BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25666_g2_i4 len=2689 path=[8300:0-370 197:371-399 226:400-523
@350@!:524-744 571:745-754 10472:755-771 10489:772-779 606:780-820
6572:821-823 6575:824-827 654:828-859 686:860-1035 862:1036-1047
874:1048-1100 927:1101-1139 966:1140-1186 1013:1187-1214
1041:1215-1276 1103:1277-1346 1173:1347-1375 1202:1376-1408
1235:1409-1415 1242:1416-1587 1414:1588-1727 1554:1728-1755
6027:1756-1808 6080:1809-1919 1746:1920-1957 1784:1958-1972
1799:1973-2017 10797:2018-2026 6214:2027-2039 1866:2040-2051
1878:2052-2076 1903:2077-2084 1911:2085-2121 7296:2122-2150
1977:2151-2175 5052:2176-2194 2021:2195-2233 5136:2234-2454
2284:2455-2479 9651:2480-2688]

Length=2689
                                                                      Score     E

ref|XP_009630206.1|  PREDICTED: probable acyl-activating enzyme 1...   1052   0.0      
ref|XP_009794482.1|  PREDICTED: probable acyl-activating enzyme 1...   1041   0.0      
ref|XP_006360961.1|  PREDICTED: probable acyl-activating enzyme 1...   1039   0.0      
ref|XP_004247889.1|  PREDICTED: probable acyl-activating enzyme 1...   1028   0.0      
emb|CDP15104.1|  unnamed protein product                               1004   0.0      
ref|XP_011101589.1|  PREDICTED: LOW QUALITY PROTEIN: probable acy...    997   0.0      
ref|XP_007221302.1|  hypothetical protein PRUPE_ppa001870mg             974   0.0      
ref|XP_010653199.1|  PREDICTED: probable acyl-activating enzyme 1...    968   0.0      
ref|XP_003524920.1|  PREDICTED: probable acyl-activating enzyme 1...    966   0.0      
ref|XP_008222738.1|  PREDICTED: probable acyl-activating enzyme 1...    964   0.0      
ref|XP_004296965.1|  PREDICTED: probable acyl-activating enzyme 1...    964   0.0      
ref|XP_008380459.1|  PREDICTED: probable acyl-activating enzyme 1...    961   0.0      
gb|EYU31521.1|  hypothetical protein MIMGU_mgv1a001985mg                958   0.0      
ref|XP_009373573.1|  PREDICTED: probable acyl-activating enzyme 1...    952   0.0      
ref|XP_007034195.1|  AMP-dependent synthetase and ligase family p...    950   0.0      
ref|XP_011010078.1|  PREDICTED: probable acyl-activating enzyme 1...    946   0.0      
gb|KDP32594.1|  hypothetical protein JCGZ_13144                         944   0.0      
ref|XP_011045809.1|  PREDICTED: probable acyl-activating enzyme 1...    942   0.0      
ref|XP_002298670.1|  AMP-binding family protein                         938   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006369826.1|  hypothetical protein POPTR_0001s32900g             936   0.0      
gb|AET04094.2|  long-chain-fatty-acid CoA ligase (AMP-forming)          933   0.0      
ref|XP_003601697.1|  Annotation was added to scaffolds in Novembe...    929   0.0      
ref|XP_006492527.1|  PREDICTED: probable acyl-activating enzyme 1...    927   0.0      
ref|XP_006421037.1|  hypothetical protein CICLE_v10004427mg             926   0.0      
ref|XP_007153625.1|  hypothetical protein PHAVU_003G051300g             925   0.0      
ref|XP_004502250.1|  PREDICTED: probable acyl-activating enzyme 1...    924   0.0      
ref|XP_004138459.1|  PREDICTED: probable acyl-activating enzyme 1...    924   0.0      
ref|XP_008458147.1|  PREDICTED: probable acyl-activating enzyme 1...    922   0.0      
ref|XP_007163805.1|  hypothetical protein PHAVU_001G265700g             921   0.0      
ref|XP_008222768.1|  PREDICTED: probable acyl-activating enzyme 1...    915   0.0      
ref|XP_003537522.1|  PREDICTED: probable acyl-activating enzyme 1...    914   0.0      
gb|KHN44470.1|  Putative acyl-activating enzyme 16, chloroplastic       913   0.0      
ref|XP_004170826.1|  PREDICTED: probable acyl-activating enzyme 1...    913   0.0      
gb|KHG16797.1|  putative acyl-activating enzyme 16, chloroplastic       912   0.0      
gb|KHG16796.1|  putative acyl-activating enzyme 16, chloroplastic       912   0.0      
ref|XP_007221278.1|  hypothetical protein PRUPE_ppa001880mg             910   0.0      
gb|AES71951.2|  long-chain-fatty-acid CoA ligase (AMP-forming)          909   0.0      
ref|XP_010023616.1|  PREDICTED: probable acyl-activating enzyme 1...    908   0.0      
ref|XP_010023617.1|  PREDICTED: long-chain-fatty-acid--[acyl-carr...    907   0.0      
ref|XP_010247392.1|  PREDICTED: probable acyl-activating enzyme 1...    900   0.0      
ref|NP_189021.2|  acyl activating enzyme 16                             897   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAM28629.1|AF503771_1  acyl-CoA synthetase-like protein              897   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008222739.1|  PREDICTED: probable acyl-activating enzyme 1...    895   0.0      
ref|XP_010488454.1|  PREDICTED: probable acyl-activating enzyme 1...    894   0.0      
ref|XP_002885598.1|  hypothetical protein ARALYDRAFT_898924             894   0.0      
ref|XP_010527443.1|  PREDICTED: probable acyl-activating enzyme 1...    893   0.0      
ref|XP_006299603.1|  hypothetical protein CARUB_v10015782mg             893   0.0      
ref|XP_010466735.1|  PREDICTED: probable acyl-activating enzyme 1...    890   0.0      
ref|XP_009373570.1|  PREDICTED: probable acyl-activating enzyme 1...    890   0.0      
gb|KFK39674.1|  amp-binding protein                                     888   0.0      
ref|XP_010527441.1|  PREDICTED: probable acyl-activating enzyme 1...    888   0.0      
ref|XP_010673322.1|  PREDICTED: probable acyl-activating enzyme 1...    886   0.0      
ref|XP_010532731.1|  PREDICTED: probable acyl-activating enzyme 1...    884   0.0      
ref|XP_004296968.1|  PREDICTED: probable acyl-activating enzyme 1...    884   0.0      
ref|XP_003629618.1|  Annotation was added to scaffolds in Novembe...    883   0.0      
ref|XP_010512892.1|  PREDICTED: probable acyl-activating enzyme 1...    879   0.0      
ref|XP_006418838.1|  hypothetical protein EUTSA_v10002419mg             878   0.0      
ref|XP_006830562.1|  hypothetical protein AMTR_s00117p00114400          877   0.0      
ref|XP_010532730.1|  PREDICTED: probable acyl-activating enzyme 1...    877   0.0      
ref|XP_009373571.1|  PREDICTED: probable acyl-activating enzyme 1...    876   0.0      
ref|XP_008794653.1|  PREDICTED: LOW QUALITY PROTEIN: probable acy...    875   0.0      
ref|XP_009135864.1|  PREDICTED: probable acyl-activating enzyme 1...    872   0.0      
gb|AAM28628.1|AF503770_1  acyl-CoA synthetase-like protein              867   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009135863.1|  PREDICTED: probable acyl-activating enzyme 1...    865   0.0      
ref|XP_010435196.1|  PREDICTED: long-chain-fatty-acid--[acyl-carr...    865   0.0      
ref|NP_193143.2|  long-chain-fatty-acid--[acyl-carrier-protein] l...    864   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDY53212.1|  BnaC03g74060D                                          863   0.0      
ref|XP_010905150.1|  PREDICTED: probable acyl-activating enzyme 1...    863   0.0      
ref|XP_010905151.1|  PREDICTED: probable acyl-activating enzyme 1...    862   0.0      
emb|CDY01190.1|  BnaA04g06290D                                          862   0.0      
ref|XP_006421036.1|  hypothetical protein CICLE_v10004427mg             861   0.0      
ref|XP_010450111.1|  PREDICTED: long-chain-fatty-acid--[acyl-carr...    861   0.0      
ref|XP_010435195.1|  PREDICTED: long-chain-fatty-acid--[acyl-carr...    860   0.0      
emb|CDY67321.1|  BnaA03g57590D                                          860   0.0      
ref|XP_007034196.1|  AMP-dependent synthetase and ligase family p...    856   0.0      
ref|XP_009139565.1|  PREDICTED: long-chain-fatty-acid--[acyl-carr...    859   0.0      
ref|XP_006285501.1|  hypothetical protein CARUB_v10006937mg             858   0.0      
gb|KFK36301.1|  hypothetical protein AALP_AA4G104500                    857   0.0      
emb|CAA96521.1|  AMP-binding protein                                    856   0.0      Brassica napus [oilseed rape]
ref|XP_002520618.1|  long-chain-fatty-acid CoA ligase, putative         852   0.0      Ricinus communis
ref|XP_006414818.1|  hypothetical protein EUTSA_v10024478mg             857   0.0      
emb|CDY12731.1|  BnaC04g29100D                                          855   0.0      
ref|XP_008665752.1|  PREDICTED: probable acyl-activating enzyme 1...    857   0.0      
ref|XP_002868316.1|  acyl-activating enzyme 15                          854   0.0      
ref|XP_006665086.1|  PREDICTED: probable acyl-activating enzyme 1...    850   0.0      
ref|XP_010532733.1|  PREDICTED: probable acyl-activating enzyme 1...    853   0.0      
ref|XP_004981061.1|  PREDICTED: probable acyl-activating enzyme 1...    850   0.0      
ref|NP_001051878.1|  Os03g0845500                                       845   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CAB10186.1|  AMP-binding protein                                    839   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010229410.1|  PREDICTED: probable acyl-activating enzyme 1...    835   0.0      
gb|KDO47449.1|  hypothetical protein CISIN_1g0065302mg                  813   0.0      
gb|EMS60031.1|  Long-chain-fatty-acid--CoA ligase FadD15                816   0.0      
ref|XP_006414817.1|  hypothetical protein EUTSA_v10024478mg             806   0.0      
gb|EEC76517.1|  hypothetical protein OsI_14303                          791   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_007034198.1|  AMP-dependent synthetase and ligase family p...    779   0.0      
ref|XP_007034200.1|  AMP-dependent synthetase and ligase family p...    778   0.0      
ref|XP_010466736.1|  PREDICTED: probable acyl-activating enzyme 1...    764   0.0      
ref|XP_010488455.1|  PREDICTED: probable acyl-activating enzyme 1...    764   0.0      
gb|EMT11835.1|  Long-chain-fatty-acid--CoA ligase 1                     765   0.0      
gb|EMS60032.1|  Long-chain-fatty-acid--CoA ligase FadD15                762   0.0      
ref|XP_010532734.1|  PREDICTED: probable acyl-activating enzyme 1...    755   0.0      
ref|XP_010512900.1|  PREDICTED: probable acyl-activating enzyme 1...    754   0.0      
ref|XP_010527445.1|  PREDICTED: probable acyl-activating enzyme 1...    748   0.0      
gb|EMT11836.1|  Long-chain-fatty-acid--CoA ligase 1                     752   0.0      
ref|XP_010527446.1|  PREDICTED: probable acyl-activating enzyme 1...    746   0.0      
ref|XP_009373572.1|  PREDICTED: probable acyl-activating enzyme 1...    742   0.0      
ref|XP_010532735.1|  PREDICTED: probable acyl-activating enzyme 1...    737   0.0      
ref|XP_010247393.1|  PREDICTED: long-chain-fatty-acid--[acyl-carr...    722   0.0      
gb|KDO47450.1|  hypothetical protein CISIN_1g0065302mg                  697   0.0      
ref|XP_002520615.1|  long-chain-fatty-acid CoA ligase, putative         698   0.0      Ricinus communis
ref|XP_006373098.1|  hypothetical protein POPTR_0017s087001g            678   0.0      
ref|XP_010097961.1|  Long-chain-fatty-acid--[acyl-carrier-protein...    675   0.0      
ref|XP_003601698.1|  Annotation was added to scaffolds in Novembe...    671   0.0      
ref|XP_001774133.1|  predicted protein                                  676   0.0      
gb|KDO47451.1|  hypothetical protein CISIN_1g0065302mg                  668   0.0      
ref|XP_006665087.1|  PREDICTED: probable acyl-activating enzyme 1...    666   0.0      
ref|XP_002962119.1|  hypothetical protein SELMODRAFT_76207              667   0.0      
ref|XP_002970967.1|  hypothetical protein SELMODRAFT_95195              665   0.0      
gb|ABF99869.1|  AMP-binding protein, putative, expressed                656   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_001777520.1|  predicted protein                                  654   0.0      
ref|XP_007034199.1|  AMP-dependent synthetase and ligase family p...    639   0.0      
ref|XP_007034197.1|  AMP-dependent synthetase and ligase family p...    619   0.0      
gb|KDO47452.1|  hypothetical protein CISIN_1g0065302mg                  614   0.0      
ref|XP_003601700.1|  Annotation was added to scaffolds in Novembe...    583   0.0      
gb|KDO47453.1|  hypothetical protein CISIN_1g0065302mg                  550   0.0      
dbj|BAD94085.1|  A6 anther-specific protein                             534   1e-178   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009412885.1|  PREDICTED: probable acyl-activating enzyme 1...    502   1e-163   
ref|WP_015230005.1|  AMP-forming long-chain acyl-CoA synthetase         487   5e-157   
ref|WP_017654245.1|  long-chain fatty acid--CoA ligase                  486   3e-156   
ref|WP_026222074.1|  long-chain fatty acid--CoA ligase                  473   2e-151   
ref|WP_015136927.1|  AMP-forming long-chain acyl-CoA synthetase         471   9e-151   
ref|WP_035989484.1|  long-chain fatty acid--CoA ligase                  471   1e-150   
ref|WP_015227680.1|  AMP-dependent synthetase and ligase                470   2e-150   
ref|WP_015160237.1|  AMP-forming long-chain acyl-CoA synthetase         469   7e-150   
ref|WP_006631982.1|  long-chain fatty acid--CoA ligase                  468   1e-149   
ref|WP_015194635.1|  Long-chain-fatty-acid--CoA ligase                  467   3e-149   
ref|WP_011319906.1|  long-chain fatty acid--CoA ligase                  465   2e-148   
ref|WP_017299996.1|  hypothetical protein                               464   3e-148   
ref|WP_009556060.1|  AMP-forming long-chain acyl-CoA synthetase         464   4e-148   
ref|WP_036008122.1|  long-chain fatty acid--CoA ligase                  464   5e-148   
ref|WP_017319192.1|  long-chain fatty acid--CoA ligase                  462   5e-147   
ref|WP_030005920.1|  long-chain fatty acid--CoA ligase                  461   6e-147   
ref|WP_012593707.1|  MULTISPECIES: long-chain fatty acid--CoA ligase    461   8e-147   
ref|WP_010997751.1|  long-chain fatty acid--CoA ligase                  462   9e-147   
ref|WP_012306304.1|  long-chain fatty acid--CoA ligase                  461   1e-146   
ref|WP_009456154.1|  MULTISPECIES: long-chain fatty acid--CoA ligase    461   2e-146   
ref|WP_016869319.1|  long-chain fatty acid--CoA ligase                  460   2e-146   
ref|WP_019495179.1|  hypothetical protein                               459   2e-146   
ref|WP_015179466.1|  Long-chain-fatty-acid--CoA ligase                  459   3e-146   
ref|WP_026732497.1|  long-chain fatty acid--CoA ligase                  459   6e-146   
ref|WP_006099512.1|  long-chain fatty acid--CoA ligase                  458   9e-146   
ref|WP_028091012.1|  long-chain fatty acid--CoA ligase                  457   2e-145   
ref|WP_006510671.1|  AMP-forming long-chain acyl-CoA synthetase         457   3e-145   
ref|WP_016876481.1|  long-chain fatty acid--CoA ligase                  457   3e-145   
ref|WP_006195846.1|  long-chain fatty acid--CoA ligase                  457   5e-145   
ref|WP_028085498.1|  long-chain fatty acid--CoA ligase                  456   6e-145   
ref|WP_039755787.1|  long-chain fatty acid--CoA ligase                  456   8e-145   
ref|WP_017745833.1|  long-chain fatty acid--CoA ligase                  456   1e-144   
ref|WP_024546827.1|  long-chain fatty acid--CoA ligase                  455   1e-144   
ref|WP_011242936.1|  long-chain fatty acid--CoA ligase                  453   7e-144   
ref|WP_027403759.1|  long-chain fatty acid--CoA ligase                  453   7e-144   
ref|WP_015112569.1|  long-chain-fatty-acid--CoA ligase                  453   9e-144   
ref|WP_039726338.1|  long-chain fatty acid--CoA ligase                  453   1e-143   
ref|WP_006099666.1|  long-chain fatty acid--CoA ligase                  454   1e-143   
ref|WP_015171245.1|  AMP-dependent synthetase and ligase                452   2e-143   
ref|WP_008277348.1|  long-chain fatty acid--CoA ligase                  451   3e-143   
ref|WP_015083357.1|  AMP-dependent synthetase and ligase                452   3e-143   
ref|WP_006529031.1|  AMP-forming long-chain acyl-CoA synthetase         451   4e-143   
ref|WP_015143127.1|  AMP-forming long-chain acyl-CoA synthetase         451   5e-143   
ref|WP_015183076.1|  AMP-forming long-chain acyl-CoA synthetase         452   5e-143   
ref|WP_016951321.1|  long-chain fatty acid--CoA ligase                  452   5e-143   
ref|WP_016864475.1|  long-chain fatty acid--CoA ligase                  451   6e-143   
ref|WP_011377787.1|  long-chain fatty acid--CoA ligase                  451   7e-143   
ref|WP_015212903.1|  Long-chain-fatty-acid--CoA ligase                  450   1e-142   
ref|WP_013190687.1|  long-chain fatty acid--CoA ligase                  450   1e-142   
ref|WP_015130782.1|  long-chain-fatty-acid--CoA ligase                  450   2e-142   
ref|WP_009543965.1|  MULTISPECIES: long-chain fatty acid--CoA ligase    449   2e-142   
ref|WP_024124407.1|  long-chain-fatty-acid:[acyl-carrier protein]...    450   2e-142   
ref|WP_012630314.1|  long-chain fatty acid--CoA ligase                  450   3e-142   
ref|WP_015200141.1|  AMP-dependent synthetase and ligase                449   4e-142   
ref|WP_026721870.1|  long-chain fatty acid--CoA ligase                  449   6e-142   
ref|WP_006519553.1|  AMP-forming long-chain acyl-CoA synthetase         448   7e-142   
ref|WP_017309714.1|  long-chain fatty acid--CoA ligase                  447   2e-141   
ref|WP_006616497.1|  long-chain fatty acid--CoA ligase                  447   2e-141   
ref|WP_008190408.1|  long-chain fatty acid--CoA ligase                  447   2e-141   
ref|WP_017292788.1|  hypothetical protein                               446   3e-141   
ref|WP_038026639.1|  long-chain fatty acid--CoA ligase                  445   5e-141   
ref|WP_039201422.1|  long-chain fatty acid--CoA ligase                  446   5e-141   
ref|WP_009784468.1|  long-chain fatty acid--CoA ligase                  446   6e-141   
ref|WP_038093147.1|  long-chain fatty acid--CoA ligase                  446   6e-141   
ref|WP_015210069.1|  AMP-forming long-chain acyl-CoA synthetase         446   8e-141   
ref|WP_017319808.1|  long-chain fatty acid--CoA ligase                  446   9e-141   
ref|WP_017662217.1|  hypothetical protein                               445   1e-140   
ref|WP_036481162.1|  long-chain fatty acid--CoA ligase                  444   2e-140   
ref|WP_011057141.1|  long-chain fatty acid--CoA ligase                  444   2e-140   
ref|WP_015118913.1|  AMP-forming long-chain acyl-CoA synthetase         444   2e-140   
gb|AHJ26688.1|  Long-chain-fatty-acid--CoA ligase                       442   5e-140   
ref|WP_023067609.1|  AMP-binding enzyme family protein                  443   7e-140   
ref|WP_019505659.1|  hypothetical protein                               442   7e-140   
ref|WP_027841906.1|  long-chain fatty acid--CoA ligase                  442   1e-139   
ref|WP_008052332.1|  long-chain fatty acid--CoA ligase                  442   1e-139   
ref|WP_035159130.1|  long-chain fatty acid--CoA ligase                  442   1e-139   
ref|WP_035759345.1|  long-chain fatty acid--CoA ligase                  442   1e-139   
ref|WP_008318746.1|  AMP-forming long-chain acyl-CoA synthetase         442   2e-139   
ref|WP_006624419.1|  long-chain fatty acid--CoA ligase                  442   2e-139   
ref|WP_021830165.1|  Long-chain-fatty-acid--CoA ligase                  441   2e-139   
ref|WP_015189613.1|  Long-chain-fatty-acid--CoA ligase                  441   4e-139   
ref|WP_007304012.1|  long-chain fatty acid--CoA ligase                  440   8e-139   
ref|WP_007357266.1|  MULTISPECIES: long-chain fatty acid--CoA ligase    440   9e-139   
ref|WP_037217968.1|  long-chain fatty acid--CoA ligase                  440   1e-138   
ref|WP_012597852.1|  long-chain fatty acid--CoA ligase                  439   2e-138   
ref|WP_021836463.1|  Long-chain-fatty-acid--CoA ligase                  439   2e-138   
ref|WP_039748344.1|  long-chain fatty acid--CoA ligase                  439   3e-138   
ref|WP_015205129.1|  long-chain-fatty-acid--CoA ligase                  438   6e-138   
emb|CAN68253.1|  hypothetical protein VITISV_043922                     446   7e-138   Vitis vinifera
ref|WP_006453938.1|  long-chain fatty acid--CoA ligase                  437   1e-137   
ref|WP_015198061.1|  long-chain-fatty-acid--CoA ligase                  437   1e-137   
ref|WP_017305909.1|  hypothetical protein                               436   2e-137   
ref|WP_015224012.1|  AMP-dependent synthetase and ligase                436   3e-137   
ref|WP_012165737.1|  long-chain fatty acid--CoA ligase                  436   4e-137   
ref|WP_036946772.1|  long-chain fatty acid--CoA ligase                  434   7e-137   
ref|WP_015146448.1|  AMP-forming long-chain acyl-CoA synthetase         435   2e-136   
ref|WP_011611460.1|  long-chain fatty acid--CoA ligase                  434   2e-136   
ref|WP_002792569.1|  long-chain fatty acid--CoA ligase                  433   3e-136   
ref|WP_010476871.1|  long-chain fatty acid--CoA ligase                  433   4e-136   
gb|KHG01039.1|  putative acyl-activating enzyme 16, chloroplastic...    422   4e-136   
ref|WP_015163446.1|  o-succinylbenzoate--CoA ligase                     432   5e-136   
ref|WP_013324773.1|  long-chain fatty acid--CoA ligase                  431   2e-135   
ref|WP_002786219.1|  long-chain fatty acid--CoA ligase                  431   2e-135   
ref|WP_015154034.1|  AMP-dependent synthetase and ligase                432   2e-135   
ref|WP_023071993.1|  amp-forming long-chain acyl- synthetase            430   4e-135   
ref|WP_002764891.1|  long-chain fatty acid--CoA ligase                  430   4e-135   
ref|WP_015218552.1|  long-chain-fatty-acid--CoA ligase                  429   8e-135   
ref|WP_024970666.1|  long-chain fatty acid--CoA ligase                  429   9e-135   
ref|WP_022607660.1|  Long-chain acyl-CoA synthetase (AMP-forming)       429   1e-134   
ref|WP_031293345.1|  long-chain fatty acid--CoA ligase                  431   1e-134   
ref|WP_002801649.1|  long-chain fatty acid--CoA ligase                  429   1e-134   
ref|WP_002782035.1|  Long-chain-fatty-acid CoA ligase                   429   1e-134   
gb|ESA34965.1|  long-chain-fatty-acid-- ligase                          431   1e-134   
ref|WP_016515700.1|  Long-chain-fatty-acid--CoA ligase FadD15           429   1e-134   
ref|WP_002755702.1|  long-chain fatty acid--CoA ligase                  429   1e-134   
ref|WP_002740553.1|  AMP-binding enzyme family protein                  428   2e-134   
ref|WP_002737027.1|  AMP-binding enzyme family protein                  428   2e-134   
ref|WP_009626371.1|  Long-chain-fatty-acid--CoA ligase                  427   4e-134   
ref|WP_008203626.1|  long-chain fatty acid--CoA ligase                  427   5e-134   
ref|WP_029633861.1|  long-chain fatty acid--CoA ligase [                428   5e-134   
ref|WP_033334433.1|  long-chain fatty acid--CoA ligase                  429   5e-134   
ref|WP_014407070.1|  long-chain fatty acid--CoA ligase                  427   7e-134   
dbj|GAL91805.1|  long-chain-fatty-acid--CoA ligase                      426   1e-133   
ref|WP_017712353.1|  hypothetical protein                               427   1e-133   
ref|WP_015169215.1|  AMP-forming long-chain acyl-CoA synthetase         425   2e-133   
ref|WP_012268077.1|  long-chain fatty acid--CoA ligase                  426   2e-133   
ref|WP_015390133.1|  long-chain-fatty-acid CoA ligase                   427   3e-133   
ref|WP_002773019.1|  long-chain fatty acid--CoA ligase                  425   4e-133   
ref|WP_010871652.1|  long-chain fatty acid--CoA ligase                  426   5e-133   
ref|WP_002796528.1|  long-chain fatty acid--CoA ligase                  424   6e-133   
dbj|BAP17565.1|  long-chain-fatty-acid CoA ligase                       424   8e-133   
ref|WP_012412622.1|  long-chain fatty acid--CoA ligase                  424   8e-133   
ref|WP_038022034.1|  long-chain fatty acid--CoA ligase                  423   2e-132   
ref|WP_011433761.1|  long-chain fatty acid--CoA ligase                  423   2e-132   
gb|AIE74353.1|  Long-chain-fatty-acid--CoA ligase                       422   5e-132   
ref|WP_011429056.1|  long-chain fatty acid--CoA ligase                  421   7e-132   
ref|WP_026785662.1|  long-chain fatty acid--CoA ligase                  422   9e-132   
ref|WP_026796246.1|  long-chain fatty acid--CoA ligase                  421   1e-131   
ref|WP_027248814.1|  long-chain fatty acid--CoA ligase                  421   2e-131   
ref|WP_002756611.1|  long-chain fatty acid--CoA ligase                  420   2e-131   
ref|WP_026796111.1|  MULTISPECIES: long-chain fatty acid--CoA ligase    420   3e-131   
gb|KFF41113.1|  AMP-forming long-chain acyl-CoA synthetase              420   3e-131   
ref|WP_010315475.1|  long-chain fatty acid--CoA ligase                  418   2e-130   
ref|WP_036266845.1|  long-chain fatty acid--CoA ligase                  419   2e-130   
ref|WP_006171891.1|  long-chain fatty acid--CoA ligase                  418   2e-130   
dbj|BAM50739.1|  long-chain-fatty-acid CoA ligase                       414   3e-129   
gb|KEI66709.1|  FadD                                                    415   3e-129   
ref|WP_008232254.1|  Long-chain-fatty-acid--CoA ligase                  415   4e-129   
ref|WP_010310742.1|  long-chain fatty acid--CoA ligase                  414   6e-129   
ref|XP_002949145.1|  hypothetical protein VOLCADRAFT_120723             414   7e-129   
ref|WP_026098118.1|  long-chain fatty acid--CoA ligase                  414   2e-128   
ref|WP_039714229.1|  long-chain fatty acid--CoA ligase                  413   5e-128   
ref|WP_006042062.1|  long-chain fatty acid--CoA ligase                  410   2e-127   
gb|EPS66812.1|  hypothetical protein M569_07964                         394   6e-126   
ref|WP_012953612.1|  long-chain fatty acid--CoA ligase                  405   1e-125   
ref|WP_017325478.1|  hypothetical protein                               405   2e-125   
ref|WP_011932492.1|  long-chain fatty acid--CoA ligase                  405   2e-125   
ref|WP_015108920.1|  AMP-forming long-chain acyl-CoA synthetase         402   2e-124   
ref|WP_006910198.1|  long-chain fatty acid--CoA ligase                  400   2e-123   
ref|WP_037990820.1|  long-chain fatty acid--CoA ligase                  399   5e-123   
ref|WP_011364960.1|  long-chain fatty acid--CoA ligase                  397   9e-123   
ref|XP_005705549.1|  long-chain acyl-CoA synthetase                     401   1e-122   
ref|XP_005539427.1|  long-chain-fatty-acid CoA ligase                   401   5e-122   
ref|WP_006854721.1|  long-chain fatty acid--CoA ligase                  395   2e-121   
gb|AHF64441.1|  putative long-chain-fatty-acid--CoA ligase              393   7e-121   
ref|WP_011359472.1|  long-chain fatty acid--CoA ligase                  392   9e-121   
ref|WP_038548731.1|  long-chain fatty acid--CoA ligase                  391   3e-120   
gb|AII44167.1|  long-chain fatty acid--CoA ligase                       391   3e-120   
ref|WP_038553646.1|  long-chain fatty acid--CoA ligase                  390   5e-120   
ref|WP_011826748.1|  long-chain fatty acid--CoA ligase                  389   1e-119   
ref|WP_037989023.1|  long-chain fatty acid--CoA ligase                  388   5e-119   
gb|EAU72280.1|  putative long-chain-fatty-acid--CoA ligase              388   6e-119   
ref|WP_038022938.1|  long-chain fatty acid--CoA ligase                  386   4e-118   
gb|EAU72991.1|  putative long-chain-fatty-acid--CoA ligase              385   8e-118   
ref|WP_011129594.1|  long-chain fatty acid--CoA ligase                  383   7e-117   
ref|WP_012194954.1|  long-chain fatty acid--CoA ligase                  382   1e-116   
ref|WP_011127536.1|  long-chain fatty acid--CoA ligase                  381   1e-116   
ref|WP_011936212.1|  long-chain fatty acid--CoA ligase                  381   2e-116   
ref|WP_025781956.1|  long-chain fatty acid--CoA ligase                  377   6e-115   
gb|AII45855.1|  long-chain fatty acid--CoA ligase                       377   1e-114   
ref|WP_036910762.1|  MULTISPECIES: long-chain fatty acid--CoA ligase    375   2e-114   
ref|WP_011618553.1|  long-chain fatty acid--CoA ligase                  375   3e-114   
ref|WP_035829623.1|  long-chain fatty acid--CoA ligase                  375   3e-114   
gb|KGG30325.1|  Long-chain-fatty-acid--CoA ligase                       376   3e-114   
gb|KGG29531.1|  Long-chain-fatty-acid--CoA ligase                       376   5e-114   
ref|WP_036891753.1|  MULTISPECIES: long-chain fatty acid--CoA ligase    372   5e-113   
ref|WP_011124554.1|  long-chain fatty acid--CoA ligase                  372   2e-112   
gb|KGG12998.1|  Long-chain-fatty-acid--CoA ligase                       369   2e-111   
ref|WP_036901975.1|  long-chain fatty acid--CoA ligase                  368   2e-111   
ref|WP_007100492.1|  long-chain fatty acid--CoA ligase                  367   4e-111   
ref|WP_036918115.1|  MULTISPECIES: long-chain fatty acid--CoA ligase    364   7e-110   
ref|WP_011819781.1|  long-chain fatty acid--CoA ligase                  363   8e-110   
tpg|DAA52475.1|  TPA: hypothetical protein ZEAMMB73_557217              362   1e-109   
gb|KGG16562.1|  Long-chain-fatty-acid-CoA ligase                        364   1e-109   
ref|WP_011132038.1|  long-chain fatty acid--CoA ligase                  360   1e-108   
ref|WP_036899955.1|  long-chain fatty acid--CoA ligase                  360   3e-108   
ref|WP_036907821.1|  long-chain fatty acid--CoA ligase                  359   6e-108   
emb|CBJ32681.1|  long chain acyl-CoA synthetase                         360   2e-107   
ref|WP_038651377.1|  long-chain fatty acid--CoA ligase                  357   4e-107   
ref|WP_011823205.1|  long-chain fatty acid--CoA ligase                  357   6e-107   
ref|WP_011294370.1|  long-chain fatty acid--CoA ligase                  355   2e-106   
ref|WP_025914231.1|  long-chain fatty acid--CoA ligase                  353   6e-106   
ref|XP_005718027.1|  acid-thiol ligase                                  357   7e-106   
ref|WP_025938957.1|  long-chain fatty acid--CoA ligase                  352   2e-105   
ref|WP_026032716.1|  long-chain fatty acid--CoA ligase                  352   3e-105   
ref|WP_025924210.1|  MULTISPECIES: long-chain fatty acid--CoA ligase    351   6e-105   
ref|WP_025922183.1|  long-chain fatty acid--CoA ligase                  350   7e-105   
ref|WP_025929197.1|  long-chain fatty acid--CoA ligase                  350   7e-105   
ref|WP_032517532.1|  long-chain fatty acid--CoA ligase                  350   7e-105   
ref|WP_011375959.1|  long-chain fatty acid--CoA ligase                  350   1e-104   
ref|WP_025934861.1|  long-chain fatty acid--CoA ligase                  348   5e-104   
ref|WP_025929825.1|  long-chain fatty acid--CoA ligase                  348   8e-104   
ref|YP_002049345.1|  putative long-chain-fatty-acid--CoA ligase         347   1e-103   
ref|WP_019478665.1|  hypothetical protein                               347   2e-103   
ref|WP_025952422.1|  long-chain fatty acid--CoA ligase                  345   8e-103   
ref|WP_025926062.1|  long-chain fatty acid--CoA ligase                  344   1e-102   
gb|ABE11263.1|  putative long-chain-fatty-acid--CoA ligase              344   2e-102   
ref|WP_032521317.1|  long-chain fatty acid--CoA ligase                  344   3e-102   
ref|WP_032526713.1|  long-chain fatty acid--CoA ligase                  343   7e-102   
gb|AIQ94463.1|  Long-chain-fatty-acid--CoA ligase                       342   9e-102   
ref|WP_025979585.1|  long-chain fatty acid--CoA ligase                  342   1e-101   
ref|WP_025953472.1|  long-chain fatty acid--CoA ligase                  342   1e-101   
ref|WP_012007235.1|  long-chain fatty acid--CoA ligase                  340   5e-101   
ref|WP_025880638.1|  long-chain fatty acid--CoA ligase                  340   6e-101   
ref|WP_002805955.1|  long-chain fatty acid--CoA ligase                  340   7e-101   
ref|WP_025928083.1|  long-chain fatty acid--CoA ligase                  340   1e-100   
ref|WP_025931438.1|  MULTISPECIES: long-chain fatty acid--CoA ligase    339   1e-100   
ref|WP_032515578.1|  long-chain fatty acid--CoA ligase                  339   1e-100   
ref|WP_025942181.1|  MULTISPECIES: long-chain fatty acid--CoA ligase    339   2e-100   
ref|WP_032519526.1|  long-chain fatty acid--CoA ligase                  338   3e-100   
ref|WP_025973747.1|  long-chain fatty acid--CoA ligase                  338   3e-100   
ref|WP_025922978.1|  long-chain fatty acid--CoA ligase                  338   3e-100   
ref|WP_032524119.1|  long-chain fatty acid--CoA ligase                  338   4e-100   
ref|WP_025892795.1|  long-chain fatty acid--CoA ligase                  338   4e-100   
ref|WP_025968487.1|  long-chain fatty acid--CoA ligase                  338   4e-100   
ref|WP_025959364.1|  long-chain fatty acid--CoA ligase                  338   4e-100   
ref|WP_025906344.1|  long-chain fatty acid--CoA ligase                  338   5e-100   
ref|WP_025975301.1|  long-chain fatty acid--CoA ligase                  337   6e-100   
ref|WP_025974936.1|  long-chain fatty acid--CoA ligase                  337   6e-100   
ref|WP_025891452.1|  long-chain fatty acid--CoA ligase                  337   6e-100   
ref|WP_025887548.1|  MULTISPECIES: long-chain fatty acid--CoA ligase    337   6e-100   
ref|WP_025967869.1|  long-chain fatty acid--CoA ligase                  337   6e-100   
ref|WP_025974475.1|  long-chain fatty acid--CoA ligase                  337   7e-100   
ref|WP_025953961.1|  long-chain fatty acid--CoA ligase                  337   9e-100   
ref|WP_011817913.1|  long-chain fatty acid--CoA ligase                  337   1e-99    
ref|WP_025933186.1|  long-chain fatty acid--CoA ligase                  336   2e-99    
ref|WP_025964625.1|  long-chain fatty acid--CoA ligase                  336   2e-99    
ref|WP_032513986.1|  long-chain fatty acid--CoA ligase                  336   2e-99    
ref|WP_025941357.1|  MULTISPECIES: long-chain fatty acid--CoA ligase    336   2e-99    
ref|WP_025963566.1|  long-chain fatty acid--CoA ligase                  335   3e-99    
gb|KFM23197.1|  Long-chain-fatty-acid-CoA ligase FadD15                 338   4e-99    
ref|WP_011862427.1|  long-chain fatty acid--CoA ligase                  334   1e-98    
ref|XP_002291517.1|  predicted protein                                  335   2e-97    
ref|XP_009388286.1|  PREDICTED: probable acyl-activating enzyme 1...    315   1e-96    
gb|EJK76946.1|  hypothetical protein THAOC_01260                        332   2e-96    
ref|WP_014803190.1|  AMP-dependent synthetase and ligase                327   4e-96    
gb|EWM24306.1|  amp-dependent synthetase and ligase                     330   1e-94    
ref|XP_002180281.1|  predicted protein                                  323   1e-94    
ref|WP_012670099.1|  long-chain acyl-CoA synthetase                     322   2e-94    
ref|WP_008725536.1|  Long-chain acyl-CoA synthetases (AMP-forming)      322   2e-94    
ref|WP_020063628.1|  long-chain acyl-CoA synthetase                     322   2e-94    
ref|WP_008726862.1|  long-chain acyl-CoA synthetase                     321   4e-94    
ref|WP_015675759.1|  AMP-binding enzyme                                 320   2e-93    
ref|WP_024752228.1|  long-chain fatty acid--CoA ligase                  320   2e-93    
ref|WP_012388625.1|  long-chain fatty acid--CoA ligase                  320   3e-93    
ref|WP_013313644.1|  AMP-dependent synthetase                           319   3e-93    
ref|WP_014487714.1|  long-chain acyl-CoA synthetase                     318   4e-93    
ref|WP_002701236.1|  long-chain fatty acid--CoA ligase                  318   5e-93    
ref|WP_002987416.1|  AMP-binding enzyme                                 318   9e-93    
ref|WP_013112596.1|  long-chain acyl-CoA synthetase                     317   1e-92    
ref|WP_004788983.1|  long-chain fatty acid--CoA ligase                  317   3e-92    
ref|WP_002772476.1|  long-chain fatty acid--CoA ligase                  316   4e-92    
ref|WP_002770718.1|  long-chain fatty acid--CoA ligase                  316   5e-92    
gb|AGZ03883.1|  long-chain acyl-CoA synthetase 2                        317   5e-92    
ref|WP_002973821.1|  AMP-binding enzyme                                 315   8e-92    
ref|WP_014624923.1|  AMP-dependent synthetase                           315   1e-91    
ref|WP_020777883.1|  AMP-binding enzyme                                 315   1e-91    
ref|WP_021958490.1|  aMP-dependent synthetase and ligase                312   6e-91    
ref|WP_020005386.1|  long-chain acyl-CoA synthetase                     311   1e-90    
ref|WP_004786238.1|  long-chain fatty acid--CoA ligase                  313   1e-90    
ref|WP_002772809.1|  long-chain fatty acid--CoA ligase                  311   2e-90    
ref|WP_020776439.1|  AMP-binding enzyme                                 312   3e-90    
ref|WP_015680839.1|  AMP-binding enzyme                                 312   3e-90    
ref|WP_002977060.1|  AMP-binding enzyme                                 312   3e-90    
ref|WP_012387368.1|  long-chain fatty acid--CoA ligase                  311   5e-90    
ref|WP_010881593.1|  long-chain fatty acid--CoA ligase                  310   7e-90    
ref|WP_015677490.1|  AMP-binding enzyme                                 311   8e-90    
ref|WP_015274310.1|  AMP-dependent synthetase and ligase                309   9e-90    
ref|WP_014932788.1|  AMP-dependent synthetase and ligase                310   9e-90    
ref|WP_014342779.1|  long-chain fatty acid--CoA ligase                  310   9e-90    
ref|WP_002972421.1|  AMP-binding enzyme                                 311   1e-89    
ref|WP_013944847.1|  long-chain fatty acid--CoA ligase                  310   1e-89    
ref|WP_014342297.1|  long-chain fatty acid--CoA ligase                  310   1e-89    
ref|WP_013244971.1|  long-chain acyl-CoA synthetase                     309   1e-89    
ref|WP_014936306.1|  long-chain acyl-CoA synthetase                     308   3e-89    
ref|WP_027370730.1|  long-chain fatty acid--CoA ligase                  308   3e-89    
ref|WP_037560890.1|  hypothetical protein                               307   7e-89    
ref|WP_028328465.1|  long-chain acyl-CoA synthetase                     305   2e-88    
ref|WP_018525896.1|  hypothetical protein                               304   8e-88    
gb|AJA90391.1|  long-chain fatty acid--CoA ligase                       305   9e-88    
ref|WP_014801382.1|  long-chain fatty acid--CoA ligase                  303   1e-87    
ref|WP_002678542.1|  hypothetical protein                               303   2e-87    
ref|WP_014023809.1|  long-chain fatty acid--CoA ligase                  303   4e-87    
ref|WP_022933121.1|  long-chain fatty acid--CoA ligase                  303   4e-87    
ref|WP_004789552.1|  long-chain fatty acid--CoA ligase                  303   5e-87    
ref|XP_002295745.1|  probable long-chain-fatty-acid--CoA ligase         303   5e-87    
ref|WP_020775740.1|  AMP-binding enzyme                                 302   6e-87    
ref|WP_002679461.1|  hypothetical protein                               301   6e-87    
ref|WP_002690218.1|  hypothetical protein                               301   9e-87    
ref|WP_010957030.1|  long-chain fatty acid--CoA ligase                  301   9e-87    
ref|WP_009102725.1|  Long-chain acyl-CoA synthetases (AMP-forming)      303   9e-87    
ref|WP_002670892.1|  hypothetical protein                               301   9e-87    
gb|EMB29584.1|  hypothetical protein HMPREF9727_01375                   301   9e-87    
ref|WP_015055669.1|  long-chain fatty acid--CoA ligase                  301   1e-86    
ref|WP_011601110.1|  long-chain fatty acid--CoA ligase                  301   1e-86    
gb|AIK18885.1|  long-chain fatty acid--CoA ligase                       301   1e-86    
ref|WP_038125401.1|  long-chain fatty acid--CoA ligase                  301   1e-86    
ref|WP_002669454.1|  long-chain fatty acid--CoA ligase                  301   1e-86    
ref|WP_002683202.1|  hypothetical protein                               300   2e-86    
ref|WP_014801290.1|  long-chain fatty acid--CoA ligase                  300   2e-86    
ref|WP_008882613.1|  long-chain fatty acid--CoA ligase                  301   2e-86    
ref|WP_004788516.1|  long-chain fatty acid--CoA ligase                  301   3e-86    
ref|WP_014540732.1|  long-chain fatty acid--CoA ligase                  300   3e-86    
ref|WP_010699585.1|  hypothetical protein                               299   4e-86    
ref|WP_002658094.1|  long-chain fatty acid--CoA ligase                  300   5e-86    
ref|WP_002656013.1|  long-chain fatty acid--CoA ligase                  300   5e-86    
ref|WP_014803114.1|  AMP-dependent synthetase and ligase                300   5e-86    
ref|WP_012597400.1|  long-chain fatty acid--CoA ligase                  300   5e-86    
ref|WP_002658995.1|  long-chain fatty acid--CoA ligase                  300   5e-86    
ref|WP_002661489.1|  long-chain fatty acid--CoA ligase                  300   6e-86    
ref|WP_002662676.1|  long-chain fatty acid--CoA ligase                  299   7e-86    
ref|WP_020948769.1|  long-chain-fatty-acid CoA ligase                   299   7e-86    
ref|WP_010409551.1|  long-chain fatty acid--CoA ligase                  299   9e-86    
ref|WP_011193900.1|  long-chain fatty acid--CoA ligase                  299   1e-85    
ref|WP_002663825.1|  long-chain fatty acid--CoA ligase                  299   1e-85    
ref|WP_010697490.1|  hypothetical protein                               298   2e-85    
ref|WP_013759436.1|  long-chain fatty acid--CoA ligase                  298   2e-85    
ref|WP_002557181.1|  long-chain-fatty-acid CoA ligase                   298   3e-85    
ref|WP_025408198.1|  long-chain fatty acid--CoA ligase                  297   3e-85    
ref|WP_038073689.1|  hypothetical protein                               297   4e-85    
ref|WP_006433880.1|  long-chain fatty acid--CoA ligase                  297   4e-85    
ref|WP_015026998.1|  long-chain fatty acid--CoA ligase                  297   5e-85    
ref|WP_003004832.1|  AMP-binding enzyme                                 298   5e-85    
ref|WP_022849859.1|  long-chain fatty acid--CoA ligase                  296   8e-85    
ref|WP_014653774.1|  long-chain fatty acid--CoA ligase                  296   1e-84    
ref|WP_002095232.1|  AMP-binding enzyme                                 297   1e-84    
ref|WP_008593038.1|  long-chain fatty acid--CoA ligase                  296   1e-84    
gb|EMO49556.1|  AMP-binding enzyme                                      297   1e-84    
ref|WP_002761756.1|  AMP-binding enzyme                                 296   2e-84    
ref|WP_032985880.1|  long-chain fatty acid--CoA ligase                  295   2e-84    
ref|WP_004507310.1|  AMP-binding enzyme                                 295   2e-84    
gb|AIJ29943.1|  long-chain fatty acid--CoA ligase                       295   2e-84    
ref|WP_031507679.1|  long-chain fatty acid--CoA ligase                  295   2e-84    
ref|WP_002704264.1|  long-chain fatty acid--CoA ligase                  295   2e-84    
ref|WP_004792746.1|  long-chain fatty acid--CoA ligase                  295   3e-84    
ref|WP_029357940.1|  long-chain fatty acid--CoA ligase                  295   3e-84    
ref|WP_000829709.1|  long-chain-fatty-acid--CoA ligase                  296   3e-84    
ref|WP_029346391.1|  long-chain fatty acid--CoA ligase                  295   3e-84    
ref|WP_016543310.1|  AMP-binding enzyme                                 296   3e-84    
ref|WP_024653447.1|  long-chain fatty acid--CoA ligase                  295   3e-84    
ref|WP_000829708.1|  long-chain-fatty-acid--CoA ligase                  296   3e-84    
ref|WP_000829693.1|  long-chain-fatty-acid--CoA ligase                  296   3e-84    
ref|WP_006068643.1|  long-chain fatty acid--CoA ligase                  295   4e-84    
ref|WP_000829707.1|  long-chain fatty acid--CoA ligase                  295   5e-84    
ref|WP_000829697.1|  long-chain fatty acid--CoA ligase                  295   5e-84    
ref|WP_000829710.1|  long-chain-fatty-acid--CoA ligase                  295   5e-84    
ref|WP_017855494.1|  long-chain fatty acid--CoA ligase                  295   5e-84    
ref|WP_004791244.1|  long-chain fatty acid--CoA ligase                  294   5e-84    
ref|WP_000829700.1|  long-chain-fatty-acid--CoA ligase                  295   6e-84    
ref|WP_000829696.1|  long-chain-fatty-acid--CoA ligase                  295   6e-84    
ref|WP_016753768.1|  long-chain fatty acid--CoA ligase                  295   6e-84    
ref|WP_002974622.1|  AMP-binding enzyme                                 295   6e-84    
ref|WP_000829698.1|  long-chain-fatty-acid--CoA ligase                  295   6e-84    
ref|WP_000829695.1|  long-chain-fatty-acid--CoA ligase                  295   7e-84    



>ref|XP_009630206.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
[Nicotiana tomentosiformis]
Length=724

 Score =  1052 bits (2720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/730 (74%), Positives = 639/730 (88%), Gaps = 12/730 (2%)
 Frame = -3

Query  2474  KMAALNTKSVMFLLPKSDDGNHAVHDLMSCRGFIKMKWQLNSRGSTSRKF-RVFCES--T  2304
             +M  ++ KS +F  P S  G + V    S +  +      NS+  TS++  RV+CES   
Sbjct  3     EMITMSLKSNLFATPYS--GRYGVSHFWSQQKLV------NSKSHTSQRVGRVYCESKTA  54

Query  2303  GMQIRKCSPilesillsgngll-ssEWKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSF  2127
              M+IRKCSP LES LLSGNG L  +EW+TVPDIW+T++E+FG+ +A+VDPYH+PPT++++
Sbjct  55    EMEIRKCSPFLESELLSGNGGLPLTEWRTVPDIWRTSSEKFGDRVAVVDPYHDPPTSMTY  114

Query  2126  KELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEE  1947
             K+L +EIV F+EGLRV+GLKP+EKIALFADNSCRWLVADQG MT+GAINVVRGSRSSV+E
Sbjct  115   KQLCQEIVDFSEGLRVVGLKPNEKIALFADNSCRWLVADQGTMTSGAINVVRGSRSSVQE  174

Query  1946  LLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSY  1767
             LLQ+Y+HSESVALA+DNPEMY+RIA+TF SHA VRF ILLWGEKSS+  E + G P+Y+Y
Sbjct  175   LLQLYSHSESVALAIDNPEMYNRIADTFGSHAAVRFAILLWGEKSSLGREAVQGYPVYTY  234

Query  1766  NEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQ  1587
              EII+LG++S + L  S++AR QY+YE INSDDVAT+VYTSGTTGNPKGVMLTH+NLLHQ
Sbjct  235   KEIIELGHKSRVDLFDSEDARKQYSYEAINSDDVATIVYTSGTTGNPKGVMLTHKNLLHQ  294

Query  1586  ILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQY  1407
             ILNL + VP VPGDRFLSMLPPWHAYERA EYFIF+ G EQVYTTV NLKEDL+RYQP Y
Sbjct  295   ILNLGEIVPAVPGDRFLSMLPPWHAYERACEYFIFTHGTEQVYTTVKNLKEDLRRYQPHY  354

Query  1406  LISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPS  1227
             LISVPLVYETLYSGILKQIN++S ARKLIALLFL+IS AY EAKRIYEGKCL KD KQPS
Sbjct  355   LISVPLVYETLYSGILKQINSNSAARKLIALLFLRISMAYMEAKRIYEGKCLMKDTKQPS  414

Query  1226  YLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEA  1047
             Y+VS+LDWLWAR IAA+L PLH+LA+K+VYSKIH+SIGISKAG+SGGGSLSSHVDKFFEA
Sbjct  415   YIVSLLDWLWARTIAAILWPLHMLAKKIVYSKIHASIGISKAGVSGGGSLSSHVDKFFEA  474

Query  1046  IDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVK  867
             IDIK+QNGYGLTES+PVVA R P CNVLGS+GPPIRH E+KVV+AETD+ L PGS+GIVK
Sbjct  475   IDIKIQNGYGLTESSPVVAARHPACNVLGSVGPPIRHVEVKVVNAETDEVLPPGSRGIVK  534

Query  866   AKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDT  687
             A+GP VMKGYYKNP ATKQAIDENGWLNTGDLGWI P+HS+GRSR S G IVLEGRAKDT
Sbjct  535   ARGPLVMKGYYKNPSATKQAIDENGWLNTGDLGWIAPDHSVGRSRKSGGVIVLEGRAKDT  594

Query  686   IVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDS  507
             IVLS+GENVEPSEIEEAAMGS LIQQIVVIGQD+RRLGA+++P+KEEVLLAAK+ ++VDS
Sbjct  595   IVLSTGENVEPSEIEEAAMGSRLIQQIVVIGQDQRRLGAIIVPNKEEVLLAAKRSAIVDS  654

Query  506   DATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDL  327
             + TE+S+EK   L++EEL+KWT+GC+FQ+GPIL+++EPFTID+GLLTPTMK++RD+V  L
Sbjct  655   ETTELSKEKAVGLLYEELRKWTSGCSFQVGPILIVDEPFTIDSGLLTPTMKIKRDRVAAL  714

Query  326   YKEQIEDLYK  297
             YKEQIE+LYK
Sbjct  715   YKEQIENLYK  724



>ref|XP_009794482.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
[Nicotiana sylvestris]
Length=724

 Score =  1041 bits (2693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/730 (72%), Positives = 634/730 (87%), Gaps = 12/730 (2%)
 Frame = -3

Query  2474  KMAALNTKSVMFLLPKSDDGNHAVHDLMSCRGFIKMKWQLNSRGSTSRKF-RVFCE--ST  2304
             +M  ++ KS +F  P S  G + V    S +  +      NS+   SR+  RV+CE  + 
Sbjct  3     EMITMSLKSNLFATPYS--GRYGVSHFWSQQKLV------NSKSHRSRRIGRVYCEFKTA  54

Query  2303  GMQIRKCSPilesillsgngll-ssEWKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSF  2127
              M+IRKCSP LES LLSGNG    +EW+TVPDIW+T+AE+FG+C+A+VDPYH+PPT +++
Sbjct  55    EMEIRKCSPFLESELLSGNGGFPLTEWRTVPDIWRTSAEKFGDCVAVVDPYHDPPTTMTY  114

Query  2126  KELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEE  1947
             K+L +EIV F+EGLRV+GLKP+EKIALFADNSCRWLVADQG M +GAINVVRGSRSSV+E
Sbjct  115   KQLYQEIVDFSEGLRVVGLKPNEKIALFADNSCRWLVADQGTMASGAINVVRGSRSSVQE  174

Query  1946  LLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSY  1767
             LLQ+Y+HSESVALA+DNPEMY+RI++TF SH  +RF ILLWGEKSS+  E + G P+Y+Y
Sbjct  175   LLQLYSHSESVALAIDNPEMYNRISDTFGSHTAIRFAILLWGEKSSLGREAVQGYPVYTY  234

Query  1766  NEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQ  1587
              EII+LG++S + LL S++AR QY++E INSDDVAT+VYTSGTTGNPKGVMLTH+NLLHQ
Sbjct  235   KEIIELGHKSRVDLLDSEDARKQYSFEAINSDDVATIVYTSGTTGNPKGVMLTHKNLLHQ  294

Query  1586  ILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQY  1407
             ILNL + VP VPGDRFLSMLPPWHAYERA EYFIF+ G EQVYTTV NLKEDL+RYQP Y
Sbjct  295   ILNLGEIVPAVPGDRFLSMLPPWHAYERACEYFIFTHGTEQVYTTVKNLKEDLRRYQPHY  354

Query  1406  LISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPS  1227
             LISVPLVYETLYSGILKQIN++S ARK IALLFL+IS AY EAKRIYEGKCL KD KQPS
Sbjct  355   LISVPLVYETLYSGILKQINSNSAARKFIALLFLRISMAYMEAKRIYEGKCLMKDTKQPS  414

Query  1226  YLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEA  1047
             Y+VS+LDWLWAR IAA+L PLH+LA+K+VYSKIH+SIGISKAGISGGGSLSSHVDKFFEA
Sbjct  415   YIVSLLDWLWARTIAAILWPLHMLAKKIVYSKIHASIGISKAGISGGGSLSSHVDKFFEA  474

Query  1046  IDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVK  867
             I IK+QNGYGLTES+PV++ R P CNVLGS+G PIR+ E+K+V+AETD+ L PGS+GIVK
Sbjct  475   IGIKIQNGYGLTESSPVISARHPACNVLGSVGHPIRYVEVKIVNAETDEVLPPGSRGIVK  534

Query  866   AKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDT  687
             A+GP VMKGYYKNP ATKQAIDENGWLNTGDLGWI P+HS+GRSR S G IVLEGRAKDT
Sbjct  535   ARGPLVMKGYYKNPLATKQAIDENGWLNTGDLGWIAPDHSVGRSRKSGGVIVLEGRAKDT  594

Query  686   IVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDS  507
             IVLS+GENVEPSEIEEAAMGS+LIQQIVVIGQD+RRLGA+++P+KEE+LLAAK+ ++VDS
Sbjct  595   IVLSTGENVEPSEIEEAAMGSSLIQQIVVIGQDQRRLGAIIVPNKEEILLAAKRSAIVDS  654

Query  506   DATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDL  327
             + TEVS+EK   +++EEL+KWT+GC+FQ+GPIL+++EPFTID+GLLTPTMK++RDK+  L
Sbjct  655   ETTEVSKEKAVGILYEELRKWTSGCSFQVGPILIVDEPFTIDSGLLTPTMKIKRDKIAAL  714

Query  326   YKEQIEDLYK  297
             YKEQIE+LYK
Sbjct  715   YKEQIENLYK  724



>ref|XP_006360961.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic-like 
[Solanum tuberosum]
Length=681

 Score =  1039 bits (2686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/672 (78%), Positives = 611/672 (91%), Gaps = 1/672 (0%)
 Frame = -3

Query  2312  ESTGMQIRKCSPilesillsgngll-ssEWKTVPDIWKTAAEEFGNCIALVDPYHNPPTN  2136
             ++T ++IRKCSP LES LLSGNG    +EW+TVPDIW+T+AE+FG+ +A+VDPYH+PPT 
Sbjct  9     QTTEVEIRKCSPFLESELLSGNGGFPLTEWRTVPDIWRTSAEKFGDRVAVVDPYHDPPTT  68

Query  2135  LSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSS  1956
             +++K+L++EIV F+EGLRVIGLKP EKIALFADNSCRWLVADQG+M +GAINVVRGSRSS
Sbjct  69    MTYKQLDQEIVDFSEGLRVIGLKPHEKIALFADNSCRWLVADQGMMASGAINVVRGSRSS  128

Query  1955  VEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPI  1776
              +ELLQ+Y+HSESVALA+DNPEMY+RIA+TF SHA VRF+ILLWGEKSS+ ++   G P+
Sbjct  129   DQELLQLYSHSESVALAIDNPEMYNRIADTFGSHAAVRFVILLWGEKSSLVTDARQGYPV  188

Query  1775  YSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENL  1596
             Y+Y EII+LG++S + LL S++AR QY+YE INSDDVATLVYTSGTTGNPKGVMLTH+NL
Sbjct  189   YTYKEIIELGHKSRVDLLDSEDARKQYSYEAINSDDVATLVYTSGTTGNPKGVMLTHKNL  248

Query  1595  LHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQ  1416
             LHQILNLW+ VP VPGDRFLSMLPPWHAYERA EYFIF+ G EQVYTTV NLKEDL+RYQ
Sbjct  249   LHQILNLWEIVPAVPGDRFLSMLPPWHAYERACEYFIFTHGTEQVYTTVKNLKEDLRRYQ  308

Query  1415  PQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQK  1236
             P YLISVPLVYETLYSGILKQIN++S ARKLIA LFL+IS AY EAKRIYEGKCLTKD K
Sbjct  309   PHYLISVPLVYETLYSGILKQINSNSAARKLIAQLFLRISMAYMEAKRIYEGKCLTKDMK  368

Query  1235  QPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKF  1056
             QPSY+VS+LDWLWAR IAA+L PLH+LA+K+VYSKIHS IGISKAGISGGGSLSSHVDKF
Sbjct  369   QPSYIVSLLDWLWARTIAAILLPLHMLAKKIVYSKIHSGIGISKAGISGGGSLSSHVDKF  428

Query  1055  FEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKG  876
             FEAIDIK+QNGYGLTESAPV+A R   CNVLGSIG PIRH E+KVV++ETD+ L PGSKG
Sbjct  429   FEAIDIKIQNGYGLTESAPVIAARSLTCNVLGSIGRPIRHVEVKVVNSETDEVLPPGSKG  488

Query  875   IVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRA  696
              VKA+GP +MKGYYKNP ATKQAIDENGWLNTGDLGWIVP+HSIGRSRN  G IVLEGRA
Sbjct  489   TVKARGPLIMKGYYKNPVATKQAIDENGWLNTGDLGWIVPDHSIGRSRNCGGAIVLEGRA  548

Query  695   KDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSV  516
             KDTIVLS+GENVEPSEIEEAAMGS+LIQQIVVIGQD+RRLGA+++P+KEEVLLAAK+ +V
Sbjct  549   KDTIVLSTGENVEPSEIEEAAMGSSLIQQIVVIGQDQRRLGAIIVPNKEEVLLAAKRSAV  608

Query  515   VDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKV  336
             VDS+ TEVS+EKT  L+H+EL+KWT+GC+FQ+GPILL+++PFTID+GLLTPTMK++RD+V
Sbjct  609   VDSETTEVSKEKTVGLLHDELRKWTSGCSFQVGPILLVDQPFTIDSGLLTPTMKIKRDRV  668

Query  335   TDLYKEQIEDLY  300
               LYKEQI++LY
Sbjct  669   AALYKEQIDNLY  680



>ref|XP_004247889.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
[Solanum lycopersicum]
Length=723

 Score =  1028 bits (2658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/726 (73%), Positives = 628/726 (87%), Gaps = 12/726 (2%)
 Frame = -3

Query  2462  LNTKSVMFLLPKSDDGNHAVHDLMSCRGFIKMKWQLNSRGSTSRKF-RVFCESTGMQ--I  2292
             ++ KS +F  P    G H V    S +  + +        S SRK  RV C+S   +  I
Sbjct  6     MSLKSNLFATPCR--GRHGVSQFWSQQQLVTI------LVSKSRKLGRVHCQSKTAEVDI  57

Query  2291  RKCSPilesillsgngll-ssEWKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELE  2115
             RKCSP LES LLSGNG L  +EW+TVPDIW+T+AE+FG+ +A+VDPYH+PPT +++K+L+
Sbjct  58    RKCSPFLESELLSGNGGLPLTEWRTVPDIWRTSAEKFGDRVAVVDPYHDPPTTMTYKQLD  117

Query  2114  KEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQI  1935
             +EIV F+EGLRVIGLKP EKIALFADNSCRWLVADQG+M +GAINVVRGSRSS +ELLQ+
Sbjct  118   QEIVDFSEGLRVIGLKPHEKIALFADNSCRWLVADQGMMASGAINVVRGSRSSDQELLQL  177

Query  1934  YNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEII  1755
             Y+HSESVALA+DNPEMY+RIA+TF SHA +RF+ILLWGEKSS+ +E   G PIY+Y EI+
Sbjct  178   YSHSESVALAIDNPEMYNRIADTFGSHAALRFVILLWGEKSSLVTEARQGYPIYTYKEIV  237

Query  1754  DLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNL  1575
             +LG++S + LL S++AR +Y+YE INSDDVATLVYTSGTTGNPKGVMLTH+NLLHQILNL
Sbjct  238   ELGHKSRVDLLDSEDARKRYSYEAINSDDVATLVYTSGTTGNPKGVMLTHKNLLHQILNL  297

Query  1574  WDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISV  1395
             W+ VP VPGDRFLSMLPPWHAYERA EYFIF+ G EQVYTTV NLKEDL+RYQP YLISV
Sbjct  298   WEIVPAVPGDRFLSMLPPWHAYERACEYFIFTRGTEQVYTTVKNLKEDLRRYQPHYLISV  357

Query  1394  PLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVS  1215
             PLVYETLYSGI+KQIN++S ARK IA LFL+IS AY EAKRIYEGKCLTKD KQPSY+VS
Sbjct  358   PLVYETLYSGIIKQINSNSAARKHIAQLFLRISMAYMEAKRIYEGKCLTKDTKQPSYIVS  417

Query  1214  VLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAIDIK  1035
             +LDWLWA+ IAA+L PLH+LA+K+VYSKIHS IGISKAGISGGGSLSSHVDKFFEAIDIK
Sbjct  418   LLDWLWAQTIAAILLPLHMLAKKIVYSKIHSGIGISKAGISGGGSLSSHVDKFFEAIDIK  477

Query  1034  LQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGP  855
             +QNGYGLTESAPV+A R   CNVLGSIG PIRH E+KVV++ETD+ L PGSKG VKA+GP
Sbjct  478   IQNGYGLTESAPVIAARSLTCNVLGSIGRPIRHVEVKVVNSETDEVLPPGSKGTVKARGP  537

Query  854   QVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLS  675
              +MKGYYKNP ATKQAIDENGWLNTGDLGWIVP+ SIGRSRN  G IVLEGRAKDTIVLS
Sbjct  538   LIMKGYYKNPVATKQAIDENGWLNTGDLGWIVPDLSIGRSRNCGGAIVLEGRAKDTIVLS  597

Query  674   SGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATE  495
             +GENVEPSEIEEAAMGS+LIQQIV+IGQD+RRLGA+++P+KEEVLLAAK+ ++VDS+ TE
Sbjct  598   TGENVEPSEIEEAAMGSSLIQQIVIIGQDQRRLGAIIVPNKEEVLLAAKRSAIVDSETTE  657

Query  494   VSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQ  315
             VS++K   L+HEEL+KWT+ C+FQ+GPIL++++PFTID+GLLTPTMK++RD+V  LYKEQ
Sbjct  658   VSKDKALGLLHEELRKWTSDCSFQVGPILVVDQPFTIDSGLLTPTMKIKRDRVAALYKEQ  717

Query  314   IEDLYK  297
             I++LYK
Sbjct  718   IDNLYK  723



>emb|CDP15104.1| unnamed protein product [Coffea canephora]
Length=726

 Score =  1004 bits (2596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/718 (71%), Positives = 614/718 (86%), Gaps = 10/718 (1%)
 Frame = -3

Query  2426  SDDGNHAVHDLMSCRGFIKMKWQLNSRGSTSRKFR-----VFCESTG--MQIRKCSPile  2268
             S DG +AV  L+    F+  K  L+ R  + R FR     V+CEST   M IRKCSP LE
Sbjct  11    SCDGRYAVQCLLGNHRFVNSK-VLSRRCCSFRDFRKRMLRVYCESTTTEMHIRKCSPFLE  69

Query  2267  sill-sgngllssEWKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAE  2091
             S+LL     + S+EWK VPDIW+T+AE+FG+ IALVDPYH+PPTN+++K+LE+EI++F+E
Sbjct  70    SVLLCGNGVVSSTEWKAVPDIWRTSAEKFGDRIALVDPYHDPPTNMTYKQLEQEILNFSE  129

Query  2090  GLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVA  1911
             GLRVIG+KP EK+ALFADNSCRWLVADQGIM TGA+NVVRGSRSSV+EL QIY HS+SVA
Sbjct  130   GLRVIGVKPGEKMALFADNSCRWLVADQGIMATGAVNVVRGSRSSVDELFQIYIHSDSVA  189

Query  1910  LAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHM  1731
             L VDNPEMY+RIA+ F S A ++F+ILLWG+KSS++SEV +G P+Y Y EIIDLG ES  
Sbjct  190   LVVDNPEMYNRIADAFSSQATLQFVILLWGDKSSLSSEV-EGLPVYCYQEIIDLGQESRR  248

Query  1730  ALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVP  1551
             ALL SQ+AR QY YE I+SDDVATL+YTSGTTGNPKG+MLTH+N+LHQI NLWD VP VP
Sbjct  249   ALLSSQDARQQYAYEAISSDDVATLIYTSGTTGNPKGIMLTHKNILHQITNLWDIVPAVP  308

Query  1550  GDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLY  1371
             GDRFLS+LPPWH YER+ EYFIF+ G EQVYTTV NLK+DL+RYQP YLISVPL+YETLY
Sbjct  309   GDRFLSILPPWHVYERSCEYFIFTYGTEQVYTTVKNLKDDLRRYQPHYLISVPLIYETLY  368

Query  1370  SGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWAR  1191
             SGI KQ  TSS  RK +ALLFL+ S AY EAKR+YEGKCLT+  ++PSY+V+VLDW++AR
Sbjct  369   SGIQKQFATSSAVRKFVALLFLRTSMAYMEAKRVYEGKCLTRSPEEPSYMVAVLDWVYAR  428

Query  1190  AIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLT  1011
              IAA+L PLH+LARK+VYSKIH++IGISKAGISGGGSL SH+DKFFEAID+K+QNGYGLT
Sbjct  429   IIAAILLPLHMLARKIVYSKIHAAIGISKAGISGGGSLPSHIDKFFEAIDVKVQNGYGLT  488

Query  1010  ESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYK  831
             ES+PVVA R P+CNVLGSIG PI+HTE+KVVDAETD+ L  GS GIVK +GPQVMKGYYK
Sbjct  489   ESSPVVAARYPDCNVLGSIGRPIQHTEVKVVDAETDEILPAGSIGIVKVRGPQVMKGYYK  548

Query  830   NPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPS  651
             N  ATKQAIDENGWLNTGD+GWI P+HS+G SR S G IVLEGRAKDTIVLS+GENVEPS
Sbjct  549   NSTATKQAIDENGWLNTGDIGWIAPHHSLGASRQSGGVIVLEGRAKDTIVLSTGENVEPS  608

Query  650   EIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSK  471
              IEEAAM SNLIQQIVVIGQD+RRLGA+++P+KEEV+LAAKKLS++DSDA+E+S++K + 
Sbjct  609   VIEEAAMRSNLIQQIVVIGQDQRRLGAIIVPNKEEVILAAKKLSILDSDASELSKDKMTS  668

Query  470   LIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             L++EEL++WT+ C FQ+GPI++ +EPFTID GL+TPTMKV+RDKV   Y+EQI+++YK
Sbjct  669   LLYEELRRWTSECPFQVGPIIIADEPFTIDAGLMTPTMKVKRDKVVAEYQEQIQNIYK  726



>ref|XP_011101589.1| PREDICTED: LOW QUALITY PROTEIN: probable acyl-activating enzyme 
16, chloroplastic [Sesamum indicum]
Length=731

 Score =   997 bits (2577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/705 (73%), Positives = 606/705 (86%), Gaps = 6/705 (1%)
 Frame = -3

Query  2402  HDLMSCRGFIKMKWQLNSRGSTSRKFRVFCESTG--MQIRKCSPilesillsgngll-ss  2232
             H L+  R F K   +  +  + +RKFRV+C+S    MQIRK SPILES LLSGN +L S+
Sbjct  27    HRLIDSRLFFK---KCGAFATGNRKFRVYCDSKTKEMQIRKFSPILESDLLSGNEVLPSN  83

Query  2231  EWKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKI  2052
              W+ VPDIW+T+AE+FGN IALVDPYH+PPTN+++K+LE+EI++F EGLRVIGLKP+EK+
Sbjct  84    GWQVVPDIWRTSAEKFGNRIALVDPYHDPPTNMTYKQLEQEILNFCEGLRVIGLKPEEKL  143

Query  2051  ALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIA  1872
             A+FADNS RWLV+DQGIM TGAINVVRG+RSSVEELLQIYNHSES  L VD+PEM +RI+
Sbjct  144   AIFADNSSRWLVSDQGIMATGAINVVRGTRSSVEELLQIYNHSESCGLVVDDPEMLNRIS  203

Query  1871  ETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYT  1692
             ETF+S A VRF+ILLWGEKSSI +E     PIYSY EIIDLG+E+  AL HSQ+AR QY 
Sbjct  204   ETFYSRAAVRFVILLWGEKSSIKNEAAGEIPIYSYKEIIDLGHENREALRHSQDARKQYI  263

Query  1691  YEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHA  1512
             Y+ I+S DVATLVYTSGTTGNPKGVMLTH+NLLHQI NLWD VP VPGDRFLSMLPPWHA
Sbjct  264   YKTISSGDVATLVYTSGTTGNPKGVMLTHKNLLHQITNLWDIVPAVPGDRFLSMLPPWHA  323

Query  1511  YERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPA  1332
             YERA EYFIF+ G EQVYTTV NLKEDL+RYQP Y+ISVPLVYETLYSGI KQI+TSS A
Sbjct  324   YERACEYFIFTHGIEQVYTTVKNLKEDLRRYQPHYVISVPLVYETLYSGIQKQISTSSAA  383

Query  1331  RKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLA  1152
             RKL+ALLFL+IS AY EAKRIYEGKCL ++  QPS L +  DWL AR IA +L PLH LA
Sbjct  384   RKLVALLFLRISLAYMEAKRIYEGKCLARNLAQPSQLSAFFDWLLARIIAVILWPLHALA  443

Query  1151  RKLVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNC  972
             +K+VYSKIHSSIGISKAGISGGGSL  HVDKFFEAIDIK+QNGYGLTES+PVVA R P C
Sbjct  444   KKIVYSKIHSSIGISKAGISGGGSLPPHVDKFFEAIDIKVQNGYGLTESSPVVAARHPXC  503

Query  971   NVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENG  792
             NVLGSIG PIRHTEIKVVDAETD+ L   SKGIVK +GPQVMKGYYKNP AT+QAIDE G
Sbjct  504   NVLGSIGHPIRHTEIKVVDAETDEVLPYSSKGIVKVRGPQVMKGYYKNPEATRQAIDEYG  563

Query  791   WLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQ  612
             WLNTGD+GWI P HS GRSR + G IVLEGRAKDTIVLS+GENVEPSEIE AA+ S+LIQ
Sbjct  564   WLNTGDIGWISPPHSRGRSRQAGGVIVLEGRAKDTIVLSTGENVEPSEIEAAALRSSLIQ  623

Query  611   QIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGC  432
             QIVVIGQD+RRLGA+++P+KEE+LL AK+LS+V+S+A+E+S++K   ++HEEL+KWT+ C
Sbjct  624   QIVVIGQDQRRLGAIIVPNKEEILLEAKRLSIVESNASELSKQKQINMLHEELRKWTSDC  683

Query  431   TFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             +FQ+GPIL+++EPFTID+GL+TPTMK+RRD+V  LYKEQI++LYK
Sbjct  684   SFQVGPILVLDEPFTIDSGLMTPTMKIRRDRVVSLYKEQIDNLYK  728



>ref|XP_007221302.1| hypothetical protein PRUPE_ppa001870mg [Prunus persica]
 gb|EMJ22501.1| hypothetical protein PRUPE_ppa001870mg [Prunus persica]
Length=751

 Score =   974 bits (2518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/736 (68%), Positives = 610/736 (83%), Gaps = 14/736 (2%)
 Frame = -3

Query  2474  KMAALNTKSVMFLLPKSDDGNHAVHDLMSCRGFIKMKWQLNS----RGS--TSRKFRVFC  2313
             +MA ++ ++ + L+  S  G HA+  L S   F   +  L +    RG    +R FRVFC
Sbjct  20    QMATISVRNNLVLVSSSQCG-HALQFLFSNYKFRTRQVFLGTWNGRRGGFPLNRGFRVFC  78

Query  2312  ESTG--MQIRKCSPilesillsgngllss-EWKTVPDIWKTAAEEFGNCIALVDPYHNPP  2142
             +S    MQIR+ SP LES  L  NG   S EW  VPDIW+++AE +G+ IAL DPYH+PP
Sbjct  79    QSKTEEMQIRRYSPFLESAFLDRNGAFVSGEWHAVPDIWRSSAERYGDRIALTDPYHDPP  138

Query  2141  TNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSR  1962
             +++++K+LE+EI+ FAEGLRV+G+KP+EKIALFADNSCRWLVADQGIM TGAINVVRGSR
Sbjct  139   SSMTYKQLEEEILDFAEGLRVVGVKPEEKIALFADNSCRWLVADQGIMATGAINVVRGSR  198

Query  1961  SSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGR  1782
             SSVEELLQIY+HSESVALAVD+PE+++RIAE F S   ++F+ILLWG+KSS+ SE   G+
Sbjct  199   SSVEELLQIYDHSESVALAVDSPELFNRIAEAFSSKVVMKFVILLWGDKSSLASE---GK  255

Query  1781  -PIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTH  1605
              P+++Y EI+DLG ES  +     +AR QY +E INSDD+ATLVYTSGTTGNPKGVMLTH
Sbjct  256   IPVFNYREILDLGRESRKSAPDFNDARQQYVHEAINSDDIATLVYTSGTTGNPKGVMLTH  315

Query  1604  ENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLK  1425
              NLLHQI NLWD VP   GDRFLSMLPPWHAYERA EYFIF+ G EQVYTTV NLK+DL+
Sbjct  316   RNLLHQIKNLWDVVPAEVGDRFLSMLPPWHAYERACEYFIFTYGIEQVYTTVRNLKDDLR  375

Query  1424  RYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTK  1245
              YQP Y+ISVPLVYETLYSGI KQI+TSS ARK IAL F++IS AY E KRIYEG  LT+
Sbjct  376   HYQPNYIISVPLVYETLYSGIQKQISTSSAARKFIALTFIRISLAYMEFKRIYEGTYLTR  435

Query  1244  DQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHV  1065
             +QKQPSYL SV DWLWAR +AA+L PLH+L +KLVYSKIHS+IGISKAGISGGGSL  HV
Sbjct  436   NQKQPSYLASVYDWLWARIVAAILWPLHMLGKKLVYSKIHSAIGISKAGISGGGSLPPHV  495

Query  1064  DKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPG  885
             DKFFEAI +K+QNGYGLTE++PV+A RRPNCNVLGS+GPPIRHTE KVV++ET + L PG
Sbjct  496   DKFFEAIGVKVQNGYGLTETSPVIAARRPNCNVLGSVGPPIRHTEFKVVESETGEVLLPG  555

Query  884   SKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLE  705
             S GIVK +GPQVMKGYYKNP AT+Q +DE+GWLNTGD+GWI P+HS GRSR   G +VLE
Sbjct  556   STGIVKVRGPQVMKGYYKNPGATEQVLDEDGWLNTGDIGWIAPHHSTGRSRRCGGVVVLE  615

Query  704   GRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKK  525
             GRAKDTIVLS+GENVEP E+EEAAM S+LIQQIVV+GQD+RRLGA+++P+K+EVLLAAKK
Sbjct  616   GRAKDTIVLSTGENVEPVELEEAAMRSSLIQQIVVVGQDQRRLGAIIVPNKDEVLLAAKK  675

Query  524   LSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRR  345
             LS+VD +A+++S++K + L++EEL+KWT+GC+FQIGPIL+++EPFTID+G +TPTMK+RR
Sbjct  676   LSIVDVNASDLSKDKMTSLLYEELRKWTSGCSFQIGPILIVDEPFTIDSGFMTPTMKIRR  735

Query  344   DKVTDLYKEQIEDLYK  297
             D+V   YKEQIE+LYK
Sbjct  736   DRVVAQYKEQIENLYK  751



>ref|XP_010653199.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
[Vitis vinifera]
 ref|XP_010653200.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
[Vitis vinifera]
 emb|CBI39044.3| unnamed protein product [Vitis vinifera]
Length=730

 Score =   968 bits (2502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/680 (71%), Positives = 580/680 (85%), Gaps = 3/680 (0%)
 Frame = -3

Query  2330  KFRVFCESTG--MQIRKCSPilesillsgn-gllssEWKTVPDIWKTAAEEFGNCIALVD  2160
             +FRVF +S     QIRK SP LE   L G+  L S EWK VPDIW+++AE +G+ +ALVD
Sbjct  50    RFRVFSQSMTEERQIRKFSPFLEREFLLGDGVLASDEWKAVPDIWRSSAERYGDRVALVD  109

Query  2159  PYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAIN  1980
             PYH+PP+N+++K+LE+EI+ F+EGLR IG+KPDEK+ALFADNSCRWL+ADQGIM  GAIN
Sbjct  110   PYHDPPSNMTYKQLEQEILDFSEGLRAIGVKPDEKLALFADNSCRWLIADQGIMAIGAIN  169

Query  1979  VVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITS  1800
             VVRGSRSSVEELLQIY HSESVALAVDNPE++ RIAETF S A +RF++LLWGEKS + S
Sbjct  170   VVRGSRSSVEELLQIYIHSESVALAVDNPELFGRIAETFCSRAAIRFVVLLWGEKSCLPS  229

Query  1799  EVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKG  1620
             EVMD  P+++Y EIIDLG E     L S  AR  Y YE I+S+D+ATLVYTSGTTGNPKG
Sbjct  230   EVMDRVPVFNYKEIIDLGRECRSVFLDSHYARKNYIYEAISSNDIATLVYTSGTTGNPKG  289

Query  1619  VMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINL  1440
             VMLTH+NLLHQI NLWD VP  PGDRFLSMLP WHAYERA+EYFIF+ G EQVYTTV NL
Sbjct  290   VMLTHQNLLHQIKNLWDIVPAEPGDRFLSMLPSWHAYERASEYFIFTHGIEQVYTTVPNL  349

Query  1439  KEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEG  1260
             KEDL+RYQPQYLISVPLVYETLYSGI KQI+TSS  RKL+AL F++IS AY E KRIYEG
Sbjct  350   KEDLRRYQPQYLISVPLVYETLYSGIQKQISTSSTVRKLVALTFIRISLAYMELKRIYEG  409

Query  1259  KCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggs  1080
             K L K QKQ SY+ S+ DWLWA+ IAA+L P+H+L +KLVYSKIHS+IGISKAG+SGGGS
Sbjct  410   KFLQKSQKQYSYIASIFDWLWAKIIAAILWPVHMLGKKLVYSKIHSAIGISKAGVSGGGS  469

Query  1079  lssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDK  900
             L SHVD+FFEAIDIK+QNGYGLTE +PV A RRP CNVLGS+G PIRHTEIK+VD+ETD+
Sbjct  470   LPSHVDRFFEAIDIKVQNGYGLTECSPVTAARRPTCNVLGSVGHPIRHTEIKIVDSETDE  529

Query  899   ALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSG  720
              L PGSKGIVK KGP VMKGYYKN  ATK+ +DE+GWLNTGD+GWI P+HS+GRSR+  G
Sbjct  530   LLPPGSKGIVKVKGPHVMKGYYKNELATKKVLDEDGWLNTGDIGWIAPHHSVGRSRHCGG  589

Query  719   FIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVL  540
              IVLEGRAKDTIVLS+GENVEP+E+EEAAM S LIQQIVVIGQD+RRLGA+++P+KEEVL
Sbjct  590   VIVLEGRAKDTIVLSTGENVEPTELEEAAMRSTLIQQIVVIGQDQRRLGAIIVPNKEEVL  649

Query  539   LAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPT  360
              AAK+LS+++++ +E+S+EK + L+HEE++ WT G +FQIGPIL+++EPFTID+GL+TPT
Sbjct  650   AAAKRLSILNANTSELSKEKITGLLHEEIRTWTEGFSFQIGPILVVDEPFTIDSGLMTPT  709

Query  359   MKVRRDKVTDLYKEQIEDLY  300
             MK+RRD+V  LY+EQI  LY
Sbjct  710   MKIRRDRVAALYQEQIAHLY  729



>ref|XP_003524920.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic-like 
isoform X1 [Glycine max]
 ref|XP_006580145.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic-like 
isoform X2 [Glycine max]
Length=733

 Score =   966 bits (2497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/715 (68%), Positives = 596/715 (83%), Gaps = 10/715 (1%)
 Frame = -3

Query  2414  NHAVHDLMSCRGFIKMKWQLNSRG-------STSRKFRVFCESTG--MQIRKCSPilesi  2262
             +HA+   +S   F ++ +     G       S    FRVFC+S    ++IRKCSP LES 
Sbjct  18    HHALSRFLSPCNFSRITFSRRKYGVGGPAPSSPLSHFRVFCQSKTEILEIRKCSPFLESS  77

Query  2261  llsgng-llssEWKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGL  2085
             LL GNG + S EWK VPDIW+++AE++GN +ALVDPYH+PPT +++ +LE+ I+ FAEGL
Sbjct  78    LLLGNGGVASDEWKAVPDIWRSSAEKYGNNVALVDPYHDPPTTMTYTQLEQAILDFAEGL  137

Query  2084  RVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALA  1905
             RVIG++PDEK+ALFADNSCRWLVADQG+M +GAINVVRGSRSSVEELLQIYNHSESVAL 
Sbjct  138   RVIGVRPDEKLALFADNSCRWLVADQGMMASGAINVVRGSRSSVEELLQIYNHSESVALV  197

Query  1904  VDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMAL  1725
             VDNPEM++R+A TF+S   +RFIILLWGEK+ +  +     P++++ E+IDLG +S  AL
Sbjct  198   VDNPEMFNRVANTFYSRTSMRFIILLWGEKAELVGQENKHVPVFTFMEVIDLGRQSRRAL  257

Query  1724  LHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGD  1545
              ++ +A  +Y YE IN+D +ATLVYTSGTTGNPKGVMLTH NLLHQI NLWD VP   GD
Sbjct  258   SNAHDAGQRYIYEAINTDSIATLVYTSGTTGNPKGVMLTHRNLLHQIKNLWDIVPAEAGD  317

Query  1544  RFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSG  1365
             RFLSMLPPWHAYERA EYFIF+ G EQVYTTV NLK+DL+RYQPQYLISVPLV+ETLYSG
Sbjct  318   RFLSMLPPWHAYERACEYFIFTCGIEQVYTTVRNLKDDLQRYQPQYLISVPLVFETLYSG  377

Query  1364  ILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAI  1185
             I+KQI+T S  RKL+AL F++ S AY E KRIYEGKCLTK++KQ SY  S+LDWLWAR I
Sbjct  378   IMKQISTGSVVRKLVALTFIRSSIAYMEYKRIYEGKCLTKNKKQASYAYSMLDWLWARTI  437

Query  1184  AALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTES  1005
             A +L PLH+LA+KLVYSKIHS+IGISKAGISGGGSL   VDKFFEAI +K+QNGYGLTE+
Sbjct  438   ATILLPLHILAKKLVYSKIHSAIGISKAGISGGGSLPWEVDKFFEAIGVKVQNGYGLTET  497

Query  1004  APVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNP  825
             +PV+A RRP CNV+GS+G PIRHTE K+VD+ETD+ L PGSKGI+K +GPQVM+GY+KN 
Sbjct  498   SPVIAARRPRCNVIGSVGHPIRHTEFKIVDSETDEVLPPGSKGILKVRGPQVMEGYFKNS  557

Query  824   FATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEI  645
              AT QA+D +GWLNTGD+GWIVP+HS GRSRNSSG IV+EGRAKDTIVLS+GENVEP E+
Sbjct  558   LATNQALDGDGWLNTGDIGWIVPHHSTGRSRNSSGVIVVEGRAKDTIVLSTGENVEPLEL  617

Query  644   EEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLI  465
             EEAAM S++IQQIVV+GQDKRRLGA+++P+KEEVL  A+KLS++DS++++VSEEK + LI
Sbjct  618   EEAAMRSSIIQQIVVVGQDKRRLGAVIVPNKEEVLKVARKLSIIDSNSSDVSEEKVTSLI  677

Query  464   HEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             ++EL+ WT+   FQIGPILL+NEPFTIDNGL+TPTMK+RRD+V   Y+EQI++LY
Sbjct  678   YKELKTWTSESPFQIGPILLVNEPFTIDNGLMTPTMKIRRDRVVAQYREQIDNLY  732



>ref|XP_008222738.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
isoform X1 [Prunus mume]
Length=751

 Score =   964 bits (2493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/736 (67%), Positives = 607/736 (82%), Gaps = 14/736 (2%)
 Frame = -3

Query  2474  KMAALNTKSVMFLLPKSDDGNHAVHDLMSCRGFIKMKWQLNS----RGS--TSRKFRVFC  2313
             +MA +++++ + L+  S    HA+  L S   F   +  L +    RG    +R FRVFC
Sbjct  20    QMATISSRNNLVLVSSSHCA-HALQFLFSNYKFRTRQVFLGTWNGRRGGFPLNRGFRVFC  78

Query  2312  ESTG--MQIRKCSPilesill-sgngllssEWKTVPDIWKTAAEEFGNCIALVDPYHNPP  2142
             +S    MQIR+ SP LES  L      +S EW  VPDIW+++AE +G+ +AL DPYH+PP
Sbjct  79    QSKTEEMQIRRYSPFLESAFLDRNGAFVSGEWHAVPDIWRSSAERYGDRVALTDPYHDPP  138

Query  2141  TNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSR  1962
             +++++K+LE+ I+ F+EGLRV+G+KP+EKIALFADNSCRWLVADQGIM TGAINVVRGSR
Sbjct  139   SSMTYKQLEEGILDFSEGLRVVGVKPEEKIALFADNSCRWLVADQGIMATGAINVVRGSR  198

Query  1961  SSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGR  1782
             SSVEELLQIY+HSESVALAVD+PE+++RIAE F S   ++F+ILLWG+KSS+ +E   G+
Sbjct  199   SSVEELLQIYDHSESVALAVDSPELFNRIAEAFGSKVVMKFVILLWGDKSSLANE---GK  255

Query  1781  -PIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTH  1605
              P ++Y EI+DLG ES  +     +AR QY +E INSDD+ATLVYTSGTTGNPKGVMLTH
Sbjct  256   IPFFNYGEILDLGRESRNSAPDFNDARQQYVHEAINSDDIATLVYTSGTTGNPKGVMLTH  315

Query  1604  ENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLK  1425
              NLLHQI NLWD VP   GDRFLSMLPPWHAYERA EYFIF+ G EQVYTTV NLK+DL+
Sbjct  316   RNLLHQIKNLWDVVPAEVGDRFLSMLPPWHAYERACEYFIFTCGIEQVYTTVRNLKDDLR  375

Query  1424  RYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTK  1245
              YQP Y+ISVPLVYETLYSGI KQI+TSS ARK IAL F++IS AY E KRIYEG  LT+
Sbjct  376   HYQPNYIISVPLVYETLYSGIQKQISTSSAARKFIALTFIRISLAYMEFKRIYEGTYLTR  435

Query  1244  DQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHV  1065
             ++KQPSYL SV DWLWAR +AA+L PLH+L +KLVYSKIHS+IGISKAG+SGGGSL  HV
Sbjct  436   NRKQPSYLASVYDWLWARIVAAILWPLHMLGKKLVYSKIHSAIGISKAGVSGGGSLPPHV  495

Query  1064  DKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPG  885
             DKFFEAI +K+QNGYGLTE++PVVA RRPNCNVLGS+GPPIRHTE KVV++ET + L PG
Sbjct  496   DKFFEAIGVKVQNGYGLTETSPVVAARRPNCNVLGSVGPPIRHTEFKVVESETGEVLLPG  555

Query  884   SKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLE  705
             S GIVK +GPQVMKGYYKNP AT+Q +DE+GWLNTGD+GWI P+HS GRSR   G +VLE
Sbjct  556   STGIVKVRGPQVMKGYYKNPGATEQVLDEDGWLNTGDIGWIAPHHSTGRSRRCGGVVVLE  615

Query  704   GRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKK  525
             GRAKDTIVLS+GENVEP E+EEAAM S+LIQQIVV+GQD+RRLGA+++P+KEEVLLAAKK
Sbjct  616   GRAKDTIVLSTGENVEPVELEEAAMRSSLIQQIVVVGQDQRRLGAIIVPNKEEVLLAAKK  675

Query  524   LSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRR  345
             LS+VD +A+++S++K + L++EEL+KWT+GC+FQIGPIL+++EPFTID+G +TPTMK+RR
Sbjct  676   LSIVDVNASDLSKDKKTSLLYEELRKWTSGCSFQIGPILIVDEPFTIDSGFMTPTMKIRR  735

Query  344   DKVTDLYKEQIEDLYK  297
             D+V   YKEQIE+LYK
Sbjct  736   DRVVAQYKEQIENLYK  751



>ref|XP_004296965.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=730

 Score =   964 bits (2491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/685 (70%), Positives = 590/685 (86%), Gaps = 5/685 (1%)
 Frame = -3

Query  2342  STSRKFRVFCESTG--MQIRKCSP-ilesillsgngllssEWKTVPDIWKTAAEEFGNCI  2172
             S +  FRVFC+S    +QIRK SP +  ++L   + L++ EW+ VPDIW+T+AE++G+ +
Sbjct  47    SQNSGFRVFCQSKTEEIQIRKYSPFLESALLDGNDALVADEWQAVPDIWRTSAEKYGDHV  106

Query  2171  ALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTT  1992
             AL DPYH+PP+N+++K+LE+EI+ F+EGLR++G+KP EKIALFADNSCRWLVADQGIM T
Sbjct  107   ALTDPYHDPPSNMTYKQLEQEILDFSEGLRIVGVKPAEKIALFADNSCRWLVADQGIMAT  166

Query  1991  GAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKS  1812
             GAINVVRGSRSSVEELLQIY+HSESVALAVD+PE+++RIAE F S   ++F+ILLWGEKS
Sbjct  167   GAINVVRGSRSSVEELLQIYDHSESVALAVDSPELFNRIAEPFCSKVVMKFVILLWGEKS  226

Query  1811  SITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTG  1632
             S+ SE  +  P+++Y +I+DLG ES   LL++ +AR  YT+E INS+D+ATLVYTSGTTG
Sbjct  227   SLASE--ENIPVFNYKDILDLGQESRKRLLNASDARQYYTHEAINSNDIATLVYTSGTTG  284

Query  1631  NPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTT  1452
             NPKGVMLTH NLLHQ+ NLWD VP  PGDRFLSMLPPWHAYERAAEYF F+ G EQVYTT
Sbjct  285   NPKGVMLTHRNLLHQVRNLWDIVPAEPGDRFLSMLPPWHAYERAAEYFTFTYGVEQVYTT  344

Query  1451  VINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKR  1272
             V NLK+DL+ YQP+Y++SVPLVYETLY+GI KQI++SS ARKLIAL FL+IS AY E KR
Sbjct  345   VKNLKDDLRHYQPKYVVSVPLVYETLYNGIQKQISSSSKARKLIALSFLRISLAYMEFKR  404

Query  1271  IYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagis  1092
             IYEG  LT++QKQPSY  ++ DWLWAR +AA+L PLH+L  KLVYSKIHS+IGISKAGIS
Sbjct  405   IYEGTYLTRNQKQPSYYAALADWLWARIVAAILLPLHMLGTKLVYSKIHSAIGISKAGIS  464

Query  1091  gggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDA  912
             GGGSL SHVDKFFEAI IK+QNGYGLTES+PV+A RRPNCNVLGS+G PIRHTE KVVD+
Sbjct  465   GGGSLPSHVDKFFEAIGIKVQNGYGLTESSPVIAARRPNCNVLGSVGHPIRHTEFKVVDS  524

Query  911   ETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSR  732
             ETD+ L PGS GIVK  GPQVMKGYYKNP ATKQ +DE+GWLNTGD+GWI P+HSIGRSR
Sbjct  525   ETDEVLPPGSSGIVKVTGPQVMKGYYKNPGATKQVLDEDGWLNTGDIGWIAPHHSIGRSR  584

Query  731   NSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHK  552
             +  G +VLEGRAKDTIVLS+GENVEP E+EEAAM S+LIQQIVVIGQD+RRLGA+++P++
Sbjct  585   SCGGVVVLEGRAKDTIVLSTGENVEPVELEEAAMRSSLIQQIVVIGQDQRRLGAIIVPNR  644

Query  551   EEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGL  372
             EE LLAA K S  D++ +++S++K + L++EEL+KWT+GC+FQIGPIL+++EPFTID+GL
Sbjct  645   EEALLAATKSSSGDANISDLSKDKLTGLLYEELKKWTSGCSFQIGPILIVDEPFTIDSGL  704

Query  371   LTPTMKVRRDKVTDLYKEQIEDLYK  297
             +TPTMK+RRDKV   YKEQIE+LYK
Sbjct  705   MTPTMKIRRDKVVAQYKEQIEELYK  729



>ref|XP_008380459.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
[Malus domestica]
Length=745

 Score =   961 bits (2483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/726 (67%), Positives = 597/726 (82%), Gaps = 13/726 (2%)
 Frame = -3

Query  2441  FLLPKSDDGNHAVHDLMSCRGF----IKMKWQLNSRGS--TSRKFRVFCEST----GMQI  2292
              LL  S D   A+  L S   F    + ++     RG    +R FRVFCES      +QI
Sbjct  22    LLLASSSDCGGALQFLFSSYSFRSRCVFLRTWHGRRGGFLPNRGFRVFCESKLQTEELQI  81

Query  2291  RKCSPilesillsgn-gllssEWKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELE  2115
             R+ SP LES  L+ N   +S EW+ VPDIW+++AE +G+ +AL DPYH+PP+++++K+LE
Sbjct  82    RRYSPFLESAFLNRNGASVSDEWQAVPDIWRSSAERYGDRVALTDPYHDPPSSMTYKQLE  141

Query  2114  KEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQI  1935
             +EI+ F+EGLRV+G+KP++KIALFA+NSCRWLVADQGIM TGAINVVRGSRSSVEELLQI
Sbjct  142   EEILDFSEGLRVVGVKPEDKIALFANNSCRWLVADQGIMATGAINVVRGSRSSVEELLQI  201

Query  1934  YNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEII  1755
             Y+HSESVALAVD+PE++++IAE F S    +F+ILLWGEKSS+ SE  +  P+++Y EI+
Sbjct  202   YDHSESVALAVDSPELFNQIAEAFSSKVVTKFVILLWGEKSSLASE--EKTPVFNYKEIL  259

Query  1754  DLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNL  1575
             DLG ES  ++L   +AR +YTYE INSDDVATLVYTSGTTGNPKGVMLTH NLLHQI NL
Sbjct  260   DLGRESRKSMLDFNDARGKYTYETINSDDVATLVYTSGTTGNPKGVMLTHRNLLHQIKNL  319

Query  1574  WDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISV  1395
             WD VP   GDRFLSMLPPWHAYERA EYF  + G EQVYTTV NLKEDL +YQP ++ISV
Sbjct  320   WDVVPAEAGDRFLSMLPPWHAYERACEYFTLTYGIEQVYTTVRNLKEDLLQYQPNFIISV  379

Query  1394  PLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVS  1215
             PLVYETLYSGI KQI+ SS ARK IAL F++IS AY E KRIYEG  LT++QKQPSYL S
Sbjct  380   PLVYETLYSGIQKQISMSSTARKFIALTFIRISLAYMELKRIYEGTYLTRNQKQPSYLAS  439

Query  1214  VLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAIDIK  1035
             + DWLWAR +AA+L PLH+L +KLVY+KIHS++GISKAGISGGGSL SHVDKFFEAI +K
Sbjct  440   LYDWLWARVVAAILWPLHMLGKKLVYTKIHSAVGISKAGISGGGSLPSHVDKFFEAIGVK  499

Query  1034  LQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGP  855
             +QNGYGLTE++PV+A RRPN NVLGS+GPPIRHTE KVVD ET + L PGS GI+  +GP
Sbjct  500   VQNGYGLTETSPVIAARRPNNNVLGSVGPPIRHTEFKVVDLETGEVLPPGSSGIINVRGP  559

Query  854   QVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLS  675
             QVMKGYYKNP ATKQ +DE+GWL+TGD+GWI P+HS GRSR   G IVLEGRAKDTIVLS
Sbjct  560   QVMKGYYKNPAATKQVLDEDGWLSTGDIGWIAPHHSTGRSRRCGGVIVLEGRAKDTIVLS  619

Query  674   SGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATE  495
             +GENVEP E+EEAAM S+LIQQIVV+GQD+RRLGA+++P+KEEVLLAAKKLS+VD +A+E
Sbjct  620   TGENVEPVELEEAAMRSSLIQQIVVVGQDQRRLGAIIVPNKEEVLLAAKKLSIVDVNASE  679

Query  494   VSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQ  315
             +S +K   L++E+L++WTTGC+FQIGPIL+++EPFTID+GL+TPTMK+RRD+V   +KEQ
Sbjct  680   LSMDKMKNLVYEDLRRWTTGCSFQIGPILIVDEPFTIDSGLMTPTMKIRRDRVVAQFKEQ  739

Query  314   IEDLYK  297
             I +LYK
Sbjct  740   INNLYK  745



>gb|EYU31521.1| hypothetical protein MIMGU_mgv1a001985mg [Erythranthe guttata]
Length=730

 Score =   958 bits (2476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/700 (70%), Positives = 593/700 (85%), Gaps = 13/700 (2%)
 Frame = -3

Query  2384  RGFIKMKWQLNSRGSTSRKFRVFCESTG--MQIRKCSPilesillsgngll-ssEWKTVP  2214
             RGF+  K          R FRV C+S    ++IRK SP+LES ++ GNG+L S+E  T+P
Sbjct  40    RGFVVAK---------PRNFRVRCDSQTKEIEIRKFSPVLESDVIQGNGVLPSNELTTIP  90

Query  2213  DIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADN  2034
             DIW+++A++FG+ +ALVDPYH P TN+++K+LE+EI++F EGLRVIGLKP+EK+ALFADN
Sbjct  91    DIWRSSAQKFGDRVALVDPYHKPATNMTYKQLEQEILNFCEGLRVIGLKPEEKLALFADN  150

Query  2033  SCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSH  1854
             SCRWLV+DQGIM TGAINVVRG+RSS EELLQIYNHSESVAL VDNPEMY+RI ETF S 
Sbjct  151   SCRWLVSDQGIMATGAINVVRGTRSSSEELLQIYNHSESVALVVDNPEMYNRIVETFQSR  210

Query  1853  ADVRFIILLWGEKSSI-TSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPIN  1677
             A VRF++LLWGEKSSI   E     PIYSY EII  G+E+   LL S++AR+QY Y+ I+
Sbjct  211   AIVRFVVLLWGEKSSIPNGESATDIPIYSYEEIIKFGHENRALLLRSEDARNQYIYKTIS  270

Query  1676  SDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAA  1497
             SDDVATLVYTSGTTGNPKGVMLTH NLLHQ+ NLWD VP VPGDRFLSMLPPWHAYERA 
Sbjct  271   SDDVATLVYTSGTTGNPKGVMLTHRNLLHQVSNLWDIVPAVPGDRFLSMLPPWHAYERAC  330

Query  1496  EYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIA  1317
             EYFIF+ G E VYT+V  L++DL+RYQP Y+ISVPLVYETLYSGI KQINTSS ARKL+A
Sbjct  331   EYFIFTHGVEHVYTSVQKLRDDLRRYQPHYVISVPLVYETLYSGIQKQINTSSAARKLVA  390

Query  1316  LLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVY  1137
             LLFLKIS AY +AKRIYEGKCLT++ +QPS+L ++ DWL +  +A +L PLH LA+ +VY
Sbjct  391   LLFLKISLAYMDAKRIYEGKCLTRNLEQPSHLSALFDWLRSGIVATVLWPLHTLAKIIVY  450

Query  1136  skihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGS  957
              KIHS+IGISKAG+SGGGSL  HVD+FFEAIDIK+ NGYGLTES+PVVA RRP CNV GS
Sbjct  451   RKIHSTIGISKAGVSGGGSLPPHVDRFFEAIDIKVLNGYGLTESSPVVAARRPTCNVPGS  510

Query  956   IGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTG  777
             IG PIRHTEIKVVDA+TDK L  GSKGIVK +GPQVMKGYYKNP ATK+AIDE GWLNTG
Sbjct  511   IGHPIRHTEIKVVDADTDKILPYGSKGIVKVRGPQVMKGYYKNPSATKKAIDEEGWLNTG  570

Query  776   DLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVI  597
             D+GWI   HS GRSR + G IVLEGRAKDTIVLS+GENVEP+EIEEAA+ S++IQQIVVI
Sbjct  571   DIGWISSPHSRGRSRQTGGVIVLEGRAKDTIVLSTGENVEPAEIEEAALRSSIIQQIVVI  630

Query  596   GQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIG  417
             GQD+RRLGA+++P+KEE+LL AK+LS+V++DA+E+ ++K   L+HEEL+KWT+ C+FQ+G
Sbjct  631   GQDQRRLGAIIVPNKEEILLQAKRLSLVEADASELDKQKQVNLVHEELRKWTSDCSFQVG  690

Query  416   PILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             PIL+++EPFTID+GL+TPTMK+RRD+V  LYKEQI++LYK
Sbjct  691   PILVVDEPFTIDSGLMTPTMKIRRDRVVSLYKEQIDNLYK  730



>ref|XP_009373573.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
[Pyrus x bretschneideri]
Length=745

 Score =   952 bits (2461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/685 (70%), Positives = 579/685 (85%), Gaps = 7/685 (1%)
 Frame = -3

Query  2336  SRKFRVFCEST----GMQIRKCSPilesillsgngllss-EWKTVPDIWKTAAEEFGNCI  2172
             +R FRVFCES      + IR+ SP LES  L+  G   S EW+ VPDIW+++AE +G+ +
Sbjct  63    NRGFRVFCESKLQTEELLIRRYSPFLESAFLNRKGSSVSDEWQAVPDIWRSSAERYGDRV  122

Query  2171  ALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTT  1992
             AL DPYH+PP+++++K+LE+EI+ F+EGLRV+G+KP++KIALFADNSCRWLVADQGIM T
Sbjct  123   ALTDPYHDPPSSMTYKQLEEEILDFSEGLRVVGVKPEDKIALFADNSCRWLVADQGIMAT  182

Query  1991  GAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKS  1812
             GAINVVRGSRSSVEELLQIY+HSESVALAVD+PE+++RIAE F S   ++F+ILLWGEKS
Sbjct  183   GAINVVRGSRSSVEELLQIYDHSESVALAVDSPELFNRIAEAFSSKVVMKFVILLWGEKS  242

Query  1811  SITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTG  1632
             S+ SE  +  P+++Y EI+DLG  S  ++L   +AR +YTYE INSDDVATLVYTSGTTG
Sbjct  243   SLASE--EETPVFNYKEILDLGRGSRKSMLDFNDARGKYTYETINSDDVATLVYTSGTTG  300

Query  1631  NPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTT  1452
             NP+GVMLTH NLLHQI NLWD VP   GDRFLSMLPPWHAYERA EYF  + G EQVYTT
Sbjct  301   NPRGVMLTHRNLLHQIKNLWDVVPAEAGDRFLSMLPPWHAYERACEYFTLTYGIEQVYTT  360

Query  1451  VINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKR  1272
             V NLKEDL +YQP ++ISVPLVYETLYSGI KQI+TSS ARK IAL F++IS AY E KR
Sbjct  361   VRNLKEDLLQYQPNFIISVPLVYETLYSGIQKQISTSSTARKFIALTFIRISLAYMEFKR  420

Query  1271  IYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagis  1092
             IYEG  LT++QKQ SYL S+ DWLWAR +AA+L PLH+L +KLVYSKIHS+IGISKAGIS
Sbjct  421   IYEGTYLTRNQKQASYLASLYDWLWARVVAAILWPLHMLGKKLVYSKIHSAIGISKAGIS  480

Query  1091  gggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDA  912
             GGGSL  HVDKFFEAI +K+QNGYGLTE++PV+A RRPN NVLGS+GPPIRHTE KVVD 
Sbjct  481   GGGSLPLHVDKFFEAIGVKVQNGYGLTETSPVIAARRPNNNVLGSVGPPIRHTEFKVVDL  540

Query  911   ETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSR  732
             ET + L PGS GIV  +GPQVMKGYYKNP ATKQ +DE+GWL+TGD+GWI P+HS GRSR
Sbjct  541   ETGEVLPPGSSGIVNVRGPQVMKGYYKNPAATKQVLDEDGWLSTGDIGWIAPHHSTGRSR  600

Query  731   NSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHK  552
                G IVLEGRAKDTIVLS+GENVEP E+EEAAM S+LIQQIVV+GQD+RRLGA+++P+K
Sbjct  601   RCGGVIVLEGRAKDTIVLSTGENVEPVELEEAAMRSSLIQQIVVVGQDQRRLGAIIVPNK  660

Query  551   EEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGL  372
             EEVLLAAKKLS+VD +A+E+S +K   L++E+L++WTTGC+FQIGPIL+++E FTID+GL
Sbjct  661   EEVLLAAKKLSIVDVNASELSMDKMKNLVYEDLRRWTTGCSFQIGPILIVDESFTIDSGL  720

Query  371   LTPTMKVRRDKVTDLYKEQIEDLYK  297
             +TPTMK+RRD+V   YKEQI +LYK
Sbjct  721   MTPTMKIRRDRVVAQYKEQIHNLYK  745



>ref|XP_007034195.1| AMP-dependent synthetase and ligase family protein isoform 1 
[Theobroma cacao]
 gb|EOY05121.1| AMP-dependent synthetase and ligase family protein isoform 1 
[Theobroma cacao]
Length=754

 Score =   950 bits (2456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/685 (70%), Positives = 575/685 (84%), Gaps = 3/685 (0%)
 Frame = -3

Query  2342  STSRKFRVFCESTG--MQIRKCSPilesillsgngllss-EWKTVPDIWKTAAEEFGNCI  2172
             S   KFRVFCES    +QIR+CSP+LE + LS N  + S EWK VPDIW+++AE++G+ +
Sbjct  70    SPGSKFRVFCESKTQELQIRRCSPLLEKVSLSSNDAVVSDEWKAVPDIWRSSAEKYGDRV  129

Query  2171  ALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTT  1992
             A+VDPYH+PP+ +++ +LE+EI+ FAEGLR+IGLKP++K+ALFADNS RWLVADQGIM  
Sbjct  130   AVVDPYHDPPSTMTYIQLEQEILDFAEGLRLIGLKPEDKLALFADNSSRWLVADQGIMAM  189

Query  1991  GAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKS  1812
             GAINVVRGSRS+VEELL IYNHSESV L VDNPE ++R+A TF S A +RFI+LLWGEKS
Sbjct  190   GAINVVRGSRSAVEELLHIYNHSESVGLVVDNPEFFNRLAGTFCSKATMRFIVLLWGEKS  249

Query  1811  SITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTG  1632
              + +    G PI+SY EI++LG ES + L  S +AR  Y YE I SDDVATLVYTSGTT 
Sbjct  250   CLATGETQGVPIFSYREIMELGRESRVGLTDSHDARQGYIYEAIGSDDVATLVYTSGTTD  309

Query  1631  NPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTT  1452
             NPKGVMLTH+NLLHQI NLWD VP   GDRFLSMLP WHAYERA EYFIF+ G EQ YTT
Sbjct  310   NPKGVMLTHKNLLHQIRNLWDVVPAEAGDRFLSMLPSWHAYERACEYFIFTHGIEQEYTT  369

Query  1451  VINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKR  1272
             V NLK+DL+ YQP YLISVPLVYETLYSGI KQI TSS ARK IAL F+++S AY + KR
Sbjct  370   VRNLKDDLRHYQPHYLISVPLVYETLYSGIQKQIYTSSTARKFIALTFIRVSLAYMDLKR  429

Query  1271  IYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagis  1092
             IYEG CLT+DQKQPSY+VS+L+WLWAR IAA+L PLH+LA+KLVY KIHS+IGISKAGIS
Sbjct  430   IYEGLCLTRDQKQPSYVVSMLEWLWARIIAAILWPLHVLAKKLVYEKIHSAIGISKAGIS  489

Query  1091  gggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDA  912
             GGGSL  H+DKFFEAI +KLQNGYGLTES+PV+A RRPNCNVLGS+G PI+HTE K+VD+
Sbjct  490   GGGSLPMHIDKFFEAIGVKLQNGYGLTESSPVIAARRPNCNVLGSVGHPIQHTEFKIVDS  549

Query  911   ETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSR  732
             ETD+ L PGSKGIVK +GPQVMKGYYKNP AT+QA+DE+GWLNTGD+GWI P HS G+S 
Sbjct  550   ETDEVLPPGSKGIVKVRGPQVMKGYYKNPLATRQALDEDGWLNTGDIGWIAPCHSAGQSH  609

Query  731   NSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHK  552
                G IVLEGRAKDTIVLS+GENVEP EIEEAAM S+LIQQIVV+GQD+RRL A+++P+K
Sbjct  610   RCGGVIVLEGRAKDTIVLSTGENVEPLEIEEAAMRSSLIQQIVVVGQDQRRLAAIIVPNK  669

Query  551   EEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGL  372
             +EVL AAK LS+VD+DA ++ + K + L++EEL KWT+ C+FQIGPIL+++EPF+ID GL
Sbjct  670   DEVLQAAKNLSIVDADAADLGKGKMTSLLYEELWKWTSECSFQIGPILIVDEPFSIDGGL  729

Query  371   LTPTMKVRRDKVTDLYKEQIEDLYK  297
             +TPTMK+RRDKV   YKE+I +LY+
Sbjct  730   MTPTMKIRRDKVVAQYKEEIANLYE  754



>ref|XP_011010078.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
[Populus euphratica]
Length=751

 Score =   946 bits (2444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/685 (70%), Positives = 578/685 (84%), Gaps = 3/685 (0%)
 Frame = -3

Query  2342  STSRKFRVFCESTG--MQIRKCSPilesillsgn-gllssEWKTVPDIWKTAAEEFGNCI  2172
             S+ R FR+ CE+    ++IR+CSP LE  L+S N  L S +W+ VPDIW+++AE++G+ I
Sbjct  67    SSRRGFRLSCETKTEEIKIRRCSPYLERTLVSSNGALTSDDWRAVPDIWRSSAEKYGDRI  126

Query  2171  ALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTT  1992
             A+VDPYH+PPT+ ++K+LE+EI+ F+EGLRVIG+KPDEK+ALFADNS RWLV DQG+M  
Sbjct  127   AVVDPYHDPPTSFTYKQLEQEILHFSEGLRVIGVKPDEKLALFADNSYRWLVTDQGMMAM  186

Query  1991  GAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKS  1812
             GA++VVRGSRSS+EELLQIY HSESVALAVDN E+++RI ETF S A  RF+ILLWGEKS
Sbjct  187   GAVDVVRGSRSSIEELLQIYIHSESVALAVDNAELFNRIVETFSSKAAPRFVILLWGEKS  246

Query  1811  SITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTG  1632
              +    M+G PI+SY EIIDLG ES      S +AR  Y YE I+SDD+ATLVYTSGTTG
Sbjct  247   HLAINRMEGIPIFSYKEIIDLGQESCKTFSDSDDARQHYKYETISSDDIATLVYTSGTTG  306

Query  1631  NPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTT  1452
             NPKGVMLTH+NLLHQI NLWD +P  P DRFLSMLPPWHAYERAAEYF+F+ G EQVYTT
Sbjct  307   NPKGVMLTHKNLLHQINNLWDVLPAQPADRFLSMLPPWHAYERAAEYFLFTRGTEQVYTT  366

Query  1451  VINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKR  1272
             V NLK DL++YQP YLI+VPLV+ETLYSGI KQ++TSS  RK +A +F+KIS AY E KR
Sbjct  367   VRNLKVDLQQYQPHYLITVPLVFETLYSGIQKQLSTSSTLRKFLAFMFIKISLAYMEMKR  426

Query  1271  IYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagis  1092
             I+EG  L + +K+P Y VS+LDWLWAR IAA+L P+H+LA+KLVY KIHS+IGISKAG+S
Sbjct  427   IHEGTYLVRSRKEPLYFVSMLDWLWARIIAAILLPVHMLAKKLVYCKIHSAIGISKAGVS  486

Query  1091  gggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDA  912
             GGGSL SHVDKFFEAI + +QNGYG+TES+PV A RRP+ NVLGSIG PIRHTE K+VDA
Sbjct  487   GGGSLPSHVDKFFEAIGVVVQNGYGMTESSPVTAARRPSNNVLGSIGLPIRHTEFKIVDA  546

Query  911   ETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSR  732
             ET +AL  GSKGIVK +GPQVMKGYYK+P ATKQAIDE+GWLNTGD+GWI P HS GRSR
Sbjct  547   ETGEALPHGSKGIVKVRGPQVMKGYYKDPLATKQAIDEDGWLNTGDIGWIAPYHSRGRSR  606

Query  731   NSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHK  552
             +  G IVLEGRAKDTIVL +GENVEP E+EEAAM S+LIQQIVVIGQD+RRLGA+V+P+K
Sbjct  607   HCGGVIVLEGRAKDTIVLLTGENVEPLELEEAAMRSSLIQQIVVIGQDQRRLGAIVVPNK  666

Query  551   EEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGL  372
             +EVL AAKK S+VD DATE+S+++ + L++EEL+KWT+GC FQIGPIL+I+EPFTID+GL
Sbjct  667   DEVLEAAKKRSIVDPDATELSKKQITSLLYEELRKWTSGCCFQIGPILVIDEPFTIDSGL  726

