSFTFGDFSTETLTFRKTRVTRVAFGCG  241

Query  591  QTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPV  415
              N+G+  GA GLLGL  G ++F  Q   +    FSYCL    A +   S+ FG   +  
Sbjct  242  HDNEGLFVGADGLLGLGRGRLSFPVQTGRRFNQKFSYCLVDRSASAKPSSIVFGDSAVSR  301

Query  414  GAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRL  238
             A + PLL++ +  T YY+ L G+ VG   +  +S  +F+L   GNGGVI+D GTSVTRL
Sbjct  302  TARFTPLLKNPKLDTFYYLELLGISVGGAPVRGVSASLFKLDPAGNGGVIIDSGTSVTRL  361

Query  237  PKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAK  58
             + AY  LR  +    + + RAP FS  DTC+DL+GL  V+VPT+   F    + +L A 
Sbjct  362  TRPAYIALRDAFRVGASHLKRAPEFSLFDTCFDLSGLTEVKVPTVVLHFRDSDV-SLPAT  420

Query  57   NILIPVNKRGIFCFAFA  7
            N LIPV+  G FCFAFA
Sbjct  421  NYLIPVDNSGSFCFAFA  437



>ref|XP_004512945.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cicer 
arietinum]
Length=502

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 128/311 (41%), Positives = 189/311 (61%), Gaps = 5/311 (2%)
 Frame = -2

Query  930  GIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFAIVPC  751
            G  EY  R+GVG P +  Y+ +DTGS++ W+QC+PC  C+ Q DP++DPT SS++  + C
Sbjct  163  GSGEYFTRLGVGQPEKPYYMVLDTGSDVNWIQCKPCSDCYQQSDPIYDPTTSSTYGPLTC  222

Query  750  SSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQTNQGM  574
             +  C  + +  C  G+C Y + Y DGS+ +G  V ET++FG   V  V +GC   N+G+
Sbjct  223  EAQQCQALEISACRNGKCLYQVSYGDGSFTVGEFVTETVSFGSGSVNRVAIGCGHDNEGL  282

Query  573  VTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAVWVPL  394
              GA GLLGL GG+++  +QI   +   FSYCL    +  S +LEF     P  +V  P+
Sbjct  283  FVGAAGLLGLGGGALSLTSQIKASS---FSYCLVDRDSAKSSTLEFN-SARPSDSVTAPM  338

Query  393  LRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVAYETL  214
            L++ +  T YY+ L+G+ VG   + +  ++F   +   GGVI+D GT+VTRL   AYE++
Sbjct  339  LKNQKLDTFYYVQLTGMSVGGEMVNVPPEIFETDQSTGGGVIIDSGTAVTRLQSQAYESV  398

Query  213  RYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILIPVNK  34
            R  +      +  A   +  DTCYDL+ L +V+VPT+SF F   ++W L AKN LIPV+ 
Sbjct  399  RDAFKRLTQNLRSAEGVAIFDTCYDLSSLRSVRVPTVSFHFGNDRVWDLPAKNYLIPVDS  458

Query  33   RGIFCFAFAPS  1
             G FCFAFAP+
Sbjct  459  DGTFCFAFAPT  469



>ref|XP_010916474.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=512

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 138/323 (43%), Positives = 185/323 (57%), Gaps = 12/323 (4%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G PP+  Y+ +DTGS++ WVQCQPC  C+ Q DP+FDP+ SSS++
Sbjct  160  GTSQGSGEYFSRVGIGNPPKPLYMVLDTGSDVTWVQCQPCADCYEQSDPIFDPSASSSYS  219

Query  762  IVPCSSTICNRIHLGCTRGR--------CSYGIVYIDGSYNMGTMVQETITFGGTV-VRD  610
             +PC S  C  + +   R          C Y + Y DGSY +G    ET+T G +  V  
Sbjct  220  PLPCDSPRCRALDISACRNSSGGAEGSSCLYQVSYGDGSYTVGDFGTETVTLGDSAPVAG  279