Query  371   LTPTMKVRRDKVTDLYKEQIEDLYK  297
             +TPTMK+RRDKV  LYKEQI DLYK
Sbjct  727   MTPTMKIRRDKVVALYKEQIADLYK  751



>gb|KDP32594.1| hypothetical protein JCGZ_13144 [Jatropha curcas]
Length=722

 Score =   944 bits (2440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/713 (68%), Positives = 585/713 (82%), Gaps = 5/713 (1%)
 Frame = -3

Query  2420  DGNHAVHDLM-SCRGFIKMKWQLNSRGSTSRKFRVFCEST--GMQIRKCSPilesillsg  2250
             D  HA H L  S R   ++  +  +  S+ R+FRV+CE+     ++RKCSP LE  LL+ 
Sbjct  10    DHTHASHKLFYSFRTCNRIFLRKCNNLSSIRRFRVYCETKIEEKKVRKCSPHLEKALLAR  69

Query  2249  --ngllssEWKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVI  2076
                 L S EW+ VPDIW+T AE++G+ +ALVDPYH+PPTN+++ +LE+EI+ F+EGLRVI
Sbjct  70    NGVALASDEWRAVPDIWRTTAEKYGDRVALVDPYHDPPTNMTYGQLEQEILHFSEGLRVI  129

Query  2075  GLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDN  1896
             G+KP++KIALFADNSCRWLVADQG+M  GAINVVRGSRSSVEELLQIY HSESVALA+D+
Sbjct  130   GVKPNDKIALFADNSCRWLVADQGMMAMGAINVVRGSRSSVEELLQIYTHSESVALAIDS  189

Query  1895  PEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHS  1716
             PE+++RI+ETF S A + FIILLWGEKS +    M G P++SY EII+LG ES   L  S
Sbjct  190   PELFNRISETFCSKAVISFIILLWGEKSQLAIGGMKGVPVFSYKEIIELGQESRRTLFDS  249

Query  1715  QEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFL  1536
               AR    YE I+ DD+AT+VYTSGTTGNPKGVMLTH+NLLHQI NLW  VP  PGDRFL
Sbjct  250   NYARQYCVYETISLDDIATIVYTSGTTGNPKGVMLTHKNLLHQINNLWVVVPAEPGDRFL  309

Query  1535  SMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILK  1356
             SMLPPWHAYERA EYFI + G EQVYTTV NLKEDL+RYQP Y++SVPLVYETLY GI K
Sbjct  310   SMLPPWHAYERACEYFIMAHGAEQVYTTVRNLKEDLQRYQPNYMVSVPLVYETLYRGIQK  369

Query  1355  QINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAAL  1176
             QI+TSS  RKL+AL F+K+S AY E KRIYEG  LT+ QKQPS+LVS+LD LWAR +A +
Sbjct  370   QISTSSTIRKLVALTFIKVSLAYMEFKRIYEGTYLTQTQKQPSHLVSLLDCLWARILATI  429

Query  1175  LCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPV  996
             L P+H+LA KLVYSKI S+IG+SKAGISGGGSL  +VDK FEAI +K+QNGYG+TES+PV
Sbjct  430   LFPVHMLATKLVYSKIQSAIGLSKAGISGGGSLPLYVDKLFEAIGVKVQNGYGMTESSPV  489

Query  995   VACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFAT  816
              A RRP  NVLGSIGPP+  TE KVVDAET + L  GSKGIVK +GPQVMKGYYKNP+AT
Sbjct  490   TAARRPTWNVLGSIGPPLPDTEFKVVDAETGETLPDGSKGIVKVRGPQVMKGYYKNPWAT  549

Query  815   KQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEA  636
             KQ IDENGWL+TGD+GWI P+HSIGRSR   G IVLEGRAKDTIVLS+GENVEPSE+EEA
Sbjct  550   KQVIDENGWLSTGDIGWIAPHHSIGRSRRCGGVIVLEGRAKDTIVLSTGENVEPSELEEA  609

Query  635   AMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEE  456
             AM S LIQQIVVIGQD+RRLGA+V+P+KEEVL AAK +S+++S+ +E+S+E+ + L+ EE
Sbjct  610   AMRSALIQQIVVIGQDQRRLGAIVVPNKEEVLRAAKMMSIINSNDSELSKEQLTTLVDEE  669

Query  455   LQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             L+KWT+GC+FQIGPIL+++EPFTI+NG++TPTMK+RRDKV D  +EQI +LYK
Sbjct  670   LRKWTSGCSFQIGPILIVDEPFTIENGMMTPTMKIRRDKVMDKLREQIANLYK  722



>ref|XP_011045809.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
[Populus euphratica]
Length=752

 Score =   942 bits (2435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/694 (69%), Positives = 578/694 (83%), Gaps = 3/694 (0%)
 Frame = -3

Query  2369  MKWQLNSRGSTSRKFRVFCESTG--MQIRKCSPilesillsgn-gllssEWKTVPDIWKT  2199
             ++ Q N   S  R FRV CE+    ++IR+CSP LES L+S N  L S +W+ VPDIW++
Sbjct  59    LRKQRNYGFSPRRGFRVSCETKTEEIKIRRCSPNLESALVSRNGALTSDDWRAVPDIWRS  118

Query  2198  AAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWL  2019
             +AE++G+ +A+VDP+H+PPT+L++K+LE+EI+ F+EGLRVIG+ PDEK+ALFADNS RWL
Sbjct  119   SAEKYGDQVAVVDPHHDPPTSLTYKQLEQEILDFSEGLRVIGVMPDEKLALFADNSYRWL  178

Query  2018  VADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRF  1839
             VADQG+M  GA++VVRGSRSSVEELLQIYNHSESVALAVDNPE+ +RIAETF S A  RF
Sbjct  179   VADQGMMAMGAVDVVRGSRSSVEELLQIYNHSESVALAVDNPELLNRIAETFSSKAAPRF  238

Query  1838  IILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVAT  1659
             +ILLWGEKSS+T  VM+G PI++Y EIIDLG ES  +   S +AR  Y YE I+SDD+AT
Sbjct  239   VILLWGEKSSLTINVMEGIPIFNYKEIIDLGRESRKSFFDSSDARQHYKYETISSDDIAT  298

Query  1658  LVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFS  1479
             LVYTSGTTGNPKGVMLTH+NLLHQI N W+ VP  P DRFLSMLPPWHAYERA EYFIF+
Sbjct  299   LVYTSGTTGNPKGVMLTHKNLLHQINNFWEIVPAQPADRFLSMLPPWHAYERACEYFIFA  358

Query  1478  LGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKI  1299
              G EQVYTTV N K DL++YQP Y+ISVPLVYETLYSGI KQI+TSS  RKL+A  F+KI
Sbjct  359   NGAEQVYTTVRNFKVDLQQYQPHYVISVPLVYETLYSGIQKQISTSSTLRKLLAFTFIKI  418

Query  1298  SFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihss  1119
             S AY E KRIYEG  LT+ Q + SY  S+L WLWAR +AA+L P+H+LA KLVYSKI S+
Sbjct  419   SLAYMEMKRIYEGTYLTRSQNEQSYFASILGWLWARIVAAILLPVHMLAEKLVYSKIQSA  478

Query  1118  igiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIR  939
             IGI KAG+SGGGSL +HVDKFFEAI + L NGYG+TES+PV+A RR   NVLGS+G PIR
Sbjct  479   IGIRKAGVSGGGSLPAHVDKFFEAIGVVLLNGYGMTESSPVLAARRLGNNVLGSVGHPIR  538

Query  938   HTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIV  759
             HTE K+VD+ET K+L  GSKGIV+ +GPQVMKGYYKNP ATKQA+DE+GWLNTGDLGWI 
Sbjct  539   HTEFKIVDSETGKSLPHGSKGIVRVRGPQVMKGYYKNPLATKQAVDEDGWLNTGDLGWIA  598

Query  758   PNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRR  579
             P HS G+SR   G IVLEGRAKDTIVL++GENVEP E+EEAAM S+LIQQIVVIGQD+RR
Sbjct  599   PYHSRGKSRRCGGVIVLEGRAKDTIVLTTGENVEPLELEEAAMKSSLIQQIVVIGQDQRR  658

Query  578   LGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLIN  399
             LGA+V+P+KEEVL  AKKLS+VD+DATE+S+++ + L+ +EL+KWT+  +FQIGP+L+I+
Sbjct  659   LGAIVVPNKEEVLEVAKKLSIVDADATELSKKQIASLLDKELRKWTSEASFQIGPVLVID  718

Query  398   EPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             E FTID+GL+TPTMK+RRDKV  LY+EQI +LYK
Sbjct  719   ESFTIDSGLMTPTMKIRRDKVVALYEEQIANLYK  752



>ref|XP_002298670.1| AMP-binding family protein [Populus trichocarpa]
 ref|XP_006369825.1| hypothetical protein POPTR_0001s32900g [Populus trichocarpa]
 gb|EEE83475.1| AMP-binding family protein [Populus trichocarpa]
 gb|ERP66394.1| hypothetical protein POPTR_0001s32900g [Populus trichocarpa]
Length=694

 Score =   938 bits (2424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/692 (69%), Positives = 578/692 (84%), Gaps = 1/692 (0%)
 Frame = -3

Query  2369  MKWQLNSRGSTSRKFRVFCESTGMQIRKCSPilesillsgn-gllssEWKTVPDIWKTAA  2193
             ++ Q N   S  R FRV CE+  ++IR+CSP LES L+S N  L S +W+ VPDIW+++A
Sbjct  3     LQKQRNYGFSARRGFRVSCETKEIKIRRCSPNLESALVSRNGALTSDDWRAVPDIWRSSA  62

Query  2192  EEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVA  2013
             E++G+ +A+VDP+H+PPT++++K+LE+EI+ F+EGLRVIG+KPDEK+ALFADNS RWLVA
Sbjct  63    EKYGDQVAVVDPHHDPPTSMTYKQLEEEILDFSEGLRVIGVKPDEKLALFADNSYRWLVA  122

Query  2012  DQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFII  1833
             DQG+M  GA++VVRGSRSSVEELLQIYNHSESVALAVDNPE+++RIAETF S+A  RF+I
Sbjct  123   DQGMMAMGAVDVVRGSRSSVEELLQIYNHSESVALAVDNPELFNRIAETFSSNAAPRFVI  182

Query  1832  LLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLV  1653
             LLWGEKSS+T   M+G PI++Y EIIDLG ES  A   S +AR  Y YE I+SDD+ATLV
Sbjct  183   LLWGEKSSLTINAMEGIPIFNYKEIIDLGRESRKAFFDSGDARQHYKYETISSDDIATLV  242

Query  1652  YTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLG  1473
             YTSGTTGNPKGVMLTH+NLLHQI N W+ VP  P DRFLSMLPPWHAYERA EYFIF+ G
Sbjct  243   YTSGTTGNPKGVMLTHKNLLHQINNFWEIVPAQPADRFLSMLPPWHAYERACEYFIFANG  302

Query  1472  CEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISF  1293
              EQVYTTV N K DL++YQP YLISVPLV+ETLYSGI KQI+ SS  RKL+A  F+KIS 
Sbjct  303   AEQVYTTVRNFKVDLQQYQPHYLISVPLVFETLYSGIQKQISKSSTLRKLLAFTFIKISL  362

Query  1292  AYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssig  1113
             AY E KRIYEG  LT+ Q + SY VS+L WL AR  AA+L P+H+LA KLVYSKI S+IG
Sbjct  363   AYMEMKRIYEGTYLTRSQNEQSYFVSILGWLRARIFAAILLPVHMLAEKLVYSKIQSAIG  422

Query  1112  iskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHT  933
             I KAG+SGGGSL +HVDKFFEAI + L NGYG+TES+PV+A R+ + NVLGS+G PIRHT
Sbjct  423   IRKAGVSGGGSLPAHVDKFFEAIGVVLLNGYGMTESSPVLAARQLSNNVLGSVGHPIRHT  482

Query  932   EIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPN  753
             E K+VDAET K+L  GSKGIV+ +GPQVMKGYYKNP ATKQA+DE+GWLNTGDLGWI P 
Sbjct  483   EFKIVDAETGKSLPYGSKGIVRVRGPQVMKGYYKNPLATKQAVDEDGWLNTGDLGWIAPY  542

Query  752   HSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLG  573
             HS G+S    G IVLEGRAKDTIVLS+GENVEP E+EEAAM S+LIQQIVVIGQD+RRLG
Sbjct  543   HSRGKSCRCGGIIVLEGRAKDTIVLSTGENVEPLELEEAAMKSSLIQQIVVIGQDQRRLG  602

Query  572   ALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEP  393
             A+V+P+KEEVL  AKKLS+VD+DATE+S+++ + L+ +EL+KWT+  +FQIGP+L+I+E 
Sbjct  603   AIVVPNKEEVLEVAKKLSIVDADATELSKKQIANLLDKELRKWTSEASFQIGPVLVIDES  662

Query  392   FTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             FTID+GL+TPTMK+RRDKV  LY+EQI +LYK
Sbjct  663   FTIDSGLMTPTMKIRRDKVVALYEEQIANLYK  694



>ref|XP_006369826.1| hypothetical protein POPTR_0001s32900g [Populus trichocarpa]
 ref|XP_006369827.1| hypothetical protein POPTR_0001s32900g [Populus trichocarpa]
 gb|ERP66395.1| hypothetical protein POPTR_0001s32900g [Populus trichocarpa]
 gb|ERP66396.1| hypothetical protein POPTR_0001s32900g [Populus trichocarpa]
Length=752

 Score =   936 bits (2418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/694 (68%), Positives = 578/694 (83%), Gaps = 3/694 (0%)
 Frame = -3

Query  2369  MKWQLNSRGSTSRKFRVFCESTG--MQIRKCSPilesillsgn-gllssEWKTVPDIWKT  2199
             ++ Q N   S  R FRV CE+    ++IR+CSP LES L+S N  L S +W+ VPDIW++
Sbjct  59    LQKQRNYGFSARRGFRVSCETKTEEIKIRRCSPNLESALVSRNGALTSDDWRAVPDIWRS  118

Query  2198  AAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWL  2019
             +AE++G+ +A+VDP+H+PPT++++K+LE+EI+ F+EGLRVIG+KPDEK+ALFADNS RWL
Sbjct  119   SAEKYGDQVAVVDPHHDPPTSMTYKQLEEEILDFSEGLRVIGVKPDEKLALFADNSYRWL  178

Query  2018  VADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRF  1839
             VADQG+M  GA++VVRGSRSSVEELLQIYNHSESVALAVDNPE+++RIAETF S+A  RF
Sbjct  179   VADQGMMAMGAVDVVRGSRSSVEELLQIYNHSESVALAVDNPELFNRIAETFSSNAAPRF  238

Query  1838  IILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVAT  1659
             +ILLWGEKSS+T   M+G PI++Y EIIDLG ES  A   S +AR  Y YE I+SDD+AT
Sbjct  239   VILLWGEKSSLTINAMEGIPIFNYKEIIDLGRESRKAFFDSGDARQHYKYETISSDDIAT  298

Query  1658  LVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFS  1479
             LVYTSGTTGNPKGVMLTH+NLLHQI N W+ VP  P DRFLSMLPPWHAYERA EYFIF+
Sbjct  299   LVYTSGTTGNPKGVMLTHKNLLHQINNFWEIVPAQPADRFLSMLPPWHAYERACEYFIFA  358

Query  1478  LGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKI  1299
              G EQVYTTV N K DL++YQP YLISVPLV+ETLYSGI KQI+ SS  RKL+A  F+KI
Sbjct  359   NGAEQVYTTVRNFKVDLQQYQPHYLISVPLVFETLYSGIQKQISKSSTLRKLLAFTFIKI  418

Query  1298  SFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihss  1119
             S AY E KRIYEG  LT+ Q + SY VS+L WL AR  AA+L P+H+LA KLVYSKI S+
Sbjct  419   SLAYMEMKRIYEGTYLTRSQNEQSYFVSILGWLRARIFAAILLPVHMLAEKLVYSKIQSA  478

Query  1118  igiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIR  939
             IGI KAG+SGGGSL +HVDKFFEAI + L NGYG+TES+PV+A R+ + NVLGS+G PIR
Sbjct  479   IGIRKAGVSGGGSLPAHVDKFFEAIGVVLLNGYGMTESSPVLAARQLSNNVLGSVGHPIR  538

Query  938   HTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIV  759
             HTE K+VDAET K+L  GSKGIV+ +GPQVMKGYYKNP ATKQA+DE+GWLNTGDLGWI 
Sbjct  539   HTEFKIVDAETGKSLPYGSKGIVRVRGPQVMKGYYKNPLATKQAVDEDGWLNTGDLGWIA  598

Query  758   PNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRR  579
             P HS G+S    G IVLEGRAKDTIVLS+GENVEP E+EEAAM S+LIQQIVVIGQD+RR
Sbjct  599   PYHSRGKSCRCGGIIVLEGRAKDTIVLSTGENVEPLELEEAAMKSSLIQQIVVIGQDQRR  658

Query  578   LGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLIN  399
             LGA+V+P+KEEVL  AKKLS+VD+DATE+S+++ + L+ +EL+KWT+  +FQIGP+L+I+
Sbjct  659   LGAIVVPNKEEVLEVAKKLSIVDADATELSKKQIANLLDKELRKWTSEASFQIGPVLVID  718

Query  398   EPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             E FTID+GL+TPTMK+RRDKV  LY+EQI +LYK
Sbjct  719   ESFTIDSGLMTPTMKIRRDKVVALYEEQIANLYK  752



>gb|AET04094.2| long-chain-fatty-acid CoA ligase (AMP-forming) [Medicago truncatula]
Length=724

 Score =   933 bits (2412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/693 (69%), Positives = 572/693 (83%), Gaps = 14/693 (2%)
 Frame = -3

Query  2333  RKFRVFCES---TGMQIRKCSPilesills--------gngllssEWKTVPDIWKTAAEE  2187
             R FRVF +S   T   IRKCSP LES +L              S EWK VPDIW+++AE+
Sbjct  32    RCFRVFSQSNTETVQIIRKCSPFLESSMLVGNNNNNNNAAVDSSHEWKVVPDIWRSSAEK  91

Query  2186  FGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQ  2007
             +G+ +ALVD YH+PP+ +++ +LE+ I+ +AEGLRVIG++PDEK+ALFADNSCRWLVADQ
Sbjct  92    YGDKVALVDQYHHPPSTITYNQLEQAILDYAEGLRVIGVRPDEKLALFADNSCRWLVADQ  151

Query  2006  GIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILL  1827
             G+M +GAINVVRGSRSSVEELLQIYNHSESVALAVD PEM++RIA+ F+S   +RFIILL
Sbjct  152   GMMASGAINVVRGSRSSVEELLQIYNHSESVALAVDGPEMFNRIAKPFYSKTGMRFIILL  211

Query  1826  WGEKS--SITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLV  1653
             WGEKS  ++ +E     PI+S+ E+IDLG ES MAL  S EA  +Y YE INSDD+ATL+
Sbjct  212   WGEKSDLNLIAEENKEVPIFSFMEVIDLGRESRMALSDSHEASQRYVYEAINSDDIATLI  271

Query  1652  YTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLG  1473
             YTSGTTGNPKGVMLTH NLLHQI NLWD VP   GDRFLSMLPPWHAYERA EYFIF+ G
Sbjct  272   YTSGTTGNPKGVMLTHRNLLHQIKNLWDTVPAEVGDRFLSMLPPWHAYERACEYFIFTCG  331

Query  1472  CEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISF  1293
              EQVYTTV NLK+DL RYQP Y+ISVPLV+ETLYSGI KQI+TS P RKL+AL F+++S 
Sbjct  332   IEQVYTTVRNLKDDLGRYQPHYMISVPLVFETLYSGIQKQISTSPPVRKLVALTFIRVSL  391

Query  1292  AYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssig  1113
             AY E KRIYEGKCLT++ KQPS + S+LD LWAR IA +L P+HLLA K VYSKIHS+IG
Sbjct  392   AYMEYKRIYEGKCLTRNVKQPSIVNSMLDCLWARIIATILFPIHLLAIKFVYSKIHSAIG  451

Query  1112  iskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHT  933
             +SKAGISGGGSL   VDKFFEAI +K+QNGYGLTE++PV+A RRP CNV+GS+G P++HT
Sbjct  452   LSKAGISGGGSLPLEVDKFFEAIGVKVQNGYGLTETSPVIAARRPRCNVIGSVGHPVQHT  511

Query  932   EIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPN  753
             E KVVD+ET + L PGSKGI+K +GP VM GYYKNP AT QA+D++GWLNTGDLGWI P+
Sbjct  512   EFKVVDSETGEVLPPGSKGILKVRGPPVMNGYYKNPLATNQALDKDGWLNTGDLGWIAPH  571

Query  752   HSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLG  573
             HS GRSRNSSG IV++GRAKDTIVLS+GENVEP+E+EEAAM S++IQQIVVIGQDKRRLG
Sbjct  572   HSTGRSRNSSGVIVVDGRAKDTIVLSTGENVEPAELEEAAMRSSIIQQIVVIGQDKRRLG  631

Query  572   ALVLPHKEEVLLAAKKLSVVDSDATE-VSEEKTSKLIHEELQKWTTGCTFQIGPILLINE  396
             A+++P+ EEVL  A++LS++DS ++  VSEEK   LI++EL+ W +   FQIGPILL+NE
Sbjct  632   AIIVPNSEEVLKVARELSIIDSISSNVVSEEKVLNLIYKELKTWMSESPFQIGPILLVNE  691

Query  395   PFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             PFTIDNGL+TPTMK+RRD+V   YKEQI+DLYK
Sbjct  692   PFTIDNGLMTPTMKIRRDRVVAKYKEQIDDLYK  724



>ref|XP_003601697.1| Annotation was added to scaffolds in November 2011~Long-chain-fatty-acid 
CoA ligase [Medicago truncatula]
 gb|AES71948.1| long-chain-fatty-acid CoA ligase (AMP-forming) [Medicago truncatula]
Length=720

 Score =   929 bits (2401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/687 (67%), Positives = 567/687 (83%), Gaps = 7/687 (1%)
 Frame = -3

Query  2342  STSRKFRVFCESTG----MQIRKCSPilesillsgngllssEWKTVPDIWKTAAEEFGNC  2175
             S +  FRVFC +       +IR+ SP+LES    G  L    WK VPDIW+T+AE++G+ 
Sbjct  36    SPTSSFRVFCHTQSKTKKTEIRRFSPLLESSGNGGVALDE--WKAVPDIWRTSAEKYGDK  93

Query  2174  IALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMT  1995
             +ALVD YH+PP+ +++K+L+  I++FAEGLRVIG+KPDEKIALFADNSCRWLVADQG+M 
Sbjct  94    VALVDQYHDPPSTMTYKQLKDAILNFAEGLRVIGVKPDEKIALFADNSCRWLVADQGMMA  153

Query  1994  TGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEK  1815
              GAINVVRGSRSS+EELLQIYNHSESVALAVDNPEMY++IA+ F+    +RFIILLWGEK
Sbjct  154   IGAINVVRGSRSSIEELLQIYNHSESVALAVDNPEMYNQIAKPFYLKTSIRFIILLWGEK  213

Query  1814  SSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTT  1635
             SS+ +E   G PIY++ E+I+ G +S  AL  S +AR  Y +E I  DD+ATLVYTSGTT
Sbjct  214   SSLVNEADKGVPIYTFMEVINFGRQSRRALHTSDDAREHYIFETIKLDDIATLVYTSGTT  273

Query  1634  GNPKGVMLTHENLLHQILNLWDPVPVV-PGDRFLSMLPPWHAYERAAEYFIFSLGCEQVY  1458
             GNPKGVMLTH+NLLHQI +L D VP    GD+FLSMLPPWHAYERA EY +FS G E +Y
Sbjct  274   GNPKGVMLTHQNLLHQIKHLSDVVPTTEAGDKFLSMLPPWHAYERACEYLVFSRGLEHIY  333

Query  1457  TTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEA  1278
             TTV NLK+DL RY+P  ++SVPLV+ETLYSGI+KQI+TSS  RKL+AL F+++S  Y E 
Sbjct  334   TTVRNLKDDLGRYKPHLMVSVPLVFETLYSGIMKQISTSSLVRKLVALTFIRVSLGYMEC  393

Query  1277  KRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskag  1098
             KRIYEGKCLTK+QK PSYL ++LDWLWAR +A +L P+H+LA KLVYSKI S+IGIS A 
Sbjct  394   KRIYEGKCLTKNQKAPSYLYAMLDWLWARIMATILYPVHMLANKLVYSKIRSTIGISTAA  453

Query  1097  isgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVV  918
             ISGGGSL SHVDKFFEAI + LQNGYGLTE++PV+A RR  C+V+GS+G P++HTE KVV
Sbjct  454   ISGGGSLPSHVDKFFEAIGLNLQNGYGLTETSPVIAARRLGCDVIGSVGYPLKHTEFKVV  513

Query  917   DAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGR  738
             D+ET + L PGSKGI+K +GPQ+MKGYYKNP AT + ID +GWLNTGD+GWI  +HS GR
Sbjct  514   DSETGEVLPPGSKGILKVRGPQLMKGYYKNPLATNRVIDSDGWLNTGDIGWIAAHHSTGR  573

Query  737   SRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLP  558
             SRNS G IV+EGRAKDTIVLSSGENVEP E+EEAA  SNLIQQIVVIGQDKRRLGA+++P
Sbjct  574   SRNSGGVIVVEGRAKDTIVLSSGENVEPGELEEAATRSNLIQQIVVIGQDKRRLGAIIVP  633

Query  557   HKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDN  378
             +KEEVL AAK+LS++DS++++VS+EK + LI+ EL+ WT+G  FQIGPILL+N+PFTIDN
Sbjct  634   NKEEVLKAAKELSIIDSNSSDVSQEKVTSLIYNELRTWTSGFPFQIGPILLVNDPFTIDN  693

Query  377   GLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             GL+TPTMKVRRD+V   Y++QIE+LYK
Sbjct  694   GLMTPTMKVRRDRVVAQYRDQIENLYK  720



>ref|XP_006492527.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic-like 
[Citrus sinensis]
Length=728

 Score =   927 bits (2396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/682 (68%), Positives = 572/682 (84%), Gaps = 4/682 (1%)
 Frame = -3

Query  2330  KFRVFCESTGM---QIRKCSPilesillsgn-gllssEWKTVPDIWKTAAEEFGNCIALV  2163
             +FRVFCES      QIR+CSP LE  LL  N  L S EWK VPDIW++ A+++G+ IA++
Sbjct  47    RFRVFCESKTTEHKQIRRCSPFLERSLLLSNGSLDSDEWKAVPDIWRSTADKYGDSIAVI  106

Query  2162  DPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAI  1983
             DPYH+PP+  ++K+LE+EI+ FAEGLRVIG+KP+EK++LF+DNSCRWLVADQG++ TGAI
Sbjct  107   DPYHDPPSKFTYKQLEQEILDFAEGLRVIGVKPEEKLSLFSDNSCRWLVADQGMLATGAI  166

Query  1982  NVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSIT  1803
             NVVRGSRSS EELL IYNHSESVALAV+NPE ++RIAET  S A +RF+ILLWG+KSS+ 
Sbjct  167   NVVRGSRSSSEELLHIYNHSESVALAVENPEFFNRIAETLCSKAAMRFVILLWGKKSSVA  226

Query  1802  SEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPK  1623
              ++++  P++SY+EIIDLG ES  A   S +AR  Y YE I SDD+AT VYTSGTTGNPK
Sbjct  227   PDIVEEIPVFSYDEIIDLGQESRKAFSDSNDARKHYKYETIGSDDIATYVYTSGTTGNPK  286

Query  1622  GVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVIN  1443
             GVMLTH+NLLHQI +L+D VP   GD+FLSMLPPWH YERA  YFIFS G E +YT V N
Sbjct  287   GVMLTHKNLLHQIRSLYDIVPAENGDKFLSMLPPWHVYERACGYFIFSRGIELMYTAVRN  346

Query  1442  LKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYE  1263
             LK+DL+RYQP Y+ISVPLVYETLYSGI KQI TSS AR+++A   ++ISFAY   KRIYE
Sbjct  347   LKDDLQRYQPHYMISVPLVYETLYSGIQKQIFTSSAARRVVARALIRISFAYTAFKRIYE  406

Query  1262  GKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisggg  1083
             G CLT++QKQPSYLV+++DWLWAR I A+L PLHLLA KLVY KI S+IGISKAG+SGGG
Sbjct  407   GFCLTRNQKQPSYLVALIDWLWARIICAILWPLHLLAEKLVYKKIQSAIGISKAGVSGGG  466

Query  1082  slssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETD  903
             SL  H+D F+EAI +K+Q GYGLTES+PV+A RRP CNVLGS+G PI HTEIK+VDAET+
Sbjct  467   SLPMHIDLFYEAIGVKVQVGYGLTESSPVIAARRPTCNVLGSVGHPINHTEIKIVDAETN  526

Query  902   KALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSS  723
             + L  GSKGIVK +G QVMKGY+KNP ATKQA+DE+GWLNTGD+GWI P+HS GRSR   
Sbjct  527   EVLPAGSKGIVKVRGSQVMKGYFKNPSATKQALDEDGWLNTGDIGWIAPHHSRGRSRRCG  586

Query  722   GFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEV  543
             G +VLEGRAKDTIVLS+GENVEP E+EEAA+ S+LI+QIVVIGQD+RR GA+++P KEEV
Sbjct  587   GVLVLEGRAKDTIVLSTGENVEPLELEEAALRSSLIRQIVVIGQDQRRPGAIIVPDKEEV  646

Query  542   LLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTP  363
             L+AAK+LS+V +DA+E+S+EKT  L++ EL+KWT+ C+FQIGPI +++EPFTID+GL+TP
Sbjct  647   LMAAKRLSIVHADASELSKEKTISLLYGELRKWTSKCSFQIGPIHVVDEPFTIDSGLMTP  706

Query  362   TMKVRRDKVTDLYKEQIEDLYK  297
             TMK+RRD+V   +KE+IE+LYK
Sbjct  707   TMKIRRDRVAAQFKEEIENLYK  728



>ref|XP_006421037.1| hypothetical protein CICLE_v10004427mg [Citrus clementina]
 gb|ESR34277.1| hypothetical protein CICLE_v10004427mg [Citrus clementina]
Length=728

 Score =   926 bits (2392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/682 (68%), Positives = 574/682 (84%), Gaps = 4/682 (1%)
 Frame = -3

Query  2330  KFRVFCESTGM---QIRKCSPilesillsgn-gllssEWKTVPDIWKTAAEEFGNCIALV  2163
             +FRVFCES      QIR+CSP LE  LLS N  L S EWK VPDIW++ A+++ + IA++
Sbjct  47    RFRVFCESKTTEHKQIRRCSPFLERSLLSSNGSLDSDEWKAVPDIWRSTADKYADSIAVI  106

Query  2162  DPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAI  1983
             DPYH+PP+  ++K+LE+EI+ FAEGLRVIG+KP+EK++LF+DNSCRWLVADQG++ TGAI
Sbjct  107   DPYHDPPSKFTYKQLEQEILDFAEGLRVIGVKPEEKLSLFSDNSCRWLVADQGMLATGAI  166

Query  1982  NVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSIT  1803
             NVVRGSRSS EELL IYNHSESVALAV+NPE ++RIAET  S A +RFIILLWG+KSS+ 
Sbjct  167   NVVRGSRSSSEELLHIYNHSESVALAVENPEFFNRIAETLCSKAAMRFIILLWGKKSSVA  226

Query  1802  SEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPK  1623
              ++++  P++SY+EIIDLG ES  A   S +AR  Y YE I SDD+AT VYTSGTTGNPK
Sbjct  227   PDIVEEIPVFSYDEIIDLGRESRKAFSDSNDARKHYKYETIGSDDIATYVYTSGTTGNPK  286

Query  1622  GVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVIN  1443
             GVMLTH+NLLHQI +L+D VP   GD+FLSMLPPWH YERA  YFIFS G E +YT V N
Sbjct  287   GVMLTHKNLLHQIRSLYDIVPAENGDKFLSMLPPWHVYERACGYFIFSRGIELMYTAVRN  346

Query  1442  LKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYE  1263
             LK+DL+RYQP Y+ISVPLVYETLYSGI KQI TSS AR+++A   ++ISFAY   KRIYE
Sbjct  347   LKDDLQRYQPHYMISVPLVYETLYSGIQKQIFTSSAARRVVARALIRISFAYTAFKRIYE  406

Query  1262  GKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisggg  1083
             G CLT++QK+PSYLV+++DWLWAR I A+L PLHLLA KLVY KI S+IGISKAG+SGGG
Sbjct  407   GFCLTRNQKEPSYLVALIDWLWARIICAILWPLHLLAEKLVYKKIQSAIGISKAGVSGGG  466

Query  1082  slssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETD  903
             SL  H+D F+EAI +K+Q GYGLTES+PV+A RRP CNVLGS+G PI+HTEIK+VDAET+
Sbjct  467   SLPMHIDLFYEAIGVKVQVGYGLTESSPVIAARRPTCNVLGSVGHPIKHTEIKIVDAETN  526

Query  902   KALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSS  723
             + L  GSKGIVK +G QVMKGY+KNP ATKQA+DE+GWLNTGD+GWI P+HS GRSR   
Sbjct  527   EVLPAGSKGIVKVRGSQVMKGYFKNPSATKQALDEDGWLNTGDIGWIAPHHSRGRSRRCG  586

Query  722   GFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEV  543
             G +VLEGRAKDTIVLS+GENVEP E+EEAA+ S+LI+QIVVIGQD+RR GA+++P KEEV
Sbjct  587   GVLVLEGRAKDTIVLSTGENVEPLELEEAALRSSLIRQIVVIGQDQRRPGAIIVPDKEEV  646

Query  542   LLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTP  363
             L+AAK+LS+V ++A+E+S+EKT  L++ EL+KWT+ C+FQIGPIL+++EPFTID+GL+TP
Sbjct  647   LMAAKRLSIVHAEASELSKEKTISLLYGELRKWTSKCSFQIGPILVVDEPFTIDSGLMTP  706

Query  362   TMKVRRDKVTDLYKEQIEDLYK  297
             TMK+RRD+V   +KE+IE+LYK
Sbjct  707   TMKIRRDRVAAQFKEEIENLYK  728



>ref|XP_007153625.1| hypothetical protein PHAVU_003G051300g [Phaseolus vulgaris]
 gb|ESW25619.1| hypothetical protein PHAVU_003G051300g [Phaseolus vulgaris]
Length=729

 Score =   925 bits (2391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/715 (65%), Positives = 581/715 (81%), Gaps = 12/715 (2%)
 Frame = -3

Query  2414  NHAVHDLMSCRGFIKMKWQLNSRG------STSRKFRVFC--ESTGMQIRKCSPilesil  2259
             ++A+    SC  F ++ +   + G      S    FRVFC  E+  ++IR+C+P LES L
Sbjct  18    HYALPLFHSCTNFTRITFSPTNYGAALAPSSPLSHFRVFCRSETETLEIRRCAPFLESSL  77

Query  2258  lsgn-gllssEWKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLR  2082
             L  N  + S EWK VPDIW+++AE++G+ +ALVDPYH+PPT +++K+LE+ I+ FAEGLR
Sbjct  78    LLDNGDVASDEWKVVPDIWRSSAEKYGDNVALVDPYHHPPTTMTYKQLEQAILDFAEGLR  137

Query  2081  VIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAV  1902
             VIG+KPDEK+ALFADNSCRWLVADQG+M +GAINVVRGSRSSV ELLQIYNHSESVAL V
Sbjct  138   VIGVKPDEKLALFADNSCRWLVADQGMMASGAINVVRGSRSSVAELLQIYNHSESVALVV  197

Query  1901  DNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALL  1722
             DN EM++R+A TF+S   +RFIILLWGEKS + ++     P++++ ++IDLG ES   L 
Sbjct  198   DNSEMFNRVANTFYSTTTMRFIILLWGEKSELVAQQNKHIPVFTFTQLIDLGAESRTKL-  256

Query  1721  HSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDR  1542
                +   +Y YE I SD +ATL+YTSGTTGNPKGVMLTH+NLLHQI NLWD VP   GDR
Sbjct  257   --SKPEQRYMYEAIKSDSIATLIYTSGTTGNPKGVMLTHQNLLHQIKNLWDIVPAKVGDR  314

Query  1541  FLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGI  1362
             FLSMLPPWHAYERA EYFIF+ G +Q YTTV NLK+DL+RYQP YLISVPLV+E LYSGI
Sbjct  315   FLSMLPPWHAYERACEYFIFTCGIQQQYTTVRNLKDDLERYQPHYLISVPLVFEILYSGI  374

Query  1361  LKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIA  1182
             +KQI+TSS  R+L+AL F+ +S AY E KRIYEGKCL  ++KQ SY+ S+L+WLWAR IA
Sbjct  375   MKQISTSSAVRRLVALTFISVSLAYMEYKRIYEGKCLPMNKKQASYVYSMLEWLWARIIA  434

Query  1181  ALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESA  1002
              LL P+H+LA+KLVY+KIHS+IGISKAGISGGGSL   VDKFFEAI +K+QNGYGLTE++
Sbjct  435   TLLLPIHILAKKLVYNKIHSAIGISKAGISGGGSLPWEVDKFFEAIGVKVQNGYGLTETS  494

Query  1001  PVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPF  822
             PVVA RRP CNVLGSIG PI  TE K+VD+ET + L PGSKGI+K +GPQVMKGY+KN  
Sbjct  495   PVVAARRPGCNVLGSIGHPIHETEFKIVDSETGEVLPPGSKGILKVRGPQVMKGYFKNDL  554

Query  821   ATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIE  642
             AT +A+D +GWLNTGD+GWI P+HS GRSR+SSG IV+EGRAKDTIVL +GENVEP E+E
Sbjct  555   ATSEALDGDGWLNTGDIGWISPHHSTGRSRHSSGMIVVEGRAKDTIVLLTGENVEPGELE  614

Query  641   EAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIH  462
             EAAM S LIQQIV++GQDKRRLGA+++P+KEEVL+ A+KLS+++SD ++VSEEK   LI+
Sbjct  615   EAAMRSCLIQQIVIVGQDKRRLGAVIVPNKEEVLMVARKLSIINSDNSDVSEEKVKTLIY  674

Query  461   EELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             +EL+ W +   FQIGPILL+NEPFTIDNGL+TPTMK+RRD+V   YK+QI++LYK
Sbjct  675   KELKTWMSKSPFQIGPILLVNEPFTIDNGLMTPTMKIRRDRVVTQYKDQIDNLYK  729



>ref|XP_004502250.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic-like 
[Cicer arietinum]
Length=721

 Score =   924 bits (2387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/688 (68%), Positives = 565/688 (82%), Gaps = 6/688 (1%)
 Frame = -3

Query  2342  STSRKFRVFC-----ESTGMQIRKCSPilesillsgn-gllssEWKTVPDIWKTAAEEFG  2181
             S +  FRVFC     ++  +QIR+ SP+LES L+SGN  +   EWK VPDIW+T+AE+FG
Sbjct  34    SRTSSFRVFCCQSEFKTEKVQIRRFSPLLESSLVSGNGAVALDEWKAVPDIWRTSAEKFG  93

Query  2180  NCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGI  2001
             + +ALVD YH+PPT +++K+LE  I+ FAEGLRVIG+KPDEKIALFADNSCRWLVADQG+
Sbjct  94    DNVALVDQYHDPPTTMTYKQLEDAILDFAEGLRVIGVKPDEKIALFADNSCRWLVADQGM  153

Query  2000  MTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWG  1821
             M  GAINVVRGSRSS+EELLQIYNHSESVALAVDNPEM++RIA+ F+  + +RFIILLWG
Sbjct  154   MAIGAINVVRGSRSSIEELLQIYNHSESVALAVDNPEMFNRIAKPFYLKSSIRFIILLWG  213

Query  1820  EKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSG  1641
             EKS + SE     PI+++ E+I LG E   AL    +AR  Y +E I SDD+ATLVYTSG
Sbjct  214   EKSCLVSEGNKEVPIFTFMEVIHLGRECRKALFECHDARQPYKFEAIKSDDIATLVYTSG  273

Query  1640  TTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQV  1461
             TTGNPKGVMLTH NLLHQI +L D  P   GD FLSMLPPWHAYERA EYFIF+ G EQ+
Sbjct  274   TTGNPKGVMLTHHNLLHQIKHLTDVAPAEVGDIFLSMLPPWHAYERACEYFIFARGVEQI  333

Query  1460  YTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKE  1281
             YTTV NLK+DL RYQPQ ++SVPLVYETLYSGI KQI+TSS  RK +AL F++IS  Y E
Sbjct  334   YTTVRNLKDDLGRYQPQLMVSVPLVYETLYSGIQKQISTSSLIRKFVALTFIRISLGYME  393

Query  1280  AKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiska  1101
              KRIYEGKCLT +QK PS+L S+LD +WAR IAA+L P+H+LA KLVYSKI S+IGISK 
Sbjct  394   YKRIYEGKCLTSNQKPPSFLYSILDLIWARLIAAILYPIHMLANKLVYSKIRSTIGISKV  453

Query  1100  gisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKV  921
              ISGGGSL SHVDKFFEAI   LQNGYGLTE++PV+A RRP C+V+GS+G PI+HTE KV
Sbjct  454   AISGGGSLPSHVDKFFEAIGFNLQNGYGLTETSPVIAARRPGCDVIGSVGYPIKHTEFKV  513

Query  920   VDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIG  741
             VD+ET + L PGSKGI+K +GP +MKGYYKNP AT QAID +GWLNTGD+GWIVP HS G
Sbjct  514   VDSETGEILPPGSKGILKVRGPPLMKGYYKNPSATSQAIDRDGWLNTGDIGWIVPYHSTG  573

Query  740   RSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVL  561
             RSRNS G IV+EGRAKDTIVLSSGENVEP E+EEAA+ SNLIQQIVVIGQDKRRLGA+V+
Sbjct  574   RSRNSGGVIVVEGRAKDTIVLSSGENVEPGELEEAALRSNLIQQIVVIGQDKRRLGAVVV  633

Query  560   PHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTID  381
             P+KE  L  A++LS++DS ++++S+EK + LI+ EL+ WT+   FQIGPILL+N+PFTID
Sbjct  634   PNKEGALKVARELSIIDSKSSDISQEKLTSLIYNELRTWTSEFPFQIGPILLVNDPFTID  693

Query  380   NGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             NGL+TPTMK+RRD+V   +K+QIE+LYK
Sbjct  694   NGLMTPTMKIRRDRVMAQFKDQIENLYK  721



>ref|XP_004138459.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic-like 
[Cucumis sativus]
 gb|KGN45714.1| hypothetical protein Csa_6G007970 [Cucumis sativus]
Length=731

 Score =   924 bits (2387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/723 (65%), Positives = 576/723 (80%), Gaps = 15/723 (2%)
 Frame = -3

Query  2456  TKSVMFLLPKSDDGNHAVHDLMSCRGFIKMKWQLNSRGSTSRKFRVFC--ESTGMQIRKC  2283
             T+ + FL   S +G+H + + +          +  +R S  R  RVFC  E+  +Q+R+ 
Sbjct  21    TRPLHFLF--SHNGSHLLQNCV----------ESGARRSAIRDCRVFCQSETETLQLRRY  68

Query  2282  SPilesill-sgngllssEWKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEI  2106
             SP+LES  +   +  +S EW+ VPDIW+++AE +G+ IALVDPYHNP + +++KELE+ I
Sbjct  69    SPLLESSFVPGISATVSDEWQAVPDIWRSSAERYGDRIALVDPYHNPASKMTYKELEQSI  128

Query  2105  VSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNH  1926
             ++F+EGLRVIG+KPDEKIALFADNSCRWLVADQGIMT GAINVVRGSRSS EELLQIYNH
Sbjct  129   LNFSEGLRVIGIKPDEKIALFADNSCRWLVADQGIMTMGAINVVRGSRSSSEELLQIYNH  188

Query  1925  SESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLG  1746
             SESVAL VDNPE+++RI ETFH    +R +ILLWGEKSS+ +E +DG  ++ YN+I+D+G
Sbjct  189   SESVALVVDNPELFNRIVETFHLKTSMRCVILLWGEKSSLANEGVDGITVFDYNDIMDMG  248

Query  1745  NESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDP  1566
              ES   +L S +A+  YTYEPINSDD+ATLVYTSGTTGNPKGVMLTH NLLHQI NLWD 
Sbjct  249   RESRKVMLGSHDAKQCYTYEPINSDDIATLVYTSGTTGNPKGVMLTHRNLLHQIKNLWDI  308

Query  1565  VPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLV  1386
             VP   GD+FLSMLPPWHAYERA EYFIF+ G EQ YTT+ NLK+DL+ YQP YLISVPLV
Sbjct  309   VPAKVGDKFLSMLPPWHAYERACEYFIFTFGVEQAYTTIRNLKDDLRHYQPDYLISVPLV  368

Query  1385  YETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLD  1206
             YETLYSGI KQI  SS  RKLI L F+ +S AY E KRIYEG  LT+   QP++LVS LD
Sbjct  369   YETLYSGIQKQILASSNLRKLIVLAFINVSLAYMELKRIYEGTYLTRSNVQPTHLVSALD  428

Query  1205  WLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAIDIKLQN  1026
             WL+AR  A++L P+H+LA+ +VYSK+ S+IGI KAGISGGGSL SHVD FFEAI I +QN
Sbjct  429   WLFARMTASILWPIHMLAKIIVYSKVQSAIGIWKAGISGGGSLPSHVDLFFEAIGITVQN  488

Query  1025  GYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVM  846
             GYGLTE +PVVA RRP CNVLGS+G PIRHTE ++VD ET  AL PGS+GIV+ +GPQVM
Sbjct  489   GYGLTECSPVVAARRPTCNVLGSVGHPIRHTEFRIVDMETGDALPPGSRGIVEVRGPQVM  548

Query  845   KGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGE  666
             KGYYKN  AT+Q +D+ GW ++GD+GWI P+HS GRSR   G IVL+GRAKDTIVL +GE
Sbjct  549   KGYYKNSSATQQVLDKEGWFSSGDIGWIAPHHSRGRSRRCGGVIVLDGRAKDTIVLLTGE  608

Query  665   NVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSE  486
             NVEP+ IEEAAM S LIQQIVVIGQD+RRLGA+V P+KEEVL AAKKLS  DS  ++VS 
Sbjct  609   NVEPTVIEEAAMRSTLIQQIVVIGQDQRRLGAIVFPNKEEVLSAAKKLSAEDSSTSDVSN  668

Query  485   EKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIED  306
             E  + LI+ E++KWT+ C FQIGPIL++NEPFTIDNGL+TPTMKVRRDKV+  YK++IE+
Sbjct  669   ETLTNLIYSEVRKWTSECPFQIGPILIVNEPFTIDNGLMTPTMKVRRDKVSAYYKKEIEN  728

Query  305   LYK  297
             L+K
Sbjct  729   LFK  731



>ref|XP_008458147.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
[Cucumis melo]
Length=731

 Score =   922 bits (2382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/718 (66%), Positives = 576/718 (80%), Gaps = 11/718 (2%)
 Frame = -3

Query  2426  SDDGNHAVHDLMSCRGFIKMKWQLNSRGSTSRKF-----RVFCESTG--MQIRKCSPile  2268
             S D   ++H L S  G   ++   N  GS +R+      RVFC+S    +Q+R+ SP+LE
Sbjct  17    SSDCPRSLHFLFSHYGSHLLQ---NCVGSGARRLAIRDCRVFCQSKTETLQLRRYSPLLE  73

Query  2267  sill-sgngllssEWKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAE  2091
             S  +   +  +S EW+ VPDIW+++AE +G+ IALVDPYHNP + +++KELE+ I++F+E
Sbjct  74    SSFVPGTSATVSDEWQAVPDIWRSSAERYGDRIALVDPYHNPASKMTYKELEQSILNFSE  133

Query  2090  GLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVA  1911
             GLR IG+KPDEKIALFADNSCRWLVADQGIMT GAINVVRGSRSS EELLQIYNHSESVA
Sbjct  134   GLRAIGIKPDEKIALFADNSCRWLVADQGIMTMGAINVVRGSRSSSEELLQIYNHSESVA  193

Query  1910  LAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHM  1731
             L VDNPE+++RI ETFH  A +R +ILLWGEKSS+ +E +D   ++ YN+I+D+G ES  
Sbjct  194   LVVDNPELFNRILETFHLKASMRCVILLWGEKSSLANEGVDDITVFDYNDIMDMGRESRK  253

Query  1730  ALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVP  1551
              +L S +A+ +YTYEPI+SDD+ATLVYTSGTTGNPKGVMLTH NLLHQI NLWD VP   
Sbjct  254   VMLGSHDAKQRYTYEPISSDDIATLVYTSGTTGNPKGVMLTHRNLLHQIKNLWDIVPAKV  313

Query  1550  GDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLY  1371
             GD+FLSMLPPWHAYERA EYFIF+ G EQ YTT+ NLK+DL++YQP YLISVPLVYETLY
Sbjct  314   GDKFLSMLPPWHAYERACEYFIFTFGVEQAYTTIRNLKDDLRQYQPDYLISVPLVYETLY  373

Query  1370  SGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWAR  1191
             SGI KQI  SS AR+LI L F+ +S AY + KRIYEG  LT+ + QP+++VS LDWL+AR
Sbjct  374   SGIQKQILASSNARRLIVLAFINVSLAYMQLKRIYEGTYLTRSKVQPTHIVSALDWLFAR  433

Query  1190  AIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLT  1011
               AA+L P+H+LA+ +VYSK+ S+IGI KAGISGGGSL SHVD FFEAI I +QNGYGLT
Sbjct  434   MTAAILWPIHMLAKIVVYSKVQSAIGIWKAGISGGGSLPSHVDLFFEAIGITVQNGYGLT  493

Query  1010  ESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYK  831
             E +PVVA RRP CNVLGS+G PIRHTE ++VD ET  AL PGS+GIV+ +GPQVMKGYYK
Sbjct  494   ECSPVVAARRPTCNVLGSVGHPIRHTEFRIVDMETGDALPPGSRGIVEVRGPQVMKGYYK  553

Query  830   NPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPS  651
             N  AT+Q +D+ GW +TGD+GWI P+HS GRSR   G IVL+GRAKDTIVL +GENVEP+
Sbjct  554   NSSATQQVLDQEGWFSTGDIGWIAPHHSRGRSRRCGGVIVLDGRAKDTIVLLTGENVEPT  613

Query  650   EIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSK  471
              IEEAAM S LIQQIVVIGQD+RRLGA+V P+KEEVL AAKKLS  DS  ++VS E  + 
Sbjct  614   VIEEAAMRSTLIQQIVVIGQDQRRLGAIVFPNKEEVLSAAKKLSAEDSSTSDVSNEILTN  673

Query  470   LIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             LI+ E++KWT+ C FQIGPIL++NEPFTIDNGL+TPTMKVRRDKV   YK++IE+L+K
Sbjct  674   LIYSEVRKWTSECPFQIGPILIVNEPFTIDNGLMTPTMKVRRDKVAAYYKKEIENLFK  731



>ref|XP_007163805.1| hypothetical protein PHAVU_001G265700g [Phaseolus vulgaris]
 gb|ESW35799.1| hypothetical protein PHAVU_001G265700g [Phaseolus vulgaris]
Length=719

 Score =   921 bits (2380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/680 (69%), Positives = 568/680 (84%), Gaps = 5/680 (1%)
 Frame = -3

Query  2321  VFCE----STGMQIRKCSPilesills-gngllssEWKTVPDIWKTAAEEFGNCIALVDP  2157
             VFC+    +     R+CSP LES LLS  + + S EWK VPDIW+++AE++G+ IALVDP
Sbjct  40    VFCQFEPKTEKPLTRRCSPFLESSLLSGSDVVASDEWKAVPDIWRSSAEKYGDKIALVDP  99

Query  2156  YHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINV  1977
             YH+PP+ +++KELE  I+ FAEGLRVIG++P EK+ALFADNSCRWLVADQG+M  GAINV
Sbjct  100   YHDPPSTMTYKELEDAILDFAEGLRVIGVRPYEKLALFADNSCRWLVADQGMMACGAINV  159

Query  1976  VRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSE  1797
             VRGSRSS+EELLQIYNHSESVALAVDNPEM++RIA+ F+S   +RFIILLWGEKS + SE
Sbjct  160   VRGSRSSIEELLQIYNHSESVALAVDNPEMFNRIAKLFYSKTSMRFIILLWGEKSGLVSE  219

Query  1796  VMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGV  1617
                G P+Y++ E++ LG ES   L  S + R  Y YE I SDD+ATLVYTSGTTGNPKGV
Sbjct  220   GEKGVPVYTFMEVVHLGQESRRVLFDSLDNRKHYMYEAIKSDDIATLVYTSGTTGNPKGV  279

Query  1616  MLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLK  1437
             MLTH+NLLHQI NL D VP   GDRFLSMLP WHAYERA+EYFIFS G EQVYTTV  LK
Sbjct  280   MLTHQNLLHQIKNLGDIVPAEVGDRFLSMLPSWHAYERASEYFIFSCGVEQVYTTVRKLK  339

Query  1436  EDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGK  1257
             +DL+RYQP YLISVPLVYETLYSGI KQI+TSS  RKL+AL F++ S  Y E +RIYEGK
Sbjct  340   DDLRRYQPHYLISVPLVYETLYSGIQKQISTSSLVRKLVALTFIRASLRYMECRRIYEGK  399

Query  1256  CLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggsl  1077
             CL KDQK PSYL S+LDWLWAR IA +L P+HLLA KLVYSKIHS+IGISKAGISGGGSL
Sbjct  400   CLMKDQKPPSYLHSMLDWLWARIIATILFPVHLLATKLVYSKIHSAIGISKAGISGGGSL  459

Query  1076  ssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKA  897
             SSHVD+FFEAI + +QNGYGLTE++PV+A R+ +CNV+GS+G PI+HTE KV+D+ETD+ 
Sbjct  460   SSHVDRFFEAIGVTVQNGYGLTETSPVIAARQLSCNVIGSVGHPIKHTEFKVIDSETDEV  519

Query  896   LSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGF  717
             L PGSKGI+K +GPQ+MKGYYKNP AT Q +D +GWLNTGD+GWIVP+HS GRSRNSSG 
Sbjct  520   LPPGSKGILKVRGPQLMKGYYKNPSATNQVLDRDGWLNTGDIGWIVPHHSTGRSRNSSGV  579

Query  716   IVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLL  537
             IV++GRAKDTIVLS+GENVEP E+EEAAM S+LI QIVVIGQDKRRLGA+++P+ EEVL 
Sbjct  580   IVVDGRAKDTIVLSTGENVEPGELEEAAMRSSLIHQIVVIGQDKRRLGAVIVPNNEEVLK  639

Query  536   AAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTM  357
             AA++ S++D ++++V +E  + LI +EL+ WT+   FQIGP+L++N+PFTIDNGL+TPTM
Sbjct  640   AARESSIIDPNSSDVVQENVTSLICKELRTWTSESPFQIGPVLVVNDPFTIDNGLMTPTM  699

Query  356   KVRRDKVTDLYKEQIEDLYK  297
             K+RRDKV   Y++QIE+LYK
Sbjct  700   KIRRDKVVAQYRDQIENLYK  719



>ref|XP_008222768.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
[Prunus mume]
Length=748

 Score =   915 bits (2364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/733 (64%), Positives = 589/733 (80%), Gaps = 19/733 (3%)
 Frame = -3

Query  2450  SVMFLLPKSD-----DGNHAVHDLMSCRGF----IKMKWQLNSRG--STSRKFRVFCEST  2304
             + +FL P S      D  HA+  L S   F    I ++    SRG  S +R FR+FC+S 
Sbjct  20    TTIFLTPNSILRNSFDCGHALQFLCSNHKFRSRQIFLRKCYGSRGGFSLNRGFRLFCQSK  79

Query  2303  G--MQIRKCSP-ilesillsgngllssEWKTVPDIWKTAAEEFGNCIALVDPYHNPPTNL  2133
                MQIR+ SP +   +L + +  +S EW+ VPDIW+++AE++G+ +ALVDPYH+PP+NL
Sbjct  80    TEEMQIRRYSPFLESVLLDANDASVSDEWRAVPDIWRSSAEKYGDRVALVDPYHDPPSNL  139

Query  2132  SFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSV  1953
             ++KELE+EI+ F+EGLRV+G+KP+EKIALFADNSCRWLVADQGIM TGAINV RGSRSSV
Sbjct  140   TYKELEQEILDFSEGLRVVGVKPEEKIALFADNSCRWLVADQGIMATGAINVARGSRSSV  199

Query  1952  EELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGR-PI  1776
             EEL QIYNHS+SVALAVD+PE+ +R +E F+S   ++FI+LLWGEKSS+ SE   G+ PI
Sbjct  200   EELSQIYNHSDSVALAVDSPELLNRFSEEFYSKP-IKFIVLLWGEKSSLVSE---GKVPI  255

Query  1775  YSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENL  1596
             ++Y EI+DLG +S   +L S + +    +EPI  DDVA LVYTSGT+GNPKGV+LTH NL
Sbjct  256   FNYKEILDLGRDSRKIMLDSDDKQQYCLHEPIKPDDVAALVYTSGTSGNPKGVILTHRNL  315

Query  1595  LHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQ  1416
             +HQI NL D VP V GD+FLSMLPPWH YERA EYF F+ G EQ YT V  LK+DL++YQ
Sbjct  316   MHQIKNLSDIVPAVGGDKFLSMLPPWHCYERACEYFAFTCGIEQFYTNVRKLKDDLRQYQ  375

Query  1415  PQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQK  1236
             P Y+ISVPLVYETLYSGI KQI++SS   K +AL F++IS AY E KRIYEG CLT++QK
Sbjct  376   PNYVISVPLVYETLYSGIQKQISSSSTVLKFVALTFIRISLAYMEFKRIYEGTCLTRNQK  435

Query  1235  QPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKF  1056
             QP YLVS+ DWLWAR IAALL PLH+L +KLVY  IHS++GISKAGISGGG L SHVDKF
Sbjct  436   QPPYLVSISDWLWARVIAALLWPLHVLGKKLVYRNIHSALGISKAGISGGGCLPSHVDKF  495

Query  1055  FEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKG  876
             FEAID+KL NGYGLTE++PVVA RRPNCNV+GS+G PIRH E KVVD+ET + L PG  G
Sbjct  496   FEAIDVKLLNGYGLTETSPVVAARRPNCNVVGSVGHPIRHIEFKVVDSETSEVLPPGLSG  555

Query  875   IVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRA  696
             I+K +GP VMKGYYKNP ATK  +D++GWLNTGD+GWI P+HS GRSR   G +VLEGRA
Sbjct  556   ILKVRGPPVMKGYYKNPGATKHVLDDDGWLNTGDIGWIAPHHSTGRSRRCGGVVVLEGRA  615

Query  695   KDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSV  516
             KDTIVLS+GEN+EP+E+EEAA+ S+LIQQIVVIGQD+RRLGA+++P+KEE L+AAKKLS+
Sbjct  616   KDTIVLSTGENIEPAELEEAALRSSLIQQIVVIGQDQRRLGAIIVPNKEEALIAAKKLSL  675

Query  515   VDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKV  336
             VD DA+++S ++ + L++EEL+KWT+G +FQIGPIL+  EPFTID+GL+TPTMK+RRD++
Sbjct  676   VDIDASDLSNDRMTNLLYEELRKWTSGRSFQIGPILIAEEPFTIDSGLMTPTMKIRRDRI  735

Query  335   TDLYKEQIEDLYK  297
                YK+QI++L+K
Sbjct  736   VAQYKDQIDNLFK  748



>ref|XP_003537522.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic-like 
[Glycine max]
Length=720

 Score =   914 bits (2362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/680 (70%), Positives = 571/680 (84%), Gaps = 5/680 (1%)
 Frame = -3

Query  2321  VFC----ESTGMQIRKCSPilesillsgng-llssEWKTVPDIWKTAAEEFGNCIALVDP  2157
             VFC    E+     R+CSP LES LLSGNG + S+EWK VPDIW+++AE++G+ IALVDP
Sbjct  41    VFCQLQSETEKPLTRRCSPFLESSLLSGNGGVASNEWKAVPDIWRSSAEKYGDKIALVDP  100

Query  2156  YHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINV  1977
             YH+PP+ +++K+LE  I+ FAEGLRVIG++P+EK+ALFADNSCRWLVADQG+M  GAINV
Sbjct  101   YHDPPSTMTYKQLEDAILDFAEGLRVIGVRPNEKLALFADNSCRWLVADQGMMACGAINV  160

Query  1976  VRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSE  1797
             VRGSRSS+EELLQIYNHSESVALAVDNPEM +RIA+ F+  A +RFIILLWGEKS + SE
Sbjct  161   VRGSRSSIEELLQIYNHSESVALAVDNPEMLNRIAKLFYLKASMRFIILLWGEKSGLVSE  220

Query  1796  VMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGV  1617
                  P++++ E+I LG ES   L  S + R  Y YE I SDD+ATLVYTSGTTGNPKGV
Sbjct  221   GDKEVPVFTFTEVIHLGQESRRVLFDSLDTRKHYMYEAIKSDDIATLVYTSGTTGNPKGV  280

Query  1616  MLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLK  1437
             MLTH+NLLHQI NL D VP   GDRFLSMLP WHAYERA EYFIFS G EQVYTTV NLK
Sbjct  281   MLTHQNLLHQIKNLGDIVPAEVGDRFLSMLPSWHAYERACEYFIFSCGVEQVYTTVRNLK  340

Query  1436  EDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGK  1257
             EDL  YQP YLISVPLVYETLYSGI KQI+TSS  RKL+AL F+++S  Y E KRIYEGK
Sbjct  341   EDLGHYQPHYLISVPLVYETLYSGIQKQISTSSLVRKLVALTFIRVSLRYMECKRIYEGK  400

Query  1256  CLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggsl  1077
             CLTKDQK PSYL S+LDWLWAR +A +L P+HLLA+ LVY KIHS+IGISKAG+SGGGSL
Sbjct  401   CLTKDQKPPSYLHSILDWLWARVVATILFPVHLLAKILVYHKIHSAIGISKAGVSGGGSL  460

Query  1076  ssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKA  897
             SSHVD+FFEAI + +QNGYGLTE++PV+A RR + NV+GS+G PI+HTE KVVD+ETD+ 
Sbjct  461   SSHVDRFFEAIGVNVQNGYGLTETSPVIAARRLSYNVIGSVGHPIKHTEFKVVDSETDEV  520

Query  896   LSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGF  717
             L PGSKGI+K +GPQ+MKGYYKNP AT Q +D +GWLNTGD+GWIVP+HS GRSRNSSG 
Sbjct  521   LPPGSKGILKVRGPQLMKGYYKNPSATNQVLDRDGWLNTGDIGWIVPHHSTGRSRNSSGV  580

Query  716   IVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLL  537
             IV++GRAKDTIVLS+GENVEP E+EEAAM S+LI QIVVIGQDKRRLGA+++P+KEEVL 
Sbjct  581   IVVDGRAKDTIVLSTGENVEPGELEEAAMRSSLIHQIVVIGQDKRRLGAVIVPNKEEVLK  640

Query  536   AAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTM  357
             AA++ S++DS++++ S+EK + LI++EL+ WT+   FQIGP+LL+N+PFTIDNGL+TPTM
Sbjct  641   AARESSIIDSNSSDASQEKVTSLIYKELRTWTSESPFQIGPVLLVNDPFTIDNGLMTPTM  700

Query  356   KVRRDKVTDLYKEQIEDLYK  297
             K+RRDKV   Y +QIE+LYK
Sbjct  701   KIRRDKVVAQYGDQIENLYK  720



>gb|KHN44470.1| Putative acyl-activating enzyme 16, chloroplastic, partial [Glycine 
soja]
Length=668

 Score =   913 bits (2360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/666 (71%), Positives = 566/666 (85%), Gaps = 1/666 (0%)
 Frame = -3

Query  2291  RKCSPilesillsgng-llssEWKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELE  2115
             R+CSP LES LLSGNG + S+EWK VPDIW+++AE++G+ IALVDPYH+PP+ +++K+LE
Sbjct  3     RRCSPFLESSLLSGNGGVASNEWKAVPDIWRSSAEKYGDKIALVDPYHDPPSTMTYKQLE  62

Query  2114  KEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQI  1935
               I+ FAEGLRVIG++P+EK+ALFADNSCRWLVADQG+M  GAINVVRGSRSS+EELLQI
Sbjct  63    DAILDFAEGLRVIGVRPNEKLALFADNSCRWLVADQGMMACGAINVVRGSRSSIEELLQI  122

Query  1934  YNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEII  1755
             YNHSESVALAVDNPEM +RIA+ F+  A +RFIILLWGEKS + SE     P++++ E+I
Sbjct  123   YNHSESVALAVDNPEMLNRIAKLFYLKASMRFIILLWGEKSGLVSEGDKEVPVFTFTEVI  182

Query  1754  DLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNL  1575
              LG ES   L  S + R  Y YE I SDD+ATLVYTSGTTGNPKGVMLTH+NLLHQI NL
Sbjct  183   HLGQESRRVLFDSLDTRKHYMYEAIKSDDIATLVYTSGTTGNPKGVMLTHQNLLHQIKNL  242

Query  1574  WDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISV  1395
              D VP   GDRFLSMLP WHAYERA EYFIFS G EQVYTTV NLKEDL  YQP YLISV
Sbjct  243   GDIVPAEVGDRFLSMLPSWHAYERACEYFIFSCGVEQVYTTVRNLKEDLGHYQPHYLISV  302

Query  1394  PLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVS  1215
             PLVYETLYSGI KQI+TSS  RKL+AL F+++S  Y E KRIYEGKCLTKDQK PSYL S
Sbjct  303   PLVYETLYSGIQKQISTSSLVRKLVALTFIRVSLRYMECKRIYEGKCLTKDQKPPSYLHS  362

Query  1214  VLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAIDIK  1035
             +LDWLWAR +A +L P+HLLA+ LVY KIHS+IGISKAG+SGGGSLSSHVD+FFEAI + 
Sbjct  363   ILDWLWARVVATILFPVHLLAKILVYRKIHSAIGISKAGVSGGGSLSSHVDRFFEAIGVN  422

Query  1034  LQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGP  855
             +QNGYGLTE++PV+A RR + NV+GS+G PI+HTE KVVD+ETD+ L PGSKGI+K +GP
Sbjct  423   VQNGYGLTETSPVIAARRLSYNVIGSVGHPIKHTEFKVVDSETDEVLPPGSKGILKVRGP  482

Query  854   QVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLS  675
             Q+MKGYYKNP AT Q +D +GWLNTGD+GWIVP+HS GRSRNSSG IV++GRAKDTIVLS
Sbjct  483   QLMKGYYKNPSATNQVLDRDGWLNTGDIGWIVPHHSTGRSRNSSGVIVVDGRAKDTIVLS  542

Query  674   SGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATE  495
             +GENVEP E+EEAAM S+LI QIVVIGQDKRRLGA+++P+KEEVL AA++ S++DS++++
Sbjct  543   TGENVEPGELEEAAMRSSLIHQIVVIGQDKRRLGAVIVPNKEEVLKAARESSIIDSNSSD  602

Query  494   VSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQ  315
              S+EK + LI++EL+ WT+   FQIGP+LL+N+PFTIDNGL+TPTMK+RRDKV   Y +Q
Sbjct  603   ASQEKVTSLIYKELRTWTSESPFQIGPVLLVNDPFTIDNGLMTPTMKIRRDKVVAQYGDQ  662

Query  314   IEDLYK  297
             IE+LYK
Sbjct  663   IENLYK  668



>ref|XP_004170826.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic-like, 
partial [Cucumis sativus]
Length=672

 Score =   913 bits (2359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/669 (68%), Positives = 552/669 (83%), Gaps = 1/669 (0%)
 Frame = -3

Query  2300  MQIRKCSPilesill-sgngllssEWKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFK  2124
             +Q+R+ SP+LES  +   +  +S EW+ VPDIW+++AE +G+ IALVDPYHNP + +++K
Sbjct  4     LQLRRYSPLLESSFVPGISATVSDEWQAVPDIWRSSAERYGDRIALVDPYHNPASKMTYK  63

Query  2123  ELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEEL  1944
             ELE+ I++F+EGLRVIG+KPDEKIALFADNSCRWLVADQGIMT GAINVVRGSRSS EEL
Sbjct  64    ELEQSILNFSEGLRVIGIKPDEKIALFADNSCRWLVADQGIMTMGAINVVRGSRSSSEEL  123

Query  1943  LQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYN  1764
             LQIYNHSESVAL VDNPE+++RI ETFH    +R +ILLWGEKSS+ +E +DG  ++ YN
Sbjct  124   LQIYNHSESVALVVDNPELFNRIVETFHLKTSMRCVILLWGEKSSLANEGVDGITVFDYN  183

Query  1763  EIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQI  1584
             +I+D+G ES   +L S +A+  YTYEPINSDD+ATLVYTSGTTGNPKGVMLTH NLLHQI
Sbjct  184   DIMDMGRESRKVMLGSHDAKQCYTYEPINSDDIATLVYTSGTTGNPKGVMLTHRNLLHQI  243

Query  1583  LNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYL  1404
              NLWD VP   GD+FLSMLPPWHAYERA EYFIF+ G EQ YTT+ NLK+DL+ YQP YL
Sbjct  244   KNLWDIVPAKVGDKFLSMLPPWHAYERACEYFIFTFGVEQAYTTIRNLKDDLRHYQPDYL  303

Query  1403  ISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSY  1224
             ISVPLVYETLYSGI KQI  SS  RKLI L F+ +S AY E KRIYEG  LT+   QP++
Sbjct  304   ISVPLVYETLYSGIQKQILASSNLRKLIVLAFINVSLAYMELKRIYEGTYLTRSNVQPTH  363

Query  1223  LVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAI  1044
             LVS LDWL+AR  A++L P+H+LA+ +VYSK+ S+IGI KAGISGGGSL SHVD FFEAI
Sbjct  364   LVSALDWLFARMTASILWPIHMLAKIIVYSKVQSAIGIWKAGISGGGSLPSHVDLFFEAI  423

Query  1043  DIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKA  864
              I +QNGYGLTE +PVVA RRP CNVLGS+G PIRHTE ++VD ET  AL PGS+GIV+ 
Sbjct  424   GITVQNGYGLTECSPVVAARRPTCNVLGSVGHPIRHTEFRIVDMETGDALPPGSRGIVEV  483

Query  863   KGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTI  684
             +GPQVMKGYYKN  AT+Q +D+ GW ++GD+GWI P+HS GRSR   G IVL+GRAKDTI
Sbjct  484   RGPQVMKGYYKNSSATQQVLDKEGWFSSGDIGWIAPHHSRGRSRRCGGVIVLDGRAKDTI  543

Query  683   VLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSD  504
             VL +GENVEP+ IEEAAM S LIQQIVVIGQD+RRLGA+V P+KEEVL AAKKLS  DS 
Sbjct  544   VLLTGENVEPTVIEEAAMRSTLIQQIVVIGQDQRRLGAIVFPNKEEVLSAAKKLSAEDSS  603

Query  503   ATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLY  324
              ++VS E  + LI+ E++KWT+ C FQIGPIL++NEPFTIDNGL+TPTMKVRRDKV+  Y
Sbjct  604   TSDVSNETLTNLIYSEVRKWTSECPFQIGPILIVNEPFTIDNGLMTPTMKVRRDKVSAYY  663

Query  323   KEQIEDLYK  297
             K++IE+L+K
Sbjct  664   KKEIENLFK  672



>gb|KHG16797.1| putative acyl-activating enzyme 16, chloroplastic [Gossypium 
arboreum]
Length=731

 Score =   912 bits (2358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/681 (68%), Positives = 561/681 (82%), Gaps = 6/681 (1%)
 Frame = -3

Query  2330  KFRVFCESTGM--QIRKCSPilesill-sgngllssEWKTVPDIWKTAAEEFGNCIALVD  2160
             K RVFCES     QIR+CSP+LE   L S   L S EWK VPDIW+++AE+ G+ +A+VD
Sbjct  49    KSRVFCESKTQEGQIRRCSPLLEKASLPSNGALASDEWKAVPDIWRSSAEKHGDRVAVVD  108

Query  2159  PYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAIN  1980
             PYH+PP+ +++K+LE+EI+ F EGLRVIG+ P+EK+ALFADNSCRWL ADQGIM  GAIN
Sbjct  109   PYHDPPSTMTYKQLEQEILDFTEGLRVIGVNPEEKVALFADNSCRWLAADQGIMAMGAIN  168

Query  1979  VVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITS  1800
             VVRGSRS+VEELL IYNHSESV L VDNPE ++R+A TF S A +RFI+LLWGEK  ++S
Sbjct  169   VVRGSRSAVEELLHIYNHSESVGLVVDNPEFFNRLAGTFSSKATMRFIVLLWGEKVCLSS  228

Query  1799  EVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKG  1620
                   PI+SY EII+LG ES +A + S +AR    YE I SDD+AT+VYTSGTTGNPKG
Sbjct  229   GETHSVPIFSYKEIIELGRESRVAHIDSHDARQGCKYEIIGSDDIATIVYTSGTTGNPKG  288

Query  1619  VMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINL  1440
             VMLTH+NLLHQI NLWD VP   GDRFLSMLP WH YERA EYF F+ G EQVYTTV NL
Sbjct  289   VMLTHKNLLHQIENLWDVVPTEAGDRFLSMLPTWHVYERACEYFTFTHGIEQVYTTVRNL  348

Query  1439  KEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEG  1260
             K+DL+ YQPQYLISVPLVYETLY GI KQI+TSS  RKLIA+ F+++S AY E KRIYEG
Sbjct  349   KDDLRHYQPQYLISVPLVYETLYRGIQKQISTSSTIRKLIAVSFIRVSLAYMEFKRIYEG  408

Query  1259  KCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggs  1080
               LT++ +QPSYL S+LD LWAR IAA+L PLH+LA+KLVY KIHSSIGISKAG++GGGS
Sbjct  409   LYLTRNTEQPSYLASMLDCLWARIIAAILWPLHVLAKKLVYQKIHSSIGISKAGVNGGGS  468

Query  1079  lssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDK  900
             L  H+DKFFEAI + +QNGYGLTES+PVVACRRP CNV+GSIG PI+HTE KVVD++T +
Sbjct  469   LPMHLDKFFEAIGVTVQNGYGLTESSPVVACRRPYCNVIGSIGHPIQHTEFKVVDSKTGE  528

Query  899   ALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSG  720
              L PG++GIVK +GPQVMKGYYKNP ATKQA+DE+GWL+TGD+GWI P+HS+GRSR   G
Sbjct  529   VLPPGTRGIVKVRGPQVMKGYYKNPLATKQALDEDGWLDTGDIGWIAPHHSVGRSRRCGG  588

Query  719   FIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVL  540
              IVLEGRAKDTIVLSSGENVEP EIEEAAM S+LIQQIVV   D+RRL A+++P+K+EVL
Sbjct  589   VIVLEGRAKDTIVLSSGENVEPLEIEEAAMRSSLIQQIVV---DQRRLAAIIVPNKDEVL  645

Query  539   LAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPT  360
              AAK  S+VD DA ++  +K + L++EEL KWT+ C+FQ+GPIL+++EPFTID+GL+TPT
Sbjct  646   QAAKVSSIVDPDAVDLGRDKMTSLLYEELSKWTSECSFQVGPILVVDEPFTIDSGLMTPT  705

Query  359   MKVRRDKVTDLYKEQIEDLYK  297
             MK+RRD+V   YKE+I +LYK
Sbjct  706   MKIRRDQVVAKYKEEIANLYK  726



>gb|KHG16796.1| putative acyl-activating enzyme 16, chloroplastic [Gossypium 
arboreum]
Length=726

 Score =   912 bits (2356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/681 (68%), Positives = 561/681 (82%), Gaps = 6/681 (1%)
 Frame = -3

Query  2330  KFRVFCESTGM--QIRKCSPilesill-sgngllssEWKTVPDIWKTAAEEFGNCIALVD  2160
             K RVFCES     QIR+CSP+LE   L S   L S EWK VPDIW+++AE+ G+ +A+VD
Sbjct  49    KSRVFCESKTQEGQIRRCSPLLEKASLPSNGALASDEWKAVPDIWRSSAEKHGDRVAVVD  108

Query  2159  PYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAIN  1980
             PYH+PP+ +++K+LE+EI+ F EGLRVIG+ P+EK+ALFADNSCRWL ADQGIM  GAIN
Sbjct  109   PYHDPPSTMTYKQLEQEILDFTEGLRVIGVNPEEKVALFADNSCRWLAADQGIMAMGAIN  168

Query  1979  VVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITS  1800
             VVRGSRS+VEELL IYNHSESV L VDNPE ++R+A TF S A +RFI+LLWGEK  ++S
Sbjct  169   VVRGSRSAVEELLHIYNHSESVGLVVDNPEFFNRLAGTFSSKATMRFIVLLWGEKVCLSS  228

Query  1799  EVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKG  1620
                   PI+SY EII+LG ES +A + S +AR    YE I SDD+AT+VYTSGTTGNPKG
Sbjct  229   GETHSVPIFSYKEIIELGRESRVAHIDSHDARQGCKYEIIGSDDIATIVYTSGTTGNPKG  288

Query  1619  VMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINL  1440
             VMLTH+NLLHQI NLWD VP   GDRFLSMLP WH YERA EYF F+ G EQVYTTV NL
Sbjct  289   VMLTHKNLLHQIENLWDVVPTEAGDRFLSMLPTWHVYERACEYFTFTHGIEQVYTTVRNL  348

Query  1439  KEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEG  1260
             K+DL+ YQPQYLISVPLVYETLY GI KQI+TSS  RKLIA+ F+++S AY E KRIYEG
Sbjct  349   KDDLRHYQPQYLISVPLVYETLYRGIQKQISTSSTIRKLIAVSFIRVSLAYMEFKRIYEG  408

Query  1259  KCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggs  1080
               LT++ +QPSYL S+LD LWAR IAA+L PLH+LA+KLVY KIHSSIGISKAG++GGGS
Sbjct  409   LYLTRNTEQPSYLASMLDCLWARIIAAILWPLHVLAKKLVYQKIHSSIGISKAGVNGGGS  468

Query  1079  lssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDK  900
             L  H+DKFFEAI + +QNGYGLTES+PVVACRRP CNV+GSIG PI+HTE KVVD++T +
Sbjct  469   LPMHLDKFFEAIGVTVQNGYGLTESSPVVACRRPYCNVIGSIGHPIQHTEFKVVDSKTGE  528

Query  899   ALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSG  720
              L PG++GIVK +GPQVMKGYYKNP ATKQA+DE+GWL+TGD+GWI P+HS+GRSR   G
Sbjct  529   VLPPGTRGIVKVRGPQVMKGYYKNPLATKQALDEDGWLDTGDIGWIAPHHSVGRSRRCGG  588

Query  719   FIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVL  540
              IVLEGRAKDTIVLSSGENVEP EIEEAAM S+LIQQIVV   D+RRL A+++P+K+EVL
Sbjct  589   VIVLEGRAKDTIVLSSGENVEPLEIEEAAMRSSLIQQIVV---DQRRLAAIIVPNKDEVL  645

Query  539   LAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPT  360
              AAK  S+VD DA ++  +K + L++EEL KWT+ C+FQ+GPIL+++EPFTID+GL+TPT
Sbjct  646   QAAKVSSIVDPDAVDLGRDKMTSLLYEELSKWTSECSFQVGPILVVDEPFTIDSGLMTPT  705

Query  359   MKVRRDKVTDLYKEQIEDLYK  297
             MK+RRD+V   YKE+I +LYK
Sbjct  706   MKIRRDQVVAKYKEEIANLYK  726



>ref|XP_007221278.1| hypothetical protein PRUPE_ppa001880mg [Prunus persica]
 gb|EMJ22477.1| hypothetical protein PRUPE_ppa001880mg [Prunus persica]
Length=748

 Score =   910 bits (2351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/733 (64%), Positives = 591/733 (81%), Gaps = 19/733 (3%)
 Frame = -3

Query  2450  SVMFLLPKSD-----DGNHAVHDLMSCRGF----IKMKWQLNSRG--STSRKFRVFCEST  2304
             + +FL P S      D  HA+  L S   F    I ++    SRG  S +R FR+FC+S 
Sbjct  20    TTIFLTPNSILRNSFDCGHALQFLCSNHKFRSRQIFLRKCYGSRGGFSLNRGFRLFCQSK  79

Query  2303  G--MQIRKCSP-ilesillsgngllssEWKTVPDIWKTAAEEFGNCIALVDPYHNPPTNL  2133
                MQIR+ SP +   +L + +  +S+EW+ VPDIW+++AE++G+ +ALVDPYH+PP+NL
Sbjct  80    TEEMQIRRYSPFLESVLLDANDASVSNEWRAVPDIWRSSAEKYGDRVALVDPYHDPPSNL  139

Query  2132  SFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSV  1953
             ++K+LE+EI+ F+EGLRV+G+KP+EKIALFADNSCRWLVADQGIM TGAINV RGSRSSV
Sbjct  140   TYKQLEQEILDFSEGLRVVGVKPEEKIALFADNSCRWLVADQGIMATGAINVARGSRSSV  199

Query  1952  EELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGR-PI  1776
             EEL QIYNHS+SVALAVD+PE+ +R +E F+S   ++FI+LLWGEKSS+ SE   G+ PI
Sbjct  200   EELSQIYNHSDSVALAVDSPELLNRFSEEFYSKP-IKFIVLLWGEKSSLVSE---GKVPI  255

Query  1775  YSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENL  1596
             ++Y EI+DLG +S   +L S + +    ++PI  DDVA LVYTSGT+GNPKGV+LTH NL
Sbjct  256   FNYKEILDLGRDSRKIMLDSDDKQQYCLHKPIKPDDVAALVYTSGTSGNPKGVILTHRNL  315

Query  1595  LHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQ  1416
             +HQI NL D VP V GD+FLSMLPPWH YERA EYF F+ G EQ YT V  LK+DL++YQ
Sbjct  316   MHQIKNLSDIVPAVGGDKFLSMLPPWHCYERACEYFAFTCGIEQFYTNVRKLKDDLRQYQ  375

Query  1415  PQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQK  1236
             P Y+ISVPLVYETLYSGI KQI++SS   K +AL F++IS AY E KRIYEG  LT++QK
Sbjct  376   PNYVISVPLVYETLYSGIQKQISSSSTVLKFVALTFIRISLAYMEFKRIYEGTYLTRNQK  435

Query  1235  QPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKF  1056
             QP YLVS+ DWLWAR IAALL PLH+L +KLVY  IHS++GISKAGISGGG L SHVDKF
Sbjct  436   QPPYLVSISDWLWARVIAALLWPLHVLGKKLVYRNIHSALGISKAGISGGGFLPSHVDKF  495

Query  1055  FEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKG  876
             FEAID+KL NGYGLTE++PVVA RRPNCNV+GS+G PIRH E KVVD+ET + L PG  G
Sbjct  496   FEAIDVKLLNGYGLTETSPVVAARRPNCNVVGSVGHPIRHIEFKVVDSETSEVLPPGLSG  555

Query  875   IVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRA  696
             I+K +GP VMKGYYKNP ATK  +D++GWLNTGD+GWI P+HS GRSR+  G +VLEGRA
Sbjct  556   ILKVRGPPVMKGYYKNPGATKHVLDDDGWLNTGDIGWIAPHHSTGRSRHCGGVVVLEGRA  615

Query  695   KDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSV  516
             KDTIVLS+GEN+EP+E+EEAA+ S+LIQQIVVIGQD+RRLGA+++P+KEE LLAAKKLS+
Sbjct  616   KDTIVLSTGENIEPAELEEAALRSSLIQQIVVIGQDQRRLGAIIVPNKEEALLAAKKLSL  675

Query  515   VDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKV  336
             VD DA+++S ++ + L++EEL+KWT+G +FQIGPIL+ +EPFTID+GL+TPTMK+RRD++
Sbjct  676   VDIDASDLSNDRMTNLLYEELRKWTSGRSFQIGPILIADEPFTIDSGLMTPTMKIRRDRI  735

Query  335   TDLYKEQIEDLYK  297
                YK+QI++L+K
Sbjct  736   VAQYKDQIDNLFK  748



>gb|AES71951.2| long-chain-fatty-acid CoA ligase (AMP-forming) [Medicago truncatula]
Length=715

 Score =   909 bits (2350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/678 (68%), Positives = 564/678 (83%), Gaps = 2/678 (0%)
 Frame = -3

Query  2330  KFRVFCESTGMQIRKCSPilesillsgngllssEWKTVPDIWKTAAEEFGNCIALVDPYH  2151
             + R+FC+S     R    +  S+L   +G++S EWKTVPDIW+++AE++G+ IAL+DPYH
Sbjct  40    RTRIFCQSQSKIRRFSPLLESSLLSGNDGVVSDEWKTVPDIWRSSAEKYGDKIALIDPYH  99

Query  2150  NPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVR  1971
             +PP+ +++K+LE  I+ FAEGLRVIG+ P+EKIALFADNSCRWLVADQG+M TGAINVVR
Sbjct  100   DPPSTMTYKQLEDAILDFAEGLRVIGVSPNEKIALFADNSCRWLVADQGMMATGAINVVR  159

Query  1970  GSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVM  1791
             GSRSS+EELLQIYNHSES+ALAVDNPEM++RIA+ F   A +RF+ILLWGEKS + +E  
Sbjct  160   GSRSSIEELLQIYNHSESIALAVDNPEMFNRIAKAFDLKASMRFVILLWGEKSCLVNEGS  219

Query  1790  DGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVML  1611
                PI+++ EI+ LG  S   L  S +AR  Y +E I SDD+ATLVYTSGTTGNPKGVML
Sbjct  220   KEVPIFTFTEIMHLGRGSRR-LFESHDARKHYVFEAIKSDDIATLVYTSGTTGNPKGVML  278

Query  1610  THENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKED  1431
             TH+NLLHQI    D VP   GDRFLSMLPPWHAYERA EYFIFS G +QVYTTV NLK+D
Sbjct  279   THQNLLHQIKFYSDIVPAEVGDRFLSMLPPWHAYERACEYFIFSCGVDQVYTTVRNLKDD  338

Query  1430  LKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCL  1251
             L+RYQP YLISVPLVYE+LYSGI +QI+TSS  RKL+AL F+++S  Y E KRIYEGKCL
Sbjct  339   LERYQPHYLISVPLVYESLYSGIQRQISTSSLVRKLVALTFIRVSLGYMECKRIYEGKCL  398

Query  1250  TKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslss  1071
             TK+QK PSYL ++LDWL AR IA +L P+H+LA+KLVYSKIHS+IG SKAGISGGGSL S
Sbjct  399   TKNQKSPSYLYAMLDWLGARIIATILFPIHMLAKKLVYSKIHSAIGFSKAGISGGGSLPS  458

Query  1070  HVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALS  891
             HVD+FFEAI + LQNGYGLTE++PV+A RR +CNV+GS+G P++HTE KVVD+ET + L 
Sbjct  459   HVDRFFEAIGVTLQNGYGLTETSPVIAARRLSCNVIGSVGHPLKHTEFKVVDSETGEVLP  518

Query  890   PGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIV  711
             PG KGI+K +GPQ+MKGYYKNP AT QAID++GWLNTGD+GWI   HS GRSRN  G IV
Sbjct  519   PGYKGILKVRGPQLMKGYYKNPSATNQAIDKDGWLNTGDIGWIAAYHSSGRSRNCGGVIV  578

Query  710   LEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAA  531
             +EGRAKDTIVLSSGENVEP E+EEAAM S+LIQQIVVIGQDKRRLGA+V+P+K EVL AA
Sbjct  579   VEGRAKDTIVLSSGENVEPVELEEAAMRSSLIQQIVVIGQDKRRLGAVVVPNK-EVLKAA  637

Query  530   KKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKV  351
             ++LS++DS+++++S+E  + LI+ EL+ WT+   FQIGPILL+N+PFTIDNGL+TPTMK+
Sbjct  638   RELSIIDSNSSDLSQENVTSLIYNELRTWTSEFPFQIGPILLVNDPFTIDNGLMTPTMKI  697

Query  350   RRDKVTDLYKEQIEDLYK  297
             RRD++   YKEQIE+LYK
Sbjct  698   RRDRIMAQYKEQIENLYK  715



>ref|XP_010023616.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
isoform X1 [Eucalyptus grandis]
 gb|KCW59925.1| hypothetical protein EUGRSUZ_H02649 [Eucalyptus grandis]
Length=751

 Score =   908 bits (2347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/688 (68%), Positives = 570/688 (83%), Gaps = 5/688 (1%)
 Frame = -3

Query  2348  RGSTSRK--FRVFC--ESTGMQIRKCSPilesillsgngllss-EWKTVPDIWKTAAEEF  2184
             RG +  +   RV C  E+   Q+R+ SPILE  LLS    L+  EW  VPDIW+  AE++
Sbjct  63    RGPSRHRSPLRVSCRAETDEKQMRRYSPILEGALLSSGDGLALDEWTAVPDIWRFCAEKY  122

Query  2183  GNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQG  2004
             G+ IALVDPYH PP+N+++ +LE+EI++F+EGLRVIG+KPDEK+AL+ADNS RWL+ADQG
Sbjct  123   GDRIALVDPYHGPPSNITYNQLEQEILNFSEGLRVIGVKPDEKLALYADNSYRWLIADQG  182

Query  2003  IMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLW  1824
             +M TGAINVVRGSRSSVEELLQIY HSESVALAVD+PE+Y+RIAE F   A ++F+ILLW
Sbjct  183   MMATGAINVVRGSRSSVEELLQIYQHSESVALAVDSPELYNRIAEVFCDKASMKFVILLW  242

Query  1823  GEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTS  1644
             G+K+S++    +  P++SYNEII LG +S  +LL S    +   YE I+SDDVATL+YTS
Sbjct  243   GDKASLSIRGTEEIPVFSYNEIIHLGQDSRKSLLSSNGTWNPDDYELISSDDVATLMYTS  302

Query  1643  GTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQ  1464
             GTTGNPKGVMLTH N LHQI NLWD VP VPGDRFLS+LPPWHAYERA EYFIF+ G EQ
Sbjct  303   GTTGNPKGVMLTHRNFLHQIKNLWDVVPAVPGDRFLSILPPWHAYERACEYFIFTHGVEQ  362

Query  1463  VYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYK  1284
             VYTTV  LKEDL++YQP YLISVPLVYETLYSGI KQ++T   ARKLIAL F++IS A+ 
Sbjct  363   VYTTVRYLKEDLQQYQPHYLISVPLVYETLYSGIQKQLSTGPAARKLIALTFIRISMAFM  422

Query  1283  EAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigisk  1104
             + KRIYEGK LT+DQK+PSYLVS+LD L AR  AA+L PLH+LAR++VYSKIHS+IGISK
Sbjct  423   DFKRIYEGKYLTRDQKEPSYLVSMLDCLLARIFAAILWPLHMLARRIVYSKIHSAIGISK  482

Query  1103  agisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIK  924
             AGISGGGSL   +DKFFEAI + +QNGYGLTE +PV A RR  CNVLGSIG PIR+TE K
Sbjct  483   AGISGGGSLPPFIDKFFEAIGVTVQNGYGLTECSPVTAARRRTCNVLGSIGHPIRYTEFK  542

Query  923   VVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSI  744
             +V  ETD+ L PGSKGIVK +GPQVMKGYYKNP AT Q +D +GW NTGD+GW+ P+HS 
Sbjct  543   IVHPETDELLPPGSKGIVKLRGPQVMKGYYKNPSATSQVLDASGWFNTGDVGWMAPHHSS  602

Query  743   GRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALV  564
             GRSR+S G IVLEGRAKDTIVLS+GENVEP+EIEEAAM S+LIQQIVVIGQD+RRLGA++
Sbjct  603   GRSRHSGGVIVLEGRAKDTIVLSTGENVEPAEIEEAAMRSSLIQQIVVIGQDQRRLGAII  662

Query  563   LPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTI  384
             +P+KEE LL AK++S+VD++A E+S+EK S L++EEL+ WT+ CTFQIGPIL+++EPFTI
Sbjct  663   VPNKEEALLVAKRMSIVDANAMELSKEKMSSLLYEELRTWTSKCTFQIGPILIVDEPFTI  722

Query  383   DNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             D GL+TPTMK+RRD++ ++YK+QI  LY
Sbjct  723   DGGLMTPTMKIRRDRIVEIYKDQILKLY  750



>ref|XP_010023617.1| PREDICTED: long-chain-fatty-acid--[acyl-carrier-protein] ligase 
AEE15, chloroplastic-like isoform X2 [Eucalyptus grandis]
 ref|XP_010023618.1| PREDICTED: long-chain-fatty-acid--[acyl-carrier-protein] ligase 
AEE15, chloroplastic-like isoform X2 [Eucalyptus grandis]
Length=667

 Score =   907 bits (2345),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/643 (70%), Positives = 546/643 (85%), Gaps = 0/643 (0%)
 Frame = -3

Query  2228  WKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIA  2049
             W  VPDIW+  AE++G+ IALVDPYH PP+N+++ +LE+EI++F+EGLRVIG+KPDEK+A
Sbjct  24    WTAVPDIWRFCAEKYGDRIALVDPYHGPPSNITYNQLEQEILNFSEGLRVIGVKPDEKLA  83

Query  2048  LFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAE  1869
             L+ADNS RWL+ADQG+M TGAINVVRGSRSSVEELLQIY HSESVALAVD+PE+Y+RIAE
Sbjct  84    LYADNSYRWLIADQGMMATGAINVVRGSRSSVEELLQIYQHSESVALAVDSPELYNRIAE  143

Query  1868  TFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTY  1689
              F   A ++F+ILLWG+K+S++    +  P++SYNEII LG +S  +LL S    +   Y
Sbjct  144   VFCDKASMKFVILLWGDKASLSIRGTEEIPVFSYNEIIHLGQDSRKSLLSSNGTWNPDDY  203

Query  1688  EPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAY  1509
             E I+SDDVATL+YTSGTTGNPKGVMLTH N LHQI NLWD VP VPGDRFLS+LPPWHAY
Sbjct  204   ELISSDDVATLMYTSGTTGNPKGVMLTHRNFLHQIKNLWDVVPAVPGDRFLSILPPWHAY  263

Query  1508  ERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPAR  1329
             ERA EYFIF+ G EQVYTTV  LKEDL++YQP YLISVPLVYETLYSGI KQ++T   AR
Sbjct  264   ERACEYFIFTHGVEQVYTTVRYLKEDLQQYQPHYLISVPLVYETLYSGIQKQLSTGPAAR  323

Query  1328  KLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLAR  1149
             KLIAL F++IS A+ + KRIYEGK LT+DQK+PSYLVS+LD L AR  AA+L PLH+LAR
Sbjct  324   KLIALTFIRISMAFMDFKRIYEGKYLTRDQKEPSYLVSMLDCLLARIFAAILWPLHMLAR  383

Query  1148  KLVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
             ++VYSKIHS+IGISKAGISGGGSL   +DKFFEAI + +QNGYGLTE +PV A RR  CN
Sbjct  384   RIVYSKIHSAIGISKAGISGGGSLPPFIDKFFEAIGVTVQNGYGLTECSPVTAARRRTCN  443

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             VLGSIG PIR+TE K+V  ETD+ L PGSKGIVK +GPQVMKGYYKNP AT Q +D +GW
Sbjct  444   VLGSIGHPIRYTEFKIVHPETDELLPPGSKGIVKLRGPQVMKGYYKNPSATSQVLDASGW  503

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              NTGD+GW+ P+HS GRSR+S G IVLEGRAKDTIVLS+GENVEP+EIEEAAM S+LIQQ
Sbjct  504   FNTGDVGWMAPHHSSGRSRHSGGVIVLEGRAKDTIVLSTGENVEPAEIEEAAMRSSLIQQ  563

Query  608   IVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCT  429
             IVVIGQD+RRLGA+++P+KEE LL AK++S+VD++A E+S+EK S L++EEL+ WT+ CT
Sbjct  564   IVVIGQDQRRLGAIIVPNKEEALLVAKRMSIVDANAMELSKEKMSSLLYEELRTWTSKCT  623

Query  428   FQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             FQIGPIL+++EPFTID GL+TPTMK+RRD++ ++YK+QI  LY
Sbjct  624   FQIGPILIVDEPFTIDGGLMTPTMKIRRDRIVEIYKDQILKLY  666



>ref|XP_010247392.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
isoform X1 [Nelumbo nucifera]
Length=732

 Score =   900 bits (2326),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/723 (65%), Positives = 576/723 (80%), Gaps = 11/723 (2%)
 Frame = -3

Query  2438  LLPKSDDGNHAVHDLMSCR--GFIKMKWQLNSRGSTSRKFR---VFCESTGM----QIRK  2286
             L+  S D        +S R  G  ++  +  S G  SR  R   V CES       ++R+
Sbjct  10    LVLNSPDARKVFGFFLSRRQAGTSRIFQKRRSSGRCSRLARRPVVCCESNPEPEEPRVRR  69

Query  2285  CSPilesillsgngllssE-WKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKE  2109
             CSP+LES+LLSG  +L S  WK VPDIWK++AE +G  IALVDPYH+PP+ L++K+LE+E
Sbjct  70    CSPLLESVLLSGETILYSGDWKAVPDIWKSSAERYGGLIALVDPYHDPPSELTYKQLEQE  129

Query  2108  IVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYN  1929
             I++FAEGLRVIG+KPDEK+ALFADNSCRWL+ADQGIM  GAINVVRG+RSS EELLQIYN
Sbjct  130   ILNFAEGLRVIGIKPDEKVALFADNSCRWLIADQGIMAIGAINVVRGTRSSTEELLQIYN  189

Query  1928  HSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDL  1749
             HSES AL +DNP+ + RIAE F S A +R +ILLWGEKS +++ V++G  I++YNEIIDL
Sbjct  190   HSESTALIMDNPDFFKRIAEGFSSKAVIRSVILLWGEKSCLSNYVIEGLTIFNYNEIIDL  249

Query  1748  GNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWD  1569
             G ES   LL + +    + YE I+SDD ATLVYTSGTTG PKGVML+H+NLLHQI NLW+
Sbjct  250   GRESRRVLLETNKG-GLHIYETISSDDTATLVYTSGTTGAPKGVMLSHQNLLHQIKNLWN  308

Query  1568  PVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPL  1389
              VP   GD+FLSMLPPWH YERAAEYF F+ G +QVYT V NLKEDL+RYQP YLISVPL
Sbjct  309   IVPAEAGDKFLSMLPPWHTYERAAEYFTFTCGVQQVYTNVKNLKEDLRRYQPHYLISVPL  368

Query  1388  VYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVL  1209
             +YETLYSGI KQI+TSS ARK+IA+  ++IS  Y E+KRIYEGK LT++QK    +  ++
Sbjct  369   IYETLYSGIQKQISTSSIARKVIAVALIRISLLYMESKRIYEGKVLTRNQKPHPLIFLMV  428

Query  1208  DWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAIDIKLQ  1029
             DW WAR  A +L PLH+L  KLVYSKIHS+IGISKAGISGG SL  HVD+FFEAI +KLQ
Sbjct  429   DWFWARITATILWPLHILGMKLVYSKIHSAIGISKAGISGGASLPLHVDRFFEAIGVKLQ  488

Query  1028  NGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQV  849
             NGYGLTES+PVVA R+P  NVLGS+G P+RHTE+K+VD+ET + L  GSKGIVK +GPQV
Sbjct  489   NGYGLTESSPVVAARQPTYNVLGSVGHPLRHTEVKIVDSETGEVLPAGSKGIVKVRGPQV  548

Query  848   MKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSG  669
             MKGYYKNP AT Q +DE GWL TGD+GWI P+HSIGRSRN  G +VLEGR KDTIVL +G
Sbjct  549   MKGYYKNPSATTQVLDEEGWLCTGDIGWIAPSHSIGRSRNCGGVLVLEGRGKDTIVLVTG  608

Query  668   ENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVS  489
             ENVEPSE+EE+A+ S+LIQQIVVIGQD+RRLGAL++P+KEE+L AAKK S++D+DA+E+S
Sbjct  609   ENVEPSELEESAIRSSLIQQIVVIGQDQRRLGALIVPNKEEILEAAKKRSILDADASELS  668

Query  488   EEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIE  309
             +EK   L+HEE++ WT+ C+FQIGPILL+ EPFTI+NGL+TPTMK+RRD+V   Y +QI 
Sbjct  669   KEKMITLLHEEVRTWTSHCSFQIGPILLVEEPFTIENGLMTPTMKIRRDRVIARYSDQIA  728

Query  308   DLY  300
             +LY
Sbjct  729   ELY  731



>ref|NP_189021.2| acyl activating enzyme 16 [Arabidopsis thaliana]
 sp|Q9LK39.1|AAE16_ARATH RecName: Full=Probable acyl-activating enzyme 16, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01855.1| long-chain-fatty-acid CoA ligase [Arabidopsis thaliana]
 gb|AEE76814.1| AMP-dependent synthetase and ligase family protein [Arabidopsis 
thaliana]
Length=722

 Score =   897 bits (2319),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/688 (66%), Positives = 555/688 (81%), Gaps = 10/688 (1%)
 Frame = -3

Query  2342  STSRKFRVFCES--TGMQIRKCSPilesill-sgngllssEWKTVPDIWKTAAEEFGNCI  2172
             ++ R FRV CES     ++R+CSP LE + L     L S+EWK+VPDIW+++ E++G+ +
Sbjct  39    TSRRGFRVRCESKIQEKELRRCSPFLERLSLPREAALSSNEWKSVPDIWRSSVEKYGDRV  98

Query  2171  ALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTT  1992
             A+VDPYH+PP+  ++++LE+EI+ F EGLRV+G+K DEKIALFADNSCRWLVADQGIM T
Sbjct  99    AVVDPYHDPPSTFTYRQLEQEILDFVEGLRVVGVKADEKIALFADNSCRWLVADQGIMAT  158

Query  1991  GAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKS  1812
             GA+NVVRGSRSSVEELLQIY HSESVAL VDNPE ++RIAE+F   A  +F+ILLWGEKS
Sbjct  159   GAVNVVRGSRSSVEELLQIYCHSESVALVVDNPEFFNRIAESFSYKAAPKFVILLWGEKS  218

Query  1811  SITSEVMDGR--PIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGT  1638
             S+   V  GR  P+YSYNEI   G E       S ++  +Y YE I+ DD+AT++YTSGT
Sbjct  219   SL---VTAGRHTPVYSYNEIKKFGQERRAKFARSNDS-GKYEYEYIDPDDIATIMYTSGT  274

Query  1637  TGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVY  1458
             TGNPKGVMLTH+NLLHQI NL D VP   G+RFLSMLP WHAYERA EYFIF+ G EQ Y
Sbjct  275   TGNPKGVMLTHQNLLHQIRNLSDFVPAEAGERFLSMLPSWHAYERACEYFIFTCGVEQKY  334

Query  1457  TTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEA  1278
             T++  LK+DLKRYQP YLISVPLVYETLYSGI KQI+ SSPARK +AL  +K+S AY E 
Sbjct  335   TSIRFLKDDLKRYQPHYLISVPLVYETLYSGIQKQISASSPARKFLALTLIKVSLAYTEM  394

Query  1277  KRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskag  1098
             KR+YEG CLTK+QK P Y+VS++DWLWAR +A  L PLH+LA KLV+ KI SSIGI+KAG
Sbjct  395   KRVYEGLCLTKNQKPPMYIVSLVDWLWARVVAFFLWPLHMLAEKLVHRKIRSSIGITKAG  454

Query  1097  isgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVV  918
             +SGGGSL  HVDKFFEAI + +QNGYGLTE++PVV+ RR  CNVLGS+G PI+ TE K+V
Sbjct  455   VSGGGSLPMHVDKFFEAIGVNVQNGYGLTETSPVVSARRLRCNVLGSVGHPIKDTEFKIV  514

Query  917   DAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGR  738
             D ET   L PGSKGIVK +GP VMKGYYKNP ATKQ ID++GW NTGD+GWI P HS GR
Sbjct  515   DHETGTVLPPGSKGIVKVRGPPVMKGYYKNPLATKQVIDDDGWFNTGDMGWITPQHSTGR  574

Query  737   SRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLP  558
             SR+  G IVLEGRAKDTIVLS+GENVEP EIEEAAM SNLIQQIVVIGQD+RRLGA+V+P
Sbjct  575   SRSCGGVIVLEGRAKDTIVLSTGENVEPLEIEEAAMRSNLIQQIVVIGQDQRRLGAIVIP  634

Query  557   HKEEVLLAAK-KLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTID  381
             +KE    AAK K+S VDS+  E+S+E  + +++EEL+KWT+ C+FQ+GP+L+++EPFTID
Sbjct  635   NKEAAEGAAKQKISPVDSEVNELSKETITSMVYEELRKWTSQCSFQVGPVLIVDEPFTID  694

Query  380   NGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             NGL+TPTMK+RRDKV D YK +IE LYK
Sbjct  695   NGLMTPTMKIRRDKVVDQYKNEIERLYK  722



>gb|AAM28629.1|AF503771_1 acyl-CoA synthetase-like protein [Arabidopsis thaliana]
Length=722

 Score =   897 bits (2317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/688 (66%), Positives = 555/688 (81%), Gaps = 10/688 (1%)
 Frame = -3

Query  2342  STSRKFRVFCES--TGMQIRKCSPilesill-sgngllssEWKTVPDIWKTAAEEFGNCI  2172
             ++ R FRV CES     ++R+CSP LE + L     L S+EWK+VPDIW+++ E++G+ +
Sbjct  39    TSRRGFRVRCESKIQEKELRRCSPFLERLSLPREAALSSNEWKSVPDIWRSSVEKYGDRV  98

Query  2171  ALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTT  1992
             A+VDPYH+PP+  ++++LE+EI+ F EGLRV+G+K DEKIALFADNSCRWLVADQGIM T
Sbjct  99    AVVDPYHDPPSTFTYRQLEQEILDFVEGLRVVGVKADEKIALFADNSCRWLVADQGIMAT  158

Query  1991  GAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKS  1812
             GA+NVVRGSRSSVEELLQIY HSESVAL VDNPE ++RIAE+F   A  +F+ILLWGEKS
Sbjct  159   GAVNVVRGSRSSVEELLQIYCHSESVALVVDNPEFFNRIAESFSYKAAPKFVILLWGEKS  218

Query  1811  SITSEVMDGR--PIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGT  1638
             S+   V  GR  P+YSYNEI   G E       S ++  +Y YE I+ DD+AT++YTSGT
Sbjct  219   SL---VTAGRHTPVYSYNEIKKFGQERRAKFARSNDS-GKYEYEYIDPDDIATIMYTSGT  274

Query  1637  TGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVY  1458
             TGNPKGVMLTH+NLLHQI NL D VP   G+RFLSMLP WHAYERA EYFIF+ G EQ Y
Sbjct  275   TGNPKGVMLTHQNLLHQIRNLSDFVPAEAGERFLSMLPSWHAYERACEYFIFTCGVEQKY  334

Query  1457  TTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEA  1278
             T++  LK+DLKRYQP YLISVPLVYETLYSGI KQI+ SSPARK +AL  +K+S AY E 
Sbjct  335   TSIRFLKDDLKRYQPHYLISVPLVYETLYSGIQKQISASSPARKFLALTLIKVSLAYTEM  394

Query  1277  KRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskag  1098
             KR+YEG CLTK+QK P Y+VS++DWLWAR +A  L PLH+LA KLV+ KI SSIGI+KAG
Sbjct  395   KRVYEGLCLTKNQKPPMYIVSLVDWLWARVVAFFLWPLHMLAEKLVHRKIRSSIGITKAG  454

Query  1097  isgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVV  918
             +SGGGSL  HVDKFFEAI + +QNGYGLTE++PVV+ RR  CNVLGS+G PI+ TE K+V
Sbjct  455   VSGGGSLPMHVDKFFEAIGVNVQNGYGLTETSPVVSARRLRCNVLGSVGHPIKDTEFKIV  514

Query  917   DAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGR  738
             D ET   L PGSKGIVK +GP VMKGYYKNP ATKQ ID++GW NTGD+GWI P HS GR
Sbjct  515   DHETGTVLPPGSKGIVKVRGPPVMKGYYKNPLATKQVIDDDGWFNTGDMGWITPQHSTGR  574

Query  737   SRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLP  558
             SR+  G IVLEGRAKDTIVLS+GENVEP EIEEAAM SNLIQQIVVIGQD+RRLGA+V+P
Sbjct  575   SRSCGGVIVLEGRAKDTIVLSTGENVEPLEIEEAAMRSNLIQQIVVIGQDQRRLGAIVIP  634

Query  557   HKEEVLLAAK-KLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTID  381
             +KE    AAK K+S VDS+  E+S+E  + +++EEL+KWT+ C+FQ+GP+L+++EPFTID
Sbjct  635   NKEAAEGAAKQKISPVDSEVNELSKETITSMVYEELRKWTSQCSFQVGPVLIVDEPFTID  694

Query  380   NGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             NGL+TPTMK+RRDKV D YK +IE LYK
Sbjct  695   NGLMTPTMKIRRDKVVDQYKNEIERLYK  722



>ref|XP_008222739.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
isoform X2 [Prunus mume]
Length=609

 Score =   895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/609 (73%), Positives = 530/609 (87%), Gaps = 4/609 (1%)
 Frame = -3

Query  2120  LEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELL  1941
             LE+ I+ F+EGLRV+G+KP+EKIALFADNSCRWLVADQGIM TGAINVVRGSRSSVEELL
Sbjct  4     LEEGILDFSEGLRVVGVKPEEKIALFADNSCRWLVADQGIMATGAINVVRGSRSSVEELL  63

Query  1940  QIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGR-PIYSYN  1764
             QIY+HSESVALAVD+PE+++RIAE F S   ++F+ILLWG+KSS+ +E   G+ P ++Y 
Sbjct  64    QIYDHSESVALAVDSPELFNRIAEAFGSKVVMKFVILLWGDKSSLANE---GKIPFFNYG  120

Query  1763  EIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQI  1584
             EI+DLG ES  +     +AR QY +E INSDD+ATLVYTSGTTGNPKGVMLTH NLLHQI
Sbjct  121   EILDLGRESRNSAPDFNDARQQYVHEAINSDDIATLVYTSGTTGNPKGVMLTHRNLLHQI  180

Query  1583  LNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYL  1404
              NLWD VP   GDRFLSMLPPWHAYERA EYFIF+ G EQVYTTV NLK+DL+ YQP Y+
Sbjct  181   KNLWDVVPAEVGDRFLSMLPPWHAYERACEYFIFTCGIEQVYTTVRNLKDDLRHYQPNYI  240

Query  1403  ISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSY  1224
             ISVPLVYETLYSGI KQI+TSS ARK IAL F++IS AY E KRIYEG  LT+++KQPSY
Sbjct  241   ISVPLVYETLYSGIQKQISTSSAARKFIALTFIRISLAYMEFKRIYEGTYLTRNRKQPSY  300

Query  1223  LVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAI  1044
             L SV DWLWAR +AA+L PLH+L +KLVYSKIHS+IGISKAG+SGGGSL  HVDKFFEAI
Sbjct  301   LASVYDWLWARIVAAILWPLHMLGKKLVYSKIHSAIGISKAGVSGGGSLPPHVDKFFEAI  360

Query  1043  DIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKA  864
              +K+QNGYGLTE++PVVA RRPNCNVLGS+GPPIRHTE KVV++ET + L PGS GIVK 
Sbjct  361   GVKVQNGYGLTETSPVVAARRPNCNVLGSVGPPIRHTEFKVVESETGEVLLPGSTGIVKV  420

Query  863   KGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTI  684
             +GPQVMKGYYKNP AT+Q +DE+GWLNTGD+GWI P+HS GRSR   G +VLEGRAKDTI
Sbjct  421   RGPQVMKGYYKNPGATEQVLDEDGWLNTGDIGWIAPHHSTGRSRRCGGVVVLEGRAKDTI  480

Query  683   VLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSD  504
             VLS+GENVEP E+EEAAM S+LIQQIVV+GQD+RRLGA+++P+KEEVLLAAKKLS+VD +
Sbjct  481   VLSTGENVEPVELEEAAMRSSLIQQIVVVGQDQRRLGAIIVPNKEEVLLAAKKLSIVDVN  540

Query  503   ATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLY  324
             A+++S++K + L++EEL+KWT+GC+FQIGPIL+++EPFTID+G +TPTMK+RRD+V   Y
Sbjct  541   ASDLSKDKKTSLLYEELRKWTSGCSFQIGPILIVDEPFTIDSGFMTPTMKIRRDRVVAQY  600

Query  323   KEQIEDLYK  297
             KEQIE+LYK
Sbjct  601   KEQIENLYK  609



>ref|XP_010488454.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
isoform X1 [Camelina sativa]
Length=719

 Score =   894 bits (2311),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/683 (66%), Positives = 548/683 (80%), Gaps = 6/683 (1%)
 Frame = -3

Query  2333  RKFRVFCEST--GMQIRKCSPilesill-sgngllssEWKTVPDIWKTAAEEFGNCIALV  2163
             R FRV CEST    ++R+CSP LE   L     L  +EWK VPDIW+++ E++G+ +A+V
Sbjct  39    RGFRVSCESTIQEKELRRCSPFLERSSLPKEAALRCNEWKAVPDIWRSSVEKYGDKVAVV  98

Query  2162  DPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAI  1983
             DPYH+PP+  +++ LE+EI+ F EGLRV+G+K DEKIALFADNSCRWLVADQGIM TGA+
Sbjct  99    DPYHDPPSTFTYRHLEQEILDFVEGLRVVGVKADEKIALFADNSCRWLVADQGIMATGAV  158

Query  1982  NVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSIT  1803
             NVVRGSRSSVEELLQIY HSESVAL VDNPE ++RIAE+F   A  RF+ILLWG+KSS+ 
Sbjct  159   NVVRGSRSSVEELLQIYCHSESVALVVDNPEFFNRIAESFSYKAPPRFVILLWGDKSSLV  218

Query  1802  SEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPK  1623
             + V    P+YSYNEI   G E       S +   +Y YE IN DD AT++YTSGTTGNPK
Sbjct  219   T-VGRQTPVYSYNEIKRFGQERRAKFARSNDG-GRYEYEFINPDDTATIMYTSGTTGNPK  276

Query  1622  GVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVIN  1443
             GVMLTH+NLLHQI NL D VP   G+RFLSMLP WHAYERA EYFIF+ G EQ YT++  
Sbjct  277   GVMLTHQNLLHQIRNLSDFVPAEAGERFLSMLPSWHAYERACEYFIFTCGVEQKYTSIRF  336

Query  1442  LKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYE  1263
             LK+DLK+YQP YLISVPLVYETLYSGI KQI+TSSPARK +AL  +K+S AY E +RI E
Sbjct  337   LKDDLKQYQPHYLISVPLVYETLYSGIQKQISTSSPARKFVALTLIKVSLAYTEMRRISE  396

Query  1262  GKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisggg  1083
             G CLTK+QK P Y+ S++DWLWAR +A +L PLH+LA KLV+ KI SS+GI+KAG+SGGG
Sbjct  397   GLCLTKNQKPPMYIASLVDWLWARVVAFVLLPLHMLAEKLVHRKIRSSVGITKAGVSGGG  456

Query  1082  slssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETD  903
             SL  HVDKFFEAI + +QNGYGLTE++PVV+ RR NCNVLGS+G PI+ TE K+VD ET 
Sbjct  457   SLPMHVDKFFEAIGVNVQNGYGLTETSPVVSARRLNCNVLGSVGHPIKDTEFKIVDPETG  516

Query  902   KALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSS  723
               L PGSKGIVK +GP VMKGYYKNP ATKQ IDE+GW NTGD+GWI P HS+GRSR+  
Sbjct  517   SVLPPGSKGIVKVRGPPVMKGYYKNPLATKQVIDEDGWFNTGDMGWITPQHSVGRSRSCG  576

Query  722   GFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEV  543
             G IVLEGRAKDTIVLS+GENVEP EIEEAAM SNLIQQIVVIGQD+RRLGA+++P+KE  
Sbjct  577   GVIVLEGRAKDTIVLSTGENVEPLEIEEAAMRSNLIQQIVVIGQDQRRLGAIIIPNKEAA  636

Query  542   LLAAK-KLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLT  366
               AAK K+S +D +  E+S+E  + +++EEL+KWT+ C+FQ+GP+L+++EPFTIDNGL+T
Sbjct  637   EGAAKQKISPLDLEVNELSKETITSMVYEELRKWTSQCSFQVGPVLIVDEPFTIDNGLMT  696

Query  365   PTMKVRRDKVTDLYKEQIEDLYK  297
             PTMK+RRDKV D YK +IE LYK
Sbjct  697   PTMKIRRDKVVDQYKNEIERLYK  719



>ref|XP_002885598.1| hypothetical protein ARALYDRAFT_898924 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61857.1| hypothetical protein ARALYDRAFT_898924 [Arabidopsis lyrata subsp. 
lyrata]
Length=722

 Score =   894 bits (2310),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/686 (67%), Positives = 555/686 (81%), Gaps = 7/686 (1%)
 Frame = -3

Query  2339  TSRK-FRVFCES--TGMQIRKCSPilesill-sgngllssEWKTVPDIWKTAAEEFGNCI  2172
             TSRK FRV CES     ++R+CSP LE + L     L S+EWK VPDIW+++ E++G+ +
Sbjct  39    TSRKGFRVRCESKIQEKELRRCSPFLERLSLPREAALGSNEWKAVPDIWRSSVEKYGDRV  98

Query  2171  ALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTT  1992
             A+VDPYH+PP+  ++++LE+EI+ F EGLRV+G+K DEKIALFADNSCRWLVADQGIM T
Sbjct  99    AVVDPYHDPPSTFTYRQLEQEILDFVEGLRVVGVKADEKIALFADNSCRWLVADQGIMAT  158

Query  1991  GAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKS  1812
             GA+NVVRGSRSSVEELLQIY HSESVAL VDNPE ++RIAE+F   A  +F+ILLWGEKS
Sbjct  159   GAVNVVRGSRSSVEELLQIYCHSESVALVVDNPEFFNRIAESFSCKAAPKFVILLWGEKS  218

Query  1811  SITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTG  1632
             S+ +  M   P+YSYNEI + G E       S +A  +Y YE I+ DD+AT++YTSGTTG
Sbjct  219   SLVTAGMP-TPVYSYNEIKNFGQERRAKFARSNDA-GKYEYEFIDPDDIATIMYTSGTTG  276

Query  1631  NPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTT  1452
             NPKGVMLTH+NLLHQI NL D VP   G+RFLSMLP WHAYERA EYFIF+ G EQ YT+
Sbjct  277   NPKGVMLTHQNLLHQIRNLSDFVPAEAGERFLSMLPSWHAYERACEYFIFTCGVEQKYTS  336

Query  1451  VINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKR  1272
             +  LK DLK+YQP YLISVPLVYETLYSGI KQI+TSSP RK +AL  +K+S AY E KR
Sbjct  337   IRFLKGDLKQYQPHYLISVPLVYETLYSGIQKQISTSSPVRKFLALTLIKVSLAYTEMKR  396

Query  1271  IYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagis  1092
             IYEG CLTK+QK P Y+VS++DWLWAR +A +L PLH+LA KLV+ KI SSIGI+KAG+S
Sbjct  397   IYEGLCLTKNQKPPLYIVSLVDWLWARVVAFVLWPLHILAEKLVHKKIRSSIGITKAGVS  456

Query  1091  gggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDA  912
             GGGSL  HVDKFFEAI + +QNGYGLTE++PVV+ RR  CNVLGS+G PI+ TE K+VD 
Sbjct  457   GGGSLPMHVDKFFEAISVNVQNGYGLTETSPVVSARRLRCNVLGSVGHPIKDTEFKIVDH  516

Query  911   ETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSR  732
             ET   L PGSKGIVK +GP VMKGYYKNP ATKQ ID++GW NTGD+GWI P HS GRSR
Sbjct  517   ETGTVLPPGSKGIVKVRGPPVMKGYYKNPLATKQVIDDDGWFNTGDMGWITPQHSTGRSR  576

Query  731   NSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHK  552
             +  G IVLEGRAKDTIVLS+GENVEP EIEEAAM SNLIQQIVVIGQD+RRLGA+V+P+K
Sbjct  577   SCGGVIVLEGRAKDTIVLSTGENVEPLEIEEAAMRSNLIQQIVVIGQDQRRLGAIVIPNK  636

Query  551   EEVLLAAK-KLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNG  375
             E    AAK K+S VD +  E+S+E+ + +++EEL+KWT+ C+FQ+GP+L+++EPFTIDNG
Sbjct  637   EAAEGAAKQKISPVDPEVNELSKERITSMVYEELKKWTSQCSFQVGPVLIVDEPFTIDNG  696

Query  374   LLTPTMKVRRDKVTDLYKEQIEDLYK  297
             L+TPTMK+RRDKV D YK +I+ LYK
Sbjct  697   LMTPTMKIRRDKVVDQYKNEIDRLYK  722



>ref|XP_010527443.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
isoform X3 [Tarenaya hassleriana]
Length=720

 Score =   893 bits (2307),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/704 (64%), Positives = 567/704 (81%), Gaps = 16/704 (2%)
 Frame = -3

Query  2396  LMSCRGFIKMKWQLNSRGSTSRKFRVFCESTGMQIRKCSPilesills-gngllssEWKT  2220
             L+  +GF+        R S  R FR+ CES   ++R+CSP LE   LS  +   S EW+ 
Sbjct  29    LLGYKGFVP-----RVRISRRRTFRLHCESKEKEVRRCSPFLERSALSGDDASSSREWRA  83

Query  2219  VPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFA  2040
             +PDIW+++AE++G+ +A++DPYH+PPT L++K+LE+EI+SFAEGLRV+G+KPD+KIALFA
Sbjct  84    IPDIWRSSAEKYGDRVAVIDPYHDPPTKLTYKQLEQEILSFAEGLRVVGVKPDDKIALFA  143

Query  2039  DNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFH  1860
             DNSCRWLVADQG M TGA+NVVRGSRSSVEELLQIYNHSESVAL VDNPE ++RI+ETF 
Sbjct  144   DNSCRWLVADQGTMATGAVNVVRGSRSSVEELLQIYNHSESVALVVDNPEFFNRISETFS  203

Query  1859  SHADVRFIILLWGEKSSITSEVMDG--RPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
             S A++RF+ILLWGEKSS+    M+G   P+YSY EI+D G E     L +     +Y YE
Sbjct  204   SRANLRFVILLWGEKSSL---FMEGTRSPVYSYTEIMDFGWER----LRNSFGSGKYEYE  256

Query  1685  PINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYE  1506
              IN DD A+++YTSGTTGNPKGVMLTH NLLHQI +L   VP   GDRFLSMLP WHAYE
Sbjct  257   YINPDDTASIMYTSGTTGNPKGVMLTHRNLLHQISSLHASVPTEAGDRFLSMLPSWHAYE  316

Query  1505  RAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARK  1326
             RA EYFIF+ G EQ+YT++  LK+DLK+Y+P YLISVPLVYETLYSGI KQI+ SS  RK
Sbjct  317   RACEYFIFTHGVEQMYTSIRYLKDDLKQYRPHYLISVPLVYETLYSGIQKQISASSAPRK  376

Query  1325  LIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARK  1146
              +A   ++IS AY E KRIYEG CL+K+QK P YLVS++DWL ARA AA+L PLH+LA++
Sbjct  377   FLAFTLIRISLAYMETKRIYEGFCLSKNQKPPPYLVSLVDWLSARAAAAILWPLHMLAKR  436

Query  1145  LVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNV  966
             LVY KI SSIGI KAGISGG SL  H+DKFFEA+ + +QNGYGLTE++PV++ RR +CNV
Sbjct  437   LVYEKILSSIGILKAGISGGSSLPMHIDKFFEAVGLDVQNGYGLTETSPVISVRRLSCNV  496

Query  965   LGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWL  786
             LGS+G PIR TE+KV+D ET+  L PG KGIVK +GPQVMKGYYKNP AT+Q +DE+GW 
Sbjct  497   LGSVGHPIRDTELKVMDFETNNVLPPGLKGIVKVRGPQVMKGYYKNPLATRQVLDEDGWF  556

Query  785   NTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQI  606
             NTGD+GWI P+H  GRSR+  G IVLEGRAKDTIVLS+GENVEP EIEEAAM S+LIQQI
Sbjct  557   NTGDMGWIAPHHPTGRSRSVGGSIVLEGRAKDTIVLSTGENVEPLEIEEAAMRSSLIQQI  616

Query  605   VVIGQDKRRLGALVLPHKEEVLLAAKKL-SVVDSDATEVSEEKTSKLIHEELQKWTTGCT  429
             +VIGQD+RR+GA+++P+KEE  +AA+   S  DS A+E+S+EK + ++++EL+KWT+ C+
Sbjct  617   LVIGQDQRRIGAIIVPNKEEADIAAENNDSPGDSRASELSKEKLTSMVYKELRKWTSECS  676

Query  428   FQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             FQ+GP+L+++EPFT+DNGL+TPTMK+RRDKV D YK++I +LYK
Sbjct  677   FQVGPVLVVDEPFTVDNGLMTPTMKIRRDKVVDKYKDEIANLYK  720



>ref|XP_006299603.1| hypothetical protein CARUB_v10015782mg [Capsella rubella]
 gb|EOA32501.1| hypothetical protein CARUB_v10015782mg [Capsella rubella]
Length=723

 Score =   893 bits (2307),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/688 (66%), Positives = 552/688 (80%), Gaps = 6/688 (1%)
 Frame = -3

Query  2348  RGSTSRKFRVFCEST--GMQIRKCSPilesill-sgngllssEWKTVPDIWKTAAEEFGN  2178
             R ++ R FRV CEST    ++R+CSP LE   L     L S+EWK VPDIW+++ E++G+
Sbjct  38    RRTSRRGFRVRCESTIQEKELRRCSPFLERSSLPKEVALRSNEWKAVPDIWRSSVEKYGD  97

Query  2177  CIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIM  1998
              +A+VDPYH+PPT  ++++LE+EI+ F EGLRV+G+K DEKIALFADNSCRWL+ADQGIM
Sbjct  98    RVAVVDPYHDPPTTFTYRQLEQEILDFVEGLRVVGVKADEKIALFADNSCRWLIADQGIM  157

Query  1997  TTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGE  1818
              TGA+NVVRGSRSSVEELLQIY HSESVAL VDNPE Y+RIAE+F   A  RF+ILLWGE
Sbjct  158   ATGAVNVVRGSRSSVEELLQIYCHSESVALVVDNPEFYNRIAESFSYKAPPRFVILLWGE  217

Query  1817  KSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGT  1638
             KSS+ + V    P+YSYNEI   G E       S +A  +Y YE IN DD AT++YTSGT
Sbjct  218   KSSLVT-VGRQTPVYSYNEIKRFGQERRAKFARSNDA-GKYEYEYINPDDTATIMYTSGT  275

Query  1637  TGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVY  1458
             TGNPKGVMLTH+NLLHQ+ NL D VP   G+RFLSMLP WHAYERA EYFIF+ G EQ Y
Sbjct  276   TGNPKGVMLTHQNLLHQVKNLSDFVPSQAGERFLSMLPSWHAYERACEYFIFTCGVEQKY  335

Query  1457  TTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEA  1278
             T++  LK+DLK+YQP YLISVPLVYETLYSGI KQI+TSSP RK +AL  +K+S AY E 
Sbjct  336   TSIRFLKDDLKQYQPHYLISVPLVYETLYSGIQKQISTSSPVRKFLALTLIKVSLAYTEM  395

Query  1277  KRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskag  1098
             +RI+EG CLTK+QK P Y+VS++DWLWAR +A  L PLH+LA  LV+ KI SS+GI+KAG
Sbjct  396   RRIHEGLCLTKNQKPPMYIVSLVDWLWARVVAFFLWPLHMLAENLVHRKIRSSVGITKAG  455

Query  1097  isgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVV  918
             +SGGGSL  HVDKFFEAI + +QNGYGLTE++PV++ R+ +CNVLGS+G PI+ TE K+V
Sbjct  456   VSGGGSLPMHVDKFFEAIGVNVQNGYGLTETSPVISARKLSCNVLGSVGHPIKDTEFKIV  515

Query  917   DAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGR  738
             D ET   L PGSKGIVK +GP VMKGYYKNP ATKQ ID++GW NTGD+GWI P HS GR
Sbjct  516   DPETGSVLPPGSKGIVKVRGPPVMKGYYKNPLATKQVIDDDGWFNTGDMGWIAPKHSAGR  575

Query  737   SRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLP  558
             SR+  G +VLEGRAKDTIVLS+GENVEP EIEEAAM SNLIQQIVVIGQD+RRLGA+++P
Sbjct  576   SRSCGGVLVLEGRAKDTIVLSTGENVEPLEIEEAAMRSNLIQQIVVIGQDQRRLGAIIIP  635

Query  557   HKEEVLLAAK-KLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTID  381
             +KE    AAK K+S VD +  E+S+E  + +++EEL+KWT+ C+FQ+GP+L+++EPFTID
Sbjct  636   NKEAAEEAAKQKISPVDPEVNELSKETITSMVYEELRKWTSQCSFQVGPVLIVDEPFTID  695

Query  380   NGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             NGL+TPTMK+RRDKV D YK +IE LYK
Sbjct  696   NGLMTPTMKIRRDKVVDQYKSEIERLYK  723



>ref|XP_010466735.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
isoform X1 [Camelina sativa]
Length=723

 Score =   890 bits (2300),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/679 (66%), Positives = 549/679 (81%), Gaps = 6/679 (1%)
 Frame = -3

Query  2321  VFCEST--GMQIRKCSPilesill-sgngllssEWKTVPDIWKTAAEEFGNCIALVDPYH  2151
             V CEST    ++R+CSP LE   L     L S+EW+ VPDIW+++ E++G+ +A+VDPYH
Sbjct  47    VLCESTIQEKELRRCSPFLERSSLPKEAALRSNEWRAVPDIWRSSVEKYGDKVAVVDPYH  106

Query  2150  NPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVR  1971
             +PP+  ++++LE+EI+ F EGLRV+G+K DEKIALFADNSCRWLVADQGIM TGA+NVVR
Sbjct  107   DPPSTFTYRQLEQEILDFVEGLRVVGVKADEKIALFADNSCRWLVADQGIMATGAVNVVR  166

Query  1970  GSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVM  1791
             GSRSS+EELLQIY HSESVAL VDNPE Y+RIAE+F   A  RF+ILLWG+KSS+ + V 
Sbjct  167   GSRSSIEELLQIYCHSESVALVVDNPEFYNRIAESFSYKAPPRFVILLWGDKSSLVT-VG  225

Query  1790  DGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVML  1611
                P+YSYNEI   G E       S +AR +Y YE I+ DD AT++YTSGTTGNPKGVML
Sbjct  226   RQTPVYSYNEIKRFGQERRAKFARSNDAR-KYEYEFIDPDDTATIMYTSGTTGNPKGVML  284

Query  1610  THENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKED  1431
             TH+NLLHQI NL D VP   G+RFLSMLP WHAYERA EYFIF+ G EQ YT++  LK+D
Sbjct  285   THQNLLHQIRNLSDFVPAEAGERFLSMLPSWHAYERACEYFIFTCGVEQKYTSIRFLKDD  344

Query  1430  LKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCL  1251
             LK+YQP YLISVPLVYETLYSGI KQI+TSSPARK +AL  +K+S AY E +RI EG CL
Sbjct  345   LKQYQPHYLISVPLVYETLYSGIQKQISTSSPARKFVALTLIKVSLAYMEMRRISEGLCL  404

Query  1250  TKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslss  1071
             TK+QK P Y+VS++DWLWAR +A +L PLH+LA KLV+ +I SS+GI+KAG+SGGGSL  
Sbjct  405   TKNQKPPMYVVSLVDWLWARVVAFVLLPLHMLAEKLVHREIRSSVGITKAGVSGGGSLPM  464

Query  1070  HVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALS  891
             HVDKFFEAI + +QNGYGLTE++PVV+ RR NCNVLGS+G PI+ TE K+VD ET   L 
Sbjct  465   HVDKFFEAIGVNVQNGYGLTETSPVVSARRLNCNVLGSVGHPIKDTEFKIVDPETGSDLP  524

Query  890   PGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIV  711
             PGSKGIVK +G  VMKGYYKNP ATKQ IDE+GW NTGD+GWI P HS+GRSR+  G IV
Sbjct  525   PGSKGIVKVRGRPVMKGYYKNPLATKQVIDEDGWFNTGDMGWITPQHSVGRSRSCGGVIV  584

Query  710   LEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAA  531
             LEGRAKDTIVLS+GENVEP EIEEAAM SNLIQQIVVIGQD+RRLGA+++P+KE    AA
Sbjct  585   LEGRAKDTIVLSTGENVEPLEIEEAAMRSNLIQQIVVIGQDQRRLGAIIIPNKEAAEGAA  644

Query  530   K-KLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMK  354
             K K+S +D +  E+S+E  + +++EEL+KWT+ C+FQ+GP+L+++EPFTIDNGL+TPTMK
Sbjct  645   KQKISPLDPEVNELSKETITSMVYEELRKWTSQCSFQVGPVLIVDEPFTIDNGLMTPTMK  704

Query  353   VRRDKVTDLYKEQIEDLYK  297
             +RRDKV D YK +IE LYK
Sbjct  705   IRRDKVVDQYKNEIERLYK  723



>ref|XP_009373570.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=745

 Score =   890 bits (2299),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/740 (64%), Positives = 590/740 (80%), Gaps = 21/740 (3%)
 Frame = -3

Query  2468  AALNTKSVMFLLPK-----SDDGNHAVH---DLMSCRG-FIKMKWQLNSRG--STSRKFR  2322
             A++N  +  FL P      S D  H +    +  S  G     KW   SRG  S SR FR
Sbjct  11    ASVNQMATFFLAPNYVLGSSSDCGHTLQFRSNNNSRSGELFHRKWH-GSRGGISVSRGFR  69

Query  2321  VFCE--STGMQIRKCSP-ilesillsgngllssEWKTVPDIWKTAAEEFGNCIALVDPYH  2151
             V C+  +   QIR+ SP +   +L   +   S +WK VPDIW+++A ++G+ +ALVDP+H
Sbjct  70    VLCQFKTEEKQIRRHSPFLERVLLDDSDASESDKWKAVPDIWRSSAAKYGDLVALVDPFH  129

Query  2150  NPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVR  1971
             +PP+++++K+LE+EI+ FAEG+RV+G+KPDEKIALFADNSCRWLVADQGIM TGAINVVR
Sbjct  130   DPPSSITYKQLEQEILDFAEGMRVVGVKPDEKIALFADNSCRWLVADQGIMATGAINVVR  189

Query  1970  GSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVM  1791
             GSRSSVEELLQIYNHS+SVALAVD+PE+++RI+E F S A ++FI+LLWGEKSS+ +E  
Sbjct  190   GSRSSVEELLQIYNHSDSVALAVDSPELFNRISEEFCSKA-MKFIVLLWGEKSSLKNE--  246

Query  1790  DGR-PIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVM  1614
              G+ PI+ Y EI+DLG ES  +LL S + +   TYE I SDDVATLVYTSGT+GNPKGVM
Sbjct  247   -GKVPIFDYKEILDLGRESRKSLLDSDDKQQSDTYEVIKSDDVATLVYTSGTSGNPKGVM  305

Query  1613  LTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKE  1434
             LTH NLLHQI NLWD VP V GD+FLSMLPPWH YERA EYF F+ G EQ YT+V  +K+
Sbjct  306   LTHRNLLHQIKNLWDAVPCVGGDKFLSMLPPWHCYERACEYFAFTCGVEQFYTSVRKMKD  365

Query  1433  DLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKC  1254
             DL++YQP Y+ISVPLVYE+LYSGI KQI+++S  RKLIAL F++IS AY E KRIYEGK 
Sbjct  366   DLRKYQPTYIISVPLVYESLYSGIQKQISSASTVRKLIALTFIRISMAYMEFKRIYEGKY  425

Query  1253  LTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggsls  1074
             LT++ KQ SYLVSV DWLWAR IAA L PLH+L +KLVYSKI S+IGISKAGISGGG L 
Sbjct  426   LTRNPKQSSYLVSVADWLWARIIAAFLWPLHVLGKKLVYSKIQSAIGISKAGISGGGCLP  485

Query  1073  sHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKAL  894
             SHVDKFFEAID+KL NGYGLTE++PVVA RR N NV+GS+G PIRHTE KVVD+ET + L
Sbjct  486   SHVDKFFEAIDMKLLNGYGLTETSPVVASRRLNFNVIGSVGLPIRHTEFKVVDSETGEVL  545

Query  893   SPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFI  714
             SPG  GI+K +GPQVMKGYYKNP  TK+A+D++GWL+TGD+GWI P+HSIGRSR   G +
Sbjct  546   SPGLSGILKVRGPQVMKGYYKNPGTTKKALDDDGWLDTGDIGWIAPHHSIGRSRCCGGVV  605

Query  713   VLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPH-KEEVLL  537
             VLEGRAKDTIVL +GENVEP EIEEAA+ S+LIQQIVVIGQD+RRLGA+V+P+ +E +L 
Sbjct  606   VLEGRAKDTIVLLTGENVEPVEIEEAALRSSLIQQIVVIGQDQRRLGAIVVPNKEEALLA  665

Query  536   AAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTM  357
             A K  +V  +DA+ +S ++ + L++EEL+KWT+GC+FQIGPI++  EPFTID+GL+TPTM
Sbjct  666   AKKLAAVDAADASSLSNDRLTSLVYEELRKWTSGCSFQIGPIIIAEEPFTIDSGLMTPTM  725

Query  356   KVRRDKVTDLYKEQIEDLYK  297
             K+RRD+V   YKEQI++L+K
Sbjct  726   KIRRDRVVAQYKEQIDNLFK  745



>gb|KFK39674.1| amp-binding protein [Arabis alpina]
Length=738

 Score =   888 bits (2295),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/716 (64%), Positives = 558/716 (78%), Gaps = 26/716 (4%)
 Frame = -3

Query  2372  KMKWQLNSRGSTSRKFRVFCEST-------------------GMQ---IRKCSPilesil  2259
             ++++ LN +G   R FRV CEST                   G+Q   +R+CSP LE   
Sbjct  25    RLRFTLNQKGFVRRGFRVRCESTASFFQSLTLKVLCFSIDSFGIQEKELRRCSPFLERSS  84

Query  2258  l-sgngllssEWKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLR  2082
             L     L S EWK VPDIW+++ E++G+ +ALVDPYH PP+  +++ELE+EI+ F EGLR
Sbjct  85    LPREAALCSDEWKAVPDIWRSSVEKYGDRVALVDPYHEPPSKFTYRELEQEILDFVEGLR  144

Query  2081  VIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAV  1902
             V+G+K DEKIALFADNSCRWLVADQGIM TGA+NVVRGSRSSVEELLQIY HS+SVAL V
Sbjct  145   VVGMKADEKIALFADNSCRWLVADQGIMATGAVNVVRGSRSSVEELLQIYCHSDSVALVV  204

Query  1901  DNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALL  1722
             DNPE ++RIAE F   A +RF+ILLWGEKSS+  +V     +Y+YNEI   G E      
Sbjct  205   DNPEFFNRIAEPFSYKAPLRFVILLWGEKSSLV-KVGRQTAVYTYNEIKKFGQERRATFA  263

Query  1721  HSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDR  1542
              S +A  +Y YE IN  D AT++YTSGTTGNPKGVMLTH+NLLHQI NL   VP   G+R
Sbjct  264   GSSDA-GKYEYEFINPADTATIMYTSGTTGNPKGVMLTHQNLLHQIRNLSGFVPAKAGER  322

Query  1541  FLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGI  1362
             FLSMLP WHAYERA EYFIF+ G EQ+YT++  LK+DLKRYQP YLISVPLVYETLYSGI
Sbjct  323   FLSMLPSWHAYERACEYFIFTCGVEQMYTSIRFLKDDLKRYQPHYLISVPLVYETLYSGI  382

Query  1361  LKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIA  1182
              KQI+TSSPARK +AL  +++S AY E +RIYEG CLTK+QK P Y+VS++DWLWAR +A
Sbjct  383   QKQISTSSPARKFLALTLIRVSLAYTEMRRIYEGLCLTKNQKPPMYIVSLVDWLWARVVA  442

Query  1181  ALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESA  1002
              +L PLH+LA +LV+ KI SSIGISKAG+SGGGSL  HVDKFFEAI + +QNGYGLTE++
Sbjct  443   FVLWPLHMLAERLVHKKIRSSIGISKAGVSGGGSLPMHVDKFFEAIGVNVQNGYGLTETS  502

Query  1001  PVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPF  822
             PVV+ RR +CNVLGS+G PI+ TE K+VD ET   L PGSKGIVK +GP VMKGYYKNP 
Sbjct  503   PVVSARRLSCNVLGSVGHPIKGTEFKIVDHETGSVLPPGSKGIVKVRGPPVMKGYYKNPQ  562

Query  821   ATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIE  642
             ATKQ IDE GWL+TGD+GWI P HS GRSR+  G IVLEGRAKDTIVLS+GENVEP EIE
Sbjct  563   ATKQVIDEGGWLSTGDMGWIAPQHSTGRSRSCGGVIVLEGRAKDTIVLSTGENVEPLEIE  622

Query  641   EAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAK-KLSVVDSDATEVSEEKTSKLI  465
             EAAM S+LIQQIVVIGQD+RRLGA++ P+KE    AAK K+S VD +  E+S+E  + ++
Sbjct  623   EAAMRSDLIQQIVVIGQDERRLGAIIKPNKEAAESAAKSKMSPVDPEVNELSKETVTSMV  682

Query  464   HEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             +EEL+KWT+ C+FQ+GP+L+++EPFTIDNGL+TPTMK+RRDKV D YK++I+ LYK
Sbjct  683   YEELRKWTSECSFQVGPVLIVDEPFTIDNGLMTPTMKIRRDKVVDKYKDEIDRLYK  738



>ref|XP_010527441.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010527442.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=722

 Score =   888 bits (2294),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/706 (64%), Positives = 567/706 (80%), Gaps = 18/706 (3%)
 Frame = -3

Query  2396  LMSCRGFIKMKWQLNSRGSTSRKFRVFCES--TGMQIRKCSPilesills-gngllssEW  2226
             L+  +GF+        R S  R FR+ CES     ++R+CSP LE   LS  +   S EW
Sbjct  29    LLGYKGFVP-----RVRISRRRTFRLHCESKIQEKEVRRCSPFLERSALSGDDASSSREW  83

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             + +PDIW+++AE++G+ +A++DPYH+PPT L++K+LE+EI+SFAEGLRV+G+KPD+KIAL
Sbjct  84    RAIPDIWRSSAEKYGDRVAVIDPYHDPPTKLTYKQLEQEILSFAEGLRVVGVKPDDKIAL  143

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             FADNSCRWLVADQG M TGA+NVVRGSRSSVEELLQIYNHSESVAL VDNPE ++RI+ET
Sbjct  144   FADNSCRWLVADQGTMATGAVNVVRGSRSSVEELLQIYNHSESVALVVDNPEFFNRISET  203

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDG--RPIYSYNEIIDLGNESHMALLHSQEARHQYT  1692
             F S A++RF+ILLWGEKSS+    M+G   P+YSY EI+D G E     L +     +Y 
Sbjct  204   FSSRANLRFVILLWGEKSSL---FMEGTRSPVYSYTEIMDFGWER----LRNSFGSGKYE  256

Query  1691  YEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHA  1512
             YE IN DD A+++YTSGTTGNPKGVMLTH NLLHQI +L   VP   GDRFLSMLP WHA
Sbjct  257   YEYINPDDTASIMYTSGTTGNPKGVMLTHRNLLHQISSLHASVPTEAGDRFLSMLPSWHA  316

Query  1511  YERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPA  1332
             YERA EYFIF+ G EQ+YT++  LK+DLK+Y+P YLISVPLVYETLYSGI KQI+ SS  
Sbjct  317   YERACEYFIFTHGVEQMYTSIRYLKDDLKQYRPHYLISVPLVYETLYSGIQKQISASSAP  376

Query  1331  RKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLA  1152
             RK +A   ++IS AY E KRIYEG CL+K+QK P YLVS++DWL ARA AA+L PLH+LA
Sbjct  377   RKFLAFTLIRISLAYMETKRIYEGFCLSKNQKPPPYLVSLVDWLSARAAAAILWPLHMLA  436

Query  1151  RKLVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNC  972
             ++LVY KI SSIGI KAGISGG SL  H+DKFFEA+ + +QNGYGLTE++PV++ RR +C
Sbjct  437   KRLVYEKILSSIGILKAGISGGSSLPMHIDKFFEAVGLDVQNGYGLTETSPVISVRRLSC  496

Query  971   NVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENG  792
             NVLGS+G PIR TE+KV+D ET+  L PG KGIVK +GPQVMKGYYKNP AT+Q +DE+G
Sbjct  497   NVLGSVGHPIRDTELKVMDFETNNVLPPGLKGIVKVRGPQVMKGYYKNPLATRQVLDEDG  556

Query  791   WLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQ  612
             W NTGD+GWI P+H  GRSR+  G IVLEGRAKDTIVLS+GENVEP EIEEAAM S+LIQ
Sbjct  557   WFNTGDMGWIAPHHPTGRSRSVGGSIVLEGRAKDTIVLSTGENVEPLEIEEAAMRSSLIQ  616

Query  611   QIVVIGQDKRRLGALVLPHKEEVLLAAKKL-SVVDSDATEVSEEKTSKLIHEELQKWTTG  435
             QI+VIGQD+RR+GA+++P+KEE  +AA+   S  DS A+E+S+EK + ++++EL+KWT+ 
Sbjct  617   QILVIGQDQRRIGAIIVPNKEEADIAAENNDSPGDSRASELSKEKLTSMVYKELRKWTSE  676

Query  434   CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             C+FQ+GP+L+++EPFT+DNGL+TPTMK+RRDKV D YK++I +LYK
Sbjct  677   CSFQVGPVLVVDEPFTVDNGLMTPTMKIRRDKVVDKYKDEIANLYK  722



>ref|XP_010673322.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=739

 Score =   886 bits (2290),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/699 (65%), Positives = 561/699 (80%), Gaps = 5/699 (1%)
 Frame = -3

Query  2378  FIKMKWQLNSRGSTSRKFRVFCESTG----MQIRKCSPilesillsgngll-ssEWKTVP  2214
             F    W+        RK    C  T     +Q R+C+P+LE  +L    LL SS+WKTVP
Sbjct  41    FTHRCWKQLGSFRLRRKLVCVCSQTAETEELQKRRCAPLLEHEILYNRVLLGSSDWKTVP  100

Query  2213  DIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADN  2034
             DIW+TAAE++ +  AL+D YH PP  L++K+LE+EI+ F+EGLRV+G++P EK+ALFADN
Sbjct  101   DIWRTAAEKYADRTALIDRYHEPPLELTYKQLEQEILDFSEGLRVVGIEPYEKVALFADN  160

Query  2033  SCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSH  1854
             SCRWL+ADQG M  GAINVVRGSRSS EELLQIYNHSESVAL VDNP +++R+A+ F   
Sbjct  161   SCRWLIADQGTMAMGAINVVRGSRSSTEELLQIYNHSESVALLVDNPALFNRMADLFVGQ  220

Query  1853  ADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINS  1674
             A  +F+ILLWGEKS ++  V D   +++Y+EII +G ES   L  S +AR  Y+YEPI+S
Sbjct  221   ASTKFVILLWGEKSDLSEGVSDRLSVFNYSEIIAMGKESRKHLSDSYDARKLYSYEPISS  280

Query  1673  DDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAE  1494
             DDVATL+YTSGTTGNPKGVM+TH NLLHQI +LWD VPV  GD+FLSMLPPWHAYERAAE
Sbjct  281   DDVATLMYTSGTTGNPKGVMITHRNLLHQIRSLWDVVPVRAGDKFLSMLPPWHAYERAAE  340

Query  1493  YFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIAL  1314
             YFIFS G EQVYTTV NLKEDLK YQP YLISVPLVYETLYS I KQI  +S  RK+IAL
Sbjct  341   YFIFSYGIEQVYTTVKNLKEDLKNYQPDYLISVPLVYETLYSAIQKQIAANSVVRKIIAL  400

Query  1313  LFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYs  1134
               +KIS  Y E KRIYEGK L K Q+Q SYL++++DWLWA   A +L P+H LA+ L+YS
Sbjct  401   ALIKISLTYMELKRIYEGKYLPKKQQQQSYLIALVDWLWAGVAATVLWPIHNLAKLLLYS  460

Query  1133  kihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSI  954
             KI S+IGISKAGISGGGSL  H+DKFFEAI I +QNGYGLTES+PVVA RRP  N+LGS+
Sbjct  461   KIKSAIGISKAGISGGGSLPLHIDKFFEAIGIIVQNGYGLTESSPVVAARRPAYNILGSV  520

Query  953   GPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGD  774
             G P++ TEIKVV+A+TD+ LSPGSKGI+K +GPQVM GY+KNP AT+Q +D+NGWLNTGD
Sbjct  521   GHPLKRTEIKVVNADTDEVLSPGSKGIIKVRGPQVMTGYFKNPSATRQVLDDNGWLNTGD  580

Query  773   LGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIG  594
             LGWI P HS GRSR   G +VLEGRAKDTIVLS+GENVEPSEIEEAA+ S+LI+QIV+IG
Sbjct  581   LGWISPCHSSGRSRLCGGVLVLEGRAKDTIVLSTGENVEPSEIEEAAVRSSLIEQIVIIG  640

Query  593   QDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGP  414
             QD+RRLGA+++P+KEE L AAK+ S+VD+DA+E+ +E+ + L+ EEL+KWT+  +FQ+GP
Sbjct  641   QDQRRLGAIIVPNKEEALQAAKRSSLVDADASELKKERLTNLLREELRKWTSEFSFQVGP  700

Query  413   ILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             +L+++EPFTID+GL+TPT+K+RRD V D Y+++I +LY+
Sbjct  701   VLIVDEPFTIDSGLMTPTLKIRRDVVADRYRDEIANLYR  739



>ref|XP_010532731.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=749

 Score =   884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/706 (65%), Positives = 569/706 (81%), Gaps = 16/706 (2%)
 Frame = -3

Query  2393  MSCRGFIKMKWQLNSRGSTSRKFRVFCES--TGMQIRKCSPilesillsg-ngllssEWK  2223
             + CRGF     +     S+ R+FR+ C+S     ++R+CSP+LE   LSG   L SSEWK
Sbjct  53    LGCRGF-----RPGFGISSYRRFRIHCDSKIQEKEVRRCSPLLERSALSGGVALSSSEWK  107

Query  2222  TVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALF  2043
              VPDIW+++AE++G+ +ALVDPYH+PP+NL++K+LE+EI+ FAEGLR++G+KPDEKIALF
Sbjct  108   AVPDIWRSSAEKYGDRVALVDPYHDPPSNLTYKQLEQEILDFAEGLRIVGVKPDEKIALF  167

Query  2042  ADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETF  1863
             ADNSCRWLV DQGIM TGA+NVVRGSRSSVEELLQIY+HSESVAL VDNPE ++RI++ F
Sbjct  168   ADNSCRWLVTDQGIMATGAVNVVRGSRSSVEELLQIYSHSESVALVVDNPEFFNRISKKF  227

Query  1862  HSHADVRFIILLWGEKSSITSEVMDG--RPIYSYNEIIDLGNESHMALLHSQEARHQYTY  1689
              +    RF+ILLWGEKSS+   VM+G   P+YSY EII+   E     L S +   +Y Y
Sbjct  228   STKVSPRFVILLWGEKSSL---VMEGIRSPVYSYTEIINFRREKLRNPLGSDDD-GKYEY  283

Query  1688  EPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAY  1509
             E IN DD A ++YTSGTTGNPKGVMLTH NLLHQI NL++ VP  PGDRFLSMLP WHAY
Sbjct  284   EFINPDDTAAIMYTSGTTGNPKGVMLTHRNLLHQINNLFEIVPAEPGDRFLSMLPSWHAY  343

Query  1508  ERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPAR  1329
             ER+ EYFIF+ G EQ+YT++  LK+DLKRYQP YLISVPLVYETLYSGI KQI+TSS AR
Sbjct  344   ERSCEYFIFTHGVEQMYTSIRYLKDDLKRYQPHYLISVPLVYETLYSGIQKQISTSSAAR  403

Query  1328  KLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLAR  1149
             K +AL  +KIS AY E +RIYEG CLTK+Q  P YL+S++DWL AR  AA+L PLH+LA+
Sbjct  404   KFVALTLIKISLAYMEMRRIYEGVCLTKNQNPPPYLISLVDWLIARVAAAILWPLHMLAK  463

Query  1148  KLVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
             + VY KI SSIGISKAGISGGGSL  HVDKFFEA+ + +QNGYGLTE++PV++ RR +CN
Sbjct  464   RFVYRKILSSIGISKAGISGGGSLPMHVDKFFEAVGVNVQNGYGLTETSPVISARRLSCN  523

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             VLGS+G PI+ TE KVVD+ET+  L PGSKGIVK +GPQVMKGYYKNP ATKQ +DE+GW
Sbjct  524   VLGSVGHPIQDTEFKVVDSETNNVLPPGSKGIVKVRGPQVMKGYYKNPLATKQVLDEDGW  583

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              +TGD+GWI P+H IGRS +  G IVLEGRAKDTIVLS+GENVEP EIEEAA+ S+LIQQ
Sbjct  584   FDTGDMGWIAPHHLIGRSCSCGGVIVLEGRAKDTIVLSTGENVEPLEIEEAALRSSLIQQ  643

Query  608   IVVIGQDKRRLGALVLPHKEEVLLAAK-KLSVVDSDATE-VSEEKTSKLIHEELQKWTTG  435
             IVVIGQD+RR+GA+++P+KEE  +A K   S  D  A+E +S+EK + +++EEL+KWT+ 
Sbjct  644   IVVIGQDQRRIGAIIVPNKEEADIAPKNNNSDTDPGASELISKEKLTSMVYEELRKWTSE  703

Query  434   CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             C++Q+GP+L+++EPFTIDNGL+TPTMK+RRDKV   YK++I  LYK
Sbjct  704   CSYQVGPVLIVDEPFTIDNGLMTPTMKIRRDKVVKKYKDEIAKLYK  749



>ref|XP_004296968.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=728

 Score =   884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/726 (62%), Positives = 579/726 (80%), Gaps = 16/726 (2%)
 Frame = -3

Query  2444  MFLLPKSDDGNHAVHDLMSCRGFIKMKWQLNSRGST------SRKFRVFCESTG--MQIR  2289
             +F++    D  HA   L S +   K++ +  +R  T      +R F  FC+S     QIR
Sbjct  9     LFIVGTCSDSGHAFQFLCSHK---KLRSRQRARYPTPTGFPLNRPFHAFCQSKTEEKQIR  65

Query  2288  KCSPilesills-gngllssEWKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEK  2112
             + SP LES  ++  + L+  +W+ VPDIWK+++E++G+ +AL DPYH+PP+  ++K+LEK
Sbjct  66    RYSPFLESASVNGNHSLVHDDWQAVPDIWKSSSEKYGDLVALTDPYHDPPSTFTYKQLEK  125

Query  2111  EIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIY  1932
             EI+ F+EGLRV+G++P+EKIALFA+NSCRWLVADQGIM TGAINVVRGSRSSV+ELLQIY
Sbjct  126   EILDFSEGLRVVGVRPEEKIALFAENSCRWLVADQGIMATGAINVVRGSRSSVKELLQIY  185

Query  1931  NHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGR-PIYSYNEII  1755
             +HS+SVA+A+DNPE++ RI+E F S A ++F+ILLWGEKSS+ S   DG+ P++ Y EI+
Sbjct  186   DHSDSVAVAIDNPELFDRISEEFCSKAVMKFVILLWGEKSSLIS---DGKIPVFKYEEIL  242

Query  1754  DLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNL  1575
             DLG ES   + +S + R    YE INSDD+AT+VYTSGT+GNPKGV+LTH NLLHQI NL
Sbjct  243   DLGRESRSHMHNSNDGRQHTMYEAINSDDIATVVYTSGTSGNPKGVILTHRNLLHQIKNL  302

Query  1574  WDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISV  1395
              D VP V G++FLSMLPPWH YERA+EYF F+ G EQ YTTV  LK DL++YQP ++ISV
Sbjct  303   GDIVPAVGGNKFLSMLPPWHCYERASEYFAFTRGIEQFYTTVRKLKADLRQYQPDFVISV  362

Query  1394  PLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVS  1215
             PLVYETLYSGI KQI++SS   KLI L F++IS AY E KRIYEG  LT+  K  S+LVS
Sbjct  363   PLVYETLYSGIHKQISSSSTVLKLITLTFIRISLAYMEFKRIYEGTYLTRKHKPSSHLVS  422

Query  1214  VLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAIDIK  1035
             + DW+ AR +AALL PLH++ + L+YSKI S+IGI+KAGISGGG+L SHVDKFFEAI I 
Sbjct  423   IADWVMARVVAALLWPLHVMGQNLIYSKIQSAIGITKAGISGGGNLPSHVDKFFEAIGIN  482

Query  1034  LQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGP  855
             L NGYGLTE++PVVA R+P+CNVLGS+G PIRHTE KVVD+ET + L PG  GIVK +GP
Sbjct  483   LLNGYGLTETSPVVAARQPSCNVLGSVGHPIRHTEFKVVDSETGEVLLPGLSGIVKVRGP  542

Query  854   QVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLS  675
             QVMKGYYKNP AT+Q +D++GWL+TGD+GWI P+HSIGRSR S G IVLEGRAKDTIVLS
Sbjct  543   QVMKGYYKNPGATEQVLDKDGWLDTGDIGWIAPHHSIGRSRRSGGVIVLEGRAKDTIVLS  602

Query  674   SGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATE  495
             +GENVEP E+EEAA  S+LIQQIVVIGQD+RRLGA+++P+KEE LLAAK LS+VD +A+E
Sbjct  603   TGENVEPVELEEAASRSSLIQQIVVIGQDQRRLGAIIVPNKEEALLAAKNLSLVDINASE  662

Query  494   VSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQ  315
             +S+E    L+ ++L+KWT+ C+FQIG IL+ +EPFTID+GL+T TMK+RRD+V   YKEQ
Sbjct  663   LSKETIKSLVSQDLRKWTSSCSFQIGRILIADEPFTIDSGLMTLTMKIRRDRVVARYKEQ  722

Query  314   IEDLYK  297
             I++L+K
Sbjct  723   IDNLFK  728



>ref|XP_003629618.1| Annotation was added to scaffolds in November 2011~Long-chain-fatty-acid 
CoA ligase [Medicago truncatula]
Length=823

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/792 (60%), Positives = 575/792 (73%), Gaps = 113/792 (14%)
 Frame = -3

Query  2333  RKFRVFCES---TGMQIRKCSPilesills--------gngllssEWKTVPDIWKTAAEE  2187
             R FRVF +S   T   IRKCSP LES +L              S EWK VPDIW+++AE+
Sbjct  32    RCFRVFSQSNTETVQIIRKCSPFLESSMLVGNNNNNNNAAVDSSHEWKVVPDIWRSSAEK  91

Query  2186  FGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQ  2007
             +G+ +ALVD YH+PP+ +++ +LE+ I+ +AEGLRVIG++PDEK+ALFADNSCRWLVADQ
Sbjct  92    YGDKVALVDQYHHPPSTITYNQLEQAILDYAEGLRVIGVRPDEKLALFADNSCRWLVADQ  151

Query  2006  G------------------------------------------------IMTTGAINVVR  1971
             G                                                +M +GAINVVR
Sbjct  152   GGALAQSCCHVAERSRVQVLETTSCVKESVRLRTIHQNGGTSSWTLVLGMMASGAINVVR  211

Query  1970  GSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKS--SITSE  1797
             GSRSSVEELLQIYNHSESVALAVD PEM++RIA+ F+S   +RFIILLWGEKS  ++ +E
Sbjct  212   GSRSSVEELLQIYNHSESVALAVDGPEMFNRIAKPFYSKTGMRFIILLWGEKSDLNLIAE  271

Query  1796  VMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGV  1617
                  PI+S+ E+IDLG ES MAL  S EA  +Y YE INSDD+ATL+YTSGTTGNPKGV
Sbjct  272   ENKEVPIFSFMEVIDLGRESRMALSDSHEASQRYVYEAINSDDIATLIYTSGTTGNPKGV  331

Query  1616  MLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLK  1437
             MLTH NLLHQI NLWD VP   GDRFLSMLPPWHAYERA EYFIF+ G EQVYTTV NLK
Sbjct  332   MLTHRNLLHQIKNLWDTVPAEVGDRFLSMLPPWHAYERACEYFIFTCGIEQVYTTVRNLK  391

Query  1436  EDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYE--  1263
             +DL RYQP Y+ISVPLV+ETLYSGI KQI+TS P RKL+AL F+++S AY E KRIYE  
Sbjct  392   DDLGRYQPHYMISVPLVFETLYSGIQKQISTSPPVRKLVALTFIRVSLAYMEYKRIYEVT  451

Query  1262  --GKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisg  1089
               GKCLT++ KQPS + S+LD LWAR IA +L P+HLLA K VYSKIHS+IG+SKAGISG
Sbjct  452   LVGKCLTRNVKQPSIVNSMLDCLWARIIATILFPIHLLAIKFVYSKIHSAIGLSKAGISG  511

Query  1088  ggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAE  909
             GGSL   VDKFFEAI +K+QNGYGLTE++PV+A RRP CNV+GS+G P++HTE KVVD+E
Sbjct  512   GGSLPLEVDKFFEAIGVKVQNGYGLTETSPVIAARRPRCNVIGSVGHPVQHTEFKVVDSE  571

Query  908   TDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRN  729
             T + L PGSKGI+K +GP VM GYYKNP AT QA+D++GWLNTGDLGWI P+HS GRSRN
Sbjct  572   TGEVLPPGSKGILKVRGPPVMNGYYKNPLATNQALDKDGWLNTGDLGWIAPHHSTGRSRN  631

Query  728   SSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKE  549
             SSG IV++GRAKDTIVLS+GENVEP+E+EEAAM S++IQQIVVIGQDKRRLGA+++P+ E
Sbjct  632   SSGVIVVDGRAKDTIVLSTGENVEPAELEEAAMRSSIIQQIVVIGQDKRRLGAIIVPNSE  691

Query  548   EVLLAAKKLSVVDSDATE-VSEEKTSKLIHEELQ-----------------------KWT  441
             EVL  A++LS++DS ++  VSEEK   LI++EL+                        WT
Sbjct  692   EVLKVARELSIIDSISSNVVSEEKVLNLIYKELKTCDRVIGTKYPPALPMSTTAMFTNWT  751

Query  440   T----------------GCT--------FQIGPILLINEPFTIDNGLLTPTMKVRRDKVT  333
             +                 C+        FQIGPILL+NEPFTIDNGL+TPTMK+RRD+V 
Sbjct  752   SFLNSDLDVFAFISFFLSCSTYRMSESPFQIGPILLVNEPFTIDNGLMTPTMKIRRDRVV  811

Query  332   DLYKEQIEDLYK  297
               YKEQI+DLYK
Sbjct  812   AKYKEQIDDLYK  823



>ref|XP_010512892.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
isoform X1 [Camelina sativa]
Length=725

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/679 (66%), Positives = 543/679 (80%), Gaps = 6/679 (1%)
 Frame = -3

Query  2321  VFCEST--GMQIRKCSPilesill-sgngllssEWKTVPDIWKTAAEEFGNCIALVDPYH  2151
             V CEST    ++R+CSP LE         L S+EWK VPDIW+++ E++G+ +A+VDPYH
Sbjct  49    VSCESTIQEKELRRCSPFLERSSFPKEAALRSNEWKAVPDIWRSSVEKYGDRVAVVDPYH  108

Query  2150  NPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVR  1971
             +PP+  ++++LE+EI+ F EGLRV+G+K DEKIALFADNSCRWLVADQGI+  GAINVVR
Sbjct  109   DPPSTFTYRQLEQEILDFVEGLRVVGVKADEKIALFADNSCRWLVADQGIIAAGAINVVR  168

Query  1970  GSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVM  1791
             GSRSSVEELLQIY HSESVAL VDNPE ++RIA +F   A  RF+ILLWG+KSS+ + V 
Sbjct  169   GSRSSVEELLQIYCHSESVALVVDNPEFFNRIAASFSYKAPPRFVILLWGDKSSLVT-VG  227

Query  1790  DGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVML  1611
                P+YSYNEI   G E       S +A  +Y YE IN DD AT++YTSGTTGNPKGVML
Sbjct  228   RQTPVYSYNEIKRFGQERRAKFARSNDA-ERYEYEFINPDDTATIMYTSGTTGNPKGVML  286

Query  1610  THENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKED  1431
             TH+NLLHQI NL D VP   G+RFLSMLP WHAYERA EYFIF+ G EQ YT++  LK+D
Sbjct  287   THQNLLHQIRNLSDFVPAEAGERFLSMLPSWHAYERACEYFIFTCGVEQKYTSIRFLKDD  346

Query  1430  LKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCL  1251
             LK+YQP YLISVPLVYETLYSGI KQI+TSSPARK +AL  +K+S AY E +RI EG CL
Sbjct  347   LKQYQPHYLISVPLVYETLYSGIQKQISTSSPARKFLALTLIKVSLAYMEMRRISEGLCL  406

Query  1250  TKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslss  1071
             TK+QK P Y+ S++DWLWAR +A +L PLH+LA KLV+ KI SS+GI+KAG+SGGGSL  
Sbjct  407   TKNQKPPMYIASLVDWLWARVVAFVLLPLHMLAEKLVHRKIRSSVGITKAGVSGGGSLPM  466

Query  1070  HVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALS  891
             HVDKFFEAI + +QNGYGLTE++PVV+ RR NCNVLGS+G PI+ TE K+VD ET   L 
Sbjct  467   HVDKFFEAIGVNVQNGYGLTETSPVVSARRLNCNVLGSVGHPIKDTEFKIVDPETGSVLP  526

Query  890   PGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIV  711
             PGSKGIVK +GP VMKGYYKNP ATKQ IDE+GW N+GD+GWI P HS GRSR+  G IV
Sbjct  527   PGSKGIVKVRGPPVMKGYYKNPLATKQVIDEDGWFNSGDMGWITPQHSAGRSRSCGGVIV  586

Query  710   LEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAA  531
             LEGRAKDTIVL +GENVEP EIEEAAM SNLIQQIVVIGQD+RRLGA+++P+KE    A+
Sbjct  587   LEGRAKDTIVLLTGENVEPLEIEEAAMRSNLIQQIVVIGQDQRRLGAIIIPNKEAAEGAS  646

Query  530   K-KLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMK  354
             K K+S +D +  E+S+E  + +++EEL+KWT+ C+FQ+GP+L+++EPFTIDNGL+TPTMK
Sbjct  647   KQKISPLDPEVNELSKETITSMVYEELRKWTSQCSFQVGPVLIVDEPFTIDNGLMTPTMK  706

Query  353   VRRDKVTDLYKEQIEDLYK  297
             +RRDKV D YK +IE LYK
Sbjct  707   IRRDKVVDQYKNEIERLYK  725



>ref|XP_006418838.1| hypothetical protein EUTSA_v10002419mg [Eutrema salsugineum]
 gb|ESQ37274.1| hypothetical protein EUTSA_v10002419mg [Eutrema salsugineum]
Length=721

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/685 (65%), Positives = 546/685 (80%), Gaps = 6/685 (1%)
 Frame = -3

Query  2342  STSRKFRVFCEST--GMQIRKCSPilesillsgngllssEWKTVPDIWKTAAEEFGNCIA  2169
             S+ R  R+ CEST    ++R+CSP LE   L      +  WK V DIW+++AE+FG+ +A
Sbjct  40    SSRRISRLRCESTVQEKELRRCSPFLERSSLPAALRSNE-WKAVSDIWRSSAEKFGDRVA  98

Query  2168  LVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTG  1989
             ++DPYH+PP+  ++K+LE+EI+ F EGLR +G K DEKIALFADNSCRWLVADQGIM TG
Sbjct  99    VIDPYHDPPSTFTYKQLEEEILDFVEGLRAVGGKADEKIALFADNSCRWLVADQGIMATG  158

Query  1988  AINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSS  1809
             A+NVVRGSRSSVEELLQIY HSESVAL VDNPE ++RIAE F   A +RF+ILLWG+KSS
Sbjct  159   AVNVVRGSRSSVEELLQIYCHSESVALVVDNPEFFNRIAEPFTYKAPLRFVILLWGDKSS  218

Query  1808  ITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGN  1629
             + +      P+YSYNEI  LG E       S++A  +Y YE I+ DD AT++YTSGTTGN
Sbjct  219   LVT-TNRQTPVYSYNEIKKLGQERRAKFAGSKDA-GKYEYEFIDPDDTATIMYTSGTTGN  276

Query  1628  PKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTV  1449
             PKGVMLTH+NLLHQI NL + VP   G+RFLSMLP WHAYERA EYFIF+ G EQ YT++
Sbjct  277   PKGVMLTHQNLLHQIKNLSEFVPAKAGERFLSMLPSWHAYERACEYFIFTCGVEQKYTSI  336

Query  1448  INLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRI  1269
               LK+DLKRYQP YLISVPLVYETLYSGI KQI+TSS  RK +AL  +KIS AY E +RI
Sbjct  337   RFLKDDLKRYQPHYLISVPLVYETLYSGIQKQISTSSATRKFLALTLIKISLAYMEMRRI  396

Query  1268  YEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisg  1089
             YEG CLTK++K P Y+VS++DWLWAR  A +L PLH+LA KLV+ KI SSIGISKAG+SG
Sbjct  397   YEGLCLTKNEKPPMYIVSLVDWLWARVAAFVLWPLHMLAEKLVHQKIRSSIGISKAGVSG  456

Query  1088  ggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAE  909
             GGSL  HVDKFFEAI + +QNGYGLTE++PV++ RR  CNVLG++G PI+ TE K+VD E
Sbjct  457   GGSLPMHVDKFFEAIGVNVQNGYGLTETSPVISARRLRCNVLGTVGHPIKDTEFKIVDNE  516

Query  908   TDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRN  729
             T   L PGSKGIVK +GP VMKGYYKNP ATKQ IDE+GWLNTGD+GWI P+HS GRSR+
Sbjct  517   TGTVLPPGSKGIVKVRGPPVMKGYYKNPLATKQVIDEDGWLNTGDMGWIAPHHSTGRSRS  576

Query  728   SSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKE  549
               G IVLEGRAKDTIVLS+GENVEP EIEEAAM SNLI QIVVIGQD+RRLGA+V+P+KE
Sbjct  577   CGGVIVLEGRAKDTIVLSTGENVEPLEIEEAAMRSNLIHQIVVIGQDQRRLGAIVIPNKE  636

Query  548   EVLLAAK-KLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGL  372
                 AAK K+S VD +  E+S+E  + +++EEL+KWT+ C+FQ+GP+L+++EPFTIDNG 
Sbjct  637   VAEGAAKQKISPVDPEVNELSKETITSMVYEELRKWTSECSFQVGPVLIVDEPFTIDNGF  696

Query  371   LTPTMKVRRDKVTDLYKEQIEDLYK  297
             +TPTMK+RRDKV D YK++I+ LYK
Sbjct  697   MTPTMKIRRDKVVDQYKDEIDRLYK  721



>ref|XP_006830562.1| hypothetical protein AMTR_s00117p00114400 [Amborella trichopoda]
 gb|ERM97978.1| hypothetical protein AMTR_s00117p00114400 [Amborella trichopoda]
Length=707

 Score =   877 bits (2267),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/668 (68%), Positives = 545/668 (82%), Gaps = 2/668 (0%)
 Frame = -3

Query  2300  MQIRKCSPilesillsgngllssEWKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKE  2121
             + ++KCSP+LES LLSG+  L+  WK VPDIWK++A+++G+ +ALVDPYH+PP+ +++K+
Sbjct  42    LHVKKCSPLLESTLLSGSNFLTPTWKAVPDIWKSSADKYGDQVALVDPYHDPPSKMTYKQ  101

Query  2120  LEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELL  1941
             LE+EI++FAEGLRV G+ PDEKIALFADNSCRWLVADQG M TGAINVVRGSRSSVEELL
Sbjct  102   LEQEILNFAEGLRVAGIFPDEKIALFADNSCRWLVADQGTMATGAINVVRGSRSSVEELL  161

Query  1940  QIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNE  1761
             QIY HSESVAL VDNP+++++IA T  S A +RF++LLWGEKSS  S++MDG  +YSY E
Sbjct  162   QIYTHSESVALIVDNPDLFNKIARTLSSRAMMRFVVLLWGEKSSCDSQLMDGMQLYSYKE  221

Query  1760  IIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQIL  1581
             II+LG +S   LL S +  H + Y  IN  D+ATLVYTSGTTG PKGVMLTH+NLLHQI 
Sbjct  222   IINLGQKSR-GLLASYKG-HSHGYVAINPKDIATLVYTSGTTGVPKGVMLTHQNLLHQIK  279

Query  1580  NLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLI  1401
             NLWD VP +PGDRFLSMLPPWH YERAAEYFIF+ G EQVYTTV NLKEDL+RYQP YLI
Sbjct  280   NLWDIVPTIPGDRFLSMLPPWHVYERAAEYFIFTCGIEQVYTTVKNLKEDLQRYQPHYLI  339

Query  1400  SVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYL  1221
             SVPLVYETLY GI KQI+ SS ARK +A   + IS  + E KRIYEGK L++   Q S L
Sbjct  340   SVPLVYETLYGGIQKQISVSSRARKTVAYALINISLTFMEFKRIYEGKALSQVHIQHSAL  399

Query  1220  VSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAID  1041
             VS  DWLWAR +AA L PLHLLA  LVYSKIHSSIGISKAGISGGGS+  HVDKFFEAI 
Sbjct  400   VSFFDWLWARTVAAFLWPLHLLAVTLVYSKIHSSIGISKAGISGGGSMPLHVDKFFEAIG  459

Query  1040  IKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAK  861
             I LQNGYGLTES+PVVA R P+CNVLG++GPP+ +TEIKVVD ETD AL  GSKGIVK +
Sbjct  460   INLQNGYGLTESSPVVAARLPDCNVLGTVGPPLPYTEIKVVDPETDVALPDGSKGIVKVR  519

Query  860   GPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIV  681
             GPQVMKGYYKNP +T++ +D+  WLNTGD+GWI P +S GRSR   G ++LEGRAKDTIV
Sbjct  520   GPQVMKGYYKNPTSTREVLDDESWLNTGDIGWIAPRNSTGRSRRCGGLLILEGRAKDTIV  579

Query  680   LSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDA  501
             L++GENVEPS IEEAA+ S+LI QIVVIGQD+RRLGAL++P+K+E+LL A+KL   +   
Sbjct  580   LTTGENVEPSVIEEAALQSSLIHQIVVIGQDQRRLGALIVPNKDELLLVARKLLKSNDPD  639

Query  500   TEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYK  321
                S+E  + +I +EL+ WT+ C+FQIGP LL+ EP TID+GLLTPTMK+RRDKV D ++
Sbjct  640   VGPSKELLNSVIRDELKHWTSDCSFQIGPFLLLEEPLTIDSGLLTPTMKIRRDKVMDRFR  699

Query  320   EQIEDLYK  297
             ++I  LY+
Sbjct  700   DEISKLYR  707



>ref|XP_010532730.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=764

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/721 (63%), Positives = 569/721 (79%), Gaps = 31/721 (4%)
 Frame = -3

Query  2393  MSCRGFIKMKWQLNSRGSTSRKFRVFCESTGMQIRKCSPilesillsg-ngllssEWKTV  2217
             + CRGF     +     S+ R+FR+ C+S   ++R+CSP+LE   LSG   L SSEWK V
Sbjct  53    LGCRGF-----RPGFGISSYRRFRIHCDSKEKEVRRCSPLLERSALSGGVALSSSEWKAV  107

Query  2216  PDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFAD  2037
             PDIW+++AE++G+ +ALVDPYH+PP+NL++K+LE+EI+ FAEGLR++G+KPDEKIALFAD
Sbjct  108   PDIWRSSAEKYGDRVALVDPYHDPPSNLTYKQLEQEILDFAEGLRIVGVKPDEKIALFAD  167

Query  2036  NSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHS  1857
             NSCRWLV DQGIM TGA+NVVRGSRSSVEELLQIY+HSESVAL VDNPE ++RI++ F +
Sbjct  168   NSCRWLVTDQGIMATGAVNVVRGSRSSVEELLQIYSHSESVALVVDNPEFFNRISKKFST  227

Query  1856  HADVRFIILLWGEKSSITSEVMDG--RPIYSYNEIIDLGNESHMALLHSQEARHQYTYEP  1683
                 RF+ILLWGEKSS+   VM+G   P+YSY EII+   E     L S +   +Y YE 
Sbjct  228   KVSPRFVILLWGEKSSL---VMEGIRSPVYSYTEIINFRREKLRNPLGSDDD-GKYEYEF  283

Query  1682  INSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVP----------------  1551
             IN DD A ++YTSGTTGNPKGVMLTH NLLHQI NL++ VP  P                
Sbjct  284   INPDDTAAIMYTSGTTGNPKGVMLTHRNLLHQINNLFEIVPAEPTAKELLAKHRDXXXXE  343

Query  1550  -GDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETL  1374
              GDRFLSMLP WHAYER+ EYFIF+ G EQ+YT++  LK+DLKRYQP YLISVPLVYETL
Sbjct  344   PGDRFLSMLPSWHAYERSCEYFIFTHGVEQMYTSIRYLKDDLKRYQPHYLISVPLVYETL  403

Query  1373  YSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWA  1194
             YSGI KQI+TSS ARK +AL  +KIS AY E +RIYEG CLTK+Q  P YL+S++DWL A
Sbjct  404   YSGIQKQISTSSAARKFVALTLIKISLAYMEMRRIYEGVCLTKNQNPPPYLISLVDWLIA  463

Query  1193  RAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGL  1014
             R  AA+L PLH+LA++ VY KI SSIGISKAGISGGGSL  HVDKFFEA+ + +QNGYGL
Sbjct  464   RVAAAILWPLHMLAKRFVYRKILSSIGISKAGISGGGSLPMHVDKFFEAVGVNVQNGYGL  523

Query  1013  TESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYY  834
             TE++PV++ RR +CNVLGS+G PI+ TE KVVD+ET+  L PGSKGIVK +GPQVMKGYY
Sbjct  524   TETSPVISARRLSCNVLGSVGHPIQDTEFKVVDSETNNVLPPGSKGIVKVRGPQVMKGYY  583

Query  833   KNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEP  654
             KNP ATKQ +DE+GW +TGD+GWI P+H IGRS +  G IVLEGRAKDTIVLS+GENVEP
Sbjct  584   KNPLATKQVLDEDGWFDTGDMGWIAPHHLIGRSCSCGGVIVLEGRAKDTIVLSTGENVEP  643

Query  653   SEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAK-KLSVVDSDATE-VSEEK  480
              EIEEAA+ S+LIQQIVVIGQD+RR+GA+++P+KEE  +A K   S  D  A+E +S+EK
Sbjct  644   LEIEEAALRSSLIQQIVVIGQDQRRIGAIIVPNKEEADIAPKNNNSDTDPGASELISKEK  703

Query  479   TSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
              + +++EEL+KWT+ C++Q+GP+L+++EPFTIDNGL+TPTMK+RRDKV   YK++I  LY
Sbjct  704   LTSMVYEELRKWTSECSYQVGPVLIVDEPFTIDNGLMTPTMKIRRDKVVKKYKDEIAKLY  763

Query  299   K  297
             K
Sbjct  764   K  764



>ref|XP_009373571.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=690

 Score =   876 bits (2264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/681 (67%), Positives = 565/681 (83%), Gaps = 7/681 (1%)
 Frame = -3

Query  2330  KFRVFCESTGMQIRKCSP-ilesillsgngllssEWKTVPDIWKTAAEEFGNCIALVDPY  2154
             K +   ++   QIR+ SP +   +L   +   S +WK VPDIW+++A ++G+ +ALVDP+
Sbjct  14    KKKTMLQTEEKQIRRHSPFLERVLLDDSDASESDKWKAVPDIWRSSAAKYGDLVALVDPF  73

Query  2153  HNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVV  1974
             H+PP+++++K+LE+EI+ FAEG+RV+G+KPDEKIALFADNSCRWLVADQGIM TGAINVV
Sbjct  74    HDPPSSITYKQLEQEILDFAEGMRVVGVKPDEKIALFADNSCRWLVADQGIMATGAINVV  133

Query  1973  RGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEV  1794
             RGSRSSVEELLQIYNHS+SVALAVD+PE+++RI+E F S A ++FI+LLWGEKSS+ +E 
Sbjct  134   RGSRSSVEELLQIYNHSDSVALAVDSPELFNRISEEFCSKA-MKFIVLLWGEKSSLKNE-  191

Query  1793  MDGR-PIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGV  1617
               G+ PI+ Y EI+DLG ES  +LL S + +   TYE I SDDVATLVYTSGT+GNPKGV
Sbjct  192   --GKVPIFDYKEILDLGRESRKSLLDSDDKQQSDTYEVIKSDDVATLVYTSGTSGNPKGV  249

Query  1616  MLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLK  1437
             MLTH NLLHQI NLWD VP V GD+FLSMLPPWH YERA EYF F+ G EQ YT+V  +K
Sbjct  250   MLTHRNLLHQIKNLWDAVPCVGGDKFLSMLPPWHCYERACEYFAFTCGVEQFYTSVRKMK  309

Query  1436  EDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGK  1257
             +DL++YQP Y+ISVPLVYE+LYSGI KQI+++S  RKLIAL F++IS AY E KRIYEGK
Sbjct  310   DDLRKYQPTYIISVPLVYESLYSGIQKQISSASTVRKLIALTFIRISMAYMEFKRIYEGK  369

Query  1256  CLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggsl  1077
              LT++ KQ SYLVSV DWLWAR IAA L PLH+L +KLVYSKI S+IGISKAGISGGG L
Sbjct  370   YLTRNPKQSSYLVSVADWLWARIIAAFLWPLHVLGKKLVYSKIQSAIGISKAGISGGGCL  429

Query  1076  ssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKA  897
              SHVDKFFEAID+KL NGYGLTE++PVVA RR N NV+GS+G PIRHTE KVVD+ET + 
Sbjct  430   PSHVDKFFEAIDMKLLNGYGLTETSPVVASRRLNFNVIGSVGLPIRHTEFKVVDSETGEV  489

Query  896   LSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGF  717
             LSPG  GI+K +GPQVMKGYYKNP  TK+A+D++GWL+TGD+GWI P+HSIGRSR   G 
Sbjct  490   LSPGLSGILKVRGPQVMKGYYKNPGTTKKALDDDGWLDTGDIGWIAPHHSIGRSRCCGGV  549

Query  716   IVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPH-KEEVL  540
             +VLEGRAKDTIVL +GENVEP EIEEAA+ S+LIQQIVVIGQD+RRLGA+V+P+ +E +L
Sbjct  550   VVLEGRAKDTIVLLTGENVEPVEIEEAALRSSLIQQIVVIGQDQRRLGAIVVPNKEEALL  609

Query  539   LAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPT  360
              A K  +V  +DA+ +S ++ + L++EEL+KWT+GC+FQIGPI++  EPFTID+GL+TPT
Sbjct  610   AAKKLAAVDAADASSLSNDRLTSLVYEELRKWTSGCSFQIGPIIIAEEPFTIDSGLMTPT  669

Query  359   MKVRRDKVTDLYKEQIEDLYK  297
             MK+RRD+V   YKEQI++L+K
Sbjct  670   MKIRRDRVVAQYKEQIDNLFK  690



>ref|XP_008794653.1| PREDICTED: LOW QUALITY PROTEIN: probable acyl-activating enzyme 
16, chloroplastic [Phoenix dactylifera]
Length=734

 Score =   875 bits (2261),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/687 (66%), Positives = 546/687 (79%), Gaps = 4/687 (1%)
 Frame = -3

Query  2348  RGSTSRKFRVFC--ESTGMQIRKCSPilesill-sgngllssEWKTVPDIWKTAAEEFGN  2178
             R S  R+ RV C  E      R+CSP LES LL S N L   EWK VPDIWK+ AE++G+
Sbjct  45    RPSRVREVRVLCNLELEHPVRRRCSPFLESALLPSANNLTLDEWKAVPDIWKSTAEKYGD  104

Query  2177  CIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIM  1998
              +ALVDPYH PP+ L++K+LE+EI++FAEGLRV+G+ PDEK+ALFADNSCRWL+ADQGIM
Sbjct  105   RVALVDPYHEPPSKLTYKQLEQEILNFAEGLRVLGVIPDEKLALFADNSCRWLIADQGIM  164

Query  1997  TTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGE  1818
              TGAINVVRG+RSS +EL QIY HSESVAL VD+P+   R+AE+    A VRFI+LLWGE
Sbjct  165   ATGAINVVRGTRSSDDELFQIYKHSESVALVVDSPQFLDRLAESLIPKAVVRFIVLLWGE  224

Query  1817  KSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGT  1638
             KS +  + +   P+Y Y EII+LG ESH  LL S +    Y  E I  +DVA L+YTSGT
Sbjct  225   KSCLNGKAVKDIPLYDYREIIELGRESHHTLLQSWKQGQNYACETIGPEDVAALMYTSGT  284

Query  1637  TGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVY  1458
             +G PKGVMLTH+NLLHQI NLWD VP   GDRFLSMLPPWHAYERA EYFIF+ G EQVY
Sbjct  285   SGTPKGVMLTHQNLLHQIRNLWDVVPAEAGDRFLSMLPPWHAYERACEYFIFTYGIEQVY  344

Query  1457  TTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEA  1278
             T V NLK+DL+RYQP YLISVPLVYETLY  I KQI++SS ARKL+AL  + IS  Y EA
Sbjct  345   TNVKNLKDDLQRYQPHYLISVPLVYETLYRSINKQISSSSAARKLVALTLINISLLYMEA  404

Query  1277  KRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskag  1098
             KRIYEG+ + +   Q S ++ ++DWL  R +AALL PLH L  KLVY KIHS+IGISKAG
Sbjct  405   KRIYEGRVIAEKHGQKSSIIVLIDWLLGRIVAALLWPLHNLGMKLVYGKIHSAIGISKAG  464

Query  1097  isgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVV  918
             ISGGGSL  ++D+FFEAI +K+QNGYGLTE++PVVA RRP+CNVLG++G P+++TEIK+V
Sbjct  465   ISGGGSLPMYIDRFFEAIGVKVQNGYGLTETSPVVAARRPDCNVLGTVGHPLKYTEIKIV  524

Query  917   DAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGR  738
             DAET   L  GSKGIVK +GPQVMKGYYKNP  T++A+DE GW NTGD+GWIVP HS GR
Sbjct  525   DAETGNILPYGSKGIVKIRGPQVMKGYYKNPSTTREALDEEGWFNTGDIGWIVPKHSTGR  584

Query  737   SRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLP  558
             SR   G +VLEGRAKDTIVLS+GENVEP+E+E AAM SNLIQQIVVIGQD+RRLGAL++P
Sbjct  585   SRKCGGMLVLEGRAKDTIVLSTGENVEPAELEAAAMRSNLIQQIVVIGQDQRRLGALIVP  644

Query  557   HKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDN  378
             +K+E+L  AKKLS +D + +E+S++K   L+++E++ WT GC+FQIGPIL+++EPFTIDN
Sbjct  645   NKDELLAVAKKLSFID-ETSELSKKKMMSLLYDEVKTWTAGCSFQIGPILIVDEPFTIDN  703

Query  377   GLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             GL+T TMKVRRDKV   Y EQI DLYK
Sbjct  704   GLMTATMKVRRDKVAAKYSEQITDLYK  730



>ref|XP_009135864.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
isoform X2 [Brassica rapa]
Length=724

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/685 (64%), Positives = 548/685 (80%), Gaps = 9/685 (1%)
 Frame = -3

Query  2330  KFRVFCESTGMQ--IRKCSPilesill----sgngllssEWKTVPDIWKTAAEEFGNCIA  2169
             +FRV CEST  +  + +CSP LE + +    +   L S+EWK VPDIW+++AE++G+ +A
Sbjct  42    RFRVHCESTVQEKELGRCSPFLERLTVPGGDAAAALRSNEWKAVPDIWRSSAEKYGDRVA  101

Query  2168  LVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTG  1989
             +VDPYH+PP+  ++++LE+EI+ F EGLR +G+K DEKIALFADNSCRWLVADQGIM TG
Sbjct  102   VVDPYHDPPSTFTYRQLEQEILDFVEGLRAVGVKADEKIALFADNSCRWLVADQGIMATG  161

Query  1988  AINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSS  1809
             A+NVVRGSRSSVEELL IY HS+SV L VDNPE ++RIA+TF   A ++F+ILLWG+KSS
Sbjct  162   AVNVVRGSRSSVEELLHIYCHSDSVGLVVDNPEFFNRIADTFSYKASLKFVILLWGDKSS  221

Query  1808  ITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGN  1629
             + +      P+YSYNEI +LG E       S +A  +Y YE I  DD AT++YTSGTTGN
Sbjct  222   LATSSRQ-TPVYSYNEIKNLGQERRAEHAGSNDA-GKYEYEFIGPDDTATIMYTSGTTGN  279

Query  1628  PKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTV  1449
             PKGVMLTH+NLLHQI NL + VP   G+RFLSMLP WHAYERA EYFIF+ G EQ YT++
Sbjct  280   PKGVMLTHQNLLHQIRNLSEFVPAKAGERFLSMLPSWHAYERACEYFIFTCGVEQKYTSI  339

Query  1448  INLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRI  1269
               LK+DLKRYQP YLISVPLVYETLYSGI KQI+TSSP RK +AL  ++IS AY E +R+
Sbjct  340   RFLKDDLKRYQPHYLISVPLVYETLYSGIQKQISTSSPVRKFLALSLIRISLAYTEMRRV  399

Query  1268  YEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisg  1089
             YEG CLTK+QK P Y+V+++DWLWAR +A +L PLH+LA KLV+ KI SSIGI+KAG+SG
Sbjct  400   YEGLCLTKNQKPPVYIVALVDWLWARVVAFVLWPLHMLAEKLVHKKIRSSIGITKAGVSG  459

Query  1088  ggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAE  909
             GGSL  H+DKFFEAI + +QNGYGLTE++PVV+ RR +CNVLGS+G PI+ TE K+VD E
Sbjct  460   GGSLPMHIDKFFEAIGVNVQNGYGLTETSPVVSARRISCNVLGSVGHPIKDTEFKIVDQE  519

Query  908   TDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRN  729
             T   L PGSKGIVK +GP VM+GYYKNP ATKQ ID++GW NTGD+GWI P+HS GR R+
Sbjct  520   TGNVLPPGSKGIVKVRGPPVMRGYYKNPMATKQVIDDDGWFNTGDMGWIAPHHSTGRRRS  579

Query  728   SSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKE  549
               G IVLEGRAKDTIVLS+GENVEP EIEEAA+ S+LIQQIVVIGQD+RRLGA+V+P+KE
Sbjct  580   CGGVIVLEGRAKDTIVLSTGENVEPLEIEEAALRSSLIQQIVVIGQDQRRLGAIVIPNKE  639

Query  548   EVLLAAK-KLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGL  372
                  AK K+S VD +  E+S+E  + +++EEL+KWT+ C+FQ+GP+L++ EPFTIDNG 
Sbjct  640   AAEGVAKNKISAVDPEVNELSKETLTSMVYEELRKWTSECSFQVGPVLIVEEPFTIDNGF  699

Query  371   LTPTMKVRRDKVTDLYKEQIEDLYK  297
             +TPTMK+RRDKV D YK++I  LYK
Sbjct  700   MTPTMKIRRDKVVDRYKDEIARLYK  724



>gb|AAM28628.1|AF503770_1 acyl-CoA synthetase-like protein [Arabidopsis thaliana]
Length=709

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/695 (64%), Positives = 552/695 (79%), Gaps = 13/695 (2%)
 Frame = -3

Query  2381  GFIKMKWQLNSRGSTSRKFRVFCESTGMQIRKCSPilesills-gngllssEWKTVPDIW  2205
             GF  +    + R  + R+FRV CES   +++  SP LES   S    L SSEWK VPDIW
Sbjct  26    GFRLISGHESVRIPSFRRFRVHCESKEKEVKPSSPFLESSSFSGDAALRSSEWKAVPDIW  85

Query  2204  KTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCR  2025
             +++AE++G+ +ALVDPYH+PP  L++K+LE+EI+ FAEGLRV+G+K DEKIALFADNSCR
Sbjct  86    RSSAEKYGDRVALVDPYHDPPLKLTYKQLEQEILDFAEGLRVLGVKADEKIALFADNSCR  145

Query  2024  WLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADV  1845
             WLV+DQGIM TGA+NVVRGSRSSVEELLQIY HSESVA+ VDNPE ++RIAE+F S A +
Sbjct  146   WLVSDQGIMATGAVNVVRGSRSSVEELLQIYRHSESVAIVVDNPEFFNRIAESFTSKASL  205

Query  1844  RFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDV  1665
             RF+ILLWGEKSS+ ++ M   P+YSY EII+ G ES   L  S + R  Y  + I+SDD 
Sbjct  206   RFLILLWGEKSSLVTQGMQ-IPVYSYAEIINQGQESRAKLSASNDTR-SYRNQFIDSDDT  263

Query  1664  ATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFI  1485
             A ++YTSGTTGNPKGVMLTH NLLHQI +L   VP + GD+FLSMLP WHAYERA+EYFI
Sbjct  264   AAIMYTSGTTGNPKGVMLTHRNLLHQIKHLSKYVPALAGDKFLSMLPSWHAYERASEYFI  323

Query  1484  FSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFL  1305
             F+ G EQ+YT++  LK+DLKRYQP Y++SVPLVYETLYSGI KQI+ SS  RK +AL  +
Sbjct  324   FTCGVEQMYTSIRYLKDDLKRYQPNYIVSVPLVYETLYSGIQKQISASSAGRKFLALTLI  383

Query  1304  KISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskih  1125
             K+S AY E KRIYEG CLTK+QK P Y+V+ +DWLWAR IAALL PLH+LA+KL+Y KIH
Sbjct  384   KVSMAYMEMKRIYEGMCLTKEQKPPMYIVAFVDWLWARVIAALLWPLHMLAKKLIYKKIH  443

Query  1124  ssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPP  945
             SSIGISKAGISGGGSL  HVDKFFEAI + LQNGYGLTE++PVV  R  +CNVLGS G P
Sbjct  444   SSIGISKAGISGGGSLPIHVDKFFEAIGVILQNGYGLTETSPVVCARTLSCNVLGSAGHP  503

Query  944   IRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGW  765
             +  TE K+VD ET+  L PGSKGI+K +GPQVMKGYYKNP  TKQ ++E+GW NTGD GW
Sbjct  504   MHGTEFKIVDPETNNVLPPGSKGIIKVRGPQVMKGYYKNPSTTKQVLNESGWFNTGDTGW  563

Query  764   IVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDK  585
             I P+HS GRSR+ +G IVLEGRAKDTIVLS+GENVEP EIEEAAM S +I+QIVVIGQD+
Sbjct  564   IAPHHSKGRSRHCAGVIVLEGRAKDTIVLSTGENVEPLEIEEAAMRSRVIEQIVVIGQDR  623

Query  584   RRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILL  405
             RRLGA+++P+KEE    A+++        E S+E    L+++EL+KWT+ C+FQ+GP+L+
Sbjct  624   RRLGAIIIPNKEE----AQRVD------PETSKETLKSLVYQELRKWTSECSFQVGPVLI  673

Query  404   INEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             +++PFTIDNGL+TPTMK+RRD V   YKE+I+ LY
Sbjct  674   VDDPFTIDNGLMTPTMKIRRDMVVAKYKEEIDQLY  708



>ref|XP_009135863.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
isoform X1 [Brassica rapa]
Length=730

 Score =   865 bits (2236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/691 (63%), Positives = 548/691 (79%), Gaps = 15/691 (2%)
 Frame = -3

Query  2330  KFRVFCESTGMQ--IRKCSPilesill----sgngllssEWKTVPDIWKTAAEEFGNCIA  2169
             +FRV CEST  +  + +CSP LE + +    +   L S+EWK VPDIW+++AE++G+ +A
Sbjct  42    RFRVHCESTVQEKELGRCSPFLERLTVPGGDAAAALRSNEWKAVPDIWRSSAEKYGDRVA  101

Query  2168  LVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTG  1989
             +VDPYH+PP+  ++++LE+EI+ F EGLR +G+K DEKIALFADNSCRWLVADQGIM TG
Sbjct  102   VVDPYHDPPSTFTYRQLEQEILDFVEGLRAVGVKADEKIALFADNSCRWLVADQGIMATG  161

Query  1988  AINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSS  1809
             A+NVVRGSRSSVEELL IY HS+SV L VDNPE ++RIA+TF   A ++F+ILLWG+KSS
Sbjct  162   AVNVVRGSRSSVEELLHIYCHSDSVGLVVDNPEFFNRIADTFSYKASLKFVILLWGDKSS  221

Query  1808  ITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGN  1629
             + +      P+YSYNEI +LG E       S +A  +Y YE I  DD AT++YTSGTTGN
Sbjct  222   LATSSRQ-TPVYSYNEIKNLGQERRAEHAGSNDA-GKYEYEFIGPDDTATIMYTSGTTGN  279

Query  1628  PKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTV  1449
             PKGVMLTH+NLLHQI NL + VP   G+RFLSMLP WHAYERA EYFIF+ G EQ YT++
Sbjct  280   PKGVMLTHQNLLHQIRNLSEFVPAKAGERFLSMLPSWHAYERACEYFIFTCGVEQKYTSI  339

Query  1448  INLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRI  1269
               LK+DLKRYQP YLISVPLVYETLYSGI KQI+TSSP RK +AL  ++IS AY E +R+
Sbjct  340   RFLKDDLKRYQPHYLISVPLVYETLYSGIQKQISTSSPVRKFLALSLIRISLAYTEMRRV  399

Query  1268  YEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisg  1089
             YEG CLTK+QK P Y+V+++DWLWAR +A +L PLH+LA KLV+ KI SSIGI+KAG+SG
Sbjct  400   YEGLCLTKNQKPPVYIVALVDWLWARVVAFVLWPLHMLAEKLVHKKIRSSIGITKAGVSG  459

Query  1088  ggslssHVDKFFE------AIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEI  927
             GGSL  H+DKFFE      AI + +QNGYGLTE++PVV+ RR +CNVLGS+G PI+ TE 
Sbjct  460   GGSLPMHIDKFFESLFLVQAIGVNVQNGYGLTETSPVVSARRISCNVLGSVGHPIKDTEF  519

Query  926   KVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHS  747
             K+VD ET   L PGSKGIVK +GP VM+GYYKNP ATKQ ID++GW NTGD+GWI P+HS
Sbjct  520   KIVDQETGNVLPPGSKGIVKVRGPPVMRGYYKNPMATKQVIDDDGWFNTGDMGWIAPHHS  579

Query  746   IGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGAL  567
              GR R+  G IVLEGRAKDTIVLS+GENVEP EIEEAA+ S+LIQQIVVIGQD+RRLGA+
Sbjct  580   TGRRRSCGGVIVLEGRAKDTIVLSTGENVEPLEIEEAALRSSLIQQIVVIGQDQRRLGAI  639

Query  566   VLPHKEEVLLAAK-KLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPF  390
             V+P+KE     AK K+S VD +  E+S+E  + +++EEL+KWT+ C+FQ+GP+L++ EPF
Sbjct  640   VIPNKEAAEGVAKNKISAVDPEVNELSKETLTSMVYEELRKWTSECSFQVGPVLIVEEPF  699

Query  389   TIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             TIDNG +TPTMK+RRDKV D YK++I  LYK
Sbjct  700   TIDNGFMTPTMKIRRDKVVDRYKDEIARLYK  730



>ref|XP_010435196.1| PREDICTED: long-chain-fatty-acid--[acyl-carrier-protein] ligase 
AEE15, chloroplastic isoform X2 [Camelina sativa]
Length=740

 Score =   865 bits (2234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/702 (64%), Positives = 555/702 (79%), Gaps = 19/702 (3%)
 Frame = -3

Query  2402  HDLMSCRGFIKMKWQLNSRGSTSRKFRVFCESTGMQIRKCSPilesills-gngllssEW  2226
             HD     GF  +      R  + R+FR+ CES   ++R  SP+LES  LS  + L S+EW
Sbjct  56    HDF----GFRLISSHEGVRVPSFRRFRIHCESKEKEVRTSSPVLESSSLSGDSALRSNEW  111

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             K VPDIW+++A+++G+ +ALVDPYH+PP  L++K++E+EI+ FAEGLRV+G+K +EKI L
Sbjct  112   KAVPDIWRSSADKYGDRVALVDPYHDPPLKLTYKQVEQEILDFAEGLRVVGMKANEKIGL  171

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             FADNSCRWLV+DQGIM TGA+NVVRGSRSSVEELLQIY HSESVAL VDNPE ++RIAET
Sbjct  172   FADNSCRWLVSDQGIMATGAVNVVRGSRSSVEELLQIYRHSESVALVVDNPEFFNRIAET  231

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
             F S A +RF+ILLWGEKSS+ ++ +   P+YSY EI  LG E    L  S++  +   Y 
Sbjct  232   FTSKASLRFLILLWGEKSSLVTQGLQ-VPVYSYAEIKSLGQERRAKLSGSKDTSN---YN  287

Query  1685  PINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYE  1506
              INSDD+A ++YTSGTTGNPKGV LTH NLLHQI +L   VP   GDRFLSMLP WHAYE
Sbjct  288   FINSDDIAAIMYTSGTTGNPKGVTLTHRNLLHQIKHLSKYVPAQAGDRFLSMLPSWHAYE  347

Query  1505  RAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARK  1326
             RA+EYFIF+ G EQ+YT++  LK+DLKRYQP Y++SVPLVYETLYSGI KQI++SS ARK
Sbjct  348   RASEYFIFTCGIEQMYTSIRYLKDDLKRYQPNYIVSVPLVYETLYSGIQKQISSSSAARK  407

Query  1325  LIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARK  1146
             L+AL  +++S AY E KRIYEG CLTK+QK P Y+V+++DWLWAR IAALL PLH+LA+ 
Sbjct  408   LLALTLIRVSMAYMEMKRIYEGMCLTKEQKPPMYIVALVDWLWARVIAALLWPLHMLAKM  467

Query  1145  LVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNV  966
             L+Y KIH+SIGISKAGISGGGSL  HVDKFFEAI + LQNGYGLTE++PVV  R  + NV
Sbjct  468   LIYKKIHASIGISKAGISGGGSLPIHVDKFFEAIGVTLQNGYGLTETSPVVCARTLSYNV  527

Query  965   LGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWL  786
             LGS G P+  TE K+VD ET+  L PGSKGI+K +GPQVMKGYYKNP  TKQ ++E+GW 
Sbjct  528   LGSAGHPMHGTEFKIVDPETNNVLPPGSKGIIKVRGPQVMKGYYKNPLTTKQVLNESGWF  587

Query  785   NTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQI  606
             NTGD GWI P+HSIGRSR   G IVLEGRAKDTIVLS+GENVEP EIEEAAM S+LI QI
Sbjct  588   NTGDTGWIAPHHSIGRSRRCGGVIVLEGRAKDTIVLSTGENVEPLEIEEAAMRSSLIDQI  647

Query  605   VVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTF  426
             +VIGQD+RRLGA+++P+KEE    A+++        E+ EEK   LI++EL+KWT+ C+F
Sbjct  648   LVIGQDRRRLGAIIIPNKEE----AQRVD------PEIPEEKLKSLIYQELRKWTSECSF  697

Query  425   QIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             Q+GP+L+I+EPFTIDNGL+TPTMK+RRDKV   YK++I+ LY
Sbjct  698   QVGPVLIIDEPFTIDNGLMTPTMKIRRDKVEAKYKDEIDQLY  739



>ref|NP_193143.2| long-chain-fatty-acid--[acyl-carrier-protein] ligase AEE15 [Arabidopsis 
thaliana]
 sp|Q8W471.1|AAE15_ARATH RecName: Full=Long-chain-fatty-acid--[acyl-carrier-protein] ligase 
AEE15, chloroplastic; AltName: Full=Acyl-[acyl-carrier-protein] 
synthetase; AltName: Full=Acyl-activating enzyme 15; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL32882.1| A6 anther-specific protein [Arabidopsis thaliana]
 gb|AAQ56775.1| At4g14070 [Arabidopsis thaliana]
 gb|ABK88270.1| chloroplast acyl ACP synthetase [Arabidopsis thaliana]
 gb|AEE83367.1| long-chain-fatty-acid--[acyl-carrier-protein] ligase AEE15 [Arabidopsis 
thaliana]
Length=727

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/695 (64%), Positives = 550/695 (79%), Gaps = 13/695 (2%)
 Frame = -3

Query  2381  GFIKMKWQLNSRGSTSRKFRVFCESTGMQIRKCSPilesills-gngllssEWKTVPDIW  2205
             GF  +    + R  + R+FRV CES   +++  SP LES   S    L SSEWK VPDIW
Sbjct  44    GFRLISGHESVRIPSFRRFRVHCESKEKEVKPSSPFLESSSFSGDAALRSSEWKAVPDIW  103

Query  2204  KTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCR  2025
             +++AE++G+ +ALVDPYH+PP  L++K+LE+EI+ FAEGLRV+G+K DEKIALFADNSCR
Sbjct  104   RSSAEKYGDRVALVDPYHDPPLKLTYKQLEQEILDFAEGLRVLGVKADEKIALFADNSCR  163

Query  2024  WLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADV  1845
             WLV+DQGIM TGA+NVVRGSRSSVEELLQIY HSESVA+ VDNPE ++RIAE+F S A +
Sbjct  164   WLVSDQGIMATGAVNVVRGSRSSVEELLQIYRHSESVAIVVDNPEFFNRIAESFTSKASL  223

Query  1844  RFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDV  1665
             RF+ILLWGEKSS+ ++ M   P+YSY EII+ G ES   L  S + R  Y  + I+SDD 
Sbjct  224   RFLILLWGEKSSLVTQGMQ-IPVYSYAEIINQGQESRAKLSASNDTR-SYRNQFIDSDDT  281

Query  1664  ATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFI  1485
             A ++YTSGTTGNPKGVMLTH NLLHQI +L   VP   GD+FLSMLP WHAYERA+EYFI
Sbjct  282   AAIMYTSGTTGNPKGVMLTHRNLLHQIKHLSKYVPAQAGDKFLSMLPSWHAYERASEYFI  341

Query  1484  FSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFL  1305
             F+ G EQ+YT++  LK+DLKRYQP Y++SVPLVYETLYSGI KQI+ SS  RK +AL  +
Sbjct  342   FTCGVEQMYTSIRYLKDDLKRYQPNYIVSVPLVYETLYSGIQKQISASSAGRKFLALTLI  401

Query  1304  KISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskih  1125
             K+S AY E KRIYEG CLTK+QK P Y+V+ +DWLWAR IAALL PLH+LA+KL+Y KIH
Sbjct  402   KVSMAYMEMKRIYEGMCLTKEQKPPMYIVAFVDWLWARVIAALLWPLHMLAKKLIYKKIH  461

Query  1124  ssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPP  945
             SSIGISKAGISGGGSL  HVDKFFEAI + LQNGYGLTE++PVV  R  +CNVLGS G P
Sbjct  462   SSIGISKAGISGGGSLPIHVDKFFEAIGVILQNGYGLTETSPVVCARTLSCNVLGSAGHP  521

Query  944   IRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGW  765
             +  TE K+VD ET+  L PGSKGI+K +GPQVMKGYYKNP  TKQ ++E+GW NTGD GW
Sbjct  522   MHGTEFKIVDPETNNVLPPGSKGIIKVRGPQVMKGYYKNPSTTKQVLNESGWFNTGDTGW  581

Query  764   IVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDK  585
             I P+HS GRSR+  G IVLEGRAKDTIVLS+GENVEP EIEEAAM S +I+QIVVIGQD+
Sbjct  582   IAPHHSKGRSRHCGGVIVLEGRAKDTIVLSTGENVEPLEIEEAAMRSRVIEQIVVIGQDR  641

Query  584   RRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILL  405
             RRLGA+++P+KEE    A+++        E S+E    L+++EL+KWT+ C+FQ+GP+L+
Sbjct  642   RRLGAIIIPNKEE----AQRVD------PETSKETLKSLVYQELRKWTSECSFQVGPVLI  691

Query  404   INEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             +++PFTIDNGL+TPTMK+RRD V   YKE+I+ LY
Sbjct  692   VDDPFTIDNGLMTPTMKIRRDMVVAKYKEEIDQLY  726



>emb|CDY53212.1| BnaC03g74060D [Brassica napus]
Length=748

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/690 (63%), Positives = 548/690 (79%), Gaps = 11/690 (2%)
 Frame = -3

Query  2351  SRGSTSRKFRVFCESTGMQIRKCSPilesill----sgngllssEWKTVPDIWKTAAEEF  2184
             +R S+  +FRV  +  G    +CSP LE + +    +   L S+EWK VPDIW+++AE++
Sbjct  65    TRVSSRLRFRVQEKELG----RCSPFLEGLTVPGNDASAALRSNEWKAVPDIWRSSAEKY  120

Query  2183  GNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQG  2004
             G+ +A+VDPYH+PP+  ++++LE+EI+ F EGLR +G+K DEKIALFADNSCRWLVADQG
Sbjct  121   GDRVAVVDPYHDPPSTFTYRQLEQEILDFVEGLRAVGVKADEKIALFADNSCRWLVADQG  180

Query  2003  IMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLW  1824
             IM TGA+NVVRGSRSSVEELL IY HS+SV L VDNPE ++RIA+TF   A ++F+ILLW
Sbjct  181   IMATGAVNVVRGSRSSVEELLHIYCHSDSVGLVVDNPEFFNRIADTFSYKASLKFVILLW  240

Query  1823  GEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTS  1644
             G+KSS+ +      P+YSYNEI +LG E       S +A  +Y YE I  DD AT++YTS
Sbjct  241   GDKSSLATSSRQ-TPVYSYNEIKNLGQERRAEHAGSSDA-GKYEYEFIGPDDTATIMYTS  298

Query  1643  GTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQ  1464
             GTTGNPKGVMLTH+NLLHQI NL + VP   G+RFLSMLP WHAYERA EYFIF+ G EQ
Sbjct  299   GTTGNPKGVMLTHQNLLHQIRNLSEFVPAKAGERFLSMLPSWHAYERACEYFIFTCGVEQ  358

Query  1463  VYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYK  1284
              YT++  LK+DLKRYQP YLISVPLVYETLYSGI KQI+TSSP RK +AL  ++IS AY 
Sbjct  359   KYTSIRFLKDDLKRYQPHYLISVPLVYETLYSGIQKQISTSSPVRKFLALTLIRISLAYT  418

Query  1283  EAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigisk  1104
             E +R+YEG CLTK QK P Y+V+++DWL AR +A +L PLH+LA KLVY KI SSIGI+K
Sbjct  419   EMRRVYEGLCLTKSQKPPVYIVALVDWLCARVVAFVLWPLHMLAEKLVYKKIRSSIGITK  478

Query  1103  agisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIK  924
             AG++GGGSL  H+DKFFEAI + +QNGYGLTE++PVV+ RR +CNVLGS+G PI+ TE K
Sbjct  479   AGVTGGGSLPMHIDKFFEAIGVNVQNGYGLTETSPVVSARRLSCNVLGSVGHPIKDTEFK  538

Query  923   VVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSI  744
             +VD ET   L PGSKGIVK +GP VM+GYYKNP A+KQ ID++GW NTGD+GWI P+HS 
Sbjct  539   IVDQETGTVLPPGSKGIVKVRGPPVMRGYYKNPVASKQVIDDDGWFNTGDMGWIAPHHST  598

Query  743   GRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALV  564
             GRSR+  G IVLEGRAKDTIVLS+GENVEP EIEEAAM S+LIQQIVVIGQD+RRLGA+V
Sbjct  599   GRSRSCGGVIVLEGRAKDTIVLSTGENVEPLEIEEAAMRSSLIQQIVVIGQDQRRLGAIV  658

Query  563   LPHKEEVLLAAK-KLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFT  387
             +P+KE     AK K+S VD +  E+S+E  + +++EEL+KWT+ C+FQ+GP+L++ EPFT
Sbjct  659   IPNKEAAEGVAKNKISPVDPEVNELSKETLTSMVYEELRKWTSECSFQVGPVLIVEEPFT  718

Query  386   IDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             IDNG +TPTMK+RRDKV D YK++I+ LYK
Sbjct  719   IDNGFMTPTMKIRRDKVVDRYKDEIDRLYK  748



>ref|XP_010905150.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
isoform X1 [Elaeis guineensis]
Length=737

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/691 (66%), Positives = 552/691 (80%), Gaps = 5/691 (1%)
 Frame = -3

Query  2357  LNSRGSTSRKFRVFC--ESTGMQIRKCSPilesill-sgngllssEWKTVPDIWKTAAEE  2187
             L  R S   + RV C  E      R+CSP LES LL S N L   EWK VPDIWKT AE+
Sbjct  44    LRLRPSRVPEVRVLCSLELEHPVRRRCSPFLESALLPSVNNLTLDEWKAVPDIWKTTAEK  103

Query  2186  FGNCIALVDPYHNPPTNLSFKE-LEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVAD  2010
             +G+ +ALVDPYH PP+ L++KE LE+EI++FAEGLRV+G+ PDEK+ALFADNSCRWL+AD
Sbjct  104   YGDRVALVDPYHEPPSKLTYKEQLEQEILNFAEGLRVLGVIPDEKLALFADNSCRWLIAD  163

Query  2009  QGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIIL  1830
             QGIM TGAINVVRG RSS +ELLQIYNHSESVAL VD+P+ ++R+AE+    ADVRF++L
Sbjct  164   QGIMATGAINVVRGIRSSDDELLQIYNHSESVALVVDSPQFFNRLAESLIPRADVRFVVL  223

Query  1829  LWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVY  1650
             LWGEKS + S+ + G P+Y Y E+I+LG ESH  LL S +       E I   DVATL+Y
Sbjct  224   LWGEKSCLNSKAVKGMPLYDYREVIELGRESHHTLLQSCKRGEYQESETIGPGDVATLMY  283

Query  1649  TSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGC  1470
             TSGT+G PKGVMLTH+NLLHQI N+WD VP   GDRFLSMLPPWHAYERA EYFIF+ G 
Sbjct  284   TSGTSGTPKGVMLTHQNLLHQIRNMWDIVPAEAGDRFLSMLPPWHAYERACEYFIFTYGI  343

Query  1469  EQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFA  1290
             EQVYT V NLK+DLK+YQP YLISVPLVYETLY  I KQI++SS ARKL+AL  + IS  
Sbjct  344   EQVYTNVQNLKDDLKQYQPHYLISVPLVYETLYRSIQKQISSSSAARKLVALALINISLL  403

Query  1289  YKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigi  1110
             Y EAKR+YEG+ L +   Q S ++ ++DWL  R +AALL PLH L  KLVYSKIHSSIGI
Sbjct  404   YMEAKRVYEGRVLAEKHGQRSSIIILIDWLLGRIVAALLWPLHNLGVKLVYSKIHSSIGI  463

Query  1109  skagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTE  930
             SKAGISGGGSL +++D+FFEAI +K+QNGYGLTE++PVVA RRPNCNVLG++G P++HTE
Sbjct  464   SKAGISGGGSLPTNIDRFFEAISVKVQNGYGLTETSPVVAARRPNCNVLGTVGHPLKHTE  523

Query  929   IKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNH  750
             IK+VDAET   L  GSKGIVK +GPQVMKGYYKNP AT +AID  GW NTGD+GWIVP H
Sbjct  524   IKIVDAETGNILPYGSKGIVKIRGPQVMKGYYKNPSATSEAIDVEGWFNTGDIGWIVPKH  583

Query  749   SIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGA  570
             S+G+SR   G +VLEGRAKDTIVLS+GENVEP+E+E AAM SNLIQQIVVIGQD+RRLGA
Sbjct  584   SMGQSRQCGGMLVLEGRAKDTIVLSTGENVEPAELEAAAMRSNLIQQIVVIGQDQRRLGA  643

Query  569   LVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPF  390
             L++P+K+E+L  AK LS++D + +E+S+EK   L++ E++ WT GC+FQIGPIL+++EPF
Sbjct  644   LIVPNKDELLAKAKMLSIID-ETSELSKEKMMSLLYNEVKTWTAGCSFQIGPILILDEPF  702

Query  389   TIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             TIDNGL+T TMKVRRDKV   Y EQI +LYK
Sbjct  703   TIDNGLMTATMKVRRDKVAAKYSEQITNLYK  733



>ref|XP_010905151.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
isoform X2 [Elaeis guineensis]
Length=734

 Score =   862 bits (2228),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/691 (66%), Positives = 552/691 (80%), Gaps = 5/691 (1%)
 Frame = -3

Query  2357  LNSRGSTSRKFRVFC--ESTGMQIRKCSPilesill-sgngllssEWKTVPDIWKTAAEE  2187
             L  R S   + RV C  E      R+CSP LES LL S N L   EWK VPDIWKT AE+
Sbjct  44    LRLRPSRVPEVRVLCSLELEHPVRRRCSPFLESALLPSVNNLTLDEWKAVPDIWKTTAEK  103

Query  2186  FGNCIALVDPYHNPPTNLSFKE-LEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVAD  2010
             +G+ +ALVDPYH PP+ L++KE LE+EI++FAEGLRV+G+ PDEK+ALFADNSCRWL+AD
Sbjct  104   YGDRVALVDPYHEPPSKLTYKEQLEQEILNFAEGLRVLGVIPDEKLALFADNSCRWLIAD  163

Query  2009  QGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIIL  1830
             QGIM TGAINVVRG RSS +ELLQIYNHSESVAL VD+P+ ++R+AE+    ADVRF++L
Sbjct  164   QGIMATGAINVVRGIRSSDDELLQIYNHSESVALVVDSPQFFNRLAESLIPRADVRFVVL  223

Query  1829  LWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVY  1650
             LWGEKS + S+ + G P+Y Y E+I+LG ESH  LL S +       E I   DVATL+Y
Sbjct  224   LWGEKSCLNSKAVKGMPLYDYREVIELGRESHHTLLQSCKRGEYQESETIGPGDVATLMY  283

Query  1649  TSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGC  1470
             TSGT+G PKGVMLTH+NLLHQI N+WD VP   GDRFLSMLPPWHAYERA EYFIF+ G 
Sbjct  284   TSGTSGTPKGVMLTHQNLLHQIRNMWDIVPAEAGDRFLSMLPPWHAYERACEYFIFTYGI  343

Query  1469  EQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFA  1290
             EQVYT V NLK+DLK+YQP YLISVPLVYETLY  I KQI++SS ARKL+AL  + IS  
Sbjct  344   EQVYTNVQNLKDDLKQYQPHYLISVPLVYETLYRSIQKQISSSSAARKLVALALINISLL  403

Query  1289  YKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigi  1110
             Y EAKR+YEG+ L +   Q S ++ ++DWL  R +AALL PLH L  KLVYSKIHSSIGI
Sbjct  404   YMEAKRVYEGRVLAEKHGQRSSIIILIDWLLGRIVAALLWPLHNLGVKLVYSKIHSSIGI  463

Query  1109  skagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTE  930
             SKAGISGGGSL +++D+FFEAI +K+QNGYGLTE++PVVA RRPNCNVLG++G P++HTE
Sbjct  464   SKAGISGGGSLPTNIDRFFEAISVKVQNGYGLTETSPVVAARRPNCNVLGTVGHPLKHTE  523

Query  929   IKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNH  750
             IK+VDAET   L  GSKGIVK +GPQVMKGYYKNP AT +AID  GW NTGD+GWIVP H
Sbjct  524   IKIVDAETGNILPYGSKGIVKIRGPQVMKGYYKNPSATSEAIDVEGWFNTGDIGWIVPKH  583

Query  749   SIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGA  570
             S+G+SR   G +VLEGRAKDTIVLS+GENVEP+E+E AAM SNLIQQIVVIGQD+RRLGA
Sbjct  584   SMGQSRQCGGMLVLEGRAKDTIVLSTGENVEPAELEAAAMRSNLIQQIVVIGQDQRRLGA  643

Query  569   LVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPF  390
             L++P+K+E+L  AK LS++D + +E+S+EK   L++ E++ WT GC+FQIGPIL+++EPF
Sbjct  644   LIVPNKDELLAKAKMLSIID-ETSELSKEKMMSLLYNEVKTWTAGCSFQIGPILILDEPF  702

Query  389   TIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             TIDNGL+T TMKVRRDKV   Y EQI +LYK
Sbjct  703   TIDNGLMTATMKVRRDKVAAKYSEQITNLYK  733



>emb|CDY01190.1| BnaA04g06290D [Brassica napus]
Length=719

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/701 (63%), Positives = 550/701 (78%), Gaps = 21/701 (3%)
 Frame = -3

Query  2390  SCRGFIKMKWQLNS----RGSTSRKFRVFCESTGMQIRKCSPilesillsgngllssEWK  2223
             S R F  ++++L S    R  + R+FR+ C S G ++        S+      L S+EWK
Sbjct  35    SSREFHNLRFRLISGPRVRVPSFRRFRIHCVSKGKEVTPII-ESSSLSGGDAALRSNEWK  93

Query  2222  TVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALF  2043
              VPDIW+++A+++G+ +ALVDPYH+PP  L++ +LE+EI+ FAEGLR +G+KPDEKIALF
Sbjct  94    AVPDIWRSSADKYGDKVALVDPYHDPPLKLTYNQLEQEILDFAEGLRAVGVKPDEKIALF  153

Query  2042  ADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETF  1863
             ADNSCRWLV+DQGIM+TGA+NVVRGSRSSVEELLQIY HSESVAL VDNPE ++RIA+TF
Sbjct  154   ADNSCRWLVSDQGIMSTGAVNVVRGSRSSVEELLQIYQHSESVALVVDNPEFFNRIADTF  213

Query  1862  HSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEP  1683
              S A +RF+ILLWGEKSS+ ++ M   P+YSY +I +LG E        + A    T +P
Sbjct  214   TSKASLRFLILLWGEKSSLVTQGMQ-IPVYSYTDIKNLGQE--------KRAGSNDTRKP  264

Query  1682  INSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYER  1503
             IN DD A ++YTSGTTGNPKGVMLTH NLLHQI +L   VP   GDRFLSMLP WHAYER
Sbjct  265   INPDDTAAIMYTSGTTGNPKGVMLTHRNLLHQIKHLSAYVPAEAGDRFLSMLPSWHAYER  324

Query  1502  AAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKL  1323
             A EYFIF+ G EQ+YT++  LK+DLKRYQP YLISVPLVYETLYSGI KQI+TSS ARK 
Sbjct  325   ACEYFIFTCGVEQMYTSIRFLKDDLKRYQPHYLISVPLVYETLYSGIQKQISTSSAARKF  384

Query  1322  IALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKL  1143
             +AL  +KIS  Y E KRIYEG CLTK+QK P Y+VS++DWL AR IAALL PLH+LA+ L
Sbjct  385   LALTLIKISLQYMEMKRIYEGMCLTKEQKPPMYIVSLVDWLRARVIAALLWPLHMLAKIL  444

Query  1142  VYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVL  963
             +Y KIH+SIGISKAGISGGGSL  H+DKFFEAI + LQNGYGLTE++PV+  R  +CNVL
Sbjct  445   IYKKIHASIGISKAGISGGGSLPIHIDKFFEAIGVILQNGYGLTETSPVICARTLSCNVL  504

Query  962   GSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLN  783
             GS G P+  TE K+VD ET+  L PGSKGIVK +GPQ+MKGYYKNP  TKQ ++E+GW N
Sbjct  505   GSAGYPMHGTEFKIVDPETNTVLPPGSKGIVKVRGPQIMKGYYKNPTTTKQVLNESGWFN  564

Query  782   TGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIV  603
             TGD+GWI P+HS GRSR   G IVLEGRAKDTIVLS+GENVEP EIEEAAM S LI QIV
Sbjct  565   TGDMGWIAPHHSTGRSRRCGGLIVLEGRAKDTIVLSTGENVEPLEIEEAAMRSRLIDQIV  624

Query  602   VIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQ  423
             VIGQD+RRLGA+++P+KEE    A+KL   D + +++S+EK   L+++EL+KWT+ C+FQ
Sbjct  625   VIGQDQRRLGAIIIPNKEE----AEKL---DPETSQLSDEKLKSLVYQELRKWTSECSFQ  677

Query  422   IGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             +GP+L+++EPFTIDNGL+TPTMK+RRDKV   YK++I  LY
Sbjct  678   VGPVLIVDEPFTIDNGLMTPTMKIRRDKVVAKYKDEINQLY  718



>ref|XP_006421036.1| hypothetical protein CICLE_v10004427mg [Citrus clementina]
 gb|ESR34276.1| hypothetical protein CICLE_v10004427mg [Citrus clementina]
Length=663

 Score =   861 bits (2225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/609 (70%), Positives = 521/609 (86%), Gaps = 0/609 (0%)
 Frame = -3

Query  2123  ELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEEL  1944
             +LE+EI+ FAEGLRVIG+KP+EK++LF+DNSCRWLVADQG++ TGAINVVRGSRSS EEL
Sbjct  55    KLEQEILDFAEGLRVIGVKPEEKLSLFSDNSCRWLVADQGMLATGAINVVRGSRSSSEEL  114

Query  1943  LQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYN  1764
             L IYNHSESVALAV+NPE ++RIAET  S A +RFIILLWG+KSS+  ++++  P++SY+
Sbjct  115   LHIYNHSESVALAVENPEFFNRIAETLCSKAAMRFIILLWGKKSSVAPDIVEEIPVFSYD  174

Query  1763  EIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQI  1584
             EIIDLG ES  A   S +AR  Y YE I SDD+AT VYTSGTTGNPKGVMLTH+NLLHQI
Sbjct  175   EIIDLGRESRKAFSDSNDARKHYKYETIGSDDIATYVYTSGTTGNPKGVMLTHKNLLHQI  234

Query  1583  LNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYL  1404
              +L+D VP   GD+FLSMLPPWH YERA  YFIFS G E +YT V NLK+DL+RYQP Y+
Sbjct  235   RSLYDIVPAENGDKFLSMLPPWHVYERACGYFIFSRGIELMYTAVRNLKDDLQRYQPHYM  294

Query  1403  ISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSY  1224
             ISVPLVYETLYSGI KQI TSS AR+++A   ++ISFAY   KRIYEG CLT++QK+PSY
Sbjct  295   ISVPLVYETLYSGIQKQIFTSSAARRVVARALIRISFAYTAFKRIYEGFCLTRNQKEPSY  354

Query  1223  LVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAI  1044
             LV+++DWLWAR I A+L PLHLLA KLVY KI S+IGISKAG+SGGGSL  H+D F+EAI
Sbjct  355   LVALIDWLWARIICAILWPLHLLAEKLVYKKIQSAIGISKAGVSGGGSLPMHIDLFYEAI  414

Query  1043  DIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKA  864
              +K+Q GYGLTES+PV+A RRP CNVLGS+G PI+HTEIK+VDAET++ L  GSKGIVK 
Sbjct  415   GVKVQVGYGLTESSPVIAARRPTCNVLGSVGHPIKHTEIKIVDAETNEVLPAGSKGIVKV  474

Query  863   KGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTI  684
             +G QVMKGY+KNP ATKQA+DE+GWLNTGD+GWI P+HS GRSR   G +VLEGRAKDTI
Sbjct  475   RGSQVMKGYFKNPSATKQALDEDGWLNTGDIGWIAPHHSRGRSRRCGGVLVLEGRAKDTI  534

Query  683   VLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSD  504
             VLS+GENVEP E+EEAA+ S+LI+QIVVIGQD+RR GA+++P KEEVL+AAK+LS+V ++
Sbjct  535   VLSTGENVEPLELEEAALRSSLIRQIVVIGQDQRRPGAIIVPDKEEVLMAAKRLSIVHAE  594

Query  503   ATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLY  324
             A+E+S+EKT  L++ EL+KWT+ C+FQIGPIL+++EPFTID+GL+TPTMK+RRD+V   +
Sbjct  595   ASELSKEKTISLLYGELRKWTSKCSFQIGPILVVDEPFTIDSGLMTPTMKIRRDRVAAQF  654

Query  323   KEQIEDLYK  297
             KE+IE+LYK
Sbjct  655   KEEIENLYK  663



>ref|XP_010450111.1| PREDICTED: long-chain-fatty-acid--[acyl-carrier-protein] ligase 
AEE15, chloroplastic-like [Camelina sativa]
Length=742

 Score =   861 bits (2224),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/679 (65%), Positives = 546/679 (80%), Gaps = 15/679 (2%)
 Frame = -3

Query  2333  RKFRVFCESTGMQIRKCSPilesills-gngllssEWKTVPDIWKTAAEEFGNCIALVDP  2157
             R+FR+ CES   ++R  SP++ES+ LS    L S+EWK VPDIW+++AE++G+ +ALVDP
Sbjct  77    RRFRIHCESKEKEVRTSSPVIESLSLSGDAALRSNEWKAVPDIWRSSAEKYGDRVALVDP  136

Query  2156  YHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINV  1977
             YH+PP  L++K+LE++I+ FAEGLRV+G+K +EKI LFADNSCRWLV+DQGIM TGA+NV
Sbjct  137   YHDPPLKLTYKQLEQDILDFAEGLRVVGMKANEKIGLFADNSCRWLVSDQGIMATGAVNV  196

Query  1976  VRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSE  1797
             VRGSRSSVEELLQIY HSESVAL VDNPE ++RIAETF S A +RF+ILLWGEKSS+ ++
Sbjct  197   VRGSRSSVEELLQIYRHSESVALVVDNPEFFNRIAETFTSKASLRFLILLWGEKSSLVTQ  256

Query  1796  VMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGV  1617
              +   P+YSY +I  LG ES      S + R+   Y  INSDDVA ++YTSGTTGNPKGV
Sbjct  257   GLQ-VPVYSYADIKSLGQESRAKSSGSNDTRN---YNFINSDDVAAIMYTSGTTGNPKGV  312

Query  1616  MLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLK  1437
             MLTH NLL QI +L   VP   GD+FLSMLP WHAYERA EYFIF+ G EQ+YT++  LK
Sbjct  313   MLTHRNLLQQIKHLSKYVPAQAGDKFLSMLPSWHAYERACEYFIFTCGIEQMYTSIRYLK  372

Query  1436  EDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGK  1257
             +DLKRYQP Y++SVPLVYETLYSGI KQI++SS ARK +AL  +K+S AY E KRIYEG 
Sbjct  373   DDLKRYQPNYIVSVPLVYETLYSGIQKQISSSSAARKFLALTLIKVSMAYMEMKRIYEGT  432

Query  1256  CLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggsl  1077
             CLTK+QK P Y+V+++DWL+AR +AALL PLH+LA+ L+Y KIH+SIGISKAGISGGGSL
Sbjct  433   CLTKEQKPPMYIVALVDWLFARVVAALLWPLHMLAKMLIYKKIHASIGISKAGISGGGSL  492

Query  1076  ssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKA  897
               HVDKFFEAI + LQNGYGLTE++PVV  R  + NVLGS G P+  TE K+VD ET+  
Sbjct  493   PIHVDKFFEAIGVTLQNGYGLTETSPVVCARTLSYNVLGSAGHPMHGTEFKIVDPETNDV  552

Query  896   LSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGF  717
             L PG+KGI+K +GPQVMKGYYKNP  TKQ ++E+GW NTGD GWI P+HSIGRSR   G 
Sbjct  553   LPPGTKGIIKVRGPQVMKGYYKNPLTTKQVLNESGWFNTGDTGWIAPHHSIGRSRRCGGV  612