Query  609  VTMGCSQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGR  430
            V  GC   N+G+  GA GLL L GG ++F +QI  ++    SYCL    + +S +LE G 
Sbjct  280  VAFGCGHDNEGLFVGAAGLLALGGGPLSFPSQISARS---LSYCLVDRDSPASSTLELGA  336

Query  429  EIIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTS  250
                   V  PLLR+ +  T YY+GLSG+ VG   L I    F + E G+GGVI+D GT+
Sbjct  337  SAASGAEVAAPLLRNRKLDTFYYVGLSGISVGGKMLSIPPSSFAMDESGSGGVIVDSGTA  396

Query  249  VTRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWT  70
            VTRL   AY  LR  +    A +P A   S  DTCYDL+   +V+VPT+ F F  G+   
Sbjct  397  VTRLQADAYGALRDAFRRGTAGLPAAEGVSLFDTCYDLSSRTSVEVPTVGFHFPQGRELR  456

Query  69   LAAKNILIPVNKRGIFCFAFAPS  1
            L AKN LIPV+  G +C AFAP+
Sbjct  457  LPAKNYLIPVDGVGTYCLAFAPT  479



>ref|XP_003565317.2| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brachypodium 
distachyon]
Length=529

 Score =   244 bits (624),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 142/319 (45%), Positives = 184/319 (58%), Gaps = 16/319 (5%)
 Frame = -2

Query  930  GIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFAIVPC  751
            G  EY  RIG+G+P +  Y+ +DTGS++ W+QC PC  C+ Q DP+FDP  SSS+A VPC
Sbjct  181  GSGEYFSRIGIGSPARQLYMVLDTGSDVTWLQCAPCADCYAQSDPLFDPALSSSYATVPC  240

Query  750  SSTICNRI-----HLGCTRGR--CSYGIVYIDGSYNMGTMVQETITFGG---TVVRDVTM  601
             S  C  +     H     G   C Y + Y DGSY +G    ET+T GG     V DV +
Sbjct  241  DSPHCRALDASACHNNAANGNSSCVYEVAYGDGSYTVGDFATETLTLGGDGSAAVHDVAI  300

Query  600  GCSQTNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREII  421
            GC   N+G+  GA GLL L GG ++F +QI   +   FSYCL    + S+ +L+FG    
Sbjct  301  GCGHDNEGLFVGAAGLLALGGGPLSFPSQI---SATEFSYCLVDRDSPSASTLQFGAS--  355

Query  420  PVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKL-PISEDVFRLTEQGNGGVIMDIGTSVT  244
                V  PL+RS R+ T YY+ L+G+ VG   L  I    F + EQG+GGVI+D GT+VT
Sbjct  356  DSSTVTAPLMRSPRSNTFYYVALNGISVGGETLSDIPPAAFAMDEQGSGGVIVDSGTAVT  415

Query  243  RLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLA  64
            RL   AY  LR  ++     +PRA   S  DTCYDL G  +VQVP +S  F GG    L 
Sbjct  416  RLQSSAYSALRDAFVRGTQALPRASGVSLFDTCYDLAGRSSVQVPAVSLRFEGGGELKLP  475

Query  63   AKNILIPVNKRGIFCFAFA  7
            AKN LIPV+  G +C AFA
Sbjct  476  AKNYLIPVDGAGTYCLAFA  494



>ref|XP_010265215.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Nelumbo 
nucifera]
Length=494

 Score =   243 bits (620),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 140/316 (44%), Positives = 195/316 (62%), Gaps = 6/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+G+G P +  Y+ IDTGS++ WVQC PC  C+ Q DP+++P+ SSS++
Sbjct  150  GMSQGSGEYFSRLGIGVPAKQLYMVIDTGSDVNWVQCAPCTDCYDQADPIYEPSSSSSYS  209

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + C S  C  + +  C  G C Y + Y DGSY +G  V ETITFG +  V ++ +GC  
Sbjct  210  PLSCDSEQCKSLDVSACRNGSCLYQVSYGDGSYTVGDFVTETITFGNSGAVNNIALGCGH  269