Query  716   IVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLL  537
             IVLEGRAKDTIVLS+GENVEP EIEEAAM S+LI+QI+VIGQD+RRLGA+V+P+KEE   
Sbjct  613   IVLEGRAKDTIVLSTGENVEPLEIEEAAMRSSLIEQILVIGQDRRRLGAIVIPNKEEA--  670

Query  536   AAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTM  357
                    VD D   +S+EK   LI++EL++WT+ C+FQ+GP+L+I+EPFTIDNGL+TPTM
Sbjct  671   -----QRVDPD---ISKEKLKSLIYQELREWTSECSFQVGPVLIIDEPFTIDNGLMTPTM  722

Query  356   KVRRDKVTDLYKEQIEDLY  300
             KVRRDKV   YK++I+ LY
Sbjct  723   KVRRDKVVAKYKDEIDQLY  741



>ref|XP_010435195.1| PREDICTED: long-chain-fatty-acid--[acyl-carrier-protein] ligase 
AEE15, chloroplastic isoform X1 [Camelina sativa]
Length=744

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/706 (63%), Positives = 555/706 (79%), Gaps = 23/706 (3%)
 Frame = -3

Query  2402  HDLMSCRGFIKMKWQLNSRGSTSRKFRVFCESTG----MQIRKCSPilesills-gngll  2238
             HD     GF  +      R  + R+FR+ CES       ++R  SP+LES  LS  + L 
Sbjct  56    HDF----GFRLISSHEGVRVPSFRRFRIHCESKASSKEKEVRTSSPVLESSSLSGDSALR  111

Query  2237  ssEWKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDE  2058
             S+EWK VPDIW+++A+++G+ +ALVDPYH+PP  L++K++E+EI+ FAEGLRV+G+K +E
Sbjct  112   SNEWKAVPDIWRSSADKYGDRVALVDPYHDPPLKLTYKQVEQEILDFAEGLRVVGMKANE  171

Query  2057  KIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSR  1878
             KI LFADNSCRWLV+DQGIM TGA+NVVRGSRSSVEELLQIY HSESVAL VDNPE ++R
Sbjct  172   KIGLFADNSCRWLVSDQGIMATGAVNVVRGSRSSVEELLQIYRHSESVALVVDNPEFFNR  231

Query  1877  IAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQ  1698
             IAETF S A +RF+ILLWGEKSS+ ++ +   P+YSY EI  LG E    L  S++  + 
Sbjct  232   IAETFTSKASLRFLILLWGEKSSLVTQGLQ-VPVYSYAEIKSLGQERRAKLSGSKDTSN-  289

Query  1697  YTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPW  1518
               Y  INSDD+A ++YTSGTTGNPKGV LTH NLLHQI +L   VP   GDRFLSMLP W
Sbjct  290   --YNFINSDDIAAIMYTSGTTGNPKGVTLTHRNLLHQIKHLSKYVPAQAGDRFLSMLPSW  347

Query  1517  HAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSS  1338
             HAYERA+EYFIF+ G EQ+YT++  LK+DLKRYQP Y++SVPLVYETLYSGI KQI++SS
Sbjct  348   HAYERASEYFIFTCGIEQMYTSIRYLKDDLKRYQPNYIVSVPLVYETLYSGIQKQISSSS  407

Query  1337  PARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHL  1158
              ARKL+AL  +++S AY E KRIYEG CLTK+QK P Y+V+++DWLWAR IAALL PLH+
Sbjct  408   AARKLLALTLIRVSMAYMEMKRIYEGMCLTKEQKPPMYIVALVDWLWARVIAALLWPLHM  467

Query  1157  LARKLVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRP  978
             LA+ L+Y KIH+SIGISKAGISGGGSL  HVDKFFEAI + LQNGYGLTE++PVV  R  
Sbjct  468   LAKMLIYKKIHASIGISKAGISGGGSLPIHVDKFFEAIGVTLQNGYGLTETSPVVCARTL  527

Query  977   NCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDE  798
             + NVLGS G P+  TE K+VD ET+  L PGSKGI+K +GPQVMKGYYKNP  TKQ ++E
Sbjct  528   SYNVLGSAGHPMHGTEFKIVDPETNNVLPPGSKGIIKVRGPQVMKGYYKNPLTTKQVLNE  587

Query  797   NGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNL  618
             +GW NTGD GWI P+HSIGRSR   G IVLEGRAKDTIVLS+GENVEP EIEEAAM S+L
Sbjct  588   SGWFNTGDTGWIAPHHSIGRSRRCGGVIVLEGRAKDTIVLSTGENVEPLEIEEAAMRSSL  647

Query  617   IQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTT  438
             I QI+VIGQD+RRLGA+++P+KEE    A+++        E+ EEK   LI++EL+KWT+
Sbjct  648   IDQILVIGQDRRRLGAIIIPNKEE----AQRVD------PEIPEEKLKSLIYQELRKWTS  697

Query  437   GCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
              C+FQ+GP+L+I+EPFTIDNGL+TPTMK+RRDKV   YK++I+ LY
Sbjct  698   ECSFQVGPVLIIDEPFTIDNGLMTPTMKIRRDKVEAKYKDEIDQLY  743



>emb|CDY67321.1| BnaA03g57590D [Brassica napus]
Length=718

 Score =   860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/645 (65%), Positives = 524/645 (81%), Gaps = 3/645 (0%)
 Frame = -3

Query  2228  WKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIA  2049
             WK VPDIW+++AE++G+ +A+VDPYH+ P+  ++++LE+EI+ F EGLR +G+K DEKIA
Sbjct  76    WKAVPDIWRSSAEKYGDRVAVVDPYHDSPSTFTYRQLEQEILDFVEGLRAVGVKADEKIA  135

Query  2048  LFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAE  1869
             LFADNSCRWLVADQGIM TGA+NVVRGSRSSVEELL IY HS+SV L VDNPE ++RIA+
Sbjct  136   LFADNSCRWLVADQGIMATGAVNVVRGSRSSVEELLHIYCHSDSVGLVVDNPEFFNRIAD  195

Query  1868  TFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTY  1689
             TF   A ++F+ILLWG+KSS+        P+YSYNEI +LG +       S +A  +Y Y
Sbjct  196   TFSYKASLKFVILLWGDKSSLVKSSRQ-TPVYSYNEIKNLGQQRRAEHAGSSDA-GKYEY  253

Query  1688  EPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAY  1509
             E I  DD AT++YTSGTTGNPKGVMLTH+NLLHQI NL + VP   G+RFLSMLP WHAY
Sbjct  254   EFIGPDDTATIMYTSGTTGNPKGVMLTHQNLLHQIRNLSEFVPAKAGERFLSMLPSWHAY  313

Query  1508  ERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPAR  1329
             ERA EYFIF+ G EQ YT++  LK+DLKRYQP YLISVPLVYETLYSGI KQI+TSSP R
Sbjct  314   ERACEYFIFTCGVEQKYTSIRFLKDDLKRYQPHYLISVPLVYETLYSGIQKQISTSSPVR  373

Query  1328  KLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLAR  1149
             K +AL  ++IS AY E +R+YEG CLTK+QK P Y+V+++DWLWAR +A +L PLH+LA 
Sbjct  374   KFLALSLIRISLAYTEMRRVYEGLCLTKNQKPPVYIVALVDWLWARVVAFVLWPLHMLAE  433

Query  1148  KLVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
             KLV+ KI SSIGI+KAG+SGGGSL  H+DKFFEAI + +QNGYGLTE++PVV+ RR +C+
Sbjct  434   KLVHKKIRSSIGITKAGVSGGGSLPMHIDKFFEAIGVNVQNGYGLTETSPVVSARRISCH  493

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             VLGS+G PI+ TE K+VD ET   L PGSKGIVK +GP VM+GYYKNP ATKQ ID++GW
Sbjct  494   VLGSVGHPIKDTEFKIVDQETGNVLPPGSKGIVKVRGPPVMRGYYKNPMATKQVIDDDGW  553

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              NTGD+GWI P+HS GR R+  G IVLEGRAKDTIVLS+GENVEP EIEEAA+ S+LIQQ
Sbjct  554   FNTGDMGWIAPHHSTGRRRSCGGVIVLEGRAKDTIVLSTGENVEPLEIEEAALRSSLIQQ  613

Query  608   IVVIGQDKRRLGALVLPHKEEVLLAAK-KLSVVDSDATEVSEEKTSKLIHEELQKWTTGC  432
             IVVIGQD+RRLGA+V+P+KE     AK K+S VD +  E+S+E  + +++EEL+KWT+ C
Sbjct  614   IVVIGQDQRRLGAIVIPNKEAAEGVAKNKISAVDPEVNELSKETLTSMVYEELRKWTSEC  673

Query  431   TFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             +FQ+GP+L++ EPFTIDNG +TPTMK+RRDKV DLYK++I  LYK
Sbjct  674   SFQVGPVLIVEEPFTIDNGFMTPTMKIRRDKVVDLYKDEIARLYK  718



>ref|XP_007034196.1| AMP-dependent synthetase and ligase family protein isoform 2 
[Theobroma cacao]
 gb|EOY05122.1| AMP-dependent synthetase and ligase family protein isoform 2 
[Theobroma cacao]
Length=600

 Score =   856 bits (2211),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/613 (70%), Positives = 510/613 (83%), Gaps = 13/613 (2%)
 Frame = -3

Query  2135  LSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSS  1956
             +++ +LE+EI+ FAEGLR+IGLKP++K+ALFADNS RWLVADQGIM  GAINVVRGSRS+
Sbjct  1     MTYIQLEQEILDFAEGLRLIGLKPEDKLALFADNSSRWLVADQGIMAMGAINVVRGSRSA  60

Query  1955  VEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPI  1776
             VEELL IYNHSESV L VDNPE ++R+A TF S A +RFI+LLWGEKS + +    G PI
Sbjct  61    VEELLHIYNHSESVGLVVDNPEFFNRLAGTFCSKATMRFIVLLWGEKSCLATGETQGVPI  120

Query  1775  YSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENL  1596
             +SY EI++LG ES + L  S +AR  Y YE I SDDVATLVYTSGTT NPKGVMLTH+NL
Sbjct  121   FSYREIMELGRESRVGLTDSHDARQGYIYEAIGSDDVATLVYTSGTTDNPKGVMLTHKNL  180

Query  1595  LHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQ  1416
             LHQI NLWD VP   GDRFLSMLP WHAYERA EYFIF+ G EQ YTTV NLK+DL+ YQ
Sbjct  181   LHQIRNLWDVVPAEAGDRFLSMLPSWHAYERACEYFIFTHGIEQEYTTVRNLKDDLRHYQ  240

Query  1415  PQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQK  1236
             P YLISVPLVYETLYSGI KQI TSS ARK IAL F++             G CLT+DQK
Sbjct  241   PHYLISVPLVYETLYSGIQKQIYTSSTARKFIALTFIR-------------GLCLTRDQK  287

Query  1235  QPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKF  1056
             QPSY+VS+L+WLWAR IAA+L PLH+LA+KLVY KIHS+IGISKAGISGGGSL  H+DKF
Sbjct  288   QPSYVVSMLEWLWARIIAAILWPLHVLAKKLVYEKIHSAIGISKAGISGGGSLPMHIDKF  347

Query  1055  FEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKG  876
             FEAI +KLQNGYGLTES+PV+A RRPNCNVLGS+G PI+HTE K+VD+ETD+ L PGSKG
Sbjct  348   FEAIGVKLQNGYGLTESSPVIAARRPNCNVLGSVGHPIQHTEFKIVDSETDEVLPPGSKG  407

Query  875   IVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRA  696
             IVK +GPQVMKGYYKNP AT+QA+DE+GWLNTGD+GWI P HS G+S    G IVLEGRA
Sbjct  408   IVKVRGPQVMKGYYKNPLATRQALDEDGWLNTGDIGWIAPCHSAGQSHRCGGVIVLEGRA  467

Query  695   KDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSV  516
             KDTIVLS+GENVEP EIEEAAM S+LIQQIVV+GQD+RRL A+++P+K+EVL AAK LS+
Sbjct  468   KDTIVLSTGENVEPLEIEEAAMRSSLIQQIVVVGQDQRRLAAIIVPNKDEVLQAAKNLSI  527

Query  515   VDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKV  336
             VD+DA ++ + K + L++EEL KWT+ C+FQIGPIL+++EPF+ID GL+TPTMK+RRDKV
Sbjct  528   VDADAADLGKGKMTSLLYEELWKWTSECSFQIGPILIVDEPFSIDGGLMTPTMKIRRDKV  587

Query  335   TDLYKEQIEDLYK  297
                YKE+I +LY+
Sbjct  588   VAQYKEEIANLYE  600



>ref|XP_009139565.1| PREDICTED: long-chain-fatty-acid--[acyl-carrier-protein] ligase 
AEE15, chloroplastic [Brassica rapa]
Length=719

 Score =   859 bits (2219),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/701 (63%), Positives = 550/701 (78%), Gaps = 21/701 (3%)
 Frame = -3

Query  2390  SCRGFIKMKWQLNS----RGSTSRKFRVFCESTGMQIRKCSPilesillsgngllssEWK  2223
             S R F  ++++L S    R  + R+FR+ C S G ++        S+      L S+EWK
Sbjct  35    SSREFHDLRFRLISGPRVRVPSFRRFRIHCVSKGKEVTPII-ESSSLSGGDAALRSNEWK  93

Query  2222  TVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALF  2043
              VPDIW+++A+++G+ +ALVDPYH+PP  L++ +LE+EI+ F+EGLR +G+KPDEKIALF
Sbjct  94    AVPDIWRSSADKYGDKVALVDPYHDPPLKLTYNQLEQEILDFSEGLRAVGVKPDEKIALF  153

Query  2042  ADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETF  1863
             ADNSCRWLV+DQGIM+TGA+NVVRGSRSSVEELLQIY HSESVAL VDNPE ++RIA+TF
Sbjct  154   ADNSCRWLVSDQGIMSTGAVNVVRGSRSSVEELLQIYQHSESVALVVDNPEFFNRIADTF  213

Query  1862  HSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEP  1683
              S A +RF+ILLWGEKSS+ ++ M   P+YSY +I +LG E        + A    T +P
Sbjct  214   TSKASLRFLILLWGEKSSLVTQGMQ-IPVYSYTDIKNLGQE--------KRAGSNDTRKP  264

Query  1682  INSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYER  1503
             IN DD A ++YTSGTTGNPKGVMLTH NLLHQI +L   VP   GDRFLSMLP WHAYER
Sbjct  265   INPDDTAAIMYTSGTTGNPKGVMLTHRNLLHQIKHLSAYVPAEAGDRFLSMLPSWHAYER  324

Query  1502  AAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKL  1323
             A EYFIF+ G EQ+YT++  LK+DLKRYQP YLISVPLVYETLYSGI KQI+TSS ARK 
Sbjct  325   ACEYFIFTCGVEQMYTSIRFLKDDLKRYQPHYLISVPLVYETLYSGIQKQISTSSAARKF  384

Query  1322  IALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKL  1143
             +AL  +KIS  Y E KRIYEG CLTK+QK P Y+VS++DWL AR IAALL PLH+LA+ L
Sbjct  385   LALTLIKISLQYMEMKRIYEGMCLTKEQKPPMYIVSLVDWLRARVIAALLWPLHMLAKIL  444

Query  1142  VYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVL  963
             +Y KIH+SIGISKAGISGGGSL  H+DKFFEAI + LQNGYGLTE++PV+  R  +CNVL
Sbjct  445   IYKKIHASIGISKAGISGGGSLPIHIDKFFEAIGVILQNGYGLTETSPVICARTLSCNVL  504

Query  962   GSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLN  783
             GS G P+  TE K+VD ET+  L PGSKGIVK +GPQ+MKGYYKNP  TKQ ++E+GW N
Sbjct  505   GSAGYPMHGTEFKIVDPETNTVLPPGSKGIVKVRGPQIMKGYYKNPTTTKQVLNESGWFN  564

Query  782   TGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIV  603
             TGD+GWI P+HS GRSR   G IVLEGRAKDTIVLS+GENVEP EIEEAAM S LI QIV
Sbjct  565   TGDMGWIAPHHSTGRSRCCGGLIVLEGRAKDTIVLSTGENVEPLEIEEAAMRSRLIDQIV  624

Query  602   VIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQ  423
             VIGQD+RRLGA+++P+KEE    A+KL   D + +++S+EK   L+++EL+KWT+ C+FQ
Sbjct  625   VIGQDQRRLGAIIIPNKEE----AEKL---DPETSQLSDEKLKSLVYQELRKWTSECSFQ  677

Query  422   IGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             +GP+L+++EPFTIDNGL+TPTMK+RRDKV   YK++I  LY
Sbjct  678   VGPVLIVDEPFTIDNGLMTPTMKIRRDKVVAKYKDEINQLY  718



>ref|XP_006285501.1| hypothetical protein CARUB_v10006937mg [Capsella rubella]
 gb|EOA18399.1| hypothetical protein CARUB_v10006937mg [Capsella rubella]
Length=718

 Score =   858 bits (2216),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/683 (64%), Positives = 545/683 (80%), Gaps = 20/683 (3%)
 Frame = -3

Query  2348  RGSTSRKFRVFCESTGMQIRKCSPilesillsgngllssEWKTVPDIWKTAAEEFGNCIA  2169
             R  + R+FR+ CES   ++R  S      L+  + LLS+EWK VPDIW+++AE++G+ +A
Sbjct  55    RVPSFRRFRIHCESKAKEVRPSS------LVIESSLLSNEWKAVPDIWRSSAEKYGDRVA  108

Query  2168  LVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTG  1989
             LVDPYH+PP  L++K+LE+EI+ FAEGLRV+G+K DEKI LFADNSCRWLV+DQGIM TG
Sbjct  109   LVDPYHDPPLKLTYKQLEQEILDFAEGLRVVGVKADEKIGLFADNSCRWLVSDQGIMATG  168

Query  1988  AINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSS  1809
             A+NVVRGSRSSVEELLQIY HSESVAL VDNPE ++RIAETF S A +RF+ILLWGEKSS
Sbjct  169   AVNVVRGSRSSVEELLQIYRHSESVALVVDNPEFFNRIAETFTSKASLRFLILLWGEKSS  228

Query  1808  ITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGN  1629
             + S+ +   P+YSY +I  LG ES   L  S +  +   Y  INSDD+A ++YTSGTTGN
Sbjct  229   LVSQGLQ-IPVYSYADIKSLGQESRANLSGSNDTSN---YNFINSDDIAAIMYTSGTTGN  284

Query  1628  PKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTV  1449
             PKGV LTH NLLHQI +L   VP   GD+FLSMLP WHAYERA+EYFIF+ G EQ+YT++
Sbjct  285   PKGVTLTHRNLLHQIKHLSKYVPAQAGDKFLSMLPSWHAYERASEYFIFTCGIEQMYTSI  344

Query  1448  INLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRI  1269
               LK+DLKRYQP Y++SVPLVYETLYSGI KQI++SS ARK +AL  +K+S AY E KRI
Sbjct  345   RYLKDDLKRYQPNYIVSVPLVYETLYSGIQKQISSSSAARKFLALTLIKVSMAYMEMKRI  404

Query  1268  YEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisg  1089
             YEG CLTK+QK P ++V+ +DWLWAR +AALL PLH+LA+ L+Y KIH+SIGISKAGISG
Sbjct  405   YEGMCLTKEQKPPMHIVAFVDWLWARVVAALLWPLHMLAKMLIYKKIHASIGISKAGISG  464

Query  1088  ggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAE  909
             GGSL  HVDKFFEAI + LQNGYGLTE++PVV  R  + NVLGS G P+  TE K+VD E
Sbjct  465   GGSLPIHVDKFFEAIGVTLQNGYGLTETSPVVCARTLSYNVLGSAGHPMHGTEFKIVDPE  524

Query  908   TDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRN  729
             T+  L PG KGI+K +GPQVMKGYYKNP  TKQ ++E+GW NTGD GWI P+HSIGRSR 
Sbjct  525   TNDVLPPGVKGIIKVRGPQVMKGYYKNPLTTKQVLNESGWFNTGDTGWIAPHHSIGRSRR  584

Query  728   SSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKE  549
               G IVLEGRAKDTIVLS+GENVEP EIEEAAM S+LI+QI+VIGQD+RRLGA+++P+KE
Sbjct  585   CGGVIVLEGRAKDTIVLSTGENVEPLEIEEAAMRSSLIEQILVIGQDRRRLGAIIIPNKE  644

Query  548   EVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLL  369
             E    A++++       E+++E    LI++EL+KWT+ C+FQ+GP+L+I+EPFTIDNGL+
Sbjct  645   E----AQRVN------PEITKETLKSLIYQELRKWTSECSFQVGPVLIIDEPFTIDNGLM  694

Query  368   TPTMKVRRDKVTDLYKEQIEDLY  300
             TPTMK+RRDKV   YK++I+ LY
Sbjct  695   TPTMKIRRDKVVAKYKDEIDQLY  717



>gb|KFK36301.1| hypothetical protein AALP_AA4G104500 [Arabis alpina]
Length=707

 Score =   857 bits (2215),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/683 (63%), Positives = 538/683 (79%), Gaps = 15/683 (2%)
 Frame = -3

Query  2348  RGSTSRKFRVFCESTGMQIRKCSPilesillsgngllssEWKTVPDIWKTAAEEFGNCIA  2169
             R  + R+ ++ C+S   ++R+        +     L ++EW+ VPDIW+++AE++G+ +A
Sbjct  39    RFHSFRRSKIHCQSKEKEVRRS-------VSRDTALGTNEWRAVPDIWRSSAEKYGDTVA  91

Query  2168  LVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTG  1989
             LVDPYH+PP  L++K+LE+EI+ FAEGLR +G+K DEKIALFADNSCRWLV+DQGIM TG
Sbjct  92    LVDPYHDPPLELTYKQLEQEILDFAEGLRDVGVKADEKIALFADNSCRWLVSDQGIMATG  151

Query  1988  AINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSS  1809
             A+NVVRGSRSSVEELLQIY HS+SVAL VDNPE ++RIAE F S A VRF+ILLWGEKSS
Sbjct  152   AVNVVRGSRSSVEELLQIYRHSDSVALVVDNPEFFNRIAEAFTSKASVRFMILLWGEKSS  211

Query  1808  ITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGN  1629
             + ++ M   P+YSY EI +LG E       S +  + Y YE I+SDD AT++YTSGTTGN
Sbjct  212   LVTQEMQ-IPVYSYTEIKNLGQERRAKFSESNDTGN-YEYELIDSDDTATIMYTSGTTGN  269

Query  1628  PKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTV  1449
             PKGVMLTH NLLH++ +L   VP   GDRFLSMLP WHAYERA EYFIF+ G EQ+YT++
Sbjct  270   PKGVMLTHRNLLHEMKHLSKYVPAETGDRFLSMLPSWHAYERACEYFIFTCGVEQMYTSI  329

Query  1448  INLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRI  1269
               LK+DLKRYQP Y++SVPLVYETLYSGI KQI+TSS ARK +A   +++S AY E KRI
Sbjct  330   RFLKDDLKRYQPHYILSVPLVYETLYSGIQKQISTSSAARKFLARTLIRVSLAYMEMKRI  389

Query  1268  YEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisg  1089
             YEG CLTK+QK P +++++LDWLWAR +AALL PLH+LA++L+Y KI +SIG+SKAGISG
Sbjct  390   YEGMCLTKEQKPPMHIIALLDWLWARVVAALLWPLHMLAKRLIYKKIQASIGMSKAGISG  449

Query  1088  ggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAE  909
             GGSL  HVDKF+EAI + +QNGYGLTE++PVV  R  +CNV+GS G P+  TE K+VD E
Sbjct  450   GGSLPIHVDKFYEAIGVSIQNGYGLTETSPVVCARMLSCNVIGSAGHPMDGTEFKIVDPE  509

Query  908   TDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRN  729
             TD  L PGSKGIVK +GPQ+MKGYYKNP  TKQ +DENGW NTGD GWI P+HS GRSR 
Sbjct  510   TDNVLPPGSKGIVKVRGPQIMKGYYKNPLTTKQVVDENGWFNTGDTGWIAPHHSRGRSRR  569

Query  728   SSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKE  549
               G IVLEGRAKDTIVLS+GENVEPSEIEEAAM S+LI+QIVVIGQD+RR+GA+++ +KE
Sbjct  570   CGGVIVLEGRAKDTIVLSTGENVEPSEIEEAAMRSSLIEQIVVIGQDQRRIGAIIILNKE  629

Query  548   EVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLL  369
             E         VV+      S+E    L+++EL+KWT+ C+FQ+GP+L+++EPFTIDNGL+
Sbjct  630   EA------ERVVNETTKLSSKETLKSLVYKELKKWTSECSFQVGPVLIVDEPFTIDNGLM  683

Query  368   TPTMKVRRDKVTDLYKEQIEDLY  300
             TPTMK+RRDKV   YK++I+ LY
Sbjct  684   TPTMKIRRDKVVAKYKDEIDQLY  706



>emb|CAA96521.1| AMP-binding protein [Brassica napus]
Length=701

 Score =   856 bits (2211),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/703 (63%), Positives = 546/703 (78%), Gaps = 25/703 (4%)
 Frame = -3

Query  2390  SCRGFIKMKWQLNS----RGSTSRKFRVFCESTGMQIRKCSP--ilesillsgngllssE  2229
             S R F  ++++L S    R  + R+FR+ C S G   +  +P     S       L  SE
Sbjct  17    SSRDFHDLRFRLISGPRVRVPSFRRFRIHCVSKG---KDVTPIIESSSSSGGDAALSYSE  73

Query  2228  WKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIA  2049
             WK VPDIW+++AE++G+ IALVDPYH+PP  L++ +LE+EI+ FAEGLR +G+K DEKIA
Sbjct  74    WKAVPDIWRSSAEKYGDKIALVDPYHDPPLKLTYNQLEQEILDFAEGLRAVGVKADEKIA  133

Query  2048  LFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAE  1869
             LFADNSCRWLV+DQGIM+TGA+NVVRGSRSSVEELLQIY HSESVAL VDNPE ++RIA+
Sbjct  134   LFADNSCRWLVSDQGIMSTGAVNVVRGSRSSVEELLQIYQHSESVALVVDNPEFFNRIAD  193

Query  1868  TFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTY  1689
             TF S   +RF+ILLWGEKSS+ ++ M   P+YSY +I +LG E        + A    T 
Sbjct  194   TFTSKVSLRFLILLWGEKSSLVTQGMQ-IPVYSYTDIKNLGQE--------KRAGSNDTR  244

Query  1688  EPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAY  1509
             + IN DD A ++YTSGTTGNPKGVMLTH NLLHQI +L   VP   GDRFLSMLP WHAY
Sbjct  245   KSINPDDTAAIMYTSGTTGNPKGVMLTHRNLLHQIKHLSAYVPAEAGDRFLSMLPSWHAY  304

Query  1508  ERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPAR  1329
             ERA EYFIF+ G EQ+YT++  LKEDLKRYQP YLISVPLVYETLYSGI KQI+TSS AR
Sbjct  305   ERACEYFIFTCGVEQMYTSIRFLKEDLKRYQPHYLISVPLVYETLYSGIQKQISTSSAAR  364

Query  1328  KLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLAR  1149
             K +AL  +KIS AY E KRIYEG CLTK+QK P Y+VS++DWL AR +AALL PLH+LA+
Sbjct  365   KYLALTLIKISLAYMEMKRIYEGMCLTKEQKPPMYIVSLVDWLRARVVAALLWPLHMLAK  424

Query  1148  KLVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
              L+Y KIH+SIGISKAGISGGGSL  H+DKFFEAI + LQNGYGLTE++PV+  R  +CN
Sbjct  425   ILIYKKIHASIGISKAGISGGGSLPIHIDKFFEAIGVILQNGYGLTETSPVICARTLSCN  484

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             V+GS G P+  TE K+VD ET+  L PGSKGIVK +GPQ+MKGYYKNP  TKQ ++E+GW
Sbjct  485   VIGSAGYPMHGTEFKIVDPETNTVLPPGSKGIVKVRGPQIMKGYYKNPTTTKQVLNESGW  544

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              NTGD+GWI P+HS GRSR   G IVLEGRAKDTIVLS+GENVEP EIEEAAM S LI Q
Sbjct  545   FNTGDMGWIAPHHSTGRSRRCGGLIVLEGRAKDTIVLSTGENVEPLEIEEAAMRSRLIDQ  604

Query  608   IVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCT  429
             IVVIGQD+RRLGA+++P+KEE    A+KL   D + +++S EK   L+++EL+KWT+ C+
Sbjct  605   IVVIGQDQRRLGAIIMPNKEE----AEKL---DPETSQLSSEKLKSLVYQELRKWTSECS  657

Query  428   FQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             FQ+GP+L+++EPFTIDNGL+TPTMK+RRDKV   YK++I  LY
Sbjct  658   FQVGPVLIVDEPFTIDNGLMTPTMKIRRDKVVAKYKDEINQLY  700



>ref|XP_002520618.1| long-chain-fatty-acid CoA ligase, putative [Ricinus communis]
 gb|EEF41754.1| long-chain-fatty-acid CoA ligase, putative [Ricinus communis]
Length=627

 Score =   852 bits (2202),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/595 (71%), Positives = 506/595 (85%), Gaps = 2/595 (0%)
 Frame = -3

Query  2228  WKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIA  2049
             WK VPDIW+T+AE++G+ +ALVDPYH+PPTN ++ +LE+EI++F+EGLRVIG+KP+EK+A
Sbjct  35    WKAVPDIWRTSAEKYGDRVALVDPYHDPPTNFTYNQLEQEILNFSEGLRVIGVKPNEKVA  94

Query  2048  LFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAE  1869
             LFADNSCRWLVADQGIM  GAINV RGSRSSVEELLQIYNHSESVAL VD+PE+++RIAE
Sbjct  95    LFADNSCRWLVADQGIMAMGAINVARGSRSSVEELLQIYNHSESVALVVDSPELFNRIAE  154

Query  1868  TFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTY  1689
             T  S+A + FIILLWGEKSS+  + MDG P+++Y +I++LG ES  AL  S +A  +Y Y
Sbjct  155   TLCSNAVITFIILLWGEKSSLAIKGMDGIPVFNYKQIVNLGRESRRALHDSDDAWQRYVY  214

Query  1688  EPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAY  1509
             E I+SDDVAT++YTSGTTGNPKGVMLTH+NLLHQI NL D  P  PGDRFLSMLPPWH Y
Sbjct  215   ETISSDDVATVIYTSGTTGNPKGVMLTHKNLLHQINNLLDVFPAEPGDRFLSMLPPWHVY  274

Query  1508  ERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPAR  1329
             ER  EY+I +LG EQVYT V NLKEDLK+YQP Y+ SVPLVYETL  GI KQI+ SS   
Sbjct  275   ERTCEYYIMTLGVEQVYTIVRNLKEDLKQYQPHYMFSVPLVYETL--GIQKQISRSSTIH  332

Query  1328  KLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLAR  1149
             KL+AL F+++S AY E KRIYEG  LT+ QKQPSYL+S+LD LWAR +AA+L P+H+LA+
Sbjct  333   KLVALTFIRVSLAYMEFKRIYEGTFLTRIQKQPSYLISLLDCLWARIMAAILLPVHMLAK  392

Query  1148  KLVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
              L Y KIH +IGISKAGIS GGSL  HVDKFFEAI +KLQNGYG+TES+PV A RRP CN
Sbjct  393   NLFYHKIHLAIGISKAGISAGGSLPMHVDKFFEAIGVKLQNGYGMTESSPVTAVRRPTCN  452

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             VLGSIG PIRHTE KVVDAETD+AL  GSKGIVK +GPQVMKGYYKNP+ATKQ +DE GW
Sbjct  453   VLGSIGHPIRHTEFKVVDAETDEALPDGSKGIVKVRGPQVMKGYYKNPWATKQVLDEEGW  512

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
             LNTGD+GWI P+HSIGRSR  SG +VLEGRAKDTIVLS+GEN+EPSEIEEAAM S LIQQ
Sbjct  513   LNTGDIGWIAPHHSIGRSRQCSGVVVLEGRAKDTIVLSTGENIEPSEIEEAAMRSALIQQ  572

Query  608   IVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKW  444
             I+VIGQD+RRLGA+++P+KEEVLLAAKKLS++D++ +E+ +E+ + ++ EEL+ W
Sbjct  573   IIVIGQDQRRLGAIIVPNKEEVLLAAKKLSIIDANTSELKKEQMASMLDEELRNW  627



>ref|XP_006414818.1| hypothetical protein EUTSA_v10024478mg [Eutrema salsugineum]
 gb|ESQ56271.1| hypothetical protein EUTSA_v10024478mg [Eutrema salsugineum]
Length=769

 Score =   857 bits (2214),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/681 (65%), Positives = 538/681 (79%), Gaps = 18/681 (3%)
 Frame = -3

Query  2333  RKFRVFCESTGMQI---RKCSPilesillsgngllssEWKTVPDIWKTAAEEFGNCIALV  2163
             R+FR+ C S   ++      SP  ++ L S        WK VPDIW+++AE++G+ +AL+
Sbjct  103   RRFRIHCVSKEKEVCILESSSPSGDAALRSNE------WKAVPDIWRSSAEKYGDKVALI  156

Query  2162  DPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAI  1983
             DPYH+PP  L++K+LE+EI+ FAEGLRV+G+K DEKIALFADNSCRWLV+DQGIM TGA+
Sbjct  157   DPYHDPPLKLTYKQLEQEILDFAEGLRVVGVKADEKIALFADNSCRWLVSDQGIMATGAV  216

Query  1982  NVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSIT  1803
             NVVRGSRSSVEELLQIY HSESVAL VDN E ++RIA+TF S A +RF+ILLWGEKSS+ 
Sbjct  217   NVVRGSRSSVEELLQIYRHSESVALVVDNLEFFNRIADTFTSKASLRFLILLWGEKSSLA  276

Query  1802  SEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPK  1623
             ++ M   P+Y+Y EI +LG E    L  S + R +  Y+ INSDD A ++YTSGTTGNPK
Sbjct  277   TQGMQ-IPVYTYTEIQNLGQERRAKLSGSNDTR-KSVYDSINSDDTAAIMYTSGTTGNPK  334

Query  1622  GVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVIN  1443
             GVMLTH NLLHQI +L   VP   GDRFLSMLP WHAYERA EYFIF+ G EQ+YT++  
Sbjct  335   GVMLTHRNLLHQIKHLSAYVPAQAGDRFLSMLPSWHAYERACEYFIFTCGVEQMYTSIRF  394

Query  1442  LKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYE  1263
             LK+DLKRYQP YLISVPLVYETLYSGI KQI+TSS ARK +AL  +KIS  Y E KRIYE
Sbjct  395   LKDDLKRYQPHYLISVPLVYETLYSGIQKQISTSSAARKFLALTLIKISLVYMEMKRIYE  454

Query  1262  GKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisggg  1083
             G CLTK+QK P Y+VS++D+L AR +AALL PLH+LA+ L+Y KIHSSIGISKAGISGGG
Sbjct  455   GMCLTKEQKPPMYIVSLVDYLRARVVAALLWPLHMLAKSLIYKKIHSSIGISKAGISGGG  514

Query  1082  slssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETD  903
             SL  H+DKFFEAI + LQNGYGLTE++PVV  R  +CNVLGS G P+  TE K+VD ET+
Sbjct  515   SLPIHIDKFFEAIGVILQNGYGLTETSPVVCARTLSCNVLGSAGHPMHGTEFKIVDPETN  574

Query  902   KALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSS  723
               L PGSKGIVK +GPQ+MKGYYKNP  TKQ ++E+GW NTGD GWI P+HS GRSR   
Sbjct  575   NVLPPGSKGIVKVRGPQIMKGYYKNPSTTKQVLNESGWFNTGDTGWIAPHHSTGRSRRCG  634

Query  722   GFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEV  543
             G IVLEGRAKDTIVLS+GENVEP EIEEAAM S LI+QIVVIGQD+RRLGA+++P+KEE 
Sbjct  635   GLIVLEGRAKDTIVLSTGENVEPLEIEEAAMRSRLIEQIVVIGQDQRRLGAIIIPNKEE-  693

Query  542   LLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTP  363
                A+K   VD + ++ S+EK   L+++EL+KWT+ C+FQ+GP+L++ EPFTIDNGL+TP
Sbjct  694   ---AEK---VDPETSKQSKEKLKSLVYQELRKWTSECSFQVGPVLIVEEPFTIDNGLMTP  747

Query  362   TMKVRRDKVTDLYKEQIEDLY  300
             TMK+RRDKV   YK++I  LY
Sbjct  748   TMKIRRDKVVAKYKDEINQLY  768



>emb|CDY12731.1| BnaC04g29100D [Brassica napus]
Length=725

 Score =   855 bits (2210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/701 (63%), Positives = 544/701 (78%), Gaps = 21/701 (3%)
 Frame = -3

Query  2390  SCRGFIKMKWQLNS----RGSTSRKFRVFCESTGMQIRKCSPilesillsgngllssEWK  2223
             S R F  ++++L S    R  + R+FR+ C S G  +        S       L  SEWK
Sbjct  41    SSRDFHDLRFRLISGPRVRVPSFRRFRIHCVSKGKDVTPII-ESSSSSGGDAALSYSEWK  99

Query  2222  TVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALF  2043
              VPDIW+++AE++G+ IALVDPYH+PP  L++ +LE+EI+ FAEGLR +G+K DEKIALF
Sbjct  100   AVPDIWRSSAEKYGDKIALVDPYHDPPLKLTYNQLEQEILDFAEGLRAVGVKADEKIALF  159

Query  2042  ADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETF  1863
             ADNSCRWLV+DQGIM+TGA+NVVRGSRSSVEELLQIY HSESVAL VDNPE ++RIA+TF
Sbjct  160   ADNSCRWLVSDQGIMSTGAVNVVRGSRSSVEELLQIYQHSESVALVVDNPEFFNRIADTF  219

Query  1862  HSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEP  1683
              S   +RF+ILLWGEKSS+ ++ M   P+YSY +I +LG E        + A    T + 
Sbjct  220   TSKVSLRFLILLWGEKSSLVTQGMQ-IPVYSYTDIKNLGQE--------KRAGSNDTRKS  270

Query  1682  INSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYER  1503
             IN DD A ++YTSGTTGNPKGVMLTH NLLHQI +L   VP   GDRFLSMLP WHAYER
Sbjct  271   INPDDTAAIMYTSGTTGNPKGVMLTHRNLLHQIKHLSAYVPAEAGDRFLSMLPSWHAYER  330

Query  1502  AAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKL  1323
             A EYFIF+ G EQ+YT++  LKEDLKRYQP YLISVPLVYETLYSGI KQI+TSS ARK 
Sbjct  331   ACEYFIFTCGVEQMYTSIRFLKEDLKRYQPHYLISVPLVYETLYSGIQKQISTSSAARKY  390

Query  1322  IALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKL  1143
             +AL  +KIS AY E KRIYEG CLTK+QK P Y+VS++DWL AR +AALL PLH+LA+ L
Sbjct  391   LALTLIKISLAYMEMKRIYEGMCLTKEQKPPMYIVSLVDWLRARVVAALLWPLHMLAKIL  450

Query  1142  VYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVL  963
             +Y KIH+SIGISKAGISGGGSL  H+DKFFEAI + LQNGYGLTE++PV+  R  +CNV+
Sbjct  451   IYKKIHASIGISKAGISGGGSLPIHIDKFFEAIGVILQNGYGLTETSPVICARTLSCNVI  510

Query  962   GSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLN  783
             GS G P+  TE K+VD ET+  L PGSKGIVK +GPQ+MKGYYKNP  TKQ ++E+GW N
Sbjct  511   GSAGYPMHGTEFKIVDPETNTVLPPGSKGIVKVRGPQIMKGYYKNPTTTKQVLNESGWFN  570

Query  782   TGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIV  603
             TGD+GWI P+HS GRSR   G IVLEGRAKDTIVLS+GENVEP EIEEAAM S LI QIV
Sbjct  571   TGDMGWIAPHHSTGRSRRCGGLIVLEGRAKDTIVLSTGENVEPLEIEEAAMRSRLIDQIV  630

Query  602   VIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQ  423
             VIGQD+RRLGA+++P+KEE    A+KL   D + +++S EK   L+++EL+KWT+ C+FQ
Sbjct  631   VIGQDQRRLGAIIMPNKEE----AEKL---DPETSQLSSEKLKSLVYQELRKWTSECSFQ  683

Query  422   IGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             +GP+L+++EPFTIDNGL+TPTMK+RRDKV   YK++I  LY
Sbjct  684   VGPVLIVDEPFTIDNGLMTPTMKIRRDKVVAKYKDEINQLY  724



>ref|XP_008665752.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
[Zea mays]
Length=798

 Score =   857 bits (2215),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/669 (65%), Positives = 540/669 (81%), Gaps = 3/669 (0%)
 Frame = -3

Query  2297  QIRK-CSPilesill-sgngllssEWKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFK  2124
             Q+RK CSP+LES LL  G+     EWK VPDIW+TAAE++ + +A+VDPYH PPT  ++ 
Sbjct  131   QVRKKCSPLLESALLPGGSDSTLHEWKAVPDIWRTAAEKYADLVAVVDPYHEPPTEWTYT  190

Query  2123  ELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEEL  1944
             +LE+EI+ F++GLR IG+ PDEK+ALFADNSCRWLVADQGIM TGAINVVRG+RSS EEL
Sbjct  191   QLEQEILDFSQGLRAIGVAPDEKLALFADNSCRWLVADQGIMATGAINVVRGTRSSDEEL  250

Query  1943  LQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYN  1764
              QIY HSES+AL VD+P+ ++R+AE+F S  + RFI+LLWG+KS I S+ +   P+Y Y 
Sbjct  251   FQIYTHSESIALVVDSPQFFNRLAESFMSRINTRFIVLLWGDKSCIDSQAIKDIPLYGYK  310

Query  1763  EIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQI  1584
             +II+LG ES  AL  S E   Q  +E I+ +DVATL+YTSGT+G PKGVMLTH NLLHQI
Sbjct  311   DIIELGRESRNALFLSDEQGQQDVFESISPEDVATLIYTSGTSGTPKGVMLTHRNLLHQI  370

Query  1583  LNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYL  1404
              NLW+ VP  PGDRFLSMLP WHAYERA EYFIFS G +QVYTTV  LKEDL+RYQPQY+
Sbjct  371   NNLWEIVPAEPGDRFLSMLPTWHAYERACEYFIFSYGIQQVYTTVKYLKEDLQRYQPQYI  430

Query  1403  ISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSY  1224
             ISVPLVYETLY  I +QI++SS ARK+IAL  +KISF Y EAK+IYEG  L+ +  +PS 
Sbjct  431   ISVPLVYETLYISIHRQISSSSAARKIIALSLIKISFLYMEAKKIYEGTVLSNNLVKPSV  490

Query  1223  LVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAI  1044
             +  ++ WLWAR +AA L PLH LA+ LVY KIHS+IGISKAGISGGGSL  HVDKFFEAI
Sbjct  491   IAYMMKWLWARLVAAFLWPLHNLAKILVYKKIHSAIGISKAGISGGGSLPMHVDKFFEAI  550

Query  1043  DIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKA  864
              IK+QNGYGLTE++PVVA RRP CNVLG++G PI+HTEIK+ D ET + L  GSKGIVK 
Sbjct  551   GIKVQNGYGLTETSPVVAARRPFCNVLGTVGHPIKHTEIKIFDIETGEVLPDGSKGIVKI  610

Query  863   KGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTI  684
             KGPQVMKGYYKNP AT +A D+ GW +TGD+GWIVP+H++G SR   G IVLEGRAKDTI
Sbjct  611   KGPQVMKGYYKNPSATNEAFDQEGWFSTGDVGWIVPHHAMGPSRQCGGMIVLEGRAKDTI  670

Query  683   VLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSD  504
             VLS+GENVEP+EIEEAA  S LI QIVVIGQD+RRLGA+++P+ +EVL  AK+ S++  D
Sbjct  671   VLSTGENVEPAEIEEAASRSTLINQIVVIGQDQRRLGAIIVPNNDEVLAEAKRKSILGED  730

Query  503   ATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLY  324
               E++++K   ++++EL+ WT  C+F++GPIL+++EPFTIDNGL+TPTMK+RRDKVTD Y
Sbjct  731   G-ELAKDKVMNMLYDELRTWTAHCSFRVGPILVVDEPFTIDNGLMTPTMKIRRDKVTDKY  789

Query  323   KEQIEDLYK  297
             + +IE L+K
Sbjct  790   RREIEALFK  798



>ref|XP_002868316.1| acyl-activating enzyme 15 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44575.1| acyl-activating enzyme 15 [Arabidopsis lyrata subsp. lyrata]
Length=727

 Score =   854 bits (2206),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/679 (65%), Positives = 544/679 (80%), Gaps = 13/679 (2%)
 Frame = -3

Query  2333  RKFRVFCESTGMQIRKCSPilesillsgngl-lssEWKTVPDIWKTAAEEFGNCIALVDP  2157
             ++FR+ CES   ++R  SP+LES  LSG     S+EWK VPDIW+++AE+FG+ +ALVDP
Sbjct  60    QRFRIHCESKEKEVRSSSPVLESSSLSGGSALRSNEWKAVPDIWRSSAEKFGDRVALVDP  119

Query  2156  YHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINV  1977
             YH+PP  L++KELE+EI+ FAEGLRV+G+K DEKIALFADNSCRWLV+DQGIM TGA+NV
Sbjct  120   YHDPPLKLTYKELEQEILDFAEGLRVLGVKADEKIALFADNSCRWLVSDQGIMATGAVNV  179

Query  1976  VRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSE  1797
             VRGSRSSVEELLQIY HSESVAL VDN E ++RIAE+F S A +RF+ILLWGEKSS+ ++
Sbjct  180   VRGSRSSVEELLQIYRHSESVALVVDNSEFFNRIAESFTSKASLRFLILLWGEKSSLVTQ  239

Query  1796  VMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGV  1617
              M   P+Y+Y EI + G ES   L  S + R  Y  + INSDD A ++YTSGTTGNPKGV
Sbjct  240   GMQ-IPVYTYAEIKNQGQESRAKLSGSNDTR-SYRNQFINSDDTAAIMYTSGTTGNPKGV  297

Query  1616  MLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLK  1437
             MLTH NLLHQI +L   VP   GD+FLSMLP WHAYERA+EYFIF+ G EQ+YT++  LK
Sbjct  298   MLTHRNLLHQIKHLSKYVPAQAGDKFLSMLPSWHAYERASEYFIFTCGVEQMYTSIRYLK  357

Query  1436  EDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGK  1257
             +DLKRYQP Y++SVPLVYETLYSG+ KQI+ SS  RK +AL  +++S AY E KRIYEG 
Sbjct  358   DDLKRYQPNYIVSVPLVYETLYSGMQKQISASSAGRKFLALTLIRVSMAYMEMKRIYEGM  417

Query  1256  CLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggsl  1077
             CLTK+QK P Y+V+ +DWLWAR +AALL PLH+LA++L+Y KI+SSIGISKAGISGGGSL
Sbjct  418   CLTKEQKPPMYIVAFVDWLWARVVAALLWPLHMLAKRLIYKKIYSSIGISKAGISGGGSL  477

Query  1076  ssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKA  897
               HVDKFFEAI + LQNGYGLTE++PVV  R  +CNVLGS G P+  TE K+VD ET+  
Sbjct  478   PIHVDKFFEAIGVILQNGYGLTETSPVVCARTLSCNVLGSAGNPMHGTEFKIVDPETNNV  537

Query  896   LSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGF  717
             L PGSKGI+K +GPQVMKGYYKNP  TK+ ++E+GW NTGD GWI P+HS GRSR   G 
Sbjct  538   LPPGSKGIIKVRGPQVMKGYYKNPSTTKKVLNESGWFNTGDTGWIAPHHSRGRSRRCGGV  597

Query  716   IVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLL  537
             IVLEGRAKDTIVLS+GENVEP EIEEAAM S LI+QIVVIGQD+RRLGA+++P+KEE   
Sbjct  598   IVLEGRAKDTIVLSTGENVEPLEIEEAAMRSRLIEQIVVIGQDRRRLGAIIIPNKEE---  654

Query  536   AAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTM  357
              A+++        E S+E    L+++EL+KWT+ C+FQ+GP+L+++EPFTIDNGL+TPTM
Sbjct  655   -AQRVD------PETSKETQKSLVYQELKKWTSECSFQVGPVLIVDEPFTIDNGLMTPTM  707

Query  356   KVRRDKVTDLYKEQIEDLY  300
             K+RRDKV   YK++I+ LY
Sbjct  708   KIRRDKVVAKYKDEIDQLY  726



>ref|XP_006665086.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic-like 
isoform X1 [Oryza brachyantha]
Length=642

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/641 (65%), Positives = 526/641 (82%), Gaps = 1/641 (0%)
 Frame = -3

Query  2219  VPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFA  2040
             VPDIW+TAAE++ + +ALVDPYH PP+ L++K+LE+EI+ F++GLRVIG+ PDEK+ALFA
Sbjct  3     VPDIWRTAAEKYADRVALVDPYHEPPSELTYKQLEQEILDFSQGLRVIGVAPDEKVALFA  62

Query  2039  DNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFH  1860
             DNSCRWLVADQGIM TGAINVVRG+RSS EEL QIY HSES+AL VD+P+ ++R+AE+F 
Sbjct  63    DNSCRWLVADQGIMATGAINVVRGTRSSDEELFQIYTHSESIALVVDSPQFFNRLAESFI  122

Query  1859  SHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPI  1680
             S  +  F++LLWGEKS + SE ++G P+Y + +I  LG+ES   L  S+E   Q  +E I
Sbjct  123   SRINAGFVVLLWGEKSCLNSEAVNGIPLYDFKDITQLGHESRNTLRQSREQDQQVVFETI  182

Query  1679  NSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERA  1500
               DDVATL+YTSGT+G PKGVMLTH NLLHQI NLWD VP VPGDRFLSMLPPWHAYERA
Sbjct  183   TPDDVATLIYTSGTSGAPKGVMLTHRNLLHQIKNLWDFVPAVPGDRFLSMLPPWHAYERA  242

Query  1499  AEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLI  1320
             +EYFIF+ G +QVYTTV  LKEDL++YQPQY++SVPLVYETLYS I +QIN+SS ARK+I
Sbjct  243   SEYFIFTYGIQQVYTTVKYLKEDLQQYQPQYIVSVPLVYETLYSSIQRQINSSSTARKVI  302

Query  1319  ALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLV  1140
             AL  +KIS  Y EAKRIYEG  L+ +  + S++V +++WL A  +A LL PLH LA KLV
Sbjct  303   ALALIKISLLYMEAKRIYEGTVLSNNPVKQSFIVYMVNWLSASIVAGLLWPLHNLANKLV  362

Query  1139  YskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLG  960
             Y KIHS+IGISKAGISGGGSL  HVD+FFEAI +K+QNGYGLTE++PVVA RRP CNVLG
Sbjct  363   YKKIHSAIGISKAGISGGGSLPMHVDRFFEAIGVKVQNGYGLTETSPVVAARRPFCNVLG  422

Query  959   SIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNT  780
             ++G P++HTEIK+VD ET + +  GSKG+VK +GPQVMKGYYKNP AT + +D+ GW +T
Sbjct  423   TVGHPVKHTEIKIVDIETGEVIPDGSKGVVKVRGPQVMKGYYKNPSATNKVLDQEGWFDT  482

Query  779   GDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVV  600
             GD+GWI P+   G SR   G +VLEGRAKDTIVL++GENVEP+EIEEAA+ S+LI QIVV
Sbjct  483   GDIGWIAPHCPTGSSRKCGGMLVLEGRAKDTIVLTTGENVEPAEIEEAAIRSDLINQIVV  542

Query  599   IGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQI  420
             +GQDKRRLGA+++P+ +E L  AK+ S++D    E++++K   L+++EL+ WT+GC+FQI
Sbjct  543   VGQDKRRLGAIIVPNYDEALATAKRKSILDG-TNELAKDKVLNLLYDELRTWTSGCSFQI  601

Query  419   GPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             GPIL+++EPFT+DNGLLTPT+K+RRDKVT  Y ++I+ LYK
Sbjct  602   GPILIVDEPFTVDNGLLTPTLKIRRDKVTAKYNKEIDGLYK  642



>ref|XP_010532733.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
isoform X3 [Tarenaya hassleriana]
Length=741

 Score =   853 bits (2203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/706 (63%), Positives = 558/706 (79%), Gaps = 24/706 (3%)
 Frame = -3

Query  2393  MSCRGFIKMKWQLNSRGSTSRKFRVFCES--TGMQIRKCSPilesillsg-ngllssEWK  2223
             + CRGF     +     S+ R+FR+ C+S     ++R+CSP+LE   LSG   L SSEWK
Sbjct  53    LGCRGF-----RPGFGISSYRRFRIHCDSKIQEKEVRRCSPLLERSALSGGVALSSSEWK  107

Query  2222  TVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALF  2043
              VPDIW+++AE++G+ +ALVDPYH+PP+NL++K+LE+EI+ FAEGLR++G+KPDEKIALF
Sbjct  108   AVPDIWRSSAEKYGDRVALVDPYHDPPSNLTYKQLEQEILDFAEGLRIVGVKPDEKIALF  167

Query  2042  ADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETF  1863
             ADNSCRWLV DQGIM TGA+NVVRGSRSSVEELLQIY+HSESVAL VDNPE ++RI++ F
Sbjct  168   ADNSCRWLVTDQGIMATGAVNVVRGSRSSVEELLQIYSHSESVALVVDNPEFFNRISKKF  227

Query  1862  HSHADVRFIILLWGEKSSITSEVMDG--RPIYSYNEIIDLGNESHMALLHSQEARHQYTY  1689
              +    RF+ILLWGEKSS+   VM+G   P+YSY EII+   E     L S +   +Y Y
Sbjct  228   STKVSPRFVILLWGEKSSL---VMEGIRSPVYSYTEIINFRREKLRNPLGSDDD-GKYEY  283

Query  1688  EPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAY  1509
             E IN DD A ++YTSGTTGNPKGVMLTH NLLHQI NL++ VP  PGDRFLSMLP WHAY
Sbjct  284   EFINPDDTAAIMYTSGTTGNPKGVMLTHRNLLHQINNLFEIVPAEPGDRFLSMLPSWHAY  343

Query  1508  ERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPAR  1329
             ER+  + +    C++         +DLKRYQP YLISVPLVYETLYSGI KQI+TSS AR
Sbjct  344   ERSFSFALTDPMCQRT--------DDLKRYQPHYLISVPLVYETLYSGIQKQISTSSAAR  395

Query  1328  KLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLAR  1149
             K +AL  +KIS AY E +RIYEG CLTK+Q  P YL+S++DWL AR  AA+L PLH+LA+
Sbjct  396   KFVALTLIKISLAYMEMRRIYEGVCLTKNQNPPPYLISLVDWLIARVAAAILWPLHMLAK  455

Query  1148  KLVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
             + VY KI SSIGISKAGISGGGSL  HVDKFFEA+ + +QNGYGLTE++PV++ RR +CN
Sbjct  456   RFVYRKILSSIGISKAGISGGGSLPMHVDKFFEAVGVNVQNGYGLTETSPVISARRLSCN  515

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             VLGS+G PI+ TE KVVD+ET+  L PGSKGIVK +GPQVMKGYYKNP ATKQ +DE+GW
Sbjct  516   VLGSVGHPIQDTEFKVVDSETNNVLPPGSKGIVKVRGPQVMKGYYKNPLATKQVLDEDGW  575

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              +TGD+GWI P+H IGRS +  G IVLEGRAKDTIVLS+GENVEP EIEEAA+ S+LIQQ
Sbjct  576   FDTGDMGWIAPHHLIGRSCSCGGVIVLEGRAKDTIVLSTGENVEPLEIEEAALRSSLIQQ  635

Query  608   IVVIGQDKRRLGALVLPHKEEVLLAAK-KLSVVDSDATE-VSEEKTSKLIHEELQKWTTG  435
             IVVIGQD+RR+GA+++P+KEE  +A K   S  D  A+E +S+EK + +++EEL+KWT+ 
Sbjct  636   IVVIGQDQRRIGAIIVPNKEEADIAPKNNNSDTDPGASELISKEKLTSMVYEELRKWTSE  695

Query  434   CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             C++Q+GP+L+++EPFTIDNGL+TPTMK+RRDKV   YK++I  LYK
Sbjct  696   CSYQVGPVLIVDEPFTIDNGLMTPTMKIRRDKVVKKYKDEIAKLYK  741



>ref|XP_004981061.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic-like 
[Setaria italica]
Length=725

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/666 (65%), Positives = 541/666 (81%), Gaps = 2/666 (0%)
 Frame = -3

Query  2291  RKCSPilesill-sgngllssEWKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELE  2115
             RKCSP+LES+LL   + L   EWK VPDIW+TAAE++ + +A++DPYH PPT  ++ +LE
Sbjct  61    RKCSPLLESVLLPGRSDLTVHEWKAVPDIWRTAAEKYPDLVAVIDPYHEPPTEWTYTQLE  120

Query  2114  KEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQI  1935
             +EI+ F++GLR IG+ PDEK+ALFADNSCRWLVADQGIM TGAINVVRG+RSS EEL QI
Sbjct  121   QEILDFSQGLRAIGVAPDEKLALFADNSCRWLVADQGIMATGAINVVRGTRSSDEELYQI  180

Query  1934  YNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEII  1755
             Y HSES+AL VD+P+ ++R+AE+F    + RFI+LLWG+KSSI S+ +   P+YSY +I 
Sbjct  181   YTHSESIALVVDSPQFFNRLAESFIPRINPRFIMLLWGDKSSIDSQAVKDIPLYSYKDIT  240

Query  1754  DLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNL  1575
             +LG ES  AL  S +   Q  +E I+ +DVATL+YTSGT+G PKGVMLTH NLLHQI NL
Sbjct  241   ELGRESRNALFLSGQQGQQDVFETISPEDVATLIYTSGTSGTPKGVMLTHRNLLHQINNL  300

Query  1574  WDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISV  1395
             WD VP   GDRFLSMLPPWHAYERA EYFIF+ G +QVYTTV  LKEDL+RYQPQY+ISV
Sbjct  301   WDIVPAERGDRFLSMLPPWHAYERACEYFIFTYGIQQVYTTVKYLKEDLQRYQPQYIISV  360

Query  1394  PLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVS  1215
             PLVYETLYS I +QI++SS ARK+IAL  +KIS  Y EAK+IYEG  L+ +  +PS++V 
Sbjct  361   PLVYETLYSSIHRQISSSSAARKIIALSLIKISLLYMEAKKIYEGTVLSNNTAEPSFIVY  420

Query  1214  VLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAIDIK  1035
             ++ WLWAR +AA L PLH LA+ LVY KIHS+IGISKAGISGGGSL  HVDKFFEAI IK
Sbjct  421   MVKWLWARFVAAFLWPLHNLAKILVYKKIHSAIGISKAGISGGGSLPMHVDKFFEAIGIK  480

Query  1034  LQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGP  855
             +QNGYGLTE++PVVA RRP CNVLG++G P++HTEIKV D ET + L  GSKGIVK KGP
Sbjct  481   VQNGYGLTETSPVVAARRPFCNVLGTVGHPVKHTEIKVFDIETGEVLPDGSKGIVKIKGP  540

Query  854   QVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLS  675
             QVMKGYYKNP +T +A+D+ GW +TGD+GWIVP+H++G SR   G +VLEGRAKDTIVLS
Sbjct  541   QVMKGYYKNPSSTNEALDQEGWFSTGDIGWIVPHHAVGPSRKCGGMLVLEGRAKDTIVLS  600

Query  674   SGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATE  495
             +GENVEP+EIEEAA  SNLI QIVVIGQD+RRLGA+++P+ +EVL  AK+ S++D +  E
Sbjct  601   TGENVEPAEIEEAAGRSNLINQIVVIGQDQRRLGAIIVPNNDEVLAEAKRKSILDENG-E  659

Query  494   VSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQ  315
             + ++K   ++++EL+ WT  C+F+IGPI++ +EPFTIDNGL+TPTMK+RRDKVT  Y+ +
Sbjct  660   LGKDKVMNMLYDELRIWTAHCSFRIGPIMIADEPFTIDNGLMTPTMKIRRDKVTAKYQRE  719

Query  314   IEDLYK  297
             IE L+K
Sbjct  720   IEALFK  725



>ref|NP_001051878.1| Os03g0845500 [Oryza sativa Japonica Group]
 gb|AAS07378.1| putative AMP-binding protein [Oryza sativa Japonica Group]
 gb|ABF99868.1| AMP-binding protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13792.1| Os03g0845500 [Oryza sativa Japonica Group]
 gb|EEE60290.1| hypothetical protein OsJ_13349 [Oryza sativa Japonica Group]
Length=750

 Score =   845 bits (2182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/666 (65%), Positives = 542/666 (81%), Gaps = 2/666 (0%)
 Frame = -3

Query  2291  RKCSPilesill-sgngllssEWKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELE  2115
             RKCSP+LES LL  GNGL + +W  VPDIW+TAAE++ + +ALVDPYH PP+ L++K+LE
Sbjct  86    RKCSPLLESALLPGGNGLTTHDWMAVPDIWRTAAEKYADRVALVDPYHEPPSELTYKQLE  145

Query  2114  KEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQI  1935
             +EI+ F++GLR IG+ PDEKIALFADNSCRWLVADQGIM TGAINVVRG+RSS EEL QI
Sbjct  146   QEILDFSQGLRAIGVAPDEKIALFADNSCRWLVADQGIMATGAINVVRGTRSSDEELFQI  205

Query  1934  YNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEII  1755
             Y HSES+AL VD+P+ ++R+AE+F S  + RFI+LLWGEKS + SEV++G P+Y + +I 
Sbjct  206   YTHSESIALVVDSPQFFNRLAESFISRINARFIVLLWGEKSCLNSEVVNGIPLYDFKDIT  265

Query  1754  DLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNL  1575
              LG ES   L HS E   Q  +E I  DDVATL+YTSGT+G PKGVMLTH NLLHQI NL
Sbjct  266   QLGRESRNTLRHSHEQGQQVVFETITPDDVATLIYTSGTSGTPKGVMLTHRNLLHQIKNL  325

Query  1574  WDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISV  1395
             WD VP VPGDRFLSMLPPWHAYERA+EYFIF+ G +QVYTTV  LKEDL+RYQPQY++SV
Sbjct  326   WDFVPAVPGDRFLSMLPPWHAYERASEYFIFTYGIQQVYTTVKYLKEDLQRYQPQYIVSV  385

Query  1394  PLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVS  1215
             PLVYE LYS I +QI++SS ARK +AL  +KIS  Y EAKRIYEG  L+ +  +PS++V 
Sbjct  386   PLVYEILYSSIQRQISSSSTARKFVALALIKISLLYMEAKRIYEGTVLSNNPVKPSFIVY  445

Query  1214  VLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAIDIK  1035
             +++WL AR +AALL PLH LA+ LVY KIHS+IGISKAGISGGGSL  HVDKFFEAI +K
Sbjct  446   MVNWLSARIVAALLWPLHNLAKTLVYKKIHSAIGISKAGISGGGSLPMHVDKFFEAIGVK  505

Query  1034  LQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGP  855
             +QNGYGLTE++PVVA RRP CNVLG++G P++HTEIKVVD ET + L  GSKG+VK +GP
Sbjct  506   VQNGYGLTETSPVVAARRPFCNVLGTVGHPVKHTEIKVVDMETGEVLPDGSKGVVKVRGP  565

Query  854   QVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLS  675
             QVMKGYYKNP AT + +D+ GW +TGD+GWI P+   G SR   G +VLEGRAKDTIVL+
Sbjct  566   QVMKGYYKNPSATNKVLDQEGWFDTGDIGWIAPHCPTGPSRKCGGMLVLEGRAKDTIVLT  625

Query  674   SGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATE  495
             +GENVEP+EIEEAA  S+LI QIVV+GQDKRR+GAL++P+ +EVL  AK+ S++D +  E
Sbjct  626   TGENVEPAEIEEAASRSDLINQIVVVGQDKRRIGALIVPNYDEVLATAKRKSILDGN-NE  684

Query  494   VSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQ  315
             ++++K   L+++EL+ W   C+FQIGPIL+++EPFT+DNGLLTPT+K+RRDKVT  Y  +
Sbjct  685   LAKDKVLNLLYDELRTWMVDCSFQIGPILIVDEPFTVDNGLLTPTLKLRRDKVTAKYHRE  744

Query  314   IEDLYK  297
             I+ LYK
Sbjct  745   IDALYK  750



>emb|CAB10186.1| AMP-binding protein [Arabidopsis thaliana]
 emb|CAB78449.1| AMP-binding protein [Arabidopsis thaliana]
Length=698

 Score =   839 bits (2168),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/643 (66%), Positives = 519/643 (81%), Gaps = 17/643 (3%)
 Frame = -3

Query  2228  WKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIA  2049
             WK VPDIW+++AE++G+ +ALVDPYH+PP  L++K+LE+EI+ FAEGLRV+G+K DEKIA
Sbjct  72    WKAVPDIWRSSAEKYGDRVALVDPYHDPPLKLTYKQLEQEILDFAEGLRVLGVKADEKIA  131

Query  2048  LFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAE  1869
             LFADNSCRWLV+DQG     A+NVVRGSRSSVEELLQIY HSESVA+ VDNPE ++RIAE
Sbjct  132   LFADNSCRWLVSDQG-----AVNVVRGSRSSVEELLQIYRHSESVAIVVDNPEFFNRIAE  186

Query  1868  TFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTY  1689
             +F S A +RF+ILLWGEKSS+ ++ M   P+YSY EII+ G ES   L  S + R  Y  
Sbjct  187   SFTSKASLRFLILLWGEKSSLVTQGMQ-IPVYSYAEIINQGQESRAKLSASNDTR-SYRN  244

Query  1688  EPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAY  1509
             + I+SDD A ++YTSGTTGNPKGVMLTH NLLHQI +L   VP   GD+FLSMLP WHAY
Sbjct  245   QFIDSDDTAAIMYTSGTTGNPKGVMLTHRNLLHQIKHLSKYVPAQAGDKFLSMLPSWHAY  304

Query  1508  ERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPAR  1329
             ERA+EYFIF+ G EQ+YT++  LK+DLKRYQP Y++SVPLVYETLYSGI KQI+ SS  R
Sbjct  305   ERASEYFIFTCGVEQMYTSIRYLKDDLKRYQPNYIVSVPLVYETLYSGIQKQISASSAGR  364

Query  1328  KLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLAR  1149
             K +AL  +K+S AY E KRIYEG CLTK+QK P Y+V+ +DWLWAR IAALL PLH+LA+
Sbjct  365   KFLALTLIKVSMAYMEMKRIYEGMCLTKEQKPPMYIVAFVDWLWARVIAALLWPLHMLAK  424

Query  1148  KLVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
             KL+Y KIHSSIGISKAGISGGGSL  HVDKFFEAI + LQNGYGLTE++PVV  R  +CN
Sbjct  425   KLIYKKIHSSIGISKAGISGGGSLPIHVDKFFEAIGVILQNGYGLTETSPVVCARTLSCN  484

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             VLGS G P+  TE K+VD ET+  L PGSKGI+K +GPQVMKGYYKNP  TKQ ++E+GW
Sbjct  485   VLGSAGHPMHGTEFKIVDPETNNVLPPGSKGIIKVRGPQVMKGYYKNPSTTKQVLNESGW  544

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              NTGD GWI P+HS GRSR+  G IVLEGRAKDTIVLS+GENVEP EIEEAAM S +I+Q
Sbjct  545   FNTGDTGWIAPHHSKGRSRHCGGVIVLEGRAKDTIVLSTGENVEPLEIEEAAMRSRVIEQ  604

Query  608   IVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCT  429
             IVVIGQD+RRLGA+++P+KEE    A+++        E S+E    L+++EL+KWT+ C+
Sbjct  605   IVVIGQDRRRLGAIIIPNKEE----AQRVD------PETSKETLKSLVYQELRKWTSECS  654

Query  428   FQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             FQ+GP+L++++PFTIDNGL+TPTMK+RRD V   YKE+I+ LY
Sbjct  655   FQVGPVLIVDDPFTIDNGLMTPTMKIRRDMVVAKYKEEIDQLY  697



>ref|XP_010229410.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
[Brachypodium distachyon]
Length=726

 Score =   835 bits (2158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/666 (65%), Positives = 538/666 (81%), Gaps = 2/666 (0%)
 Frame = -3

Query  2291  RKCSPilesill-sgngllssEWKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELE  2115
             RKCSP+LES LL  GN L   EWK VPDIW+TAAE++ + +ALVDPYH+PP+ L++K+LE
Sbjct  62    RKCSPLLESALLPGGNDLAVHEWKAVPDIWRTAAEKYADRVALVDPYHDPPSELTYKQLE  121

Query  2114  KEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQI  1935
             + I+ F+ GLR +G+ PDEK+ALFADNSCRWLVADQGIM TGAINVVRG+RSS EEL QI
Sbjct  122   QHILDFSHGLRAVGVAPDEKLALFADNSCRWLVADQGIMATGAINVVRGTRSSDEELFQI  181

Query  1934  YNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEII  1755
             Y HSES+AL VD+P+ ++R+AE+F    + RF++LLWG+KSS+ S+ +   P+Y YN+I 
Sbjct  182   YTHSESIALVVDSPQFFNRLAESFTLRINARFVVLLWGDKSSLNSKAVKDIPVYDYNDIT  241

Query  1754  DLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNL  1575
              LG E+  A+ +S E   Q  +E I  +DVATL+YTSGT G PKGVMLTH NLLHQI NL
Sbjct  242   QLGRENRNAVHNSHEQGQQGVFEAITPEDVATLIYTSGTGGTPKGVMLTHRNLLHQINNL  301

Query  1574  WDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISV  1395
             WD VP VPGDRFLSMLPPWHAYER+ EYFIF+ G +QVYT V  LKEDL+RYQP Y+ISV
Sbjct  302   WDIVPAVPGDRFLSMLPPWHAYERSTEYFIFTCGIQQVYTAVKYLKEDLQRYQPHYVISV  361

Query  1394  PLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVS  1215
             PLVYETLYS I +QI++SS ARK +AL  +KIS  Y E+K+IYEG  L+ +  +PS++V 
Sbjct  362   PLVYETLYSSIQRQISSSSTARKTLALALIKISLQYMESKKIYEGTVLSNNPVEPSHIVC  421

Query  1214  VLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAIDIK  1035
             +++ LWAR I ALL P H LA+ LVY KIHSSIGISKAGISGGGSL  HVDKFFEAI IK
Sbjct  422   MVNCLWARIIVALLWPFHNLAKLLVYKKIHSSIGISKAGISGGGSLPMHVDKFFEAIGIK  481

Query  1034  LQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGP  855
             +QNGYGLTE++PVVA RRP CNVLG++G P++HTEIKVVD ET +AL  GSKGIVK KGP
Sbjct  482   VQNGYGLTETSPVVAARRPFCNVLGTVGHPVKHTEIKVVDIETGEALPDGSKGIVKIKGP  541

Query  854   QVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLS  675
              VMKGYYKNP AT +A+D+ GW NTGD+GW+ P+H+ G SR   G +VLEGRAKDTIVL+
Sbjct  542   PVMKGYYKNPSATNKALDQEGWFNTGDIGWLAPHHTTGPSRKCGGMLVLEGRAKDTIVLT  601

Query  674   SGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATE  495
             +GENVEP+E+EEAA  SNLIQQI+VIGQD+RRLGA+++P+ +EVL  AK+ S +D D  E
Sbjct  602   TGENVEPAELEEAAGRSNLIQQIMVIGQDRRRLGAIIVPNNDEVLATAKRKSRLDGD-NE  660

Query  494   VSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQ  315
             +++     L+++EL+ WT GC+FQIGPIL+++EPFTIDNGL+TPTMK+RRDKV   Y+ +
Sbjct  661   LAKATILNLLYDELRAWTVGCSFQIGPILIVDEPFTIDNGLMTPTMKIRRDKVAAKYQRE  720

Query  314   IEDLYK  297
             IE+LYK
Sbjct  721   IEELYK  726



>gb|KDO47449.1| hypothetical protein CISIN_1g0065302mg, partial [Citrus sinensis]
Length=586

 Score =   813 bits (2101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/580 (70%), Positives = 493/580 (85%), Gaps = 0/580 (0%)
 Frame = -3

Query  2120  LEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELL  1941
             LE+EI+ FAEGLRVIG+KP+EK++LF+DNSCRWLVADQG++ TGAINVVRGSRSS EELL
Sbjct  1     LEQEILDFAEGLRVIGVKPEEKLSLFSDNSCRWLVADQGMLATGAINVVRGSRSSSEELL  60

Query  1940  QIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNE  1761
              IYNHSESVALAV+NPE ++RIAET  S A +RFIILLWG+KSS+  ++++  P++SY+E
Sbjct  61    HIYNHSESVALAVENPEFFNRIAETLCSKAAMRFIILLWGKKSSVAPDIVEEIPVFSYDE  120

Query  1760  IIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQIL  1581
             IIDLG ES  A   S +AR  Y YE I SDD+AT VYTSGTTGNPKGVMLTH+NLLHQI 
Sbjct  121   IIDLGRESRKAFSDSNDARKHYKYETIGSDDIATYVYTSGTTGNPKGVMLTHKNLLHQIR  180

Query  1580  NLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLI  1401
             +L+D VP   GD+FLSMLPPWH YERA  YFIFS G E +YT V NLK+DL+RYQP Y+I
Sbjct  181   SLYDIVPAENGDKFLSMLPPWHVYERACGYFIFSRGIELMYTAVRNLKDDLQRYQPHYMI  240

Query  1400  SVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYL  1221
             SVPLVYETLYSGI KQI TSS AR+++A   ++ISFAY   KRIYEG CLT++QKQPSYL
Sbjct  241   SVPLVYETLYSGIQKQIFTSSAARRVVARALIRISFAYTAFKRIYEGFCLTRNQKQPSYL  300

Query  1220  VSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAID  1041
             V+++DWLWAR I A+L PLHLLA KLVY KI S+IGISKAG+SGGGSL  H+D F+EAI 
Sbjct  301   VALIDWLWARIICAILWPLHLLAEKLVYKKIQSAIGISKAGVSGGGSLPMHIDLFYEAIG  360

Query  1040  IKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAK  861
             +K+Q GYGLTES+PV+A RRP CNVLGS+G PI HTEIK+VDAET++ L  GSKGIVK +
Sbjct  361   VKVQVGYGLTESSPVIAARRPTCNVLGSVGHPINHTEIKIVDAETNEVLPAGSKGIVKVR  420

Query  860   GPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIV  681
             G QVM+GY+KNP ATKQA+DE+GWLNTGD+GWI P+HS GRSR   G +VLEGRAKDTIV
Sbjct  421   GSQVMQGYFKNPSATKQALDEDGWLNTGDIGWIAPHHSRGRSRRCGGVLVLEGRAKDTIV  480

Query  680   LSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDA  501
             LS+GENVEP E+EEAA+ S+LI+QIVVIGQD+RR GA+++P KEEVL+AAK+LS+V +DA
Sbjct  481   LSTGENVEPLELEEAALRSSLIRQIVVIGQDQRRPGAIIVPDKEEVLMAAKRLSIVHADA  540

Query  500   TEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTID  381
             +E+S+EKT  L++ EL+KWT+ C+FQIGPI +++EPFT++
Sbjct  541   SELSKEKTISLLYGELRKWTSKCSFQIGPIHVVDEPFTVN  580



>gb|EMS60031.1| Long-chain-fatty-acid--CoA ligase FadD15 [Triticum urartu]
Length=696

 Score =   816 bits (2107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/685 (62%), Positives = 533/685 (78%), Gaps = 21/685 (3%)
 Frame = -3

Query  2291  RKCSPilesill-sgngllssEWKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELE  2115
             RKCSP+L+S LL  G+ L   EWK VPDIW+TAAE++ + +AL DPYH+PP+ L++K+LE
Sbjct  13    RKCSPLLDSALLPGGSELAVHEWKAVPDIWRTAAEKYADRVALRDPYHDPPSELTYKQLE  72

Query  2114  KEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQI  1935
             ++I+ F+ GLRV+G  PDEKIALFADNSCRWLVADQGIM TGAINVVRG++SS EEL QI
Sbjct  73    QQILDFSHGLRVVGGAPDEKIALFADNSCRWLVADQGIMATGAINVVRGTKSSDEELFQI  132

Query  1934  YNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEII  1755
             Y+HSES+AL VD+P+ ++R+AE+F S  + RFI+LLWG+KSS+ S+ +   P+Y YN+I 
Sbjct  133   YSHSESIALVVDSPQFFNRLAESFISRINARFIVLLWGDKSSLNSKAVMDIPVYDYNDIT  192

Query  1754  DLGNESHMALLHSQEAR---HQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQI  1584
             +LG E+  AL +S E      Q  +E I  +DVATL+YTSGT G PKGVMLTH NLLHQI
Sbjct  193   ELGRENRNALCYSSELSKQGQQGVFEAIGPEDVATLIYTSGTGGTPKGVMLTHRNLLHQI  252

Query  1583  LNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYL  1404
              NLW+ VP VPGDRFLSMLPPWHAYER+ EYFIF+ G +QVYTTV +LK DL+ +QP Y+
Sbjct  253   NNLWEIVPAVPGDRFLSMLPPWHAYERSTEYFIFTHGIQQVYTTVKHLKADLQHHQPHYI  312

Query  1403  ISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYE-------------  1263
             ISVPLVYETLYS I +QI+TSSPARK +AL  +KIS  + EAK+IYE             
Sbjct  313   ISVPLVYETLYSSIQRQISTSSPARKTVALALIKISLLFMEAKKIYELSQFSLSVFFFRY  372

Query  1262  ---GKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagis  1092
                G  L+    +PS++  + ++L AR +AALL PLH LA+ LVY KIHSSIGISKAGIS
Sbjct  373   SGKGTVLSNSPVKPSFIFYMFNYLRARIVAALLWPLHNLAKMLVYKKIHSSIGISKAGIS  432

Query  1091  gggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDA  912
             GGGSL  HVDKFFEAI IK+QNGYGLTE++PVVA RRP CNVLG++G PI+HTEIK+VD 
Sbjct  433   GGGSLPMHVDKFFEAIGIKVQNGYGLTETSPVVAARRPFCNVLGTVGHPIKHTEIKIVDI  492

Query  911   ETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSR  732
             ET + L  GSKGIVK KG  VMKGYYKNP AT +A+D  GW NTGD+GWI P+H+ G SR
Sbjct  493   ETGEVLPDGSKGIVKIKGLPVMKGYYKNPSATNKALDLEGWFNTGDIGWIAPHHATGPSR  552

Query  731   NSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHK  552
                G +VLEGRAKDTIVL++GENVEP+E+EEAA  S+LI QI+VIGQD+RRLGA+++P+ 
Sbjct  553   KCGGMLVLEGRAKDTIVLTTGENVEPAELEEAASRSSLIDQIMVIGQDRRRLGAIIVPNN  612

Query  551   EEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGL  372
             +EV+ AAK+    D +   ++++    L++ EL+ W  GC+FQIGP+L+++EPFTIDNGL
Sbjct  613   DEVVAAAKRKYSFDGN-NGLAKDTVMSLLYAELKTWMAGCSFQIGPVLVVDEPFTIDNGL  671

Query  371   LTPTMKVRRDKVTDLYKEQIEDLYK  297
             +TPTMK+RRDKV   Y+ +IE LYK
Sbjct  672   MTPTMKIRRDKVAAKYQSEIEALYK  696



>ref|XP_006414817.1| hypothetical protein EUTSA_v10024478mg [Eutrema salsugineum]
 gb|ESQ56270.1| hypothetical protein EUTSA_v10024478mg [Eutrema salsugineum]
Length=742

 Score =   806 bits (2083),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/681 (62%), Positives = 517/681 (76%), Gaps = 45/681 (7%)
 Frame = -3

Query  2333  RKFRVFCESTGMQI---RKCSPilesillsgngllssEWKTVPDIWKTAAEEFGNCIALV  2163
             R+FR+ C S   ++      SP  ++ L S        WK VPDIW+++AE++G+ +AL+
Sbjct  103   RRFRIHCVSKEKEVCILESSSPSGDAALRSNE------WKAVPDIWRSSAEKYGDKVALI  156

Query  2162  DPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAI  1983
             DPYH+PP  L++K+LE+EI+ FAEGLRV+G+K DEKIALFADNSCRWLV+DQGIM TGA+
Sbjct  157   DPYHDPPLKLTYKQLEQEILDFAEGLRVVGVKADEKIALFADNSCRWLVSDQGIMATGAV  216

Query  1982  NVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSIT  1803
             NVVRGSRSSVEELLQIY HSESVAL VDN E ++RIA+TF S A +RF+ILLWGEKSS+ 
Sbjct  217   NVVRGSRSSVEELLQIYRHSESVALVVDNLEFFNRIADTFTSKASLRFLILLWGEKSSLA  276

Query  1802  SEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPK  1623
             ++ M   P+Y+Y EI +LG E    L  S + R +  Y+ INSDD A ++YTSGTTGNPK
Sbjct  277   TQGMQ-IPVYTYTEIQNLGQERRAKLSGSNDTR-KSVYDSINSDDTAAIMYTSGTTGNPK  334

Query  1622  GVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVIN  1443
             GVMLTH NLLHQI +L   VP   GDRFLSMLP WHAYERA EYFIF+ G EQ+YT++  
Sbjct  335   GVMLTHRNLLHQIKHLSAYVPAQAGDRFLSMLPSWHAYERACEYFIFTCGVEQMYTSIRF  394

Query  1442  LKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYE  1263
             LK+DLKRYQP YLISVPLVYETLYSGI KQI+TSS ARK +AL  +KIS  Y E KRIYE
Sbjct  395   LKDDLKRYQPHYLISVPLVYETLYSGIQKQISTSSAARKFLALTLIKISLVYMEMKRIYE  454

Query  1262  GKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisggg  1083
             G CLTK+QK P Y+VS++D+L AR +AALL PLH+LA+ L+Y KIHSSIGISKAGISGGG
Sbjct  455   GMCLTKEQKPPMYIVSLVDYLRARVVAALLWPLHMLAKSLIYKKIHSSIGISKAGISGGG  514

Query  1082  slssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETD  903
             SL  H+DKFFE                           VLGS G P+  TE K+VD ET+
Sbjct  515   SLPIHIDKFFE---------------------------VLGSAGHPMHGTEFKIVDPETN  547

Query  902   KALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSS  723
               L PGSKGIVK +GPQ+MKGYYKNP  TKQ ++E+GW NTGD GWI P+HS GRSR   
Sbjct  548   NVLPPGSKGIVKVRGPQIMKGYYKNPSTTKQVLNESGWFNTGDTGWIAPHHSTGRSRRCG  607

Query  722   GFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEV  543
             G IVLEGRAKDTIVLS+GENVEP EIEEAAM S LI+QIVVIGQD+RRLGA+++P+KEE 
Sbjct  608   GLIVLEGRAKDTIVLSTGENVEPLEIEEAAMRSRLIEQIVVIGQDQRRLGAIIIPNKEE-  666

Query  542   LLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTP  363
                A+K   VD + ++ S+EK   L+++EL+KWT+ C+FQ+GP+L++ EPFTIDNGL+TP
Sbjct  667   ---AEK---VDPETSKQSKEKLKSLVYQELRKWTSECSFQVGPVLIVEEPFTIDNGLMTP  720

Query  362   TMKVRRDKVTDLYKEQIEDLY  300
             TMK+RRDKV   YK++I  LY
Sbjct  721   TMKIRRDKVVAKYKDEINQLY  741



>gb|EEC76517.1| hypothetical protein OsI_14303 [Oryza sativa Indica Group]
Length=682

 Score =   791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/666 (63%), Positives = 519/666 (78%), Gaps = 41/666 (6%)
 Frame = -3

Query  2291  RKCSPilesill-sgngllssEWKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELE  2115
             RKCSP+LES LL  GNGL + +W  VPDIW+TAAE++ + +ALVDPYH PP+ L++K+LE
Sbjct  57    RKCSPLLESALLPGGNGLTTHDWMAVPDIWRTAAEKYADRVALVDPYHEPPSELTYKQLE  116

Query  2114  KEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQI  1935
             +EI+ F++GLR IG+ PDEKIALFADNSCRWLVADQGIM TGAINVVRG+RSS EEL QI
Sbjct  117   QEILDFSQGLRAIGVAPDEKIALFADNSCRWLVADQGIMATGAINVVRGTRSSDEELFQI  176

Query  1934  YNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEII  1755
             Y HSES+AL VD+P+ ++R+AE+F S  + RFI+LLWG+                     
Sbjct  177   YTHSESIALVVDSPQFFNRLAESFISRINARFIVLLWGQ---------------------  215

Query  1754  DLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNL  1575
                               Q  +E I  DDVATL+YTSGT+G PKGVMLTH NLLHQI NL
Sbjct  216   ------------------QVVFETITPDDVATLIYTSGTSGTPKGVMLTHRNLLHQIKNL  257

Query  1574  WDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISV  1395
             WD VP VPGDRFLSMLPPWHAYERA+EYFIF+ G +QVYTTV  LKEDL+RYQPQY++SV
Sbjct  258   WDFVPAVPGDRFLSMLPPWHAYERASEYFIFTYGIQQVYTTVKYLKEDLQRYQPQYIVSV  317

Query  1394  PLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVS  1215
             PLVYE LYS I +QI++SS ARK +AL  +KIS  Y EAKRIYEG  L+ +  +PS++V 
Sbjct  318   PLVYEILYSSIQRQISSSSTARKFVALALIKISLLYMEAKRIYEGTVLSNNPVKPSFIVY  377

Query  1214  VLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAIDIK  1035
             +++WL AR +AALL PLH LA+ LVY KIHS+IGISKAGISGGGSL  HVDKFFEAI +K
Sbjct  378   MVNWLSARIVAALLWPLHNLAKTLVYKKIHSAIGISKAGISGGGSLPMHVDKFFEAIGVK  437

Query  1034  LQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGP  855
             +QNGYGLTE++PVVA RRP CNVLG++G P++HTEIKVVD ET + L  GSKG+VK +GP
Sbjct  438   VQNGYGLTETSPVVAARRPFCNVLGTVGHPVKHTEIKVVDMETGEVLPDGSKGVVKVRGP  497

Query  854   QVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLS  675
             QVMKGYYKNP AT + +D+ GW +TGD+GWI P+   G SR   G +VLEGRAKDTIVL+
Sbjct  498   QVMKGYYKNPSATNKVLDQEGWFDTGDIGWIAPHCPTGPSRKCGGMLVLEGRAKDTIVLT  557

Query  674   SGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATE  495
             +GENVEP+EIEEAA  S+LI QIVV+GQDKRR+GAL++P+ +EVL  AK+ S++D  + E
Sbjct  558   TGENVEPAEIEEAASRSDLINQIVVVGQDKRRIGALIVPNYDEVLATAKRKSILDG-SNE  616

Query  494   VSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQ  315
             ++++K   L+++EL+ W   C+FQIGPIL+++EPFT+DNGLLTPT+K+RRDKVT  Y  +
Sbjct  617   LAKDKVLNLLYDELRTWMVDCSFQIGPILIVDEPFTVDNGLLTPTLKLRRDKVTAKYHRE  676

Query  314   IEDLYK  297
             I+ LYK
Sbjct  677   IDALYK  682



>ref|XP_007034198.1| AMP-dependent synthetase and ligase family protein isoform 4 
[Theobroma cacao]
 gb|EOY05124.1| AMP-dependent synthetase and ligase family protein isoform 4 
[Theobroma cacao]
Length=635

 Score =   779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/562 (71%), Positives = 469/562 (83%), Gaps = 3/562 (1%)
 Frame = -3

Query  2342  STSRKFRVFCESTG--MQIRKCSPilesillsgngllss-EWKTVPDIWKTAAEEFGNCI  2172
             S   KFRVFCES    +QIR+CSP+LE + LS N  + S EWK VPDIW+++AE++G+ +
Sbjct  70    SPGSKFRVFCESKTQELQIRRCSPLLEKVSLSSNDAVVSDEWKAVPDIWRSSAEKYGDRV  129

Query  2171  ALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTT  1992
             A+VDPYH+PP+ +++ +LE+EI+ FAEGLR+IGLKP++K+ALFADNS RWLVADQGIM  
Sbjct  130   AVVDPYHDPPSTMTYIQLEQEILDFAEGLRLIGLKPEDKLALFADNSSRWLVADQGIMAM  189

Query  1991  GAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKS  1812
             GAINVVRGSRS+VEELL IYNHSESV L VDNPE ++R+A TF S A +RFI+LLWGEKS
Sbjct  190   GAINVVRGSRSAVEELLHIYNHSESVGLVVDNPEFFNRLAGTFCSKATMRFIVLLWGEKS  249

Query  1811  SITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTG  1632
              + +    G PI+SY EI++LG ES + L  S +AR  Y YE I SDDVATLVYTSGTT 
Sbjct  250   CLATGETQGVPIFSYREIMELGRESRVGLTDSHDARQGYIYEAIGSDDVATLVYTSGTTD  309

Query  1631  NPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTT  1452
             NPKGVMLTH+NLLHQI NLWD VP   GDRFLSMLP WHAYERA EYFIF+ G EQ YTT
Sbjct  310   NPKGVMLTHKNLLHQIRNLWDVVPAEAGDRFLSMLPSWHAYERACEYFIFTHGIEQEYTT  369

Query  1451  VINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKR  1272
             V NLK+DL+ YQP YLISVPLVYETLYSGI KQI TSS ARK IAL F+++S AY + KR
Sbjct  370   VRNLKDDLRHYQPHYLISVPLVYETLYSGIQKQIYTSSTARKFIALTFIRVSLAYMDLKR  429

Query  1271  IYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagis  1092
             IYEG CLT+DQKQPSY+VS+L+WLWAR IAA+L PLH+LA+KLVY KIHS+IGISKAGIS
Sbjct  430   IYEGLCLTRDQKQPSYVVSMLEWLWARIIAAILWPLHVLAKKLVYEKIHSAIGISKAGIS  489

Query  1091  gggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDA  912
             GGGSL  H+DKFFEAI +KLQNGYGLTES+PV+A RRPNCNVLGS+G PI+HTE K+VD+
Sbjct  490   GGGSLPMHIDKFFEAIGVKLQNGYGLTESSPVIAARRPNCNVLGSVGHPIQHTEFKIVDS  549

Query  911   ETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSR  732
             ETD+ L PGSKGIVK +GPQVMKGYYKNP AT+QA+DE+GWLNTGD+GWI P HS G+S 
Sbjct  550   ETDEVLPPGSKGIVKVRGPQVMKGYYKNPLATRQALDEDGWLNTGDIGWIAPCHSAGQSH  609

Query  731   NSSGFIVLEGRAKDTIVLSSGE  666
                G IVLEGRAKDTIVLS+G+
Sbjct  610   RCGGVIVLEGRAKDTIVLSTGK  631



>ref|XP_007034200.1| AMP-dependent synthetase and ligase family protein isoform 6 
[Theobroma cacao]
 gb|EOY05126.1| AMP-dependent synthetase and ligase family protein isoform 6 
[Theobroma cacao]
Length=634

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/561 (71%), Positives = 468/561 (83%), Gaps = 3/561 (1%)
 Frame = -3

Query  2342  STSRKFRVFCESTG--MQIRKCSPilesillsgngllss-EWKTVPDIWKTAAEEFGNCI  2172
             S   KFRVFCES    +QIR+CSP+LE + LS N  + S EWK VPDIW+++AE++G+ +
Sbjct  70    SPGSKFRVFCESKTQELQIRRCSPLLEKVSLSSNDAVVSDEWKAVPDIWRSSAEKYGDRV  129

Query  2171  ALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTT  1992
             A+VDPYH+PP+ +++ +LE+EI+ FAEGLR+IGLKP++K+ALFADNS RWLVADQGIM  
Sbjct  130   AVVDPYHDPPSTMTYIQLEQEILDFAEGLRLIGLKPEDKLALFADNSSRWLVADQGIMAM  189

Query  1991  GAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKS  1812
             GAINVVRGSRS+VEELL IYNHSESV L VDNPE ++R+A TF S A +RFI+LLWGEKS
Sbjct  190   GAINVVRGSRSAVEELLHIYNHSESVGLVVDNPEFFNRLAGTFCSKATMRFIVLLWGEKS  249

Query  1811  SITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTG  1632
              + +    G PI+SY EI++LG ES + L  S +AR  Y YE I SDDVATLVYTSGTT 
Sbjct  250   CLATGETQGVPIFSYREIMELGRESRVGLTDSHDARQGYIYEAIGSDDVATLVYTSGTTD  309

Query  1631  NPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTT  1452
             NPKGVMLTH+NLLHQI NLWD VP   GDRFLSMLP WHAYERA EYFIF+ G EQ YTT
Sbjct  310   NPKGVMLTHKNLLHQIRNLWDVVPAEAGDRFLSMLPSWHAYERACEYFIFTHGIEQEYTT  369

Query  1451  VINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKR  1272
             V NLK+DL+ YQP YLISVPLVYETLYSGI KQI TSS ARK IAL F+++S AY + KR
Sbjct  370   VRNLKDDLRHYQPHYLISVPLVYETLYSGIQKQIYTSSTARKFIALTFIRVSLAYMDLKR  429

Query  1271  IYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagis  1092
             IYEG CLT+DQKQPSY+VS+L+WLWAR IAA+L PLH+LA+KLVY KIHS+IGISKAGIS
Sbjct  430   IYEGLCLTRDQKQPSYVVSMLEWLWARIIAAILWPLHVLAKKLVYEKIHSAIGISKAGIS  489

Query  1091  gggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDA  912
             GGGSL  H+DKFFEAI +KLQNGYGLTES+PV+A RRPNCNVLGS+G PI+HTE K+VD+
Sbjct  490   GGGSLPMHIDKFFEAIGVKLQNGYGLTESSPVIAARRPNCNVLGSVGHPIQHTEFKIVDS  549

Query  911   ETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSR  732
             ETD+ L PGSKGIVK +GPQVMKGYYKNP AT+QA+DE+GWLNTGD+GWI P HS G+S 
Sbjct  550   ETDEVLPPGSKGIVKVRGPQVMKGYYKNPLATRQALDEDGWLNTGDIGWIAPCHSAGQSH  609

Query  731   NSSGFIVLEGRAKDTIVLSSG  669
                G IVLEGRAKDTIVLS+G
Sbjct  610   RCGGVIVLEGRAKDTIVLSTG  630



>ref|XP_010466736.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
isoform X2 [Camelina sativa]
Length=601

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/571 (68%), Positives = 464/571 (81%), Gaps = 3/571 (1%)
 Frame = -3

Query  2006  GIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILL  1827
             GIM TGA+NVVRGSRSS+EELLQIY HSESVAL VDNPE Y+RIAE+F   A  RF+ILL
Sbjct  33    GIMATGAVNVVRGSRSSIEELLQIYCHSESVALVVDNPEFYNRIAESFSYKAPPRFVILL  92

Query  1826  WGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYT  1647
             WG+KSS+ + V    P+YSYNEI   G E       S +AR +Y YE I+ DD AT++YT
Sbjct  93    WGDKSSLVT-VGRQTPVYSYNEIKRFGQERRAKFARSNDAR-KYEYEFIDPDDTATIMYT  150

Query  1646  SGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCE  1467
             SGTTGNPKGVMLTH+NLLHQI NL D VP   G+RFLSMLP WHAYERA EYFIF+ G E
Sbjct  151   SGTTGNPKGVMLTHQNLLHQIRNLSDFVPAEAGERFLSMLPSWHAYERACEYFIFTCGVE  210

Query  1466  QVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAY  1287
             Q YT++  LK+DLK+YQP YLISVPLVYETLYSGI KQI+TSSPARK +AL  +K+S AY
Sbjct  211   QKYTSIRFLKDDLKQYQPHYLISVPLVYETLYSGIQKQISTSSPARKFVALTLIKVSLAY  270

Query  1286  KEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigis  1107
              E +RI EG CLTK+QK P Y+VS++DWLWAR +A +L PLH+LA KLV+ +I SS+GI+
Sbjct  271   MEMRRISEGLCLTKNQKPPMYVVSLVDWLWARVVAFVLLPLHMLAEKLVHREIRSSVGIT  330

Query  1106  kagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEI  927
             KAG+SGGGSL  HVDKFFEAI + +QNGYGLTE++PVV+ RR NCNVLGS+G PI+ TE 
Sbjct  331   KAGVSGGGSLPMHVDKFFEAIGVNVQNGYGLTETSPVVSARRLNCNVLGSVGHPIKDTEF  390

Query  926   KVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHS  747
             K+VD ET   L PGSKGIVK +G  VMKGYYKNP ATKQ IDE+GW NTGD+GWI P HS
Sbjct  391   KIVDPETGSDLPPGSKGIVKVRGRPVMKGYYKNPLATKQVIDEDGWFNTGDMGWITPQHS  450

Query  746   IGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGAL  567
             +GRSR+  G IVLEGRAKDTIVLS+GENVEP EIEEAAM SNLIQQIVVIGQD+RRLGA+
Sbjct  451   VGRSRSCGGVIVLEGRAKDTIVLSTGENVEPLEIEEAAMRSNLIQQIVVIGQDQRRLGAI  510

Query  566   VLPHKEEVLLAAK-KLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPF  390
             ++P+KE    AAK K+S +D +  E+S+E  + +++EEL+KWT+ C+FQ+GP+L+++EPF
Sbjct  511   IIPNKEAAEGAAKQKISPLDPEVNELSKETITSMVYEELRKWTSQCSFQVGPVLIVDEPF  570

Query  389   TIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             TIDNGL+TPTMK+RRDKV D YK +IE LYK
Sbjct  571   TIDNGLMTPTMKIRRDKVVDQYKNEIERLYK  601



>ref|XP_010488455.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
isoform X2 [Camelina sativa]
Length=601

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/571 (68%), Positives = 462/571 (81%), Gaps = 3/571 (1%)
 Frame = -3

Query  2006  GIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILL  1827
             GIM TGA+NVVRGSRSSVEELLQIY HSESVAL VDNPE ++RIAE+F   A  RF+ILL
Sbjct  33    GIMATGAVNVVRGSRSSVEELLQIYCHSESVALVVDNPEFFNRIAESFSYKAPPRFVILL  92

Query  1826  WGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYT  1647
             WG+KSS+ + V    P+YSYNEI   G E       S +   +Y YE IN DD AT++YT
Sbjct  93    WGDKSSLVT-VGRQTPVYSYNEIKRFGQERRAKFARSNDG-GRYEYEFINPDDTATIMYT  150

Query  1646  SGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCE  1467
             SGTTGNPKGVMLTH+NLLHQI NL D VP   G+RFLSMLP WHAYERA EYFIF+ G E
Sbjct  151   SGTTGNPKGVMLTHQNLLHQIRNLSDFVPAEAGERFLSMLPSWHAYERACEYFIFTCGVE  210

Query  1466  QVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAY  1287
             Q YT++  LK+DLK+YQP YLISVPLVYETLYSGI KQI+TSSPARK +AL  +K+S AY
Sbjct  211   QKYTSIRFLKDDLKQYQPHYLISVPLVYETLYSGIQKQISTSSPARKFVALTLIKVSLAY  270

Query  1286  KEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigis  1107
              E +RI EG CLTK+QK P Y+ S++DWLWAR +A +L PLH+LA KLV+ KI SS+GI+
Sbjct  271   TEMRRISEGLCLTKNQKPPMYIASLVDWLWARVVAFVLLPLHMLAEKLVHRKIRSSVGIT  330

Query  1106  kagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEI  927
             KAG+SGGGSL  HVDKFFEAI + +QNGYGLTE++PVV+ RR NCNVLGS+G PI+ TE 
Sbjct  331   KAGVSGGGSLPMHVDKFFEAIGVNVQNGYGLTETSPVVSARRLNCNVLGSVGHPIKDTEF  390

Query  926   KVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHS  747
             K+VD ET   L PGSKGIVK +GP VMKGYYKNP ATKQ IDE+GW NTGD+GWI P HS
Sbjct  391   KIVDPETGSVLPPGSKGIVKVRGPPVMKGYYKNPLATKQVIDEDGWFNTGDMGWITPQHS  450

Query  746   IGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGAL  567
             +GRSR+  G IVLEGRAKDTIVLS+GENVEP EIEEAAM SNLIQQIVVIGQD+RRLGA+
Sbjct  451   VGRSRSCGGVIVLEGRAKDTIVLSTGENVEPLEIEEAAMRSNLIQQIVVIGQDQRRLGAI  510

Query  566   VLPHKEEVLLAAK-KLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPF  390
             ++P+KE    AAK K+S +D +  E+S+E  + +++EEL+KWT+ C+FQ+GP+L+++EPF
Sbjct  511   IIPNKEAAEGAAKQKISPLDLEVNELSKETITSMVYEELRKWTSQCSFQVGPVLIVDEPF  570

Query  389   TIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             TIDNGL+TPTMK+RRDKV D YK +IE LYK
Sbjct  571   TIDNGLMTPTMKIRRDKVVDQYKNEIERLYK  601



>gb|EMT11835.1| Long-chain-fatty-acid--CoA ligase 1 [Aegilops tauschii]
Length=649

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/644 (58%), Positives = 473/644 (73%), Gaps = 54/644 (8%)
 Frame = -3

Query  2228  WKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIA  2049
             WK VPDIW+TAA+++ + +ALVDPYH+PP+ L++K+LE++I+ F+ GLR +G+ PDEK+A
Sbjct  60    WKAVPDIWRTAAQKYPDSVALVDPYHDPPSELTYKQLEQQILDFSHGLRAVGVAPDEKLA  119

Query  2048  LFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAE  1869
             LFADNSCRWLVADQGIM TGAINVVRG++SS EEL QIYNHSES+AL VD+P+ ++R+AE
Sbjct  120   LFADNSCRWLVADQGIMATGAINVVRGTKSSDEELFQIYNHSESIALVVDSPQFFNRLAE  179

Query  1868  TFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTY  1689
             TF S  + RFI+LLWG+KSS+ S+ +   P+Y YN+I +LG E+  AL +S E   Q  +
Sbjct  180   TFISRINARFIVLLWGDKSSLNSKAVMDIPVYDYNDITELGQENRNALCYSSEQGRQGVF  239

Query  1688  EPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAY  1509
             E I  +DVATL+YTSGT+G PKGVMLTH NLLHQI N+W+ VP VPGDRFLSMLPPWHAY
Sbjct  240   EAITPEDVATLIYTSGTSGTPKGVMLTHRNLLHQINNMWEIVPAVPGDRFLSMLPPWHAY  299

Query  1508  ERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPAR  1329
             ER+AEYFI + G +Q+Y++V  LK DL++YQP Y+ SVPLVYETLYS I +QI++S PAR
Sbjct  300   ERSAEYFILTHGTQQIYSSVKYLKADLQKYQPHYIFSVPLVYETLYSSIQRQISSSYPAR  359

Query  1328  KLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLAR  1149
             K +AL  +KIS  Y EAK+I+E                      A        P+H    
Sbjct  360   KTVALALIKISLLYMEAKKIFE----------------------AAISGGGSLPMH----  393

Query  1148  KLVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
                                        VDKFFEAI IK+QNGYGLTE++P VA RRP CN
Sbjct  394   ---------------------------VDKFFEAIGIKVQNGYGLTETSPAVAARRPFCN  426

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             VLG++G PI+HTEIK+VD ET + L  GSKGIVK KGP VMKGYYKNP AT  A+D+ GW
Sbjct  427   VLGTVGHPIKHTEIKIVDIETGEVLPDGSKGIVKIKGPPVMKGYYKNPSATNNALDQEGW  486

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              NTGD+GWI P+H+ G SR   G +VLEGRAKDTIVL++GENVEP+E+EE A  S+LI Q
Sbjct  487   FNTGDIGWIAPHHATGPSRKCGGILVLEGRAKDTIVLATGENVEPAELEEIASRSSLIDQ  546

Query  608   IVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCT  429
             I+VIGQD+RRLGA+V+P+  E L AAK+ S +D +  E +++    L+++EL+ W  GC+
Sbjct  547   IMVIGQDRRRLGAIVVPNNNEALAAAKRKSSLDGNNDE-AKDTVMNLLYDELRTWMAGCS  605

Query  428   FQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             FQIGPIL++ EPFTIDNGL+TPTMK+RRD+V   Y+ +IE LYK
Sbjct  606   FQIGPILVVEEPFTIDNGLMTPTMKIRRDRVAAKYQSEIEALYK  649



>gb|EMS60032.1| Long-chain-fatty-acid--CoA ligase FadD15 [Triticum urartu]
Length=640

 Score =   762 bits (1968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/644 (58%), Positives = 474/644 (74%), Gaps = 54/644 (8%)
 Frame = -3

Query  2228  WKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIA  2049
             WK VPDIW+TAAE++ + +ALVDPYH+PP+ L++K+LE++I+ F+ GLR +G+ PDEK+A
Sbjct  51    WKAVPDIWRTAAEKYPDSVALVDPYHDPPSELTYKQLEQQILDFSHGLRAVGVAPDEKVA  110

Query  2048  LFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAE  1869
             LFADNSCRWLVADQGIM TGAINVVRG++SS EEL QIY+HSES+AL VD+P+ ++R+AE
Sbjct  111   LFADNSCRWLVADQGIMATGAINVVRGTKSSDEELFQIYSHSESIALVVDSPQFFNRLAE  170

Query  1868  TFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTY  1689
             TF S  + RFI+LLWG+KSS+ S+ +   P+Y YN+I +LG E+  AL +S E   Q  +
Sbjct  171   TFISRINARFIVLLWGDKSSLNSKAVMDIPVYDYNDITELGRENRNALCYSSEQGRQGVF  230

Query  1688  EPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAY  1509
             E I  +DVATL+YTSGT+G PKGVMLTH NLLHQI N+W+ VP VPGDRFLSMLPPWHAY
Sbjct  231   EAITPEDVATLIYTSGTSGAPKGVMLTHRNLLHQINNMWEIVPAVPGDRFLSMLPPWHAY  290

Query  1508  ERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPAR  1329
             ER+AEYFI + G +Q+Y++V  LK DL++YQP Y+ SVPLVYETLYS I +QI++SSPAR
Sbjct  291   ERSAEYFILTHGTQQIYSSVKYLKADLQKYQPHYVFSVPLVYETLYSSIQRQISSSSPAR  350

Query  1328  KLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLAR  1149
             K +AL  +KIS  Y EAK+I+E                      A        P+H    
Sbjct  351   KTVALALIKISLLYMEAKKIFE----------------------AAISGGGSLPMH----  384

Query  1148  KLVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
                                        VDKFFEAI IK+QNGYGLTE++P VA RRP CN
Sbjct  385   ---------------------------VDKFFEAIGIKVQNGYGLTETSPAVAARRPFCN  417

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             VLG++G PI+HTEIK+VD ET + L  GSKGIVK KGP VMKGYYKNP AT  A+D+ GW
Sbjct  418   VLGTVGHPIKHTEIKIVDIETGEVLPDGSKGIVKIKGPPVMKGYYKNPSATNNALDQEGW  477

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              NTGD+GWI P+H+ G SR   G +VLEGRAKDTIVL++GENVEP+E+EE A  S+LI Q
Sbjct  478   FNTGDIGWIAPHHATGPSRKCGGILVLEGRAKDTIVLATGENVEPAELEEIASRSSLIDQ  537

Query  608   IVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCT  429
             I+VIGQD+RRLGA+V+P+  E L AAK+ S +D +  E +++    L+++EL+ W  GC+
Sbjct  538   IMVIGQDRRRLGAIVVPNNNEALAAAKRKSSLDGNNDE-AKDTVMNLLYDELRTWMAGCS  596

Query  428   FQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             FQIGPIL++ EPFTIDNGL+TPTMK+RRD+V   Y+ +IE LY+
Sbjct  597   FQIGPILVVEEPFTIDNGLMTPTMKIRRDRVAAKYQSEIEALYE  640



>ref|XP_010532734.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
isoform X4 [Tarenaya hassleriana]
Length=587

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/588 (66%), Positives = 475/588 (81%), Gaps = 8/588 (1%)
 Frame = -3

Query  2048  LFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAE  1869
             L   ++ RWLV DQGIM TGA+NVVRGSRSSVEELLQIY+HSESVAL VDNPE ++RI++
Sbjct  4     LLTLHTNRWLVTDQGIMATGAVNVVRGSRSSVEELLQIYSHSESVALVVDNPEFFNRISK  63

Query  1868  TFHSHADVRFIILLWGEKSSITSEVMDG--RPIYSYNEIIDLGNESHMALLHSQEARHQY  1695
              F +    RF+ILLWGEKSS+   VM+G   P+YSY EII+   E     L S +   +Y
Sbjct  64    KFSTKVSPRFVILLWGEKSSL---VMEGIRSPVYSYTEIINFRREKLRNPLGSDDD-GKY  119

Query  1694  TYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWH  1515
              YE IN DD A ++YTSGTTGNPKGVMLTH NLLHQI NL++ VP  PGDRFLSMLP WH
Sbjct  120   EYEFINPDDTAAIMYTSGTTGNPKGVMLTHRNLLHQINNLFEIVPAEPGDRFLSMLPSWH  179

Query  1514  AYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSP  1335
             AYER+ EYFIF+ G EQ+YT++  LK+DLKRYQP YLISVPLVYETLYSGI KQI+TSS 
Sbjct  180   AYERSCEYFIFTHGVEQMYTSIRYLKDDLKRYQPHYLISVPLVYETLYSGIQKQISTSSA  239

Query  1334  ARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLL  1155
             ARK +AL  +KIS AY E +RIYEG CLTK+Q  P YL+S++DWL AR  AA+L PLH+L
Sbjct  240   ARKFVALTLIKISLAYMEMRRIYEGVCLTKNQNPPPYLISLVDWLIARVAAAILWPLHML  299

Query  1154  ARKLVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPN  975
             A++ VY KI SSIGISKAGISGGGSL  HVDKFFEA+ + +QNGYGLTE++PV++ RR +
Sbjct  300   AKRFVYRKILSSIGISKAGISGGGSLPMHVDKFFEAVGVNVQNGYGLTETSPVISARRLS  359

Query  974   CNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDEN  795
             CNVLGS+G PI+ TE KVVD+ET+  L PGSKGIVK +GPQVMKGYYKNP ATKQ +DE+
Sbjct  360   CNVLGSVGHPIQDTEFKVVDSETNNVLPPGSKGIVKVRGPQVMKGYYKNPLATKQVLDED  419

Query  794   GWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLI  615
             GW +TGD+GWI P+H IGRS +  G IVLEGRAKDTIVLS+GENVEP EIEEAA+ S+LI
Sbjct  420   GWFDTGDMGWIAPHHLIGRSCSCGGVIVLEGRAKDTIVLSTGENVEPLEIEEAALRSSLI  479

Query  614   QQIVVIGQDKRRLGALVLPHKEEVLLAAK-KLSVVDSDATE-VSEEKTSKLIHEELQKWT  441
             QQIVVIGQD+RR+GA+++P+KEE  +A K   S  D  A+E +S+EK + +++EEL+KWT
Sbjct  480   QQIVVIGQDQRRIGAIIVPNKEEADIAPKNNNSDTDPGASELISKEKLTSMVYEELRKWT  539

Query  440   TGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             + C++Q+GP+L+++EPFTIDNGL+TPTMK+RRDKV   YK++I  LYK
Sbjct  540   SECSYQVGPVLIVDEPFTIDNGLMTPTMKIRRDKVVKKYKDEIAKLYK  587



>ref|XP_010512900.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
isoform X2 [Camelina sativa]
Length=601

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/571 (67%), Positives = 459/571 (80%), Gaps = 3/571 (1%)
 Frame = -3

Query  2006  GIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILL  1827
             GI+  GAINVVRGSRSSVEELLQIY HSESVAL VDNPE ++RIA +F   A  RF+ILL
Sbjct  33    GIIAAGAINVVRGSRSSVEELLQIYCHSESVALVVDNPEFFNRIAASFSYKAPPRFVILL  92

Query  1826  WGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYT  1647
             WG+KSS+ + V    P+YSYNEI   G E       S +A  +Y YE IN DD AT++YT
Sbjct  93    WGDKSSLVT-VGRQTPVYSYNEIKRFGQERRAKFARSNDA-ERYEYEFINPDDTATIMYT  150

Query  1646  SGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCE  1467
             SGTTGNPKGVMLTH+NLLHQI NL D VP   G+RFLSMLP WHAYERA EYFIF+ G E
Sbjct  151   SGTTGNPKGVMLTHQNLLHQIRNLSDFVPAEAGERFLSMLPSWHAYERACEYFIFTCGVE  210

Query  1466  QVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAY  1287
             Q YT++  LK+DLK+YQP YLISVPLVYETLYSGI KQI+TSSPARK +AL  +K+S AY
Sbjct  211   QKYTSIRFLKDDLKQYQPHYLISVPLVYETLYSGIQKQISTSSPARKFLALTLIKVSLAY  270

Query  1286  KEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigis  1107
              E +RI EG CLTK+QK P Y+ S++DWLWAR +A +L PLH+LA KLV+ KI SS+GI+
Sbjct  271   MEMRRISEGLCLTKNQKPPMYIASLVDWLWARVVAFVLLPLHMLAEKLVHRKIRSSVGIT  330

Query  1106  kagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEI  927
             KAG+SGGGSL  HVDKFFEAI + +QNGYGLTE++PVV+ RR NCNVLGS+G PI+ TE 
Sbjct  331   KAGVSGGGSLPMHVDKFFEAIGVNVQNGYGLTETSPVVSARRLNCNVLGSVGHPIKDTEF  390

Query  926   KVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHS  747
             K+VD ET   L PGSKGIVK +GP VMKGYYKNP ATKQ IDE+GW N+GD+GWI P HS
Sbjct  391   KIVDPETGSVLPPGSKGIVKVRGPPVMKGYYKNPLATKQVIDEDGWFNSGDMGWITPQHS  450

Query  746   IGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGAL  567
              GRSR+  G IVLEGRAKDTIVL +GENVEP EIEEAAM SNLIQQIVVIGQD+RRLGA+
Sbjct  451   AGRSRSCGGVIVLEGRAKDTIVLLTGENVEPLEIEEAAMRSNLIQQIVVIGQDQRRLGAI  510

Query  566   VLPHKEEVLLAAK-KLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPF  390
             ++P+KE    A+K K+S +D +  E+S+E  + +++EEL+KWT+ C+FQ+GP+L+++EPF
Sbjct  511   IIPNKEAAEGASKQKISPLDPEVNELSKETITSMVYEELRKWTSQCSFQVGPVLIVDEPF  570

Query  389   TIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             TIDNGL+TPTMK+RRDKV D YK +IE LYK
Sbjct  571   TIDNGLMTPTMKIRRDKVVDQYKNEIERLYK  601



>ref|XP_010527445.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
isoform X4 [Tarenaya hassleriana]
Length=568

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/573 (66%), Positives = 467/573 (82%), Gaps = 10/573 (2%)
 Frame = -3

Query  2006  GIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILL  1827
             G M TGA+NVVRGSRSSVEELLQIYNHSESVAL VDNPE ++RI+ETF S A++RF+ILL
Sbjct  3     GTMATGAVNVVRGSRSSVEELLQIYNHSESVALVVDNPEFFNRISETFSSRANLRFVILL  62

Query  1826  WGEKSSITSEVMDG--RPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLV  1653
             WGEKSS+    M+G   P+YSY EI+D G E     L +     +Y YE IN DD A+++
Sbjct  63    WGEKSSL---FMEGTRSPVYSYTEIMDFGWER----LRNSFGSGKYEYEYINPDDTASIM  115

Query  1652  YTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLG  1473
             YTSGTTGNPKGVMLTH NLLHQI +L   VP   GDRFLSMLP WHAYERA EYFIF+ G
Sbjct  116   YTSGTTGNPKGVMLTHRNLLHQISSLHASVPTEAGDRFLSMLPSWHAYERACEYFIFTHG  175

Query  1472  CEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISF  1293
              EQ+YT++  LK+DLK+Y+P YLISVPLVYETLYSGI KQI+ SS  RK +A   ++IS 
Sbjct  176   VEQMYTSIRYLKDDLKQYRPHYLISVPLVYETLYSGIQKQISASSAPRKFLAFTLIRISL  235

Query  1292  AYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssig  1113
             AY E KRIYEG CL+K+QK P YLVS++DWL ARA AA+L PLH+LA++LVY KI SSIG
Sbjct  236   AYMETKRIYEGFCLSKNQKPPPYLVSLVDWLSARAAAAILWPLHMLAKRLVYEKILSSIG  295

Query  1112  iskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHT  933
             I KAGISGG SL  H+DKFFEA+ + +QNGYGLTE++PV++ RR +CNVLGS+G PIR T
Sbjct  296   ILKAGISGGSSLPMHIDKFFEAVGLDVQNGYGLTETSPVISVRRLSCNVLGSVGHPIRDT  355

Query  932   EIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPN  753
             E+KV+D ET+  L PG KGIVK +GPQVMKGYYKNP AT+Q +DE+GW NTGD+GWI P+
Sbjct  356   ELKVMDFETNNVLPPGLKGIVKVRGPQVMKGYYKNPLATRQVLDEDGWFNTGDMGWIAPH  415

Query  752   HSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLG  573
             H  GRSR+  G IVLEGRAKDTIVLS+GENVEP EIEEAAM S+LIQQI+VIGQD+RR+G
Sbjct  416   HPTGRSRSVGGSIVLEGRAKDTIVLSTGENVEPLEIEEAAMRSSLIQQILVIGQDQRRIG  475

Query  572   ALVLPHKEEVLLAAKKL-SVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINE  396
             A+++P+KEE  +AA+   S  DS A+E+S+EK + ++++EL+KWT+ C+FQ+GP+L+++E
Sbjct  476   AIIVPNKEEADIAAENNDSPGDSRASELSKEKLTSMVYKELRKWTSECSFQVGPVLVVDE  535

Query  395   PFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             PFT+DNGL+TPTMK+RRDKV D YK++I +LYK
Sbjct  536   PFTVDNGLMTPTMKIRRDKVVDKYKDEIANLYK  568



>gb|EMT11836.1| Long-chain-fatty-acid--CoA ligase 1 [Aegilops tauschii]
Length=694

 Score =   752 bits (1942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/728 (54%), Positives = 491/728 (67%), Gaps = 117/728 (16%)
 Frame = -3

Query  2291  RKCSPilesill-sgngllssEWKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELE  2115
             RKCSP+L+S LL  G+ L   EWK VPDIW+TAAE++ + +ALVDPYH+PP+ L++K+LE
Sbjct  21    RKCSPLLDSALLPGGSELAVHEWKAVPDIWRTAAEKYADLVALVDPYHDPPSKLTYKQLE  80

Query  2114  KEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQI  1935
             ++I+ F+ GLR IG+ PDEK+ALFADNSCRWLVADQGIM TGAINVVRG++SS EEL QI
Sbjct  81    QQILDFSHGLRAIGVAPDEKLALFADNSCRWLVADQGIMATGAINVVRGTKSSDEELFQI  140

Query  1934  YNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEII  1755
             Y+HSES+AL VD+P+ ++R+AE+F S  + RFI+LLWG+KSS+ S+ +   P+Y YN+I 
Sbjct  141   YSHSESIALVVDSPQFFNRLAESFISRINARFIVLLWGDKSSLNSKAVMDIPVYDYNDIT  200

Query  1754  DLGNESHMALLHSQE---ARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQI  1584
             +LG E+  AL +S E      Q  +E I  +DVATL+YTSGT G PKGVMLTH NLLHQI
Sbjct  201   ELGRENRNALCYSSELFEQGQQGVFEAIGPEDVATLIYTSGTGGTPKGVMLTHRNLLHQI  260

Query  1583  LNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYL  1404
              NLWD VP VPGDRFLSMLPPWHAYER+ EYFIF+ G +QVYTTV +LK DL+ +QP Y+
Sbjct  261   NNLWDIVPAVPGDRFLSMLPPWHAYERSTEYFIFTHGIQQVYTTVKHLKADLQHHQPHYI  320

Query  1403  ISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSY  1224
             ISVPLVYETLYS I +QI+ S PARK +AL  +KIS  + EAK+IYE             
Sbjct  321   ISVPLVYETLYSSIQRQISASPPARKTVALALIKISLLFMEAKKIYE-------------  367

Query  1223  LVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAI  1044
                      A        P+H                               VDKFFEAI
Sbjct  368   ---------AGISGGGSLPMH-------------------------------VDKFFEAI  387

Query  1043  DIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKA  864
              IK+QNGYGLTE++PVVA RRP CNVLG++G PI+HTEIK+VD ET + L  GSKGIVK 
Sbjct  388   GIKVQNGYGLTETSPVVAARRPFCNVLGTVGHPIKHTEIKIVDIETGEVLPDGSKGIVKI  447

Query  863   KGPQVMKG----------------------------------------------YYK---  831
             KGP VMKG                                              YYK   
Sbjct  448   KGPPVMKGYYKVLGTVGHPIKHTEIKIVDIETGEVLPDGSKGIVKIKGLPVMKGYYKKVL  507

Query  830   ----------NPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIV  681
                       NP AT +A+D  GW NTGD+GWI P+H+ G SR   G +VLEGRAKDTIV
Sbjct  508   IYLLKLRLSQNPSATNKALDLEGWFNTGDIGWIAPHHATGPSRKCGGMLVLEGRAKDTIV  567

Query  680   LSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDA  501
             L++GENVEP+E+EEAA  S+LI QI+VIGQD+RRLGA+++P+ +EV+ AAK+ S +D + 
Sbjct  568   LTTGENVEPAELEEAASRSSLIDQIMVIGQDRRRLGAIIVPNNDEVVAAAKRKSSLDGN-  626

Query  500   TEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYK  321
               ++++    L+H EL+ W  GC+FQIGPIL+++EPFTIDNGL+TPTMK+RRDKV   Y+
Sbjct  627   NGLAKDTVMSLLHAELKTWMAGCSFQIGPILVVDEPFTIDNGLMTPTMKIRRDKVAAKYQ  686

Query  320   EQIEDLYK  297
              +IE LYK
Sbjct  687   SEIEALYK  694



>ref|XP_010527446.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
isoform X5 [Tarenaya hassleriana]
 ref|XP_010527447.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
isoform X5 [Tarenaya hassleriana]
Length=564

 Score =   746 bits (1926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/571 (66%), Positives = 466/571 (82%), Gaps = 10/571 (2%)
 Frame = -3

Query  2000  MTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWG  1821
             M TGA+NVVRGSRSSVEELLQIYNHSESVAL VDNPE ++RI+ETF S A++RF+ILLWG
Sbjct  1     MATGAVNVVRGSRSSVEELLQIYNHSESVALVVDNPEFFNRISETFSSRANLRFVILLWG  60

Query  1820  EKSSITSEVMDG--RPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYT  1647
             EKSS+    M+G   P+YSY EI+D G E     L +     +Y YE IN DD A+++YT
Sbjct  61    EKSSL---FMEGTRSPVYSYTEIMDFGWER----LRNSFGSGKYEYEYINPDDTASIMYT  113

Query  1646  SGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCE  1467
             SGTTGNPKGVMLTH NLLHQI +L   VP   GDRFLSMLP WHAYERA EYFIF+ G E
Sbjct  114   SGTTGNPKGVMLTHRNLLHQISSLHASVPTEAGDRFLSMLPSWHAYERACEYFIFTHGVE  173

Query  1466  QVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAY  1287
             Q+YT++  LK+DLK+Y+P YLISVPLVYETLYSGI KQI+ SS  RK +A   ++IS AY
Sbjct  174   QMYTSIRYLKDDLKQYRPHYLISVPLVYETLYSGIQKQISASSAPRKFLAFTLIRISLAY  233

Query  1286  KEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigis  1107
              E KRIYEG CL+K+QK P YLVS++DWL ARA AA+L PLH+LA++LVY KI SSIGI 
Sbjct  234   METKRIYEGFCLSKNQKPPPYLVSLVDWLSARAAAAILWPLHMLAKRLVYEKILSSIGIL  293

Query  1106  kagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEI  927
             KAGISGG SL  H+DKFFEA+ + +QNGYGLTE++PV++ RR +CNVLGS+G PIR TE+
Sbjct  294   KAGISGGSSLPMHIDKFFEAVGLDVQNGYGLTETSPVISVRRLSCNVLGSVGHPIRDTEL  353

Query  926   KVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHS  747
             KV+D ET+  L PG KGIVK +GPQVMKGYYKNP AT+Q +DE+GW NTGD+GWI P+H 
Sbjct  354   KVMDFETNNVLPPGLKGIVKVRGPQVMKGYYKNPLATRQVLDEDGWFNTGDMGWIAPHHP  413

Query  746   IGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGAL  567
              GRSR+  G IVLEGRAKDTIVLS+GENVEP EIEEAAM S+LIQQI+VIGQD+RR+GA+
Sbjct  414   TGRSRSVGGSIVLEGRAKDTIVLSTGENVEPLEIEEAAMRSSLIQQILVIGQDQRRIGAI  473

Query  566   VLPHKEEVLLAAKKL-SVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPF  390
             ++P+KEE  +AA+   S  DS A+E+S+EK + ++++EL+KWT+ C+FQ+GP+L+++EPF
Sbjct  474   IVPNKEEADIAAENNDSPGDSRASELSKEKLTSMVYKELRKWTSECSFQVGPVLVVDEPF  533

Query  389   TIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             T+DNGL+TPTMK+RRDKV D YK++I +LYK
Sbjct  534   TVDNGLMTPTMKIRRDKVVDKYKDEIANLYK  564



>ref|XP_009373572.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
isoform X3 [Pyrus x bretschneideri]
Length=623

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/612 (65%), Positives = 482/612 (79%), Gaps = 20/612 (3%)
 Frame = -3

Query  2468  AALNTKSVMFLLPK-----SDDGNHAVH---DLMSCRG-FIKMKWQLNSRG--STSRKFR  2322
             A++N  +  FL P      S D  H +    +  S  G     KW   SRG  S SR FR
Sbjct  11    ASVNQMATFFLAPNYVLGSSSDCGHTLQFRSNNNSRSGELFHRKWH-GSRGGISVSRGFR  69

Query  2321  VFCE--STGMQIRKCSP-ilesillsgngllssEWKTVPDIWKTAAEEFGNCIALVDPYH  2151
             V C+  +   QIR+ SP +   +L   +   S +WK VPDIW+++A ++G+ +ALVDP+H
Sbjct  70    VLCQFKTEEKQIRRHSPFLERVLLDDSDASESDKWKAVPDIWRSSAAKYGDLVALVDPFH  129

Query  2150  NPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVR  1971
             +PP+++++K+LE+EI+ FAEG+RV+G+KPDEKIALFADNSCRWLVADQGIM TGAINVVR
Sbjct  130   DPPSSITYKQLEQEILDFAEGMRVVGVKPDEKIALFADNSCRWLVADQGIMATGAINVVR  189

Query  1970  GSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVM  1791
             GSRSSVEELLQIYNHS+SVALAVD+PE+++RI+E F S A ++FI+LLWGEKSS+ +E  
Sbjct  190   GSRSSVEELLQIYNHSDSVALAVDSPELFNRISEEFCSKA-MKFIVLLWGEKSSLKNE--  246

Query  1790  DGR-PIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVM  1614
              G+ PI+ Y EI+DLG ES  +LL S + +   TYE I SDDVATLVYTSGT+GNPKGVM
Sbjct  247   -GKVPIFDYKEILDLGRESRKSLLDSDDKQQSDTYEVIKSDDVATLVYTSGTSGNPKGVM  305

Query  1613  LTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKE  1434
             LTH NLLHQI NLWD VP V GD+FLSMLPPWH YERA EYF F+ G EQ YT+V  +K+
Sbjct  306   LTHRNLLHQIKNLWDAVPCVGGDKFLSMLPPWHCYERACEYFAFTCGVEQFYTSVRKMKD  365

Query  1433  DLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKC  1254
             DL++YQP Y+ISVPLVYE+LYSGI KQI+++S  RKLIAL F++IS AY E KRIYEGK 
Sbjct  366   DLRKYQPTYIISVPLVYESLYSGIQKQISSASTVRKLIALTFIRISMAYMEFKRIYEGKY  425

Query  1253  LTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggsls  1074
             LT++ KQ SYLVSV DWLWAR IAA L PLH+L +KLVYSKI S+IGISKAGISGGG L 
Sbjct  426   LTRNPKQSSYLVSVADWLWARIIAAFLWPLHVLGKKLVYSKIQSAIGISKAGISGGGCLP  485

Query  1073  sHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKAL  894
             SHVDKFFEAID+KL NGYGLTE++PVVA RR N NV+GS+G PIRHTE KVVD+ET + L
Sbjct  486   SHVDKFFEAIDMKLLNGYGLTETSPVVASRRLNFNVIGSVGLPIRHTEFKVVDSETGEVL  545

Query  893   SPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFI  714
             SPG  GI+K +GPQVMKGYYKNP  TK+A+D++GWL+TGD+GWI P+HSIGRSR   G +
Sbjct  546   SPGLSGILKVRGPQVMKGYYKNPGTTKKALDDDGWLDTGDIGWIAPHHSIGRSRCCGGVV  605

Query  713   VLEGRAKDTIVL  678
             VLEGRAKDTIVL
Sbjct  606   VLEGRAKDTIVL  617



>ref|XP_010532735.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
isoform X5 [Tarenaya hassleriana]
Length=568

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/572 (66%), Positives = 464/572 (81%), Gaps = 8/572 (1%)
 Frame = -3

Query  2000  MTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWG  1821
             M TGA+NVVRGSRSSVEELLQIY+HSESVAL VDNPE ++RI++ F +    RF+ILLWG
Sbjct  1     MATGAVNVVRGSRSSVEELLQIYSHSESVALVVDNPEFFNRISKKFSTKVSPRFVILLWG  60

Query  1820  EKSSITSEVMDG--RPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYT  1647
             EKSS+   VM+G   P+YSY EII+   E     L S +   +Y YE IN DD A ++YT
Sbjct  61    EKSSL---VMEGIRSPVYSYTEIINFRREKLRNPLGSDDD-GKYEYEFINPDDTAAIMYT  116

Query  1646  SGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCE  1467
             SGTTGNPKGVMLTH NLLHQI NL++ VP  PGDRFLSMLP WHAYER+ EYFIF+ G E
Sbjct  117   SGTTGNPKGVMLTHRNLLHQINNLFEIVPAEPGDRFLSMLPSWHAYERSCEYFIFTHGVE  176

Query  1466  QVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAY  1287
             Q+YT++  LK+DLKRYQP YLISVPLVYETLYSGI KQI+TSS ARK +AL  +KIS AY
Sbjct  177   QMYTSIRYLKDDLKRYQPHYLISVPLVYETLYSGIQKQISTSSAARKFVALTLIKISLAY  236

Query  1286  KEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigis  1107
              E +RIYEG CLTK+Q  P YL+S++DWL AR  AA+L PLH+LA++ VY KI SSIGIS
Sbjct  237   MEMRRIYEGVCLTKNQNPPPYLISLVDWLIARVAAAILWPLHMLAKRFVYRKILSSIGIS  296

Query  1106  kagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEI  927
             KAGISGGGSL  HVDKFFEA+ + +QNGYGLTE++PV++ RR +CNVLGS+G PI+ TE 
Sbjct  297   KAGISGGGSLPMHVDKFFEAVGVNVQNGYGLTETSPVISARRLSCNVLGSVGHPIQDTEF  356

Query  926   KVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHS  747
             KVVD+ET+  L PGSKGIVK +GPQVMKGYYKNP ATKQ +DE+GW +TGD+GWI P+H 
Sbjct  357   KVVDSETNNVLPPGSKGIVKVRGPQVMKGYYKNPLATKQVLDEDGWFDTGDMGWIAPHHL  416

Query  746   IGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGAL  567
             IGRS +  G IVLEGRAKDTIVLS+GENVEP EIEEAA+ S+LIQQIVVIGQD+RR+GA+
Sbjct  417   IGRSCSCGGVIVLEGRAKDTIVLSTGENVEPLEIEEAALRSSLIQQIVVIGQDQRRIGAI  476

Query  566   VLPHKEEVLLAAK-KLSVVDSDATE-VSEEKTSKLIHEELQKWTTGCTFQIGPILLINEP  393
             ++P+KEE  +A K   S  D  A+E +S+EK + +++EEL+KWT+ C++Q+GP+L+++EP
Sbjct  477   IVPNKEEADIAPKNNNSDTDPGASELISKEKLTSMVYEELRKWTSECSYQVGPVLIVDEP  536

Query  392   FTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             FTIDNGL+TPTMK+RRDKV   YK++I  LYK
Sbjct  537   FTIDNGLMTPTMKIRRDKVVKKYKDEIAKLYK  568



>ref|XP_010247393.1| PREDICTED: long-chain-fatty-acid--[acyl-carrier-protein] ligase 
AEE15, chloroplastic-like isoform X2 [Nelumbo nucifera]
Length=619

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/600 (65%), Positives = 467/600 (78%), Gaps = 11/600 (2%)
 Frame = -3

Query  2438  LLPKSDDGNHAVHDLMSCR--GFIKMKWQLNSRGSTSRKFR---VFCESTGM----QIRK  2286
             L+  S D        +S R  G  ++  +  S G  SR  R   V CES       ++R+
Sbjct  10    LVLNSPDARKVFGFFLSRRQAGTSRIFQKRRSSGRCSRLARRPVVCCESNPEPEEPRVRR  69

Query  2285  CSPilesillsgngllssE-WKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKE  2109
             CSP+LES+LLSG  +L S  WK VPDIWK++AE +G  IALVDPYH+PP+ L++K+LE+E
Sbjct  70    CSPLLESVLLSGETILYSGDWKAVPDIWKSSAERYGGLIALVDPYHDPPSELTYKQLEQE  129

Query  2108  IVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYN  1929
             I++FAEGLRVIG+KPDEK+ALFADNSCRWL+ADQGIM  GAINVVRG+RSS EELLQIYN
Sbjct  130   ILNFAEGLRVIGIKPDEKVALFADNSCRWLIADQGIMAIGAINVVRGTRSSTEELLQIYN  189

Query  1928  HSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDL  1749
             HSES AL +DNP+ + RIAE F S A +R +ILLWGEKS +++ V++G  I++YNEIIDL
Sbjct  190   HSESTALIMDNPDFFKRIAEGFSSKAVIRSVILLWGEKSCLSNYVIEGLTIFNYNEIIDL  249

Query  1748  GNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWD  1569
             G ES   LL + +    + YE I+SDD ATLVYTSGTTG PKGVML+H+NLLHQI NLW+
Sbjct  250   GRESRRVLLETNKG-GLHIYETISSDDTATLVYTSGTTGAPKGVMLSHQNLLHQIKNLWN  308

Query  1568  PVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPL  1389
              VP   GD+FLSMLPPWH YERAAEYF F+ G +QVYT V NLKEDL+RYQP YLISVPL
Sbjct  309   IVPAEAGDKFLSMLPPWHTYERAAEYFTFTCGVQQVYTNVKNLKEDLRRYQPHYLISVPL  368

Query  1388  VYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVL  1209
             +YETLYSGI KQI+TSS ARK+IA+  ++IS  Y E+KRIYEGK LT++QK    +  ++
Sbjct  369   IYETLYSGIQKQISTSSIARKVIAVALIRISLLYMESKRIYEGKVLTRNQKPHPLIFLMV  428

Query  1208  DWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAIDIKLQ  1029
             DW WAR  A +L PLH+L  KLVYSKIHS+IGISKAGISGG SL  HVD+FFEAI +KLQ
Sbjct  429   DWFWARITATILWPLHILGMKLVYSKIHSAIGISKAGISGGASLPLHVDRFFEAIGVKLQ  488

Query  1028  NGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQV  849
             NGYGLTES+PVVA R+P  NVLGS+G P+RHTE+K+VD+ET + L  GSKGIVK +GPQV
Sbjct  489   NGYGLTESSPVVAARQPTYNVLGSVGHPLRHTEVKIVDSETGEVLPAGSKGIVKVRGPQV  548

Query  848   MKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSG  669
             MKGYYKNP AT Q +DE GWL TGD+GWI P+HSIGRSRN  G +VLEGR KDTIVL +G
Sbjct  549   MKGYYKNPSATTQVLDEEGWLCTGDIGWIAPSHSIGRSRNCGGVLVLEGRGKDTIVLVTG  608



>gb|KDO47450.1| hypothetical protein CISIN_1g0065302mg [Citrus sinensis]
Length=520

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/512 (68%), Positives = 429/512 (84%), Gaps = 0/512 (0%)
 Frame = -3

Query  1916  VALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNES  1737
             VALAV+NPE ++RIAET  S A +RFIILLWG+KSS+  ++++  P++SY+EIIDLG ES
Sbjct  3     VALAVENPEFFNRIAETLCSKAAMRFIILLWGKKSSVAPDIVEEIPVFSYDEIIDLGRES  62

Query  1736  HMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPV  1557
               A   S +AR  Y YE I SDD+AT VYTSGTTGNPKGVMLTH+NLLHQI +L+D VP 
Sbjct  63    RKAFSDSNDARKHYKYETIGSDDIATYVYTSGTTGNPKGVMLTHKNLLHQIRSLYDIVPA  122

Query  1556  VPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYET  1377
               GD+FLSMLPPWH YERA  YFIFS G E +YT V NLK+DL+RYQP Y+ISVPLVYET
Sbjct  123   ENGDKFLSMLPPWHVYERACGYFIFSRGIELMYTAVRNLKDDLQRYQPHYMISVPLVYET  182

Query  1376  LYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLW  1197
             LYSGI KQI TSS AR+++A   ++ISFAY   KRIYEG CLT++QKQPSYLV+++DWLW
Sbjct  183   LYSGIQKQIFTSSAARRVVARALIRISFAYTAFKRIYEGFCLTRNQKQPSYLVALIDWLW  242

Query  1196  ARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYG  1017
             AR I A+L PLHLLA KLVY KI S+IGISKAG+SGGGSL  H+D F+EAI +K+Q GYG
Sbjct  243   ARIICAILWPLHLLAEKLVYKKIQSAIGISKAGVSGGGSLPMHIDLFYEAIGVKVQVGYG  302

Query  1016  LTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGY  837
             LTES+PV+A RRP CNVLGS+G PI HTEIK+VDAET++ L  GSKGIVK +G QVM+GY
Sbjct  303   LTESSPVIAARRPTCNVLGSVGHPINHTEIKIVDAETNEVLPAGSKGIVKVRGSQVMQGY  362

Query  836   YKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVE  657
             +KNP ATKQA+DE+GWLNTGD+GWI P+HS GRSR   G +VLEGRAKDTIVLS+GENVE
Sbjct  363   FKNPSATKQALDEDGWLNTGDIGWIAPHHSRGRSRRCGGVLVLEGRAKDTIVLSTGENVE  422

Query  656   PSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKT  477
             P E+EEAA+ S+LI+QIVVIGQD+RR GA+++P KEEVL+AAK+LS+V +DA+E+S+EKT
Sbjct  423   PLELEEAALRSSLIRQIVVIGQDQRRPGAIIVPDKEEVLMAAKRLSIVHADASELSKEKT  482

Query  476   SKLIHEELQKWTTGCTFQIGPILLINEPFTID  381
               L++ EL+KWT+ C+FQIGPI +++EPFT++
Sbjct  483   ISLLYGELRKWTSKCSFQIGPIHVVDEPFTVN  514



>ref|XP_002520615.1| long-chain-fatty-acid CoA ligase, putative [Ricinus communis]
 gb|EEF41751.1| long-chain-fatty-acid CoA ligase, putative [Ricinus communis]
Length=571

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/512 (71%), Positives = 429/512 (84%), Gaps = 2/512 (0%)
 Frame = -3

Query  2360  QLNSRGSTS-RKFRVFCESTGMQIRKCSPilesillsgnglls-sEWKTVPDIWKTAAEE  2187
             ++N RG +S  +FRV+CES   ++++CSP LE  LL  NG L   EWK VPDIW+T+AE+
Sbjct  53    RINHRGFSSISRFRVYCESEEKKVKRCSPYLEKALLRSNGELVPDEWKAVPDIWRTSAEK  112

Query  2186  FGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQ  2007
             +G+ +ALVDPYH+PPTN ++ +LE+EI++F+EGLR+I +KP+EKIALFADNSCRWLVADQ
Sbjct  113   YGDRVALVDPYHDPPTNFTYNQLEQEILNFSEGLRIIEVKPNEKIALFADNSCRWLVADQ  172

Query  2006  GIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILL  1827
             GIM  GAINVVRGSRSSVEEL QIYNHSESVAL VD+PE+++RIAET  S+A + FIILL
Sbjct  173   GIMAMGAINVVRGSRSSVEELSQIYNHSESVALVVDSPELFNRIAETLCSNAVITFIILL  232

Query  1826  WGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYT  1647
             WGEKS +  + MDG P+++Y +I+DLG ES   LL S +A  QY YE I+SDDVATLVYT
Sbjct  233   WGEKSGLDIKGMDGIPVFNYKQIVDLGRESRKVLLDSDDAWRQYVYETISSDDVATLVYT  292

Query  1646  SGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCE  1467
             SGTTGNPKGVMLTH+NLLHQI NL D VP  PGDRFLSMLPPWHAYERA EYFI +LG E
Sbjct  293   SGTTGNPKGVMLTHKNLLHQINNLLDVVPAEPGDRFLSMLPPWHAYERACEYFIMTLGVE  352

Query  1466  QVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAY  1287
             QV+TTV NLKEDLK YQP Y+ISVPLVYETLYSGI KQI+TSS  RKL+AL F+++S AY
Sbjct  353   QVFTTVRNLKEDLKHYQPHYMISVPLVYETLYSGIQKQISTSSTIRKLVALTFIRVSLAY  412

Query  1286  KEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigis  1107
              E KRIYEG  LT+ QKQPSYL+S+LD LWAR +AA+L P+H+LA+KLVY KIH +IGIS
Sbjct  413   MEFKRIYEGTYLTRIQKQPSYLISLLDCLWARIMAAILLPVHMLAKKLVYRKIHLAIGIS  472

Query  1106  kagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEI  927
             KAGISGGGSL  HVDKFFEAI +K+QNGYG+TES+PV A RRP CNVLGSIG PIRHTE 
Sbjct  473   KAGISGGGSLPMHVDKFFEAIGVKVQNGYGMTESSPVTAARRPTCNVLGSIGHPIRHTEF  532

Query  926   KVVDAETDKALSPGSKGIVKAKGPQVMKGYYK  831
             KVVDAETD+A   GSKGIVK KGPQVMKGYYK
Sbjct  533   KVVDAETDEAFPDGSKGIVKVKGPQVMKGYYK  564



>ref|XP_006373098.1| hypothetical protein POPTR_0017s087001g, partial [Populus trichocarpa]
 gb|ERP50895.1| hypothetical protein POPTR_0017s087001g, partial [Populus trichocarpa]
Length=570

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/507 (70%), Positives = 423/507 (83%), Gaps = 3/507 (1%)
 Frame = -3

Query  2342  STSRKFRVFCESTG--MQIRKCSPilesillsgn-gllssEWKTVPDIWKTAAEEFGNCI  2172
             S+ R FR+ CE+    ++IR+CSP LE  L+S N  L S +W+ VPDIW+++AE++G+ I
Sbjct  64    SSRRGFRLSCETKTEEIKIRRCSPYLERTLVSSNGALTSDDWRAVPDIWRSSAEKYGDRI  123

Query  2171  ALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTT  1992
             A+VDPYH+PPT+L++K+LE+EI+ F+EGLRVIG+KPDEK+ALFADNS RWLV DQG+M  
Sbjct  124   AVVDPYHDPPTSLTYKQLEQEILDFSEGLRVIGVKPDEKLALFADNSYRWLVTDQGMMAM  183

Query  1991  GAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKS  1812
             GA++VVRGSRSS+EELLQIY HSESVALAVDNPE+++RI ETF S A  RF+ILLWGEKS
Sbjct  184   GAVDVVRGSRSSIEELLQIYIHSESVALAVDNPELFNRIVETFCSKAAPRFVILLWGEKS  243

Query  1811  SITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTG  1632
              +    M+G PI+SY EIIDLG ES  A   S +AR  Y YE I+SDD+ATLVYTSGTTG
Sbjct  244   HLAINRMEGIPIFSYKEIIDLGQESCKAFSDSDDARQHYKYETISSDDIATLVYTSGTTG  303

Query  1631  NPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTT  1452
             NPKGVMLTH+NLLHQI NLWD VP  P DRFLSMLPPWHAYERAAEYFIF+ G EQVYTT
Sbjct  304   NPKGVMLTHKNLLHQINNLWDVVPAQPADRFLSMLPPWHAYERAAEYFIFTHGTEQVYTT  363

Query  1451  VINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKR  1272
             V NLK DL++YQP YLI+VPLV+ETLYSGI KQ++TSS  RK++A +F+KIS  Y E KR
Sbjct  364   VRNLKVDLQQYQPHYLITVPLVFETLYSGIQKQLSTSSALRKILAFMFIKISLTYMEMKR  423

Query  1271  IYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagis  1092
             IYEG  L + +K+P Y VS+LDWLWAR IAA+L P+H+LA+KLVYSKIHS+IGISKAG+S
Sbjct  424   IYEGTYLVRSRKEPPYFVSMLDWLWARIIAAILLPVHMLAKKLVYSKIHSAIGISKAGVS  483

Query  1091  gggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDA  912
             GGGSL SHVDKFFEAI + +QNGYG+TES+PV A RRP+ NVLGSIG PIRHTE K+VDA
Sbjct  484   GGGSLPSHVDKFFEAIGVVVQNGYGMTESSPVTAARRPSNNVLGSIGLPIRHTEFKIVDA  543

Query  911   ETDKALSPGSKGIVKAKGPQVMKGYYK  831
             ET +AL  GSKGIVK +GPQVMKGYYK
Sbjct  544   ETGEALPHGSKGIVKVRGPQVMKGYYK  570



>ref|XP_010097961.1| Long-chain-fatty-acid--[acyl-carrier-protein] ligase AEE15 [Morus 
notabilis]
 gb|EXB73691.1| Long-chain-fatty-acid--[acyl-carrier-protein] ligase AEE15 [Morus 
notabilis]
Length=567

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/503 (68%), Positives = 408/503 (81%), Gaps = 21/503 (4%)
 Frame = -3

Query  2330  KFRVFCESTG--MQIRKCSPilesillsgn-gllssEWKTVPDIWKTAAEEFGNCIALVD  2160
             +FRV C++    +QIR+CSP LES LLS N  L+  EWK VPDIW+TAAE++G  +A+ D
Sbjct  53    RFRVSCQAQTEEVQIRRCSPFLESSLLSSNGTLVYDEWKAVPDIWRTAAEKYGKYVAVTD  112

Query  2159  PYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAIN  1980
             PYH+ P+ L++K+LE+EI+ F+EGLRVIG+KPDEK+ALFADNSCRWLVADQGIM TGAIN
Sbjct  113   PYHDHPSTLTYKQLEQEILDFSEGLRVIGIKPDEKVALFADNSCRWLVADQGIMATGAIN  172

Query  1979  VVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITS  1800
             VVRGSRSS+EELL IYNHSESV LAVDNPE+++RI+E F S A++RF+ILLWG+KSS+ S
Sbjct  173   VVRGSRSSIEELLHIYNHSESVGLAVDNPELFNRISEAFQSKANMRFVILLWGDKSSLPS  232

Query  1799  EVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKG  1620
               + G+P+++Y +II LG ES  A+ +S + R  Y YE INS+DVATLVYTSGTTGNPKG
Sbjct  233   GGVKGKPVFNYKDIISLGQESRNAISNSNDVRKNYVYEAINSEDVATLVYTSGTTGNPKG  292

Query  1619  VMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINL  1440
             VMLTH NLLHQI NLWD VP   GD+FLSMLPPWHAYERAAEYF F+ G EQVYTTV NL
Sbjct  293   VMLTHRNLLHQIRNLWDIVPCEAGDKFLSMLPPWHAYERAAEYFTFTFGVEQVYTTVRNL  352

Query  1439  KEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEG  1260
             KEDL+ YQP+Y+ISVPLVYETLYSGI KQI+TSS ARKLIAL FL+ S  Y E KRIYEG
Sbjct  353   KEDLRHYQPEYIISVPLVYETLYSGIEKQISTSSAARKLIALTFLQASMTYMEFKRIYEG  412

Query  1259  KCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggs  1080
               LTK+QKQPSY++S+LDWLWAR IA LL PLH LA+ LVYSKIHS++GIS         
Sbjct  413   MYLTKNQKQPSYIISLLDWLWARIIAGLLWPLHALAKNLVYSKIHSALGIS---------  463

Query  1079  lssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDK  900
                      +AI++K+QNGYGLTES+PVV+ R P CNVLGS+G PIRHTE KVVD+ET +
Sbjct  464   ---------KAIEVKVQNGYGLTESSPVVSARLPTCNVLGSVGHPIRHTEFKVVDSETGE  514

Query  899   ALSPGSKGIVKAKGPQVMKGYYK  831
              L PG KGIVK +GPQVMKGY+K
Sbjct  515   VLPPGEKGIVKVRGPQVMKGYFK  537


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -3

Query  392  FTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
            F ID+GL+TPTMK+RRDKV DLYKEQI++LYK
Sbjct  536  FKIDSGLMTPTMKIRRDKVMDLYKEQIDNLYK  567



>ref|XP_003601698.1| Annotation was added to scaffolds in November 2011~Long-chain-fatty-acid 
CoA ligase [Medicago truncatula]
 gb|AES71949.1| long-chain-fatty-acid CoA ligase (AMP-forming) [Medicago truncatula]
Length=512

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/484 (69%), Positives = 406/484 (84%), Gaps = 1/484 (0%)
 Frame = -3

Query  1745  NESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDP  1566
             N+ H  L+++  A   Y +E I  DD+ATLVYTSGTTGNPKGVMLTH+NLLHQI +L D 
Sbjct  29    NQVHNKLIYNVIAGEHYIFETIKLDDIATLVYTSGTTGNPKGVMLTHQNLLHQIKHLSDV  88

Query  1565  VPVV-PGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPL  1389
             VP    GD+FLSMLPPWHAYERA EY +FS G E +YTTV NLK+DL RY+P  ++SVPL
Sbjct  89    VPTTEAGDKFLSMLPPWHAYERACEYLVFSRGLEHIYTTVRNLKDDLGRYKPHLMVSVPL  148

Query  1388  VYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVL  1209
             V+ETLYSGI+KQI+TSS  RKL+AL F+++S  Y E KRIYEGKCLTK+QK PSYL ++L
Sbjct  149   VFETLYSGIMKQISTSSLVRKLVALTFIRVSLGYMECKRIYEGKCLTKNQKAPSYLYAML  208

Query  1208  DWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAIDIKLQ  1029
             DWLWAR +A +L P+H+LA KLVYSKI S+IGIS A ISGGGSL SHVDKFFEAI + LQ
Sbjct  209   DWLWARIMATILYPVHMLANKLVYSKIRSTIGISTAAISGGGSLPSHVDKFFEAIGLNLQ  268

Query  1028  NGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQV  849
             NGYGLTE++PV+A RR  C+V+GS+G P++HTE KVVD+ET + L PGSKGI+K +GPQ+
Sbjct  269   NGYGLTETSPVIAARRLGCDVIGSVGYPLKHTEFKVVDSETGEVLPPGSKGILKVRGPQL  328

Query  848   MKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSG  669
             MKGYYKNP AT + ID +GWLNTGD+GWI  +HS GRSRNS G IV+EGRAKDTIVLSSG
Sbjct  329   MKGYYKNPLATNRVIDSDGWLNTGDIGWIAAHHSTGRSRNSGGVIVVEGRAKDTIVLSSG  388

Query  668   ENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVS  489
             ENVEP E+EEAA  SNLIQQIVVIGQDKRRLGA+++P+KEEVL AAK+LS++DS++++VS
Sbjct  389   ENVEPGELEEAATRSNLIQQIVVIGQDKRRLGAIIVPNKEEVLKAAKELSIIDSNSSDVS  448

Query  488   EEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIE  309
             +EK + LI+ EL+ WT+G  FQIGPILL+N+PFTIDNGL+TPTMKVRRD+V   Y++QIE
Sbjct  449   QEKVTSLIYNELRTWTSGFPFQIGPILLVNDPFTIDNGLMTPTMKVRRDRVVAQYRDQIE  508

Query  308   DLYK  297
             +LYK
Sbjct  509   NLYK  512



>ref|XP_001774133.1| predicted protein [Physcomitrella patens]
 gb|EDQ61047.1| predicted protein [Physcomitrella patens]
Length=672

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/647 (52%), Positives = 453/647 (70%), Gaps = 7/647 (1%)
 Frame = -3

Query  2228  WKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIA  2049
             W  VPDIW+TAA ++G  +ALVDP+ +PP  L+F ++E+ I++FAEGLR  G++P++ +A
Sbjct  30    WVAVPDIWRTAAVKYGERVALVDPHRDPPAELTFSQVEEAILNFAEGLRAAGIQPNQTVA  89

Query  2048  LFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAE  1869
             LFADNS RWL+ADQGI+  GA+N VRGSRSS EELL IY+HS+SVAL +DN E++ ++A 
Sbjct  90    LFADNSYRWLIADQGILAAGAVNAVRGSRSSAEELLYIYSHSDSVALVIDNAELFKKLAP  149

Query  1868  TFHSHADVRFIILLWGEKSSITS---EVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQ  1698
                  A V+F++LLWG+K SI S     +   PI++++E ++LG  S      S      
Sbjct  150   MLRESAKVKFVVLLWGDKQSIVSTNGSFLKDTPIHTFDEFVELGEGSRET--SSGGYYRN  207

Query  1697  YTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPW  1518
               +E I+SDD ATLVYTSGTTG PK VMLTH NLLHQ++NLW  +   PG RFL++LPPW
Sbjct  208   ILHEKIHSDDTATLVYTSGTTGKPKAVMLTHGNLLHQVINLWSVIQPSPGQRFLTILPPW  267

Query  1517  HAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSS  1338
             H YER+ EYF  S G   VYT+V +LKEDL  Y+P Y ++VPLV++ LY+G+ KQ+N ++
Sbjct  268   HMYERSCEYFYLSRGVNHVYTSVKSLKEDLVLYKPDYFVAVPLVFDLLYNGVQKQLNAAT  327

Query  1337  PARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHL  1158
               RK +A+  + IS  Y +AKR+ +G+ L   +K+     +  +WL A  + ++L PLHL
Sbjct  328   GFRKTLAMALISISTKYMDAKRVAQGRDLASARKKQPIFTAAKEWLAAMVVMSILLPLHL  387

Query  1157  LARKLVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRP  978
             + + LV+ K   +       ISGGGSL +HVDKFFE I I + NGYGLTE++PV++CR P
Sbjct  388   ITKLLVF-KKIRATLTMGTAISGGGSLPTHVDKFFEMIGIPVLNGYGLTETSPVLSCRLP  446

Query  977   NCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDE  798
               N+LGS+G PI  T +K+VD ET++ L PG KG+VKA GPQ+MKGYYK   ATK+AID 
Sbjct  447   YNNILGSVGIPIPGTRVKIVDPETNRQLGPGIKGLVKASGPQIMKGYYKAK-ATKKAIDP  505

Query  797   NGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNL  618
              GW +TGDLGWI P   IG +R   G ++L+GRAKDTIVLS+GENVEP+EIEE    S+L
Sbjct  506   EGWFDTGDLGWIAPKMGIGCARRCGGVLILDGRAKDTIVLSTGENVEPTEIEEVMSQSSL  565

Query  617   IQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTT  438
             IQ IVV+GQD+RRLGALV+ +K+E+  AAK+      +  E S+      I EEL+ +  
Sbjct  566   IQNIVVLGQDQRRLGALVVANKDELYAAAKERMQAKGNTAEPSDADLRACIREELRTYGA  625

Query  437   GCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             GC+  +    ++ EPFT++NG LTPTMKVRRD VT  YKEQ+  L+K
Sbjct  626   GCSHSVATFEILYEPFTVENGFLTPTMKVRRDVVTAKYKEQVNALFK  672



>gb|KDO47451.1| hypothetical protein CISIN_1g0065302mg [Citrus sinensis]
Length=495

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/489 (68%), Positives = 411/489 (84%), Gaps = 0/489 (0%)
 Frame = -3

Query  1847  VRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDD  1668
             +RFIILLWG+KSS+  ++++  P++SY+EIIDLG ES  A   S +AR  Y YE I SDD
Sbjct  1     MRFIILLWGKKSSVAPDIVEEIPVFSYDEIIDLGRESRKAFSDSNDARKHYKYETIGSDD  60

Query  1667  VATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYF  1488
             +AT VYTSGTTGNPKGVMLTH+NLLHQI +L+D VP   GD+FLSMLPPWH YERA  YF
Sbjct  61    IATYVYTSGTTGNPKGVMLTHKNLLHQIRSLYDIVPAENGDKFLSMLPPWHVYERACGYF  120

Query  1487  IFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLF  1308
             IFS G E +YT V NLK+DL+RYQP Y+ISVPLVYETLYSGI KQI TSS AR+++A   
Sbjct  121   IFSRGIELMYTAVRNLKDDLQRYQPHYMISVPLVYETLYSGIQKQIFTSSAARRVVARAL  180

Query  1307  LKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYski  1128
             ++ISFAY   KRIYEG CLT++QKQPSYLV+++DWLWAR I A+L PLHLLA KLVY KI
Sbjct  181   IRISFAYTAFKRIYEGFCLTRNQKQPSYLVALIDWLWARIICAILWPLHLLAEKLVYKKI  240

Query  1127  hssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGP  948
              S+IGISKAG+SGGGSL  H+D F+EAI +K+Q GYGLTES+PV+A RRP CNVLGS+G 
Sbjct  241   QSAIGISKAGVSGGGSLPMHIDLFYEAIGVKVQVGYGLTESSPVIAARRPTCNVLGSVGH  300

Query  947   PIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLG  768
             PI HTEIK+VDAET++ L  GSKGIVK +G QVM+GY+KNP ATKQA+DE+GWLNTGD+G
Sbjct  301   PINHTEIKIVDAETNEVLPAGSKGIVKVRGSQVMQGYFKNPSATKQALDEDGWLNTGDIG  360

Query  767   WIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQD  588
             WI P+HS GRSR   G +VLEGRAKDTIVLS+GENVEP E+EEAA+ S+LI+QIVVIGQD
Sbjct  361   WIAPHHSRGRSRRCGGVLVLEGRAKDTIVLSTGENVEPLELEEAALRSSLIRQIVVIGQD  420

Query  587   KRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPIL  408
             +RR GA+++P KEEVL+AAK+LS+V +DA+E+S+EKT  L++ EL+KWT+ C+FQIGPI 
Sbjct  421   QRRPGAIIVPDKEEVLMAAKRLSIVHADASELSKEKTISLLYGELRKWTSKCSFQIGPIH  480

Query  407   LINEPFTID  381
             +++EPFT++
Sbjct  481   VVDEPFTVN  489



>ref|XP_006665087.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic-like 
isoform X2 [Oryza brachyantha]
Length=545

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/543 (62%), Positives = 429/543 (79%), Gaps = 2/543 (0%)
 Frame = -3

Query  1922  ESVALAVDNPEMYSRIA-ETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLG  1746
             E   L + N   Y+ I  E+F S  +  F++LLWGEKS + SE ++G P+Y + +I  LG
Sbjct  4     EEQGLLMKNYFKYTLIQKESFISRINAGFVVLLWGEKSCLNSEAVNGIPLYDFKDITQLG  63

Query  1745  NESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDP  1566
             +ES   L  S+E   Q  +E I  DDVATL+YTSGT+G PKGVMLTH NLLHQI NLWD 
Sbjct  64    HESRNTLRQSREQDQQVVFETITPDDVATLIYTSGTSGAPKGVMLTHRNLLHQIKNLWDF  123

Query  1565  VPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLV  1386
             VP VPGDRFLSMLPPWHAYERA+EYFIF+ G +QVYTTV  LKEDL++YQPQY++SVPLV
Sbjct  124   VPAVPGDRFLSMLPPWHAYERASEYFIFTYGIQQVYTTVKYLKEDLQQYQPQYIVSVPLV  183

Query  1385  YETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLD  1206
             YETLYS I +QIN+SS ARK+IAL  +KIS  Y EAKRIYEG  L+ +  + S++V +++
Sbjct  184   YETLYSSIQRQINSSSTARKVIALALIKISLLYMEAKRIYEGTVLSNNPVKQSFIVYMVN  243

Query  1205  WLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAIDIKLQN  1026
             WL A  +A LL PLH LA KLVY KIHS+IGISKAGISGGGSL  HVD+FFEAI +K+QN
Sbjct  244   WLSASIVAGLLWPLHNLANKLVYKKIHSAIGISKAGISGGGSLPMHVDRFFEAIGVKVQN  303

Query  1025  GYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVM  846
             GYGLTE++PVVA RRP CNVLG++G P++HTEIK+VD ET + +  GSKG+VK +GPQVM
Sbjct  304   GYGLTETSPVVAARRPFCNVLGTVGHPVKHTEIKIVDIETGEVIPDGSKGVVKVRGPQVM  363

Query  845   KGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGE  666
             KGYYKNP AT + +D+ GW +TGD+GWI P+   G SR   G +VLEGRAKDTIVL++GE
Sbjct  364   KGYYKNPSATNKVLDQEGWFDTGDIGWIAPHCPTGSSRKCGGMLVLEGRAKDTIVLTTGE  423

Query  665   NVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSE  486
             NVEP+EIEEAA+ S+LI QIVV+GQDKRRLGA+++P+ +E L  AK+ S++D    E+++
Sbjct  424   NVEPAEIEEAAIRSDLINQIVVVGQDKRRLGAIIVPNYDEALATAKRKSILDG-TNELAK  482

Query  485   EKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIED  306
             +K   L+++EL+ WT+GC+FQIGPIL+++EPFT+DNGLLTPT+K+RRDKVT  Y ++I+ 
Sbjct  483   DKVLNLLYDELRTWTSGCSFQIGPILIVDEPFTVDNGLLTPTLKIRRDKVTAKYNKEIDG  542

Query  305   LYK  297
             LYK
Sbjct  543   LYK  545



>ref|XP_002962119.1| hypothetical protein SELMODRAFT_76207, partial [Selaginella moellendorffii]
 gb|EFJ37379.1| hypothetical protein SELMODRAFT_76207, partial [Selaginella moellendorffii]
Length=617

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/643 (53%), Positives = 464/643 (72%), Gaps = 31/643 (5%)
 Frame = -3

Query  2228  WKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIA  2049
             W+ VPD+W++ +E++G  +ALVDP  +PP  +++ ++E+ I++FAE +R +G+ PDE +A
Sbjct  2     WRAVPDLWRSCSEKYGKRVALVDPRRDPPVRMTYLQVEEAILNFAEAMRSLGVSPDEHVA  61

Query  2048  LFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAE  1869
             LFADNSCRWL+ADQGIM  GA N VRGSRSS EEL+ I  HS+SVAL +D PE+  R+  
Sbjct  62    LFADNSCRWLIADQGIMAMGAANAVRGSRSSDEELVYILKHSDSVALVIDTPELLKRLEA  121

Query  1868  TFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTY  1689
              F+    ++F++LLWG+K    +      P+++Y E I LG +S       +E     + 
Sbjct  122   RFNDSLSLKFVVLLWGQKPESFA-----FPVFTYEECISLGQKS-------REKPGTTSA  169

Query  1688  EPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAY  1509
              PI   DVAT+VYTSGTTGNPKGVMLTH N++HQ+  L   +  VPGDRFLS+LPPWH Y
Sbjct  170   LPIQPQDVATIVYTSGTTGNPKGVMLTHANIIHQMKYLDQCIQPVPGDRFLSLLPPWHMY  229

Query  1508  ERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPAR  1329
             ER AEYF F+ G EQVYTTV  LK+DL+ Y  QY +SVPLVY+TLYSG+ KQ++ +S  R
Sbjct  230   ERVAEYFTFTRGIEQVYTTVKFLKDDLQAYPTQYFVSVPLVYDTLYSGVQKQLSKASGLR  289

Query  1328  KLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLAR  1149
             + + + F+ IS  +K+ KRI EG+ LT+ ++ P+ L   L    A  +A +L PLH L  
Sbjct  290   RALVMGFMAISSFFKDLKRISEGRSLTRAKEHPNRLECFL----AGVMAMILSPLHFLGD  345

Query  1148  KLVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
             K+V+SKI ++IGI KAGISGGGSL  HVDKFFE + I L NGYGLTES+PVV+ R  + N
Sbjct  346   KIVFSKIRAAIGIQKAGISGGGSLPKHVDKFFEVVGITLLNGYGLTESSPVVSTRAFSDN  405

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             VLG++G P+  TE+K+VD E+ K L+ G+KGIV  +GPQVMKGYYKNP AT++AID +GW
Sbjct  406   VLGTVGMPLPETEVKIVDPESRKPLANGNKGIVTVRGPQVMKGYYKNPDATQKAIDGDGW  465

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
             L+TGDLGW+ P    G +R   G +VLEGRAK+TIVLS+GENVEP+EIEEAA+ S+LI Q
Sbjct  466   LDTGDLGWVAPVWKTGAARKCGGMLVLEGRAKETIVLSTGENVEPTEIEEAALQSSLIDQ  525

Query  608   IVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCT  429
             I+V+GQD+RRLGAL++  K             D+ AT  ++ K+  L+ EELQ+ T+ C+
Sbjct  526   IMVVGQDQRRLGALIVASK-------------DTAATSANDLKS--LVREELQRCTSSCS  570

Query  428   FQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             FQIGP +++NEPFT++NGLLTPTMK+RRD +   Y+ QI+ L+
Sbjct  571   FQIGPFVIVNEPFTMENGLLTPTMKLRRDAILTRYRNQIDYLF  613



>ref|XP_002970967.1| hypothetical protein SELMODRAFT_95195, partial [Selaginella moellendorffii]
 gb|EFJ27565.1| hypothetical protein SELMODRAFT_95195, partial [Selaginella moellendorffii]
Length=616

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/643 (53%), Positives = 464/643 (72%), Gaps = 32/643 (5%)
 Frame = -3

Query  2228  WKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIA  2049
             W+ VPD+W++ +E +G  +ALVDP  +PP  +++ ++E+ I++FAE +R +G+ PDE +A
Sbjct  2     WRAVPDLWRSCSERYGKRVALVDPRRDPPIRMTYLQVEEAILNFAEAMRSLGVSPDEHVA  61

Query  2048  LFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAE  1869
             LFADNSCRWL+ADQGIM  GA N VRGSRSS EEL+ I  HS+SVAL +D PE+  R+  
Sbjct  62    LFADNSCRWLIADQGIMAMGAANAVRGSRSSDEELVYILKHSDSVALVIDTPELLKRLEA  121

Query  1868  TFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTY  1689
              F+    ++F++LLWG+K    +      P+++Y E I LG +S          +   T 
Sbjct  122   RFNDSLSLKFVVLLWGQKPESFA-----FPVFTYEECISLGQKSR--------EKPGTTS  168

Query  1688  EPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAY  1509
             + + S DVAT+VYTSGTTGNPKGVMLTH N++HQ+  L   +  VPGDRFLS+LPPWH Y
Sbjct  169   KILWSFDVATIVYTSGTTGNPKGVMLTHANIIHQMKYLDQCIQPVPGDRFLSLLPPWHMY  228

Query  1508  ERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPAR  1329
             ER AEYF F+ G EQVYT+V  LK+DL+ Y  QY +SVPLVY+TLYSG+ KQ++ +S  R
Sbjct  229   ERVAEYFTFTRGIEQVYTSVKFLKDDLQAYPTQYFVSVPLVYDTLYSGVQKQLSKASGLR  288

Query  1328  KLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLAR  1149
             + + + F+ IS  +K+ KRI EG+ LT+ ++ P+ L   L    A  +A +L PLH L  
Sbjct  289   RALVMGFMAISSFFKDLKRISEGRSLTRAREHPNRLECFL----AGVMAMILSPLHFLGD  344

Query  1148  KLVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
             K+V+SKI ++IGI KAGISGGGSL  HVDKFFE + I L NGYGLTES+PVV+ R  + N
Sbjct  345   KIVFSKIRAAIGIRKAGISGGGSLPKHVDKFFEVVGITLLNGYGLTESSPVVSTRAFSDN  404

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             VLG++G P+R TE+K+VD E+ K L+ G+KGIV  +GPQVMKGYYKNP AT++AID +GW
Sbjct  405   VLGTVGMPLRETEVKIVDPESRKTLANGNKGIVTVRGPQVMKGYYKNPDATQKAIDGDGW  464

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
             L+TGDLGW+ P    G +R   G +VLEGRAK+TIVLS+GENVEP+EIEEAA+ S+LI Q
Sbjct  465   LDTGDLGWVAPVWKTGAARKCGGMLVLEGRAKETIVLSTGENVEPTEIEEAALQSSLIDQ  524

Query  608   IVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCT  429
             I+V+GQD+RRLGAL++  K             D+ AT  ++ K+  L+ EELQ+ T+ C+
Sbjct  525   IMVVGQDQRRLGALIVASK-------------DTAATSANDLKS--LVREELQRCTSSCS  569

Query  428   FQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             FQIGP +++NEPFT++NGLLTPTMK+RRD +   Y+ QI+ L+
Sbjct  570   FQIGPFVIVNEPFTMENGLLTPTMKLRRDAILTRYRNQIDYLF  612



>gb|ABF99869.1| AMP-binding protein, putative, expressed [Oryza sativa Japonica 
Group]
Length=545

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/525 (64%), Positives = 421/525 (80%), Gaps = 1/525 (0%)
 Frame = -3

Query  1871  ETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYT  1692
             E+F S  + RFI+LLWGEKS + SEV++G P+Y + +I  LG ES   L HS E   Q  
Sbjct  22    ESFISRINARFIVLLWGEKSCLNSEVVNGIPLYDFKDITQLGRESRNTLRHSHEQGQQVV  81

Query  1691  YEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHA  1512
             +E I  DDVATL+YTSGT+G PKGVMLTH NLLHQI NLWD VP VPGDRFLSMLPPWHA
Sbjct  82    FETITPDDVATLIYTSGTSGTPKGVMLTHRNLLHQIKNLWDFVPAVPGDRFLSMLPPWHA  141

Query  1511  YERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPA  1332
             YERA+EYFIF+ G +QVYTTV  LKEDL+RYQPQY++SVPLVYE LYS I +QI++SS A
Sbjct  142   YERASEYFIFTYGIQQVYTTVKYLKEDLQRYQPQYIVSVPLVYEILYSSIQRQISSSSTA  201

Query  1331  RKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLA  1152
             RK +AL  +KIS  Y EAKRIYEG  L+ +  +PS++V +++WL AR +AALL PLH LA
Sbjct  202   RKFVALALIKISLLYMEAKRIYEGTVLSNNPVKPSFIVYMVNWLSARIVAALLWPLHNLA  261

Query  1151  RKLVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNC  972
             + LVY KIHS+IGISKAGISGGGSL  HVDKFFEAI +K+QNGYGLTE++PVVA RRP C
Sbjct  262   KTLVYKKIHSAIGISKAGISGGGSLPMHVDKFFEAIGVKVQNGYGLTETSPVVAARRPFC  321

Query  971   NVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENG  792
             NVLG++G P++HTEIKVVD ET + L  GSKG+VK +GPQVMKGYYKNP AT + +D+ G
Sbjct  322   NVLGTVGHPVKHTEIKVVDMETGEVLPDGSKGVVKVRGPQVMKGYYKNPSATNKVLDQEG  381

Query  791   WLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQ  612
             W +TGD+GWI P+   G SR   G +VLEGRAKDTIVL++GENVEP+EIEEAA  S+LI 
Sbjct  382   WFDTGDIGWIAPHCPTGPSRKCGGMLVLEGRAKDTIVLTTGENVEPAEIEEAASRSDLIN  441

Query  611   QIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGC  432
             QIVV+GQDKRR+GAL++P+ +EVL  AK+ S++D +  E++++K   L+++EL+ W   C
Sbjct  442   QIVVVGQDKRRIGALIVPNYDEVLATAKRKSILDGN-NELAKDKVLNLLYDELRTWMVDC  500

Query  431   TFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             +FQIGPIL+++EPFT+DNGLLTPT+K+RRDKVT  Y  +I+ LYK
Sbjct  501   SFQIGPILIVDEPFTVDNGLLTPTLKLRRDKVTAKYHREIDALYK  545



>ref|XP_001777520.1| predicted protein [Physcomitrella patens]
 gb|EDQ57695.1| predicted protein [Physcomitrella patens]
Length=778

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/666 (54%), Positives = 475/666 (71%), Gaps = 4/666 (1%)
 Frame = -3

Query  2291  RKCSPilesillsgngllssEWKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEK  2112
             RKC+P+ E    S     S  W+ VPDIWKTAAE++G+ +ALVDP+  PP+ +++K+LE+
Sbjct  109   RKCAPLFEGASESLPSESSE-WRAVPDIWKTAAEKYGDRVALVDPHRQPPSQITYKQLEQ  167

Query  2111  EIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIY  1932
              I+ FAEGLRV G++PD+ ++LFADNS RWL++DQGIM  GA+  VRGSRSS +EL  I 
Sbjct  168   SILDFAEGLRVCGIRPDQHMSLFADNSHRWLISDQGIMAAGAVAAVRGSRSSTDELYHIV  227

Query  1931  NHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGR--PIYSYNEI  1758
              HS+SVAL VDN E+Y++IA+    +  ++F+I+LW  K ++  ++ DG   P YS++E+
Sbjct  228   THSDSVALVVDNLEIYNKIADRLKGNTVIKFVIVLWTSKDTL-KDLKDGSEVPFYSFDEL  286

Query  1757  IDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILN  1578
             +  G  S  AL     +  +   + I+ DDVATLVYTSGTTGNPKGVMLTH NLLHQI++
Sbjct  287   MASGRTSRQALAAVASSGERVQCDVIHPDDVATLVYTSGTTGNPKGVMLTHANLLHQIVH  346

Query  1577  LWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLIS  1398
             L   V   PGDRFLS+LPPWH YER+AEYF  S G  QVYT+V  LKEDL RY P Y ++
Sbjct  347   LGSVVQPGPGDRFLSLLPPWHMYERSAEYFALSRGVSQVYTSVKTLKEDLARYPPDYFVA  406

Query  1397  VPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLV  1218
             VPLV++ LYSG+ KQI   S  RK IAL  L +S  + + KR  EG+ +TK ++  S + 
Sbjct  407   VPLVFDILYSGVQKQIAAGSKFRKQIALTLLSLSLKFVDIKRKQEGRDVTKGRESFSPVA  466

Query  1217  SVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAIDI  1038
             +   W  A   A LL P HLLA+KLVYSKI +SIGI KA ISGGGSL  +VD+FFEAI I
Sbjct  467   AAKVWAIATIGALLLLPFHLLAQKLVYSKILASIGIKKAAISGGGSLPPYVDRFFEAIGI  526

Query  1037  KLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKG  858
             ++ NGYGLTE++PVV+CR P+ NVLG++G PI  TEIKVVD  +   + PG KG VK +G
Sbjct  527   RVLNGYGLTETSPVVSCRLPSNNVLGTVGGPIPETEIKVVDPNSGNIVPPGIKGSVKIRG  586

Query  857   PQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVL  678
             PQVMKGYYKNP AT +AID +GW  TGDLGW VP+  +G +R   G +VL+GRAKDTIVL
Sbjct  587   PQVMKGYYKNPAATSKAIDSDGWFETGDLGWKVPSSPVGPARMCGGLLVLDGRAKDTIVL  646

Query  677   SSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDAT  498
             S+GENVEP EIEEA M S LIQ ++++GQDKRRLGAL++ +KEE+  A K+  +   D++
Sbjct  647   STGENVEPQEIEEAIMQSKLIQNVMLVGQDKRRLGALIVGNKEELEAAVKEYKLAKGDSS  706

Query  497   EVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKE  318
             +  +   + +I  E+ +     ++ +GP  LI E FTI+NGL+TPTMKVRR+ V + YK+
Sbjct  707   KPIKSDRTNVIRREINRLLANSSWPVGPFALIEESFTIENGLMTPTMKVRREVVYERYKD  766

Query  317   QIEDLY  300
             +I+ L+
Sbjct  767   EIDGLF  772



>ref|XP_007034199.1| AMP-dependent synthetase and ligase family protein isoform 5 
[Theobroma cacao]
 gb|EOY05125.1| AMP-dependent synthetase and ligase family protein isoform 5 
[Theobroma cacao]
Length=543

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/474 (70%), Positives = 394/474 (83%), Gaps = 3/474 (1%)
 Frame = -3

Query  2342  STSRKFRVFCESTG--MQIRKCSPilesillsgngllss-EWKTVPDIWKTAAEEFGNCI  2172
             S   KFRVFCES    +QIR+CSP+LE + LS N  + S EWK VPDIW+++AE++G+ +
Sbjct  70    SPGSKFRVFCESKTQELQIRRCSPLLEKVSLSSNDAVVSDEWKAVPDIWRSSAEKYGDRV  129

Query  2171  ALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTT  1992
             A+VDPYH+PP+ +++ +LE+EI+ FAEGLR+IGLKP++K+ALFADNS RWLVADQGIM  
Sbjct  130   AVVDPYHDPPSTMTYIQLEQEILDFAEGLRLIGLKPEDKLALFADNSSRWLVADQGIMAM  189

Query  1991  GAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKS  1812
             GAINVVRGSRS+VEELL IYNHSESV L VDNPE ++R+A TF S A +RFI+LLWGEKS
Sbjct  190   GAINVVRGSRSAVEELLHIYNHSESVGLVVDNPEFFNRLAGTFCSKATMRFIVLLWGEKS  249

Query  1811  SITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTG  1632
              + +    G PI+SY EI++LG ES + L  S +AR  Y YE I SDDVATLVYTSGTT 
Sbjct  250   CLATGETQGVPIFSYREIMELGRESRVGLTDSHDARQGYIYEAIGSDDVATLVYTSGTTD  309

Query  1631  NPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTT  1452
             NPKGVMLTH+NLLHQI NLWD VP   GDRFLSMLP WHAYERA EYFIF+ G EQ YTT
Sbjct  310   NPKGVMLTHKNLLHQIRNLWDVVPAEAGDRFLSMLPSWHAYERACEYFIFTHGIEQEYTT  369

Query  1451  VINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKR  1272
             V NLK+DL+ YQP YLISVPLVYETLYSGI KQI TSS ARK IAL F+++S AY + KR
Sbjct  370   VRNLKDDLRHYQPHYLISVPLVYETLYSGIQKQIYTSSTARKFIALTFIRVSLAYMDLKR  429

Query  1271  IYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagis  1092
             IYEG CLT+DQKQPSY+VS+L+WLWAR IAA+L PLH+LA+KLVY KIHS+IGISKAGIS
Sbjct  430   IYEGLCLTRDQKQPSYVVSMLEWLWARIIAAILWPLHVLAKKLVYEKIHSAIGISKAGIS  489

Query  1091  gggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTE  930
             GGGSL  H+DKFFEAI +KLQNGYGLTES+PV+A RRPNCNVLGS+G PI+HTE
Sbjct  490   GGGSLPMHIDKFFEAIGVKLQNGYGLTESSPVIAARRPNCNVLGSVGHPIQHTE  543



>ref|XP_007034197.1| AMP-dependent synthetase and ligase family protein isoform 3 
[Theobroma cacao]
 gb|EOY05123.1| AMP-dependent synthetase and ligase family protein isoform 3 
[Theobroma cacao]
Length=531

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/462 (70%), Positives = 383/462 (83%), Gaps = 3/462 (1%)
 Frame = -3

Query  2342  STSRKFRVFCESTG--MQIRKCSPilesillsgngllss-EWKTVPDIWKTAAEEFGNCI  2172
             S   KFRVFCES    +QIR+CSP+LE + LS N  + S EWK VPDIW+++AE++G+ +
Sbjct  70    SPGSKFRVFCESKTQELQIRRCSPLLEKVSLSSNDAVVSDEWKAVPDIWRSSAEKYGDRV  129

Query  2171  ALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTT  1992
             A+VDPYH+PP+ +++ +LE+EI+ FAEGLR+IGLKP++K+ALFADNS RWLVADQGIM  
Sbjct  130   AVVDPYHDPPSTMTYIQLEQEILDFAEGLRLIGLKPEDKLALFADNSSRWLVADQGIMAM  189

Query  1991  GAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKS  1812
             GAINVVRGSRS+VEELL IYNHSESV L VDNPE ++R+A TF S A +RFI+LLWGEKS
Sbjct  190   GAINVVRGSRSAVEELLHIYNHSESVGLVVDNPEFFNRLAGTFCSKATMRFIVLLWGEKS  249

Query  1811  SITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTG  1632
              + +    G PI+SY EI++LG ES + L  S +AR  Y YE I SDDVATLVYTSGTT 
Sbjct  250   CLATGETQGVPIFSYREIMELGRESRVGLTDSHDARQGYIYEAIGSDDVATLVYTSGTTD  309

Query  1631  NPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTT  1452
             NPKGVMLTH+NLLHQI NLWD VP   GDRFLSMLP WHAYERA EYFIF+ G EQ YTT
Sbjct  310   NPKGVMLTHKNLLHQIRNLWDVVPAEAGDRFLSMLPSWHAYERACEYFIFTHGIEQEYTT  369

Query  1451  VINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKR  1272
             V NLK+DL+ YQP YLISVPLVYETLYSGI KQI TSS ARK IAL F+++S AY + KR
Sbjct  370   VRNLKDDLRHYQPHYLISVPLVYETLYSGIQKQIYTSSTARKFIALTFIRVSLAYMDLKR  429

Query  1271  IYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagis  1092
             IYEG CLT+DQKQPSY+VS+L+WLWAR IAA+L PLH+LA+KLVY KIHS+IGISKAGIS
Sbjct  430   IYEGLCLTRDQKQPSYVVSMLEWLWARIIAAILWPLHVLAKKLVYEKIHSAIGISKAGIS  489

Query  1091  gggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNV  966
             GGGSL  H+DKFFEAI +KLQNGYGLTES+PV+A RRPNCN+
Sbjct  490   GGGSLPMHIDKFFEAIGVKLQNGYGLTESSPVIAARRPNCNI  531



>gb|KDO47452.1| hypothetical protein CISIN_1g0065302mg [Citrus sinensis]
Length=461

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/443 (70%), Positives = 375/443 (85%), Gaps = 0/443 (0%)
 Frame = -3

Query  1709  ARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSM  1530
             A   Y YE I SDD+AT VYTSGTTGNPKGVMLTH+NLLHQI +L+D VP   GD+FLSM
Sbjct  13    AGKHYKYETIGSDDIATYVYTSGTTGNPKGVMLTHKNLLHQIRSLYDIVPAENGDKFLSM  72

Query  1529  LPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQI  1350
             LPPWH YERA  YFIFS G E +YT V NLK+DL+RYQP Y+ISVPLVYETLYSGI KQI
Sbjct  73    LPPWHVYERACGYFIFSRGIELMYTAVRNLKDDLQRYQPHYMISVPLVYETLYSGIQKQI  132

Query  1349  NTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLC  1170
              TSS AR+++A   ++ISFAY   KRIYEG CLT++QKQPSYLV+++DWLWAR I A+L 
Sbjct  133   FTSSAARRVVARALIRISFAYTAFKRIYEGFCLTRNQKQPSYLVALIDWLWARIICAILW  192

Query  1169  PLHLLARKLVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVA  990
             PLHLLA KLVY KI S+IGISKAG+SGGGSL  H+D F+EAI +K+Q GYGLTES+PV+A
Sbjct  193   PLHLLAEKLVYKKIQSAIGISKAGVSGGGSLPMHIDLFYEAIGVKVQVGYGLTESSPVIA  252

Query  989   CRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQ  810
              RRP CNVLGS+G PI HTEIK+VDAET++ L  GSKGIVK +G QVM+GY+KNP ATKQ
Sbjct  253   ARRPTCNVLGSVGHPINHTEIKIVDAETNEVLPAGSKGIVKVRGSQVMQGYFKNPSATKQ  312

Query  809   AIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAM  630
             A+DE+GWLNTGD+GWI P+HS GRSR   G +VLEGRAKDTIVLS+GENVEP E+EEAA+
Sbjct  313   ALDEDGWLNTGDIGWIAPHHSRGRSRRCGGVLVLEGRAKDTIVLSTGENVEPLELEEAAL  372

Query  629   GSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQ  450
              S+LI+QIVVIGQD+RR GA+++P KEEVL+AAK+LS+V +DA+E+S+EKT  L++ EL+
Sbjct  373   RSSLIRQIVVIGQDQRRPGAIIVPDKEEVLMAAKRLSIVHADASELSKEKTISLLYGELR  432

Query  449   KWTTGCTFQIGPILLINEPFTID  381
             KWT+ C+FQIGPI +++EPFT++
Sbjct  433   KWTSKCSFQIGPIHVVDEPFTVN  455



>ref|XP_003601700.1| Annotation was added to scaffolds in November 2011~Long-chain-fatty-acid 
CoA ligase [Medicago truncatula]
Length=522

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/421 (70%), Positives = 354/421 (84%), Gaps = 1/421 (0%)
 Frame = -3

Query  2228  WKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIA  2049
             WKTVPDIW+++AE++G+ IAL+DPYH+PP+ +++K+LE  I+ FAEGLRVIG+ P+EKIA
Sbjct  99    WKTVPDIWRSSAEKYGDKIALIDPYHDPPSTMTYKQLEDAILDFAEGLRVIGVSPNEKIA  158

Query  2048  LFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAE  1869
             LFADNSCRWLVADQG+M TGAINVVRGSRSS+EELLQIYNHSES+ALAVDNPEM++RIA+
Sbjct  159   LFADNSCRWLVADQGMMATGAINVVRGSRSSIEELLQIYNHSESIALAVDNPEMFNRIAK  218

Query  1868  TFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTY  1689
              F   A +RF+ILLWGEKS + +E     PI+++ EI+ LG  S   L  S +AR  Y +
Sbjct  219   AFDLKASMRFVILLWGEKSCLVNEGSKEVPIFTFTEIMHLGRGSR-RLFESHDARKHYVF  277

Query  1688  EPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAY  1509
             E I SDD+ATLVYTSGTTGNPKGVMLTH+NLLHQI    D VP   GDRFLSMLPPWHAY
Sbjct  278   EAIKSDDIATLVYTSGTTGNPKGVMLTHQNLLHQIKFYSDIVPAEVGDRFLSMLPPWHAY  337

Query  1508  ERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPAR  1329
             ERA EYFIFS G +QVYTTV NLK+DL+RYQP YLISVPLVYE+LYSGI +QI+TSS  R
Sbjct  338   ERACEYFIFSCGVDQVYTTVRNLKDDLERYQPHYLISVPLVYESLYSGIQRQISTSSLVR  397

Query  1328  KLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLAR  1149
             KL+AL F+++S  Y E KRIYEGKCLTK+QK PSYL ++LDWL AR IA +L P+H+LA+
Sbjct  398   KLVALTFIRVSLGYMECKRIYEGKCLTKNQKSPSYLYAMLDWLGARIIATILFPIHMLAK  457

Query  1148  KLVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
             KLVYSKIHS+IG SKAGISGGGSL SHVD+FFEAI + LQNGYGLTE++PV+A RR +CN
Sbjct  458   KLVYSKIHSAIGFSKAGISGGGSLPSHVDRFFEAIGVTLQNGYGLTETSPVIAARRLSCN  517

Query  968   V  966
             V
Sbjct  518   V  518



>gb|KDO47453.1| hypothetical protein CISIN_1g0065302mg [Citrus sinensis]
Length=467

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/403 (69%), Positives = 342/403 (85%), Gaps = 0/403 (0%)
 Frame = -3

Query  1589  QILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQ  1410
             QI +L+D VP   GD+FLSMLPPWH YERA  YFIFS G E +YT V NLK+DL+RYQP 
Sbjct  59    QIRSLYDIVPAENGDKFLSMLPPWHVYERACGYFIFSRGIELMYTAVRNLKDDLQRYQPH  118

Query  1409  YLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQP  1230
             Y+ISVPLVYETLYSGI KQI TSS AR+++A   ++ISFAY   KRIYEG CLT++QKQP
Sbjct  119   YMISVPLVYETLYSGIQKQIFTSSAARRVVARALIRISFAYTAFKRIYEGFCLTRNQKQP  178

Query  1229  SYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisgggslssHVDKFFE  1050
             SYLV+++DWLWAR I A+L PLHLLA KLVY KI S+IGISKAG+SGGGSL  H+D F+E
Sbjct  179   SYLVALIDWLWARIICAILWPLHLLAEKLVYKKIQSAIGISKAGVSGGGSLPMHIDLFYE  238

Query  1049  AIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIV  870
             AI +K+Q GYGLTES+PV+A RRP CNVLGS+G PI HTEIK+VDAET++ L  GSKGIV
Sbjct  239   AIGVKVQVGYGLTESSPVIAARRPTCNVLGSVGHPINHTEIKIVDAETNEVLPAGSKGIV  298

Query  869   KAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKD  690
             K +G QVM+GY+KNP ATKQA+DE+GWLNTGD+GWI P+HS GRSR   G +VLEGRAKD
Sbjct  299   KVRGSQVMQGYFKNPSATKQALDEDGWLNTGDIGWIAPHHSRGRSRRCGGVLVLEGRAKD  358

Query  689   TIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVD  510
             TIVLS+GENVEP E+EEAA+ S+LI+QIVVIGQD+RR GA+++P KEEVL+AAK+LS+V 
Sbjct  359   TIVLSTGENVEPLELEEAALRSSLIRQIVVIGQDQRRPGAIIVPDKEEVLMAAKRLSIVH  418

Query  509   SDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTID  381
             +DA+E+S+EKT  L++ EL+KWT+ C+FQIGPI +++EPFT++
Sbjct  419   ADASELSKEKTISLLYGELRKWTSKCSFQIGPIHVVDEPFTVN  461



>dbj|BAD94085.1| A6 anther-specific protein [Arabidopsis thaliana]
Length=402

 Score =   534 bits (1376),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 273/411 (66%), Positives = 334/411 (81%), Gaps = 10/411 (2%)
 Frame = -3

Query  1532  MLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQ  1353
             MLP WHAYERA+EYFIF+ G EQ+YT++  LK+DLKRYQP Y++SVPLVYETLYSGI KQ
Sbjct  1     MLPSWHAYERASEYFIFTCGVEQMYTSIRYLKDDLKRYQPNYIVSVPLVYETLYSGIQKQ  60

Query  1352  INTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALL  1173
             I+ SS  RK +AL  +K+S AY E KRIYEG CLTK+QK P Y+V+ +DWLWAR IAALL
Sbjct  61    ISASSAGRKFLALTLIKVSMAYMEMKRIYEGMCLTKEQKPPMYIVAFVDWLWARVIAALL  120

Query  1172  CPLHLLARKLVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVV  993
              PLH+LA+KL+Y KIHSSIGISKAGISGGGSL  HVDKFFEAI + LQNGYGLTE++PVV
Sbjct  121   WPLHMLAKKLIYKKIHSSIGISKAGISGGGSLPIHVDKFFEAIGVILQNGYGLTETSPVV  180

Query  992   ACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATK  813
               R  +CNVLGS G P+  TE K+VD ET+  L PGSKGI+K +GPQVMKGYYKNP  TK
Sbjct  181   CARTLSCNVLGSAGHPMHGTEFKIVDPETNNVLPPGSKGIIKVRGPQVMKGYYKNPSTTK  240

Query  812   QAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAA  633
             Q ++E+GW NTGD GWI P+HS GRSR+  G IVLEGRAKDTIVLS+GENVEP EIEEAA
Sbjct  241   QVLNESGWFNTGDTGWIAPHHSKGRSRHCGGVIVLEGRAKDTIVLSTGENVEPLEIEEAA  300

Query  632   MGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEEL  453
             M S +I+QIVVIGQD+RRLGA+++P+KEE    A+++        E S+E    L+++EL
Sbjct  301   MRSRVIEQIVVIGQDRRRLGAIIIPNKEE----AQRVD------PETSKETLKSLVYQEL  350

Query  452   QKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             +KWT+ C+FQ+GP+L++++PFTIDNGL+TPTMK+RRD V   YKE+I+ LY
Sbjct  351   RKWTSECSFQVGPVLIVDDPFTIDNGLMTPTMKIRRDMVVAKYKEEIDQLY  401



>ref|XP_009412885.1| PREDICTED: probable acyl-activating enzyme 16, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=591

 Score =   502 bits (1293),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 259/382 (68%), Positives = 323/382 (85%), Gaps = 1/382 (0%)
 Frame = -3

Query  1442  LKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYE  1263
             +K+DLK YQPQYLISVPLVYETLYS I KQI+TSS ARK +AL+ +K+S  Y EAKRIYE
Sbjct  211   VKDDLKLYQPQYLISVPLVYETLYSSIQKQISTSSGARKFVALMLIKVSLLYMEAKRIYE  270

Query  1262  GKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisggg  1083
             G  LTK+  Q S ++ V DWLWAR +A LL PLH LA KLVYSKIHS+IGISKAGISGG 
Sbjct  271   GGFLTKEHIQESLIIVVKDWLWARIVAVLLWPLHTLAMKLVYSKIHSAIGISKAGISGGA  330

Query  1082  slssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETD  903
             SL SH+D+FFEAI +K+QNGYGLTE++PVVA RRP+CNVLG+IG P+++TEIK+VD +T 
Sbjct  331   SLPSHIDRFFEAIGVKVQNGYGLTETSPVVAARRPSCNVLGTIGHPLKYTEIKIVDMKTG  390

Query  902   KALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSS  723
             + L  G KGIVK KGPQVMKGYYKNP AT +A+DE GW NTGD+GWI+P HS+GRSRN  
Sbjct  391   EVLPDGLKGIVKVKGPQVMKGYYKNPSATSEAVDEEGWFNTGDIGWIIPMHSMGRSRNCG  450

Query  722   GFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEV  543
             G IVLEGR+KDTIVLS+GENVEP+E+E AAM S+LIQQIVVIGQD+RRLGA+++P+K+EV
Sbjct  451   GMIVLEGRSKDTIVLSTGENVEPTELEAAAMRSSLIQQIVVIGQDQRRLGAIIVPNKDEV  510

Query  542   LLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTP  363
             L  A++ S+V+ D +E+SE K   L+++EL+ WT G +F+IGPIL+++EPFTIDNGL+TP
Sbjct  511   LAVARRQSIVNDD-SELSENKMMSLLYDELKTWTVGFSFRIGPILIVDEPFTIDNGLMTP  569

Query  362   TMKVRRDKVTDLYKEQIEDLYK  297
             TMK++R++V D Y+EQI+ LYK
Sbjct  570   TMKIKRNEVADRYREQIKQLYK  591


 Score =   179 bits (454),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 113/152 (74%), Gaps = 3/152 (2%)
 Frame = -3

Query  2333  RKFRVFC--ESTGMQIRKCSPilesillsgngl-lssEWKTVPDIWKTAAEEFGNCIALV  2163
             R  RV C  E  G+  RKC P LE   LS +      EW  +PDIWK++AE++G+ +ALV
Sbjct  48    RSHRVACHLELEGLVRRKCCPYLEGSFLSSSNDPSLHEWSAIPDIWKSSAEKYGDRVALV  107

Query  2162  DPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAI  1983
             DPYH PPT L++K+LE+EI++F+EGLRV+G+ PDEK+ALFADNSCRWL+ADQGIM TGAI
Sbjct  108   DPYHEPPTELTYKQLEQEILNFSEGLRVVGVAPDEKLALFADNSCRWLIADQGIMATGAI  167

Query  1982  NVVRGSRSSVEELLQIYNHSESVALAVDNPEM  1887
             NVVRG+RSS EEL  IY+HSE       +P M
Sbjct  168   NVVRGTRSSNEELFHIYDHSERDKYGSGHPVM  199



>ref|WP_015230005.1| AMP-forming long-chain acyl-CoA synthetase [Dactylococcopsis 
salina]
 ref|YP_007172371.1| AMP-forming long-chain acyl-CoA synthetase [Dactylococcopsis 
salina PCC 8305]
 gb|AFZ51014.1| AMP-forming long-chain acyl-CoA synthetase [Dactylococcopsis 
salina PCC 8305]
Length=636

 Score =   487 bits (1254),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 278/657 (42%), Positives = 395/657 (60%), Gaps = 53/657 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P+IW   A   G  +AL DP+  P   ++++EL ++I+ FA GL+  G+KPD KIAL
Sbjct  15    RSIPEIWSQVAPYCGKLVALDDPHQQPHLKVTYQELNEKIIQFATGLQTQGIKPDTKIAL  74

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             FADNS RW +ADQGIM  GAINVVR S++ V EL+ I   S+S AL V++ +   ++   
Sbjct  75    FADNSPRWFIADQGIMKAGAINVVRSSQADVTELIYILTDSDSTALVVEDQKTLEKLQSQ  134

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
               S   + F+ILL  E   I      G  ++++++II+LG E  ++ +            
Sbjct  135   L-SELPIEFVILLSDETVEIA-----GIKVFNFSQIIELGTEQELSFV------------  176

Query  1685  PINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYE  1506
             P   +D+ATL+YTSGTTG PKG ML+H N LHQ+  L D +    GDR LS+LP WHAYE
Sbjct  177   PREINDLATLIYTSGTTGKPKGAMLSHGNFLHQVRTLGDVIQPQAGDRVLSILPSWHAYE  236

Query  1505  RAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARK  1326
             RAAEYF+ + GC+  YT +   K+DLK  +P Y++ VP ++E++Y GI K +N  +  +K
Sbjct  237   RAAEYFLLARGCQITYTNLRAFKKDLKEQKPNYMVGVPRLWESVYDGIQKTLNQQTGTKK  296

Query  1325  LIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARK  1146
              +   FL IS  Y +AKRI E  CL       ++  SV + L A    +LL PLH L  K
Sbjct  297   KLVNFFLNISDRYIKAKRINERLCLE------NFNPSVTEKLTASVQQSLLEPLHNLGDK  350

Query  1145  LVYskihssigiskagisgggslssH-VDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
             +VY+ +  + G +   +  GG   +  +D F+E + I L  GYGLTE++PV   RR   N
Sbjct  351   VVYNTVREATGGNLKAVISGGGSLAKYIDDFYEVVGIPLLVGYGLTETSPVTHARRLYHN  410

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             + GS G  I  TE K+VD ET  +L+ G KG+V  +G QVM+GYYK P AT +AID+ GW
Sbjct  411   LRGSAGQAIPETETKIVDPETKASLNDGEKGLVMIRGTQVMQGYYKQPEATAKAIDQEGW  470

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              NTGDLGWI P          +G +VL GRAKDTIVLS+GEN+EP  +E+A + S  I Q
Sbjct  471   FNTGDLGWITP----------TGDLVLTGRAKDTIVLSNGENIEPQPLEDACLRSVYIDQ  520

Query  608   IVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEK---------TSKLIHEE  456
             I+V+GQD+R LGAL++P+ E    A ++ S  ++   + SEEK           KL  EE
Sbjct  521   IIVLGQDQRCLGALIVPNVE----ALQQWSEDNNLNLDFSEEKLPETLTNSEIQKLFREE  576

Query  455   LQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             L +            +IG   LI E F+IDNG++T T+KV+R  V + Y++ I+ ++
Sbjct  577   LNREVKNRPGYRPDDRIGVFKLIVEGFSIDNGMMTQTLKVKRPVVCERYQDMIDGMF  633



>ref|WP_017654245.1| long-chain fatty acid--CoA ligase [Microchaete sp. PCC 7126]
Length=658

 Score =   486 bits (1251),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 277/658 (42%), Positives = 404/658 (61%), Gaps = 50/658 (8%)
 Frame = -3

Query  2222  TVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALF  2043
             ++P++W  AA+ F N +AL +P+  P   +++ +L  +I  FA GL+ +G++  ++I+L 
Sbjct  33    SLPEVWPLAAQRFSNIVALHNPHAQPEVLITYAQLAAQIQQFAAGLQTLGVEIGDRISLI  92

Query  2042  ADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETF  1863
             ADNS RW +ADQGIMT+GAIN VR + +  EELL I  +S S AL V++ +   ++    
Sbjct  93    ADNSPRWFIADQGIMTSGAINAVRSALAEREELLFIIANSGSTALVVEDLKTLQKLRAGL  152

Query  1862  HSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEP  1683
             +    ++FIILL  E       +     + ++N++I +G E      H  +A  Q     
Sbjct  153   ND-LPIKFIILLTDEAPPADETLQ----LLNFNQLIAIGCE------HPLKAVQQ-----  196

Query  1682  INSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYER  1503
              N  D+ATL+YTSGTTG PKGVML+H NLLHQ+  L   V   PGD  LS+LP WH+YER
Sbjct  197   -NLHDLATLIYTSGTTGKPKGVMLSHGNLLHQVTTLGSVVQPHPGDIVLSILPTWHSYER  255

Query  1502  AAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKL  1323
             + EYF+ S GC QVYT + ++K+DLK ++P Y+I+VP ++E++Y G+ KQ       ++ 
Sbjct  256   SGEYFLLSQGCTQVYTNLRSVKKDLKEFKPNYMIAVPRLWESIYEGVQKQFREQPANKQR  315

Query  1322  IALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKL  1143
             +    L IS  Y +A+RI +G  L           S L+ L+AR  AA L PLHLL  KL
Sbjct  316   LVNFLLDISDQYIKARRIAQGLSLEHLH------ASSLERLFARITAAALFPLHLLGEKL  369

Query  1142  VYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNV  966
             VY+K+  + G     +  GG     H+D FFE + I +  GYGLTE+APV   RRP  N+
Sbjct  370   VYAKVRQATGGRIKHVISGGGALPRHIDSFFELVGINILQGYGLTETAPVTNARRPWRNL  429

Query  965   LGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWL  786
             LGS G PI  TE+K++D ET   L  G +G+V  KGPQ+M+GYY+NP AT +AID  GW 
Sbjct  430   LGSSGQPIPGTEVKIIDPETKVPLPTGKRGLVLLKGPQIMQGYYQNPEATAKAIDAEGWF  489

Query  785   NTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQI  606
             ++GDLGW+ P +           +VL GRAKDTIVLS+GEN+EP  IE+A + S  I QI
Sbjct  490   DSGDLGWVTPQND----------LVLTGRAKDTIVLSNGENIEPQPIEDACLRSPYIDQI  539

Query  605   VVIGQDKRRLGALVLPHKEEVLLAAK----KLSVVDSDATEVSEEKT---SKLIH----E  459
             +V+GQD+R +GAL++P+ E +   A+     L++ D+++T V+ ++    SK+I     +
Sbjct  540   MVVGQDQRSIGALIVPNIEALTKWAETQNLSLNIQDANSTAVNSQEINLESKIIQDLYRQ  599

Query  458   ELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             EL +            +IGP  LI EPF+I+NGLLT T+K+RR  VT+ Y+  I+ ++
Sbjct  600   ELNREVQNRPGYRADDRIGPFRLIIEPFSIENGLLTQTLKIRRHVVTERYRGIIDGMF  657



>ref|WP_026222074.1| long-chain fatty acid--CoA ligase [filamentous cyanobacterium 
ESFC-1]
Length=637

 Score =   473 bits (1217),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 270/655 (41%), Positives = 398/655 (61%), Gaps = 46/655 (7%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             K +P+IW+ AA+ F   IAL DP+ +P   LS+KEL +EI  FA GL+ +G+K D K+AL
Sbjct  14    KCLPEIWRLAAKRFSPIIALHDPHSDPEVQLSYKELYQEIQQFAAGLQAMGVKADSKVAL  73

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             F+DNS RWLVADQGIMT GA+N VR S +   ELL IY +S S +L V+N +   ++   
Sbjct  74    FSDNSPRWLVADQGIMTAGAVNAVRSSGADHRELLYIYENSGSASLVVENLKTLDKLRSG  133

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
                 + V  ++LL  E+ S    +     I +Y +++  G    + L   +         
Sbjct  134   LDDLS-VELVVLLSDEEVSEDESLT----ILNYRQLMVRGENRTLQLAKQK---------  179

Query  1685  PINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYE  1506
                 D +ATL+YTSGTTG PKGVMLTH NLLHQ+      +    GDR LS+LP WHAYE
Sbjct  180   ---PDSLATLLYTSGTTGKPKGVMLTHGNLLHQVNTAGKILKPEAGDRVLSILPSWHAYE  236

Query  1505  RAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARK  1326
             RAAEY++ S GC Q+YT++   K+DLK YQP Y+++VP ++E++Y G+ K     S  ++
Sbjct  237   RAAEYYLLSQGCTQIYTSIRYFKQDLKEYQPNYMVAVPRLWESVYEGVQKNFRAQSANKQ  296

Query  1325  LIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARK  1146
              +   FL  S  Y +AKRI  G  L  +  +P    S  D L AR  A+ L PLH L  +
Sbjct  297   RLVRFFLGASERYVKAKRICNG--LDLENSKP----SGRDRLIARLQASTLAPLHSLGDR  350

Query  1145  LVYskihssigiska-gisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
             LVY ++ ++ G      +SGGGSL+ H+D F+E + + L  GYGLTE++P+   RR   N
Sbjct  351   LVYKQVRAATGGQIKCTVSGGGSLARHLDTFYEIVGVPLVVGYGLTETSPIATARRLKHN  410

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             + GS G P+ +TEI++V  +T + L P   G+V  +GPQVM+GYYKNP AT++ +D+ GW
Sbjct  411   LRGSSGQPLPYTEIRIVHPDTHQTLPPRETGLVYIRGPQVMQGYYKNPEATEKVLDQEGW  470

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              N+GDLGW+  ++           +VL GRAKDTIVLS+GEN+EP  IE+A + S+ + Q
Sbjct  471   FNSGDLGWVTRDND----------LVLTGRAKDTIVLSTGENIEPQPIEDACVRSDFVDQ  520

Query  608   IVVIGQDKRRLGALVLPHKEEVL--LAAKKLSV-----VDSDATEVSEEKTSKLIHEELQ  450
             I+++GQD+R LGAL++P+ + +   + A+ L +      D++  ++  E   KL  +EL 
Sbjct  521   IMLVGQDQRALGALIVPNLDALQKWVKAQNLGLDIPTEEDTERKDIDSEAIQKLFRQELD  580

Query  449   KWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             +            +I    L+ EPF+I+NG+LT T+K+RR  V + +++ I  ++
Sbjct  581   REVKDRPGYRSDDRISKFRLLLEPFSIENGMLTQTLKIRRPVVYERHRDIINRMF  635



>ref|WP_015136927.1| AMP-forming long-chain acyl-CoA synthetase [Nostoc sp. PCC 7524]
 ref|YP_007074065.1| AMP-forming long-chain acyl-CoA synthetase [Nostoc sp. PCC 7524]
 gb|AFY46468.1| AMP-forming long-chain acyl-CoA synthetase [Nostoc sp. PCC 7524]
Length=658

 Score =   471 bits (1213),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 267/659 (41%), Positives = 401/659 (61%), Gaps = 50/659 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P+IW  AA++FG+ +AL +P+  P   +++ +L  +I  FA GL+ +G++  ++I+L
Sbjct  32    ESLPEIWPLAAKQFGDIVALHNPHAQPEVKITYTQLAAKIQQFAAGLQALGVQAGDRISL  91

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
              ADNS RW +ADQGI+T G ++ VR S++  EELL I  HS S AL V++ +   ++ E 
Sbjct  92    IADNSPRWFIADQGIITAGGVDAVRSSQAEREELLYIVAHSGSTALVVEDLKTLHKLRER  151

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
              +    + F++LL  E++   +E +    I +Y ++++LG            A H+    
Sbjct  152   LND-LPINFVVLL-SEEAPPAAETLR---ILNYEQLLELG------------ANHKLVKV  194

Query  1685  PINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYE  1506
              + +D++ATL+YTSGTTG PKGVML+H NLLHQ+  L   V   PGD  LS+LP WH+YE
Sbjct  195   KLAADNLATLIYTSGTTGKPKGVMLSHSNLLHQVKTLGTVVQPQPGDMVLSILPTWHSYE  254

Query  1505  RAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARK  1326
             R+ EYF+ S GC QVYT + ++K+DLK ++P ++I+VP ++E++Y G+ KQ       ++
Sbjct  255   RSGEYFLLSQGCTQVYTNLRSVKKDLKDFKPNFMIAVPRLWESIYEGVQKQFREQPAKKQ  314

Query  1325  LIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARK  1146
              +    L  S  Y +AKRI +G  L          VS +  L AR IA+ L PLH L  +
Sbjct  315   RLIYSLLGASERYIKAKRIAQGLSLDHLH------VSSMGRLGARIIASALFPLHALGER  368

Query  1145  LVYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
             LVY K+  + G     +  GG     H+D FFE I +++  GYGLTE++PV   RRP  N
Sbjct  369   LVYGKVREATGGRIKQVISGGGALPRHIDNFFEIIGVEILQGYGLTETSPVTNARRPWHN  428

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             + GS G PI  TE+K+VD ET + L+ G +G+V  +GPQVM+GYY+NP AT + ID  GW
Sbjct  429   LRGSSGQPIPGTEVKIVDPETRQPLAAGKRGLVLLRGPQVMQGYYQNPEATAKVIDAEGW  488

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              N+GDLGWI P +           +VL GRAKDTIVL++GEN+EP  IE+A + S  I Q
Sbjct  489   FNSGDLGWITPYND----------LVLTGRAKDTIVLTNGENIEPQPIEDACLRSPYIDQ  538

Query  608   IVVIGQDKRRLGALVLPHKEEVLLAA----KKLSVVDSDATEVSEEKT---SKLIH----  462
             I+++GQD+R +GAL++P+ E +   A    + L   D++ T  S E     SK+I     
Sbjct  539   IMLVGQDQRCIGALIVPNLEALEKWAEAQNRTLITEDNNLTSSSGETITLESKMIQDLFR  598

Query  461   EELQKWTTGCTF-----QIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             +EL +            ++GP  LI EPF+I+NGL+T T+K+RR  V + Y + I  ++
Sbjct  599   QELNREVQNRPGYRPDDRVGPFRLILEPFSIENGLMTQTLKIRRHVVMERYHDLIAAMF  657



>ref|WP_035989484.1| long-chain fatty acid--CoA ligase [Leptolyngbya sp. KIOST-1]
Length=656

 Score =   471 bits (1212),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 271/657 (41%), Positives = 394/657 (60%), Gaps = 53/657 (8%)
 Frame = -3

Query  2213  DIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADN  2034
             +IW   AE +G+ IAL DP+  P   L+++++   I +FA GL+ +G++    +ALFADN
Sbjct  33    EIWPRVAEVYGDVIALNDPHGQPAATLTYRQMWDAIRTFASGLQALGVENRAHVALFADN  92

Query  2033  SCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSH  1854
             S RW +ADQGIMT G +N VR + +  EEL+ I  HSES  L V++  + +R+     + 
Sbjct  93    SHRWFIADQGIMTAGGMNAVRSATAETEELVYIAQHSESTVLVVESVALLNRLQNRLDT-  151

Query  1853  ADVRFIILLWGEKSSITSEVMDGR-PIYSYNEIIDLGNESHMALLHSQEARHQYTYEPIN  1677
               +  +ILL  E+        DGR  + ++ +++ LG E              YT   + 
Sbjct  152   LPITLVILLSDEEPPT-----DGRCKVLNFAQLMALGAE------------RPYTPVSLQ  194

Query  1676  SDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAA  1497
               D+ATL+YTSGTTG PKGVML+H NLLHQI  L   V   PGDR + +LP WH++ER A
Sbjct  195   PTDLATLIYTSGTTGQPKGVMLSHRNLLHQINTLTAVVQPQPGDRVVGILPSWHSFERTA  254

Query  1496  EYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIA  1317
             EYF+ S GC Q Y+++ +LK DLK  +PQY++ VP ++E++Y G  KQ    +P ++ + 
Sbjct  255   EYFLLSRGCTQTYSSIRHLKADLKATKPQYMVGVPRLWESIYEGAQKQFREQTPGKQKLI  314

Query  1316  LLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVY  1137
               F  +S  Y E   ++  + +  D+ + S+       L +  +A +L PLH L +KLVY
Sbjct  315   FTFFGLSQRYVE--NLWRWQDMKIDEPELSFPQR----LGSGLMALVLWPLHQLGKKLVY  368

Query  1136  skihssigiskagisgggslssH-VDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLG  960
              K+  + G     +  GG   +  +D FFE I + L  GYGLTE+APV++ RRP  N+ G
Sbjct  369   GKVREATGGQVKQLISGGGSLARHIDIFFEIIGVPLLVGYGLTETAPVLSARRPWHNLRG  428

Query  959   SIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNT  780
             + G PI  TE+K+VD ET + L  GS+G+V A+GPQVM+GYY+NP AT++AID  GW +T
Sbjct  429   AAGQPIPFTEVKIVDPETRQELPQGSQGLVLARGPQVMEGYYRNPEATQKAIDPEGWFDT  488

Query  779   GDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVV  600
             GDLGWI        SR+  G +VL GRAKDTIVL++GEN+EP  IE+A + S  I QI++
Sbjct  489   GDLGWI--------SRD--GNVVLTGRAKDTIVLTNGENIEPQPIEDACIRSKYIDQIML  538

Query  599   IGQDKRRLGALVLPHKEEV--LLAAKKLSV----------VDSDATEVSEEKTSKLIHEE  456
             +GQD+R LGAL++P+ E +     A+ L V           D  A  + + +  KL  +E
Sbjct  539   VGQDQRSLGALIVPNLEALQGWATAQALFVAVPGDDTPVPADCTAITLDDGRVQKLFRDE  598

Query  455   LQKWTTGCTF-----QIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             L +            +IGP  L+ EPF+IDNGLLT T+KVRR  V D Y++ I+ ++
Sbjct  599   LGREVKDRPGYRPDDRIGPFRLVLEPFSIDNGLLTQTLKVRRPVVADRYRDMIDAMF  655



>ref|WP_015227680.1| AMP-dependent synthetase and ligase [Halothece sp. PCC 7418]
 ref|YP_007170022.1| AMP-dependent synthetase and ligase [Halothece sp. PCC 7418]
 gb|AFZ45808.1| AMP-dependent synthetase and ligase [Halothece sp. PCC 7418]
Length=636

 Score =   470 bits (1209),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 277/654 (42%), Positives = 402/654 (61%), Gaps = 47/654 (7%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P+IW   A   G  IAL DP+ +PP  +++++L ++I  FA GL+  G++PD KIAL
Sbjct  15    QSLPEIWSQVAPYCGKLIALDDPHQDPPVQITYQQLNQKIKQFASGLQAQGIEPDTKIAL  74

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             F+DNS RW +ADQGI++ GA++VVR S++   EL  I   S+S  L V++ +   ++   
Sbjct  75    FSDNSPRWFIADQGILSAGAVDVVRSSQADPAELAYILTDSDSKVLMVEDYKTLEKLQGE  134

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
               ++  ++ +ILL  E  +I SE +   P  ++++++  GN+             ++T  
Sbjct  135   L-ANLPIQLVILLSDE--TIESEEI---PTLNFSQLMAQGNQK------------EFTLV  176

Query  1685  PINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYE  1506
             P   DD+ATL+YTSGTTG PKG ML+H N LHQ+  + D +    GDR LS+LP WHAYE
Sbjct  177   PRKKDDLATLIYTSGTTGKPKGAMLSHGNFLHQVRAIGDVIQPQAGDRVLSILPSWHAYE  236

Query  1505  RAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARK  1326
             RAAEYF+ S GC  +YT + + K+DL+  +P Y++ VP ++E++Y GI K +N  +  +K
Sbjct  237   RAAEYFLLSRGCHLIYTNLRSFKKDLREQKPNYMVGVPRLWESVYDGIQKNLNQQTGNKK  296

Query  1325  LIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARK  1146
              +   FL IS  Y + KRI EG  L  +  +PS +      L A +  ++L PLH L  K
Sbjct  297   KLIDFFLSISNRYLKTKRISEG--LDLENLRPSLIAK----LTASSQCSVLKPLHNLGDK  350

Query  1145  LVYskihssi-giskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
             +VY  +  +  G  KA ISGGG+L+ H+D F+E I I L  GYGLTE++PV   RR   N
Sbjct  351   IVYQTVREATGGNLKAVISGGGALAKHIDDFYELIGIPLLVGYGLTETSPVTHARRLYHN  410

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             + GS GP I  TE K+VD ET K+L  G KG+V  +G QVM+GYYK P AT +AIDE GW
Sbjct  411   LRGSSGPAIPETETKIVDPETKKSLPDGEKGLVMIRGTQVMQGYYKKPEATAKAIDEEGW  470

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              NTGDLGWI P          +G +VL GRAKDTIVLS+GEN+EP  +E A + S  I Q
Sbjct  471   FNTGDLGWITP----------TGDLVLTGRAKDTIVLSNGENIEPQPLENACLRSIYIDQ  520

Query  608   IVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKT------SKLIHEELQK  447
             I+V+GQD+R LGAL++P+  E+L    K   ++ D  E   E+T       KL  +EL +
Sbjct  521   IMVVGQDQRCLGALIVPNV-EILEQWAKDHNLNLDFAEGQLEETLANSQIQKLFRDELNR  579

Query  446   WTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
                         +IG   LI EPF++DNG++T T+K++R  V + Y++ I+ ++
Sbjct  580   EVKNRPGYRIDDRIGVFKLILEPFSMDNGMMTQTLKIKRPVVYERYQDMIDGMF  633



>ref|WP_015160237.1| AMP-forming long-chain acyl-CoA synthetase [Chamaesiphon minutus]
 ref|YP_007097622.1| AMP-forming long-chain acyl-CoA synthetase [Chamaesiphon minutus 
PCC 6605]
 gb|AFY94095.1| AMP-forming long-chain acyl-CoA synthetase [Chamaesiphon minutus 
PCC 6605]
Length=665

 Score =   469 bits (1208),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 269/668 (40%), Positives = 406/668 (61%), Gaps = 63/668 (9%)
 Frame = -3

Query  2222  TVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALF  2043
             ++P++W   A + G+ +AL  P+  P  +++++E+  +I  FA GL+ +G+KP   +ALF
Sbjct  32    SLPEVWPIVAAKCGDTVALNAPHSKPAISMTYREVATQIKLFATGLQSLGIKPQTGVALF  91

Query  2042  ADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETF  1863
             ADNS RWL+ADQGIMTTGA N VR S++ V+ELL I ++S++  L V++ +  +++++  
Sbjct  92    ADNSPRWLIADQGIMTTGAFNAVRSSQAEVQELLSILDNSQAQTLVVEDLKTLNKLSDRL  151

Query  1862  HSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEP  1683
              +   ++ IILL  E + +   +     + ++++ IDLG  +            Q+    
Sbjct  152   -ADLPIKLIILLCDETTDVELPIK----LLNFSQTIDLGRSA------------QFQPAT  194

Query  1682  INSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYER  1503
             I   D+ATL+YTSGT+GNPKGVMLTH NLLHQI      +P  PG R LS+LP WH+YER
Sbjct  195   IAKTDLATLIYTSGTSGNPKGVMLTHANLLHQINTCGTVIPATPGSRVLSILPSWHSYER  254

Query  1502  AAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKL  1323
             + EY++ S GC Q YT +   K+DLK YQP+YL++VP + E++Y GI KQ     P ++ 
Sbjct  255   SCEYYLLSQGCTQTYTNIRYFKQDLKEYQPEYLVAVPRLSESIYEGIQKQFREQPPNKQK  314

Query  1322  IALLFLKISFAYKEAKRIYEG---KCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLA  1152
             +    L +S  Y EA+RI +G   +CL     Q          L AR   A+L P+H +A
Sbjct  315   LVARLLALSTKYIEARRIVQGLSLECLNPTLGQK---------LIARLQMAILAPIHAIA  365

Query  1151  RKLVYskihssi-giskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPN  975
              KL+YSKI ++  G  +  ISGGGSL+ H+D FFE I + +  GYGLTE+AP+   RRP 
Sbjct  366   DKLIYSKIRAATGGKIRYIISGGGSLAKHLDLFFEIIGVNILVGYGLTETAPITNVRRPW  425

Query  974   CNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDEN  795
              N+  S G P+  TEI++VD +T + ++ G KG+V  +GPQVM+GYY++P AT +AID +
Sbjct  426   QNLRLSSGQPLPGTEIRIVDVDTRQPVAIGQKGLVMIRGPQVMQGYYRDPEATAKAIDVD  485

Query  794   GWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLI  615
             GW N+GDLG + PN+           + + GRAKDTIVLS+GEN+EP+ IE+A + S+ I
Sbjct  486   GWFNSGDLGMLTPNND----------LTITGRAKDTIVLSNGENIEPTPIEDACLRSSYI  535

Query  614   QQIVVIGQDKRRLGALVLPHKEEV--------LLAAKKLSVVDSDATE----------VS  489
              QIV++GQD++ LGAL++P+ E +        L+ A   +   + + E          ++
Sbjct  536   SQIVLVGQDQKALGALIVPNSEALHQWAISQNLIPAPIAATNPASSNEPNILLDNPQILN  595

Query  488   EEKTSKLIHEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLY  324
               +   L  +EL +            +I  I LI EPF+I+NGLLT T+K+RR  V   Y
Sbjct  596   NTQVIDLFRDELNREVKNRPGYRIDDRIATIKLIAEPFSIENGLLTQTLKIRRPVVMARY  655

Query  323   KEQIEDLY  300
                I++++
Sbjct  656   HGMIDEMF  663



>ref|WP_006631982.1| long-chain fatty acid--CoA ligase [Microcoleus vaginatus]
 gb|EGK89297.1| Long-chain-fatty-acid--CoA ligase [Microcoleus vaginatus FGP-2]
Length=649

 Score =   468 bits (1205),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 270/657 (41%), Positives = 396/657 (60%), Gaps = 52/657 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDE----  2058
             +++P+IW    ++FG  +AL DP+  P   L++ +L ++I  FA GL+ +G++P+     
Sbjct  30    QSIPEIWAIVKKQFGQTVALHDPHSQPEIKLTYTDLYQQIQQFAAGLQALGIEPNPGEAV  89

Query  2057  --KIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMY  1884
               ++ALFADNS RWL+ADQGIM  GA N VRG+ +  EELL I   S S AL V+N  + 
Sbjct  90    PPRVALFADNSPRWLIADQGIMMAGAANAVRGATADPEELLYIIQDSGSTALVVENRALL  149

Query  1883  SRIAETFHSHAD--VRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQE  1710
              ++    H   D  ++ I+LL  E+   TS+ +       +++++  G    +       
Sbjct  150   KKLQ---HRLPDLPIQLIVLLSDEEPE-TSQTLS---TVKFSQVMTTGANRPL-------  195

Query  1709  ARHQYTYEPIN--SDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFL  1536
                    +P N     +ATL+YTSGTTG PKGVMLTH NLLHQ+  L   +    G+  L
Sbjct  196   -------KPTNHKPQTLATLLYTSGTTGKPKGVMLTHGNLLHQLTTLGTILQPEAGESAL  248

Query  1535  SMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILK  1356
             S+LP WHAYER+ EYF+ S GC Q+YT +   K+D K Y+PQY++SVP ++E++Y  + K
Sbjct  249   SILPSWHAYERSVEYFLLSQGCTQIYTNIRYFKQDFKTYKPQYMVSVPRIWESIYEAVQK  308

Query  1355  QINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAAL  1176
             Q     P ++ +    L  S  Y E +RI +G  L+      S      + L AR  + L
Sbjct  309   QFREQPPNKQKLVDFLLSASQQYIETRRICQGLTLSLKPASGS------EKLIARTKSIL  362

Query  1175  LCPLHLLARKLVYskihssigiska-gisgggslssHVDKFFEAIDIKLQNGYGLTESAP  999
             L P+H LA KLVY K+  + G      ISGGGSL++H+D FFE  +I L  GYGLTE++P
Sbjct  363   LSPVHALAEKLVYQKVREATGGRLKWAISGGGSLAAHIDNFFEIANIGLLVGYGLTETSP  422

Query  998   VVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFA  819
             V+  RRP  N+ GS G P+ HTEIK+VD ET + L  G +G+V A+GPQ+M+GYY NP A
Sbjct  423   VLTVRRPWHNLKGSAGQPLAHTEIKIVDPETRQQLPTGQRGLVLARGPQIMQGYYLNPQA  482

Query  818   TKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEE  639
             T +AID  GW +TGDLGW+ P +           ++L GRAKDTIVLS+GEN+EP  IE+
Sbjct  483   TAKAIDPEGWFDTGDLGWLTPGND----------LILTGRAKDTIVLSNGENIEPQPIED  532

Query  638   AAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKK----LSVVDSDATEVSEEKTSK  471
             A + S  I QI+++GQD+R +GAL++P+ E V   A+     L  +D ++  + +    +
Sbjct  533   ACLRSPYIDQIMLVGQDQRSVGALIVPNAEAVQKWAETQNPPLHEIDWNSKTIQDLFRKE  592

Query  470   LIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             L  E   +       +IGP  LI EPF+++NG+LT T+K++R  VT+ Y++ I+ ++
Sbjct  593   LNREVQNRPGYRADDRIGPFRLIQEPFSMENGMLTQTLKIKRPVVTEHYRDMIDGMF  649



>ref|WP_015194635.1| Long-chain-fatty-acid--CoA ligase [Stanieria cyanosphaera]
 ref|YP_007133939.1| Long-chain-fatty-acid--CoA ligase [Stanieria cyanosphaera PCC 
7437]
 gb|AFZ36973.1| Long-chain-fatty-acid--CoA ligase [Stanieria cyanosphaera PCC 
7437]
Length=640

 Score =   467 bits (1202),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 264/659 (40%), Positives = 397/659 (60%), Gaps = 50/659 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P+IW  AA +FGN IAL DP+  P   ++++EL  +I  FA GL+ +G++P  K+AL
Sbjct  12    QSLPEIWAIAASKFGNTIALDDPHAQPEVKITYQELSVKINQFAAGLQALGVQPFAKVAL  71

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             FADNS RW +ADQGIM  GA NVVR + +  +ELL I  HS+S AL V+N +  +++  +
Sbjct  72    FADNSPRWFIADQGIMMAGAANVVRSANAEQQELLYILEHSDSSALVVENLKTLNKLGSS  131

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
               +   +  I+LL  E       +     I ++ ++++ G        HS +   Q    
Sbjct  132   V-ADLPIELIVLLSDETPQSELSIQ----IVNFEQLMETGKN------HSLQPVQQ----  176

Query  1685  PINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYE  1506
                 +++ATL+YTSGTTG PKG ML+H NLLHQ+ NL   +    GDR LS+LP WHAYE
Sbjct  177   --TKENLATLIYTSGTTGKPKGAMLSHGNLLHQVNNLTSIIKADVGDRVLSILPSWHAYE  234

Query  1505  RAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARK  1326
             R+AEYF+F+ GC   YT + +LK DL++YQP Y+++VP ++E++Y G+ KQ     P+++
Sbjct  235   RSAEYFLFAQGCTLYYTNLRSLKSDLQKYQPHYMVAVPRLWESIYEGVQKQFREQPPSKQ  294

Query  1325  LIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARK  1146
              +   F +I+  Y EA+RI EG  L          +SV   L A+  A+LL PL+ L  +
Sbjct  295   KLINYFFEIAEEYIEARRIAEGMSLEHLN------LSVGARLLAKTKASLLLPLYNLGDR  348

Query  1145  LVYskihssi-giskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
             +V+ K+  ++    K  ++GGGSL+ H+D F+E + I L  GYGLTE++PV   R    N
Sbjct  349   IVFKKVRQAVGSNVKTLVNGGGSLAKHLDDFYEIVKIPLLVGYGLTETSPVTNARTLKHN  408

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
               G+ G PI  TEIK+VD +T + L  G +G+V  +GPQVM+GYYKNP AT +AID  GW
Sbjct  409   FRGTAGKPIPETEIKIVDPQTRQTLPQGQQGLVLIRGPQVMQGYYKNPEATAKAIDPEGW  468

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              ++GDLGW+ P++           ++L GRAKDTIVLS+GEN+EP  IE+A + S  I Q
Sbjct  469   FDSGDLGWVTPDND----------LILTGRAKDTIVLSNGENIEPQPIEDACVRSPYIDQ  518

Query  608   IVVIGQDKRRLGALVLPH-----------KEEVLLAAKKLSVVDSDATEVSEEKTSKLIH  462
             I+++GQD+R LGAL++P+           K  + L A   S+ +   +++  +    L  
Sbjct  519   IMLVGQDQRALGALIVPNLDALQQWATNQKLNLNLPAPNTSLAEISQSDLYSKPVQNLFR  578

Query  461   EELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             +EL              +IG   LI EPF+ +NG +T T+K++R  V   Y++ I+ ++
Sbjct  579   QELNSQVQNRPGYRADDRIGTFRLILEPFSQENGTMTQTLKIKRPVVQQRYQQLIDSMF  637



>ref|WP_011319906.1| long-chain fatty acid--CoA ligase [Anabaena variabilis]
 ref|YP_323676.1| AMP-dependent synthetase and ligase [Anabaena variabilis ATCC 
29413]
 gb|ABA22781.1| AMP-dependent synthetase and ligase [Anabaena variabilis ATCC 
29413]
Length=658

 Score =   465 bits (1197),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 258/658 (39%), Positives = 398/658 (60%), Gaps = 50/658 (8%)
 Frame = -3

Query  2222  TVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALF  2043
             ++P+IW  AA++FG  +AL +P+  P   +++++L ++I  FA GL+ +G++  ++I+L 
Sbjct  33    SLPEIWPIAAKKFGETLALYNPHAKPEVKITYQQLAEKIQLFASGLQALGVQAGDRISLI  92

Query  2042  ADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETF  1863
             ADNS RW +ADQGIMT GA++ VR S++  EELL I  HS S AL V++ + ++++ +  
Sbjct  93    ADNSPRWFIADQGIMTAGAVDAVRSSQAEKEELLYIVAHSGSTALVVEDLKTFNKLQDRL  152

Query  1862  HSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEP  1683
             H    ++ +++L  E    T        + ++ ++I++G              H +    
Sbjct  153   HD-LPIQVVVILTDE----TPPTEQSLKVLNFLQLIEVGTN------------HAFVPVK  195

Query  1682  INSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYER  1503
                D++ATL+YTSGTTG PKGVML++ NLLHQ+      V    GD  LS+LP WH+YER
Sbjct  196   RKRDELATLIYTSGTTGKPKGVMLSYSNLLHQVTTFRVVVQPKVGDTALSILPSWHSYER  255

Query  1502  AAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKL  1323
               EY++ S GC Q+YT + ++K DLK+Y+P Y+++VP ++E++Y G+ KQ       ++ 
Sbjct  256   TVEYYLLSQGCTQIYTNLRSVKADLKQYKPNYMVAVPRLWESIYEGVQKQFREQPANKQR  315

Query  1322  IALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKL  1143
             +    L +S  Y +A+RI +G  L           S L+ L A+ +     P H+L +KL
Sbjct  316   LIKFLLGMSEKYIKAQRIAQGTSLDHLH------ASSLERLIAKVLELAFLPFHVLGQKL  369

Query  1142  VYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNV  966
             VY K+  + G     +  GG     H+D FFE I +++  GYGLTE++PV   RRP  N 
Sbjct  370   VYGKVKEATGGRFKQVISGGGALPKHIDTFFEIIGVQILQGYGLTETSPVTNVRRPWRNF  429

Query  965   LGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWL  786
             +G+ G PI  TE+K+VD ET + L  G +G+V  KGPQVM+GYY+NP AT +AID  GW 
Sbjct  430   IGTSGQPIPGTEVKIVDPETRQPLPVGQRGLVLLKGPQVMQGYYQNPEATAKAIDPQGWF  489