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  GA GL+GL GGS++F +QI   +    SYCL    + SS +LEF     P  A
Sbjct  270  DNEGLFIGAAGLIGLGGGSLSFPSQIKASS---LSYCLVDRDSSSSSTLEFDAPE-PSDA  325

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V  PLLR+ +  T YY+GL+G+ VG   L I   +F + E GNGGVI+D GT+VTRL   
Sbjct  326  VTAPLLRNTQLDTFYYVGLTGISVGGELLSIPPSLFAVDESGNGGVIVDSGTAVTRLKTE  385

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY +LR  ++     +P     +  DTCYDL+   +V+VPT++F F GG+   L AKN L
Sbjct  386  AYNSLRDAFVKGTGDLPSTSGVALFDTCYDLSSKTSVEVPTVTFHFPGGKSLPLPAKNYL  445

Query  48   IPVNKRGIFCFAFAPS  1
            +PV+ +G FCFAFAP+
Sbjct  446  VPVDSQGTFCFAFAPT  461



>ref|XP_007152794.1| hypothetical protein PHAVU_004G160200g [Phaseolus vulgaris]
 gb|ESW24788.1| hypothetical protein PHAVU_004G160200g [Phaseolus vulgaris]
Length=486

 Score =   243 bits (619),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 135/316 (43%), Positives = 189/316 (60%), Gaps = 6/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVG P +  ++ +DTGS++ W+QC+PC  C+ Q DPVFDPT SSS+ 
Sbjct  142  GTSQGSGEYFSRVGVGQPAKPFFMVLDTGSDVNWLQCKPCSDCYQQTDPVFDPTSSSSYY  201

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             + C +  C  + +  C  GRC Y + Y DGS+ +G  V ET++FGG+  V  V MGC  
Sbjct  202  PLTCDAQQCQDLEMSACRNGRCLYQVAYGDGSFTVGEYVTETVSFGGSGSVNRVAMGCGH  261

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  GA GLLGL GG ++  +QI   +   FSYCL    +  S +LEF     P  +
Sbjct  262  DNEGLFIGAAGLLGLGGGPLSLTSQIKAAS---FSYCLVDRDSGKSSTLEFNSPR-PGDS  317

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V  PLL++ +  T YY+ L+G  VG   + I  + F + + G GGVI+D GT++TRL   
Sbjct  318  VTAPLLKNQKVNTFYYVELTGFSVGGDIVSIPPETFAVDQSGVGGVIVDSGTAITRLRTQ  377

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY  +R  +      +  A   +  DTCYDL+ L +V+VPT+SF F G + W L AKN L
Sbjct  378  AYNAVRDAFKRMTQNLRPADGVALFDTCYDLSSLQSVRVPTVSFHFAGDKTWALPAKNYL  437

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+  G +CFAFAP+
Sbjct  438  IPVDSAGTYCFAFAPT  453



>ref|XP_006485768.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Citrus 
sinensis]
Length=495

 Score =   243 bits (619),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 132/316 (42%), Positives = 191/316 (60%), Gaps = 6/316 (2%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  RIGVGTPP+   + +DTGS++ W+QC+PC  C+ Q DP+FDP  SSS++
Sbjct  151  GASQGSGEYFSRIGVGTPPRQFSMVLDTGSDINWLQCRPCTECYQQSDPIFDPKTSSSYS  210

Query  762  IVPCSSTICNRIHL-GCTRGRCSYGIVYIDGSYNMGTMVQETITFGGT-VVRDVTMGCSQ  589
             +PC++  C  + +  C   RC Y + Y DGSY +G +V ET++FG +  V+ + +GC  
Sbjct  211  PLPCAAPQCKSLDVSACRANRCLYQVAYGDGSYTVGDLVTETVSFGNSGSVKGIALGCGH  270

Query  588  TNQGMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGA  409
             N+G+  G+ GLLGL GG ++   QI   +    +YCL    + +SG LEF        A
Sbjct  271  DNEGLFVGSAGLLGLGGGMLSLTKQIKAMS---LAYCLVDRDSPASGVLEFN-SARGGDA  326