Query  785   NTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQI  606
             ++GDLGW+ P++           +VL GRAKDTIVLS+GEN+EP  IE+A + S  I QI
Sbjct  490   DSGDLGWVTPDNE----------LVLTGRAKDTIVLSNGENIEPQPIEDACLRSPYIDQI  539

Query  605   VVIGQDKRRLGALVLPHKEEVLLAAKK----LSVVDSDATEVSEEKT---SKLIH----E  459
             +++GQD+R +GAL++P+ E +   A+     LSV D + T  S +K    SK+I     +
Sbjct  540   MLVGQDQRSIGALIVPNVEALAKWAESQNLVLSVEDDNLTSSSSQKINLESKMIQGLFRQ  599

Query  458   ELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             EL +            ++GP  LI EPF+I+NGL+T T+K+RR  VT+ Y++ I  ++
Sbjct  600   ELNREVQNRPGYRPDDRVGPFKLILEPFSIENGLMTQTLKIRRHVVTERYRDIINAMF  657



>ref|WP_017299996.1| hypothetical protein [Nodosilinea nodulosa]
Length=649

 Score =   464 bits (1195),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 273/656 (42%), Positives = 391/656 (60%), Gaps = 51/656 (8%)
 Frame = -3

Query  2213  DIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADN  2034
             +IW   AE++G+ +AL DP++ P T L++++L   I +FA GL+ +G++    +ALFADN
Sbjct  26    EIWPMVAEQYGDTLALHDPHYKPATTLTYRQLAAAIRTFARGLQALGVENRTHVALFADN  85

Query  2033  SCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSH  1854
             S RW +ADQGIMT G +N VR + +  EELL I  HSES  L V+   +   + +   + 
Sbjct  86    SHRWFIADQGIMTAGGMNAVRSATAEKEELLYIAGHSESTVLIVETAALLKLLRDRLDA-  144

Query  1853  ADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINS  1674
               +  +ILL  E+      +     I ++ +++ LG +              YT   I  
Sbjct  145   LPISLVILLSDEEPPADDRLK----ILNFGQLMALGQD------------RPYTPVAIQP  188

Query  1673  DDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAE  1494
             +D+ATL+YTSGTTG PKGVML+H NLLHQI  L   V   PGD+ + +LP WH++ER AE
Sbjct  189   EDLATLIYTSGTTGQPKGVMLSHRNLLHQINTLESVVQPEPGDQVIGILPSWHSFERTAE  248

Query  1493  YFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIAL  1314
             YF+ S GC Q YT + +LK DLK  +PQY++ VP ++E++Y G  KQ    SP ++ +  
Sbjct  249   YFLLSRGCTQTYTNIRHLKTDLKTVKPQYMVGVPRLWESIYEGAQKQFREQSPGKQKLIF  308

Query  1313  LFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVY-  1137
                 +S  Y E    Y+      D K     ++ L  L +  +A +L PLH L + LVY 
Sbjct  309   TCFGLSQRYVENLWRYQ------DMKLDEPHLTTLRRLGSGLVALVLWPLHQLGKALVYG  362

Query  1136  skihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGS  957
                 ++ G  K  ISGGGSL+ H+D FFE I + L  GYGLTE+APV++ RRP  N+ G+
Sbjct  363   KVREATGGRVKQLISGGGSLARHIDIFFEIIGVPLLVGYGLTETAPVLSARRPWRNLRGA  422

Query  956   IGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTG  777
              G PI  TEIK+VD ET + L  G +G+V A+GPQ+M+GYY+NP AT++AID  GW +TG
Sbjct  423   AGQPIPFTEIKIVDLETRQELPQGGQGLVLARGPQIMEGYYRNPEATRKAIDPEGWFDTG  482

Query  776   DLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVI  597
             DLGW+        SR+  G +VL GRAKDTIVL++GEN+EP  IE+A + S  I QI+++
Sbjct  483   DLGWM--------SRD--GNLVLTGRAKDTIVLTNGENIEPQPIEDACIRSKYIDQIMLV  532

Query  596   GQDKRRLGALVLPHKEEVLLAAKKL------------SVVDSDATEVSEEKTSKLIHEEL  453
             GQD+R LGAL++P+ E +   A               +  D  A  + +E+  KL  +EL
Sbjct  533   GQDQRSLGALIVPNLEALQAWAAAQALFVAAPGDDTPAPADCTAITLDDERVQKLFRDEL  592

Query  452   QKWTTGCTF-----QIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
              +            ++GP  LI EPF I+NGLLT T+KVRR  VT  Y++ I+ ++
Sbjct  593   SREVKDRPGYRPDDRVGPFRLILEPFAIENGLLTQTLKVRRPVVTARYRDMIDAMF  648



>ref|WP_009556060.1| AMP-forming long-chain acyl-CoA synthetase [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ69148.1| AMP-forming long-chain acyl-CoA synthetase [Oscillatoriales cyanobacterium 
JSC-12]
Length=659

 Score =   464 bits (1195),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 271/668 (41%), Positives = 402/668 (60%), Gaps = 61/668 (9%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P+IW  AA+ F    AL  P+  PP  L+F +L ++I   A GL+ +G++P ++I L
Sbjct  26    QSIPEIWAIAAQRFNQATALHAPHLKPPVKLTFAQLYEQIQQCASGLQALGIQPGDRICL  85

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             FADNS RWL+ADQG+M  GA+N VR S++  +EL  +  +S S+AL V++   +S++ + 
Sbjct  86    FADNSPRWLIADQGMMMAGAVNAVRSSQADKDELHFLLENSGSIALVVEDVATFSKLRDR  145

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
               S   + F+ LL  E    T     G  I ++ ++++LG            A H  + +
Sbjct  146   L-SDLPLNFVALLTDE----TPPENTGIKILNFIQLMNLG------------ANH--SLQ  186

Query  1685  PINS--DDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHA  1512
             P+N    D+ATL+YTSGTTG PKG ML+H NLLHQ+  L   V    GDR LS+LP WHA
Sbjct  187   PVNRSRQDLATLIYTSGTTGKPKGAMLSHGNLLHQVETLGAVVQPKLGDRVLSILPTWHA  246

Query  1511  YERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPA  1332
             YER+AEYF+ S GC Q+YT++  +K+DLK ++PQY++SVP ++E++Y G+ KQ       
Sbjct  247   YERSAEYFLLSQGCTQIYTSIRTVKKDLKDFKPQYMVSVPRIWESVYEGVQKQFREQPEK  306

Query  1331  RKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLA  1152
             ++ +   FL IS  Y  A+R++    L    ++PS  V +L    A A   +L PLH L 
Sbjct  307   KQKLIHFFLNISHRYIHARRVWNNLELLN--REPSLPVRLL----ALAQIVILAPLHALG  360

Query  1151  RKLVYskihssig--iskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRP  978
              K+VYSK+  +      +  ISGGGSL+ H+D FFE + I++  GYGLTE++PV   RRP
Sbjct  361   EKIVYSKVREAATGGQFRQAISGGGSLARHIDDFFEIMGIEVLVGYGLTETSPVTNARRP  420

Query  977   NCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDE  798
               N+ GS G PI  TEI++VD E+ K L  G +G+V  +GPQ+M+GYY NP AT++AID 
Sbjct  421   WRNLRGSAGQPIPGTEIRIVDPESRKPLPVGERGLVLIRGPQIMQGYYNNPEATRKAIDP  480

Query  797   NGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNL  618
              GW ++GDLGW+   +           +VL GRAKDTIVL++GEN+EP  IE+A + S  
Sbjct  481   EGWFDSGDLGWVTKEND----------LVLTGRAKDTIVLTNGENIEPQPIEDACLRSAY  530

Query  617   IQQIVVIGQDKRRLGALVLPHKEEV------------LLAAKKLSVVDSDAT-----EVS  489
             I QI+++GQD++ LGAL++P+ + +            L      +  D  A+      + 
Sbjct  531   IDQIMLVGQDQKSLGALIVPNLDALEKWAIAQGFILELPGVGSSTTTDPSASSLPPLSLD  590

Query  488   EEKTSKLIHEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLY  324
              +    LI +EL +            +IGP  LI EPF+I+NGLLT T+K+RR+ V D Y
Sbjct  591   SKPIQDLIRKELNREVQNRPGYRPDDRIGPFRLILEPFSIENGLLTQTLKIRRNVVMDRY  650

Query  323   KEQIEDLY  300
             +  I +++
Sbjct  651   QGMINEMF  658



>ref|WP_036008122.1| long-chain fatty acid--CoA ligase, partial [Leptolyngbya sp. 
JSC-1]
Length=640

 Score =   464 bits (1193),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 266/668 (40%), Positives = 404/668 (60%), Gaps = 65/668 (10%)
 Frame = -3

Query  2225  KTVPDIWKTAAE--EFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKI  2052
             + +P+IW   A+  E  N +AL DP+  P   ++F +L + I  FA GL+ +G++P E I
Sbjct  11    QALPEIWGIVAQRPEVANLVALYDPHSQPAVKITFAQLYETIRQFAAGLQALGVQPGEHI  70

Query  2051  ALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIA  1872
             A F+DNS RWL+ADQGIMT GAIN VRGS++  EEL  I  HS+S+ L + + E  +++ 
Sbjct  71    AQFSDNSPRWLIADQGIMTIGAINAVRGSQADREELQFILEHSDSIGLVIQDLETLNKVR  130

Query  1871  ETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYT  1692
             E +     +RF+ILL  E      E+      +++++++DLG            A H  T
Sbjct  131   E-YLPPLPIRFVILLTDETPPDLGEIT----TFNFSQLLDLG------------ANH--T  171

Query  1691  YEPI--NSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPW  1518
              +P+  + D +ATL+YTSGT+G PKGVML+H NL+ QIL  ++     PG+R LS+LP W
Sbjct  172   LQPVRPSRDSLATLMYTSGTSGQPKGVMLSHHNLISQILGAYEVAQPQPGERVLSILPIW  231

Query  1517  HAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSS  1338
             H YER  EYF+ + GC Q YT +  +K+D+K ++P Y++ VP ++E++Y GI KQ+    
Sbjct  232   HCYERTFEYFVLAFGCTQAYTNIRFVKKDIKDFKPHYMVGVPRLWESIYDGIQKQLREQP  291

Query  1337  PARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAAL----LC  1170
              +++ +A  FL  S  Y +A+RI +G  L      P+           R +AAL    L 
Sbjct  292   ASKQRLAHFFLTQSDRYIKARRIVQGLSLDNLHPSPA----------ERVVAALQSLVLA  341

Query  1169  PLHLLARKLVYskihssigiska-gisgggslssHVDKFFEAIDIKLQNGYGLTESAPVV  993
             PLH +  +LVY KI + +G +    +SGGGS++ H++ FFE + I +  GYGLTE++P+ 
Sbjct  342   PLHWVGDRLVYQKIRAGVGGAVKFLVSGGGSIAEHLEDFFEVVGITILGGYGLTETSPIT  401

Query  992   ACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATK  813
               RRP  N+ G+ G P+R+TE ++VD ET + L P  +G+V  +G QVM GYYKNP ATK
Sbjct  402   HVRRPWRNIRGADGQPLRNTETQIVDLETRRPLPPEKQGLVMIRGDQVMLGYYKNPEATK  461

Query  812   QAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAA  633
             +AI   GW +TGDLGW+          ++   +V+ GRAKDTIVL++GEN+EP  IE+A 
Sbjct  462   KAISPEGWFDTGDLGWV----------SNQDDLVITGRAKDTIVLTNGENIEPQPIEDAC  511

Query  632   MGSNLIQQIVVIGQDKRRLGALVLPHKEEV--LLAAKKLSV----------VDSDATEVS  489
             + S  + QI+++GQD++ LGAL++P+ E V    A++ L +          V +    + 
Sbjct  512   LRSPYVDQIMLVGQDQKVLGALIVPNLEMVQQWAASQNLYIQLPDDPHSAPVGAQIIGLE  571

Query  488   EEKTSKLIHEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLY  324
             ++    L  +EL +            +IGP  L++EPF+I NGLLT T+K+RR  VTD Y
Sbjct  572   DKPVQDLFRQELNREVKNRPGYRADDRIGPFRLLSEPFSIQNGLLTQTLKIRRAVVTDRY  631

Query  323   KEQIEDLY  300
             +  I++++
Sbjct  632   RGMIDEMF  639



>ref|WP_017319192.1| long-chain fatty acid--CoA ligase [Mastigocladopsis repens]
Length=664

 Score =   462 bits (1189),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 266/665 (40%), Positives = 403/665 (61%), Gaps = 56/665 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             K++P+IW   A+  G+ +AL DP+  P   +++ +L ++I  FA GL+ +G+K  ++++L
Sbjct  32    KSLPEIWSLVAKRCGDTVALRDPHAQPEVVITYTQLFQKIQQFAAGLQALGVKVGDRVSL  91

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
              ADNS RWL+ADQGIMT GA++ VR S++  EEL+ I  +S S AL V++ + +S++ E 
Sbjct  92    IADNSPRWLIADQGIMTAGAVDAVRSSQAEREELVFILTNSGSTALVVEDLKTFSKLKER  151

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
              H    ++ +ILL  E +  T E +    I+++N+++++G +  +  +       Q+T  
Sbjct  152   LHD-LPIQLVILLSNE-APPTDETLK---IFNFNQLMEMGAQQSLTPV-------QHT--  197

Query  1685  PINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYE  1506
                 D +ATL+YTSGTTG PKG ML+H NL+HQ+L L   V    GD  LS+LP WH YE
Sbjct  198   ---PDTLATLMYTSGTTGKPKGAMLSHRNLMHQVLTLGAVVQPQVGDTALSILPTWHVYE  254

Query  1505  RAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARK  1326
             R+ EYF+ S GC Q+YT + ++K DLK ++P YL+ VP + E++Y G+ KQ       ++
Sbjct  255   RSCEYFLLSQGCTQIYTNLRSIKRDLKEFKPSYLVCVPRLLESIYEGVQKQFREQPANKQ  314

Query  1325  LIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARK  1146
              +   FL +S  Y + +RI +G  L+ +   P    S+++ L A   A+ L PLH L  +
Sbjct  315   RLINYFLGVSEQYIKTQRIAQG--LSLENLNP----SIVERLAASIQASALFPLHALGER  368

Query  1145  LVYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
             LVY+K+  + G     +  GG     H+D FFE I+I++  GYGLTE+APV   RR   N
Sbjct  369   LVYAKVREATGGKIKQMFSGGGALPKHIDDFFEIINIEILQGYGLTETAPVTHGRRYWRN  428

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             + GS+G PI  TE K+VD ET K L  G +G+V  +G Q+M+GYY+NP AT +AID  GW
Sbjct  429   LRGSVGQPIPGTETKIVDPETRKPLPTGERGLVLLRGAQIMQGYYQNPEATAKAIDTEGW  488

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              ++GDLGW+ P +           +VL GRAKDTIVL++GEN+EP  IE+A + S  I Q
Sbjct  489   FDSGDLGWVTPQND----------LVLTGRAKDTIVLTNGENIEPQPIEDACLRSPYIDQ  538

Query  608   IVVIGQDKRRLGALVLPHKEEVLL--------------AAKKLSVVDS-DATEVSEEKT-  477
             I+++GQD+R LGAL++P+ E +                AAK+ +  DS   TEVS E   
Sbjct  539   IMLVGQDQRSLGALIVPNLEALQKWVEALNLQMRLPDEAAKEQNKEDSAHQTEVSLESKI  598

Query  476   -SKLIHEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQ  315
                L  +EL +            +IGP  LI EPF+++NG++T T+K+RR  V + Y++ 
Sbjct  599   IQDLFRQELNREVQNRPGYRPDDRIGPFKLILEPFSVENGMMTQTLKIRRHVVMERYRDT  658

Query  314   IEDLY  300
             I  ++
Sbjct  659   INGMF  663



>ref|WP_030005920.1| long-chain fatty acid--CoA ligase [Synechococcus sp. NKBG042902]
Length=637

 Score =   461 bits (1186),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 270/659 (41%), Positives = 389/659 (59%), Gaps = 51/659 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++ +IW  AAE + + +AL DP+  P   L++ +L + I  F  GL+ +GL+P EK+AL
Sbjct  10    QSLSEIWAIAAERYADIVALYDPHQKPEFKLTYHQLWQGIQQFGAGLQALGLQPQEKVAL  69

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
              ADNS RW +ADQG +  GA+N VR S++  +ELL IY  SES  L V++ + + R+   
Sbjct  70    IADNSPRWFIADQGSIAAGAVNAVRSSQAEKQELLYIYTDSESRFLIVEDRKTFERLNPE  129

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
               ++   R +I L  E+   T       PI+++++++ LG++  + +             
Sbjct  130   I-TNLQPRAVIFLTDEEVPETE-----LPIFNFSQLMTLGSQESLTMPGR----------  173

Query  1685  PINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYE  1506
               +  D+ TL+YTSGTTG PKGVML+H N+L+Q+ NL   +   PGD  LS+LP WH+YE
Sbjct  174   --SPQDLMTLIYTSGTTGKPKGVMLSHGNVLYQVRNLDQVIQPNPGDVTLSILPTWHSYE  231

Query  1505  RAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARK  1326
             RAAEYF+ S GC Q+YT + N+K+DL+ Y+P Y+++VP ++E++Y G+ K +      ++
Sbjct  232   RAAEYFLLSQGCTQIYTNIRNIKKDLQTYKPGYMVAVPRIWESIYEGVQKNLREQPAKKQ  291

Query  1325  LIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARK  1146
              +   FL  S  Y   +RI     L        + VS L  L ARA A  L P HLL  K
Sbjct  292   KLVNFFLTCSQNYVLTQRIANNLSLEH------FHVSPLTRLMARAKAIALYPFHLLGNK  345

Query  1145  LVYskihssigiska-gisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
             LVY KI  + G      ISGGGSL+ H+D FFE + I +  GYGLTE++PV   RRP  N
Sbjct  346   LVYEKIRGATGGKIRYVISGGGSLAQHIDTFFEIVGINILVGYGLTETSPVTNARRPERN  405

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             V GS GP ++ TEI++VD ET + LS G KG+V  +GPQVM+GYY+ P AT +AID  GW
Sbjct  406   VRGSAGPALKGTEIRIVDPETRQTLSQGQKGLVLIRGPQVMQGYYRKPEATAKAIDPEGW  465

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              ++GDLGW+ P           G +VL GRAKDTIVL++GEN+EP  IE+A   S  I Q
Sbjct  466   FDSGDLGWVTPQ----------GDLVLTGRAKDTIVLTNGENIEPQPIEDACARSPYIDQ  515

Query  608   IVVIGQDKRRLGALVLPHKEE----VLLAAKKLSVVDSD-------ATEVSEEKTSKLIH  462
             I+++GQD++ LGAL++P+ E     V      L + D D        T++  +    L  
Sbjct  516   IMLVGQDQKSLGALIVPNLEALGQWVSQGGLGLQLPDPDIPSEQLPQTDLYSKPVLNLFK  575

Query  461   EELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             +EL +            +I    LI EPF+I+NGL+T T+KV+R  V + Y   I  LY
Sbjct  576   QELNREIKNRPGYRVDDRISDFALILEPFSIENGLMTQTLKVKRPVVAEKYAALIASLY  634



>ref|WP_012593707.1| MULTISPECIES: long-chain fatty acid--CoA ligase [Cyanothece]
 ref|YP_002370586.1| AMP-dependent synthetase/ligase [Cyanothece sp. PCC 8801]
 ref|YP_003136135.1| AMP-dependent synthetase and ligase [Cyanothece sp. PCC 8802]
 gb|ACK64430.1| AMP-dependent synthetase and ligase [Cyanothece sp. PCC 8801]
 gb|ACU99299.1| AMP-dependent synthetase and ligase [Cyanothece sp. PCC 8802]
Length=639

 Score =   461 bits (1185),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 266/661 (40%), Positives = 393/661 (59%), Gaps = 58/661 (9%)
 Frame = -3

Query  2219  VPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFA  2040
             +P+IW   A+ FG+ IAL DP+ NPP +L++ +L ++I +FA GL+ + +K   K+ALFA
Sbjct  13    LPEIWPLTAQNFGDIIALDDPHSNPPVSLTYAQLYQQIKNFAVGLQTLEVKLSSKVALFA  72

Query  2039  DNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFH  1860
             DNS RW +ADQG M  GA N VR S++  +ELL I   S+S  L V + +   ++     
Sbjct  73    DNSPRWFIADQGSMMAGAANAVRSSQADKDELLYILADSDSTTLIVQDQKTLKKLRSGID  132

Query  1859  SHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPI  1680
                 ++ IILL  E     + +       ++ +++D G++  +A+               
Sbjct  133   D-LPIQLIILLSDEAPDQEAPIK----TLNFQQLMDKGSQGTLAIATQ------------  175

Query  1679  NSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERA  1500
               D +ATL+YTSGTTG PKGVML+H NLLHQ+ NL   +   PGDR LS+LP WH+YER+
Sbjct  176   TKDSLATLIYTSGTTGQPKGVMLSHGNLLHQVTNLDSVIQPKPGDRVLSILPSWHSYERS  235

Query  1499  AEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLI  1320
             AEYF+ S GC   YT++   K DLKR++P +++ VP ++E+LY GI KQ    SP R+ +
Sbjct  236   AEYFLLSQGCTMTYTSIRTFKTDLKRFKPHHMVGVPRLWESLYEGIQKQFREQSPTRQKL  295

Query  1319  ALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLV  1140
                FL +S  Y  A+RI +   L        +  S  + L AR  A LL PLH+L  KL+
Sbjct  296   VEFFLNLSERYILAQRIAKNLSLEH------FHASSFERLLARLQATLLSPLHILGDKLI  349

Query  1139  Yskihssigis-kagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVL  963
             Y KI   +G + +  +SGGGSL+ H+D F+E +++ +  GYGLTE++PV   R  + N+ 
Sbjct  350   YGKIRQGVGGNFETMVSGGGSLAKHLDMFYEIVNLPVLVGYGLTETSPVTNARTHSHNIR  409

Query  962   GSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLN  783
             GS G P+  TEI +VD +  + L  G +G+V  +G QVM+GYYK P AT++AID +GW +
Sbjct  410   GSSGQPVPETEICIVDPDNRQILPQGQRGLVLVRGSQVMQGYYKKPEATRKAIDPDGWFD  469

Query  782   TGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIV  603
             TGDLGW+ P             +V+ GRAKDTIVLS+GEN+EP  IE+A + S  I Q++
Sbjct  470   TGDLGWLTPMQD----------LVITGRAKDTIVLSNGENIEPQAIEDACIRSPYIDQMM  519

Query  602   VIGQDKRRLGALVLPHKEEVLLAAK--KLSVVDSDATEVSEEKTSKLIHEELQKWTTGCT  429
             V+GQD++ LGAL++P+ + ++  AK  +L++   DA+   EE    ++H +L        
Sbjct  520   VVGQDQKALGALIVPNLDALVTWAKSQQLTLNLPDASASREE----ILHSDLYSQPVQSL  575

Query  428   F------------------QIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDL  303
             F                  QI    LI EPF+IDNGL+T T+K++R  VT  Y+  I+ +
Sbjct  576   FRQELSREVKNRPGYRPDDQIKTFELILEPFSIDNGLMTQTLKIKRPVVTQRYQVMIDGM  635

Query  302   Y  300
             +
Sbjct  636   F  636



>ref|WP_010997751.1| long-chain fatty acid--CoA ligase [Nostoc sp. PCC 7120]
 ref|NP_487642.1| hypothetical protein alr3602 [Nostoc sp. PCC 7120]
 dbj|BAB75301.1| alr3602 [Nostoc sp. PCC 7120]
Length=683

 Score =   462 bits (1188),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 257/661 (39%), Positives = 400/661 (61%), Gaps = 54/661 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P+IW  A ++FG  +AL +P+  P   +++++L  +I  FA GL+ +G++  ++I+L
Sbjct  57    ESLPEIWPIAGKKFGETLALYNPHAKPEVKITYQQLADKIQLFASGLQALGVQAGDRISL  116

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
              ADNS RW +ADQGIMT GA++ VR S++  EELL I  HS S AL V++ + ++++ + 
Sbjct  117   IADNSPRWFIADQGIMTAGAVDAVRSSQAEKEELLYIVAHSGSTALVVEDLKTFNKLQDR  176

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
              H    ++ +++L  E    T        + ++ ++I++G                +T+ 
Sbjct  177   LHD-LPIQVVVILTDE----TPPTEQSLKVLNFLQLIEVGKN--------------HTFV  217

Query  1685  PINS--DDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHA  1512
             P+    +++ATL+YTSGTTG PKGVML++ NLLHQ+      V    GD  LS+LP WH+
Sbjct  218   PVKRKRNELATLIYTSGTTGKPKGVMLSYSNLLHQVTTFRVVVQPKVGDTALSILPSWHS  277

Query  1511  YERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPA  1332
             YER  EY++ S GC Q+YT + ++K DLK+Y+P Y+++VP ++E++Y G+ KQ       
Sbjct  278   YERTVEYYLLSQGCTQIYTNLRSVKADLKQYKPNYMVAVPRLWESIYEGVQKQFREQPAN  337

Query  1331  RKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLA  1152
             ++ +    L +S  Y +A+RI +G  L           S L+ L A+ +     P H+L 
Sbjct  338   KQRLIKFLLGMSEKYIKAQRIAQGTSLDHLH------ASSLERLIAKVLEFAFLPFHVLG  391

Query  1151  RKLVYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVACRRPN  975
             +KLVY K+  + G     +  GG     H+D FFE I +++  GYGLTE++PV   RRP 
Sbjct  392   QKLVYGKVKEATGGRFKQVISGGGALPKHIDTFFEIIGVQILQGYGLTETSPVTNVRRPW  451

Query  974   CNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDEN  795
              N +G+ G PI  TE+K+VD ET + L  G +G+V  KGPQVM+GYY+NP AT +AID  
Sbjct  452   RNFIGTSGQPIPGTEVKIVDPETRQPLPVGKRGLVLLKGPQVMQGYYQNPEATAKAIDPQ  511

Query  794   GWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLI  615
             GW ++GDLGW+ P++           +VL GRAKDTIVLS+GEN+EP  IE+A + S  I
Sbjct  512   GWFDSGDLGWVTPDNE----------LVLTGRAKDTIVLSNGENIEPQPIEDACLRSPYI  561

Query  614   QQIVVIGQDKRRLGALVLPHKEEVLLAAKK----LSVVDSDATEVSEEKT---SKLIH--  462
              QI+++GQD+R +GAL++P+ E +   A+     LSV D + T  S +K    SK+I   
Sbjct  562   DQIMLVGQDQRSIGALIVPNVEALAKWAESQNLVLSVEDDNLTSSSSQKINLESKMIQGL  621

Query  461   --EELQKWTTGCTF-----QIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDL  303
               +EL +            ++GP  LI EPF+I+NGL+T T+K+RR  VT+ Y++ I  +
Sbjct  622   FRQELNREVQNRPGYRPDDRVGPFKLILEPFSIENGLMTQTLKLRRHVVTERYRDIINAM  681

Query  302   Y  300
             +
Sbjct  682   F  682



>ref|WP_012306304.1| long-chain fatty acid--CoA ligase [Synechococcus sp. PCC 7002]
 ref|YP_001733936.1| long-chain-fatty-acid CoA ligase [Synechococcus sp. PCC 7002]
 gb|ACA98680.1| long-chain-fatty-acid CoA ligase (AMP-forming) [Synechococcus 
sp. PCC 7002]
Length=647

 Score =   461 bits (1185),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 270/659 (41%), Positives = 389/659 (59%), Gaps = 51/659 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++  IW  AAE + + +AL DP+  P   L++ +L + I  F  GL+ +GL+P EK+AL
Sbjct  20    QSLSKIWAIAAERYADIVALYDPHQKPEFKLTYHQLWQGIQQFGAGLQALGLQPQEKVAL  79

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
              ADNS RW +ADQG +  GA+N VR S++  +ELL IY  SES  L V++ + + R+   
Sbjct  80    IADNSPRWFIADQGSIAAGAVNAVRSSQAEKQELLYIYTDSESRFLIVEDRKTFERLNPE  139

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
               ++   R +I L  E+   T       PI+++++++ LG++  + +             
Sbjct  140   I-TNLQPRAVIFLTDEEVPETE-----LPIFNFSQLMTLGSQEPLTMPGR----------  183

Query  1685  PINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYE  1506
               +  D+ TL+YTSGTTG PKGVML+H N+L+Q+ NL   +   PGD  LS+LP WH+YE
Sbjct  184   --SPQDLMTLIYTSGTTGKPKGVMLSHGNVLYQVRNLDQVIQPNPGDVTLSILPTWHSYE  241

Query  1505  RAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARK  1326
             RAAEYF+ S GC Q+YT + N+K+DL+ Y+P Y+++VP ++E++Y G+ K +      ++
Sbjct  242   RAAEYFLLSQGCTQIYTNIRNIKKDLQTYKPGYMVAVPRIWESIYEGVQKNLREQPAKKQ  301

Query  1325  LIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARK  1146
              +   FL  S  Y  A+RI     L        + VS L  L ARA A  L P HLL  K
Sbjct  302   KLVNFFLTCSQNYVLAQRIANNLSLEH------FHVSSLTRLMARAKAIALYPFHLLGNK  355

Query  1145  LVYskihssigiska-gisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
             LVY KI  + G      ISGGGSL+ H+D FFE + I +  GYGLTE++PV   RRP  N
Sbjct  356   LVYEKIRGATGGKIRYVISGGGSLAQHIDTFFEIVGINILVGYGLTETSPVTNARRPERN  415

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             V GS GP ++ TEI++VD ET + LS G KG+V  +GPQVM+GYY+ P AT +AID  GW
Sbjct  416   VCGSAGPALKGTEIRIVDPETRQTLSQGQKGLVLIRGPQVMQGYYRKPEATAKAIDPEGW  475

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              ++GDLGW+ P           G +VL GRAKDTIVL++GEN+EP  IE+A   S  I Q
Sbjct  476   FDSGDLGWVTPQ----------GDLVLTGRAKDTIVLTNGENIEPQPIEDACARSPYIDQ  525

Query  608   IVVIGQDKRRLGALVLPHKEEV----LLAAKKLSVVDSD-------ATEVSEEKTSKLIH  462
             I+++GQD++ LGAL++P+ E +          L + D D        T++  +    L  
Sbjct  526   IMLVGQDQKSLGALIVPNLEALGQWMSQGGLGLQLPDPDIPSEQLPQTDLYSKPVLNLFK  585

Query  461   EELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             +EL +            +I    LI EPF+I+NGL+T T+KV+R  V + Y   I  LY
Sbjct  586   QELNREIKNRPGYRVDDRISDFALILEPFSIENGLMTQTLKVKRPVVAEKYAALIASLY  644



>ref|WP_009456154.1| MULTISPECIES: long-chain fatty acid--CoA ligase [Fischerella]
 gb|EHC16143.1| Long-chain-fatty-acid--CoA ligase [Fischerella sp. JSC-11]
Length=659

 Score =   461 bits (1185),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 265/661 (40%), Positives = 403/661 (61%), Gaps = 54/661 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P+IW  AA++FGN +AL DP+  P   L++ EL ++I  FA GL+ +G++  ++I+L
Sbjct  32    ESLPEIWPLAAQKFGNIVALRDPHAKPEVVLTYTELCQQIQRFAAGLQALGVQAGDRISL  91

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
              ADNS RWL+ADQGIMT G ++ VR S++  EELL I  +S S AL V++ +  +++  +
Sbjct  92    IADNSPRWLIADQGIMTAGGVDAVRSSQADKEELLFIVANSGSTALVVEDLKTLNKLRGS  151

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
              +    ++F+I+L  E     +E +    +Y++++++++G               Q++ +
Sbjct  152   LND-LPIQFVIVLSNEALP-EAETLK---LYTFSQLMEIG--------------AQHSLQ  192

Query  1685  PI--NSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHA  1512
             P+  N  D+ATL+YTSGTTG PKGVMLTH NL+HQI+ +   V   PGD  LS+LP WH+
Sbjct  193   PVKRNLSDLATLIYTSGTTGKPKGVMLTHRNLMHQIVAIPVVVQPRPGDIVLSILPTWHS  252

Query  1511  YERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPA  1332
             YER+ EYF+ S GC QVYT + ++K DLK YQP Y+++VP + E++Y G  KQ      +
Sbjct  253   YERSCEYFLLSQGCTQVYTNLRSIKRDLKEYQPHYMVAVPRLLESIYEGAQKQFREQPAS  312

Query  1331  RKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLA  1152
             R+ +   F +I   Y +A+R   G  L  +   P    S+ D L A    A L PL+ L 
Sbjct  313   RQRLINFFFEIGEKYIKARRTLTG--LNLENLNP----SMGDRLTASLQVAALSPLYALG  366

Query  1151  RKLVYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVACRRPN  975
              KLVYSK+  + G     +  GG     HVD FFE + +++  GYGLTE++PV   RR  
Sbjct  367   EKLVYSKVREATGGRVKQMISGGGALPKHVDDFFEILGVEILVGYGLTETSPVTHARRHW  426

Query  974   CNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDEN  795
              N+ G+ G PI  TE K+VD ET K L  G +G+V  +GPQ+M+GYY+NP AT +AID  
Sbjct  427   RNLRGAAGQPIPGTETKIVDPETKKELPTGERGLVLLRGPQIMQGYYQNPEATAKAIDPE  486

Query  794   GWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLI  615
             GW ++GDLGW+ P +           ++L GRAKDTIVL++GEN+EP  IE+A + S  I
Sbjct  487   GWFDSGDLGWVTPQND----------LILTGRAKDTIVLTNGENIEPQPIEDACLRSPYI  536

Query  614   QQIVVIGQDKRRLGALVLPHKEEVLLAAK----KLSVVDSDATEVSEEKT---SKLIH--  462
              QI+++GQD++ LGAL++P+ E +   A     +L++ D + T  + +K    SK+I   
Sbjct  537   DQIMLVGQDRKSLGALIVPNLEALEKWAASGNLQLTIEDENVTAATSQKINLESKIIQDL  596

Query  461   --EELQKWTTGCTF-----QIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDL  303
               +EL +            +IGP  LI EPF+I+NG++T T+K++R  V   Y + I  +
Sbjct  597   FRQELNREVQNRPGYRPDDRIGPFKLILEPFSIENGMMTQTLKIKRHVVMQHYHDIINGM  656

Query  302   Y  300
             +
Sbjct  657   F  657



>ref|WP_016869319.1| long-chain fatty acid--CoA ligase [Fischerella muscicola]
Length=659

 Score =   460 bits (1184),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 264/659 (40%), Positives = 397/659 (60%), Gaps = 50/659 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P+IW  AA+ FG+ +AL DP+  P   L++ EL ++I  FA GL+ +G++  ++I+L
Sbjct  32    ESLPEIWPLAAQRFGDIVALRDPHAKPEVVLTYTELCQQIQRFAAGLQALGVQAGDRISL  91

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
              ADNS RWL+ADQGIMT GA++ VR S++  EELL I  +S S AL V++ +  +++  +
Sbjct  92    IADNSPRWLIADQGIMTAGAVDAVRSSQAEKEELLFIVANSGSTALVVEDLKTLNKLRGS  151

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
              +    ++F+I+L  E       +     +Y++++++++G            A+H     
Sbjct  152   LND-LPIQFVIVLSNEALPEAKTLK----LYTFSQLMEMG------------AKHSLQPV  194

Query  1685  PINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYE  1506
               N +D+ATL+YTSGTTG PKGVMLTH NL+HQI+ +   V   PGD  LS+LP WH+YE
Sbjct  195   KRNRNDLATLIYTSGTTGKPKGVMLTHRNLMHQIVAIPVVVQPRPGDTVLSILPTWHSYE  254

Query  1505  RAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARK  1326
             R+ EYF+ S GC QVYT + ++K DLK YQP Y+++VP + E++Y G  KQ      +R+
Sbjct  255   RSCEYFLLSQGCTQVYTNLRSIKRDLKEYQPHYMVAVPRLLESIYEGAQKQFREQPASRQ  314

Query  1325  LIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARK  1146
              +   F +I   Y +A+R   G  L      P    S+ D L A    A L PL+ L  K
Sbjct  315   RLINFFFEIGEKYIQARRTLTG--LNLQNLNP----SMGDRLTASLQVAALSPLYALGEK  368

Query  1145  LVYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
             LVYSK+  + G     +  GG     HVD FFE + +++  GYGLTE++PV   RR   N
Sbjct  369   LVYSKVREATGGRVKQMISGGGALPKHVDDFFEILGVEILVGYGLTETSPVTHARRYWRN  428

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             + G+ G PI  TE K+VD ET K L  G +G+V  +GPQ+M+GYY+NP AT +AID  GW
Sbjct  429   LRGAAGQPIPGTETKIVDPETKKELPTGERGLVLLRGPQIMQGYYQNPEATAKAIDSEGW  488

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              ++GDLGW+ P +           ++L GRAKDTIVL++GEN+EP  IE+A + S  I Q
Sbjct  489   FDSGDLGWVTPQND----------LILTGRAKDTIVLTNGENIEPQPIEDACLRSPYIDQ  538

Query  608   IVVIGQDKRRLGALVLPHKEEVLLAAK----KLSVVDSDATEVSEEKT---SKLIH----  462
             I+++GQD++ LGAL++P+ E +   A     +L + D + T  + +K    SK+I     
Sbjct  539   IMLVGQDRKSLGALIVPNLEALEKWATSGNLQLCIEDENVTAATSQKINLESKIIQDLFR  598

Query  461   EELQKWTTGCTF-----QIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             +EL +            +IGP  LI EPF+I+NG++T T+K++R  V   Y + I  ++
Sbjct  599   QELNREVQNRPGYRPDDRIGPFKLILEPFSIENGMMTQTLKIKRHVVMQHYHDIINGMF  657



>ref|WP_019495179.1| hypothetical protein [Calothrix sp. PCC 7103]
Length=644

 Score =   459 bits (1182),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 269/654 (41%), Positives = 402/654 (61%), Gaps = 52/654 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDE----  2058
             +++P +W+ AA++F +  AL+DP+  P   L++++L  +I  FA G++V+G         
Sbjct  30    QSLPGMWQIAAKQFKDVAALIDPHVKPEVTLTYEQLYYKIQQFAIGIQVLGFNQGTQDTV  89

Query  2057  --KIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMY  1884
               +IALFADNS RW++ADQGIM  GA N VR S +  +ELL I  HS S  L V+N +  
Sbjct  90    LPRIALFADNSARWIIADQGIMMAGAANAVRSSAADKDELLYILEHSGSTGLVVENIKTL  149

Query  1883  SRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEAR  1704
              ++    +S A++++I+LL  E++ I S V     I +YN+++ L + + +     +E +
Sbjct  150   KKLEPEVYS-ANIQWIVLLSDEEAPINSSV----KIINYNQLMQLASSNTL-----KEVK  199

Query  1703  HQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLP  1524
                    +N  D+ATL+YTSGTTG PKGVMLTH NL+HQ+  L   +    GD+ LS+LP
Sbjct  200   -------LNRQDLATLIYTSGTTGKPKGVMLTHGNLIHQLNTLTAVIQPAVGDKTLSILP  252

Query  1523  PWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINT  1344
              WH++ R  EY+  S GC QVYT    LK+DL+ Y+PQY++ VP ++E++Y GI K    
Sbjct  253   TWHSFGRVGEYYTLSQGCTQVYTNRRYLKQDLQEYKPQYVVGVPRLWESIYEGIQKSFRE  312

Query  1343  SSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPL  1164
              SP  + +   FL +S  + +A R ++G  L       + +++     W   I  LL PL
Sbjct  313   KSPRMQKLINNFLAVSGRFIKAVRTWKGLDLQNLNPTRAQIINA----WKTTI--LLAPL  366

Query  1163  HLLARKLVYskihssigiskagis-gggslssHVDKFFEAIDIKLQNGYGLTESAPVVAC  987
             H L   +VY KI  + G +   +  GGGSL+ H+++FFE + I +  GYGLTE++PV++ 
Sbjct  367   HFLGEMIVYKKIQQATGGNVKQLICGGGSLAQHLEEFFEIVGINILVGYGLTETSPVLSA  426

Query  986   RRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQA  807
             RR   N+ GS G PI  TE K+VD ET + LSP  KG+V A+GPQ+MKGYY NP AT++A
Sbjct  427   RRHYKNLRGSSGIPIAGTEFKIVDLETRQTLSPKQKGLVMARGPQIMKGYYLNPEATRKA  486

Query  806   IDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMG  627
             ID  GW +TGD+GW+  ++           IVL GRAKDTIVL++GEN+EP  IE+A + 
Sbjct  487   IDAEGWFDTGDIGWLTQDNQ----------IVLTGRAKDTIVLTNGENIEPQPIEDACLR  536

Query  626   SNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQK  447
             S+ I QI+++GQD++ LGAL++P+ E   L AK  + +D ++  V +     L  EE+ +
Sbjct  537   SDYIDQIMLVGQDQKFLGALIVPNMEA--LEAKLGTQIDLNSKVVRD-----LFREEINR  589

Query  446   WTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
              T          +I    LI EPFTI+NGLLT T+K+RR+ VT+ Y++ I  ++
Sbjct  590   ETRDRPGYRRDDEILVFDLIQEPFTIENGLLTQTLKIRRNVVTERYQDIIRKMF  643



>ref|WP_015179466.1| Long-chain-fatty-acid--CoA ligase [Oscillatoria nigro-viridis]
 ref|YP_007118682.1| Long-chain-fatty-acid--CoA ligase [Oscillatoria nigro-viridis 
PCC 7112]
 gb|AFZ10266.1| Long-chain-fatty-acid--CoA ligase [Oscillatoria nigro-viridis 
PCC 7112]
Length=649

 Score =   459 bits (1182),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 267/655 (41%), Positives = 394/655 (60%), Gaps = 48/655 (7%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDE----  2058
             +++P+IW    ++FG  +AL DP+  P   L++ +L ++I  FA GL+ +G++PD     
Sbjct  30    RSIPEIWAIVKQKFGQTVALHDPHSQPEIKLTYTDLYQQIQQFAAGLQALGIEPDPGEAV  89

Query  2057  --KIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMY  1884
               ++ALFADNS RWL+ADQGIM  GA N VRG+ +  EELL I   S S AL V+N  + 
Sbjct  90    PPRVALFADNSPRWLIADQGIMMAGAANAVRGATADPEELLYIIQDSGSTALVVENRALL  149

Query  1883  SRIAETFHSHAD--VRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQE  1710
              ++    H   D  ++ I+LL  E+   +  +        +++++  G    +     + 
Sbjct  150   KKLQ---HRLPDLPIQLIVLLSDEEPEASPTLN----TVKFSQVMTTGANRPL-----KP  197

Query  1709  ARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSM  1530
             + H+          +ATL+YTSGTTG PKGVMLTH NLLHQ+      +    G+  LS+
Sbjct  198   SNHK-------PQTLATLLYTSGTTGKPKGVMLTHGNLLHQVTTFGTILQPEIGESALSI  250

Query  1529  LPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQI  1350
             LP WHAYER  EYF+ S GC Q+YT++   K+D K Y+PQY+ISVP ++E++Y  + KQ 
Sbjct  251   LPSWHAYERTVEYFLLSQGCTQIYTSIRYFKQDFKAYKPQYMISVPRIWESIYEAVQKQF  310

Query  1349  NTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLC  1170
                   ++ +    L  S  Y E +RI++G  L+    +P+   S  + L AR  + LL 
Sbjct  311   REQPANKQKLVNFLLSASQQYIENRRIFQGLTLS---LKPA---SASEKLIARIKSILLW  364

Query  1169  PLHLLARKLVYskihssigiska-gisgggslssHVDKFFEAIDIKLQNGYGLTESAPVV  993
             P+H LA KLVY K+  + G      ISGGGSL++H+D FFE  +I L  GYGLTE++PV+
Sbjct  365   PVHALAEKLVYQKVREATGGRFKWAISGGGSLATHLDNFFEIANIGLLVGYGLTETSPVL  424

Query  992   ACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATK  813
               RRP  N+ GS G PI  TEIK+VD ET + L  G +G+V A+GPQ+M+GYY NP AT 
Sbjct  425   TVRRPWHNLKGSAGQPIAQTEIKIVDPETRQQLPAGQRGLVLARGPQIMQGYYLNPQATA  484

Query  812   QAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAA  633
             + ID  GW +TGDLGW+ P +           ++L GRAKDTIVLS+GEN+EP  IE+A 
Sbjct  485   KVIDPEGWFDTGDLGWLTPGND----------LILTGRAKDTIVLSNGENIEPQPIEDAC  534

Query  632   MGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKK----LSVVDSDATEVSEEKTSKLI  465
             + S  I QI+++GQD++ +GAL++P+ E V   A+     L  +D ++  + +    +L 
Sbjct  535   VRSPYIDQIMLVGQDQKSVGALIVPNAEAVQKWAETQNPPLHEIDWNSKTIQDLFRKELN  594

Query  464   HEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
              E   +       +IGP  LI EPF+I+NG+LT T+K++R  VT  Y++ I+ ++
Sbjct  595   REVQNRPGYRADDRIGPFRLIQEPFSIENGMLTQTLKIKRPVVTQHYRDMIDGMF  649



>ref|WP_026732497.1| long-chain fatty acid--CoA ligase [Fischerella sp. PCC 9605]
Length=659

 Score =   459 bits (1181),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 259/661 (39%), Positives = 398/661 (60%), Gaps = 54/661 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P+IW   A+ FGN +AL DP+  P   L++ +L ++I  FA GL+ +G++  ++I+L
Sbjct  32    ESLPEIWPLVAQRFGNIVALRDPHAQPEVILTYTQLCQQIQLFATGLQALGVQAGDRISL  91

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
              +DNS RW +ADQGIMT GA++ VR S++  EELL I  +S S AL V + +  +++   
Sbjct  92    ISDNSPRWFIADQGIMTAGAVDAVRSSQAEREELLYIVANSGSTALVVQDLKTLNKLRAR  151

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
                   ++ ++LL  +++   +E +    +YS+ +++++G            A+H  T +
Sbjct  152   LED-LPIKLVVLL-SDEAPPEAETLK---VYSFTQLMEIG------------AKH--TLQ  192

Query  1685  PI--NSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHA  1512
             P+  + D +ATL+YTSGTTG PKGVML+H NL+HQI+ +   V    GD  LS+LP WH+
Sbjct  193   PVKRSRDSLATLIYTSGTTGKPKGVMLSHRNLMHQIVAIPTVVQPQGGDIVLSILPTWHS  252

Query  1511  YERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPA  1332
             YER+ EYF+ SLGC QVYT + ++K+DLK ++P Y+++VP + E++Y G+ KQ      +
Sbjct  253   YERSCEYFLLSLGCTQVYTNLRSIKQDLKEFRPHYMVAVPRLLESIYEGVQKQFREQPAS  312

Query  1331  RKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLA  1152
             R+ +   FL IS  Y +A+R  EG  L      P    S+++ L A   AA L PLH L 
Sbjct  313   RQRLIKFFLGISEKYIQARRTVEG--LDLQNLNP----SIVERLTASTQAAALSPLHALG  366

Query  1151  RKLVYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVACRRPN  975
              KLVY+K+  + G     +  GG     HVD FFE I +++  GYGLTE++PV   RR  
Sbjct  367   EKLVYNKVREATGGRVKQMISGGGALPKHVDDFFEIIGVEILVGYGLTETSPVTHARRYW  426

Query  974   CNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDEN  795
              N+ GS G PI  TE K+VD+ET K L PG KG+V  +GPQ+M+GYY+NP AT +AID  
Sbjct  427   RNLRGSAGQPIPGTETKIVDSETRKELPPGEKGLVLLRGPQIMQGYYQNPEATAKAIDSE  486

Query  794   GWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLI  615
             GW ++GDLGW+ P +           +VL GRAKDTIVL++GEN+EP  IE+A + S  I
Sbjct  487   GWFDSGDLGWVTPQND----------LVLTGRAKDTIVLTNGENIEPQPIEDACLRSPYI  536

Query  614   QQIVVIGQDKRRLGALVLPHKE-----------EVLLAAKKLSVVDSDATEVSEEKTSKL  468
              QI+++GQD++ LGAL++P+ E           ++ +    L+   S    +  +    L
Sbjct  537   DQIMLVGQDQKSLGALIVPNLEALEKWAASQNLQLCIEEDNLASAASQKINLESKIIQDL  596

Query  467   IHEELQKWTTGCTF-----QIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDL  303
               +EL +            +IG   LI EPF+I+NG++T  + ++R  V + Y++ I  +
Sbjct  597   FRQELNREVQNRPGYRPDDRIGRFKLILEPFSIENGMMTQKLSIKRHVVMEHYRDIINGM  656

Query  302   Y  300
             +
Sbjct  657   F  657



>ref|WP_006099512.1| long-chain fatty acid--CoA ligase [Coleofasciculus chthonoplastes]
 gb|EDX77404.1| AMP-binding enzyme, putative [Coleofasciculus chthonoplastes 
PCC 7420]
Length=655

 Score =   458 bits (1179),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 265/658 (40%), Positives = 394/658 (60%), Gaps = 53/658 (8%)
 Frame = -3

Query  2219  VPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFA  2040
             +P +W  AA+ FG+ +AL +PY  P   L+F ++ ++I  FA GL+ +G+   +++ALF+
Sbjct  32    LPQVWSLAAQRFGDTVALENPYAKPEVKLTFAQMWQQIQQFAAGLQALGVSAGDRVALFS  91

Query  2039  DNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFH  1860
             +NS RW VADQGIMTTGA++VVR S++  EELL I   SE+ AL V+N +  +++ +  H
Sbjct  92    ENSSRWFVADQGIMTTGAVDVVRSSQAEQEELLYILKDSEATALVVENQDTLTKLDQHLH  151

Query  1859  SHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPI  1680
                 ++ +ILL  ++    SE+     I ++ ++++ G                +T++PI
Sbjct  152   D-LPIQLVILLSDQEPDAESELN----ILNFPQVLERGKN--------------HTFQPI  192

Query  1679  NS--DDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYE  1506
                 D +ATLVYTSGTTG PKGVML+H NLLHQ+ +L   V +  GDR LS+LP WH YE
Sbjct  193   EQAPDTLATLVYTSGTTGKPKGVMLSHGNLLHQVTSLGAIVQLEAGDRVLSILPTWHVYE  252

Query  1505  RAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARK  1326
             RA EYF  S GC  +YTT+ ++K DL    P Y +SVP + E++Y  + KQ++  S  ++
Sbjct  253   RAIEYFALSQGCTLIYTTLRHVKRDLNAQHPNYFVSVPRLLESIYETVQKQLSKESARKQ  312

Query  1325  LIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARK  1146
              +  +   IS  + +A+R+  G  L+ + +QPS        LWAR     L  +H+LA +
Sbjct  313   RLVNILFSISDRFIKARRLVHG--LSLEHQQPSGFQR----LWARLQWLTLVLIHVLADQ  366

Query  1145  LVYskihssigiskagis-gggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
              +Y KI   IG +      GGG+LS  +D F+E I I++  GYGLTE++PV+  RR   N
Sbjct  367   FIYQKIREQIGANLKQTICGGGALSQKLDDFYEIIGIEVLEGYGLTETSPVLTARRSWHN  426

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             + GS G PI  TEI++VD +T + L  G KG+V A+G Q+M+GYY+NP AT + ID  GW
Sbjct  427   LRGSAGKPILETEIRIVDPDTRETLLQGEKGLVWARGSQIMQGYYRNPEATDKVIDAQGW  486

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              NT DLGW+               +VL GRAKDTIVLS+GENVEP  IE A M S  I Q
Sbjct  487   FNTEDLGWLTVQED----------LVLTGRAKDTIVLSNGENVEPKPIENACMRSRYIDQ  536

Query  608   IVVIGQDKRRLGALVLPHKEEV--LLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTT-  438
             +VV+GQD+R LGAL++P+ + +    A  +  +   D    S E+T  L  + +Q++   
Sbjct  537   MVVVGQDQRSLGALIVPNFDNLQGWAAENQYHLQLPDGESASGEETIDLNSKPVQEFFRQ  596

Query  437   ------------GCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
                             +IG   LI+EPF+ +NG+LT T+KV+R  V + Y++ I++++
Sbjct  597   EINREAKNRPGYNPNDRIGVFRLISEPFSQENGMLTQTLKVKRHVVREQYQDLIDEMF  654



>ref|WP_028091012.1| long-chain fatty acid--CoA ligase [Dolichospermum circinale]
Length=657

 Score =   457 bits (1177),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 246/655 (38%), Positives = 391/655 (60%), Gaps = 48/655 (7%)
 Frame = -3

Query  2219  VPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPD-------  2061
             +P+IW  AA+ FG+ IAL +P+  P   +++ +L ++I  FA GL+ +G+  +       
Sbjct  34    LPEIWPLAAKRFGDIIALYNPHSQPEVKITYSQLTEQINQFAAGLQALGVNTNNSENLPY  93

Query  2060  -EKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMY  1884
              E+++L ADNS RW +ADQGIMT GA+N VR S++  EELL I +HS S +L V++ +  
Sbjct  94    GERVSLIADNSPRWFIADQGIMTAGAVNAVRSSQAEREELLYIISHSGSTSLVVEDIKTL  153

Query  1883  SRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEAR  1704
             +++ E  +  A ++ +++L  E      +     P+ ++ +++++G              
Sbjct  154   NKLGERLNELA-IKLVVILSDEIPPAELKF----PVVNFTQLLEIGRN------------  196

Query  1703  HQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLP  1524
             H+      +++ +ATL+YTSGTTG PKGVML+H NLLHQ+  L   V    GD  LS+LP
Sbjct  197   HKLVTNKYSAESLATLIYTSGTTGKPKGVMLSHRNLLHQVTTLGTIVQPKKGDTVLSILP  256

Query  1523  PWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINT  1344
              WH+YER+ EYF+ S GC Q+YT + ++K DLK+++P Y+I+VP ++E++Y G+ KQ   
Sbjct  257   TWHSYERSGEYFLLSQGCSQIYTNLRSVKGDLKKFKPNYMIAVPRLWESIYEGVQKQFRE  316

Query  1343  SSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPL  1164
                 ++ +    L+IS  Y E++RI +G  L            +++   A+ +   L  +
Sbjct  317   QPAKKQKLVKFLLEISQKYIESRRISQGLSLNHIN------AGIIERFQAKIVELALSAI  370

Query  1163  HLLARKLVYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVAC  987
             H+L  KLVY K+  + G     +  GG     H+D FFE + I++  GYGLTE++PV   
Sbjct  371   HILGEKLVYHKVRQATGGKIKHVISGGGALPKHIDNFFEIVGIEILQGYGLTETSPVTNA  430

Query  986   RRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQA  807
             RRP  N+ GS G PI  T++K+V+ ET + L  G +G+V  KGPQ+M+GYY+NP AT +A
Sbjct  431   RRPWRNLRGSSGQPIAGTKVKIVNPETRQPLPAGERGLVLLKGPQIMQGYYQNPQATNKA  490

Query  806   IDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMG  627
             ID  GW ++GDLGW+ P +           +VL GRAKDTIVLS+GEN+EP  IE+A + 
Sbjct  491   IDPQGWFDSGDLGWVTPQND----------LVLTGRAKDTIVLSNGENIEPQPIEDACLR  540

Query  626   SNLIQQIVVIGQDKRRLGALVLPHKEEVL-LAAKKLSVVDSDATEVSEEKTSKLIHEELQ  450
             S  I QI+++GQD++ +GA+++P+ E +   A  +  + DS   ++       L  +EL 
Sbjct  541   SPYIDQIMLVGQDQKSIGAIIVPNLEALAKWAETQNQINDSQKIDLESRIVQDLFRQELN  600

Query  449   KWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             +            +IGP  LI+E F+I+NG++T T+K+RR  V + Y + I  ++
Sbjct  601   REVQNRPGYRTDDRIGPFKLISEQFSIENGMMTQTLKIRRHIVMERYCDIINGMF  655



>ref|WP_006510671.1| AMP-forming long-chain acyl-CoA synthetase [Xenococcus sp. PCC 
7305]
 gb|ELS02197.1| AMP-forming long-chain acyl-CoA synthetase [Xenococcus sp. PCC 
7305]
Length=640

 Score =   457 bits (1175),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 273/659 (41%), Positives = 404/659 (61%), Gaps = 50/659 (8%)
 Frame = -3

Query  2222  TVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALF  2043
             ++P+IW  AA+ FG  +AL  P+      LS++EL ++I   A GL+ +G+   +KIALF
Sbjct  14    SLPEIWPIAAQAFGGIMALNAPHLKSKVTLSYQELYQKIQCCAAGLQALGVSSGDKIALF  73

Query  2042  ADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETF  1863
             ADNS RWL+ADQGIM  G ++VVR   +  +ELL IY +S+S +L V+N +  +R++   
Sbjct  74    ADNSPRWLIADQGIMMAGGVDVVRSGSAEQQELLYIYENSDSSSLIVENLKTLNRLSPQI  133

Query  1862  HSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEP  1683
              + + ++FIILL  E+   +S       I +++++++LG+   +A +   ++        
Sbjct  134   EALS-LKFIILLSDEEIPTSSST----KILNFSQLLELGSNHSLAKVTQDKST-------  181

Query  1682  INSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYER  1503
                  +ATL+YTSGTTG PKGVML+H NLLHQ+ NL   +    GDR LS+LP WHAYER
Sbjct  182   -----LATLIYTSGTTGKPKGVMLSHGNLLHQVNNLRQIILCEQGDRVLSILPSWHAYER  236

Query  1502  AAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKL  1323
             +AEY++ S GC Q YT + +LK DLK YQP Y+I VP ++E+LY G+ KQ    +P ++ 
Sbjct  237   SAEYYLLSQGCTQYYTNLRSLKSDLKTYQPHYMIGVPRLWESLYEGVQKQFREQAPTKQK  296

Query  1322  IALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKL  1143
             +   F  +S  Y  A+R+  G  L  D  QPS +  +   L   A    L PLHLL  K+
Sbjct  297   LINWFFNLSQKYVMARRLSRG--LDLDNLQPSAIAKLFATLQTFA----LLPLHLLGDKI  350

Query  1142  VYskihssi-giskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNV  966
             VY K+  ++ G  K  +SGGGSL+ H+D F+E ++I +  GYGLTE+APV   R  + N 
Sbjct  351   VYQKVRDAVGGKVKTFVSGGGSLAKHLDDFYELVNIPVLVGYGLTETAPVTNARTLDRNF  410

Query  965   LGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWL  786
               + G PI  TEIK+V+ ET +AL  G+KG+V  +G QVM+GYYKNP AT +AID  GW 
Sbjct  411   SKTSGQPIAETEIKIVNPETKEALPTGAKGLVLIRGSQVMQGYYKNPEATAKAIDAEGWF  470

Query  785   NTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQI  606
             ++GDLGW+ P++           +VL GRAKDTIVL++GEN+EP  IE+A + S+ I QI
Sbjct  471   DSGDLGWVTPDND----------LVLTGRAKDTIVLTNGENIEPQPIEDACIRSSYIDQI  520

Query  605   VVIGQDKRRLGALVLPHKEEVL--LAAKKLSV----VDSD-ATEVSEEKTSKLIHEELQK  447
             +++GQD+R LGAL++P+ E V   +  + L +     ++D AT  +    SK I +  +K
Sbjct  521   MLVGQDQRALGALIVPNLETVQQWITQQNLQLQLPSSEADLATVANSALYSKPIRDLFRK  580

Query  446   WTT---------GCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
               T             +I     I EPF+ +NG +T T K++R +V + Y+E I+ +Y+
Sbjct  581   ELTRQVQDRPGYRTDDRITDFQFILEPFSQENGTMTQTFKIKRPQVREKYQELIDQIYE  639



>ref|WP_016876481.1| long-chain fatty acid--CoA ligase [Chlorogloeopsis fritschii]
Length=658

 Score =   457 bits (1176),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 256/661 (39%), Positives = 397/661 (60%), Gaps = 54/661 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P+IW  AA++FGN +AL DP+      L++ +L ++I  FA GL+ +G+K  ++I+L
Sbjct  32    ESLPEIWPLAAQKFGNTVALRDPHAQSEVVLTYTQLSQQIQQFAAGLQALGVKAGDRISL  91

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
              +DNS RW +ADQG+MT GA+N VR S++  EELL I  +S S  L V++ + + ++ E 
Sbjct  92    ISDNSPRWFIADQGMMTAGAVNAVRSSQAEREELLYILANSGSTTLVVEDLKTFQKLRER  151

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
                   ++ +ILL  +++   +E +    +YS+ +++++G               Q+T E
Sbjct  152   LED-LPIQLVILL-SDEAPPEAETLK---VYSFPQLMEIG--------------AQHTLE  192

Query  1685  PINS--DDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHA  1512
             P+    + +ATL+YTSGTTG PKGVML+H NLLHQ+  L   V   PGD  LS+LP WH+
Sbjct  193   PVQQTRNQLATLIYTSGTTGKPKGVMLSHGNLLHQVTTLGAIVQPQPGDMVLSILPTWHS  252

Query  1511  YERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPA  1332
             YER+AEYF+ SLGC QVYT + ++K+DLK+++P Y+I+VP + E++Y G+ KQ      +
Sbjct  253   YERSAEYFLLSLGCTQVYTNLRSIKQDLKKFKPHYIIAVPRLLESIYEGVQKQFREQPAS  312

Query  1331  RKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLA  1152
             R+ +   F  IS  Y + +R  E   L      PS+     + L A   AA L PLHLL 
Sbjct  313   RQRLINFFFGISEKYIKLRRTVEDLDLL--HLNPSF----AERLAAVMQAAALEPLHLLG  366

Query  1151  RKLVYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVACRRPN  975
              +LVY K+  + G     +  GG     H+D FFE I +++  GYGLTE++PV   RR  
Sbjct  367   ERLVYKKVKEATGGRIKQMISGGGALPKHIDDFFEIIGVEILVGYGLTETSPVTHARRYW  426

Query  974   CNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDEN  795
              N+ GS G PI  TE+K+V+ ET + L  G +G+V  KGPQ+M+GYY+NP AT +AID  
Sbjct  427   RNLRGSAGQPIPATEVKIVNPETRQPLPTGERGLVLLKGPQIMQGYYQNPEATAKAIDPE  486

Query  794   GWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLI  615
             GW ++GDLGW+ P +           ++L GRAKDTIVL++GEN+EP  IE+A + S  I
Sbjct  487   GWFDSGDLGWVTPQND----------LILTGRAKDTIVLTNGENIEPQPIEDACVRSPYI  536

Query  614   QQIVVIGQDKRRLGALVLPHKE-----------EVLLAAKKLSVVDSDATEVSEEKTSKL  468
              QI+++GQD++ LGAL++P+ E           ++ +  K ++   S    +  +    L
Sbjct  537   DQIMLVGQDQKSLGALIVPNLEALEKWAESQNLQLCIEDKIVTSGTSQTINLESKIIQDL  596

Query  467   IHEELQKWTTGCTF-----QIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDL  303
               +EL +            +IGP  LI EPF+++NG++T  + ++R  V + Y++ I  +
Sbjct  597   FRQELNREVQNRPGYRPDDRIGPFKLILEPFSVENGMMTQKLSIKRHVVMEHYRDIINGM  656

Query  302   Y  300
             +
Sbjct  657   F  657



>ref|WP_006195846.1| long-chain fatty acid--CoA ligase [Nodularia spumigena]
 gb|EAW45859.1| hypothetical protein N9414_18935 [Nodularia spumigena CCY9414]
 gb|AHJ26720.1| Long-chain-fatty-acid--CoA ligase [Nodularia spumigena CCY9414]
Length=658

 Score =   457 bits (1175),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 257/658 (39%), Positives = 393/658 (60%), Gaps = 53/658 (8%)
 Frame = -3

Query  2219  VPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFA  2040
             +P+IW  A + FG+ +AL +P   P   +++ +L  +I  FA GL+  G++  ++I+L A
Sbjct  34    LPEIWPLAGKRFGDTVALHNPNAKPEVIITYAQLADKIQQFAAGLQASGVQAGDRISLIA  93

Query  2039  DNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFH  1860
             DNS RW +ADQG+MT GA+N VR S++  EELL I  +S S AL V +     ++ E  +
Sbjct  94    DNSPRWFIADQGMMTAGAVNAVRSSQAEREELLFIIANSGSTALVVQDLNTLDKLRERLN  153

Query  1859  SHADVRFIILLWGEKS--SITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
                 ++ IILL  E      T +V++      +++++++G            A H     
Sbjct  154   D-LPIQLIILLSDETPPPEATPKVLN------FSQLLEIG------------ANHTLMRV  194

Query  1685  PINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYE  1506
                 D +ATL+YTSGTTG PKGVML+H NLLHQ+  L   V   PGD  LS+LP WH+YE
Sbjct  195   LPKGDSLATLIYTSGTTGKPKGVMLSHNNLLHQVKTLGTVVQPQPGDVILSILPSWHSYE  254

Query  1505  RAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARK  1326
             R+ EYF+ S GC QVYT + ++K+DLK+++P Y+I+VP ++E+++ G+LKQ       ++
Sbjct  255   RSGEYFLLSQGCTQVYTNLRSVKQDLKKFKPHYMIAVPRLWESIHEGVLKQFREQPANKQ  314

Query  1325  LIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARK  1146
              +    L +S  Y + +RI +G  L           S L+   ++ +A +L P H L  +
Sbjct  315   RLINFLLGMSETYIQKQRIAQGLSLNH------LHASSLEKFASKIVALVLLPFHALGER  368

Query  1145  LVYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
             LVY+K+  ++G     +  GG     H+D FFE I +++  GYGLTE++PV   RRP  N
Sbjct  369   LVYAKVREAVGGRMKHVITGGGALPRHIDTFFEIISVEILQGYGLTETSPVTNARRPWHN  428

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             V GS G PI  TE+K+VD ET   L  G +G+V  KGPQ+M+GYY+NP AT + ID  GW
Sbjct  429   VRGSSGQPIAGTEVKIVDPETKVPLPLGERGLVLLKGPQIMQGYYQNPEATAKVIDAEGW  488

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              N+GDLGW+ P +           +VL GRAKDTIVL++GEN+EP  IE+A + S  + Q
Sbjct  489   FNSGDLGWVTPEND----------LVLTGRAKDTIVLTNGENIEPQPIEDACLRSPYVDQ  538

Query  608   IVVIGQDKRRLGALVLPHKEEVLLAAK----KLSVVDSDATEVSE--EKTSKLIH----E  459
             I+++GQD+R +GAL++P+ E +   A     +L ++  ++ E+S   +  SK+I     +
Sbjct  539   IMLVGQDQRSIGALIVPNTEALKTWASSQNLQLPLLQENSPEISTSIDLESKMIQDLFRQ  598

Query  458   ELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             EL +            ++GP  LI EPF+++NGL+T T+K+RR  V + Y++ I+ +Y
Sbjct  599   ELNREVQNRPGYRADDRVGPFRLILEPFSMENGLMTQTLKIRRHVVAERYRDIIDGMY  656



>ref|WP_028085498.1| long-chain fatty acid--CoA ligase [Dolichospermum circinale]
Length=657

 Score =   456 bits (1174),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 244/655 (37%), Positives = 390/655 (60%), Gaps = 48/655 (7%)
 Frame = -3

Query  2219  VPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPD-------  2061
             +P+IW  AA+ FG+ IAL +P+  P   +++ +L ++I  FA GL+ +G+  +       
Sbjct  34    LPEIWPLAAKRFGDIIALYNPHSQPEVKITYSQLTEQINQFAAGLQALGVNTNNSENLPY  93

Query  2060  -EKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMY  1884
              ++++L ADNS RW +ADQGIMT GA+N VR S++  EELL I +HS S +L V++    
Sbjct  94    GDRVSLIADNSPRWFIADQGIMTAGAVNAVRSSQAEREELLYIISHSGSTSLVVEDIRTL  153

Query  1883  SRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEAR  1704
             +++ E  +  A ++ +++L  E      +     P+ ++ +++++G              
Sbjct  154   NKLGERLNELA-IKLVVILSDETPPAELKF----PVVNFTQLLEIGRN------------  196

Query  1703  HQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLP  1524
             H+      +++ +ATL+YTSGTTG PKGVML+H NLLHQ+  L   V    GD  LS+LP
Sbjct  197   HKLVTNKYSAETLATLIYTSGTTGKPKGVMLSHRNLLHQVATLGTIVQPQKGDTVLSILP  256

Query  1523  PWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINT  1344
              WH+YER+ EYF+ S GC Q+YT + ++K DLK+++P Y+I+VP ++E++Y G+ KQ   
Sbjct  257   TWHSYERSGEYFLLSQGCSQIYTNLRSVKGDLKKFKPNYMIAVPRLWESIYEGVQKQFRE  316

Query  1343  SSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPL  1164
                 ++ +    L+IS  Y E++RI +G  L            +++   A+ +   L  +
Sbjct  317   QPAKKQKLVKFLLEISQKYIESRRISQGLSLNHIN------AGIIERFQAKIVELALLAI  370

Query  1163  HLLARKLVYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVAC  987
             H+L  KLVY K+  + G     +  GG     H+D FFE + +++  GYGLTE++PV   
Sbjct  371   HILGEKLVYHKVREATGGKIKHVISGGGALPKHIDNFFEIVGVEILQGYGLTETSPVTNA  430

Query  986   RRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQA  807
             RRP  N+ GS G PI  T++K+V+ ET + L  G +G+V  KGPQ+M+GYY+NP AT +A
Sbjct  431   RRPWRNLRGSSGQPIAGTKVKIVNPETRQPLPAGERGLVLLKGPQIMQGYYQNPQATNKA  490

Query  806   IDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMG  627
             ID  GW ++GDLGW+ P +           +VL GRAKDTIVLS+GEN+EP  IE+A + 
Sbjct  491   IDPQGWFDSGDLGWVTPQND----------LVLTGRAKDTIVLSNGENIEPQPIEDACLR  540

Query  626   SNLIQQIVVIGQDKRRLGALVLPHKEEVL-LAAKKLSVVDSDATEVSEEKTSKLIHEELQ  450
             S  I QI+++GQD++ +GA+++P+ E +   A  +  + DS   ++       L  +EL 
Sbjct  541   SPYIDQIMLVGQDQKSIGAIIVPNLEALAKWAETQHQINDSQKIDLESRIVQDLFRQELN  600

Query  449   KWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             +            +IGP  LI+E F+I+NG++T T+K+RR  V + Y + I  ++
Sbjct  601   REVQNRPGYRTDDRIGPFKLISEQFSIENGMMTQTLKIRRHIVMERYCDIINGMF  655



>ref|WP_039755787.1| long-chain fatty acid--CoA ligase [Synechococcus sp. UTEX 2973]
 gb|AJD58528.1| long-chain fatty acid--CoA ligase [Synechococcus sp. UTEX 2973]
Length=649

 Score =   456 bits (1172),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 261/656 (40%), Positives = 391/656 (60%), Gaps = 52/656 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDE----  2058
             +++  IW  AA +FG+  ALV P+  P   LS++EL  +I +FA GL  +G+        
Sbjct  30    QSLSQIWGRAASQFGSMPALVAPHAKPAITLSYQELAIQIQAFAAGLLALGVPTSTADDF  89

Query  2057  --KIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMY  1884
               ++A FADNS RWL+ADQG +  GA N VRG+++ V ELL +   S S+ L V++  + 
Sbjct  90    PPRLAQFADNSPRWLIADQGTLLAGAANAVRGAQAEVSELLYVLEDSGSIGLIVEDAALL  149

Query  1883  SRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEAR  1704
              ++     S + ++F+I+L  E   I     D   +  +++++++G             R
Sbjct  150   KKLQPGLASLS-LQFVIVLSDEVVEI-----DSLRVVGFSDVLEMG-------------R  190

Query  1703  HQYTYEPI-NSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSML  1527
                  EPI   D +ATL+YTSGTTG PKGVML+H NLLHQ+  L   V   PGD  LS+L
Sbjct  191   SLPAPEPILQLDRLATLIYTSGTTGRPKGVMLSHGNLLHQVTTLGVVVQPQPGDTVLSIL  250

Query  1526  PPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQIN  1347
             P WH+YERA EYF+ S GC QVYTT+ N+K+D+++Y+PQ+++SVP ++E++Y G+ KQ  
Sbjct  251   PTWHSYERACEYFLLSQGCTQVYTTLRNVKQDIRQYRPQFMVSVPRLWESIYEGVQKQFR  310

Query  1346  TSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCP  1167
                  ++ +   F  +S  Y  A+R ++G  L    + P+  ++       R +A  L P
Sbjct  311   EQPAKKRRLIDTFFGLSQRYVLARRRWQGLDLLALNQSPAQRLAE----GVRMLA--LAP  364

Query  1166  LHLLARKLVYskihssigiskagisgggslssH-VDKFFEAIDIKLQNGYGLTESAPVVA  990
             LH L  +LVY K+  + G     +  GG   +  +D FFE + + L  GYGLTE++PV+ 
Sbjct  365   LHKLGDRLVYGKVREATGGRIRQVISGGGSLALHLDTFFEIVGVDLLVGYGLTETSPVLT  424

Query  989   CRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQ  810
              RRP  N+ GS G PI  T I++VD ET +    G +G+V AKGPQ+M+GY+  P AT +
Sbjct  425   GRRPWHNLRGSAGQPIPGTAIRIVDPETKENRPSGDRGLVLAKGPQIMQGYFNKPEATAK  484

Query  809   AIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAM  630
             AID  GW +TGDLG+IV            G +VL GRAKDTIVL++GEN+EP  IE+A +
Sbjct  485   AIDAEGWFDTGDLGYIV----------GEGNLVLTGRAKDTIVLTNGENIEPQPIEDACL  534

Query  629   GSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQ  450
              S+ I QI+++GQD++ LGAL++P++E + L A +  +  +D   V +    KLI EEL 
Sbjct  535   RSSYISQIMLVGQDRKSLGALIVPNQEAIALWASEQGISQTDLQGVVQ----KLIREELN  590

Query  449   KWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             +            +IGP  LI EPF+++NG LT T+K+RR+ V + Y   I+ +++
Sbjct  591   REVRDRPGYRIDDRIGPFRLIEEPFSMENGQLTQTLKIRRNVVAEHYAAMIDGMFE  646



>ref|WP_017745833.1| long-chain fatty acid--CoA ligase [Scytonema hofmanni]
Length=662

 Score =   456 bits (1173),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 261/663 (39%), Positives = 395/663 (60%), Gaps = 54/663 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P+IW  AA++FGN +AL +P+  P   +++ +L ++I  FA GL+ +G+K  ++I+L
Sbjct  32    ESIPEIWTLAAKQFGNTVALHNPHSQPEEVITYTQLSQQIQQFAAGLQALGVKEGDRISL  91

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
              ADN  RWL+ADQGIM  GA+N VR +++  EELL I  +S S AL V++ +  +R+ E 
Sbjct  92    IADNCPRWLIADQGIMAAGAVNAVRSAQAEREELLYIIANSGSTALVVEDLKTLNRLQER  151

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
                   ++ I+LL  E S   +  ++   + ++++++++G            A+H     
Sbjct  152   L-LELPIQLIVLL-TEDSPPENTNLN---VLNFSQLMEIG------------AKHTLIPT  194

Query  1685  PINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYE  1506
                   +ATL+YTSGTTG PKGVMLTH NLLHQ+L L   V   PG+  LS+LP WH+YE
Sbjct  195   KQTRGTLATLIYTSGTTGKPKGVMLTHGNLLHQVLVLRSVVQPQPGETVLSILPTWHSYE  254

Query  1505  RAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARK  1326
             R+ EYF+ S GC QVYT + ++K DLK++QPQ+++ VP ++E++Y G  KQ       ++
Sbjct  255   RSGEYFLLSQGCTQVYTNLKSVKRDLKKFQPQFMVGVPRLWESIYEGAQKQFREQPENKQ  314

Query  1325  LIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARK  1146
              +   F  IS  + +A+RI +G  L  +   P    SV + L A A A+ L PLH L  +
Sbjct  315   RLINFFFGISEKFIKARRIAQG--LDLENLNP----SVFEQLAASAQASTLFPLHALGER  368

Query  1145  LVYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
             +VYSK+  + G     +  GG     H+D FFE I +++  GYGLTE+APV   RRP  N
Sbjct  369   IVYSKVREATGGKIKQMISGGGALPKHIDDFFEIIGVEILVGYGLTETAPVTHARRPWRN  428

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             + GS G  I  TE K+VD+ET K L  G +G+V  +GPQVM+GYY+NP AT +AID  GW
Sbjct  429   LRGSSGQAIPGTETKIVDSETRKPLPTGERGLVLLRGPQVMEGYYQNPEATAKAIDAEGW  488

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              ++GDLGW+ P +           +VL GRAKDTIVL++GEN+EP  IE+A + S  I Q
Sbjct  489   FDSGDLGWVTPQND----------LVLTGRAKDTIVLTNGENIEPQPIEDACLRSPYIDQ  538

Query  608   IVVIGQDKRRLGALVLPHKEEVL---------------LAAKKLSVVDSDATEVSEEKTS  474
             I+++GQD+R LGAL++P+ E +                +  K LS   +   ++  +   
Sbjct  539   IMLVGQDQRSLGALIVPNLEALQKWAISKNLHLRLPGEVTEKTLSNTVATEVDLESKMIQ  598

Query  473   KLIHEELQKWTTGCTF-----QIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIE  309
              L  +EL +            +IG   LI EPF+I+NG++T T+K +R  V + Y++ I 
Sbjct  599   DLFRQELNREVQNRPGYRPDDRIGLFKLILEPFSIENGMMTQTLKTKRHIVMEHYRDIIN  658

Query  308   DLY  300
              ++
Sbjct  659   GMF  661



>ref|WP_024546827.1| long-chain fatty acid--CoA ligase [Synechococcus sp. NKBG15041c]
Length=638

 Score =   455 bits (1170),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 267/665 (40%), Positives = 398/665 (60%), Gaps = 61/665 (9%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++ +IW  AA+++G+ +AL +P+  P   L++++L ++I  F  GL+ +GL+P+EK+AL
Sbjct  11    QSLSEIWAIAADQYGDIVALYNPHSEPEFKLTYRQLWQDIQRFGAGLQALGLQPEEKVAL  70

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
              ADNS RW +ADQG +  GA+N VR S++  +ELL IY+ SES  L V++ + + R++  
Sbjct  71    IADNSPRWFIADQGSIAAGAVNAVRSSQAEKQELLYIYSDSESRFLIVEDRQTFERLSPE  130

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
                    R +I L  E    T       PI+++++++ LG++  + +             
Sbjct  131   IID-LQPRAVIFLTDEAVPDTE-----LPIFNFSQLMALGSQEELKMPER----------  174

Query  1685  PINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYE  1506
               +S D+ TL+YTSGTTG PKGVML+H N+L+Q+ NL   +   PGD  LS+LP WH+YE
Sbjct  175   --SSQDLMTLIYTSGTTGKPKGVMLSHGNVLYQVRNLDQVIQPNPGDVTLSILPTWHSYE  232

Query  1505  RAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARK  1326
             RAAEYF+ S GC Q+YT + N+K+DL+ Y+P Y+++VP ++E++Y G+ K +      ++
Sbjct  233   RAAEYFLLSQGCTQIYTNIRNIKKDLQTYKPGYMVAVPRIWESIYEGVQKNLREQPAKKQ  292

Query  1325  LIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARK  1146
              +   FL  S  Y  A+RI + + L        + VS L     +  A  L PLH L  K
Sbjct  293   KLVNFFLTCSQNYVLAQRIAQNRSLEH------FSVSPLSRAVNKVKAIALAPLHALGNK  346

Query  1145  LVYskihssi-giskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
             LVY KI S+  G  +  ISGGGSL+ H+D FFE + I +  GYGLTE++PV   RRP  N
Sbjct  347   LVYQKIRSATGGKIRYVISGGGSLAQHIDTFFEIVGINILVGYGLTETSPVTNARRPEQN  406

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             V GS GP ++ TEI++VD ET + L  G KG+V  +GPQVM+GYY+ P AT +AID  GW
Sbjct  407   VRGSAGPALKGTEIRIVDLETRQPLPQGQKGLVLIRGPQVMQGYYRKPEATAKAIDPEGW  466

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              ++GDLGWI P           G +VL GRAKDTIVL++GEN+EP  IE+A + S  I Q
Sbjct  467   FDSGDLGWITP----------LGDLVLTGRAKDTIVLTNGENIEPQPIEDACVRSPYIDQ  516

Query  608   IVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSD----------------ATEVSEEKT  477
             I+++GQD++ LGAL++P+     L   +  V +S+                 T++  +  
Sbjct  517   IMLVGQDEKSLGALIVPN-----LDVLQQWVTESNLGLQLPGPGTPQETLPQTDLYSKPV  571

Query  476   SKLIHEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQI  312
               L  +EL +            +I    LI EPF+I+NGL+T T+KV+R  VT+ Y   I
Sbjct  572   LNLFKQELNREIQNRPGYRPDDRITDFALILEPFSIENGLMTQTLKVKRLVVTEKYASLI  631

Query  311   EDLYK  297
               LY+
Sbjct  632   SSLYR  636



>ref|WP_011242936.1| long-chain fatty acid--CoA ligase [Synechococcus elongatus]
 ref|YP_171334.1| long-chain-fatty-acid CoA ligase [Synechococcus elongatus PCC 
6301]
 dbj|BAD78814.1| long-chain-fatty-acid CoA ligase [Synechococcus elongatus PCC 
6301]
Length=649

 Score =   453 bits (1166),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 260/656 (40%), Positives = 390/656 (59%), Gaps = 52/656 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDE----  2058
             +++  IW  AA +FG+  ALV P+  P   LS++EL  +I +FA GL  +G+        
Sbjct  30    QSLSQIWGRAASQFGSMPALVAPHAKPAITLSYQELAIQIQAFAAGLLALGVPTSTADDF  89

Query  2057  --KIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMY  1884
               ++A FADNS RWL+ADQG +  GA N VRG+++ V ELL +   S S+ L V++  + 
Sbjct  90    PPRLAQFADNSPRWLIADQGTLLAGAANAVRGAQAEVSELLYVLEDSGSIGLIVEDAALL  149

Query  1883  SRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEAR  1704
              ++     S + ++F+I+L  E   I     D   +  +++++++G             R
Sbjct  150   KKLQPGLASLS-LQFVIVLSDEVVEI-----DSLRVVGFSDVLEMG-------------R  190

Query  1703  HQYTYEPI-NSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSML  1527
                  EPI   D +ATL+YTSGTTG PKGVML+H NLLHQ+  L   V   PGD  LS+L
Sbjct  191   SLPAPEPILQLDRLATLIYTSGTTGRPKGVMLSHGNLLHQVTTLGVVVQPQPGDTVLSIL  250

Query  1526  PPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQIN  1347
             P WH+YERA EYF+ S GC QVYTT+ N+K+D+++Y+PQ+++SVP ++E++Y G+ KQ  
Sbjct  251   PTWHSYERACEYFLLSQGCTQVYTTLRNVKQDIRQYRPQFMVSVPRLWESIYEGVQKQFR  310

Query  1346  TSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCP  1167
                  ++ +   F  +S  Y  A+R ++G  L    + P+  ++       R +A  L P
Sbjct  311   EQPAKKRRLIDTFFGLSQRYVLARRRWQGLDLLALNQSPAQRLAE----GVRMLA--LAP  364

Query  1166  LHLLARKLVYskihssigiskagisgggslssH-VDKFFEAIDIKLQNGYGLTESAPVVA  990
             LH L  +LVY K+  + G     +  GG   +  +D FFE + + L  GYGLTE++PV+ 
Sbjct  365   LHKLGDRLVYGKVREATGGRIRQVISGGGSLALHLDTFFEIVGVDLLVGYGLTETSPVLT  424

Query  989   CRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQ  810
              RRP  N+ GS G PI  T I++VD ET +    G +G+V AKGPQ+M+GY+  P AT +
Sbjct  425   GRRPWHNLRGSAGQPIPGTAIRIVDPETKENRPSGDRGLVLAKGPQIMQGYFNKPEATAK  484

Query  809   AIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAM  630
             AID  GW +TGDLG+IV            G +VL GRAKDTIVL++GEN+EP  IE+A +
Sbjct  485   AIDAEGWFDTGDLGYIV----------GEGNLVLTGRAKDTIVLTNGENIEPQPIEDACL  534

Query  629   GSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQ  450
              S+ I QI+++GQD++ LGAL++P++E + L A +  +  +D   V +    KLI EEL 
Sbjct  535   RSSYISQIMLVGQDRKSLGALIVPNQEAIALWASEQGISQTDLQGVVQ----KLIREELN  590

Query  449   KWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             +            +IGP  LI EPF+++NG LT T+K+R + V + Y   I+ +++
Sbjct  591   REVRDRPGYRIDDRIGPFRLIEEPFSMENGQLTQTLKIRSNVVAEHYAAMIDGMFE  646



>ref|WP_027403759.1| long-chain fatty acid--CoA ligase [Aphanizomenon flos-aquae]
Length=654

 Score =   453 bits (1166),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 254/655 (39%), Positives = 392/655 (60%), Gaps = 51/655 (8%)
 Frame = -3

Query  2219  VPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKP--------  2064
             +P+IW  AA++F N IAL +P+  P   +++ +L ++I  FA GL+ +G+          
Sbjct  34    LPEIWTLAAKKFDNIIALHNPHSKPEVKITYGQLSEQIQLFAAGLQALGINTHHSETLPY  93

Query  2063  DEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMY  1884
              E+I+L ADNS RW +ADQGIMT GA+N VR +++  EELL I +HS S AL V++ +  
Sbjct  94    GERISLIADNSPRWFIADQGIMTAGAVNAVRSAQADPEELLYIISHSGSTALVVEDIKTL  153

Query  1883  SRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLG-NESHMALLHSQEA  1707
             +++         ++ ++LL  E    T       P+ ++  ++++G N + +A  H+ E 
Sbjct  154   NKLGSGL-DELPIKLVVLLSDE----TPPTEFNFPVVNFTRLLEIGSNNTIVATKHTGET  208

Query  1706  RHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSML  1527
                          +ATL+YTSGTTG PKGVML+H+NLLHQ+ +L   V    GD  LS+L
Sbjct  209   -------------LATLIYTSGTTGKPKGVMLSHKNLLHQVKSLRAVVQPEKGDIVLSIL  255

Query  1526  PPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQIN  1347
             P WH+YER+ EYF+ S GC Q+YT + ++K DLK+++P Y+I+VP ++E++Y G+ KQ  
Sbjct  256   PTWHSYERSGEYFLLSQGCTQIYTNLRSVKNDLKKFKPNYMIAVPRLWESIYEGVQKQFR  315

Query  1346  TSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCP  1167
                  ++ +    L +S  Y EA+RI +G  L           S+++   A+    +L P
Sbjct  316   EQPAKKQSLVKFLLDMSQKYVEARRISQGLSLNHIH------TSLVERSQAKIAELVLLP  369

Query  1166  LHLLARKLVYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVA  990
             LH+L  KLVY+K+  + G     +  GG    +++D FFE + +++  GYGLTE++PV  
Sbjct  370   LHILGEKLVYAKVREATGGKIKHVISGGGALPAYIDNFFEIVGVEILQGYGLTETSPVTN  429

Query  989   CRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQ  810
              RRP  N+ GS G PI  TE+K+V+ ET + L  G +G+V  KGPQ+M+GYY+NP AT +
Sbjct  430   ARRPWRNLRGSSGQPIPGTEVKIVNPETRQPLPVGERGLVLLKGPQIMQGYYQNPEATNK  489

Query  809   AIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAM  630
             AID  GW ++GDLGW+ P +           +VL GRAKDTIVL++GEN+EP  IE+A +
Sbjct  490   AIDAEGWFDSGDLGWVTPEND----------LVLTGRAKDTIVLTNGENIEPQPIEDACL  539

Query  629   GSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQ  450
              S  I QI+++GQD+R +GAL++P+ E   LAA   S   ++  ++       L  +EL 
Sbjct  540   RSPYIDQIMLVGQDQRSIGALIVPNLEA--LAAWNQSQNHTEKIDLESRIVQDLFRQELN  597

Query  449   KWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             +            +IG   LI E F+I+NGL+T T+K+RR  V + Y + I+ ++
Sbjct  598   REVQNRPSYRADDRIGAFKLIEEQFSIENGLMTQTLKIRRHVVMERYCDIIDKMF  652



>ref|WP_015112569.1| long-chain-fatty-acid--CoA ligase [Nostoc sp. PCC 7107]
 ref|YP_007049498.1| long-chain-fatty-acid--CoA ligase [Nostoc sp. PCC 7107]
 gb|AFY42348.1| Long-chain-fatty-acid--CoA ligase [Nostoc sp. PCC 7107]
Length=656

 Score =   453 bits (1166),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 256/653 (39%), Positives = 387/653 (59%), Gaps = 48/653 (7%)
 Frame = -3

Query  2213  DIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADN  2034
             +IW  AA+ FGN +AL +P+  P T +++ +L ++I  FA GL+ + ++  ++I+L ADN
Sbjct  36    EIWPLAAKHFGNIVALRNPHSKPETAITYIQLAEQIQQFAAGLQGLEVQVGDRISLIADN  95

Query  2033  SCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSH  1854
             S RW +ADQGI+T G ++ VR S++  EELL I  +S S  L V++ +  +R+ +     
Sbjct  96    SPRWFIADQGIITAGGVDAVRSSQAEKEELLFIIANSGSTVLVVEDLKTLNRLRDRL-CD  154

Query  1853  ADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINS  1674
               +R +ILL  E    T    D   I +++++ + G            A+H       N 
Sbjct  155   LPIRVVILLSDE----TPPTDDHLKILNFSQLQEFG------------AKHTLVRVQQNP  198

Query  1673  DDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAE  1494
             D +ATL+YTSGTTG PKGVML+H NL+HQ+ +L   V   PGD  LS+LP WH+YER+ E
Sbjct  199   DSLATLIYTSGTTGKPKGVMLSHSNLMHQVRSLRAIVQPEPGDIVLSILPSWHSYERSGE  258

Query  1493  YFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIAL  1314
             YF+ S GC Q+YT + ++K DLK ++P ++I+VP ++E++Y G+ KQ      +++ +  
Sbjct  259   YFLLSQGCSQIYTNLRSVKRDLKEFKPNFMIAVPRLWESIYEGVQKQFREQPASKQRLIN  318

Query  1313  LFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYs  1134
               + +S  Y +A+RI +G CL           S ++ + A+  A  L PLH+L  K+VY+
Sbjct  319   FLVGMSEKYIKAQRIAQGLCLEHVN------ASAIERIGAKIQALALLPLHILGEKIVYA  372

Query  1133  kihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGS  957
             K+  + G     +  GG     H+D FFE I + +  GYGLTE++PV   RRP  N  GS
Sbjct  373   KVREATGGRIKHVISGGGALPRHIDNFFEIIGVDILQGYGLTETSPVTNARRPWRNFRGS  432

Query  956   IGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTG  777
              G PI  TE+K+VD E  + L+ G +G+V  KGPQ+M+GYY+NP AT +AID  GW ++G
Sbjct  433   SGQPIPGTEVKIVDPENRQPLAKGQRGLVLLKGPQIMQGYYQNPEATAKAIDAEGWFDSG  492

Query  776   DLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVI  597
             DLGW+ P +           +VL GRAKDTIVL++GEN+EP  IE+A + S  I QI+++
Sbjct  493   DLGWVTPEND----------LVLTGRAKDTIVLTNGENIEPQPIEDACLRSPYIDQIMLV  542

Query  596   GQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTS---------KLIHEELQKW  444
             GQD+R +GAL++P+ E +   A   +V      + SE  TS          L  +EL + 
Sbjct  543   GQDQRSIGALIVPNLEALEKWADSQNVQLRLPEQNSELSTSVDLESKIIQDLFRQELNRE  602

Query  443   TTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
                        +IGP  LI EPF+I+NGL+T T+K+RR  V + Y + I  ++
Sbjct  603   VQNRPGYRLDDRIGPFRLILEPFSIENGLMTQTLKIRRHVVAERYGDLINKMF  655



>ref|WP_039726338.1| long-chain fatty acid--CoA ligase [Lyngbya confervoides]
 gb|KIF14565.1| long-chain fatty acid--CoA ligase [Aphanocapsa montana BDHKU210001]
 gb|KIF39491.1| long-chain fatty acid--CoA ligase [Lyngbya confervoides BDU141951]
Length=657

 Score =   453 bits (1165),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 254/663 (38%), Positives = 396/663 (60%), Gaps = 57/663 (9%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P+IW  AAE +G+ +A+ DP++ P   L+++EL  +I  FA GL+ +G+     +AL
Sbjct  30    QSLPEIWPIAAERYGSQLAMDDPHNQPSAQLTYQELWSKIQQFAAGLQGLGMPSRAHVAL  89

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             FADNS RW +ADQG+M  G I+ VR +++  EEL  I  HS+S  L V+N +++ R+++ 
Sbjct  90    FADNSHRWFIADQGVMAAGGIDAVRSAQAETEELRYIAEHSDSTVLIVENLKLWRRLSDR  149

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIY---SYNEIIDLGNESHMALLHSQEARHQY  1695
             F     ++F +LL       + E +   P +   +Y++++D+G++            H +
Sbjct  150   FQD-LPMQFAVLL-------SDETVPEHPPFKMVNYSQLLDIGSQ------------HPW  189

Query  1694  TYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWH  1515
                PI +D +ATL+YTSGTTG PKGVM++H NLLHQI  L   V   PGDR L +LP WH
Sbjct  190   QPVPIEADSLATLIYTSGTTGKPKGVMISHANLLHQITTLSAVVQPQPGDRVLGLLPTWH  249

Query  1514  AYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSP  1335
              + R AEYF+++ GC Q YT++ ++K D +  +PQY++ VP ++E++Y G  K       
Sbjct  250   TFGRTAEYFLYANGCTQTYTSIRHIKADFRNSKPQYMVGVPRIWESIYEGAQKNFRDQPA  309

Query  1334  ARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLL  1155
             +++ +    L  S  Y + +R   G  L          VS +    +R +  L  PLH+L
Sbjct  310   SKQKLVNTLLWCSKKYVQNRRTANGLSLDHPH------VSSIQRFKSRLLQGLAWPLHML  363

Query  1154  ARKLVYskihssigiskagi-sgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRP  978
               KLVYSK+  + G     + SGGGSL+ H+D FFE +D+ +  GYGLTE++PVV+ RR 
Sbjct  364   GEKLVYSKVRDATGGQVKQLISGGGSLAQHIDLFFEIVDVTILVGYGLTETSPVVSARRI  423

Query  977   NCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDE  798
               N+ G+ G PI  TE K+VD ET   L    KG+V  +GPQ+M+GYYKNP AT++AID 
Sbjct  424   WANLRGASGQPIPGTEFKIVDPETKAPLPLAQKGLVLVRGPQIMQGYYKNPEATQKAIDA  483

Query  797   NGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNL  618
              GW +TGDLG++  +++          IVL GRAKDTIVL++GEN+EP  IE+  + S  
Sbjct  484   EGWFDTGDLGYLTADYN----------IVLTGRAKDTIVLTNGENIEPQPIEDVCVQSPY  533

Query  617   IQQIVVIGQDKRRLGALVLPHKEEV-LLAAKKLSVVDSDATE-----------VSEEKTS  474
             I Q++++GQD+R LGAL++P+ + +   AA +   +D+   E           + +++  
Sbjct  534   IDQMMLVGQDQRSLGALIVPNLDALQTWAATQSLYLDAPGQETENSANLPSVTLDDDRVQ  593

Query  473   KLIHEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIE  309
             KL  EEL +            ++GP  LI  PF+I++G +T T+K++R  VT  Y++ I+
Sbjct  594   KLFREELNRRVKDRPGYRPDDRVGPFRLIATPFSIEDGTMTQTLKIKRPVVTARYRDMID  653

Query  308   DLY  300
              ++
Sbjct  654   GMF  656



>ref|WP_006099666.1| long-chain fatty acid--CoA ligase [Coleofasciculus chthonoplastes]
 gb|EDX76708.1| AMP-binding enzyme, putative [Coleofasciculus chthonoplastes 
PCC 7420]
Length=672

 Score =   454 bits (1167),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 272/678 (40%), Positives = 399/678 (59%), Gaps = 74/678 (11%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKP------  2064
             +++P+IW  AA+ FG  IAL DP+  P    ++ +L ++I   A GL+ +   P      
Sbjct  32    QSLPEIWSIAAQRFGQIIALRDPHVQPEVIFTYTQLVRQIQQLAAGLQTLFDNPVIKQEQ  91

Query  2063  -----DEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVD  1899
                    ++AL ADNS RWL+ADQGIMT GA NVVR +++  EEL  I  HS S+AL V+
Sbjct  92    ESSDLPPRVALIADNSPRWLIADQGIMTAGAANVVRSAQADPEELRYILEHSGSIALVVE  151

Query  1898  NPEMYSRIAETFHSHAD---VRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMA  1728
             + +  +++      H D   ++F+ILL  E+        D   ++++++++ +G+++   
Sbjct  152   DTKTLTKL----KPHLDELPIQFVILLSDEEPP----AEDKLKVFNFSQVMSMGSKA---  200

Query  1727  LLHSQEARHQYTYEPINS--DDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVV  1554
                        T +PI +    +ATL+YTSGTTG PKGVMLTH NLLHQ+      +   
Sbjct  201   -----------TLQPIQATRQTLATLMYTSGTTGKPKGVMLTHGNLLHQVTTFGIVLQPK  249

Query  1553  PGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETL  1374
              GDR LS+LP WH YER  EYF+ S GC Q+YTT+ ++K DLK ++P Y+I VP ++E++
Sbjct  250   GGDRILSILPTWHVYERTVEYFLLSQGCTQIYTTIRHVKADLKAFKPIYMIGVPRLWESI  309

Query  1373  YSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWA  1194
             Y G+ KQ     P ++ +    L IS  Y +A+RI +G  L +    P      L+ L A
Sbjct  310   YDGVQKQFREQPPNKQKLVFTLLDISQRYIKARRIAQGLDLNQLNPSP------LERLSA  363

Query  1193  RAIAALLCPLHLLARKLVYskihssi-giskagisgggslssHVDKFFEAIDIKLQNGYG  1017
                A LL P H LA KL+Y  +  +  G  K  ISGGGSL+ H++ FFE   I++  GYG
Sbjct  364   SIQALLLLPAHKLADKLIYQTVREATGGQIKTIISGGGSLAMHLENFFEIAGIEILVGYG  423

Query  1016  LTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGY  837
             LTE++PV   RR   N+  S G P+  T+I++VD ET K L  G +G+V  KGPQVM+GY
Sbjct  424   LTETSPVTNVRRMERNLRRSSGLPMPGTQIRIVDPETRKPLPIGEQGLVLVKGPQVMQGY  483

Query  836   YKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVE  657
             YKNP AT +AID +GW +TGDLGW+ PNH           +VL GRAKDTIVL++GEN+E
Sbjct  484   YKNPEATAKAIDSDGWFDTGDLGWVTPNHD----------LVLTGRAKDTIVLTNGENIE  533

Query  656   PSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAK----KLSVVDSDATEVS  489
             P  IE+A + S  I QI+++GQD+R LGAL++P+ + +   A      L++ +SD  + S
Sbjct  534   PQPIEDACLRSPYIDQIMLVGQDQRSLGALIVPNLDALQQWAAAENITLNLPNSDTQKDS  593

Query  488   E----------EKTSKLIHEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMK  354
             E          ++   L  +EL +            +IG   LI +PF+I+NG++T T+K
Sbjct  594   ESFRTGIDLKSKEVQNLFRQELNREVKNRPGYRPDDRIGQFALILDPFSIENGMMTQTLK  653

Query  353   VRRDKVTDLYKEQIEDLY  300
             +RR  VT  Y++ I  ++
Sbjct  654   IRRPVVTQRYRDIINGMF  671



>ref|WP_015171245.1| AMP-dependent synthetase and ligase [Geitlerinema sp. PCC 7407]
 ref|YP_007108730.1| AMP-dependent synthetase and ligase [Geitlerinema sp. PCC 7407]
 gb|AFY65678.1| AMP-dependent synthetase and ligase [Geitlerinema sp. PCC 7407]
Length=655

 Score =   452 bits (1163),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 260/660 (39%), Positives = 400/660 (61%), Gaps = 53/660 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDE----  2058
             K VP++W   ++ FG   AL+DP+  P  +L++ +L ++I  FA GL+ + +  +     
Sbjct  30    KGVPEVWAEVSQRFGQITALIDPHAQPVVSLTYSQLSQQIGQFAAGLQALQVHAEPWESE  89

Query  2057  ----KIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPE  1890
                 ++ALFAD+S RWL+ADQG M  G  +VVR S++  +ELL I   S +  L V+N  
Sbjct  90    DLPPRVALFADDSPRWLIADQGSMMAGTADVVRSSQADRDELLFILEDSGARTLIVENVA  149

Query  1889  MYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQE  1710
                ++      +  ++ IILL    S  TSE + G P+ +++++++LG +          
Sbjct  150   TLKKLQAGL-GNLPLKQIILL----SDETSEAIAGVPVANFSQVMELGRDR---------  195

Query  1709  ARHQYTYEPIN--SDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFL  1536
                  + EPI    D +ATL+YTSGTTG PKGVMLTH NLLHQI  L   V   PGDR L
Sbjct  196   -----SPEPIQWRKDVLATLIYTSGTTGKPKGVMLTHGNLLHQITTLGVVVQPKPGDRVL  250

Query  1535  SMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILK  1356
             ++LP WH++ R  EYF+ + GC Q+YT++ ++K D ++++PQ+++ VP ++E++Y G+ K
Sbjct  251   TLLPTWHSFGRVGEYFLLAQGCTQIYTSIRHVKADFRKHKPQFMVGVPRLWESIYEGVQK  310

Query  1355  QINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAAL  1176
             Q      +R+ +    L  S  Y EAKR+ +G  L+ +  QP  L   +    A   AA 
Sbjct  311   QFREQPESRQKLINTLLDFSRQYVEAKRVAQGLLLSAE--QPGGLAKAI----ASLKAAA  364

Query  1175  LCPLHLLARKLVYskihssigiska-gisgggslssHVDKFFEAIDIKLQNGYGLTESAP  999
               PLH L  +LVY K+  + G      ISGGGSL+ H++ FFE + + +  GYGLTE++P
Sbjct  365   FWPLHQLGERLVYRKVREATGGELTCVISGGGSLAMHLEMFFEIVGVDVLVGYGLTETSP  424

Query  998   VVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFA  819
             V++ RR   N+ GS G PI  T +K+VD ET + L+ G +G+V A+GPQ+M GY++NP A
Sbjct  425   VLSARRSWHNLRGSSGRPIPGTALKIVDPETRQPLAFGDRGLVLAQGPQIMGGYFRNPTA  484

Query  818   TKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEE  639
             T +AID  GW +TGDLGW+ PN+           +VL GRAKDTIVL++GEN+EP  IE+
Sbjct  485   TAKAIDPEGWFDTGDLGWMTPNYD----------LVLTGRAKDTIVLTNGENIEPQPIED  534

Query  638   AAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDS-DAT-EVSEEKTSKLI  465
             A + S  I QI+++GQD++ LGAL++P+ E +   A    +  S DA+ ++   K  +LI
Sbjct  535   ACLRSAYIDQIMLVGQDQKSLGALIVPNLEALQQWALGAGITSSPDASPDLQHPKVQELI  594

Query  464   HEELQKWTTGCTF-----QIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
              +EL +            +IGP  L+ EPF+++NG++T T+K+RR  V + Y+  I++++
Sbjct  595   RQELNREVRDRPGYRPDDRIGPFRLMAEPFSVENGMMTQTLKIRRPVVMERYQGMIDEMF  654



>ref|WP_008277348.1| long-chain fatty acid--CoA ligase [Cyanothece sp. CCY0110]
 gb|EAZ89510.1| long-chain-fatty-acid CoA ligase [Cyanothece sp. CCY0110]
Length=638

 Score =   451 bits (1161),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 264/659 (40%), Positives = 394/659 (60%), Gaps = 56/659 (8%)
 Frame = -3

Query  2213  DIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADN  2034
             D+W  AA++F + +AL DP+  P   L+F +L ++I  FA GL+ +G+ PD+KI+L ADN
Sbjct  15    DVWAIAAKKFPDILALHDPHSKPEVKLTFAQLYQQIKQFASGLQALGVTPDDKISLIADN  74

Query  2033  SCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSH  1854
             S RW +ADQG M  GA N VR +++   E+  I   S+S AL V+N +   +I  +F   
Sbjct  75    SPRWFIADQGSMLAGAANAVRSAQADKNEIAYILRDSDSNALIVENQKTLDKI-RSFCDE  133

Query  1853  ADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINS  1674
               ++ IILL  E    T +  D     +Y ++++ G            A+H       + 
Sbjct  134   IPLQLIILLSDE----TPKADDTIKTLNYTQLMEEG------------AKHSLNPITKDE  177

Query  1673  DDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAE  1494
             DD+ATL+YTSGTTG PKG ML+H NLLHQ+ NL   +   PGD+ LS+LP WHAYER+ E
Sbjct  178   DDLATLIYTSGTTGQPKGAMLSHGNLLHQVRNLNAVIQPQPGDKVLSILPSWHAYERSGE  237

Query  1493  YFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIAL  1314
             YF+ S GC  +YT + N K DLK+++P +++ VP ++++LY GI KQ    SP ++ I  
Sbjct  238   YFLLSQGCTLIYTNIRNFKTDLKKFKPHHMVGVPRLWDSLYEGIQKQFREQSPTQQKIVE  297

Query  1313  LFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYs  1134
              F  IS  +  ++RI     L        +  S ++   AR  A+LL PLH L  KLVY 
Sbjct  298   FFFNISRTFILSRRIANNMSLEH------FDASAIERSIARLKASLLAPLHSLGDKLVYK  351

Query  1133  kihssigis-kagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGS  957
             KI   +G + +  +SGGGSL+ H+D F+E I++ +  GYGLTE+APV   R  + N+ GS
Sbjct  352   KIREGLGGNFETLVSGGGSLAKHLDDFYEIINVPVLVGYGLTETAPVTNARTHSHNLRGS  411

Query  956   IGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTG  777
              G PI  TEIK+VD +T + LS G KG+V  +GPQ+M+GYYK P AT +AI+  GW ++G
Sbjct  412   SGQPIPKTEIKIVDLDTREPLSQGKKGVVLLRGPQIMQGYYKKPEATAKAINPEGWFDSG  471

Query  776   DLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVI  597
             DLGWI P +           +V+ GRAKDTIVLS+GEN+EP  IE+A + S  I Q++++
Sbjct  472   DLGWITPMND----------LVITGRAKDTIVLSNGENIEPQPIEDACIRSPYIDQMMLV  521

Query  596   GQDKRRLGALVLPH---------KEEVLLA-----AKKLSVVDSDATEVSEEKTSKLIHE  459
             GQD++ LGAL++P+          +++ L      A + ++V+SD   +  +    L  +
Sbjct  522   GQDQKALGALIVPNLDALQTWDKNQQLNLTFPPEDASREAIVNSD---LYGKPVQDLFKQ  578

Query  458   ELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             EL +            QI    LI EPF+++NG++T T+K++R  VT+ Y+  I+ +++
Sbjct  579   ELNREVKNRPGYRADDQIKAFELILEPFSVENGMMTQTLKIKRPVVTERYQGMIDGMFE  637



>ref|WP_015083357.1| AMP-dependent synthetase and ligase [Anabaena sp. 90]
 ref|YP_007000859.1| AMP-dependent synthetase and ligase [Anabaena sp. 90]
 gb|AFW96802.1| AMP-dependent synthetase and ligase [Anabaena sp. 90]
Length=654

 Score =   452 bits (1162),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 248/656 (38%), Positives = 397/656 (61%), Gaps = 49/656 (7%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPD-----  2061
             +++P+IW  AA +FGN +AL +P+  P   +++ +L  +I  FA GL+ +G+  +     
Sbjct  32    ESLPEIWTLAARKFGNIVALHNPHSKPEVKITYSQLSGQIQQFAAGLQTLGININNSDTL  91

Query  2060  ---EKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPE  1890
                E+++L ADNS RW +ADQGIMT GA+N VR +++  EELL I +HS S AL +++ +
Sbjct  92    PYGERVSLIADNSPRWFIADQGIMTAGAVNAVRSAQAEREELLYIISHSGSTALVIEDLK  151

Query  1889  MYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQE  1710
               +++ E+ +    ++ ++LL  E            P+ ++++++D+G  S+  L+ +++
Sbjct  152   TLNKLGESLN-ELPIKLVVLLSDEAPPTERNF----PVVNFSQLLDIG--SNNTLIATKQ  204

Query  1709  ARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSM  1530
             +          S+ +ATL+YTSGTTG PKGVML+H+NLLHQ+ +L   V    GD  LS+
Sbjct  205   S----------SESLATLIYTSGTTGKPKGVMLSHKNLLHQVKSLGVVVQPKKGDTVLSI  254

Query  1529  LPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQI  1350
             LP WH+YER+ EYF+ S GC Q+YT + ++K DLK+++P Y+I+VP ++E++Y G+ KQ 
Sbjct  255   LPTWHSYERSGEYFLLSQGCTQIYTNLRSVKGDLKKFKPNYMIAVPRLWESIYEGVQKQF  314

Query  1349  NTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLC  1170
                   ++ +    L+ S  Y EA+RI +G  L           S ++   A+     L 
Sbjct  315   REQPAKKQSLVKFLLETSQKYIEARRICQGLSLNHIH------ASFIERSQAKITELGLL  368

Query  1169  PLHLLARKLVYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVV  993
               H L  KLVY+K+  + G +   +  GG    +++D FFE + +++  GYGLTE++PV 
Sbjct  369   LFHALGEKLVYTKVREATGGNIKHVISGGGALPAYIDNFFEIVGVEILQGYGLTETSPVT  428

Query  992   ACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATK  813
               RRP  N+ GS G PI  TE+K+V+ ET + L  G +G+V  KGPQ+M+GYY+NP AT 
Sbjct  429   NARRPWRNLRGSSGQPIPGTEVKIVNPETRQPLPVGERGLVLLKGPQIMQGYYQNPEATT  488

Query  812   QAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAA  633
             +AID  GW ++GDLGW+ P +           +VL GRAKDTIVL++GEN+EP  IE+A 
Sbjct  489   KAIDTEGWFDSGDLGWVTPEND----------LVLTGRAKDTIVLTNGENIEPQPIEDAC  538

Query  632   MGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEEL  453
             + S  I QI+++GQD+R +GAL++P+ E +   A+  +  +S   ++  +    L  +EL
Sbjct  539   LRSPYIDQIMLVGQDQRSIGALIVPNLEALEKWAETQN--NSQKIDLESKIVQDLFRQEL  596

Query  452   QKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
              +            ++GP  LI E F+I+NGL+T T+K+RR  V   Y + I  ++
Sbjct  597   NREVQNRPSYRADDRVGPFKLIEEEFSIENGLMTQTLKIRRHVVMARYCDIINAMF  652



>ref|WP_006529031.1| AMP-forming long-chain acyl-CoA synthetase [Gloeocapsa sp. PCC 
73106]
 gb|ELR98156.1| AMP-forming long-chain acyl-CoA synthetase [Gloeocapsa sp. PCC 
73106]
Length=633

 Score =   451 bits (1159),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 261/654 (40%), Positives = 394/654 (60%), Gaps = 47/654 (7%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++  IW  AA +F + IAL DP+  P  NL++++L  +I  F  GL+V+G+   +K+AL
Sbjct  14    QSLDAIWSIAAADFQDQIALRDPHSKPEVNLTYQDLNSQIKRFGAGLQVLGVTEGQKVAL  73

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
              ADNS RW +ADQGIMT G ++VVR S++  +EL+ I   S+S AL V+N +   ++   
Sbjct  74    IADNSPRWFIADQGIMTAGGVDVVRSSQAEKQELIYIIKDSDSTALVVENQKTLEKLRSD  133

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
                   +  IILL  E  S    +     + +++++++LG++S              T  
Sbjct  134   LED-LPIALIILLSEEAVSENESL----KVLNFSQLMELGSQS--------------TLT  174

Query  1685  PI--NSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHA  1512
             P+  N   +ATL+YTSGTTG PKGVML+H NLLHQ+ NL   +   PGD+ LS+LP WH+
Sbjct  175   PVSRNRASLATLIYTSGTTGKPKGVMLSHGNLLHQVNNLNTIIQPEPGDKVLSILPSWHS  234

Query  1511  YERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPA  1332
             YERAAEY+I S GC Q+YT + N K+DL+++QP ++I VP ++E++Y GI KQ+      
Sbjct  235   YERAAEYYILSQGCTQIYTNIRNFKQDLQKHQPNFMIGVPRLWESIYEGIQKQLREQPQK  294

Query  1331  RKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLA  1152
             R+ +    L+IS +Y  A+RI +G  L   +   S      D L A   A  L PLH +A
Sbjct  295   RQKLVKTCLEISESYILARRIAQGLSLEHLEANWS------DRLKAGIKATALAPLHQIA  348

Query  1151  RKLVYskihssigiska-gisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPN  975
              +LVY KI + +G +    ISGGGSL+ H++ F+E + I +  GYGLTE++PV   R+  
Sbjct  349   DRLVYRKIRNGVGGNLRFLISGGGSLAMHLENFYEVVGIPILVGYGLTETSPVTNARQIE  408

Query  974   CNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDEN  795
              N+ GS G P+  TEI++VD ET + L    +G+V  +GPQVM+GYY  P AT +AID +
Sbjct  409   HNLRGSAGKPLPETEIRIVDLETKQDLPKKKRGLVLLRGPQVMQGYYHQPEATAKAIDAS  468

Query  794   GWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLI  615
             GW +TGD+GW+  +            +VL GRAKDTIVL++GEN+EP  IE+A + S  I
Sbjct  469   GWFDTGDIGWLTCDQD----------LVLTGRAKDTIVLTNGENIEPQPIEDACLRSPYI  518

Query  614   QQIVVIGQDKRRLGALVLPHKEEV----LLAAKKLSVVDSDATEVSEEKTSKLIHEELQK  447
             +QI+++GQD+R LGAL++P+ E +    + +   L         +++  T +L   EL +
Sbjct  519   EQIMLVGQDQRALGALIVPNLEALQQWAIASGLNLDFSTPGTQALNDAATQELFRRELNR  578

Query  446   WTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
                         +IG    + EPF++DNG++T T+K++R  VT  Y + I+ L+
Sbjct  579   EVQNRPGYRSDDRIGAFAFVLEPFSLDNGMMTQTLKIKRPLVTQHYHDLIQSLF  632



>ref|WP_015143127.1| AMP-forming long-chain acyl-CoA synthetase [Pleurocapsa minor]
 ref|YP_007080378.1| AMP-forming long-chain acyl-CoA synthetase [Pleurocapsa sp. PCC 
7327]
 gb|AFY76821.1| AMP-forming long-chain acyl-CoA synthetase [Pleurocapsa sp. PCC 
7327]
Length=638

 Score =   451 bits (1159),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 269/661 (41%), Positives = 393/661 (59%), Gaps = 54/661 (8%)
 Frame = -3

Query  2222  TVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALF  2043
             ++ +IW  AA++FGN +AL DP+  P   L++ +L ++I   A GL+  G++PD K+ALF
Sbjct  12    SLSEIWAIAAQKFGNIVALHDPHAKPEVILTYAQLLEKIKQLAAGLQACGVQPDSKVALF  71

Query  2042  ADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETF  1863
             ADNS RW +ADQGI+  GA N VR + +  +ELL I + S+S +L ++N    +++    
Sbjct  72    ADNSPRWFIADQGIIMAGAANAVRSATADRDELLYILDDSDSTSLVIENLNALNKLRPQL  131

Query  1862  HSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEP  1683
                  +  ++LL  E  +    +     I ++ ++++LG ESH                P
Sbjct  132   DD-LPIELLVLLSDESPNANEPLK----ILNFKQLLELG-ESH-------------NLNP  172

Query  1682  INSD--DVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAY  1509
             I  D   +ATL+YTSGTTG PKGVML+H NLLHQ+ NL   +   PGDR LS+LP WH Y
Sbjct  173   IRQDRQTLATLIYTSGTTGKPKGVMLSHGNLLHQVTNLIAVLQPEPGDRVLSILPSWHCY  232

Query  1508  ERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPAR  1329
             ER+ EYFI S GC Q+YT + + K DLKR++P Y+I VP ++E+LY  + KQ+     ++
Sbjct  233   ERSGEYFILSHGCTQIYTNIRSFKNDLKRFKPHYMIGVPRLWESLYEAVQKQLREQPESK  292

Query  1328  KLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLAR  1149
             + +A  FL IS  Y  AKR  +G  L  +   PS      +   A+  A LL PLH L  
Sbjct  293   QRLANFFLGISTRYIMAKRTEQG--LNLENLNPSG----GERFMAKITANLLAPLHALGD  346

Query  1148  KLVYskihssi-giskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNC  972
             +LVY KI  +  G  K  ISGGG+L+ H+D F+E I + L  GYGLTE++PV   R    
Sbjct  347   RLVYQKIRQATGGNVKTLISGGGALAMHLDNFYEIIGVPLVVGYGLTETSPVTNARTLKH  406

Query  971   NVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENG  792
             N+ GS G PI  TEI++VD +T + L P  KGIV  +GPQVM+GYYK P AT + ID  G
Sbjct  407   NLRGSAGKPIPETEIRIVDPDTRQTLPPTQKGIVLIRGPQVMQGYYKKPEATAKVIDAEG  466

Query  791   WLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQ  612
             W ++GDLGW+ P +           +VL GRAKDTIVLS+GEN+EP  IE+A + S  I 
Sbjct  467   WFDSGDLGWVTPAND----------LVLTGRAKDTIVLSNGENIEPQPIEDACIRSPYID  516

Query  611   QIVVIGQDKRRLGALVLPHKEEVLLAAK----KLSVVDSDATEVSEEKTS-------KLI  465
             QI+++GQD++ LGAL++P+ E +   A+     L+  +  A+    E++         L 
Sbjct  517   QIMLVGQDQKALGALIVPNLETLKHWAQSQQLNLTFPEPGASRDEIERSDLYNKAVRDLF  576

Query  464   HEELQKWTTGCTF-----QIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
              +EL +     +      QI    LI EPF+I+N ++T T+K++R  V++ Y++ I+ ++
Sbjct  577   RQELNREVKNRSGYRPDDQIKVFELILEPFSIENSMMTQTLKIKRPVVSERYRDIIDRMF  636

Query  299   K  297
             K
Sbjct  637   K  637



>ref|WP_015183076.1| AMP-forming long-chain acyl-CoA synthetase [Microcoleus sp. PCC 
7113]
 ref|YP_007122338.1| AMP-forming long-chain acyl-CoA synthetase [Microcoleus sp. PCC 
7113]
 gb|AFZ18932.1| AMP-forming long-chain acyl-CoA synthetase [Microcoleus sp. PCC 
7113]
Length=672

 Score =   452 bits (1162),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 277/681 (41%), Positives = 406/681 (60%), Gaps = 76/681 (11%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYH-----NPPTNLSFKELEKEIVSFAEGLRVIGLKPD  2061
             +++P+IW  AA+ F N +AL DP+        P++L++ +L ++I  FA GL+ +G K +
Sbjct  28    QSLPEIWPLAAQRFKNIVALQDPHGVGALGAKPSSLTYAQLYQQIQQFAAGLQSLGFKTE  87

Query  2060  -------EKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAV  1902
                     +IALFADNS RW++ADQGI+T GA N VR +++  EELL I   S S+ L V
Sbjct  88    LDETGLPTRIALFADNSPRWMIADQGIITAGAANAVRSAQADREELLYILEDSGSIGLVV  147

Query  1901  DNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALL  1722
             +N  +   + +   S   + ++ILL  E+     E +    I +Y +++  G        
Sbjct  148   ENLALLKSLRDRLDS-LPIGWVILL-SEEQPPEGETLK---IINYAQLMAAG--------  194

Query  1721  HSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNL---WDPVPVVP  1551
                 A H  T    + D +ATL+YTSGTTG PKGVMLTH NLLHQ++N+   W P P   
Sbjct  195   ----ASHPLTSVIHHRDTLATLLYTSGTTGKPKGVMLTHGNLLHQVVNIGSVWLPEP---  247

Query  1550  GDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLY  1371
             GD+ LS+LP WHAYERA EYFI S GC Q+YT + N+K+DL+ ++PQ ++ VP ++E++Y
Sbjct  248   GDKVLSILPSWHAYERAVEYFILSQGCTQIYTNLRNVKKDLREFKPQLMVGVPRLWESIY  307

Query  1370  SGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWAR  1191
              G+ KQ       ++ +   FL +S  Y EA+R+ +G  L   Q       S ++ L AR
Sbjct  308   EGVQKQFREQPANKQRLVQNFLNVSKRYIEARRLAQGLSLGNLQP------SAIERLKAR  361

Query  1190  AIAALLCPLHLLARKLVYskihssi-giskagisgggslssHVDKFFEAIDIKLQNGYGL  1014
               A +L P+H LA K+VY K+  +  G  K  ISGGGSL+ H+D FFE I +++  GYGL
Sbjct  362   VQATVLWPVHQLANKIVYQKVREATGGQIKIVISGGGSLARHLDDFFEIIGVEVLVGYGL  421

Query  1013  TESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYY  834
             TE++PV   RRP  N+  S GPP+  TEI++V+ ET + L  G +G+V  +GPQVM+GYY
Sbjct  422   TETSPVTNVRRPWRNLRYSSGPPMPGTEIRIVNPETRQLLPQGQQGLVMVRGPQVMQGYY  481

Query  833   KNPFATKQAIDENGWLNTGDLGWIVP-NHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVE  657
             K P AT +AID +GW +TGDLGW+ P NH           +VL GRAKDTIVL++GEN+E
Sbjct  482   KKPEATAKAIDADGWFDTGDLGWVTPENH-----------LVLTGRAKDTIVLTNGENIE  530

Query  656   PSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEV--LLAAKKLSVVDSDAT-----  498
             P  IE+A + S  I QI+++GQD+R LGAL++P+ E +    AA+ L++   DA      
Sbjct  531   PQPIEDACIRSAYIDQIMLVGQDQRSLGALIVPNLEALQQWAAAQNLNLRLPDAVSPQSA  590

Query  497   ----------EVSEEKTSKLIHEELQKWTTGCTF-----QIGPILLINEPFTIDNGLLTP  363
                       ++  ++   L   EL +            +IG   LI EPF+++NG++T 
Sbjct  591   APPEEFRTAIDLQSKEVQSLFRSELNREVKNRPGYRPDDRIGSFELILEPFSLENGMMTQ  650

Query  362   TMKVRRDKVTDLYKEQIEDLY  300
             T+K+RR  V + Y + I  ++
Sbjct  651   TLKIRRPVVMERYHDIIIGMF  671



>ref|WP_016951321.1| long-chain fatty acid--CoA ligase [Anabaena sp. PCC 7108]
Length=669

 Score =   452 bits (1162),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 262/667 (39%), Positives = 400/667 (60%), Gaps = 58/667 (9%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPD-----  2061
             +++P+IW  AA++FG+ +AL +P+  P   +++ +L  +I  FA GL+ +G+        
Sbjct  34    ESLPEIWSLAAKKFGSTVALHNPHSQPEIKITYSQLANQIQRFASGLQALGVNMGDGVTS  93

Query  2060  ---EKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPE  1890
                E+I+L ADNS RW +ADQGIMT G++N VR +++  EELL I  +S S AL V++ +
Sbjct  94    TCGERISLIADNSPRWFIADQGIMTAGSVNAVRSAQAEREELLFIIANSGSTALVVEDIK  153

Query  1889  MYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQE  1710
                ++ E       ++ +ILL  E    T  + +   + ++ +++++G  S+  L+  ++
Sbjct  154   TLKKL-EAGLKDLPIKVVILLSDE----TPPIAENFQVVNFTQLLEIG--SNHTLVVIKQ  206

Query  1709  ARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSM  1530
             +R          D++ATL+YTSGTTG PKGVML+H+NLLHQ+ +L   V    GD  LS+
Sbjct  207   SR----------DNLATLIYTSGTTGKPKGVMLSHKNLLHQVTSLGVLVQPKVGDIVLSI  256

Query  1529  LPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQI  1350
             LP WH+YER+ EYF+ S GC Q+YT + ++K+DLK+Y+P Y+++VP V+E++Y G  KQ 
Sbjct  257   LPTWHSYERSCEYFLLSQGCTQIYTNLRSVKDDLKKYKPNYMVAVPRVWESIYEGAQKQF  316

Query  1349  NTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLC  1170
              T    ++ +    L +S  Y  A+RI +G  L           SV++   A+     L 
Sbjct  317   RTQPAKKQQLIKFLLAMSQKYITARRIAQGLSLDHIN------ASVIERSEAKITELALL  370

Query  1169  PLHLLARKLVYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVV  993
             P H L  KLVY+K+  + G     +  GG     H+D FFE I +++  GYGLTE++PV 
Sbjct  371   PFHALGEKLVYAKVREATGGRIKQVISGGGALPRHIDNFFEIIGVEILQGYGLTETSPVT  430

Query  992   ACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATK  813
               RRP  N+ GS G PI  TE+K+V+ ET + L  G +G+V  KGPQVM+GYY+NP ATK
Sbjct  431   NARRPWRNLRGSSGQPIPATEVKIVNPETRQPLPLGERGLVLLKGPQVMQGYYQNPEATK  490

Query  812   QAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAA  633
             + ID  GW ++GDLGW+ P +           +VL GRAKDTIVL++GEN+EP  IE+A 
Sbjct  491   KVIDAEGWFDSGDLGWVTPEND----------LVLTGRAKDTIVLTNGENIEPQPIEDAC  540

Query  632   MGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKK----LSVVDSDATEVSEEKT---S  474
             + S  I QI+++GQD+R  GAL++P+ E +   A+     LS  D + T    +K    S
Sbjct  541   LRSPYIDQIMLVGQDQRSTGALIVPNIEALAKWAENQNLILSTKDDNLTPSVSQKVNIES  600

Query  473   KLIH----EELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYK  321
             K+I     +EL +            +IGP  LI EPF+I+NGL+T T+K+RR  V + Y 
Sbjct  601   KIIQDLFRQELNREVQNRPGYRADDRIGPFRLILEPFSIENGLMTQTLKIRRYVVAERYH  660

Query  320   EQIEDLY  300
             + I+ ++
Sbjct  661   DIIDGMF  667



>ref|WP_016864475.1| long-chain fatty acid--CoA ligase [Fischerella muscicola]
Length=659

 Score =   451 bits (1160),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 259/658 (39%), Positives = 387/658 (59%), Gaps = 50/658 (8%)
 Frame = -3

Query  2222  TVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALF  2043
             ++P+IW  AA+ FGN +AL DP   P    ++ +L ++I  FA GL+ +G++  ++I+L 
Sbjct  33    SLPEIWPLAAQRFGNIVALRDPNTKPELVFTYTQLNQQIQQFAAGLQALGVQAGDRISLI  92

Query  2042  ADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETF  1863
             ADNS RW +ADQGIMT GA + VR S++  EELL I  +S S AL V++ +  +++ +  
Sbjct  93    ADNSPRWFIADQGIMTAGAADAVRSSQADKEELLFILTNSGSTALVVEDVKTLNKLRDRL  152

Query  1862  HSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEP  1683
             H    ++F+I+L  E         +   +Y++ +++++G            A+H      
Sbjct  153   HD-LPIQFVIVLSNE----ALPAAETPKLYTFTQLMEIG------------AKHSLQPVK  195

Query  1682  INSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYER  1503
              +  D+ATL+YTSGTTG PKGVMLT+ NL+HQIL     V   PGD  LS+LP WH+YER
Sbjct  196   RHPHDLATLIYTSGTTGKPKGVMLTYRNLMHQILCFPTVVQPQPGDTVLSILPTWHSYER  255

Query  1502  AAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKL  1323
             + EYF+ S+GC QVYT + ++K DLK Y+P Y+I+VP + E++Y G  KQ      +R+ 
Sbjct  256   SCEYFLLSVGCTQVYTNLRSIKRDLKEYKPHYMIAVPRLLESIYEGAQKQFREQPASRQR  315

Query  1322  IALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKL  1143
             +   F  I   Y +A+R   G  L      P     + D L A    A L PL+ L  KL
Sbjct  316   LINFFFGIGEKYIQARRTLTG--LNLQNLNP----GIGDRLTASLQVAALSPLYSLGEKL  369

Query  1142  VYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNV  966
             VYSK+  + G     +  GG     HVD FFE + +++  GYGLTE++PV   RR   N+
Sbjct  370   VYSKVREATGGRVKQMISGGGALPKHVDDFFEILGVEILVGYGLTETSPVTHVRRYWRNL  429

Query  965   LGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWL  786
              G+ G PI  TE K+VD ET K L  G +G+V  +GPQ+M+GYY+NP AT +AID  GW 
Sbjct  430   RGASGQPIPGTEAKIVDPETKKELPKGERGLVLLRGPQIMQGYYQNPEATAKAIDPEGWF  489

Query  785   NTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQI  606
             ++GDLGW+ P +           +VL GRAKDTIVL++GEN+EP  IE+A + S  I QI
Sbjct  490   DSGDLGWLTPEND----------LVLTGRAKDTIVLTNGENIEPLPIEDACLRSPYIDQI  539

Query  605   VVIGQDKRRLGALVLPHKEEV----LLAAKKLSVVDSDATEVSEEKTS-------KLIHE  459
             +++GQD++ LGAL++P+ E +    +    +L + D + T ++ +K +        L  +
Sbjct  540   MLVGQDRKSLGALIVPNLEALEKWAISQNLQLDIKDENVTSLTSQKINLESKIIQDLFRQ  599

Query  458   ELQKWTTGCTF-----QIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             EL +            +IGP  LI EPF+I+NG++T T+K++R  V   Y + I  ++
Sbjct  600   ELNREVQNRPGYRPDDRIGPFKLILEPFSIENGMMTQTLKIKRHVVMQHYHDIINGMF  657



>ref|WP_011377787.1| long-chain fatty acid--CoA ligase [Synechococcus elongatus]
 ref|YP_399935.1| long-chain-fatty-acid CoA ligase [Synechococcus elongatus PCC 
7942]
 gb|ABB56948.1| long-chain-fatty-acid CoA ligase [Synechococcus elongatus PCC 
7942]
Length=649

 Score =   451 bits (1159),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 260/656 (40%), Positives = 390/656 (59%), Gaps = 52/656 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDE----  2058
             +++  IW  AA +FG+  ALV P+  P   LS++EL  +I +FA GL  +G+        
Sbjct  30    QSLSQIWGRAASQFGSMPALVAPHAKPAITLSYQELAIQIQAFAAGLLALGVPTSTADDF  89

Query  2057  --KIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMY  1884
               ++A FADNS RWL+ADQG +  GA N VRG+++ V ELL +   S S+ L V++  + 
Sbjct  90    PPRLAQFADNSPRWLIADQGTLLAGAANAVRGAQAEVSELLYVLEDSGSIGLIVEDAALL  149

Query  1883  SRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEAR  1704
              ++     S + ++F+I+L  E   I     D   +  +++++++G             R
Sbjct  150   KKLQPGLASLS-LQFVIVLSDEVVEI-----DSLRVVGFSDVLEMG-------------R  190

Query  1703  HQYTYEPI-NSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSML  1527
                  EPI   D +ATL+YTSGTTG PKGVML+H NLLHQ+  L   V   PGD  LS+L
Sbjct  191   SLPAPEPILQLDRLATLIYTSGTTGPPKGVMLSHGNLLHQVTTLGVVVQPQPGDTVLSIL  250

Query  1526  PPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQIN  1347
             P WH+YERA EYF+ S GC QVYTT+ N+K+D+++Y+PQ+++SV  ++E++Y G+ KQ  
Sbjct  251   PTWHSYERACEYFLLSQGCTQVYTTLRNVKQDIRQYRPQFMVSVLRLWESIYEGVQKQFR  310

Query  1346  TSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCP  1167
                  ++ +   F  +S  Y  A+R ++G  L    + P+  ++       R +A  L P
Sbjct  311   EQPAKKRRLIDTFFGLSQRYVLARRRWQGLDLLALNQSPAQRLAE----GVRMLA--LAP  364

Query  1166  LHLLARKLVYskihssigiskagisgggslssH-VDKFFEAIDIKLQNGYGLTESAPVVA  990
             LH L  +LVY K+  + G     +  GG   +  +D FFE + + L  GYGLTE++PV+ 
Sbjct  365   LHKLGDRLVYGKVREATGGRIRQVISGGGSLALHLDTFFEIVGVDLLVGYGLTETSPVLT  424

Query  989   CRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQ  810
              RRP  N+ GS G PI  T I++VD ET +    G +G+V AKGPQ+M+GY+  P AT +
Sbjct  425   GRRPWHNLRGSAGQPIPGTAIRIVDPETKENRPSGDRGLVLAKGPQIMQGYFNKPEATAK  484

Query  809   AIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAM  630
             AID  GW +TGDLG+IV            G +VL GRAKDTIVL++GEN+EP  IE+A +
Sbjct  485   AIDAEGWFDTGDLGYIV----------GEGNLVLTGRAKDTIVLTNGENIEPQPIEDACL  534

Query  629   GSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQ  450
              S+ I QI+++GQD++ LGAL++P++E + L A +  +  +D   V +    KLI EEL 
Sbjct  535   RSSYISQIMLVGQDRKSLGALIVPNQEAIALWASEQGISQTDLQGVVQ----KLIREELN  590

Query  449   KWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             +            +IGP  LI EPF+++NG LT T+K+RR+ V + Y   I+ +++
Sbjct  591   REVRDRPGYRIDDRIGPFRLIEEPFSMENGQLTQTLKIRRNVVAEHYAAMIDGMFE  646



>ref|WP_015212903.1| Long-chain-fatty-acid--CoA ligase [Anabaena cylindrica]
 ref|YP_007155160.1| Long-chain-fatty-acid--CoA ligase [Anabaena cylindrica PCC 7122]
 gb|AFZ56250.1| Long-chain-fatty-acid--CoA ligase [Anabaena cylindrica PCC 7122]
Length=660

 Score =   450 bits (1158),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 253/660 (38%), Positives = 394/660 (60%), Gaps = 51/660 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVI------GLKP  2064
             +++P+IW  AA+EFGN IAL +P+  P   +++ +L ++I  FA GL+ +      G  P
Sbjct  32    ESLPEIWPLAAKEFGNTIALHNPHAKPEIQITYNQLAEQIQRFASGLQALIMDVGNGETP  91

Query  2063  --DEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPE  1890
                ++I+L ADNS RW +ADQGIMT GA+N VR +++  EELL I  +S S  + V++ +
Sbjct  92    TFGDRISLIADNSPRWFIADQGIMTAGAVNAVRSAQAEREELLFIIANSGSTVVVVEDIK  151

Query  1889  MYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQE  1710
              +++I E  +    ++ +ILL  E    T        + ++ +++++G+   +A +    
Sbjct  152   TFNKIKEGLND-LPIKLVILLADETPPTTENFR----VVNFLQVLEIGSNHTLATVKQ--  204

Query  1709  ARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSM  1530
                       +S+ +ATL+YTSGTTG PKGVML+H+NLLHQ+ +L   V    G+  LS+
Sbjct  205   ----------SSETLATLIYTSGTTGKPKGVMLSHQNLLHQVKSLGTVVQPQKGNIVLSI  254

Query  1529  LPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQI  1350
             LP WH+YER+ EYF+ S GC Q+YT +  +K+DLK+++P Y+I+VP ++E++Y G+ KQ 
Sbjct  255   LPTWHSYERSGEYFLLSQGCTQIYTNLRAVKQDLKKFKPNYMIAVPRLWESIYEGVQKQF  314

Query  1349  NTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLC  1170
                   ++ +    L +S  Y  A+RI +G  L           S  + L A+     L 
Sbjct  315   REQPAKKQQLIQFLLDMSQKYITARRITQGLSLDHIH------ASSGERLGAKIREIALW  368

Query  1169  PLHLLARKLVYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVV  993
             P   L  KLVY+K+  + G     +  GG     H+D FFE + +++  GYGLTE++PV 
Sbjct  369   PFQALGEKLVYAKVREATGGKIKQVISGGGALPRHIDNFFEIVGVEILQGYGLTETSPVT  428

Query  992   ACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATK  813
               RRP  N+ GS G PI  TE+K+V+ ET + L  G +G+V  KGPQ+M+GYY+NP ATK
Sbjct  429   NARRPWRNLRGSSGQPIPGTEVKIVNPETRQPLPVGERGLVLLKGPQIMQGYYQNPEATK  488

Query  812   QAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAA  633
             + ID  GW ++GDLGW+ P +           +VL GRAKDTIVL++GEN+EP  IE+A 
Sbjct  489   KVIDAEGWFDSGDLGWVTPQND----------LVLTGRAKDTIVLTNGENIEPQPIEDAC  538

Query  632   MGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAK----KLSVVDSDATEVSEEKTSKLI  465
             + S  + QI+++GQD+R +GAL++P+ E +   A+    K++   S   ++  +    L 
Sbjct  539   LRSPYVDQIMLVGQDQRSIGALIVPNLEALEKWAETQNDKITASTSQKIDLESKIIQDLF  598

Query  464   HEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
              +EL +            +IGP  LI EPF+I+NGL+T T+KVRR  V D Y++ I+ ++
Sbjct  599   RQELNREVKDRPGYRADDRIGPFKLILEPFSIENGLMTQTLKVRRHVVMDRYRDIIDGMF  658



>ref|WP_013190687.1| long-chain fatty acid--CoA ligase [Trichormus azollae]
 ref|YP_003720792.1| AMP-dependent synthetase and ligase ['Nostoc azollae' 0708]
 gb|ADI63669.1| AMP-dependent synthetase and ligase ['Nostoc azollae' 0708]
Length=661

 Score =   450 bits (1158),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 252/658 (38%), Positives = 395/658 (60%), Gaps = 51/658 (8%)
 Frame = -3

Query  2219  VPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLK------PD-  2061
             +P+IW  AA++FGN +AL +P+  P   +++ +L  +I  FA GL+ +G+       P+ 
Sbjct  35    LPEIWPLAAKKFGNTVALHNPHAKPEVKITYSQLADQIQRFAVGLQSLGMNMGDSETPNI  94

Query  2060  -EKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMY  1884
              E+I+L ADNS  W +ADQGIMT GA+N VR +++  EELL I  +S S  L V++ + +
Sbjct  95    GERISLIADNSPGWFIADQGIMTAGAVNAVRSAQAEREELLFIIANSGSTVLVVEDIKTF  154

Query  1883  SRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEAR  1704
              ++ +       ++ +ILL  +++  T+E ++   + ++++++++G+   +A +      
Sbjct  155   QKLEKGLKD-LPIKLVILL-SDETPPTAENLE---LVNFSQLLEIGSNHTLAPMKQ----  205

Query  1703  HQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLP  1524
                     + D +ATL+YTSGTT  PKGVML+H NLLHQ+  L   V    GD  LS+LP
Sbjct  206   --------SRDSLATLIYTSGTTAKPKGVMLSHSNLLHQVTTLGTVVQPESGDIVLSILP  257

Query  1523  PWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINT  1344
              WH+YER+ EYF+ S GC QVYT + ++K+DLK ++P Y+I+VP  +E++Y G+ KQ  +
Sbjct  258   TWHSYERSGEYFLLSQGCTQVYTNLRSVKDDLKNFKPNYIIAVPRFWESIYEGVQKQFRS  317

Query  1343  SSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPL  1164
                 ++ +    L +S  Y +A+RI EG  L+     P    S ++ L A+ +   L P 
Sbjct  318   QPAKKQQLIKFLLDMSQKYIQARRIAEG--LSLHHVNP----SAVERLGAKILELALLPF  371

Query  1163  HLLARKLVYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVAC  987
               L  KLVY+K+  + G     +  GG     H+D FFE I +++  GYGLTE++PV   
Sbjct  372   QTLGEKLVYAKVREATGDKIKQVISGGGALPQHIDNFFEIIGVEILQGYGLTETSPVTNA  431

Query  986   RRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQA  807
             RRP  N+ GS G PI  TE+K+V  ET + L  G +G+V  +GPQ+M+GYY+NP ATK+ 
Sbjct  432   RRPWRNLRGSSGQPIPGTEVKIVSPETRQPLPAGERGLVLLRGPQIMQGYYQNPEATKKV  491

Query  806   IDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMG  627
             ID  GW ++GDLGW+ P +           +VL GRAKDTIVL++GEN+EP  IE+A + 
Sbjct  492   IDAEGWFDSGDLGWVTPQND----------LVLTGRAKDTIVLTNGENIEPQPIEDACLR  541

Query  626   SNLIQQIVVIGQDKRRLGALVLPHKEEVLLAA----KKLSVVDSDATEVSEEKTSKLIHE  459
             S  I QI+++GQD+R LGAL++P+ E +  +A      ++       ++  +    L  +
Sbjct  542   SPYIDQIMLVGQDQRSLGALIVPNLEALEKSAANQNDNITASSGQKIDLESKMIQDLFRQ  601

Query  458   ELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             EL +            +IGP  LI EPF+I+NG++T T+K+RR  VTD Y + I+ ++
Sbjct  602   ELNREVKNRPGYRADDRIGPFQLIIEPFSIENGMMTQTLKIRRHVVTDEYHDIIDRMF  659



>ref|WP_015130782.1| long-chain-fatty-acid--CoA ligase [Calothrix sp. PCC 7507]
 ref|YP_007067819.1| long-chain-fatty-acid--CoA ligase [Calothrix sp. PCC 7507]
 gb|AFY34985.1| Long-chain-fatty-acid--CoA ligase [Calothrix sp. PCC 7507]
Length=658

 Score =   450 bits (1157),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 258/660 (39%), Positives = 398/660 (60%), Gaps = 54/660 (8%)
 Frame = -3

Query  2222  TVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALF  2043
             ++ +IW  AA+ FG+ +AL +P+  P   +++ +L ++I  FA GL+ +G+K  ++I+L 
Sbjct  33    SLSEIWPLAAQRFGDTVALHNPHAQPGVLITYAQLAEQIRQFAAGLQSLGVKVGDRISLI  92

Query  2042  ADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETF  1863
             ADNS RW +ADQGIMT GA + VR S++  EELL I  +S S AL V++ +   ++ E  
Sbjct  93    ADNSPRWFIADQGIMTAGAADAVRSSQAEREELLFIIANSGSTALVVEDLKTLKKLREGL  152

Query  1862  HSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEP  1683
                  +  +ILL  +++  T E +    + ++++++++G               Q+T +P
Sbjct  153   KD-LPIPLVILL-SDEAPPTEESLK---VLNFSQLMEVG--------------AQHTLQP  193

Query  1682  I--NSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAY  1509
             +  N +D+ATL+YTSGTTG PKGVML+H+NLLHQ+      V    GD  LS+LP WH+Y
Sbjct  194   VKQNREDLATLIYTSGTTGKPKGVMLSHDNLLHQVTVFGVVVQPEVGDTVLSILPSWHSY  253

Query  1508  ERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPAR  1329
             ER  EYF+ S GC QVYT + ++K+DL+ ++P Y++ VP ++E++Y G  KQ       +
Sbjct  254   ERTVEYFLLSQGCTQVYTNLRSVKKDLREFKPHYMVGVPRLWESIYEGAQKQFREQPAKK  313

Query  1328  KLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLAR  1149
             + +    L  S  Y +A+RI +   L           S ++ L AR  A+ L PLH L  
Sbjct  314   QRLINSLLGTSEKYIKAQRIAQKLDLEH------LDASAIEQLTARIQASALFPLHALGE  367

Query  1148  KLVYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNC  972
             KLVY+K+  + G     +  GG     H+D FFE I +++  GYGLTE++PV   RRP+ 
Sbjct  368   KLVYAKVREATGGRVKQMISGGGALPKHIDNFFEIIGVQILQGYGLTETSPVTHVRRPSR  427

Query  971   NVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENG  792
             N++G+ G P+  TE K+VD ET   L  G +G+V  KGPQ+M+GYY+NP AT +AID  G
Sbjct  428   NLIGASGQPLPATETKIVDPETRVPLPTGKRGLVLLKGPQIMEGYYQNPEATAKAIDPQG  487

Query  791   WLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQ  612
             W ++GDLGW+ P +           +VL GRAKDTIVL++GEN+EP  IE+A + S  + 
Sbjct  488   WFDSGDLGWLTPQND----------LVLTGRAKDTIVLTNGENIEPQPIEDACLRSPYVD  537

Query  611   QIVVIGQDKRRLGALVLPHKEEVLLAAK----KLSVVDSDATEVSEEKT---SKLIH---  462
             QI+++GQD+R LGAL++P+ E +   A+     +S+ D +  + S +K    SK+I    
Sbjct  538   QIMLVGQDQRSLGALIVPNVEALAKWAETQNLSISIQDDNVADASSQKIDLESKIIQDLF  597

Query  461   -EELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
              +EL +            +I    LI EPF+I+NGLLT T+K+RR  VT+ Y++ I+ ++
Sbjct  598   RQELNREVQNRPGYRADDRISSFRLIPEPFSIENGLLTQTLKMRRHVVTERYRDIIDGMF  657



>ref|WP_009543965.1| MULTISPECIES: long-chain fatty acid--CoA ligase [Cyanothece]
 ref|YP_001802549.1| long-chain-fatty-acid CoA ligase [Cyanothece sp. ATCC 51142]
 gb|ACB50483.1| probable long-chain-fatty-acid CoA ligase [Cyanothece sp. ATCC 
51142]
Length=638

 Score =   449 bits (1155),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 265/663 (40%), Positives = 396/663 (60%), Gaps = 60/663 (9%)
 Frame = -3

Query  2219  VPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFA  2040
             +PDIW  AA++F + +AL DP+  P   L+F +L ++I  FA GL+ +G+ PD+KI+L A
Sbjct  13    LPDIWAIAAKKFPDILALHDPHSKPEVKLTFAQLYQQIKQFASGLQALGVTPDDKISLIA  72

Query  2039  DNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFH  1860
             DNS RW +ADQG M  GA N VR +++   EL  I   S+S  L V+N +   ++  +F 
Sbjct  73    DNSPRWFIADQGSMLAGAANAVRSAQADKNELAYILRDSDSSTLIVENQKTLDKL-RSFC  131

Query  1859  SHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPI  1680
                 ++ IILL  E    T +  D     +Y+++++ G  +              T +PI
Sbjct  132   DEIPLQLIILLSDE----TPKTDDSIKTLNYSQLMEQGANN--------------TLQPI  173

Query  1679  N--SDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYE  1506
                 DD+ATL+YTSGTTG PKG ML+H NLLHQ+ NL   +    GD  LS+LP WH+YE
Sbjct  174   TKEDDDLATLIYTSGTTGQPKGAMLSHGNLLHQVKNLDAIIQPKAGDIVLSILPSWHSYE  233

Query  1505  RAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARK  1326
             R+AEYF+ S GC   YT + N K DLK+++P +++ VP ++++LY GI KQ+   SP ++
Sbjct  234   RSAEYFLLSQGCTLTYTNIRNFKTDLKKFKPHHMVGVPRLWDSLYEGIQKQLRDQSPTQQ  293

Query  1325  LIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARK  1146
              I   F  +S  +  ++RI     L        +  S  +   AR  A+LL PLH L  K
Sbjct  294   KIVQFFFNLSQTFILSRRIANNMSLEH------FDASGTERFIARLKASLLAPLHSLGDK  347

Query  1145  LVYskihssigis-kagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
             LVY+KI   +G + +  +SGGGSL+ H+D F+E I++ +  GYGLTE++PV   R  + N
Sbjct  348   LVYNKIREGLGGNFETLVSGGGSLAKHLDDFYEIINVPVLVGYGLTETSPVTNARTHSHN  407

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             + GS G PI  TEIK+VD +T + LS G KG+V  +GPQVM+GYYK P AT +AI+  GW
Sbjct  408   LRGSSGQPIPKTEIKIVDLDTGEPLSQGKKGVVLIRGPQVMQGYYKKPEATAKAINSEGW  467

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              N+GDLGWI P +           +V+ GRAKDTIVLS+GEN+EP  IE+A + S  I Q
Sbjct  468   FNSGDLGWITPMND----------LVITGRAKDTIVLSNGENIEPQPIEDACVRSAYIDQ  517

Query  608   IVVIGQDKRRLGALVLPH---------KEEVLLA-----AKKLSVVDSDATEVSEEKTSK  471
             ++++GQD++ LGAL++P+          +++ L      A + ++V+SD   +  +    
Sbjct  518   MMLVGQDQKALGALIVPNLDALQTWGKNQQLNLTFPPEDASREAIVNSD---LYGKPVQD  574

Query  470   LIHEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIED  306
             L  +EL +            QI    LI EPF+++NG++T T+K++R  VT+ Y+  I+ 
Sbjct  575   LFKQELNREVKNRPGYRADDQIKAFELILEPFSVENGMMTQTLKIKRPVVTERYQGMIDG  634

Query  305   LYK  297
             +++
Sbjct  635   MFE  637



>ref|WP_024124407.1| long-chain-fatty-acid:[acyl-carrier protein] ligase (AMP-forming) 
Aas [Thermosynechococcus sp. NK55a]
 ref|YP_008899509.1| long-chain-fatty-acid:[acyl-carrier protein] ligase (AMP-forming) 
Aas [Thermosynechococcus sp. NK55a]
 gb|AHB87996.1| long-chain-fatty-acid:[acyl-carrier protein] ligase (AMP-forming) 
Aas [Thermosynechococcus sp. NK55a]
Length=658

 Score =   450 bits (1157),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 269/662 (41%), Positives = 385/662 (58%), Gaps = 53/662 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P++W   A+  G+ +AL  PY +PPT +++ EL + I  FA GL+ +G+   +++AL
Sbjct  31    QSLPEMWPLLAQRHGDVVALDAPYEDPPTRITYSELYQRIQRFAAGLQALGVAAGDRVAL  90

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             FADNS RWL+ADQG M  GAINVVR   ++ +ELL I   S +  L ++N     ++  +
Sbjct  91    FADNSPRWLIADQGSMMAGAINVVRSGTAAAQELLYILRDSGATLLLIENLATLRKLEGS  150

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
                 A V+ ++LL GE   +T   +    + ++ ++   G    +  +            
Sbjct  151   LVDTA-VKTVVLLSGESPELTGFPLR---LLNFGQVFTEGQYGTVRAVA-----------  195

Query  1685  PINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYE  1506
              I   D+ATL+YTSGTTG PKGVM+TH  LL QI+NLW  V    GDR LS+LP WHAYE
Sbjct  196   -ITPADLATLMYTSGTTGQPKGVMVTHGGLLSQIVNLWTIVQPQVGDRILSILPIWHAYE  254

Query  1505  RAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARK  1326
             R AEYF+F+ GC Q YT + + K DLKR +P Y+I+VP ++E  Y G+ KQ+  S   ++
Sbjct  255   RVAEYFLFACGCSQTYTNLRHFKNDLKRCKPHYMIAVPRIWEGFYEGVQKQLRDSPATKR  314

Query  1325  LIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDW--LWARAIAALLCPLHLLA  1152
              +A  FL +   Y   +R+  G  LT     PS       W  L AR    LL PL+ L 
Sbjct  315   RLAQFFLSVGQHYILQRRLLTGLSLTN--PHPS------GWQKLVARVQTLLLKPLYELG  366

Query  1151  RKLVYskihssigiskagisgggslss-HVDKFFEAIDIKLQNGYGLTESAPVVACRRPN  975
              K VYSKI  + G     I  GG   + H+D F+E I++++  GYGLTE+A V+  RRP 
Sbjct  367   EKRVYSKIREATGGEIKQIISGGGALAPHLDTFYEVINLEVLVGYGLTETAVVLTARRPW  426

Query  974   CNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDEN  795
              N+ GS G PI  T IK+VD ET   L  G KG+V AKGPQVM+GYY  P AT + +D  
Sbjct  427   ANLRGSAGRPIPDTAIKIVDPETKAPLEFGQKGLVMAKGPQVMRGYYNQPEATAKVLDGE  486

Query  794   GWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLI  615
             GW +TGDLG++ PN          G +VL GR KDTIVLS+GEN+EP  IE+A + S  I
Sbjct  487   GWFDTGDLGYLTPN----------GDLVLTGRQKDTIVLSNGENIEPQPIEDACVRSPYI  536

Query  614   QQIVVIGQDKRRLGALVLPHKEEVL--LAAK--KLSVVDSDATEVSEEKTS---------  474
              QI+++GQD++ LGAL++P+ E +   +AAK  +L + +  A   S E  +         
Sbjct  537   DQIMLVGQDQKALGALIVPNLEALAEWVAAKGYRLELPNRPAGAGSGEVVTLESKVIIDL  596

Query  473   ---KLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDL  303
                +L+ E   +       +I     + EPFTI+NGLLT T+K+RR  V+D Y++ I  +
Sbjct  597   YRQELLREVQNRPGYRPDDRIATFRFVLEPFTIENGLLTQTLKIRRHVVSDRYRDMINAM  656

Query  302   YK  297
             ++
Sbjct  657   FE  658



>ref|WP_012630314.1| long-chain fatty acid--CoA ligase [Cyanothece sp. PCC 7425]
 ref|YP_002485638.1| AMP-dependent synthetase/ligase [Cyanothece sp. PCC 7425]
 gb|ACL47277.1| AMP-dependent synthetase and ligase [Cyanothece sp. PCC 7425]
Length=684

 Score =   450 bits (1158),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 265/658 (40%), Positives = 389/658 (59%), Gaps = 49/658 (7%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             + +P+IW   A ++G  IAL  P+ +P  NL++KEL  +I  FA GL+ +G++  +++AL
Sbjct  59    QALPEIWPIVARKYGEIIALKAPHESPEVNLTYKELYYQIQRFAAGLQAMGVQAGDRVAL  118

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             +ADNS RWL+ADQG M  GA+NVVR S+S  +EL+ I   S S  L V++     ++  T
Sbjct  119   YADNSPRWLIADQGSMMAGAVNVVRSSQSEAQELIYILQDSGSTTLIVEDRATLKKLTPT  178

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
                   +R I+LL  E         D  P      +       + A +  + A       
Sbjct  179   L-PDLPLRVIVLLSDE---------DPDPGLGIKMV-------NFAQVFQEGAYGTVRSV  221

Query  1685  PINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYE  1506
              +   D+ATL+YTSGTTG PKGVML+H NLLHQ+ +L   +    GDR LS+LP WH+YE
Sbjct  222   RVRKTDLATLIYTSGTTGKPKGVMLSHGNLLHQVTSLGTVIQPQAGDRVLSILPTWHSYE  281

Query  1505  RAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARK  1326
             RA EYF+FSLGC Q+YT + ++K+D+KR +PQY+++VP ++E++Y G+ +Q      +++
Sbjct  282   RACEYFLFSLGCTQIYTNLRHIKQDIKRVKPQYMVAVPRLWESIYEGVQRQFREQPASKQ  341

Query  1325  LIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARK  1146
              +   FL IS  Y +A R+  G  L  D   PS    +L    A+    LL PLH L  K
Sbjct  342   KLINFFLGISQRYIKASRLRAG--LDLDNLHPSGGQKLL----AQIQVLLLRPLHQLGEK  395

Query  1145  LVYskihssigi-skagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
             +VY K+  + G   K  ISGGGSL+ H++ F+E I +++  GYGLTE++PV+  RRP  N
Sbjct  396   IVYQKVREATGGCLKQVISGGGSLARHLEVFYEMIGVEILVGYGLTETSPVLTARRPWEN  455

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             + GS G P+ +TEIK+VD E+   LS G KG+V A+GPQ+M+GYY  P AT + +D  GW
Sbjct  456   LRGSAGKPVPYTEIKIVDPESRATLSLGEKGLVMARGPQIMQGYYGKPEATAKVLDSEGW  515

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              +TGD+GW+               +VL GR KDTIVL++GEN+EP  IE+A + S  I Q
Sbjct  516   FDTGDVGWLTDRQD----------LVLTGRQKDTIVLTNGENIEPQPIEDACLRSAYIDQ  565

Query  608   IVVIGQDKRRLGALVLPHKEEVLLAAK---------------KLSVVDSDATEVSEEKTS  474
             I+++GQD+R LGAL++P+ E +   A                K  ++D D+  V +    
Sbjct  566   IMLVGQDQRVLGALIVPNLEALEQWAASQNYALKLPDREPQTKGEMIDLDSKPVQDLYRQ  625

Query  473   KLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             +L  E   +       +IGP   I EPF+I+NGL+T T+K+RR+ V D Y+  I  ++
Sbjct  626   ELNREVKNRPGFRIDDRIGPFKFILEPFSIENGLMTQTLKIRRNVVMDRYQGMINGMF  683



>ref|WP_015200141.1| AMP-dependent synthetase and ligase [Calothrix parietina]
 ref|YP_007139497.1| AMP-dependent synthetase and ligase [Calothrix sp. PCC 6303]
 gb|AFZ03525.1| AMP-dependent synthetase and ligase [Calothrix sp. PCC 6303]
Length=658

 Score =   449 bits (1155),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 251/659 (38%), Positives = 386/659 (59%), Gaps = 50/659 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             + +P +W   A+ FG+ IA+ DP+  P    ++K+L ++I +FA GL+ +G++  E+I+L
Sbjct  32    EVLPLMWSAIAQRFGDSIAVCDPHAKPEVVFTYKQLNEKICAFASGLQALGIQAGERISL  91

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
              +DNS  WLVADQGIM  GA++ VRGS++  EELL I  +S S AL ++N +   ++ E 
Sbjct  92    ISDNSPAWLVADQGIMMAGAVDAVRGSQAEREELLYIIANSGSTALVLENFKTLKKLREG  151

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
                   ++F ILL    S  T    +   I ++ +II LG +            H     
Sbjct  152   LDDLG-IKFAILL----SEETPPPEESLKILNFEQIITLGGQ------------HTLIPT  194

Query  1685  PINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYE  1506
              +   D+ATL+YTSGTTG PKGVML H N++HQ+ +L   V    GD  LS+LP WH+YE
Sbjct  195   QLKRTDLATLIYTSGTTGKPKGVMLNHGNIMHQVTSLGSVVQPEKGDTVLSILPSWHSYE  254

Query  1505  RAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARK  1326
             R+ EYF+FS GC Q+YT++ ++K DLK+++P Y+I+VP + E++Y G+ KQ     P+++
Sbjct  255   RSCEYFLFSQGCMQIYTSLRSIKNDLKKFKPNYIIAVPRLLESIYEGVQKQFREQPPSKQ  314

Query  1325  LIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARK  1146
              +      IS  Y +A+RI +G  L  D  QP    SVLD + A+  +  L PLH +  K
Sbjct  315   KLVKNLFAISEKYIKAQRIVQGVSL--DNFQP----SVLDKITAQIQSIFLAPLHAVGEK  368

Query  1145  LVYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
             LVY K+  + G     +  GG     +VD FFE + +++  GYGLTE++PV   RR   N
Sbjct  369   LVYGKVREATGGKVKQMVSGGGALPRYVDNFFEIVGVEIFVGYGLTETSPVTHVRRSWRN  428

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             + G+ G  I  TE+K+V  ET K +  G +G+V  +GPQ+M+GYY+NP AT +AID  GW
Sbjct  429   LRGAAGLAIPGTEVKIVHPETRKPIENGQRGLVLLRGPQIMQGYYQNPEATAKAIDSEGW  488

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              ++GDLGW+   +           ++L GRAKDTIVL++GEN+EP  IE+A + S  I Q
Sbjct  489   FDSGDLGWVSDKND----------LILTGRAKDTIVLTNGENIEPQPIEDACLRSPYIDQ  538

Query  608   IVVIGQDKRRLGALVLP-----------HKEEVLLAAKKLSVVDSDATEVSEEKTSKLIH  462
             I+++GQD+R +GAL++P           H  ++ +    +++  S    +  +    L  
Sbjct  539   IMLVGQDQRSIGALIVPNLEALAKWAQEHNLDLCIQEDNVTLSGSQKINLESKIIQDLFR  598

Query  461   EELQKWTTGCTF-----QIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             +EL +            +I P  LI EPF+++NG++T T+K+RR  V + Y + I  ++
Sbjct  599   QELNREVQNRPGYRPDDRINPFRLILEPFSMENGMMTQTLKIRRHVVAEHYHDMINGMF  657



>ref|WP_026721870.1| long-chain fatty acid--CoA ligase [Fischerella sp. PCC 9431]
Length=659

 Score =   449 bits (1154),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 254/659 (39%), Positives = 389/659 (59%), Gaps = 50/659 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P+IW  AA+ FGN +AL DP+  P    ++ +L ++I  FA GL+ +G++  ++I+L
Sbjct  32    ESLPEIWPLAAQRFGNIVALRDPHAKPELVFTYTQLNQQIQQFAAGLQALGVQAGDRISL  91

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
              ADNS RW +ADQGIM  GA + VR S++  EELL I  +S S AL V++ +  +++ + 
Sbjct  92    IADNSPRWFIADQGIMAAGAADAVRSSQAEKEELLFILTNSGSTALVVEDVKTLNKLRDR  151

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
              H    ++F+I+L  E    T    +   +Y++N+++++G            A+H     
Sbjct  152   LHD-LPIQFVIVLSNE----TLPAAETPKLYTFNQLMEIG------------AKHSLQPV  194

Query  1685  PINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYE  1506
               + +D+ATL+YTSGTTG PKGVMLTH NL+HQI+ +   V   PGD  LS+LP WH+YE
Sbjct  195   KRHPNDLATLIYTSGTTGKPKGVMLTHRNLMHQIVAIPAVVQPEPGDTVLSILPTWHSYE  254

Query  1505  RAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARK  1326
             R+ EYF+ S+GC QVYT + ++K DL+ Y+P Y+++VP + E++Y G  KQ      +R+
Sbjct  255   RSCEYFLLSVGCTQVYTNLRSIKRDLQEYKPHYMVAVPRLLESIYEGAQKQFREQPASRQ  314

Query  1325  LIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARK  1146
              +   F  I   Y +A+R   G  L      P     + D L A    A L PL+ L  K
Sbjct  315   RLINFFFGIGEKYVKARRTLTG--LNLQNLNP----GIGDRLTASLQVAALSPLYSLGEK  368

Query  1145  LVYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
             LVY K+  + G     +  GG     HVD FFE + +++  GYGLTE++PV   RR   N
Sbjct  369   LVYRKVREATGGRVKQMISGGGALPKHVDDFFEILGVEILVGYGLTETSPVTHARRYWRN  428

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             + G+ G  I  TE K+VD ET K L  G +G+V  +GPQ+M+GYY+NP AT +AI+  GW
Sbjct  429   LRGAAGQAIPGTETKIVDPETKKELPTGEQGLVLLRGPQIMQGYYQNPEATAKAINPEGW  488

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              ++GDLGW+ P +           +VL GRAKDTIVL++GEN+EP  IE+A + S  I Q
Sbjct  489   FDSGDLGWLTPEND----------LVLTGRAKDTIVLTNGENIEPLPIEDACLRSPYIDQ  538

Query  608   IVVIGQDKRRLGALVLPHKEEV----LLAAKKLSVVDSDATEVSEEKTS-------KLIH  462
             I+++GQD++ LGAL++P+ E +    +    +L + D + T  + +K +        L  
Sbjct  539   IMLVGQDRKSLGALIVPNLEALEKWAISQNLQLDIKDENVTSPTSQKINLESKIIQDLFR  598

Query  461   EELQKWTTGCTF-----QIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             +EL +            +IGP  LI EPF+++NG++T T+K++R  V   Y + I  ++
Sbjct  599   QELNREVQNRPGYRPDDRIGPFKLILEPFSMENGMMTQTLKIKRHVVMQHYHDIINGMF  657



>ref|WP_006519553.1| AMP-forming long-chain acyl-CoA synthetase [Leptolyngbya sp. 
PCC 7375]
 gb|EKU98405.1| AMP-forming long-chain acyl-CoA synthetase [Leptolyngbya sp. 
PCC 7375]
Length=641

 Score =   448 bits (1152),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 259/652 (40%), Positives = 391/652 (60%), Gaps = 43/652 (7%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             ++V  IW   AE F N IAL DP+  P   L++ EL ++I  FA  L+++G+KP +KIAL
Sbjct  24    QSVAGIWPIVAERFSNQIALEDPHSTPQLKLTYGELNEQIKQFAASLQILGIKPQDKIAL  83

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             F+DN  RWLVADQGIMT GA++ VRGS++  +EL  I  +S+SVA+ V +    +++A+ 
Sbjct  84    FSDNQPRWLVADQGIMTVGAVDAVRGSQADKDELAYILENSDSVAMIVQDQATLNKLADC  143

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
                  +++FI+LL  E    T ++     + ++ ++++LG    +  +            
Sbjct  144   L-GDKNLQFIVLLSDE----TPQLETTTKLLNFTQLMELGVGVELEAVKC----------  188

Query  1685  PINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYE  1506
               +  D+ATL+YTSGT+G PKGVML+ +NLL QI      V   PG + +S+LP WH YE
Sbjct  189   --DRTDLATLMYTSGTSGRPKGVMLSQDNLLSQISGACSVVHPKPGSKVMSILPIWHCYE  246

Query  1505  RAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARK  1326
             R  EYF  S G +QVYT +  +K+DLK Y+P Y++ VP ++E++Y G+ KQ      +++
Sbjct  247   RTFEYFTLSQGVQQVYTNIRYVKKDLKAYKPNYMVGVPRLWESIYEGVQKQFREQPESKQ  306

Query  1325  LIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARK  1146
              +   FL  S  Y  AKRI E   L        Y  S  D   A    A+L P H L   
Sbjct  307   KLINFFLHQSQRYIAAKRIAENLSL-------DYSPSAFDRAMASIQCAVLLPFHKLGDS  359

Query  1145  LVYskihssigiska-gisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
             +VY KI  + G      +SGGGS++ H++ F+E ID+ +  GYGLTE++P+   RRP  N
Sbjct  360   MVYKKIREATGGDINFVVSGGGSIADHLEDFYEIIDVAILGGYGLTETSPITHVRRPWQN  419

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             + G+ G P+  TE ++VD ++ + +  G KG+V  +GPQ+M+GYYKNP AT +AID +GW
Sbjct  420   LRGADGQPLPGTETRIVDLDSRQDVPQGQKGLVLVRGPQIMQGYYKNPDATSKAIDPDGW  479

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              +TGDLG I  N          G +V+ GRAKDTIVL+SGEN+EP  IE A   S  + Q
Sbjct  480   FDTGDLGKITAN----------GDLVITGRAKDTIVLTSGENIEPQPIENACARSKYVDQ  529

Query  608   IVVIGQDKRRLGALVLPHKEEVLLAA--KKLSVVDSDATE-VSEEKTSKLIHEELQKWTT  438
             I+++GQD++ LGAL++P+ E +   A  + +++ D +  E ++  K   L  +EL +   
Sbjct  530   IMLVGQDQKVLGALIVPNLEALSQWATTQGITIDDDNPVESLNNSKVQTLFKQELTREVK  589

Query  437   G-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
                      +IGP  L++EPF+++NG+LT TMK++R  VT  Y++ I+ L+K
Sbjct  590   ARPGHRPDERIGPFTLLSEPFSMENGMLTQTMKIKRPVVTRNYQDVIDGLFK  641



>ref|WP_017309714.1| long-chain fatty acid--CoA ligase [Fischerella sp. PCC 9339]
Length=659

 Score =   447 bits (1151),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 257/658 (39%), Positives = 386/658 (59%), Gaps = 50/658 (8%)
 Frame = -3

Query  2222  TVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALF  2043
             ++P+IW  AA+ FGN +AL DP+  P +  ++ +L ++I  FA GL+ +G++  ++I+L 
Sbjct  33    SLPEIWPLAAQRFGNIVALRDPHAKPKSVFTYTQLHQQIQQFAAGLQALGVQGGDRISLI  92

Query  2042  ADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETF  1863
             ADNS RW +ADQGIMT GA++ VR S++  EELL I  +S S A+ V++ +  +++    
Sbjct  93    ADNSPRWFIADQGIMTAGAVDAVRSSQAETEELLFILTNSGSKAIVVEDVKTLNKLRSRL  152

Query  1862  HSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEP  1683
             H    ++F+I+L  E         +   +Y++ +++++G            A+H      
Sbjct  153   HD-LPIQFVIVLSNE----ALPEAETPKLYTFKQLLEIG------------AKHSLQPVK  195

Query  1682  INSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYER  1503
              N DD+ATL+YTSGTTG PKGVMLTH NL+HQIL L   V   PGD  LS+LP WH+YER
Sbjct  196   RNPDDLATLIYTSGTTGKPKGVMLTHRNLMHQILALPTVVQPQPGDIVLSILPTWHSYER  255

Query  1502  AAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKL  1323
             + EYF+ S+GC QVYT + ++K DLK Y+P Y+++VP + E++Y G  KQ      +R+ 
Sbjct  256   SCEYFLLSVGCTQVYTNLRSIKGDLKEYKPHYMVAVPRLLESIYEGAQKQFREQPASRQR  315

Query  1322  IALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKL  1143
             +   F  I   Y +A+R   G  L      P     + D   A      L PL+ L  KL
Sbjct  316   LINFFFGIGEKYIKARRTLRG--LNLQNLNP----GIGDRSTAILQVVALLPLYSLGEKL  369

Query  1142  VYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNV  966
             VYSK+  + G     +  GG     HVD FFE + +++  GYGLTE++PV   RR   N+
Sbjct  370   VYSKVREATGGRVKQMISGGGALPKHVDDFFEILGVEILVGYGLTETSPVTHARRYWRNL  429

Query  965   LGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWL  786
              G+ G  I  TE K+VD ET K L  G +G+V  +GPQ+M+GYY+NP AT +AID  GW 
Sbjct  430   RGAAGQAIPGTETKIVDPETRKELPTGERGLVLLRGPQIMQGYYQNPEATAKAIDPEGWF  489

Query  785   NTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQI  606
             ++GDLGW+ P +           +VL GRAKDTIVL++GEN+EP  IE+A + S  I QI
Sbjct  490   DSGDLGWLTPEND----------LVLTGRAKDTIVLTNGENIEPLPIEDACLRSPYIDQI  539

Query  605   VVIGQDKRRLGALVLPHKEEV----LLAAKKLSVVDSDATEVSEEKTS-------KLIHE  459
             +++GQD + LGAL++P+ E +    +    +L + D + T  + +K +        L  +
Sbjct  540   MLVGQDCKSLGALIVPNLEALEKWAISQNLQLDIKDENVTSSTSQKINLESKIIQDLFRQ  599

Query  458   ELQKWTTGCTF-----QIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             EL +            +IGP  LI EPF+++NG++T T+K++R  V   Y + I  ++
Sbjct  600   ELNREVQNRPGYRPDDRIGPFRLILEPFSMENGMMTQTLKIKRHVVMQHYHDIINGMF  657



>ref|WP_006616497.1| long-chain fatty acid--CoA ligase [Arthrospira platensis]
 ref|YP_005067361.1| probable long-chain-fatty-acid--CoA ligase [Arthrospira platensis 
NIES-39]
 dbj|BAI88823.1| probable long-chain-fatty-acid--CoA ligase [Arthrospira platensis 
NIES-39]
 gb|KDR57759.1| long-chain fatty acid--CoA ligase [Arthrospira platensis str. 
Paraca]
Length=647

 Score =   447 bits (1149),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 258/663 (39%), Positives = 397/663 (60%), Gaps = 50/663 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDE----  2058
             +++P+IW   A++    +AL +P+  P   +++ +L  +I  FA GL+ +G++P E    
Sbjct  14    QSLPEIWPILAQQIPQQVALFNPHSQPEVQITYSDLWTQIQQFAAGLQQLGVEPAEDLPS  73

Query  2057  KIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSR  1878
             ++ALFAD+S RW++ADQGI+T GA NVVRG+ +  +EL  I  +S S  L VDN  +  +
Sbjct  74    RVALFADDSPRWMIADQGILTAGAANVVRGATADPQELAYILQNSGSTGLVVDNLALLHK  133

Query  1877  IAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQ  1698
             + +       +RF++LL  E   IT+E     PI ++++++  G +  M LL+    +  
Sbjct  134   LEKAIQD-LPIRFVVLLSDE--DITAEDSLSIPIVNFSQLMTKGED--MTLLNPPTTKL-  187

Query  1697  YTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPW  1518
                     +D+ATL+YTSGTTG PKGVMLTH N LHQ++ + D +   PG+  LS+LP W
Sbjct  188   --------EDLATLLYTSGTTGKPKGVMLTHRNFLHQLITIADVIAPQPGEIVLSILPTW  239

Query  1517  HAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSS  1338
             H+  R+ +Y+  S G   +YT +   K+DL+ ++PQY++SVP ++E++Y    KQ     
Sbjct  240   HSLGRSGQYYFLSRGTMVIYTNIRYFKQDLQEFKPQYMVSVPRIWESIYEAAQKQFRDGP  299

Query  1337  PARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHL  1158
               R+ +   F  +S  Y EA+RI + K     Q+  +   + L    A+    +L P+H 
Sbjct  300   ATRQKLVNFFFGMSNRYIEARRIVQ-KLTIPGQESNNNSSTAL----AKLQTIVLTPVHA  354

Query  1157  LARKLVYskihssigiska-gisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRR  981
             L  KL+Y K+  ++G      ISGGGSL+ H++ F+E + I L  GYGLTE+APV+  RR
Sbjct  355   LGDKLIYQKVRQAVGGKLKFAISGGGSLAMHLENFYEIVGIDLLVGYGLTETAPVLTARR  414

Query  980   PNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAID  801
             P  N+ GS G PI  TEI+++D ET +   PG KG+V A+GPQVM+GY++NP AT +AID
Sbjct  415   PGHNLRGSAGRPIPETEIRIIDPETRQTYEPGHKGLVLARGPQVMRGYFQNPEATDKAID  474

Query  800   ENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSN  621
               GW +TGDLGW+ P             +VL GRAKDTIVL++GEN+EP  IE+A + S 
Sbjct  475   PEGWFDTGDLGWLTPQKD----------LVLTGRAKDTIVLTNGENIEPQPIEDACVRSP  524

Query  620   LIQQIVVIGQDKRRLGALVLPHKEE-----------VLLAAKKLSVVDSDATEVSEEKTS  474
              I QIV++GQD++ LGAL++P+ +            + +  ++      +A  +  +   
Sbjct  525   YIDQIVLVGQDQKSLGALIVPNLDALKQWASGQGLGLQVPGEEQQGEAENAIAIDSQPIQ  584

Query  473   KLIHEELQ-KWTTGCTF----QIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIE  309
              L  +EL  +     +F    +IGP  LI EPFTIDNGLLT T+K++R  V + Y++ I+
Sbjct  585   SLFRQELTLQVKNRPSFRPDDRIGPFRLILEPFTIDNGLLTQTLKIKRPVVMERYRDMID  644

Query  308   DLY  300
             ++Y
Sbjct  645   EMY  647



>ref|WP_008190408.1| long-chain fatty acid--CoA ligase [Moorea producens]
 gb|EGJ29377.1| long-chain acyl-CoA synthetase [Moorea producens 3L]
Length=659

 Score =   447 bits (1150),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 273/663 (41%), Positives = 399/663 (60%), Gaps = 53/663 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPY----HNPP-TNLSFKELEKEIVSFAEGLRVIGLKP-  2064
             K++P+IW  AA+ FG+ IAL DP+    H  P + L++ +L ++I  FA GL+ +G +P 
Sbjct  28    KSIPEIWPLAAQRFGSIIALQDPHAVGAHGAPASTLTYTQLHEQIEQFAAGLQSLGFQPK  87

Query  2063  -DEK-----IALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAV  1902
              DEK     IALFADNS RWLVADQGIMT GA+NVVR  ++  +ELL I   S S AL V
Sbjct  88    LDEKGIPTRIALFADNSPRWLVADQGIMTAGAVNVVRSGQAERQELLYILQDSGSTALVV  147

Query  1901  DNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALL  1722
             ++ +   ++ +       +  +ILL  E+   T      R I +Y ++++ G    +   
Sbjct  148   EHLKTLEKLGDRLDG-LPIELVILLSEEQPLSTG---SSRQIVNYTQLMEAGASRSVT--  201

Query  1721  HSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDR  1542
                +A H       N + +ATL+YTSGTTG PKGVML+H NLLHQ+  L   + +   DR
Sbjct  202   ---KANH-------NRETLATLLYTSGTTGKPKGVMLSHGNLLHQVNTLGTVIEIQKSDR  251

Query  1541  FLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGI  1362
              LS+LP WHAYER+AEYF+ S G  Q+YT + ++K+DLK ++P +++ VP ++E++Y G+
Sbjct  252   VLSILPTWHAYERSAEYFLLSQGSTQIYTNLRHVKKDLKTFKPNFMVGVPRLWESIYEGV  311

Query  1361  LKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIA  1182
              KQ       ++ +    L  S  Y EA+R+ +G  LT D   PS +  +L    A   A
Sbjct  312   QKQFREQPEGKQKLVQNLLGFSQRYIEARRLAQG--LTLDNLNPSPIQKLL----ATVQA  365

Query  1181  ALLCPLHLLARKLVYskihssi-giskagisgggslssHVDKFFEAIDIKLQNGYGLTES  1005
             + L P+H LA KLVY K+  +  G  K  ISGGGSL+ H+D FFE I +++  GYGLTE+
Sbjct  366   SYLWPVHQLANKLVYQKVREATGGEIKQVISGGGSLARHLDNFFEIIGVEVLVGYGLTET  425

Query  1004  APVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNP  825
             +PV   RR   N+  S GPP+  T+I++VD ET + L  G  G+V  KGPQVM+ YY  P
Sbjct  426   SPVTNARRSYRNLRFSAGPPLPETQIRIVDPETHQPLPQGQTGLVMVKGPQVMQEYYHKP  485

Query  824   FATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEI  645
              AT +AID + W +TGDLGW+ P +           +VL GRAKDTIVL++GEN+EP  I
Sbjct  486   EATAKAIDRDRWFDTGDLGWVTPQND----------LVLTGRAKDTIVLTNGENIEPQPI  535

Query  644   EEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVL--LAAKKLSV------VDSDATEVS  489
             E+A + S  I QI+++GQD++ LGAL++P+ + +    AA+ L++      VD +  EV 
Sbjct  536   EDACLRSAYIDQIMLVGQDQKALGALIVPNLDALQGWAAAQNLTLDVFAQDVDLNTKEVQ  595

Query  488   EEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIE  309
                 ++L  E   +       +I    LI EPF+ +NG++T T K+RR  VT+ Y+  I+
Sbjct  596   TLYRTELNREVQNRPGYRQDDRISTFRLILEPFSQENGMMTQTFKIRRPVVTERYRAIID  655

Query  308   DLY  300
              ++
Sbjct  656   GMF  658



>ref|WP_017292788.1| hypothetical protein [Geminocystis herdmanii]
Length=638

 Score =   446 bits (1147),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 270/660 (41%), Positives = 400/660 (61%), Gaps = 54/660 (8%)
 Frame = -3

Query  2222  TVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALF  2043
             ++ +IW     +FG+ IAL DP+  P   L+++E+++ I  FA GL+ +G++  EKIALF
Sbjct  13    SLGEIWDLVVSQFGDIIALSDPHSQPKVELNYREVDRNIKQFASGLQSLGVESGEKIALF  72

Query  2042  ADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETF  1863
             ADNS RWL+ADQGI+  G ++ VR S++  +ELL I  HS+S  L + +     ++    
Sbjct  73    ADNSPRWLMADQGIIRNGCVDAVRSSQADRKELLYILGHSDSTVLVIQDLATLKKLEPEL  132

Query  1862  HSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEP  1683
                + ++ I+LL  E  +I +E    +PIY++ + ++LG  +              T+ P
Sbjct  133   KEFS-LKSIVLLSDE--AIETEF--AQPIYNFQQFMELGANN--------------TFTP  173

Query  1682  INSD--DVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAY  1509
             ++ D  D+ATL+YTSGTTG PKGVML+H NLLHQ+  L   +  +PGDR LS+LP WH+Y
Sbjct  174   VSQDIDDLATLIYTSGTTGQPKGVMLSHRNLLHQVRYLETVIKPLPGDRILSILPSWHSY  233

Query  1508  ERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPAR  1329
             ERAAEYF+ S G   +YT +   K DLK Y+P +++ VP ++E++Y G+ KQ    S  +
Sbjct  234   ERAAEYFLLSRGTTLIYTNIRYFKGDLKEYRPHFMVGVPRLWESIYEGVQKQFRDGSKNQ  293

Query  1328  KLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLAR  1149
             + I   FL +S  Y +A RI +G  LT D   PS +  +     A+  A LL PLH L  
Sbjct  294   QKIVSFFLSVSQKYLDATRIAQG--LTLDNLNPSSIEKIT----AQITALLLLPLHKLGD  347

Query  1148  KLVYskihssigiskag-isgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNC  972
             KLVY KI   +G      ISGGGSL+ H+D FF+ + I L  GYGLTE++PV   RR + 
Sbjct  348   KLVYQKIRDGVGGCVKTWISGGGSLAKHIDNFFQIVGIPLIVGYGLTETSPVTNARRLHR  407

Query  971   NVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENG  792
             N++G+ G PI  TEIK++D ET K L  G  G+V  KG QVM+GYYKNP AT +AID  G
Sbjct  408   NIVGASGQPITETEIKIIDLETKKTLPVGKIGLVCIKGTQVMQGYYKNPEATAKAIDSEG  467

Query  791   WLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQ  612
             W ++GDLG + P +           +V+ GRAKDTIVLS+GEN+EP  +E+A + S  I 
Sbjct  468   WFDSGDLGMVTPQND----------LVITGRAKDTIVLSNGENIEPQPLEDACVRSPYID  517

Query  611   QIVVIGQDKRRLGALVLPHKEEVLLAAK----KLSVVDSDAT-------EVSEEKTSKLI  465
             QI+V+GQD++ LGAL++P+ + +   A+     L+  D+ AT       ++  ++   L 
Sbjct  518   QIMVVGQDQKYLGALIVPNLDALQKWAQSQNLNLTFPDASATMDMIENSDLYAKEVLSLY  577

Query  464   HEELQKWTTGCTF-----QIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
              +EL +            +IG   LI EPF++DNG++T T+K++R  +T  Y++ I  ++
Sbjct  578   KQELAREVKNRAGYRPDDRIGAFKLILEPFSMDNGMMTQTLKIKRPVITSHYQDIINSMF  637



>ref|WP_038026639.1| long-chain fatty acid--CoA ligase [Synechococcus sp. PCC 7336]
Length=617

 Score =   445 bits (1144),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 258/646 (40%), Positives = 379/646 (59%), Gaps = 42/646 (7%)
 Frame = -3

Query  2222  TVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALF  2043
             T+P +W+  A+ +G+ +AL DP+  P   L+++++ ++ ++FA GL+ +G    E++A+ 
Sbjct  9     TLPTLWRELADCYGDRLALRDPHSKPTVELTYRQVYEQAIAFASGLQSLGCSGGERVAIV  68

Query  2042  ADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETF  1863
             A+NS RWL+AD G    G  N  R S +   EL  I  HS+S    V+N + + R+    
Sbjct  69    AENSPRWLIADIGTAMAGLANAPRSSAADARELAYILQHSDSRIAIVENAKTWQRLQPEL  128

Query  1862  HSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEP  1683
              +  D+  +ILL       + EV++G   +              A + ++   H +T   
Sbjct  129   -AGTDIEQVILL-------SDEVVEGCLTF--------------AAVQAKGRSHSFTPPD  166

Query  1682  INSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYER  1503
             ++ +D+ATL+YTSGTTG PKGVMLTH NL+HQ+  L   +P+  GDR LS+LP WHAYER
Sbjct  167   LSREDLATLIYTSGTTGRPKGVMLTHGNLMHQVEALRQLLPLNAGDRVLSILPTWHAYER  226

Query  1502  AAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKL  1323
             A EY + S GC+ +YT   +LK DLK  QP +L++VP ++E LY GI +Q+   +  ++ 
Sbjct  227   AGEYLVLSQGCQVIYTNPRHLKTDLKTEQPHFLVAVPRIWELLYDGIQQQLQRQTGLKQA  286

Query  1322  IALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKL  1143
             +A   L IS  Y   +RI       +++    + +S L   WA   A LL PLH L  +L
Sbjct  287   LARTCLAISHRYIVERRI------ARNESIQHFHISPLRRGWAALQAGLLAPLHQLGDRL  340

Query  1142  VYskihssig-iskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNV  966
             +Y  I  ++    +  ISGGGSL SH+D FFE   I + NGYGLTE+APV+A R P+ NV
Sbjct  341   IYRTIRQAVAPQLRYAISGGGSLPSHIDTFFEVTGIAVLNGYGLTETAPVLAGRGPSHNV  400

Query  965   LGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWL  786
              G++G  I  TEIK+VD ET   L  G  G+V A+GPQVM+GYY NP AT + +  +GW 
Sbjct  401   RGTVGRAIAETEIKIVDPETHTPLPAGRVGLVFARGPQVMQGYYNNPEATAKVLSSDGWF  460

Query  785   NTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQI  606
             NT DLGW+ P          +G +VL GRAKDTIVL +GEN+EP  +E+A   S  I QI
Sbjct  461   NTEDLGWLTP----------AGDLVLTGRAKDTIVLRNGENIEPVPLEDACSRSPYIDQI  510

Query  605   VVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATE---VSEEKTSKLIHEELQKWTTG  435
             VV+GQD++RLGAL+ P++E +    +   +   +  +   V E   S+L     Q+    
Sbjct  511   VVVGQDQKRLGALIYPNEEAIAAWGQSRGLPAENLLQQAAVRELIASELKQRIRQRPGYR  570

Query  434   CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
                 I    L+ E F+I+NGL+T T+K++R +VT+ Y E I  LY+
Sbjct  571   SDDTIADFCLVPEAFSIENGLMTQTLKIKRKQVTERYAEAIASLYE  616



>ref|WP_039201422.1| long-chain fatty acid--CoA ligase [Aphanizomenon flos-aquae]
 gb|KHG41649.1| long-chain fatty acid--CoA ligase [Aphanizomenon flos-aquae 2012/KM/D3]
Length=654

 Score =   446 bits (1147),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 250/655 (38%), Positives = 391/655 (60%), Gaps = 51/655 (8%)
 Frame = -3

Query  2219  VPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKP--------  2064
             +P+IW  AA++F + IAL +P+  P   +++ +L ++I  FA GL+ +G+          
Sbjct  34    LPEIWTLAAKKFDSIIALHNPHSKPEVKITYGQLSEQIQLFAAGLQALGINNHHSETLPY  93

Query  2063  DEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMY  1884
              E+++L ADNS RW +ADQGIMT GA+N VR +++  EELL I +HS S AL V++ +  
Sbjct  94    GERVSLIADNSPRWFIADQGIMTAGAVNAVRSAQADPEELLYIISHSGSTALVVEDIKTL  153

Query  1883  SRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLG-NESHMALLHSQEA  1707
             +++         ++ ++LL  E    T       P+ ++  ++++G N + +A  H+ E 
Sbjct  154   NKLGSGL-DELPIKLVVLLSDE----TPPTEFNFPVVNFTGLLEIGSNNTLVATKHTGET  208

Query  1706  RHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSML  1527
                          +ATL+YTSGTTG PKGVML+H+NLLHQ+ +L   +    GD  LS+L
Sbjct  209   -------------LATLIYTSGTTGKPKGVMLSHKNLLHQVKSLRAVLQPEKGDLVLSIL  255

Query  1526  PPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQIN  1347
             P WH+YER+ EYF+ S GC Q+YT + ++K DLK+++P Y+I+VP ++E++Y G+ KQ  
Sbjct  256   PTWHSYERSGEYFLISQGCTQIYTNLRSVKNDLKKFKPNYMIAVPRLWESIYEGVQKQFR  315

Query  1346  TSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCP  1167
                  ++ +    L +S  Y EA+RI +   L           S+++   A+    +L P
Sbjct  316   EQPAKKQSLVKFLLDMSQKYVEARRISQRLSLNHIH------TSLIERSQAKIAELVLLP  369

Query  1166  LHLLARKLVYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVA  990
             LH+L  KLVY+K+  + G     +  GG    +++D FFE + +++  GYGLTE++PV  
Sbjct  370   LHILGEKLVYAKVREATGGKIKHVISGGGALPAYIDNFFEIVGVEILQGYGLTETSPVTN  429

Query  989   CRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQ  810
              RRP  N+ GS G PI  TE+K+V+ ET + L  G +G+V  KGPQ+M+GYY+NP AT +
Sbjct  430   ARRPWRNLRGSSGQPIPGTEVKIVNPETRQPLPVGERGLVLLKGPQIMQGYYQNPEATNK  489

Query  809   AIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAM  630
             AID  GW ++GDLGW+ P +           +VL GRAKDTIVL++GEN+EP  IE+A +
Sbjct  490   AIDAEGWFDSGDLGWVTPEND----------LVLTGRAKDTIVLTNGENIEPQPIEDACL  539

Query  629   GSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQ  450
              S  I QI+++GQD+R +GAL++P+ E   LAA   S   ++  ++       L  +EL 
Sbjct  540   RSPYIDQIMLVGQDQRSIGALIVPNLEA--LAAWNQSQNHTEKIDLESRIVQDLFRQELN  597

Query  449   KWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             +            +IG   LI E F+I+NGL+T T+K+RR  V + Y + I+ ++
Sbjct  598   REVQNRPSYRADDRIGAFKLIEEQFSIENGLMTQTLKIRRHVVMERYCDIIDKMF  652



>ref|WP_009784468.1| long-chain fatty acid--CoA ligase [Lyngbya sp. PCC 8106]
 gb|EAW36976.1| AMP-dependent synthetase and ligase [Lyngbya sp. PCC 8106]
Length=648

 Score =   446 bits (1146),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 271/662 (41%), Positives = 400/662 (60%), Gaps = 52/662 (8%)
 Frame = -3

Query  2219  VPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKP------DE  2058
             +P+IW   A++ G  IAL DP+  P   LS+ EL  +I  FA GL+ +G++         
Sbjct  17    LPEIWPILAKKAGQAIALHDPHCQPDVILSYSELWLQIQQFAAGLQTLGVEAVNEESLPT  76

Query  2057  KIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSR  1878
             +IALFAD+S RW++ADQGIMT GA +VVRG+ +   EL+ I   S SV L V +  +  R
Sbjct  77    RIALFADDSPRWIIADQGIMTAGAADVVRGATADPAELVYILKDSGSVGLVVADLSLLQR  136

Query  1877  IAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQ  1698
             +  +      ++FI+LL  E+ + +SE+    P+ ++ ++++ G +  +        R  
Sbjct  137   LRSSIED-LPIKFIVLLSDEEPN-SSEI-PTLPVLNFTQLLNHGGDFTL--------RRP  185

Query  1697  YTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPW  1518
               Y     D +ATL+YTSGTTG PKGVMLTH NL+HQ+ ++ D V    GD  LS+LP W
Sbjct  186   GVY---GQDSLATLLYTSGTTGKPKGVMLTHGNLVHQLNSIPDVVQPEIGDNVLSLLPTW  242

Query  1517  HAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSS  1338
             H++ R  +YF+ S GC Q+Y+++   K DLK ++P+Y+ SVP ++E++Y    KQ+    
Sbjct  243   HSFGRIGQYFLLSRGCTQIYSSIRYFKRDLKEFKPRYMTSVPRIWESIYEAAQKQLGEQP  302

Query  1337  PARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHL  1158
              +R+ IA     +S  Y  A+R+ +G  LT D + P  +   +    AR    LL PLH 
Sbjct  303   ASRQKIAKFCFSLSEQYVLARRVVQG--LTLDGQSPGGMQKAM----ARLKMLLLTPLHQ  356

Query  1157  LARKLVYskihssigis-kagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRR  981
             LA KLVY KI ++ G   K  ISGGGSL+ H++ F+E + + L  GYGLTE++PV+  RR
Sbjct  357   LADKLVYQKIRAATGGMFKFAISGGGSLAMHLETFYEIVGVDLLVGYGLTETSPVLTARR  416

Query  980   PNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAID  801
             P  N+ GS G PI  TEI++VD ET + L    KG+V A+GPQ+MKGY++NP AT +AID
Sbjct  417   PKHNLRGSAGKPIPQTEIRIVDLETGRVLPRLEKGLVLARGPQIMKGYFENPEATAKAID  476

Query  800   ENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSN  621
               GW NTGD+GW+        SR +   +VL GRAKDTIVLS+GEN+EP  IE+A + S 
Sbjct  477   PEGWFNTGDIGWL--------SRQND--LVLTGRAKDTIVLSNGENIEPQPIEDACVRSP  526

Query  620   LIQQIVVIGQDKRRLGALVLPHKE--EVLLAAKKL--------SVVDSDATEVSEEKTSK  471
              I Q++++GQD++ LGAL++P+ E  E    ++ L        SV DS+  ++  +    
Sbjct  527   YIDQMILVGQDQKVLGALIVPNFEGLEKWAVSQNLKLKLPHSESVNDSEGLDLESQPVQN  586

Query  470   LIHEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIED  306
             L  +EL +            +IGP  LI EPFT++NG+LT T+K++R  V + Y++ I  
Sbjct  587   LFRQELNREVKNRPSYRVDDRIGPFRLILEPFTMENGMLTQTLKIKRPIVMERYRDMINA  646

Query  305   LY  300
             +Y
Sbjct  647   MY  648



>ref|WP_038093147.1| long-chain fatty acid--CoA ligase [Tolypothrix bouteillei]
 gb|KIE13159.1| long-chain fatty acid--CoA ligase [Tolypothrix bouteillei VB521301]
Length=662

 Score =   446 bits (1147),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 260/663 (39%), Positives = 397/663 (60%), Gaps = 54/663 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P+IW  AA+EFG+ +AL +P+  P   +++ +L ++I  FA GL+ +G+K  ++++L
Sbjct  32    ESIPEIWPLAAKEFGSTVALHNPHSQPEEVITYTQLSQQIQQFAAGLQALGVKEGDRVSL  91

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
              ADN  RWL+ADQGIMT GA N VR S++  EE+L I  +S S AL V++ +  +++   
Sbjct  92    IADNCPRWLIADQGIMTAGAANAVRSSQAEREEVLYIIANSGSTALVVEDLKTLNKLQAR  151

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
                   ++ I+LL  E    T    +   + ++++++++G            A+H  T  
Sbjct  152   L-LELPIQLIVLLTEE----TPPANNNLKVLNFSQLMEIG------------AKHTLTPI  194

Query  1685  PINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYE  1506
                 + +ATL+YTSGTTG PKGVMLTH NLLHQ+L L   V   P D  LS+LP WH+YE
Sbjct  195   KRTRETLATLIYTSGTTGKPKGVMLTHGNLLHQVLVLRSVVQPQPEDTVLSILPTWHSYE  254

Query  1505  RAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARK  1326
             R+ EYF+ S GC QVYT + ++K DLK++QP++ I VP ++E++Y  + KQ       ++
Sbjct  255   RSGEYFLLSQGCTQVYTNLRSIKRDLKKFQPRFTIGVPRLWESIYEAVQKQFREQPENKQ  314

Query  1325  LIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARK  1146
              +   FL+IS  + +A+RI +G  L  +  +PS      + L A A A+ L PLH L  +
Sbjct  315   RLINFFLEISEKFIKARRIAQG--LDLENLKPSR----FEQLAASAQASALYPLHALGER  368

Query  1145  LVYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
             +VYSK+  + G     +  GG     H+D FFE I +++  GYGLTE+APV   RRP  N
Sbjct  369   IVYSKVREATGGKIKQMISGGGALPKHIDDFFEIIGVEILVGYGLTETAPVTHARRPWRN  428

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             + GS G  I  TE K+VD ET K L  G +G+V  +GPQVM+GYY+NP AT +AID  GW
Sbjct  429   LRGSAGQAIPGTETKIVDPETRKPLPTGERGLVLLRGPQVMEGYYQNPEATAKAIDTEGW  488

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              ++GDLGW+ P +           +VL GRAKDTIVL++GEN+EP  IE+A + S  I Q
Sbjct  489   FDSGDLGWLTPQND----------LVLTGRAKDTIVLTNGENIEPQPIEDACLRSPYIDQ  538

Query  608   IVVIGQDKRRLGALVLP---------HKEEVLLA------AKKLSVVDSDATEVSEEKTS  474
             I+++GQD+R +GAL++P         H + +LL+      A+ LS   +   ++  +   
Sbjct  539   IMLVGQDQRSIGALIVPNLETLQKWAHSQNLLLSLPGEATAETLSNTVAAEVDLESKMVQ  598

Query  473   KLIHEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIE  309
              L  +EL +            +IGP  LI EPF+ +NG++T T+K +R  V + Y++ I+
Sbjct  599   DLFRQELNREVQNRPGYRADDRIGPFKLILEPFSTENGMMTQTLKTKRHVVMEHYRDIID  658

Query  308   DLY  300
              ++
Sbjct  659   GMF  661



>ref|WP_015210069.1| AMP-forming long-chain acyl-CoA synthetase [Cylindrospermum stagnale]
 ref|YP_007149512.1| AMP-forming long-chain acyl-CoA synthetase [Cylindrospermum stagnale 
PCC 7417]
 gb|AFZ26832.1| AMP-forming long-chain acyl-CoA synthetase [Cylindrospermum stagnale 
PCC 7417]
Length=658

 Score =   446 bits (1146),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 245/659 (37%), Positives = 396/659 (60%), Gaps = 50/659 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P++W   A+ FGN +AL +P+  P   +++ +L +++  FA GL+ +G K  + I+L
Sbjct  32    ESLPEVWPVTAKAFGNQVALRNPHAKPEVVVTYTQLAEQMQQFAAGLQALGFKQGDSISL  91

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
              ADNS RW +ADQGIMT G +N VR +++  EELL I  +S+S AL V++ +  +++ + 
Sbjct  92    IADNSPRWFIADQGIMTAGVVNAVRSAQAEREELLFIIANSDSTALVVEDLKTLNKLQQG  151

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
              +    ++ +ILL  +++  T E +    + ++++++++G            A+H +   
Sbjct  152   LND-LPIQLVILL-SDETPPTDEFIK---VLNFSQLMEVG------------AKHNFVPV  194

Query  1685  PINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYE  1506
               N D +ATL+YTSGTTG PKGVML+H NLLHQ+  L   V    GD+ LS+LP WH+YE
Sbjct  195   KQNDDTLATLIYTSGTTGKPKGVMLSHGNLLHQVKALGAVVQPQVGDKVLSILPSWHSYE  254

Query  1505  RAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARK  1326
             R+ EYF+ S GCEQ+YT + ++K DLK+++P+++I+VP ++E++Y G+ KQ       ++
Sbjct  255   RSGEYFLLSQGCEQIYTNLRSVKADLKKFKPRFMIAVPRLWESIYEGVQKQFREQPANKQ  314

Query  1325  LIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARK  1146
              +    L IS  Y +A RI E   L           S  + L +R +A+ L P H L  +
Sbjct  315   RLIKFLLGISEKYIKAGRIAENLSLEH------LDASTFERLASRILASALFPFHALGER  368

Query  1145  LVYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
             LVY+K+  + G     +  GG     H+D FFE   +++  GYGLTE++PV   RRP  N
Sbjct  369   LVYAKVREATGGRIKYVISGGGALPKHIDNFFEITGVEILVGYGLTETSPVTHARRPWRN  428

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
               G+ G PI  TE K+VD E+ K L+   +G+V  +GPQ+M+GYY+NP AT +AID  GW
Sbjct  429   FRGTAGQPIPGTEAKIVDPESRKPLAARERGLVLLRGPQIMQGYYQNPEATAKAIDAEGW  488

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              ++GDLGW+ P +           +VL GRAKDTIVL++GEN+EP  IE+A + S  + Q
Sbjct  489   FDSGDLGWLTPEND----------LVLTGRAKDTIVLTNGENIEPQPIEDACLRSPYVDQ  538

Query  608   IVVIGQDKRRLGALVLPHKE---------EVLLAAKKLSVVDSDATEVSEEKT--SKLIH  462
             I+++GQD+R +GA+++P+ E          + L+ +  ++  S   +++ E T    L  
Sbjct  539   IMLVGQDQRCIGAIIVPNIEALEKWAEGQNLTLSIQSENITASPGQKINLESTIIQDLFR  598

Query  461   EELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             +EL +            +I    LI EPF+++NGL+T T+K+RR  V + Y++ I+ ++
Sbjct  599   QELNREVQNRPGYRADDRINRFKLIVEPFSMENGLMTQTLKIRRHVVMERYRDTIDGMF  657



>ref|WP_017319808.1| long-chain fatty acid--CoA ligase [cyanobacterium PCC 7702]
Length=659

 Score =   446 bits (1146),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 259/658 (39%), Positives = 396/658 (60%), Gaps = 50/658 (8%)
 Frame = -3

Query  2222  TVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALF  2043
             ++P+IW  AA  FGN +AL DP+  P   L++ +L ++I  FA GL+ + +K  ++++L 
Sbjct  33    SLPEIWPLAARRFGNIVALRDPHAKPEVVLTYTQLCQQIQQFAAGLQTLEVKQGDRVSLI  92

Query  2042  ADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETF  1863
             ADNS RW +ADQGIMT G +N VR S++ +EEL+ I  +S S  L  ++ + + R+ +  
Sbjct  93    ADNSPRWFIADQGIMTAGGVNAVRSSQAELEELIYILANSGSTILVAEDLKTFYRLQKRL  152

Query  1862  HSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEP  1683
              +   +R +ILL  E    T    +   IYS+ +++++G ++ +  +             
Sbjct  153   EA-LPIRLVILLSDE----TPPAAETFQIYSFAQLMEIGQKNTLQAVKQ-----------  196

Query  1682  INSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYER  1503
                D +ATL+YTSGTTG PKGVML+H NLLHQ+  L   V   PGD  LS+LP WH+YER
Sbjct  197   -TRDQLATLIYTSGTTGKPKGVMLSHGNLLHQVTTLGVVVQPQPGDIVLSILPIWHSYER  255

Query  1502  AAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKL  1323
              AEYF+ SLGC QVY+ + ++K DLK ++P Y+++VP + E++Y G+ KQ +    +R+ 
Sbjct  256   TAEYFLLSLGCTQVYSNLRSIKRDLKEFKPHYMVAVPRLLESIYEGVQKQFHEQPASRQH  315

Query  1322  IALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKL  1143
             +    L++S  Y +A+R  EG  L      PS+     + L A   AA L PLH LA++L
Sbjct  316   LINFCLRVSEKYIQARRTAEGLNLLN--LNPSW----SERLAALIQAAALKPLHSLAQRL  369

Query  1142  VYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNV  966
             VYSK+  + G        GG     H+D FFE I +++  GYGLTE++PV   RR   N+
Sbjct  370   VYSKVREATGGRIKQTISGGGALPKHIDDFFEIIGVEILVGYGLTETSPVTHARRYWRNL  429

Query  965   LGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWL  786
              GS G PI  T++K+VD ET K L  G +G+V  +GPQ+M+GYY+NP AT +AID  GW 
Sbjct  430   RGSAGQPIPATQVKIVDPETRKPLPVGKQGLVLLRGPQIMQGYYQNPEATAKAIDSEGWF  489

Query  785   NTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQI  606
             ++GDLGW+ P +           ++L GRAKDTIVL +GEN+EP  IE+A + S  I+QI
Sbjct  490   DSGDLGWVTPEND----------LILTGRAKDTIVLRNGENIEPQPIEDACLRSPYIEQI  539

Query  605   VVIGQDKRRLGALVLPHKEEVLLAAK----KLSVVDSDATEVSEEKT---SKLIH----E  459
             V++GQD++ LGAL++P+ + +   A+    +L + D + T  + +     SK+I     +
Sbjct  540   VLVGQDQKSLGALIVPNLQALQKWAESQNLQLCIEDKNVTSSTGQTINLESKIIQDLFRQ  599

Query  458   ELQKWTTGCTF-----QIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             EL +            +IGP  LI EPF+I+NG++T  + ++R  V + Y++ I  ++
Sbjct  600   ELNREVQNRPGYRPDDRIGPFKLILEPFSIENGMMTQKLSIKRHVVLERYRDLINAMF  657



>ref|WP_017662217.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=656

 Score =   445 bits (1144),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 271/656 (41%), Positives = 402/656 (61%), Gaps = 49/656 (7%)
 Frame = -3

Query  2213  DIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLK-PDE--KIALF  2043
             ++W  AA+ FG   AL DP+H     LS+ +L ++I  FA GL+ +G++  DE  ++ALF
Sbjct  33    EVWAIAADRFGQLTALHDPHHYDDLRLSYHKLWQQIRQFATGLQSLGIQLADEPPRVALF  92

Query  2042  ADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDN----PEMYSRI  1875
             A+NS RWLVADQGI+  GA NVVR S++  +ELL I+ HS+S  L V++     ++ S  
Sbjct  93    AENSPRWLVADQGIIAAGAANVVRSSQADRDELLYIFQHSQSSGLVVEDLATLDKLRSAT  152

Query  1874  AETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQY  1695
              ++   +  + ++ILL  E      E M  R + ++ +++++G            A   +
Sbjct  153   DDSLKLNDTLTWVILLSDETPP---EEMPFR-VLNFTQLMEIG------------ASGDF  196

Query  1694  TYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWH  1515
                 +  + +ATL+YTSGTTG PKG MLTH N LHQI       P  PGDR LS+LP WH
Sbjct  197   RSPAVTRETLATLIYTSGTTGRPKGAMLTHGNFLHQINAFRSVFPPEPGDRALSILPSWH  256

Query  1514  AYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSP  1335
             AYER  EY++ S GC  +YT++ + K+DLK+++P  ++ VP ++E++Y G+ K      P
Sbjct  257   AYERTCEYYLLSQGCTLIYTSIRHFKQDLKQHKPHVMVGVPRLWESIYEGVQKTFRQQPP  316

Query  1334  ARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLL  1155
              ++ +A  F+ IS  Y EAK   +G  L+ D   PS L      L A+A  A L PLH L
Sbjct  317   KKQKLANFFIDISERYIEAKHRSQG--LSLDATPPSKLQR----LKAKAKKAALSPLHRL  370

Query  1154  ARKLVYskihssigiska-gisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRP  978
               KLVYSK+ ++ G      ISGGGSL+ H+D FFE I I L  GYGLTE++PV+  RR 
Sbjct  371   GSKLVYSKVRAATGGHVKYLISGGGSLARHIDTFFEVIGINLLVGYGLTETSPVLTVRRA  430

Query  977   NCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDE  798
               N+ GS G P+  TEI +V+ ET + L  G  G+V A+GPQ+MKGYY+NP AT++AID 
Sbjct  431   WENLQGSSGLPVIDTEICIVNPETREVLPEGETGLVLARGPQIMKGYYRNPEATQKAIDP  490

Query  797   NGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNL  618
              GW +TGDLG ++P            ++VL GRAKDTIVLS+GEN+EP  IE+A + S  
Sbjct  491   QGWFDTGDLGRLLPGK----------YLVLTGRAKDTIVLSNGENIEPQPIEDACVRSAY  540

Query  617   IQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSV-VDSDAT---EVSEEKTSKLIHEELQ  450
             I QI+++GQD+++LGAL++P+ E +   A +  + V+++AT   ++  ++  KL   EL 
Sbjct  541   IDQIMLVGQDRKQLGALIVPNWEALTQWATEQGISVNAEATPPVDIEGDRVKKLFRGELN  600

Query  449   KWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             +            +IGP  LI EPF+I+NG +T T+K++R  V + Y++ I+ +++
Sbjct  601   REVKNRPGYRTDDRIGPFCLILEPFSIENGSMTQTLKIKRPVVRERYRDTIDKMFE  656



>ref|WP_036481162.1| long-chain fatty acid--CoA ligase [Myxosarcina sp. GI1]
Length=633

 Score =   444 bits (1141),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 256/656 (39%), Positives = 394/656 (60%), Gaps = 48/656 (7%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++ +I    AE+FG+ +AL DP+  P   ++++EL +++  FA GL+ +GLKP +K+A 
Sbjct  9     QSLTEITPITAEKFGDVVALHDPHSKPEVKITYRELNRQVGYFAAGLQALGLKPQDKVAF  68

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             FADNS RW + D+ IMT G ++VVR + +  +EL+ I  +S+S +L V+N ++++++   
Sbjct  69    FADNSPRWFIGDRAIMTAGGVDVVRSAGAEQQELVYILQNSDSTSLVVENLKIWTKLRSQ  128

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
                 + ++F+ILL  E+   T  +     + +Y ++IDLG ES +  +            
Sbjct  129   LKDLS-LQFVILLSDEQPESTESL----KVLNYQQLIDLGKESQLQSVQQ----------  173

Query  1685  PINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYE  1506
               +   +ATL+YTSGTTG PKGVMLTH NLLHQ+  +        GD+ LS+LP WHAYE
Sbjct  174   --DKQTLATLLYTSGTTGKPKGVMLTHGNLLHQVNAIETIFQPQAGDKLLSILPSWHAYE  231

Query  1505  RAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARK  1326
             RA EYF  + GC Q+YT +   K+DL  ++P Y++ VP ++E+L+ GI KQ+   SP+++
Sbjct  232   RAGEYFFLAHGCTQIYTNIRYFKKDLTEHKPVYMMGVPRLWESLHDGIQKQLKEQSPSQQ  291

Query  1325  LIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARK  1146
              +   FL  S  Y  AKRI     L        + VS L    AR  A  L P+H LA +
Sbjct  292   KLVKFFLDRSERYIIAKRIANNASLDH------FKVSGLARANARLEAIALAPVHKLADR  345

Query  1145  LVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNV  966
             LVY KI +++G  +A  SGGGSL+ ++D F+E I I +  GYGL+E++P+   R P  NV
Sbjct  346   LVYRKIRAAVGGIEAVCSGGGSLARYLDDFYETIGIDVFVGYGLSETSPITNARTPVHNV  405

Query  965   LGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWL  786
              G+ G P+  TEIK+VD +T + L  G  G+V  +G QVM+GYY N  AT +AID  GW 
Sbjct  406   RGTAGKPLPETEIKIVDPQTRETLPQGETGLVLIRGTQVMQGYYNNLEATAKAIDSEGWF  465

Query  785   NTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQI  606
             ++GDLGW+ P++           +VL GRAKDTIVL++GEN+EP  IE+A + S  I+QI
Sbjct  466   DSGDLGWVTPDND----------LVLTGRAKDTIVLTNGENIEPQPIEDACVRSIYIEQI  515

Query  605   VVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVSEEKTS---------KLIHEEL  453
             +++GQD+R LGAL++P+ + +   AK+ + +D   +E S+   S          L   EL
Sbjct  516   MLVGQDQRSLGALIVPNIDNLQQWAKEQN-IDFQQSESSQGINSANLNNPAIENLYRSEL  574

Query  452   QKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
              +             +    LI EPF+I+ G +T T+K++R  V + Y++ IE+++
Sbjct  575   NREIKNRPGYRADDLVKTFRLILEPFSIEAGTMTQTLKIKRPVVRERYRDIIEEMF  630



>ref|WP_011057141.1| long-chain fatty acid--CoA ligase [Thermosynechococcus elongatus]
 ref|NP_682091.1| long-chain-fatty-acid CoA ligase [Thermosynechococcus elongatus 
BP-1]
 dbj|BAC08853.1| long-chain-fatty-acid CoA ligase [Thermosynechococcus elongatus 
BP-1]
Length=658

 Score =   444 bits (1143),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 262/660 (40%), Positives = 380/660 (58%), Gaps = 49/660 (7%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P++W   A+  G+ +AL  PY +PPT +++ EL + I  FA GL+ +G+   +++AL
Sbjct  31    QSLPEMWPLLAQRHGDVVALDAPYEDPPTRITYSELYQRIQRFAAGLQALGVAAGDRVAL  90

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             F DNS RWL+ADQG M  GAINVVR   +  +ELL I   S +  L ++N     ++ E 
Sbjct  91    FPDNSPRWLIADQGSMMAGAINVVRSGTADAQELLYILRDSGATLLLIENLATLGKLQEP  150

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
                   V+ ++LL GE   +    +    + ++ ++   G    +  +            
Sbjct  151   L-VDTGVKTVVLLSGESPELAGFPLR---LLNFGQVFTEGQYGTVRAVA-----------  195

Query  1685  PINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYE  1506
              I  D++ATL+YTSGTTG PKGVM+TH  LL QI+NLW  V    GDR LS+LP WHAYE
Sbjct  196   -ITPDNLATLMYTSGTTGQPKGVMVTHGGLLSQIVNLWAIVQPQVGDRVLSILPIWHAYE  254

Query  1505  RAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARK  1326
             R AEYF+F+ GC Q YT + + K DLKR +P Y+I+VP ++E+ Y G+ KQ+  S   ++
Sbjct  255   RVAEYFLFACGCSQTYTNLRHFKNDLKRCKPHYMIAVPRIWESFYEGVQKQLRDSPATKR  314

Query  1325  LIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARK  1146
              +A  FL +   Y   +R+  G  LT    +         WL AR    LL PL+ L  K
Sbjct  315   RLAQFFLSVGQQYILQRRLLTGLSLTNPHPR-----GWQKWL-ARVQTLLLKPLYELGEK  368

Query  1145  LVYskihssigiskagisgggslss-HVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
              +YSKI  + G     +  GG   + H+D F+E I++++  GYGLTE+A V+  RR   N
Sbjct  369   RLYSKIREATGGEIKQVISGGGALAPHLDTFYEVINLEVLVGYGLTETAVVLTARRSWAN  428

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             + GS G PI  T IK+VD ET   L  G KG+V AKGPQVM+GYY  P AT + +D  GW
Sbjct  429   LRGSAGRPIPDTAIKIVDPETKAPLEFGQKGLVMAKGPQVMRGYYNQPEATAKVLDAEGW  488

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              +TGDLG++ PN          G +VL GR KDTIVLS+GEN+EP  IE+A + S  I Q
Sbjct  489   FDTGDLGYLTPN----------GDLVLTGRQKDTIVLSNGENIEPQPIEDACVRSPYIDQ  538

Query  608   IVVIGQDKRRLGALVLPHKE--EVLLAAK--KLSVVDSDATEVSEEKTS-----------  474
             I+++GQD++ LGAL++P+ E  E  + AK  +L + +  A   S E  +           
Sbjct  539   IMLVGQDQKALGALIVPNLEALEAWVVAKGYRLELPNRPAQAGSGEVVTLESKVIIDLYR  598

Query  473   -KLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
              +L+ E   +       +I     + EPFTI+NGLLT T+K+RR  V+D Y++ I  +++
Sbjct  599   QELLREVQNRPGYRPDDRIATFRFVLEPFTIENGLLTQTLKIRRHVVSDRYRDMINAMFE  658



>ref|WP_015118913.1| AMP-forming long-chain acyl-CoA synthetase [Rivularia sp. PCC 
7116]
 ref|YP_007055891.1| AMP-forming long-chain acyl-CoA synthetase [Rivularia sp. PCC 
7116]
 gb|AFY55344.1| AMP-forming long-chain acyl-CoA synthetase [Rivularia sp. PCC 
7116]
Length=663

 Score =   444 bits (1143),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 267/665 (40%), Positives = 403/665 (61%), Gaps = 58/665 (9%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNL-SFKELEKEIVSFAEGLRVIGLKPD---E  2058
             +++P+IW  AA +FG+  AL +P+  P   + ++++L  +I  FA GL+ +G+KP+    
Sbjct  33    ESLPEIWSIAASQFGDITALHNPHAKPKQEIFTYRQLFNQIQQFAAGLQALGVKPEAGIS  92

Query  2057  KIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSR  1878
             +I+L ADNS RW +ADQGIMT GA++ VR S++ V+EL  I  +S+S AL   +   + +
Sbjct  93    RISLIADNSPRWFIADQGIMTAGAVDAVRSSQADVDELAYILANSDSNALVAQDLATFEK  152

Query  1877  IAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQ  1698
             +         ++ +ILL  E+S  T EV+    ++++ +++++G            A+H 
Sbjct  153   LRPRLDD-LPIQLVILL-TEESPPTEEVIK---VFNFGQLMEIG------------AKH-  194

Query  1697  YTYEPI--NSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLP  1524
                EP+  + D +ATL+YTSGT+G PKGVML+H NLL+Q+ NL   V    GD  LS+LP
Sbjct  195   -NLEPVKRSRDSLATLLYTSGTSGKPKGVMLSHGNLLYQVRNLRAIVQPEAGDVVLSILP  253

Query  1523  PWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINT  1344
              WH  ER  EYF+ S GC QVYT + ++K DLK+Y+P Y+I+VP + E++Y G+ KQ   
Sbjct  254   TWHVLERTGEYFLLSQGCTQVYTNLRSIKNDLKKYKPHYMIAVPRILESVYEGVQKQFRE  313

Query  1343  SSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPL  1164
                +++ +   FL IS  Y +A+RI   + L      PS    +   +  +A    L PL
Sbjct  314   QPTSKQNLINRFLGISGKYIQARRI--AQNLDLQNLNPSTGERIAASIQEKA----LSPL  367

Query  1163  HLLARKLVYskihssigiskagis-gggslssHVDKFFEAIDIKLQNGYGLTESAPVVAC  987
             H LA K+VY K+  + G        GGG+L+ H+D F+E I I++  GYGLTE++PV   
Sbjct  368   HALAGKIVYGKVKEATGGRIKQFICGGGALAKHIDDFYEIIGIEILVGYGLTETSPVTHA  427

Query  986   RRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQA  807
             RR   N+ GS G  +  TE+K+VD ET K L+P  KG+V  KGPQ+M+GYYKNP ATK+A
Sbjct  428   RRHWSNLRGSSGLGVPGTEVKIVDLETRKELAPTEKGLVLLKGPQIMQGYYKNPEATKKA  487

Query  806   IDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMG  627
             ID  GW ++GDLGW+ P             IVL GRAKDTIVL++GEN+EP  IE+A + 
Sbjct  488   IDSEGWFDSGDLGWVTPRLD----------IVLTGRAKDTIVLTNGENIEPLPIEDACLR  537

Query  626   SNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAK----KLSVVDSDATEVSEEKT---SKL  468
             S+ I QI+++GQDK+ LGA ++P+ E +   A+    +L V + + T  + +K    SK+
Sbjct  538   SSFIDQIMLVGQDKKSLGAFIVPNVEALEKWAEAQNLELCVKEDNVTSSTSQKINLESKM  597

Query  467   IHEELQKWTTGCTF---------QIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQ  315
             I +  ++  T             +IGP  LI EPF+++NG++T T+KVRR  V + Y + 
Sbjct  598   IQDLFRQELTREVRNRPGYRPDDRIGPFKLILEPFSMENGMMTRTLKVRRHVVMERYHDM  657

Query  314   IEDLY  300
             IE ++
Sbjct  658   IERMF  662



>gb|AHJ26688.1| Long-chain-fatty-acid--CoA ligase [Nodularia spumigena CCY9414]
Length=635

 Score =   442 bits (1138),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 259/650 (40%), Positives = 387/650 (60%), Gaps = 47/650 (7%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             KT+P+IW  AA+ F N +A+ DP+  P  ++++ EL ++I  FA GL+ +G+    K+ L
Sbjct  24    KTLPEIWSIAAQRFSNVVAVHDPHAKPDVSMTYIELWEQIQQFAAGLQSLGVSLRAKVGL  83

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             F++N+ RWL+ADQGIM  GA++ VR S++S +EL+ I  +SE+ AL V+N    +++ E 
Sbjct  84    FSENNLRWLIADQGIMVAGAVDAVRSSQASQDELIYILRNSEATALVVENQATLNKLVEQ  143

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
              H    ++  I+L  E+     E   G  + ++++I+++G+                T+ 
Sbjct  144   IHD-LPIKLAIVLSDEEV----ETHPGLKVLNFSQIMEIGSNQ--------------TFS  184

Query  1685  PINS--DDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHA  1512
             P+    + +ATLVYTSGTTG PK  ML+H NLLHQ+ +L   V +  GDR LS+LP WH 
Sbjct  185   PVEQTRESLATLVYTSGTTGQPKATMLSHGNLLHQVSSLAVVVQLEAGDRVLSILPTWHI  244

Query  1511  YERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPA  1332
             YER  EYF FS GC  +YT + + K+DLK  +PQY +SVP + E+++  + KQ    S  
Sbjct  245   YERVIEYFAFSQGCTLIYTNLRHFKQDLKVQKPQYFVSVPRLLESIHDEVHKQFRQESAQ  304

Query  1331  RKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLW----ARAIAALLCPL  1164
             ++ +    L +S  Y  A+RI     L+ +Q+ PS        +W    AR   A+L P+
Sbjct  305   KRRLINYMLAMSDRYIRARRIVH--RLSLEQQNPS--------MWQRQRARTQTAILWPI  354

Query  1163  HLLARKLVYskihssigiskagis-gggslssHVDKFFEAIDIKLQNGYGLTESAPVVAC  987
             H LA +L+Y K+   IG        GGGSLS  ++ F+E I I++  GYGLTE+A  +  
Sbjct  355   HALADRLIYKKVREQIGAELKQTICGGGSLSPSLETFYEIIGIEVLVGYGLTETAAALTT  414

Query  986   RRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQA  807
             RRP  N+ GS G PI  TEI +VD +T K L  G KG+V A+GPQ+M+GYY NP AT +A
Sbjct  415   RRPEHNLRGSAGIPIPGTEIWIVDPKTRKTLPQGEKGLVLARGPQIMQGYYHNPEATNKA  474

Query  806   IDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMG  627
             I+  GW NT DLG++               +VL GR KDTIVLS+GENVEP  IE A + 
Sbjct  475   INPKGWFNTEDLGFLTAQQD----------LVLTGREKDTIVLSNGENVEPEPIENACLR  524

Query  626   SNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSV-VDSDATEVSEEKTSKLIHEELQ  450
             S+ I QIVV+GQD+R LGAL++P+ + +   A+   + ++ D+  V      +L  E   
Sbjct  525   SDYIDQIVVVGQDRRSLGALIVPNWDNLEEWAENQGLQLNLDSQPVQNLFRQELDREVRN  584

Query  449   KWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             +       +I P  LI+EPF+ +NG+LT T+K++R  VT+ Y + I +++
Sbjct  585   RPGYSSNDRIVPFRLISEPFSQENGMLTQTLKIKRHVVTERYSDLINEMF  634



>ref|WP_023067609.1| AMP-binding enzyme family protein [Lyngbya aestuarii]
 gb|ERT06168.1| AMP-binding enzyme family protein [Lyngbya aestuarii BL J]
Length=648

 Score =   443 bits (1139),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 270/662 (41%), Positives = 395/662 (60%), Gaps = 52/662 (8%)
 Frame = -3

Query  2219  VPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKP------DE  2058
             +P+IW   A++ G  IAL DP+  P   LS+ +L  +I  FA GL+ +G++         
Sbjct  17    LPEIWPILAKKAGQGIALHDPHCQPEVILSYSDLWLQIQQFAAGLQTLGVEAVHEEALPT  76

Query  2057  KIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSR  1878
             +IALFAD+S RW++ADQGIMT GA +VVRG+ +   EL+ I   S SV L V +  +  R
Sbjct  77    RIALFADDSPRWIIADQGIMTAGAADVVRGATADPAELVYILKDSGSVGLVVTDLSLLKR  136

Query  1877  IAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQ  1698
             +  +      ++FIILL  E+    S  +   P+ ++ ++++ G +  +        R  
Sbjct  137   LRSSIED-LPIKFIILLSDEEPD--SSEIPTLPVLNFTQLLNHGGDFTL--------RRP  185

Query  1697  YTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPW  1518
               Y       +ATL+YTSGTTG PKGVMLTH NL+HQ+  + D V    GD  LS+LP W
Sbjct  186   AVY---GQQSLATLLYTSGTTGKPKGVMLTHGNLVHQLNTIPDVVQPEIGDNVLSLLPTW  242

Query  1517  HAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSS  1338
             H++ R  +YF+ S GC QVY+++   K DLK ++P+Y+ SVP ++E++Y    KQ+    
Sbjct  243   HSFGRIGQYFLLSRGCTQVYSSIRYFKRDLKEFKPRYMTSVPRIWESIYEAAQKQLGEQP  302

Query  1337  PARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHL  1158
              +R+ IA     +S  Y  A+R+ +G  LT D + P  +   +    AR    LL PLH 
Sbjct  303   ASRQKIAKFCFSVSEQYVLARRVVQG--LTLDGQSPGGMQKAI----ARLKMLLLTPLHQ  356

Query  1157  LARKLVYskihssigis-kagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRR  981
             LA +LVY KI ++ G   K  ISGGGSL+ H++ F+E + + L  GYGLTE++PV+  RR
Sbjct  357   LADRLVYQKIRAATGGMFKFAISGGGSLAMHLETFYEIVGVDLLVGYGLTETSPVLTARR  416

Query  980   PNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAID  801
             PN N+ GS G PI  TEI++VD ET + LS   KG+V A+GPQ+MKGY++NP AT +AID
Sbjct  417   PNHNLRGSAGKPIPQTEIRIVDLETRRVLSRLEKGLVLARGPQIMKGYFENPEATAKAID  476

Query  800   ENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSN  621
               GW NTGD+GW+        SR +   +VL GRAKDTIVLS+GEN+EP  IE+A + S 
Sbjct  477   PEGWFNTGDIGWL--------SRQND--LVLTGRAKDTIVLSNGENIEPQPIEDACVRSP  526

Query  620   LIQQIVVIGQDKRRLGALVLPHKE--EVLLAAKKLS--------VVDSDATEVSEEKTSK  471
              I Q++++GQD++ LGAL++P+ E  E   A++ L         V D +  ++       
Sbjct  527   YIDQMILVGQDQKVLGALIVPNFEGLEKWAASQNLKLKLPHSELVNDGEGLDLESAPVQD  586

Query  470   LIHEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIED  306
             L  +EL +            +IGP  LI EPFT++NG+LT T+K++R  V + Y++ I  
Sbjct  587   LFRKELNREVKNRPSYRVDDRIGPFRLILEPFTMENGMLTQTLKIKRPVVMERYRDMINA  646

Query  305   LY  300
             +Y
Sbjct  647   MY  648



>ref|WP_019505659.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=642

 Score =   442 bits (1138),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 261/658 (40%), Positives = 397/658 (60%), Gaps = 49/658 (7%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P++W+ AA++FG+ IAL DP+  P   +++++L  +I  FA GL+++G+KP +K+AL
Sbjct  16    ESLPEVWQIAADKFGDTIALKDPHAKPEVVITYQDLLTQIQQFAAGLQILGIKPQDKVAL  75

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             FADNS RW +ADQGIMT G ++VVR S +  +EL  I  HS+S +L V+N +  +++   
Sbjct  76    FADNSPRWFIADQGIMTAGGVDVVRSSGAEQQELAYILEHSDSTSLVVENLKTLAKLDPQ  135

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
               +   ++ I+LL  E   + +E    + I ++ ++++LG  + +      +   QY   
Sbjct  136   L-ADLPIQLIVLLSDE---VPAEEQSIKTI-NFPQLMELGANNSL------QPVQQY---  181

Query  1685  PINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYE  1506
                 D +ATL+YTSGTTG PKGVML+H NLLHQ+  +       PGD  LS+LP WH+YE
Sbjct  182   ---KDTLATLLYTSGTTGRPKGVMLSHGNLLHQVNYVKTVFQPEPGDVLLSILPSWHSYE  238

Query  1505  RAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARK  1326
             RAAEYF  + G  Q+YT +   K+DLK ++P Y++ VP ++E+LY G+ K +   S +++
Sbjct  239   RAAEYFFLAHGGTQIYTNIRFFKQDLKEFRPTYMVGVPRLWESLYDGVQKLLGEQSESQQ  298

Query  1325  LIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARK  1146
              +  LFLK S  Y  AKRI     L        +  S +    A   A  L PLH LA K
Sbjct  299   KLVKLFLKQSERYIMAKRIANDTSLEH------FDASSIQRSLADLKAGSLYPLHALADK  352

Query  1145  LVYskihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNV  966
             LVY KI   +G  KA  SGGGSL+ ++D F+E I + +  GYGLTE++P+   R P  N+
Sbjct  353   LVYRKIREGVGNIKAVCSGGGSLAKYLDDFYETIGVDVFVGYGLTETSPITNARTPKHNI  412

Query  965   LGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWL  786
              GS G P+  TEIK+VD +T + L  G +G+V  +G QVM+GYYKNP AT +AID  GW 
Sbjct  413   RGSAGQPLPETEIKIVDPQTRQELPQGQRGLVLIRGTQVMQGYYKNPEATAKAIDPEGWF  472

Query  785   NTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQI  606
             ++GDLG++ P +           +VL GRAKDTIVL++GEN+EP  IE+A + S  I Q+
Sbjct  473   DSGDLGFVTPEND----------LVLTGRAKDTIVLTNGENIEPQPIEDACVRSIYIDQM  522

Query  605   VVIGQDKRRLGALVLPHKEEVLLAAK------KLSVVDSDATEVSE-----EKTSKLIHE  459
             +++GQD+R LGAL++P+ E + L         KL   DS   E+++     +  + L  +
Sbjct  523   MLVGQDQRSLGALIVPNLETLQLWITEQNLDLKLPSQDSSPEEIAQSSLNHKAIADLYRD  582

Query  458   ELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             EL +            +I    LI +PF+  NG++T T K++R  V + Y+  I++++
Sbjct  583   ELNREVKNRPGYRADDRITNFRLIPQPFSQANGMMTQTFKIKRPIVREKYQNLIKEMF  640



>ref|WP_027841906.1| long-chain fatty acid--CoA ligase [Mastigocoleus testarum]
Length=657

 Score =   442 bits (1138),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 262/657 (40%), Positives = 393/657 (60%), Gaps = 50/657 (8%)
 Frame = -3

Query  2219  VPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFA  2040
             +P+IW  A ++FG+ +AL  P+ +     ++ EL ++I SFA GL+ +G+K  + ++L A
Sbjct  33    LPEIWSLAVKKFGDNVALHAPHIDSGVTFTYAELFEKIQSFASGLQGLGVKAGDCVSLIA  92

Query  2039  DNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFH  1860
             DNS RWL+ADQGIMT GA+N VR  ++  EELL I  +SES  L V++ + + ++ E   
Sbjct  93    DNSPRWLIADQGIMTAGAVNAVRSCQADREELLYILGNSESTGLIVEDVKTFEKLYEGL-  151

Query  1859  SHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPI  1680
             +   +  +ILL  E    T    D   + ++ ++++LG ++ +     Q  + +Y     
Sbjct  152   TDLPIDKVILLSDE----TPPANDNVRVLNFTQLLELGAKTKL-----QPVKKKY-----  197

Query  1679  NSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERA  1500
               +D+ATL+YTSGTTG PKGVML+H NLLHQ+ NL   V    GD  LS+LP WH YER+
Sbjct  198   --EDLATLMYTSGTTGKPKGVMLSHGNLLHQVRNLGVVVQPEVGDTILSILPTWHVYERS  255

Query  1499  AEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLI  1320
             AEYF+ S GC+QVYT + ++K+DLK ++P Y++ VP + E++Y G+ KQ       ++  
Sbjct  256   AEYFLLSQGCKQVYTNLRSIKKDLKEFKPHYVVCVPRLLESIYEGVQKQFREQPAEKQGS  315

Query  1319  ALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLV  1140
                FL IS  Y +A+RI +   L+ D    S+       L A   A+ L P+H+LA +L+
Sbjct  316   ISKFLNISEKYIQAQRITQ--QLSLDHLNSSF----SQRLTAIGQASALYPMHVLAGQLI  369