Query  408  VWVPLLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKV  229
            V  PL+R+ +  T YY+GL+G  VG   + I   +F + E G+GG+I+D GT++TRL   
Sbjct  327  VTAPLIRNKKVDTFYYVGLTGFSVGGQAVQIPPSLFEMDEAGDGGIIVDCGTAITRLQTQ  386

Query  228  AYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNIL  49
            AY +LR  ++     +      +  DTCYD +GL +V+VPT+S  F  G+   L AKN L
Sbjct  387  AYNSLRDSFVRLAGNLKPTSGVALFDTCYDFSGLRSVRVPTVSLHFGAGKALDLPAKNYL  446

Query  48   IPVNKRGIFCFAFAPS  1
            IPV+  G FCFAFAP+
Sbjct  447  IPVDSAGTFCFAFAPT  462



>gb|KFK42512.1| hypothetical protein AALP_AA1G003500 [Arabis alpina]
Length=477

 Score =   242 bits (618),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 142/321 (44%), Positives = 195/321 (61%), Gaps = 14/321 (4%)
 Frame = -2

Query  942  GWDLGIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFA  763
            G   G  EY  R+GVGTP +Y Y+ +DTGS+++W+QC PCK C+ Q DP++DP +S++++
Sbjct  126  GLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCKRCYSQSDPIYDPRKSTTYS  185

Query  762  IVPCSSTICNRIH-LGC-TRGR-CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCS  592
             + CSS +C R+   GC TR R C Y + Y DGS+ +G    ET+TF    V+ V +GC 
Sbjct  186  TISCSSPLCKRLDSAGCNTRRRTCLYQVSYGDGSFTVGDFSTETLTFRRNRVKGVAVGCG  245

Query  591  QTNQGMVTgaggllglagGSMTFMAQIPGQTGG----VFSYCLASWHAESS-GSLEFGRE  427
              N+G+  GA GLLGL  G ++F    PGQTG      FSYCL    A S   S+ FG  
Sbjct  246  HDNEGLFVGAAGLLGLGKGKLSF----PGQTGHRFNQKFSYCLVDRSASSKPSSVVFGNA  301

Query  426  IIPVGAVWVPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTS  250
             +   A + PLL + +  T YY+ L G+ VG  ++P ++  VF+L   GNGGVI+D GTS
Sbjct  302  AVSRTAKFTPLLSNPKLDTFYYVELLGISVGGTRVPGVTASVFKLDSIGNGGVIIDSGTS  361

Query  249  VTRLPKVAYETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWT  70
            VTRL + AY  +R  +     T+ RA  FS  DTC+DL+    V+VPT+   F G  + +
Sbjct  362  VTRLIRPAYIAMRDAFRVGSRTLKRATDFSLFDTCFDLSNQNEVKVPTVVLHFRGADV-S  420

Query  69   LAAKNILIPVNKRGIFCFAFA  7
            L A N LIPV+  G FCFAFA
Sbjct  421  LPATNYLIPVDTNGKFCFAFA  441



>ref|XP_003520873.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=461

 Score =   241 bits (616),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 138/313 (44%), Positives = 189/313 (60%), Gaps = 6/313 (2%)
 Frame = -2

Query  930  GIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFAIVPC  751
            G  EY  RIGVGTP +Y Y+ +DTGS+++W+QC PC+ C+ Q D VFDPT+S ++A +PC
Sbjct  114  GSGEYFTRIGVGTPARYVYMVLDTGSDVVWLQCAPCRKCYTQTDHVFDPTKSRTYAGIPC  173

Query  750  SSTICNRIHL-GCTRGR--CSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQTNQ  580
             + +C R+   GC+     C Y + Y DGS+  G    ET+TF    V  V +GC   N+
Sbjct  174  GAPLCRRLDSPGCSNKNKVCQYQVSYGDGSFTFGDFSTETLTFRRNRVTRVALGCGHDNE  233

Query  579  GMVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESS-GSLEFGREIIPVGAVW  403
            G+ TGA GLLGL  G ++F  Q   +    FSYCL    A +   S+ FG   +   A +
Sbjct  234  GLFTGAAGLLGLGRGRLSFPVQTGRRFNHKFSYCLVDRSASAKPSSVIFGDSAVSRTAHF  293

Query  402  VPLLRSIRAPTTYYIGLSGLGVGNIKLP-ISEDVFRLTEQGNGGVIMDIGTSVTRLPKVA  226
             PL+++ +  T YY+ L G+ VG   +  +S  +FRL   GNGGVI+D GTSVTRL + A
Sbjct  294  TPLIKNPKLDTFYYLELLGISVGGAPVRGLSASLFRLDAAGNGGVIIDSGTSVTRLTRPA  353

Query  225  YETLRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILI  46
            Y  LR  +    + + RAP FS  DTC+DL+GL  V+VPT+   F G  + +L A N LI
Sbjct  354  YIALRDAFRIGASHLKRAPEFSLFDTCFDLSGLTEVKVPTVVLHFRGADV-SLPATNYLI  412

Query  45   PVNKRGIFCFAFA  7
            PV+  G FCFAFA
Sbjct  413  PVDNSGSFCFAFA  425



>ref|XP_002979394.1| hypothetical protein SELMODRAFT_53966, partial [Selaginella moellendorffii]
 gb|EFJ19802.1| hypothetical protein SELMODRAFT_53966, partial [Selaginella moellendorffii]
Length=353

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 131/311 (42%), Positives = 185/311 (59%), Gaps = 3/311 (1%)
 Frame = -2

Query  930  GIAEYVVRIGVGTPPQYQYLEIDTGSNLMWVQCQPCKPCFPQYDPVFDPTRSSSFAIVPC  751
            G  +Y  RIGVGTP +  Y+  DTGS++ W+QC PC+ C+ Q DP+F+P+ SSSF  + C
Sbjct  10   GSGDYFARIGVGTPARSVYMVADTGSDVSWLQCSPCRKCYRQQDPIFNPSLSSSFKPLAC  69

Query  750  SSTICNRIHL-GCTR-GRCSYGIVYIDGSYNMGTMVQETITFGGTVVRDVTMGCSQTNQG  577
            +S+IC ++ + GC+R  +C Y + Y DGS+ +G    ET++FG   VR V MGC + NQG
Sbjct  70   ASSICGKLKIKGCSRKNKCMYQVSYGDGSFTVGDFSTETLSFGEHAVRSVAMGCGRNNQG  129

Query  576  MVTgaggllglagGSMTFMAQIPGQTGGVFSYCLASWHAESSGSLEFGREIIPVGAVWVP  397
            +  GA GLLGL  G ++F +Q       VFSYCL    +  + SL FG   +P  A +  
Sbjct  130  LFHGAAGLLGLGRGPLSFPSQTGTSYASVFSYCLPRRESAIAASLVFGPSAVPEKARFTK  189

Query  396  LLRSIRAPTTYYIGLSGLGVGNIKLPISEDVFRLTEQGNGGVIMDIGTSVTRLPKVAYET  217
            LL + R  T YY+GL+ + V    + I  D F +  +G GGVI+D GT+++RL   AY  
Sbjct  190  LLPNRRLDTYYYVGLARIRVAGSPVNIPPDAFAMGSRGTGGVIVDSGTAISRLTTPAYTA  249

Query  216  LRYIYMTQIATIPRAPSFSQLDTCYDLNGLGTVQVPTISFFFTGGQIWTLAAKNILIPVN  37
            LR  + + + T P AP  S  DTCYDL+ + T  +P +   F GG    L A  IL+ V+
Sbjct  250  LRDAFRS-LVTFPSAPGISLFDTCYDLSSMKTATLPAVVLDFDGGASMPLPADGILVNVD  308

Query  36   KRGIFCFAFAP  4
              G +C AFAP
Sbjct  309  DEGTYCLAFAP  319



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2290717995426