Query  1139  Yskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVL  963
             Y K+  + G     +  GG     H+D FFE I +++  GYGLTE++PV   RR   N+ 
Sbjct  370   YKKVREATGGRIKQMISGGGALPKHIDNFFEIIGVEILVGYGLTETSPVTHARRHRTNLR  429

Query  962   GSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLN  783
             GS G PI  TE K+VD ET +AL  G +G+V  +GPQ+M+GYY+NP AT +AID  GW N
Sbjct  430   GSSGKPIPGTETKIVDPETRQALPIGKQGLVLLRGPQIMQGYYQNPEATAKAIDTEGWFN  489

Query  782   TGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIV  603
             +GDLGW+               +VL GRAKDTIVL++GEN+EP  IE+A + S  I QI+
Sbjct  490   SGDLGWVTSYQD----------LVLTGRAKDTIVLTNGENIEPQPIEDACLRSPYIDQIM  539

Query  602   VIGQDKRRLGALVLPHKEEVLLAAK----KLSVVDSDATEVSEEKTS-------KLIHEE  456
             ++GQDK+ +GAL++P+ E +   AK    +L + + + TE S +K +        L  EE
Sbjct  540   LVGQDKKFIGALIVPNLETLEQWAKNQDLELCLPEDNVTEESSQKINLEGRMIQDLFREE  599

Query  455   LQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             L +            +I    LI EPF+ +NG++T T+K+RR  V + Y + IE ++
Sbjct  600   LNREVRNRPGYRGDDRIVRFKLILEPFSKENGMMTQTLKIRRHVVVEHYHDTIEQMF  656



>ref|WP_008052332.1| long-chain fatty acid--CoA ligase [Arthrospira sp. PCC 8005]
 emb|CCE17673.1| putative long-chain-fatty-acid-CoA ligase, AMP dependent [Arthrospira 
sp. PCC 8005]
 emb|CDM96523.1| putative long-chain-fatty-acid-CoA ligase, AMP dependent [Arthrospira 
sp. PCC 8005]
Length=647

 Score =   442 bits (1137),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 257/663 (39%), Positives = 394/663 (59%), Gaps = 50/663 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDE----  2058
             +++P+IW   A++    +AL +P+  P   +++ +L  +I  FA G++ +G++P E    
Sbjct  14    QSLPEIWPILAQQIPQQVALFNPHSQPEVQITYSDLWTQIQQFAAGVQQLGVEPAEDLPS  73

Query  2057  KIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSR  1878
             ++ALFAD+S RW++ADQGI+T GA NVVRG+ +  +EL  I  +S S  L VDN  +  +
Sbjct  74    RVALFADDSPRWMIADQGILTAGAANVVRGATADPQELAYILQNSGSTGLVVDNLALLHK  133

Query  1877  IAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQ  1698
             + +       +RF++LL  E   IT+E     PI +++++I  G +  M LL+    +  
Sbjct  134   LEKAIQD-LPIRFVVLLSDE--DITAEDSLSIPIVNFSQLITKGED--MTLLNPPTTKL-  187

Query  1697  YTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPW  1518
                     +D+ATL+YTSGTTG PKGVMLTH N LHQ++ + D +   PG+  LS+LP W
Sbjct  188   --------EDLATLLYTSGTTGKPKGVMLTHRNFLHQLITIADVIAPQPGEIVLSILPTW  239

Query  1517  HAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSS  1338
             H+  R+ +Y+  S G   +YT +   K+DL+ ++PQY++SVP ++E++Y    KQ     
Sbjct  240   HSLGRSGQYYFLSRGTMVIYTNIRYFKQDLQEFKPQYMVSVPRIWESIYEAAQKQFRDGP  299

Query  1337  PARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHL  1158
               R+ +   F  +S  Y EA+RI + K     Q       + L    A+    LL P+H 
Sbjct  300   ATRQKLVNFFFGMSNRYIEARRIVQ-KLTIPGQGSNQNSSTAL----AKLQTILLTPVHA  354

Query  1157  LARKLVYskihssigiska-gisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRR  981
             L  KL+Y K+  ++G      ISGGGSL+ H++ F+E + I L  GYGLTE+APV+  RR
Sbjct  355   LGDKLIYQKVRQAVGGKLKFAISGGGSLAMHLENFYEIVGIDLLVGYGLTETAPVLTARR  414

Query  980   PNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAID  801
             P+ N+ GS G PI  TEI+++D ET +   PG KG+V A+GPQVM GY++NP AT +AID
Sbjct  415   PSHNLRGSAGRPIPETEIRIIDPETRQTCEPGYKGLVLARGPQVMTGYFQNPEATDKAID  474

Query  800   ENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSN  621
               GW +TGDLGW+ P             +VL GRAKDTIVL++GEN+EP  IE+A + S 
Sbjct  475   PEGWFDTGDLGWLTPQKD----------LVLTGRAKDTIVLTNGENIEPQPIEDACVRSP  524

Query  620   LIQQIVVIGQDKRRLGALVLPHKE-----------EVLLAAKKLSVVDSDATEVSEEKTS  474
              I QIV++GQD++ LGAL++P+ +            + +  ++      +A  +  +   
Sbjct  525   YIDQIVLVGQDQKSLGALIVPNLDALKQWASGQGLHLQVPGEEQQGETENAIAIDSQPIQ  584

Query  473   KLIHEELQ-KWTTGCTF----QIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIE  309
              L  +EL  +     +F    +IG   LI EPF+IDNGLLT T+K++R  V + Y++ I+
Sbjct  585   SLFRQELNLQVKNRPSFRPDDRIGQFRLILEPFSIDNGLLTQTLKIKRPVVMERYRDMID  644

Query  308   DLY  300
             ++Y
Sbjct  645   EMY  647



>ref|WP_035159130.1| long-chain fatty acid--CoA ligase [Calothrix sp. 336/3]
 gb|KFB84322.1| long-chain fatty acid--CoA ligase [Calothrix sp. 336/3]
Length=651

 Score =   442 bits (1137),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 251/658 (38%), Positives = 390/658 (59%), Gaps = 50/658 (8%)
 Frame = -3

Query  2222  TVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALF  2043
             ++P+IW    ++FG  +AL DP+  P   +++ +L  +I  FA GL+ +G++  ++++L 
Sbjct  26    SLPEIWSLVGQKFGKIVALRDPHSKPEVVVTYAQLSDQIRKFAAGLQALGIQAGDRLSLI  85

Query  2042  ADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETF  1863
             ADNS RWL+ADQGIM  G ++ VR S++  EELL I  +S S AL V++ +  +++ E  
Sbjct  86    ADNSTRWLIADQGIMMAGGVDAVRSSQAEKEELLFIITNSGSKALVVEDRKTLNKLRERL  145

Query  1862  HSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEP  1683
                  ++F+ILL    SS ++   D   I +++++I+LG   +   +H            
Sbjct  146   DD-LPIQFVILL----SSESAPPEDNLKILNFSQLIELGTNHNFTPVHQ-----------  189

Query  1682  INSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYER  1503
                D +ATL+YTSGTTG PKGVML+H NLLHQ+ +L   V   PGD  LS+LP WH+YER
Sbjct  190   -TRDTLATLIYTSGTTGQPKGVMLSHGNLLHQVNSLGTVVQPEPGDIVLSILPTWHSYER  248

Query  1502  AAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKL  1323
             + EYF+ S GC QVYT + ++K DLK+YQP ++I+VP + E++Y G+ KQ      +++ 
Sbjct  249   SCEYFLLSQGCTQVYTNLRSVKGDLKKYQPHFMIAVPRLLESIYEGVQKQFREQPESKQK  308

Query  1322  IALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKL  1143
             +    L  S  Y +A+R  +G  L       +   S  + L A   A +  PLH L  KL
Sbjct  309   LVKTLLGFSQKYIQARRTAQGLNLQ------NIYASAGEKLIATLQAGIFSPLHALGEKL  362

Query  1142  VYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNV  966
             +YSK+  + G     +  GG     HVD FFE + +++  GYGLTE++PV   RRP  N+
Sbjct  363   IYSKVREATGGRIKYMISGGGALPKHVDDFFETVGVEILVGYGLTETSPVTHVRRPWRNI  422

Query  965   LGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWL  786
              G+ G  I  TE K+VD ET K L  G +G+V  +GPQ+M+GYY+NP AT +AID  GW 
Sbjct  423   RGAAGQTILGTEAKIVDPETRKDLPVGERGLVLLRGPQIMQGYYQNPEATAKAIDSQGWF  482

Query  785   NTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQI  606
             ++GDLG +           ++  ++L GRAKDTIVL++GEN+EP  IE+A + S  I QI
Sbjct  483   DSGDLGLL----------TTANDLILTGRAKDTIVLTNGENIEPQPIEDACLRSPYIDQI  532

Query  605   VVIGQDKRRLGALVLPHKEEVLLAAK----KLSVVDSDATEVSEEKT---SKLIHEELQK  447
             +++GQD+R LGAL++P+ E +   A+    +L +  ++ T  + +     SK+I +  ++
Sbjct  533   MLVGQDQRSLGALIVPNVEALAAWAESQNLQLCIPQNNVTTATSQHINLESKIIQDLFRQ  592

Query  446   WTT---------GCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
               T             +I    LI EPF+++NG++T T+K+RR  V + Y++ I  ++
Sbjct  593   ELTREVQNRPGYRADDRITVFRLILEPFSMENGMMTQTLKIRRHIVMEHYRDMINAMF  650



>ref|WP_035759345.1| long-chain fatty acid--CoA ligase [Arthrospira platensis]
Length=647

 Score =   442 bits (1137),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 257/663 (39%), Positives = 394/663 (59%), Gaps = 50/663 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDE----  2058
             +++P+IW   A++    +AL +P+  P   +++ +L  +I  FA GL+ +G++P E    
Sbjct  14    QSLPEIWPILAQQIPQQVALFNPHSQPEVQITYSDLWTQIQQFAAGLQQLGVEPAEDLPN  73

Query  2057  KIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSR  1878
             ++ALFAD+S RW++ADQGI+T GA NVVRG+ +  +EL  I  +S S  L VDN  +  +
Sbjct  74    RVALFADDSPRWMIADQGILTAGAANVVRGATADPQELAYILQNSGSTGLVVDNLALLHK  133

Query  1877  IAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQ  1698
             + +       +RF++LL  E   IT+E     PI +++++I  G +  M LL+    +  
Sbjct  134   LEKAIQD-LPIRFVVLLSDE--DITAEDSLSIPIVNFSQLITKGED--MTLLNPPTTKL-  187

Query  1697  YTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPW  1518
                     +D+ATL+YTSGTTG PKGVMLTH N LHQ++ + D +   PG+  LS+LP W
Sbjct  188   --------EDLATLLYTSGTTGKPKGVMLTHRNFLHQLITIADVIAPQPGEIVLSILPTW  239

Query  1517  HAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSS  1338
             H+  R+ +Y+  S G   +YT +   K+DL+ ++PQY++SVP ++E++Y    KQ     
Sbjct  240   HSLGRSGQYYFLSRGTMVIYTNIRYFKQDLQEFKPQYMVSVPRIWESIYEAAQKQFRDGP  299

Query  1337  PARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHL  1158
               R+ +   F  +S  Y +A+RI + K     Q       + L    A+    LL P+H 
Sbjct  300   ATRQKLVNFFFGMSNRYIQARRIVQ-KLTIPGQGSNQNSSTAL----AKLQTILLTPVHA  354

Query  1157  LARKLVYskihssigiska-gisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRR  981
             L  KL+Y K+  ++G      ISGGGSL+ H++ F+E + I L  GYGLTE+APV+  RR
Sbjct  355   LGDKLIYQKVRQAVGGKLKFAISGGGSLAMHLENFYEIVGIDLLVGYGLTETAPVLTARR  414

Query  980   PNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAID  801
             P+ N+ GS G PI  TEI+++D ET +   PG KG+V A+GPQVM GY++NP AT +AID
Sbjct  415   PSHNLRGSAGRPIPETEIRIIDPETRQTCEPGYKGLVLARGPQVMTGYFQNPEATDKAID  474

Query  800   ENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSN  621
               GW +TGDLGW+ P             +VL GRAKDTIVL++GEN+EP  IE+A + S 
Sbjct  475   PEGWFDTGDLGWLTPQKD----------LVLTGRAKDTIVLTNGENIEPQPIEDACVRSP  524

Query  620   LIQQIVVIGQDKRRLGALVLPHKE-----------EVLLAAKKLSVVDSDATEVSEEKTS  474
              I QIV++GQD++ LGAL++P+ +            + +  ++      +A  +  +   
Sbjct  525   YIDQIVLVGQDQKSLGALIVPNLDALKQWASGQGLHLQVPGEEQQGETENAIAIDSQPIQ  584

Query  473   KLIHEELQ-KWTTGCTF----QIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIE  309
              L  +EL  +     +F    +IG   LI EPF+IDNGLLT T+K++R  V + Y++ I+
Sbjct  585   SLFRQELNLQVKNRPSFRPDDRIGQFRLILEPFSIDNGLLTQTLKIKRPVVMERYRDMID  644

Query  308   DLY  300
             ++Y
Sbjct  645   EMY  647



>ref|WP_008318746.1| AMP-forming long-chain acyl-CoA synthetase [Leptolyngbya sp. 
PCC 6406]
Length=657

 Score =   442 bits (1137),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 272/662 (41%), Positives = 394/662 (60%), Gaps = 55/662 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P+IW  A + +G+  AL DP+++P   LS++EL   I +FA GL+ +G+KP   IAL
Sbjct  30    QSLPEIWPLAIQYYGDRPALEDPHNSPKARLSYRELGAAIATFATGLQQLGVKPRSAIAL  89

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             FADNS RWL+ADQGIM  G  + VR + +  +EL  I  HSES  L + + +++ R+ + 
Sbjct  90    FADNSHRWLIADQGIMIAGCYDAVRSAVADGKELRYIAEHSESTTLVLQDLKLWRRL-QP  148

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
                   +   ILL  E   I  E    + + ++++++DLG              HQ T  
Sbjct  149   LLVGLPLHLGILLSDE---IPPEDAPCK-MVNFSQLMDLG--------------HQGTLT  190

Query  1685  PI--NSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHA  1512
             P+   + D+ATL+YTSGTTG PKGVM+ H NLLHQI  L   +    GDR L +LP WH 
Sbjct  191   PVPQTAHDLATLIYTSGTTGQPKGVMIRHRNLLHQIQTLGAVIQPAIGDRVLGLLPTWHT  250

Query  1511  YERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPA  1332
             + R AEYFI+S GC Q Y+ +  +K D K  +P +++ VP ++E++Y G+ KQ      +
Sbjct  251   FGRTAEYFIYSQGCTQTYSNIRTIKADFKTVKPHFMVGVPRLWESIYEGVQKQFREQPES  310

Query  1331  RKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLA  1152
             ++ +    L  S  Y E +R      L      P      L    +R  +    P HLL 
Sbjct  311   KQRLVNALLWHSQKYVENRRTANSLALDHPNASP------LRQFGSRIFSFAFLPGHLLG  364

Query  1151  RKLVYskihssigi-skagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPN  975
              KLVYSK+  + G   KA ISGGGSL+ H+D FFE I++ +  GYGLTE++PV++ RRP 
Sbjct  365   EKLVYSKVREATGGCVKALISGGGSLARHLDLFFEIINVPVLVGYGLTETSPVLSARRPW  424

Query  974   CNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDEN  795
              N+ G+ G PI  TEI+VVD ET + L  G KG+V A+GPQVM+GYYKNP AT +A+D +
Sbjct  425   RNLRGASGQPIPGTEIRVVDPETHQPLPLGQKGLVMARGPQVMEGYYKNPEATAKALDAD  484

Query  794   GWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLI  615
             GW +TGDLGWI        +R+++  IVL GRAKDTIVL++GEN+EP  IE+A + S  I
Sbjct  485   GWFDTGDLGWI--------TRDAN--IVLTGRAKDTIVLTNGENIEPQPIEDACIRSPYI  534

Query  614   QQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSV---VDSDATEVSEE-KTSKLIHEELQK  447
              QI+++GQD+R LGALV+P+ + +   A+   +   V  D+T +  E +T  L  + +QK
Sbjct  535   DQIMLVGQDQRSLGALVVPNLDALQKWAEPQGLYIEVPGDSTSIPPEFQTISLEDDRVQK  594

Query  446   WTTG-------------CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIED  306
                G                ++GP  L+ EPF+I+NG LT T+KVRR  VT+ Y++ I  
Sbjct  595   LFRGELNAQVKDRPGYRPDDRVGPFRLVPEPFSIENGALTQTLKVRRPVVTERYRDMING  654

Query  305   LY  300
             ++
Sbjct  655   MF  656



>ref|WP_006624419.1| long-chain fatty acid--CoA ligase [Arthrospira maxima]
 gb|EDZ95756.1| AMP-dependent synthetase and ligase [Arthrospira maxima CS-328]
 gb|EKD07699.1| AMP-dependent synthetase and ligase [Arthrospira platensis C1]
Length=648

 Score =   442 bits (1136),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 257/663 (39%), Positives = 394/663 (59%), Gaps = 50/663 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDE----  2058
             +++P+IW   A++    +AL +P+  P   +++ +L  +I  FA GL+ +G++P E    
Sbjct  15    QSLPEIWPILAQQIPQQVALFNPHSQPEVQITYSDLWTQIQQFAAGLQQLGVEPAEDLPN  74

Query  2057  KIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSR  1878
             ++ALFAD+S RW++ADQGI+T GA NVVRG+ +  +EL  I  +S S  L VDN  +  +
Sbjct  75    RVALFADDSPRWMIADQGILTAGAANVVRGATADPQELAYILQNSGSTGLVVDNLALLHK  134

Query  1877  IAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQ  1698
             + +       +RF++LL  E   IT+E     PI +++++I  G +  M LL+    +  
Sbjct  135   LEKAIQD-LPIRFVVLLSDE--DITAEDSLSIPIVNFSQLITKGED--MTLLNPPTTKL-  188

Query  1697  YTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPW  1518
                     +D+ATL+YTSGTTG PKGVMLTH N LHQ++ + D +   PG+  LS+LP W
Sbjct  189   --------EDLATLLYTSGTTGKPKGVMLTHRNFLHQLITIADVIAPQPGEIVLSILPTW  240

Query  1517  HAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSS  1338
             H+  R+ +Y+  S G   +YT +   K+DL+ ++PQY++SVP ++E++Y    KQ     
Sbjct  241   HSLGRSGQYYFLSRGTMVIYTNIRYFKQDLQEFKPQYMVSVPRIWESIYEAAQKQFRDGP  300

Query  1337  PARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHL  1158
               R+ +   F  +S  Y +A+RI + K     Q       + L    A+    LL P+H 
Sbjct  301   ATRQKLVNFFFGMSNRYIQARRIVQ-KLTIPGQGSNQNSSTAL----AKLQTILLTPVHA  355

Query  1157  LARKLVYskihssigiska-gisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRR  981
             L  KL+Y K+  ++G      ISGGGSL+ H++ F+E + I L  GYGLTE+APV+  RR
Sbjct  356   LGDKLIYQKVRQAVGGKLKFAISGGGSLAMHLENFYEIVGIDLLVGYGLTETAPVLTARR  415

Query  980   PNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAID  801
             P+ N+ GS G PI  TEI+++D ET +   PG KG+V A+GPQVM GY++NP AT +AID
Sbjct  416   PSHNLRGSAGRPIPETEIRIIDPETRQTCEPGYKGLVLARGPQVMTGYFQNPEATDKAID  475

Query  800   ENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSN  621
               GW +TGDLGW+ P             +VL GRAKDTIVL++GEN+EP  IE+A + S 
Sbjct  476   PEGWFDTGDLGWLTPQKD----------LVLTGRAKDTIVLTNGENIEPQPIEDACVRSP  525

Query  620   LIQQIVVIGQDKRRLGALVLPHKE-----------EVLLAAKKLSVVDSDATEVSEEKTS  474
              I QIV++GQD++ LGAL++P+ +            + +  ++      +A  +  +   
Sbjct  526   YIDQIVLVGQDQKSLGALIVPNLDALKQWASGQGLHLQVPGEEQQGETENAIAIDSQPIQ  585

Query  473   KLIHEELQ-KWTTGCTF----QIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIE  309
              L  +EL  +     +F    +IG   LI EPF+IDNGLLT T+K++R  V + Y++ I+
Sbjct  586   SLFRQELNLQVKNRPSFRPDDRIGQFRLILEPFSIDNGLLTQTLKIKRPVVMERYRDMID  645

Query  308   DLY  300
             ++Y
Sbjct  646   EMY  648



>ref|WP_021830165.1| Long-chain-fatty-acid--CoA ligase [Crocosphaera watsonii]
 emb|CCQ50524.1| Long-chain-fatty-acid--CoA ligase [Crocosphaera watsonii WH 8502]
Length=638

 Score =   441 bits (1135),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 260/658 (40%), Positives = 394/658 (60%), Gaps = 54/658 (8%)
 Frame = -3

Query  2213  DIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADN  2034
             ++W  AA++F + +AL DP   P   L++ EL +++  FA GL+ +G+ PD+KI+L ADN
Sbjct  15    EVWAIAAKKFPDIVALHDPNSKPAVKLTYAELYQKLQQFAAGLQALGVSPDDKISLIADN  74

Query  2033  SCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSH  1854
             S RW +ADQG M  GA N VR +++   EL  I   S+S  L V+N +   +I  +F   
Sbjct  75    SPRWFIADQGSMLAGAANAVRSAQADKNELAYIVRDSDSSTLIVENQKTLDKI-RSFCDE  133

Query  1853  ADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPI--  1680
               ++ IILL  E    T    D     +++++++LG ++ +              +P+  
Sbjct  134   TPLQLIILLSDE----TPNRDDPIKTLNFSQLMELGAKNSL--------------QPVKK  175

Query  1679  NSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERA  1500
             N  D+ATL+YTSGTTG PKG ML+H NLLHQ+ NL   +    GD+ LS+LP WH+YER+
Sbjct  176   NDTDLATLIYTSGTTGQPKGAMLSHGNLLHQVKNLDAVIQPKVGDQVLSILPSWHSYERS  235

Query  1499  AEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLI  1320
             AEYF+ S GC  VYT + N K D+KR++PQ+++ VP +++++Y GI KQ+   S  ++ I
Sbjct  236   AEYFLLSQGCTLVYTNIRNFKTDIKRFKPQHMVGVPRLWDSIYEGIQKQLREKSDTQQKI  295

Query  1319  ALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLV  1140
             A  F  IS  +  ++RI +   L        +  S +D   A+     L PLH L  KLV
Sbjct  296   AQFFFNISQNFILSRRIADNMSLEH------FDASAIDRFIAKLKTIFLAPLHGLGDKLV  349

Query  1139  Yskihssigis-kagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVL  963
             YSKI   +G + +  +SGGGSL+ H+D F+E I++ +  GYGLTE++PV   R  + N+ 
Sbjct  350   YSKIREGLGGNFETLMSGGGSLAKHLDDFYEIINVPVLVGYGLTETSPVSNARTHSHNLR  409

Query  962   GSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLN  783
             GS G PI HTEIK+VD +T +A+S G +G+V  +GPQVM+GYYK P AT +AID  GW N
Sbjct  410   GSSGQPIPHTEIKIVDLDTGEAVSRGKRGVVLIRGPQVMQGYYKKPEATAKAIDPEGWFN  469

Query  782   TGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIV  603
             +GDLGWI P +           +V+ GRAKDTIVL++GEN+EP  IE+A + S  I Q++
Sbjct  470   SGDLGWITPMND----------LVITGRAKDTIVLNNGENIEPQPIEDACVRSPYIDQMM  519

Query  602   VIGQDKRRLGALVLPHKEEVLLAAK----KLSVVDSDA-------TEVSEEKTSKLIHEE  456
             ++GQD++ LGAL++P+ + +    K     L+    DA       +++  +    L  +E
Sbjct  520   LVGQDQKALGALIVPNLDALQTWGKNQQLNLTFPSEDASRETIINSDLYGKPVQDLFKQE  579

Query  455   LQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             L++            QI    LI EPF+ +NG++T T+K++R  VT+ Y+  I  +++
Sbjct  580   LKREVKNRPGYRADDQIKVFELILEPFSSENGMMTQTLKIKRPIVTERYQGMINGMFE  637



>ref|WP_015189613.1| Long-chain-fatty-acid--CoA ligase [Gloeocapsa sp. PCC 7428]
 ref|YP_007128904.1| Long-chain-fatty-acid--CoA ligase [Gloeocapsa sp. PCC 7428]
 gb|AFZ31744.1| Long-chain-fatty-acid--CoA ligase [Gloeocapsa sp. PCC 7428]
Length=655

 Score =   441 bits (1134),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 251/655 (38%), Positives = 392/655 (60%), Gaps = 45/655 (7%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDE----  2058
             +++P+IW+ A + FG  IAL DP+  P T +++ +L ++I  FA  L+ + ++       
Sbjct  32    QSLPEIWQLAHQRFGKTIALRDPHATPETVITYTQLYQQIQQFAAALQALEIEVKNGDIP  91

Query  2057  -KIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYS  1881
              +IAL +DNS RWL+ADQGI+  GA NVVR S++  +ELL I  +S S+AL V+N +   
Sbjct  92    PRIALISDNSPRWLIADQGIIAAGAANVVRSSQAERQELLFILENSGSIALVVENQQTLQ  151

Query  1880  RIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARH  1701
             ++     S   + F +LL  E     +  +    + ++++++ LG    +  +       
Sbjct  152   KLRADLDS-LPISFAVLLSDEIPEADASKLK---VLNFSQLMTLGENQPLQPVQQ-----  202

Query  1700  QYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPP  1521
                    N + +ATL+YTSGTTG PKGVMLTH NLLHQ+  L   V    GDR LS+LP 
Sbjct  203   -------NRETLATLMYTSGTTGKPKGVMLTHGNLLHQVEMLGCIVQPKEGDRVLSILPT  255

Query  1520  WHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTS  1341
             WH YER  EYF+ S GC Q+YT +  +K+D++ ++P Y++ VP ++E++Y G+ KQ    
Sbjct  256   WHVYERTCEYFLLSQGCTQIYTNIRQVKKDIREFKPNYMVGVPRLWESIYEGVKKQFREQ  315

Query  1340  SPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLH  1161
                ++ +   FL  S  + EA+RI  G  L       S   S+ + L A   A  L P+H
Sbjct  316   PANKQQLIDFFLTKSQQFIEARRIVHGLSLN------SLNPSLSERLSASVQATALAPIH  369

Query  1160  LLARKLVYskihssi-giskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACR  984
              L  K+VY K+  +  G  K  ISGGGSL+ H++ FFE + +++  GYGLTE++PV   R
Sbjct  370   ALGEKIVYRKVREATGGQLKQVISGGGSLAMHLENFFEIVGVEVLVGYGLTETSPVTNAR  429

Query  983   RPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAI  804
             RP  N+ GS G P+  T++++VD ET + L  G +G+V  +GPQ+M+GYY+NP AT +AI
Sbjct  430   RPWRNLRGSAGQPLPGTQVRIVDPETRQPLPQGERGLVMVRGPQIMQGYYQNPEATAKAI  489

Query  803   DENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGS  624
             D  GW +TGDLGW+ P +           +V+ GRAKDTIVL++GEN+EP  IE+A + S
Sbjct  490   DSEGWFDTGDLGWLTPEND----------LVITGRAKDTIVLTNGENIEPQPIEDACLRS  539

Query  623   NLIQQIVVIGQDKRRLGALVLPHKE--EVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQ  450
               I QI+++GQD++ LGAL++P+ E  E   A++ + +     T+++ +    L  +EL 
Sbjct  540   PYIDQIMLVGQDQKSLGALIVPNLEALEQWAASQNIELKVDSPTDLNSKTIQNLFRQELN  599

Query  449   KWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             +            +IGP  L+ EPF+++NG++T T+K++R  VT+ Y++ I  ++
Sbjct  600   REVKNRPGYRPDDRIGPFELVLEPFSMENGMMTQTLKIKRPVVTERYRDIINKMF  654



>ref|WP_007304012.1| long-chain fatty acid--CoA ligase [Crocosphaera watsonii]
 gb|EAM52359.1| AMP-dependent synthetase and ligase [Crocosphaera watsonii WH 
8501]
 gb|EHJ14357.1| Long-chain-fatty-acid--CoA ligase [Crocosphaera watsonii WH 0003]
 emb|CCQ54795.1| Long-chain-fatty-acid--CoA ligase [Crocosphaera watsonii WH 0005]
Length=638

 Score =   440 bits (1131),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 260/658 (40%), Positives = 394/658 (60%), Gaps = 54/658 (8%)
 Frame = -3

Query  2213  DIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADN  2034
             ++W  AA++F + +AL DP   P   L++ EL +++  FA GL+ +G+ PD+KI+L ADN
Sbjct  15    EVWAIAAKKFPDIVALHDPNSKPAVKLTYAELYQKLQQFAAGLQALGVSPDDKISLIADN  74

Query  2033  SCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSH  1854
             S RW +ADQG M  GA N VR +++   EL  I   S+S  L V+N +   +I  +F   
Sbjct  75    SPRWFIADQGSMLAGAANAVRSAQADKNELAYIVRDSDSSTLIVENQKTLDKI-RSFCDE  133

Query  1853  ADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPI--  1680
               ++ IILL  E    T    D     +++++++LG ++ +              +P+  
Sbjct  134   IPLQLIILLSDE----TPNRDDPIKTLNFSQLMELGAKNSL--------------QPVKK  175

Query  1679  NSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERA  1500
             N  D+ATL+YTSGTTG PKG ML+H NLLHQ+ NL   +    GD+ LS+LP WH+YER+
Sbjct  176   NDTDLATLIYTSGTTGQPKGAMLSHGNLLHQVKNLDAVIQPKVGDQVLSILPSWHSYERS  235

Query  1499  AEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLI  1320
             AEYF+ S GC  VYT + N K D+KR++PQ+++ VP +++++Y GI KQ+   S  ++ I
Sbjct  236   AEYFLLSQGCTLVYTNIRNFKTDIKRFKPQHMVGVPRLWDSIYEGIQKQLREKSDTQQKI  295

Query  1319  ALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLV  1140
             A  F  IS  +  ++RI +   L        +  S +D   A+     L PLH L  KLV
Sbjct  296   AQFFFNISQNFILSRRIADNMSLEH------FDASAIDRFIAKLKTIFLAPLHGLGDKLV  349

Query  1139  Yskihssigis-kagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVL  963
             YSKI   +G + +  +SGGGSL+ H+D F+E I++ +  GYGLTE++PV   R  + N+ 
Sbjct  350   YSKIREGLGGNFETLMSGGGSLAKHLDDFYEIINVPVLVGYGLTETSPVSNARTHSHNLR  409

Query  962   GSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLN  783
             GS G PI HTEIK+VD +T +A+S G +G+V  +GPQVM+GYYK P AT +AID  GW N
Sbjct  410   GSSGQPIPHTEIKIVDLDTGEAVSRGKRGVVLIRGPQVMQGYYKKPEATAKAIDPEGWFN  469

Query  782   TGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIV  603
             +GDLGWI P +           +V+ GRAKDTIVL++GEN+EP  IE+A + S  I Q++
Sbjct  470   SGDLGWITPMND----------LVITGRAKDTIVLNNGENIEPQPIEDACVRSPYIDQMM  519

Query  602   VIGQDKRRLGALVLPHKEEVLLAAK----KLSVVDSDA-------TEVSEEKTSKLIHEE  456
             ++GQD++ LGAL++P+ + +    K     L+    DA       +++  +    L  +E
Sbjct  520   LVGQDQKALGALIVPNLDALQTWGKNQQLNLTFPSEDASRETIINSDLYGKPVQDLFKQE  579

Query  455   LQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             L++            QI    LI EPF+ +NG++T T+K++R  VT+ Y+  I  +++
Sbjct  580   LKREVKNRPGYRADDQIKVFELILEPFSSENGMMTQTLKIKRPIVTERYQGMINGMFE  637



>ref|WP_007357266.1| MULTISPECIES: long-chain fatty acid--CoA ligase [Kamptonema]
 emb|CBN58080.1| AMP-dependent synthetase and ligase [ [[Oscillatoria] sp. PCC 
6506]
Length=651

 Score =   440 bits (1132),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 263/654 (40%), Positives = 388/654 (59%), Gaps = 44/654 (7%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDE----  2058
             +++P+IW  A + F   IAL DP+  P   L++ EL ++I  FA GL+ +G++  E    
Sbjct  31    QSLPEIWPIAKQRFSQVIALNDPHSQPEVKLTYAELYQQIQQFAAGLQALGIESTEEGDV  90

Query  2057  --KIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMY  1884
               +IALFADNS RW++ADQGIMT GA +VVRG+ +  EELL I   S S AL V+N  + 
Sbjct  91    PDRIALFADNSPRWMIADQGIMTAGAADVVRGAGADPEELLYILQDSGSTALIVENSALL  150

Query  1883  SRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEAR  1704
              ++ +       ++FIILL  E+    SE +    +  ++E+I  G  ++  L  +   R
Sbjct  151   RKLRDRL-PDLPIQFIILLSDEEPE-KSETLT---VIKFSEVIATG--ANRPLKPTNHKR  203

Query  1703  HQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLP  1524
                         +ATL+YTSGTTG PKGV+LTH NLLHQI      +   PG+  LS+LP
Sbjct  204   Q----------TLATLLYTSGTTGKPKGVILTHGNLLHQITTFGVILQPQPGESALSILP  253

Query  1523  PWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINT  1344
              WHAYER  EY++ S GC Q+YT++   K+D K  +PQY++SVP +++++Y    KQ   
Sbjct  254   SWHAYERTVEYYLLSQGCTQIYTSIRYFKQDFKTCKPQYMVSVPRIWDSIYEAAQKQFRE  313

Query  1343  SSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPL  1164
                 ++ +    L  S  Y +++RI +   L  +   P+  ++      A+    LL PL
Sbjct  314   QPANKQKLVNFLLGTSLKYIQSRRIAQDLTLNLEPPTPAKKLT------AQIKTILLLPL  367

Query  1163  HLLARKLVYskihssigiska-gisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVAC  987
             H +  KL+Y K+  + G      ISGGGSL+ H+D FFE   I L  GYGLTE++PV+  
Sbjct  368   HAIGEKLIYQKVRQATGGQFKCAISGGGSLAMHLDNFFEITGINLLVGYGLTETSPVLTV  427

Query  986   RRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQA  807
             RRP  N+ GS G P+  TEIK+VD ET K L  G  G+V  +GPQ+M GYY NP AT +A
Sbjct  428   RRPWHNLRGSAGQPLPETEIKIVDPETRKPLPIGQIGLVLGRGPQIMGGYYLNPQATAKA  487

Query  806   IDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMG  627
             ID+ GW +TGDLGW+           S   ++L GRAKDTIVL++GEN+EP  IE+A++ 
Sbjct  488   IDKEGWFDTGDLGWMT----------SGNDLILTGRAKDTIVLTNGENIEPQPIEDASLR  537

Query  626   SNLIQQIVVIGQDKRRLGALVLPHKEEV--LLAA--KKLSVVDSDATEVSEEKTSKLIHE  459
             S  I QI+++GQD++ LGAL++P+ E V   +A+    L  +D ++  V +    +L  E
Sbjct  538   SAYIDQIMLVGQDQKFLGALIVPNHEAVQKWIASLNPSLQEIDWNSKAVQDLFRQELNRE  597

Query  458   ELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
                +       +IG   LI EPF+++NG+LT T+K++R  V + Y++ I +++K
Sbjct  598   VQNRPGYRPDDRIGSFRLILEPFSVENGMLTQTLKIKRPVVMEHYRDMINEMFK  651



>ref|WP_037217968.1| long-chain fatty acid--CoA ligase [Richelia intracellularis]
 emb|CDN11602.1| Long-chain-fatty-acid--CoA ligase [Richelia intracellularis]
Length=659

 Score =   440 bits (1132),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 257/654 (39%), Positives = 391/654 (60%), Gaps = 60/654 (9%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             ++VP+IW   A +FG+ +AL+DP+ NP   +++ +L ++I  FA GL+ +G++   +I+L
Sbjct  32    QSVPEIWSVVANKFGDAVALLDPHANPEVMVTYSQLYQQIKQFAGGLQSLGIQAGTRISL  91

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
              ADNS RWLVADQGIM  GA++ VR S+S+  E+L I  HS S AL V + +   ++ E 
Sbjct  92    IADNSPRWLVADQGIMMAGAVDAVRSSQSARAEILYILAHSGSTALLVQDLQTLKKVREG  151

Query  1865  FHSHADVRF-IILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTY  1689
              +   D+   +ILL  ++   T E +    I+++++++++G             RHQ   
Sbjct  152   LN---DLPIELILLLSDEVPPTEETIR---IFNFSQLMEMG------------TRHQLVP  193

Query  1688  EPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAY  1509
                  +D+ATL+YTSGTTG PKGVML+H NL+HQ+ NL   V    GD  LS+LP WH+Y
Sbjct  194   VQKKREDLATLIYTSGTTGKPKGVMLSHGNLMHQVANLGILVQPQAGDIILSILPTWHSY  253

Query  1508  ERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPAR  1329
             ER AEYF+ + GC Q+YT + ++K DLK+Y+P Y+++VP ++E++Y G+ KQ       +
Sbjct  254   ERTAEYFLLAQGCTQIYTNLRSIKRDLKQYKPHYMVAVPRLFESIYEGLQKQFREQPENK  313

Query  1328  KLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAAL----LCPLH  1161
             + +    L IS  Y EA+R+ +   L  +  +PS         W + +A +    L PLH
Sbjct  314   QRLVNTLLGISEKYIEARRVVQE--LDLNNFKPST--------WEKIVANIQKIVLFPLH  363

Query  1160  LLARKLVYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVACR  984
             LLA KLV++K+  + G     +  GG     H+D FFE I +++  GYGLTE++PV   R
Sbjct  364   LLADKLVHTKVREATGGRVKQMISGGGALPKHIDNFFEIIGVQILVGYGLTETSPVTHAR  423

Query  983   RPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAI  804
             R   N+ GS G  +  TE K+V  ET + L  G KG+V  +GPQ+M+GYY+N  AT +AI
Sbjct  424   RYWSNLRGSAGKAVPGTETKIVHPETRQVLKAGEKGLVLLRGPQIMQGYYQNAEATAKAI  483

Query  803   DENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGS  624
             D  GW ++GDLGW+   +           +VL GRAKDTIVLS+GEN+EP  IE+A + S
Sbjct  484   DPEGWFDSGDLGWLTAKND----------LVLTGRAKDTIVLSNGENIEPQPIEDACLRS  533

Query  623   NLIQQIVVIGQDKRRLGALVLPHKEEVLLAAK----KLSVVDSDATEVSEEKT---SKLI  465
               I QI+++GQD + LGAL +P+ + +   A     +LS+ D++  +   +K    SK+I
Sbjct  534   PYIDQIMLVGQDCKSLGALFVPNIDALEQWANSKNLQLSLEDANLAQAESQKINLESKII  593

Query  464   H----EELQKWTTGCTF-----QIGPILLINEPFTIDNGLLTPTMKVRRDKVTD  330
                  +EL +            +IGP  LI EPF+I+NG +T T+K++R  V +
Sbjct  594   QDLFRQELNREVKNRPGSRPHDRIGPFKLILEPFSIENGTMTQTLKIKRHVVME  647



>ref|WP_012597852.1| long-chain fatty acid--CoA ligase [Cyanothece sp. PCC 7424]
 ref|YP_002375773.1| AMP-dependent synthetase and ligase [Cyanothece sp. PCC 7424]
 gb|ACK68905.1| AMP-dependent synthetase and ligase [Cyanothece sp. PCC 7424]
Length=638

 Score =   439 bits (1129),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 265/659 (40%), Positives = 384/659 (58%), Gaps = 52/659 (8%)
 Frame = -3

Query  2222  TVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALF  2043
             ++ +IW  A E F + +AL DP+  P   +++ EL ++I  FA GL+ +G++   KIALF
Sbjct  12    SLSEIWPIAKERFKDIVALHDPHSKPEVIITYTELCEQIEQFARGLQALGVESGAKIALF  71

Query  2042  ADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETF  1863
             ADN  RW +ADQGI+  GA+N VR S++  +ELL IY  S+S+AL V++ +   ++    
Sbjct  72    ADNCPRWFIADQGIIMAGAVNAVRSSQAERQELLYIYTDSDSIALVVEDLKTLQKLRPEL  131

Query  1862  HSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEP  1683
                 + +F+ILL  E S       D   I ++ +++DLG            + H +    
Sbjct  132   -DQLNTQFVILLSDEYSPTD----DPLKILNFKQLLDLG------------SNHPFNPVS  174

Query  1682  INSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYER  1503
                +D+ATL+YTSGTTG PKGVMLTH N L++I +        PGDR LS+LP WHAYER
Sbjct  175   RTKEDLATLLYTSGTTGKPKGVMLTHGNFLYEINSFGVAFQPDPGDRVLSILPSWHAYER  234

Query  1502  AAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKL  1323
               EY++ S G  Q+YT + N K DLK+++P  ++ VP ++E++Y  I KQ       ++ 
Sbjct  235   TVEYYVLSQGSTQIYTNLRNFKNDLKQFKPHLMVGVPRLWESIYESIQKQFREQPAKKRK  294

Query  1322  IALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKL  1143
             I   FL +S  Y  AKRI     L          VS  + L AR  A +L PLH +  +L
Sbjct  295   IVNFFLNLSENYVIAKRIANNFSLDH------LDVSASERLMARVKATVLAPLHRVGDRL  348

Query  1142  VYskihssigiskag-isgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNV  966
             VY KI   +G      ISGGGSL+ H+D F+E ++I +  GYGLTE++PV   R  + NV
Sbjct  349   VYQKIREGVGGKVKAWISGGGSLARHIDTFYEIVNIPVLVGYGLTETSPVTNVRTLDHNV  408

Query  965   LGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWL  786
              GS GPP+  TEI++VD ET + L P  KG+V  +GPQVM+GYYK P AT +AID  GW 
Sbjct  409   RGSSGPPLPRTEIRIVDPETRQDLPPKEKGLVLIRGPQVMQGYYKKPEATAKAIDPQGWF  468

Query  785   NTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQI  606
             ++GDLG + P +           +VL GRAKDTIVLS+GEN+EP  IE+A + S  I QI
Sbjct  469   DSGDLGCVTPIND----------LVLTGRAKDTIVLSNGENIEPQPIEDACVRSPYIDQI  518

Query  605   VVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEVS------------EEKTSKLIH  462
             +++GQD++ LGAL++P+  + L A  K   +D D  ++             ++    L+ 
Sbjct  519   MLVGQDQKALGALIVPNL-DALSAWGKEQQLDLDIPDIHASRDRIKHSSLYDKPVQTLLR  577

Query  461   EELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             +EL +            QI    LI EPF+IDNG++T T+K++R  VT+ Y+  I+ +Y
Sbjct  578   QELNQRVKDRPGYRIDDQIKVFELILEPFSIDNGMMTQTLKIKRPVVTERYRAIIDGMY  636



>ref|WP_021836463.1| Long-chain-fatty-acid--CoA ligase [Crocosphaera watsonii]
 emb|CCQ63354.1| Long-chain-fatty-acid--CoA ligase [Crocosphaera watsonii WH 0401]
Length=638

 Score =   439 bits (1128),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 259/658 (39%), Positives = 393/658 (60%), Gaps = 54/658 (8%)
 Frame = -3

Query  2213  DIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADN  2034
             ++W  AA++F + +AL DP   P   L++ EL +++  FA GL+ +G+ PD+KI+L ADN
Sbjct  15    EVWAIAAKKFPDIVALHDPNSKPAVKLTYAELYQKLQQFAAGLQALGVSPDDKISLIADN  74

Query  2033  SCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSH  1854
             S RW +ADQG M  GA N VR +++   EL  I   S+S  L V+N +   +I  +F   
Sbjct  75    SPRWFIADQGSMLAGAANAVRSAQADKNELAYIVRDSDSSTLIVENQKTLDKI-RSFCDE  133

Query  1853  ADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPI--  1680
               ++ IILL  E    T    D     +++++++LG ++ +              +P+  
Sbjct  134   VPLQLIILLSDE----TPNRDDPIKTLNFSQLMELGAKNSL--------------QPVKK  175

Query  1679  NSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERA  1500
             N  D+ATL+YTSGTTG PKG ML+H NLLHQ+ NL   +    GD+ LS+LP WH+YER+
Sbjct  176   NDTDLATLIYTSGTTGQPKGAMLSHGNLLHQVKNLDAVIQPKVGDQVLSILPSWHSYERS  235

Query  1499  AEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLI  1320
             AEYF+ S GC  VYT + N K D+KR++PQ+++ VP +++++Y GI KQ+   S  ++ I
Sbjct  236   AEYFLLSQGCTLVYTNIRNFKTDIKRFKPQHMVGVPRLWDSIYEGIQKQLREKSDTQQKI  295

Query  1319  ALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLV  1140
             A  F  IS  +  ++RI +   L        +  S +D   A+     L PLH L  KLV
Sbjct  296   AQFFFNISQNFILSRRIADNMSLEH------FDASAIDRFIAKLKTIFLAPLHGLGDKLV  349

Query  1139  Yskihssigis-kagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVL  963
             YSKI   +G + +  +SGGGSL+ H+D F+E I++ +  GYGLTE++PV   R  + N+ 
Sbjct  350   YSKIREGLGGNFETLMSGGGSLAKHLDDFYEIINVPVLVGYGLTETSPVSNARTHSHNLR  409

Query  962   GSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLN  783
             GS G PI HTEIK+VD +T +A+S G +G+V  +GPQVM+GYY  P AT +AID  GW N
Sbjct  410   GSSGQPIPHTEIKIVDLDTGEAVSRGKRGVVLIRGPQVMQGYYNKPEATAKAIDPEGWFN  469

Query  782   TGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIV  603
             +GDLGWI P +           +V+ GRAKDTIVL++GEN+EP  IE+A + S  I Q++
Sbjct  470   SGDLGWITPMND----------LVITGRAKDTIVLNNGENIEPQPIEDACVRSPYIDQMM  519

Query  602   VIGQDKRRLGALVLPHKEEVLLAAK----KLSVVDSDA-------TEVSEEKTSKLIHEE  456
             ++GQD++ LGAL++P+ + +    K     L+    DA       +++  +    L  +E
Sbjct  520   LVGQDQKALGALIVPNLDALQTWGKNQQLNLTFPSEDASRETIINSDLYGKPVQDLFKQE  579

Query  455   LQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             L++            QI    LI EPF+ +NG++T T+K++R  VT+ Y+  I  +++
Sbjct  580   LKREVKNRPGYRADDQIKVFELILEPFSSENGMMTQTLKIKRPIVTERYQGMINGMFE  637



>ref|WP_039748344.1| long-chain fatty acid--CoA ligase [Hassallia byssoidea]
 gb|KIF32843.1| long-chain fatty acid--CoA ligase [Hassallia byssoidea VB512170]
Length=658

 Score =   439 bits (1128),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 255/661 (39%), Positives = 392/661 (59%), Gaps = 54/661 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +T+P+IW   A+  G+ +AL DP+  P   ++  +L ++I  FA GL+ +G+K  +++ L
Sbjct  32    ETLPEIWDLVAKRCGDTVALRDPHSKPEVVITHTQLLEKIKQFAAGLQALGVKVGDRLTL  91

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
              ADNS RW +ADQGI+  G +N VR S++  EELL I  +S S AL V++ +  +++   
Sbjct  92    IADNSPRWFIADQGILMAGGVNAVRSSQAEKEELLFIIANSGSTALVVEDLKTLNKLRSR  151

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
              +    ++FIILL  +++  +SE +    + ++++++              E+   +T +
Sbjct  152   LND-LPIQFIILL-SDEAPPSSETLK---VLNFSQLM--------------ESSANHTLQ  192

Query  1685  PINS--DDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHA  1512
             P     +D+ATL+YTSGTTG PKGVML++ NL+HQ+      V    GD  LS+LP WH 
Sbjct  193   PARQKRNDLATLMYTSGTTGKPKGVMLSYGNLMHQVTTFGTVVQPEIGDIILSILPSWHV  252

Query  1511  YERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPA  1332
             YER  EY++ S GC QVYT + + K+DL++++P Y++ VP ++E++Y G+ KQ       
Sbjct  253   YERTVEYYLLSQGCTQVYTNLRSFKKDLQQFKPNYMLGVPRLWESIYEGVQKQFREQPEN  312

Query  1331  RKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLA  1152
             ++ +    L IS  Y +A+RI E   L+ D    S +      L A   A+ L PLH L 
Sbjct  313   KQRLINSLLAISDKYIKARRIAEN--LSLDHLDASAIAR----LSASIQASALFPLHALG  366

Query  1151  RKLVYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVACRRPN  975
              KL+Y+KI  + G     +  GG     H+D FFE I +++  GYGLTE++PV   RR  
Sbjct  367   EKLIYNKIREATGGKIKQMISGGGALPKHIDNFFEIIGVEILQGYGLTETSPVTNVRRTW  426

Query  974   CNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDEN  795
              N+ GS G P+  TE K+VD ET K L+ G KG+V  KGPQ+M+GYY+NP AT +AID  
Sbjct  427   RNLRGSSGQPLPGTENKIVDPETRKPLATGEKGLVLLKGPQIMQGYYQNPEATAKAIDAE  486

Query  794   GWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLI  615
             GW ++GDLGW+ P             +VL GRAKDTIVLS+GEN+EP  IE+A + S  I
Sbjct  487   GWFDSGDLGWVTPEKD----------LVLTGRAKDTIVLSNGENIEPQPIEDACVRSPYI  536

Query  614   QQIVVIGQDKRRLGALVLPHKEEVLLAAK----KLSVVDSDATEVSEEK-------TSKL  468
              QI+++GQDKR LGA+++P+ E +   A+    +L + D + TE + +K       +  L
Sbjct  537   DQIMLVGQDKRSLGAMIVPNLEALQKWAESHNLELCIQDDNVTETTSQKINLESKMSQDL  596

Query  467   IHEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDL  303
               +EL +            +IGP  LI EPF+++NG++T T+K+RR  V + Y + I+ +
Sbjct  597   FRQELNREVQNRPGYRADDRIGPFKLILEPFSLENGMMTQTLKIRRHVVMERYHDIIDGM  656

Query  302   Y  300
             +
Sbjct  657   F  657



>ref|WP_015205129.1| long-chain-fatty-acid--CoA ligase [Crinalium epipsammum]
 ref|YP_007144545.1| long-chain-fatty-acid--CoA ligase [Crinalium epipsammum PCC 9333]
 gb|AFZ15035.1| Long-chain-fatty-acid--CoA ligase [Crinalium epipsammum PCC 9333]
Length=662

 Score =   438 bits (1127),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 252/668 (38%), Positives = 396/668 (59%), Gaps = 61/668 (9%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P+IW  AA+ FG  +AL DP+  P   +++ +L K I  FA GL+ +G+K  ++I+L
Sbjct  30    QSLPEIWSLAAQRFGETVALKDPHTKPEVVITYSQLNKLIQQFAAGLQSLGIKAGDRISL  89

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             FADNS RW +ADQGIMT GA++ VR  ++  EEL  I  +S S AL V++ +  +++ + 
Sbjct  90    FADNSPRWFIADQGIMTAGAVDAVRSGQAEQEELRFIMANSGSTALVVEDLKTLNKLRD-  148

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
             + +   ++ I+LL  E+     E +    + +++ ++++G+   +              E
Sbjct  149   YLNDLPIKLIVLLSDEEP----EELANIKMLNFSGLVEVGSSVQL--------------E  190

Query  1685  PINS--DDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHA  1512
             P+    D +ATL+YTSGTTG PKGVML+H NLLHQ+  L   +    G + LS+LP WH+
Sbjct  191   PVKQTKDTLATLIYTSGTTGQPKGVMLSHGNLLHQVTTLGTVIKPQQGSKVLSILPSWHS  250

Query  1511  YERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPA  1332
             YER+AEYF+ S GC Q+YT +  +K+DLK ++P Y+I+VP ++E++Y G  KQ       
Sbjct  251   YERSAEYFLLSQGCTQLYTNLRYIKQDLKTFKPNYMIAVPRLWESIYEGAQKQFREQPSN  310

Query  1331  RKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLA  1152
             ++ +   F  IS  Y +A+R+ +G  L  +   P    S  + + A+  A++L P+H L 
Sbjct  311   KQKLINTFFSISQRYIKARRLAQG--LDLENLNP----SATEKISAKVQASVLAPVHALG  364

Query  1151  RKLVY-skihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPN  975
              +LVY     ++ G     ISGGGSL+ H++ FFE I + +  GYGLTE++PV   RRP 
Sbjct  365   ERLVYGKVREATGGEIIQVISGGGSLAKHLENFFEIIGVNILVGYGLTETSPVTNARRPW  424

Query  974   CNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDEN  795
              N+ GS G PI  TEIK+V+ ET + L  G +G+V  KGPQVM+GYY+NP AT +AID  
Sbjct  425   HNLRGSSGKPIPGTEIKIVNPETRQPLPTGERGLVLIKGPQVMQGYYQNPEATAKAIDSE  484

Query  794   GWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLI  615
             GW ++GDLGW+   +           +VL GRAKDTIVL++GEN+EP  IE+A + S  +
Sbjct  485   GWFDSGDLGWVTKEND----------LVLTGRAKDTIVLTNGENIEPQPIEDACLRSAYV  534

Query  614   QQIVVIGQDKRRLGALVLPHKE-----------------------EVLLAAKKLSVVDSD  504
              QIV++GQD++ LGAL++P+ +                       ++  +  +L  +D D
Sbjct  535   DQIVLVGQDQKSLGALIVPNLDALQQWAFSQNLQLRLPADVPNLPKLEASQSQLKEIDLD  594

Query  503   ATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLY  324
             + ++ +    +L  E   +       +I    LI EPF+I+NG++T T+K+RR  V + Y
Sbjct  595   SKQIQDLFRQELNREVQNRPGYRSDDRIAVFKLILEPFSIENGMMTQTLKIRRPVVMERY  654

Query  323   KEQIEDLY  300
              + I  ++
Sbjct  655   HDMINGMF  662



>emb|CAN68253.1| hypothetical protein VITISV_043922 [Vitis vinifera]
Length=929

 Score =   446 bits (1148),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 227/321 (71%), Positives = 281/321 (88%), Gaps = 0/321 (0%)
 Frame = -3

Query  1262  GKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagisggg  1083
             GK L K QKQ SY+ S+ DWLWA+ IAA+L P+H+L +KL+YSKIHS+IGISKAG+SGGG
Sbjct  608   GKFLQKSQKQYSYIASIFDWLWAKIIAAILWPVHMLGKKLIYSKIHSAIGISKAGVSGGG  667

Query  1082  slssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETD  903
             SL SHVD+FFEAIDIK+QNGYGLTE +PV A RRP CNVLGS+G PIRHTEIK+VD+ETD
Sbjct  668   SLPSHVDRFFEAIDIKVQNGYGLTECSPVTAARRPTCNVLGSVGHPIRHTEIKIVDSETD  727

Query  902   KALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSS  723
             + L PGSKGIVK KGP VMKGYYKN  ATK+ +DE+GWLNTGD+GWI P+HS+GRSR+  
Sbjct  728   ELLPPGSKGIVKVKGPHVMKGYYKNELATKKVLDEDGWLNTGDIGWIAPHHSVGRSRHCG  787

Query  722   GFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEV  543
             G IVLEGRAKDTIVLS+GENVEP+E+EEAAM S LIQQIVVIGQD+RRLGA+++P+KEEV
Sbjct  788   GVIVLEGRAKDTIVLSTGENVEPTELEEAAMRSTLIQQIVVIGQDQRRLGAIIVPNKEEV  847

Query  542   LLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTP  363
             L AAK+ S+++++ +E+S+EK + L+HEE++ WT G +FQIGPIL+++EPFTID+GL+TP
Sbjct  848   LAAAKRXSILNANTSELSKEKITGLLHEEIRTWTEGFSFQIGPILVVDEPFTIDSGLMTP  907

Query  362   TMKVRRDKVTDLYKEQIEDLY  300
             TMK+RRD+V  LY+EQI  LY
Sbjct  908   TMKIRRDRVAALYQEQIAHLY  928



>ref|WP_006453938.1| long-chain fatty acid--CoA ligase [Synechococcus sp. PCC 7335]
 gb|EDX84193.1| AMP-binding enzyme, putative [Synechococcus sp. PCC 7335]
Length=640

 Score =   437 bits (1123),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 255/646 (39%), Positives = 384/646 (59%), Gaps = 38/646 (6%)
 Frame = -3

Query  2219  VPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFA  2040
             +PD+W   A  +GN +AL DP+ NP T  ++ EL   I  FA GL+ +G+ P E IALF+
Sbjct  25    IPDVWPIVAARYGNHLALYDPHTNPETKYTYGELATSISQFAAGLQRLGVVPGEAIALFS  84

Query  2039  DNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFH  1860
             +N  RW+VADQGIMT GAI+ VRG+ S   ELL I N+S+S+ L + +  +  +IA    
Sbjct  85    ENRPRWMVADQGIMTAGAIDAVRGANSDKAELLFILNNSDSIGLVIQDLSVLDKIAGDL-  143

Query  1859  SHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPI  1680
                 +RFIILL  E ++  ++ + G  + +++E++ LG E               T   +
Sbjct  144   GELGLRFIILLTDEVAASETD-LGGAKLLNFSELMALGAEQGAP-----------TPVKL  191

Query  1679  NSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERA  1500
               D  ATL+YTSGT+G PKGVMLT  NLL QI      V V P  + LS+LP WH YER+
Sbjct  192   ERDRTATLMYTSGTSGMPKGVMLTQSNLLSQIAGASSVVNVGPEQKVLSILPIWHCYERS  251

Query  1499  AEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLI  1320
              EYF+ S GC Q+YT +  +K D K + PQY+++VP ++E++Y G+ +Q  +    ++ +
Sbjct  252   FEYFVLSQGCTQIYTNIRTVKRDFKEHSPQYMVAVPRLWESIYDGVQRQFQSQPEGKQKL  311

Query  1319  ALLFLKISFAYKEAKRIYEG---KCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLAR  1149
                FL+    Y  A+R   G     LT    +       L +LW         P++ +  
Sbjct  312   IRFFLEKGHEYITARRTLSGLRLDHLTSSTGEKLAAALKLAYLW---------PIYQIGD  362

Query  1148  KLVYskihssigiska-gisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNC  972
             ++V+SKI  ++G      +SGGGS++ +++ F+E + I +  GYGLTE++P+   RRP  
Sbjct  363   RIVFSKIREAMGGKVDFLVSGGGSIADYLEDFYEVVGIPILGGYGLTETSPITHVRRPWR  422

Query  971   NVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENG  792
             N+ G+ G  +  TE  +VD ET + +  G  G+V  +GPQVMKGYYKN  AT +AID  G
Sbjct  423   NLRGADGQALPGTETAIVDPETRQPIPIGKPGLVLLRGPQVMKGYYKNAEATAKAIDSEG  482

Query  791   WLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQ  612
             W +TGDLG +             G +++ GRAKDTIVL++GEN+EP+ +E A + S  + 
Sbjct  483   WFDTGDLGRL----------TDWGDLIITGRAKDTIVLTNGENIEPTPVENACLRSPYVD  532

Query  611   QIVVIGQDKRRLGALVLPHKE--EVLLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTT  438
             QI+++GQD++ +GAL++P+KE  E   A+K +S+ D ++  + +    +L  E   +   
Sbjct  533   QIMLVGQDQKSVGALIVPNKEVLEKWAASKGVSMEDLNSKPIQDLYKQELKREISARPGY  592

Query  437   GCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
                 ++GP +L+ EPFTI+NGLLT TMKV+R KV D Y+E I+ LY
Sbjct  593   RPDERVGPFVLLEEPFTIENGLLTQTMKVKRPKVRDRYQETIDALY  638



>ref|WP_015198061.1| long-chain-fatty-acid--CoA ligase [Calothrix parietina]
 ref|YP_007137388.1| long-chain-fatty-acid--CoA ligase [Calothrix sp. PCC 6303]
 gb|AFZ01416.1| Long-chain-fatty-acid--CoA ligase [Calothrix sp. PCC 6303]
Length=657

 Score =   437 bits (1124),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 262/665 (39%), Positives = 395/665 (59%), Gaps = 63/665 (9%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEK---  2055
             +++P++W+  ++ F + +AL+DP+  P   L++ +L  +I  FA GL+ +G+K       
Sbjct  31    RSLPEMWQITSKIFPDIVALIDPHAKPKVTLTYSQLYYQIQQFAAGLQALGIKQHSTESV  90

Query  2054  ---IALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMY  1884
                +ALFADNS RW++ADQGIM  GA N VR S +  EELL I  HS S+ L ++N +  
Sbjct  91    TPIVALFADNSARWMIADQGIMMAGAANAVRSSAAEREELLYILEHSGSLGLVIENLKTL  150

Query  1883  SRIA-ETFHSHADVRFIILLWGEK---SSITSEVMDGRPIYSYNEIIDLGNESHMALLHS  1716
             ++IA E + S   +++++LL  E+   +SI S ++    I ++ +++ + ++S    L  
Sbjct  151   NKIAPEVYQSQ--IQWVVLLSDEQPENNSINSSLI----IINFEQLMQIASQSS---LQP  201

Query  1715  QEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFL  1536
              E  +Q          +ATL+YTSGTTG PKGVMLTH N LHQI  L   +    GD+ L
Sbjct  202   TELAYQ---------KLATLIYTSGTTGKPKGVMLTHGNFLHQISTLTAIIQPSVGDKTL  252

Query  1535  SMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILK  1356
             S+LP WH++ R  EY+    G  Q+Y+    LK+DL+ Y PQY+I VP ++E++Y GI K
Sbjct  253   SILPTWHSFGRVGEYYTLGQGVTQIYSNRRYLKQDLQDYTPQYVIGVPRLWESIYEGIQK  312

Query  1355  QINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAAL  1176
                  +P  + +   FL +S  Y +A R ++   L       S +++     W   I  L
Sbjct  313   SFRDKTPRMQKLIKSFLAVSKKYIKAVRTWKKIDLQNLNPTTSQIINA----WITTI--L  366

Query  1175  LCPLHLLARKLVYskihssigiskagis-gggslssHVDKFFEAIDIKLQNGYGLTESAP  999
             L PLH L   +VY KI  + G     +  GGGSL+ H++ FFE + I++  GYGLTE++P
Sbjct  367   LAPLHFLGEMIVYKKIQLATGGKVKQLICGGGSLAQHLEDFFEIVGIQILVGYGLTETSP  426

Query  998   VVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFA  819
             V++ RR   N+ G+ G P+  TE+K+VD ET + L  G +G+V AKGPQ+M+GYY NP A
Sbjct  427   VLSARRYYKNLRGASGLPLASTELKIVDLETHQPLPQGKRGLVMAKGPQIMQGYYLNPEA  486

Query  818   TKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEE  639
             T +AID  GW +TGD+GW+ P++           IVL GRAKDTIVL++GEN+EP  IE+
Sbjct  487   TSKAIDSEGWFDTGDIGWLTPDNQ----------IVLTGRAKDTIVLTNGENIEPQPIED  536

Query  638   AAMGSNLIQQIVVIGQDKRRLGALVLPHKE--EVLLAAKKLSVVDSDATEVSEEKTSKLI  465
             A + S+ I QI+++GQD++ LGAL++P  E  E  L +K   +V+ +   ++ +    LI
Sbjct  537   ACLRSDYIDQIMLVGQDQKSLGALIVPDLEILESWLLSKNQPIVNGEIG-LNNQMIRDLI  595

Query  464   HEELQKWTTG----------CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQ  315
              EEL +                F+I P     EPFTI+NGLLT T+K+RR+ VTD Y+  
Sbjct  596   REELNREVRDRKGYRRDDEIIVFEIIP-----EPFTIENGLLTQTLKIRRNIVTDRYQGV  650

Query  314   IEDLY  300
             I  ++
Sbjct  651   ITQMF  655



>ref|WP_017305909.1| hypothetical protein [Spirulina subsalsa]
Length=642

 Score =   436 bits (1122),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 256/654 (39%), Positives = 389/654 (59%), Gaps = 50/654 (8%)
 Frame = -3

Query  2213  DIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADN  2034
             ++W    E +G  IAL DP+  P   L++ +L ++I  FA GL+ +G+KP +K+ALFADN
Sbjct  22    ELWPILVENYGEIIALHDPHSKPEVILTYAQLYEKIKQFAAGLQGLGVKPHDKVALFADN  81

Query  2033  SCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSH  1854
             S RW +ADQGI+  GA + VR S++  +ELL I+ HS+S +L V +     ++     + 
Sbjct  82    SPRWFIADQGILLVGAADAVRSSQAERQELLYIFEHSDSTSLVVQDLATLRKLQPDL-AD  140

Query  1853  ADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINS  1674
               V+F++LL  E     S       I ++ + + LG E+              T +P   
Sbjct  141   LPVQFVVLLSDETPPAESPFK----IVNFAQCLVLGEET--------------TLKPATQ  182

Query  1673  --DDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERA  1500
               D +ATL+YTSGTTG PKGVMLTH N LHQ+      +   PGDR LS+LP WH+YER+
Sbjct  183   TLDMLATLIYTSGTTGRPKGVMLTHGNFLHQVNGAATVIEPQPGDRALSILPSWHSYERS  242

Query  1499  AEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLI  1320
              EYF+ S  C Q+YT++   K+D+ +++P +++ VP ++E++Y G+ K       +++ +
Sbjct  243   VEYFLLSRACTQIYTSIRTFKKDITQFKPHFMVGVPRLWESIYEGVQKSFREQPASKQRL  302

Query  1319  ALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLV  1140
                FL +S +Y +A+RI +   L       S      +   AR  A  L PLHLL  K+V
Sbjct  303   IHFFLGVSQSYVQARRIAQNMSLEHPNPSSS------ERFLARLKALSLTPLHLLGHKIV  356

Query  1139  Yskihssigi-skagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVL  963
             Y+KI ++ G   KA ISGGGSL+ H+D FFE +DI +  GYGLTE++P+   RRP  N+ 
Sbjct  357   YTKIRAATGGCVKAFISGGGSLARHIDAFFELLDIPILVGYGLTETSPIATVRRPQNNLR  416

Query  962   GSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLN  783
             GS G P+ +TEI++VD  T + L   ++G+V  +GPQVM+GYYKNP AT +AID  GW +
Sbjct  417   GSSGLPVPYTEIRIVDPTTRQTLPNQTQGLVLIRGPQVMRGYYKNPEATAKAIDPEGWFD  476

Query  782   TGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIV  603
             +GDLG I   +           +VL GRAKDTIVLS+GEN+EP  IE+A + S  I Q++
Sbjct  477   SGDLGMITHGNQ----------LVLTGRAKDTIVLSNGENIEPQPIEDACICSPYIDQMM  526

Query  602   VIGQDKRRLGALVLPHKEEVL--LAAKKLSVV-----DSDATEVSEEKTSKLIHEELQ--  450
             ++GQD++ LGAL++P+ + +   +  + L +      DS   ++   K   L  +EL   
Sbjct  527   LVGQDQKMLGALIVPNFDALQKWVTEEGLGLTLPQPGDSARQDLDHPKIMDLFRQELNQR  586

Query  449   -KWTTGCTF--QIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
              K   G     ++G   LI +PFT++NG LT T+K+RR  + + Y++ I+ +++
Sbjct  587   VKERPGYRLDDRVGVFRLIPQPFTMENGQLTQTLKMRRPVIAEQYRDMIDGMFE  640



>ref|WP_015224012.1| AMP-dependent synthetase and ligase [Cyanobacterium stanieri]
 ref|YP_007166348.1| AMP-dependent synthetase and ligase [Cyanobacterium stanieri 
PCC 7202]
 gb|AFZ48699.1| AMP-dependent synthetase and ligase [Cyanobacterium stanieri 
PCC 7202]
Length=636

 Score =   436 bits (1120),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 264/664 (40%), Positives = 391/664 (59%), Gaps = 62/664 (9%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             K++  IW     EFG+ +AL DP+  P   L+++EL  +I  FA GL+ +G++   K++L
Sbjct  13    KSLAGIWDLIPTEFGDALALHDPHSTPEVKLTYQELYGKIQLFATGLQSLGIEAGNKVSL  72

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             FADNS RWL+ADQGI+  GA++ VR S +   ELL I + S+SVAL V N E   ++   
Sbjct  73    FADNSPRWLIADQGIIMAGAVDAVRSSVAEKNELLYILDDSDSVALVVQNLECLQKLRPE  132

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGR---PIYSYNEIIDLGNESHMALLHSQEARHQY  1695
               S+  ++ +ILL       + E  +G    P+Y++  I+DLG               Q 
Sbjct  133   LDSYP-LKTVILL-------SDEEFEGGLSCPVYNFFSIMDLG--------------VQG  170

Query  1694  TYEPINSD--DVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPP  1521
             ++ PI  D  D+ATL+YTSGTTG PKGVML+H NLLHQ+ NL   +    GDR L++LP 
Sbjct  171   SFTPIKGDIDDLATLIYTSGTTGKPKGVMLSHRNLLHQVRNLETIIQPSKGDRILTILPS  230

Query  1520  WHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTS  1341
             WH+YERAAEYF+ S G   +YT++   K+DLK Y+P Y++ VP ++E++Y G+ K    S
Sbjct  231   WHSYERAAEYFLLSRGTTLIYTSIRYFKQDLKDYKPNYMVGVPRLWESIYEGVQKNFRDS  290

Query  1340  SPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLH  1161
                ++ +   FL +S  Y + KR   G  L      P    S +D         +  P H
Sbjct  291   --GKQKLVNFFLGMSQGYLDGKRAQSG--LDLQNLNP----SGMDKFVGTLKTIVFYPFH  342

Query  1160  LLARKLVYskihssigiskag-isgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACR  984
             +L  KLVY+K+   +G S    ISGGGSL+ H+D FF+ ++I L  GYGLTE++PV   R
Sbjct  343   ILGDKLVYTKVREGVGNSIKAWISGGGSLAKHIDNFFQIVNIPLLVGYGLTETSPVTNAR  402

Query  983   RPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAI  804
             R N N++G+ G P+  TEI +   ET   L  G KG+V  +G QVM+GYYK P AT +AI
Sbjct  403   RMNRNIVGASGQPLPETEIMIAHPETKTPLPQGEKGLVFIRGTQVMQGYYKKPEATAKAI  462

Query  803   DENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGS  624
             +E+GW ++GDLGW+ P++           +V+ GRAKDTIVLS+GEN+EP  +E+  + S
Sbjct  463   NEDGWFDSGDLGWVTPDND----------LVITGRAKDTIVLSNGENIEPQPLEDVCLRS  512

Query  623   NLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKK----LSVVDSDATEVSEEKTS------  474
               + QI+++GQD++ LGAL++P+ E +   AK+    L + D+ A+    E +       
Sbjct  513   AYVDQIMLVGQDQKYLGALIVPNLEALSAWAKENKVSLKIPDTGASREEVENSDLYSKEV  572

Query  473   -KLIHEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQI  312
               L  +EL +            +I    LI EPF+I NG++T T+KV+R  VT+ Y++ I
Sbjct  573   MSLFKQELNREVKNRPGYRPDDRIAVFELILEPFSIANGMMTQTLKVKRPVVTNHYQDMI  632

Query  311   EDLY  300
             + ++
Sbjct  633   DAMF  636



>ref|WP_012165737.1| long-chain fatty acid--CoA ligase [Acaryochloris marina]
 ref|YP_001519835.1| long-chain-fatty-acid-CoA ligase [Acaryochloris marina MBIC11017]
 gb|ABW30516.1| long-chain-fatty-acid-CoA ligase, putative [Acaryochloris marina 
MBIC11017]
Length=646

 Score =   436 bits (1120),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 257/661 (39%), Positives = 388/661 (59%), Gaps = 53/661 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++ +IW  AA+ FG  +AL DP+  P  NL++ EL +++  FA  L+ +G+KP +++AL
Sbjct  21    QSISEIWPIAAQRFGEIVALRDPHVKPEVNLTYVELNRQVQRFAASLQALGVKPGDRVAL  80

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             FADNS RW +ADQG +  GA+NVVR S++S EEL+ I  +S +  L V++    S++ + 
Sbjct  81    FADNSSRWFIADQGSIMAGAVNVVRSSQASPEELVYILENSGATYLLVEDAATLSKL-QP  139

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
             F +   ++ + LL  E  +   +      + ++ +I   G    +  +            
Sbjct  140   FLTKLPLKLVALLSDEDVANNGQSQ----VLNFPQIFQEGTHGAVRAV------------  183

Query  1685  PINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVP--GDRFLSMLPPWHA  1512
             P++ + +ATL+YTSGT+G PKGVML+H NLLH I  +  P  V P  GDR LS+LP WH+
Sbjct  184   PLDREHLATLIYTSGTSGKPKGVMLSHGNLLHIITAM--PAAVQPEVGDRILSILPTWHS  241

Query  1511  YERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPA  1332
             + R  +Y+  S GC Q+YT++ NLK DL+ Y+P Y+ SVP ++E+LY G+ K+       
Sbjct  242   FGRLVDYYFLSQGCTQIYTSIRNLKGDLQTYKPHYMGSVPRLWESLYEGMQKKFRGEPAT  301

Query  1331  RKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLA  1152
             R+ +   F  IS  Y  A+R  +G  L  +   PS L   L    A+     L PLH L 
Sbjct  302   RQKLINTFFGISQKYILARRTQQG--LDINNLNPSGLQRFL----AQLQMLFLGPLHQLG  355

Query  1151  RKLVYskihssigis-kagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPN  975
              ++VY+KI  ++G   K   SGGGSL+ H++ FFEA+ I+L  GYGLTE++PV+  RR  
Sbjct  356   DRIVYTKIRQAMGGQFKQSFSGGGSLAMHLETFFEAVGIELIVGYGLTETSPVLTSRRAE  415

Query  974   CNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDEN  795
              N+  S G PI  TEI++VD +T + L  G +G+V  +GPQVM+GYY+NP AT + ID+ 
Sbjct  416   HNLRRSAGKPIPKTEIRIVDPQTRQTLPTGQQGLVIVRGPQVMQGYYQNPEATAKVIDQE  475

Query  794   GWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLI  615
             GW +TGDLGW+ P             +VL GRAKDTIVLS+GEN+EP  +E+A   S+ I
Sbjct  476   GWFDTGDLGWLTPTQD----------LVLTGRAKDTIVLSNGENIEPQPLEDACARSSFI  525

Query  614   QQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVV----------DSDATEVSEEKTSKLI  465
              QI+V+GQD+R LGAL++P+ + +   A + +             S     +++    L 
Sbjct  526   DQIMVVGQDQRSLGALIVPNLDALQQWASEQNASIQHPGNTPTPGSKVLTFTDQPIQDLY  585

Query  464   HEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
              +EL +            +IGP     E F+I+NG+LT T+KVRR  V + Y++ I  ++
Sbjct  586   RQELTREVKNRPNYRPDERIGPFAFALEAFSIENGMLTQTLKVRRRVVMEHYRDMINGMF  645

Query  299   K  297
             K
Sbjct  646   K  646



>ref|WP_036946772.1| long-chain fatty acid--CoA ligase, partial [Pseudanabaena sp. 
PCC 6802]
Length=624

 Score =   434 bits (1116),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 253/639 (40%), Positives = 383/639 (60%), Gaps = 51/639 (8%)
 Frame = -3

Query  2210  IWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNS  2031
             +W+  A+   + +AL DP+  P   LS++E+  +I  F  GLR IG++  +K++L ADNS
Sbjct  24    VWQKTAQACPDTLALHDPHAKPEVKLSYREVVDQIAMFGAGLRSIGIQFGDKVSLIADNS  83

Query  2030  CRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHA  1851
              RWL+ADQGI+  GA N  R S++   ELL I  HS+S+AL V++     ++     S  
Sbjct  84    PRWLIADQGILAIGAANATRSSQAERTELLYIIEHSDSIALVVEDIVTLKKLQPDVQS-L  142

Query  1850  DVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSD  1671
              ++ IILL  E     +        Y++ +I++ G++SH         R      PI+ +
Sbjct  143   PLKTIILLSDETPPEGA--------YNFKQILERGSDSH-----GDAYRRDLGNPPIDRN  189

Query  1670  DVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEY  1491
              +ATL+YTSGTTG PKGVMLTH NLL Q+    D V   PG+  LS+LP WH+YERA EY
Sbjct  190   TLATLIYTSGTTGKPKGVMLTHGNLLTQVEGGKDMVQPFPGEVALSILPTWHSYERAGEY  249

Query  1490  FIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALL  1311
             ++ S G  Q+YT + ++K DL +Y+P ++++VP ++E++Y GI K+    SP ++ +   
Sbjct  250   YLLSQGMTQIYTNLRSIKADLVKYKPHFMLAVPRLWESVYEGISKKFAAESPFKQALIKF  309

Query  1310  FLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYsk  1131
              L  S  Y +A+RI     L    K    LV+ L        AA+L P++ LA+K+++ K
Sbjct  310   LLAGSQNYIKARRIKNDLSLEAGSK----LVATLR-------AAVLSPVYWLAQKILFEK  358

Query  1130  ihssigiskagisgggslss-HVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSI  954
             I  ++G     ++ GG     H+D F+E   I++ NGYGLTE++P++  RRP+ N+ G+ 
Sbjct  359   IREAVGGRVKYLTSGGGSLQPHIDLFYEMAGIEIINGYGLTETSPMLTARRPHRNLRGTA  418

Query  953   GPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGD  774
             G P+R+TEI++VD ++   L  G  G+V A+GPQ+M+GYYKNP AT +AID +GW +TGD
Sbjct  419   GVPLRNTEIQIVDLDSRIPLEQGKIGLVMARGPQIMQGYYKNPEATAKAIDPDGWFDTGD  478

Query  773   LGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIG  594
             LGW+  N+           ++L GRAKDTIVL++GEN+EP  IE+A   S  I QIV++G
Sbjct  479   LGWLTANND----------LILTGRAKDTIVLTNGENIEPQAIEDACTRSPYIDQIVLVG  528

Query  593   QDKRRLGALVLPH-----KEEVLLAAKKLSVVDSDATEV-SEEKTSKLIHEELQ---KWT  441
             QD+++LGAL++ +        ++    +L     D  E+ + +K   +  EEL    K  
Sbjct  529   QDRKQLGALIVANLTPLEAANIIPPGAQL----RDVLEILASDKVQAIYREELNREVKSR  584

Query  440   TGCTF--QIGPILLINEPFTIDNGLLTPTMKVRRDKVTD  330
              G T   +IGP   + EP TI+NGL+T T K+RR+ VTD
Sbjct  585   PGYTINDRIGPFAFLPEPITIENGLMTQTFKIRRNVVTD  623



>ref|WP_015146448.1| AMP-forming long-chain acyl-CoA synthetase [Oscillatoria acuminata]
 ref|YP_007083718.1| AMP-forming long-chain acyl-CoA synthetase [Oscillatoria acuminata 
PCC 6304]
 gb|AFY79798.1| AMP-forming long-chain acyl-CoA synthetase [Oscillatoria acuminata 
PCC 6304]
Length=668

 Score =   435 bits (1118),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 260/669 (39%), Positives = 398/669 (59%), Gaps = 58/669 (9%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKP-----D  2061
             +++P++W  A  +FGN +AL DP+  P   L+F +L ++I  FA G++ +GL        
Sbjct  30    QSMPEVWPLARSQFGNTLALCDPHAKPVVELTFGQLCEQIQQFAAGVQSLGLPAIADNLP  89

Query  2060  EKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYS  1881
              ++ALF+++S RW++ADQG++T GA +VVRGS +  EELL I  +S S+ L V+N  +  
Sbjct  90    PRVALFSNDSPRWMIADQGLLTAGAADVVRGSDADREELLFILQNSGSMGLVVENLALLK  149

Query  1880  RIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARH  1701
             ++         +++II L  E    T + +  + + S+ +++  G            A  
Sbjct  150   KLRPQLDD-LPIQWIIYLSDEPLP-TDDTLPVQ-VLSFQQVMAKG------------ASA  194

Query  1700  QYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPP  1521
              +   P+  + +ATL+YTSGTTG PKGVMLTH NLLHQI NL   +   PGDR +++LP 
Sbjct  195   TFQPVPLTRETLATLIYTSGTTGKPKGVMLTHGNLLHQIENLPTLMQPTPGDRIITILPT  254

Query  1520  WHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTS  1341
             WH++ R  +YF+ S GC Q YT +  LK DLK Y P+Y   VP ++E++Y G+ KQ    
Sbjct  255   WHSFGRMGQYFLLSRGCSQFYTNIRYLKADLKEYHPKYTFGVPRLWESIYEGVQKQFREQ  314

Query  1340  SPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLH  1161
                R+ +   F   S +Y EA RI +G  L   Q +P+   S  + L A    ALL PLH
Sbjct  315   PANRQKLVKTFFGFSQSYIEAGRILQGLQL---QLEPA---SGSEKLLAGIKRALLWPLH  368

Query  1160  LLARKLVYskihssigiska-gisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACR  984
              L  +LVY+K+  + G      ISGGGSL+ H++ FFE I I +  GYGLTE++PV+  R
Sbjct  369   TLGDRLVYNKVRQATGGQLQYVISGGGSLAMHIENFFEIIGIDVLVGYGLTETSPVLTAR  428

Query  983   RPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAI  804
             R   N+ GS G PI +TE+++V  ET K L  G +G+V A+GPQ+M+GYY+NP AT +AI
Sbjct  429   RFWKNLRGSAGRPIPYTELRIVHPETRKPLQTGERGLVLARGPQIMQGYYQNPEATTKAI  488

Query  803   DENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGS  624
             D  GW +TGDLGW+ P +           +VL GRAKDTIVL++GEN+EP  IE+A + S
Sbjct  489   DPEGWFDTGDLGWLTPGND----------LVLTGRAKDTIVLTNGENIEPQPIEDACIRS  538

Query  623   NLIQQIVVIGQDKRRLGALVLPHKEEV--LLAAKKLSV--------------VDSDATEV  492
               I Q++++GQD++ LGAL++P+ E +    +++ LS+                +   ++
Sbjct  539   AYIDQMMLVGQDQKCLGALIVPNFEALQQWASSQNLSLRLPENVSQGNPPPASGTREIDL  598

Query  491   SEEKTSKLIHEELQKWTTGCTF-----QIGPILLINEPFTIDNGLLTPTMKVRRDKVTDL  327
             S  +   L  +EL +            +IGP  L++EPFT++NG+LT T+K++R  +T+ 
Sbjct  599   SSPEVDNLFRQELNREVKNRPGYRPDDRIGPFSLLSEPFTMENGMLTQTLKMKRPVITER  658

Query  326   YKEQIEDLY  300
             Y ++I+ ++
Sbjct  659   YGDRIDKMF  667



>ref|WP_011611460.1| long-chain fatty acid--CoA ligase [Trichodesmium erythraeum]
 ref|YP_721558.1| AMP-dependent synthetase and ligase [Trichodesmium erythraeum 
IMS101]
 gb|ABG51085.1| AMP-dependent synthetase and ligase [Trichodesmium erythraeum 
IMS101]
Length=657

 Score =   434 bits (1116),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 267/658 (41%), Positives = 391/658 (59%), Gaps = 51/658 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDE----  2058
             +++ +IW   A+ FG   AL DP+  P   L++KEL ++I  FA GL+ + +   E    
Sbjct  34    QSLSEIWPRVAQYFGPITALHDPHAQPEVKLTYKELNEQIQKFAAGLQALEVVSKENGTS  93

Query  2057  ---KIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEM  1887
                ++ALFADNS RW++ADQGI+T G  +VVR   + +EEL+ I   S S++L ++N  +
Sbjct  94    LPTRVALFADNSPRWMIADQGIITAGGADVVRSGTTDIEELIYILKDSGSISLVLENLAL  153

Query  1886  YSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEA  1707
               R+++       +  IILL  E ++    +    P+  ++++I  G E  +        
Sbjct  154   LERLSDRLQD-LPIHLIILLSEEDANSYKSL----PVVKFSQVIAKGEERPL--------  200

Query  1706  RHQYTYEPINS--DDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLS  1533
                   +P N   + +ATL+YTSGTTG PKGVM+TH NLL+QI  L   V   PG+  LS
Sbjct  201   ------QPTNQNLETLATLIYTSGTTGKPKGVMVTHGNLLYQINFLGTVVQPSPGEFTLS  254

Query  1532  MLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQ  1353
             +LP WH++ R AEY   S GC Q+YT    LK+DL+ ++P YL+SVP ++E +Y G+ +Q
Sbjct  255   ILPTWHSFGRTAEYLFLSQGCTQIYTNKRYLKKDLQEHKPHYLMSVPRIWELIYEGVQRQ  314

Query  1352  INTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALL  1173
             +      ++ +A  FL IS  Y +A R+ +   L  +        S L+ L A   + LL
Sbjct  315   LREQPANKQKLARFFLDISERYIQACRVTQELVLELNSP------SELEKLMATWQSWLL  368

Query  1172  CPLHLLARKLVYskihssi-giskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPV  996
              P+H L  K+VY KI  +  G  K  +SGGGSL  H++ FFE I I L  GYGLTE++PV
Sbjct  369   WPIHALGTKIVYQKIRQATGGRLKFAVSGGGSLGMHLENFFEIIGIDLLVGYGLTETSPV  428

Query  995   VACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFAT  816
             +  R    N+ GS G P+  TEIK+V+ ET + L  G KG+V A+GPQ+M GYY+NP AT
Sbjct  429   LTVRHYWENLRGSSGRPLPGTEIKIVNPETYETLGFGEKGLVLARGPQIMVGYYQNPEAT  488

Query  815   KQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEA  636
             K+AID  GWLNTGD+GWI P       RN    ++L GRAKDTIVL++GEN+EP  IE A
Sbjct  489   KKAIDSEGWLNTGDIGWINP-------RND---LILTGRAKDTIVLTNGENIEPQPIENA  538

Query  635   AMGSNLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSD-ATEVSEEKTSKLIHE  459
                S  I QI+++GQD++ LGAL++P+ E V L A +  + +S    +   +   +L  +
Sbjct  539   CTRSQYIDQIMLVGQDQKYLGALIVPNFEAVELWATQSQLSESQPKIDWKSQALQELFRQ  598

Query  458   ELQKWTTGCTF-----QIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             EL +            +IGP  LI +PFTI+NG++T TMK++R  VTD Y++ I +++
Sbjct  599   ELNQEVKNRPGYRPDDRIGPFRLILDPFTIENGMMTQTMKIKRPVVTDHYRDLINEMF  656



>ref|WP_002792569.1| long-chain fatty acid--CoA ligase [Microcystis aeruginosa]
 emb|CCI22432.1| Genome sequencing data, contig C328 [Microcystis aeruginosa PCC 
9808]
Length=639

 Score =   433 bits (1114),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 258/666 (39%), Positives = 391/666 (59%), Gaps = 63/666 (9%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P++W   A+ F N IAL DP+  P   L+++EL ++I  FA  L+ +G+   E +AL
Sbjct  11    QSLPEVWSIVAQRFPNIIALHDPHSKPEVILTYRELYQQIQQFAAALQALGVTETENVAL  70

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             FADNS RW +ADQG M  GA N VR +++  EEL  I   S+S  L V+N +   ++   
Sbjct  71    FADNSPRWFIADQGSMAAGAANAVRSAQADAEELAYILADSDSQTLIVENKQTLGKLLAK  130

Query  1865  FHSHADVRFIILLWGEK---SSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQY  1695
                   ++ I+LL  E     +I+ + ++      + +++ +G E+              
Sbjct  131   I-PELPLKLIVLLTDEDPATGAISVQTLN------FKQLMAIGAEN--------------  169

Query  1694  TYEPIN--SDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPP  1521
             T +PI    +D+ATL+YTSGTTG PKGVML+H NLLHQ+ NL       PGDR LS+LP 
Sbjct  170   TLKPITKGENDLATLIYTSGTTGQPKGVMLSHGNLLHQVRNLNAIFQPDPGDRVLSILPS  229

Query  1520  WHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTS  1341
             WH+YER+ EYFI + GC Q+YT++   K+DLK++ PQ ++ VP ++E+LY GI KQ +  
Sbjct  230   WHSYERSCEYFILAQGCTQIYTSIRTFKQDLKQFSPQLMVGVPRLWESLYEGIQKQFSQQ  289

Query  1340  SPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLH  1161
                ++ +   FL+ S  Y  AKRI +   L           S ++ L AR  + LL PLH
Sbjct  290   PAKKQKLVQFFLEKSEKYVIAKRIADNLSLDHLH------ASGIERLKARIQSLLLYPLH  343

Query  1160  LLARKLVY-skihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACR  984
              +  KLVY     +     K  +SGGGSL+ H+D F+E   I +  GYGLTE++PV   R
Sbjct  344   AIGDKLVYGKIRQAVGNKVKILVSGGGSLARHLDTFYEIAGIPILVGYGLTETSPVATVR  403

Query  983   RPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAI  804
             R + N+ GS G P+  TEI +VD  + + L     G+V  +GPQVM+GYYK P AT++AI
Sbjct  404   RIDHNLRGSAGRPVFQTEICIVDLHSKEVLPTEKHGLVLIRGPQVMQGYYKKPEATEKAI  463

Query  803   DENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGS  624
               +GW ++GD+GW+           ++G +VL GRAKDTIVLS+GEN+EP  IE+A + S
Sbjct  464   SPDGWFDSGDIGWL----------TAAGDLVLTGRAKDTIVLSNGENIEPQPIEDACLRS  513

Query  623   NLIQQIVVIGQDKRRLGALVLPHKEEVLLA----AKKLSVVDSDA---------TEVSEE  483
               I QI+++GQD++ LGAL++P+ +  +LA     +KLS+   DA         +++  +
Sbjct  514   PFISQIMLVGQDQKALGALIVPNLD--ILANWAQEQKLSLNLPDAHSDRSTILSSDLYSK  571

Query  482   KTSKLIHEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKE  318
             K   L  +EL++            QI    LI EPF+++NG++T T+K++R  VT  Y++
Sbjct  572   KVLALYQQELKREVRNRPGYRTDDQIKTFELILEPFSLENGMMTQTLKIKRPVVTQRYRD  631

Query  317   QIEDLY  300
              I +++
Sbjct  632   MINEMF  637



>ref|WP_010476871.1| long-chain fatty acid--CoA ligase [Acaryochloris sp. CCMEE 5410]
Length=646

 Score =   433 bits (1114),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 256/661 (39%), Positives = 385/661 (58%), Gaps = 53/661 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++ +IW  AA+ FG  +AL DP+  P  NL++ EL +++  FA  L+ +G+KP +++AL
Sbjct  21    QSISEIWPIAAQRFGEIVALRDPHVKPEVNLTYVELNRQVQRFAASLQALGVKPGDRVAL  80

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             FADNS RW +ADQG +  GA+NVVR S++S EEL+ I  +S +  L V++    S++ + 
Sbjct  81    FADNSSRWFIADQGSIMAGAVNVVRSSQASPEELVYILENSGATFLLVEDAATLSKL-QP  139

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
             F +   ++ + LL  E  +   +      + ++ +I   G    +  +            
Sbjct  140   FLTKLPLKLVALLSDEDVANNGQSQ----VLNFPQIFQEGTHGAVRAV------------  183

Query  1685  PINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVP--GDRFLSMLPPWHA  1512
             P+  + +ATL+YTSGT+G PKGVML+H NLLH I  +  P  V P  GDR LS+LP WH+
Sbjct  184   PLGREHLATLIYTSGTSGKPKGVMLSHGNLLHIITAM--PAAVQPEVGDRILSILPTWHS  241

Query  1511  YERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPA  1332
             + R  +Y+  S GC Q+YT++ NLK DL+ Y+P Y+ SVP ++E+LY G+ K+       
Sbjct  242   FGRLVDYYFLSQGCTQIYTSIRNLKGDLQTYKPHYMGSVPRLWESLYEGMQKKFRGEPAT  301

Query  1331  RKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLA  1152
             R+ +   F  IS  Y  A+R  +   L  +   PS L   L    A+     L PLH L 
Sbjct  302   RQKLINTFFGISQKYILARRTQQ--RLDINNLNPSGLQRFL----AQLQMLFLGPLHQLG  355

Query  1151  RKLVYskihssigis-kagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPN  975
              ++VY+KI  ++G   K   SGGGSL+ H++ FFE + I+L  GYGLTE++PV+  RR  
Sbjct  356   DRIVYTKIRQAMGGQFKQSFSGGGSLAMHLETFFETVGIELIVGYGLTETSPVLTARRAE  415

Query  974   CNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDEN  795
              N+  S G PI  TEI++VD +T + L  G +G+V  +GPQVM+GYY+NP AT + ID+ 
Sbjct  416   HNLRRSAGKPIPKTEIRIVDPQTRQTLPTGQQGLVIVRGPQVMQGYYQNPEATAKVIDQE  475

Query  794   GWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLI  615
             GW +TGDLGW+ P             +VL GRAKDTIVLS+GEN+EP  +E+A   S  I
Sbjct  476   GWFDTGDLGWLTPTQD----------LVLTGRAKDTIVLSNGENIEPQPLEDACARSAFI  525

Query  614   QQIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVV----------DSDATEVSEEKTSKLI  465
              QI+V+GQD+R LGAL++P+ + +   A + +             S     +++    L 
Sbjct  526   DQIMVVGQDQRSLGALIVPNLDALQQWASEQNASIQLPGNTPPPGSKVLTFTDQPIQDLY  585

Query  464   HEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
              +EL +            +IGP     EPF+I+NG+LT T+KVRR  V + Y++ I  ++
Sbjct  586   RQELTREVKNRPNYRPDERIGPFAFALEPFSIENGMLTQTLKVRRRVVMEHYRDMINGMF  645

Query  299   K  297
             K
Sbjct  646   K  646



>gb|KHG01039.1| putative acyl-activating enzyme 16, chloroplastic -like protein 
[Gossypium arboreum]
Length=332

 Score =   422 bits (1084),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 208/311 (67%), Positives = 250/311 (80%), Gaps = 1/311 (0%)
 Frame = -3

Query  2300  MQIRKCSPilesillsgngl-lssEWKTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFK  2124
             +QIR+CSP+LE   L  NG  LS EWK VPDIW+++AE++G+ +ALVDPYH+PP+ L++ 
Sbjct  8     LQIRRCSPLLEKASLPSNGAPLSDEWKAVPDIWRSSAEKYGDRVALVDPYHDPPSTLTYN  67

Query  2123  ELEKEIVSFAEGLRVIGLKPDEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEEL  1944
             +LE+EI+ F EGLRVIG+KP+EK ALFADNSCRWLVADQGIM TGAINVVRGSRS+VEEL
Sbjct  68    QLEQEILDFTEGLRVIGVKPEEKYALFADNSCRWLVADQGIMATGAINVVRGSRSAVEEL  127

Query  1943  LQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRPIYSYN  1764
             L IYNHSESV L +DNPE ++R+A  F S+A +RFI+LLWGEKS + +    G P++SY 
Sbjct  128   LHIYNHSESVGLVIDNPEFFNRLAGKFCSNARMRFIVLLWGEKSRLANNETLGVPVFSYK  187

Query  1763  EIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQI  1584
             EI+ LG E   AL+ S +AR  Y YE I SDD+ATLVYTSGTTGNPKGVML+H+NLLHQI
Sbjct  188   EIVKLGREYRAALIDSLDARKGYRYEVIGSDDIATLVYTSGTTGNPKGVMLSHKNLLHQI  247

Query  1583  LNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYL  1404
              NL    P   GDRFLSMLP WH YERA EYFIF+ G EQVYTTV  LK+DL+ Y+P Y+
Sbjct  248   ENLGVLGPAKAGDRFLSMLPTWHTYERACEYFIFTRGIEQVYTTVRTLKDDLRNYKPDYM  307

Query  1403  ISVPLVYETLY  1371
             ISVPLVYETLY
Sbjct  308   ISVPLVYETLY  318



>ref|WP_015163446.1| o-succinylbenzoate--CoA ligase [Pseudanabaena sp. PCC 7367]
 ref|YP_007100900.1| o-succinylbenzoate--CoA ligase [Pseudanabaena sp. PCC 7367]
 gb|AFY68472.1| o-succinylbenzoate--CoA ligase [Pseudanabaena sp. PCC 7367]
Length=626

 Score =   432 bits (1111),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 256/648 (40%), Positives = 377/648 (58%), Gaps = 56/648 (9%)
 Frame = -3

Query  2210  IWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNS  2031
             +W+     + + IAL DP+  P   L+++E    I  F  GLR +G+K  +K+AL ADNS
Sbjct  21    VWQKTVAVYPDIIALHDPHAKPEVKLTYQETFSLINQFGAGLRSLGVKAGDKVALIADNS  80

Query  2030  CRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHA  1851
              RWL+ADQGI+  GA N  R S++   ELL I  HS+S AL V+N     ++        
Sbjct  81    SRWLIADQGILAIGAANATRSSQAERTELLYIVEHSDSTALVVENLATLQKLQPDLQDLP  140

Query  1850  DVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEP-INS  1674
              ++ I+LL  E      E  +G   Y+Y ++ D G +  +              +P I  
Sbjct  141   -IKLIVLLSDE------EPPEG--AYNYQQVCDRGVDKDLG-------------DPQITR  178

Query  1673  DDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAE  1494
             D +ATL+YTSGT+G PKGVMLTH N+L Q+      V   PGDR LS+LP WH+YER+ E
Sbjct  179   DTLATLIYTSGTSGKPKGVMLTHGNILTQVRGGTAMVKPFPGDRILSILPTWHSYERSCE  238

Query  1493  YFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIAL  1314
             YF+FS G  Q+YT +  +K DL  ++PQY+++VP ++E++Y GI ++ +  S  ++ +  
Sbjct  239   YFLFSQGVTQIYTNLRKIKNDLATFKPQYMLAVPRLWESIYEGIQRKFDAESATKRKLIN  298

Query  1313  LFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYs  1134
               L  S  Y +A+R+  G  LT   +           L AR       PL+ LA+KLV+ 
Sbjct  299   FLLNASNTYIKARRVVNGLSLTGGNQ-----------LKARLTMFAYAPLYWLAKKLVFD  347

Query  1133  kihssigiskagi-sgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGS  957
             KI + IG     I SGGG+L  H++ F+EA  I++  GYGLTE++P+V  RRP  N+  +
Sbjct  348   KIRAGIGGEFKYICSGGGALQPHLELFYEAAQIEILVGYGLTETSPMVTARRPERNLRTT  407

Query  956   IGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTG  777
              G P+   EIK+VD ET +A  PG +G+V A+GP +M+GYYKNP AT +AID +GW NTG
Sbjct  408   SGIPLPDAEIKIVDPETKEAFPPGKRGLVMARGPMIMQGYYKNPEATNKAIDADGWFNTG  467

Query  776   DLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVI  597
             DLG++   +           + + GRAKDTIVLS+GEN+EP  IE+A   S  I QI+++
Sbjct  468   DLGFLTHKND----------LTITGRAKDTIVLSNGENIEPLSIEDACSSSTYIDQIMLV  517

Query  596   GQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATE----VSEEKTSKLIHEELQKWTTGCT  429
             GQD+R+LGAL++P+ +   L    L   DS+  E    ++++K   +   EL +      
Sbjct  518   GQDQRQLGALIVPNLKA--LEVDGLLPADSELAESIDLLNQDKIRNVFRSELTRKVQDRP  575

Query  428   FQ-----IGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
              Q     IGP   + EPF I NG++T T KV+R+ VT+ Y++ I+ ++
Sbjct  576   GQSINDRIGPFEFLPEPFDISNGMMTQTFKVKRNVVTERYRDLIDQMF  623



>ref|WP_013324773.1| long-chain fatty acid--CoA ligase [Cyanothece sp. PCC 7822]
 ref|YP_003890008.1| AMP-dependent synthetase and ligase [Cyanothece sp. PCC 7822]
 gb|ADN16733.1| AMP-dependent synthetase and ligase [Cyanothece sp. PCC 7822]
Length=637

 Score =   431 bits (1108),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 262/656 (40%), Positives = 390/656 (59%), Gaps = 50/656 (8%)
 Frame = -3

Query  2213  DIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADN  2034
             +IW  A ++FG+ +AL DP+  P   +++ +L ++I  FA GL+ +G+ P+ KIALFADN
Sbjct  15    EIWPIAQQQFGDIVALHDPHSKPEIIITYSDLYRQIQEFARGLQALGVDPEAKIALFADN  74

Query  2033  SCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSH  1854
               RW +ADQGI+ +GA N VR S +  +ELL IYN S+S+AL V++ +  +++       
Sbjct  75    CPRWFIADQGIIISGAANAVRSSGAERQELLYIYNDSDSIALVVEDLKTLTKLRPEL-DE  133

Query  1853  ADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEPINS  1674
               V+F+ILL  E++       D   I ++ ++++LG  S    +    A           
Sbjct  134   LTVQFVILLSDEQAPTN----DPLKILNFKQLLELGANSPFKPVEQTRA-----------  178

Query  1673  DDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAE  1494
               +ATL+YTSGTTG PKGVML+H NLLHQI+N        PGDR LS+LP WH+YER  E
Sbjct  179   -SLATLIYTSGTTGKPKGVMLSHGNLLHQIINFGTVFQPEPGDRVLSILPSWHSYERTVE  237

Query  1493  YFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIAL  1314
             Y++ S G  Q+YT + + K DLKR+QP  ++ VP ++E++Y GI KQ    +  ++ +  
Sbjct  238   YYVLSQGVTQIYTNLRSFKNDLKRFQPHLMVGVPRLWESVYEGIQKQFREQNANKQKLVN  297

Query  1313  LFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYs  1134
              FLK S  Y  A+RI     L           S  + L A+  AALL PLH L  +L+Y 
Sbjct  298   FFLKQSENYILAQRIANNLSLNHLN------ASASERLQAKLKAALLAPLHALGDRLIYE  351

Query  1133  kihssigiskag-isgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGS  957
             K+   +G +    ISGGGSL+ H+D F+E ++I +  GYGLTE++PV   R    N+ GS
Sbjct  352   KVREGVGKNVKAWISGGGSLARHIDTFYEIVNIPVLVGYGLTETSPVTNVRTLERNLRGS  411

Query  956   IGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTG  777
              G P+R+TEI++VD ET + L    +G+V  +GPQVM+GYYK P AT + ID  GW ++G
Sbjct  412   CGTPLRYTEIRIVDPETRQELPVEQQGLVLIRGPQVMQGYYKKPEATAKVIDPQGWFDSG  471

Query  776   DLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVI  597
             DLGW+ P +           +V+ GRAKDTIVLS+GEN+EP  IE+A + S  I QI+++
Sbjct  472   DLGWVTPMND----------LVISGRAKDTIVLSNGENIEPQPIEDACVRSPYIDQIMLV  521

Query  596   GQDKRRLGALVLPHKEEVLLAAKK-----------LSVVDSDATEVSEEKTSKLIHEELQ  450
             GQD++ LGAL++P+ + +   AK+            S+ +  A+ +S +    L+ +EL 
Sbjct  522   GQDQKALGALIVPNLDALQTWAKQQQLDLEIPGPEASIEEIHASSLSSKPVQNLLRQELN  581

Query  449   KWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
             +            QI    LI EPF+I+NG +T T+K++R  V + Y+  I+ +YK
Sbjct  582   RLVKDRPGYRADDQIKEFELILEPFSIENGTMTQTLKIKRPVVMERYRAIIDGMYK  637



>ref|WP_002786219.1| long-chain fatty acid--CoA ligase [Microcystis aeruginosa]
 emb|CCI15162.1| Long-chain-fatty-acid CoA ligase [Microcystis aeruginosa PCC 
9807]
Length=639

 Score =   431 bits (1108),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 257/666 (39%), Positives = 392/666 (59%), Gaps = 63/666 (9%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P++W   A+ F N IAL DP+  P   L+++EL ++I  FA  L+ +G+   E +AL
Sbjct  11    QSLPEVWSIVAQRFPNIIALHDPHSKPEVILTYRELYQQIQQFAAALQALGVTETENVAL  70

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             FADNS RW +ADQG M  GA N VR +++  EEL  I   S+S  L V+N +   ++   
Sbjct  71    FADNSPRWFIADQGSMAAGAANAVRSAQADAEELAYILADSDSQTLIVENKKTLGKLLAK  130

Query  1865  FHSHADVRFIILLWGEK---SSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQY  1695
                   ++ I+LL  E     +I+ + ++      + +++ +G E+              
Sbjct  131   I-PELPLKLIVLLTDEDPDTGAISVQTLN------FKQLMAIGAEN--------------  169

Query  1694  TYEPINS--DDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPP  1521
             T +PI    +D+ATL+YTSGTTG PKGVML+H NLLHQ+ NL       PGDR LS+LP 
Sbjct  170   TLKPITKGENDLATLIYTSGTTGQPKGVMLSHGNLLHQVRNLNAIFQPDPGDRVLSILPS  229

Query  1520  WHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTS  1341
             WH+YER+ EYF  + GC Q+YT++   K+DLK++ PQ ++ VP ++E+LY GI KQ +  
Sbjct  230   WHSYERSCEYFSLAQGCTQIYTSIRTFKQDLKQFSPQLMVGVPRLWESLYEGIQKQFSQQ  289

Query  1340  SPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLH  1161
                ++ +   FL+ S  Y  AKRI +   L      P+      + L AR  + LL PLH
Sbjct  290   PAKKQKLVQFFLEKSEKYVIAKRIADNLSLDHLHASPT------ERLKARIQSLLLYPLH  343

Query  1160  LLARKLVYskihssigiskagisggg-slssHVDKFFEAIDIKLQNGYGLTESAPVVACR  984
              +  KLVY KI  ++G        GG SL+ H+D F+E   I +  GYGLTE++PV   R
Sbjct  344   AIGDKLVYGKIRQAVGNKVKIFVSGGGSLARHLDTFYEIAGIPILVGYGLTETSPVATVR  403

Query  983   RPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAI  804
             R + N+ GS G P+  TEI +VD  + + L     G+V  +GPQVM+GYYK P AT++AI
Sbjct  404   RIDHNLRGSAGRPVFQTEICIVDLHSKEVLPTEKHGLVLIRGPQVMQGYYKKPEATEKAI  463

Query  803   DENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGS  624
               +GW ++GD+GW+           ++G +VL GRAKDTIVLS+GEN+EP  IE+A + S
Sbjct  464   SPDGWFDSGDIGWL----------TAAGDLVLTGRAKDTIVLSNGENIEPQPIEDACLRS  513

Query  623   NLIQQIVVIGQDKRRLGALVLPHKEEVLLA----AKKLSV----VDSD-----ATEVSEE  483
               I QI+++GQD++ LGAL++P+ +  +LA     +KLS+    + SD     ++++  +
Sbjct  514   PFISQIMLVGQDQKALGALIVPNLD--ILANWAQEQKLSLNLPDLHSDRSTILSSDLYSK  571

Query  482   KTSKLIHEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKE  318
             K   L  +EL++            QI    LI EPF+++NG++T T+K++R  VT  Y++
Sbjct  572   KVLDLYQQELKREVRNRPSYRTDDQIKTFELILEPFSLENGMMTQTLKIKRPVVTQRYRD  631

Query  317   QIEDLY  300
              I +++
Sbjct  632   MINEMF  637



>ref|WP_015154034.1| AMP-dependent synthetase and ligase [Chroococcidiopsis thermalis]
 ref|YP_007091355.1| AMP-dependent synthetase and ligase [Chroococcidiopsis thermalis 
PCC 7203]
 gb|AFY87486.1| AMP-dependent synthetase and ligase [Chroococcidiopsis thermalis 
PCC 7203]
Length=674

 Score =   432 bits (1111),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 259/679 (38%), Positives = 392/679 (58%), Gaps = 71/679 (10%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P+IW  A ++FG+ +AL DP+  P T  ++ +L + I  FA GL+ +G+   +++ L
Sbjct  31    QSLPEIWAIAVKKFGDTVALHDPHLKPETTFTYNQLYQHIQIFAAGLQALGVAAGDRVGL  90

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
              ADNS RW++ADQGI+T G ++VVR S++  +ELL I  HS S  L +++ +  S++ E 
Sbjct  91    IADNSPRWMIADQGILTAGGVDVVRSSQAEKQELLYILEHSGSTTLVIEDRKTLSKVREG  150

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
                   ++ ++LL  E   I  E  D   I ++++++ +G    +              +
Sbjct  151   L-DKLPIQLVVLLSDE---ILDE-SDSLKIMNFSQLMAVGENQPL--------------Q  191

Query  1685  PI--NSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHA  1512
             P+  N D +ATL+YTSGTTG PKGVML+H NLLHQ+ +    V    GDR LS+LP WH 
Sbjct  192   PVAQNRDTLATLMYTSGTTGKPKGVMLSHGNLLHQVTSFGAVVQPEIGDRILSILPVWHC  251

Query  1511  YERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPA  1332
             YER+ EYF+ S GC Q+YT + ++K DLK ++P+ ++ VP ++E++Y G+ KQ       
Sbjct  252   YERSVEYFLLSQGCTQIYTNIRHVKADLKAFKPRLMVGVPRLWESIYEGVQKQFRDQPVK  311

Query  1331  RKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLA  1152
             ++ +    L IS  Y +A+RI  G  L  D   P    S L  L A    A+L P+H LA
Sbjct  312   KQRLIYSLLNISQRYIKARRIVRGLAL--DNLYP----SPLQRLQAGIQTAVLAPIHNLA  365

Query  1151  RKLVYskihssi-giskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPN  975
              +L+Y ++  +  G  +  ISGGGSL+ H++ FFE + +++  GYGLTE++PV   RRP 
Sbjct  366   DRLIYKQVREATGGRIRQVISGGGSLAMHLENFFEIVGVEILVGYGLTETSPVTHVRRPW  425

Query  974   CNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDEN  795
              N+ GS G P+  TE K+VD ET + L P  +G+V  +GPQVM+GYYKNP AT +AID  
Sbjct  426   RNLRGSSGLPMAGTEAKIVDPETRQTLPPMQRGLVLIRGPQVMQGYYKNPEATAKAIDPE  485

Query  794   GWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLI  615
             GW +TGDLG + P +           IVL GRAKDTIVLS+GEN+EP  IE+A + S  I
Sbjct  486   GWFDTGDLGLVTPKND----------IVLTGRAKDTIVLSNGENIEPQPIEDACLRSPYI  535

Query  614   QQIVVIGQDKRRLGALVLPHKE----------------EVLLAAKKLSVVDSDA------  501
              QI+++GQD+R LGAL++P+ E                EV    +       D+      
Sbjct  536   DQIMLVGQDQRSLGALIVPNLEALQQWAVSQNLQLALPEVRQGGQGEQGGTPDSRTGGFG  595

Query  500   ------TEVSEEKTSKLIHEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMK  354
                    +++      L  +EL +            +I    LI EPF+I+NG+LT T+K
Sbjct  596   NPPLPTIDLNHPAIQNLFRQELTREVQDRPGYRPDDRISTYRLILEPFSIENGMLTQTLK  655

Query  353   VRRDKVTDLYKEQIEDLYK  297
             +RR  V + Y + I+ +++
Sbjct  656   IRRPVVMERYHDMIDGMFR  674



>ref|WP_023071993.1| amp-forming long-chain acyl- synthetase [Leptolyngbya sp. Heron 
Island J]
 gb|ESA37270.1| amp-forming long-chain acyl- synthetase [Leptolyngbya sp. Heron 
Island J]
Length=641

 Score =   430 bits (1106),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 248/652 (38%), Positives = 391/652 (60%), Gaps = 43/652 (7%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++ +IW   A+ F N  A+ +P+  P   L++ +L ++I  FA GL+ +G++P +KIAL
Sbjct  24    QSIAEIWPIVADRFPNQTAVEEPHGTPEITLTYGQLAQQIQQFAAGLQTLGIQPQDKIAL  83

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             F+DN  RWLVADQGIMT GA++ VRGS++  +EL  I  HS+SVA+ V +    +++A+ 
Sbjct  84    FSDNQPRWLVADQGIMTAGAVDAVRGSQADKDELGYILEHSDSVAIIVQDQATLTKLADH  143

Query  1865  FHSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYE  1686
               +  D+RFI LL  E    T ++     + ++ ++++LG  + + +   + +R Q    
Sbjct  144   L-ADKDLRFIALLSDE----TPQLDTATKLLNFKQLMELG--AGVEVQTVEYSRGQ----  192

Query  1685  PINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYE  1506
                   +ATL+YTSGT+G PKGVML+  NLL QI      V   PG + +S+LP WH YE
Sbjct  193   ------LATLMYTSGTSGRPKGVMLSQANLLSQIAGACSVVHPKPGSKVMSILPIWHCYE  246

Query  1505  RAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARK  1326
             R  EYF  S G  Q+YT++ ++K DLK Y+P Y++ VP ++E++Y G+ KQ      +++
Sbjct  247   RTFEYFTLSQGVHQIYTSIRHVKSDLKSYKPNYMVGVPRLWESIYEGVQKQFREQPDSKQ  306

Query  1325  LIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARK  1146
              +   FL  S  Y  AKRI +   L              D   A    A+L P H L   
Sbjct  307   KLINFFLHQSQRYITAKRIADNLSLND-------TPGGFDRAMASTQCAVLKPFHKLGDT  359

Query  1145  LVYskihssigiska-gisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCN  969
             +VY K+  + G +    +SGGGS++ H++ F+E I + +  GYGLTE++P+   RRP  N
Sbjct  360   IVYKKVREATGGNINFVVSGGGSIADHLEDFYEIIGVDILGGYGLTETSPITHVRRPWQN  419

Query  968   VLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGW  789
             + G+ G P+  T+ ++VD ET + +  G +G+V  +GPQVM+GYYKNP AT +AID +GW
Sbjct  420   LRGADGQPLPGTQTRIVDLETRQDVPQGQQGLVLIRGPQVMQGYYKNPEATTKAIDPDGW  479

Query  788   LNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQ  609
              +TGDLG I  N          G +++ GRAKDTIVL++GEN+EP  +E A   S  + Q
Sbjct  480   FDTGDLGKITAN----------GDLIITGRAKDTIVLTNGENIEPQPVENACARSKYVDQ  529

Query  608   IVVIGQDKRRLGALVLPHKEEV--LLAAKKLSVVDSDATE-VSEEKTSKLIHEELQKWTT  438
             I+++GQD++ LGAL++P+ E +    A + +++ +++  E +S  K   L  +EL +   
Sbjct  530   IMLVGQDQKVLGALIVPNLEALSQWAATQGITINETNPAESLSNPKVQTLFKQELTREVK  589

Query  437   G-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLYK  297
                      +IGP  L++EPF+I+NG+LT T+K++R  VT  Y+  I+ L++
Sbjct  590   ARPGHRPDERIGPFTLLSEPFSIENGMLTQTLKIKRPVVTRNYQNVIDGLFE  641



>ref|WP_002764891.1| long-chain fatty acid--CoA ligase [Microcystis aeruginosa]
 emb|CCI02743.1| Long-chain-fatty-acid CoA ligase [Microcystis aeruginosa PCC 
9443]
Length=639

 Score =   430 bits (1105),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 257/666 (39%), Positives = 391/666 (59%), Gaps = 63/666 (9%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P++W   A+ F N IAL DP+  P   L+++EL ++I  FA  L+ +G+   E +AL
Sbjct  11    QSLPEVWSIVAQRFPNIIALHDPHSKPEVILTYRELYQQIQQFAAALQALGVTETENVAL  70

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             F DNS RW +ADQG M  GA N VR +++  EEL  I   S+S  L V+N +   ++   
Sbjct  71    FVDNSPRWFIADQGSMAAGAANAVRSAQADAEELAYILADSDSQTLIVENNKTLGKLLAK  130

Query  1865  FHSHADVRFIILLWGEK---SSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQY  1695
                   ++ I+LL  E     +I+ + ++      + +++ +G E+              
Sbjct  131   I-PELPLKLIVLLTDEDPATGAISVQTLN------FKQLMAIGAEN--------------  169

Query  1694  TYEPINS--DDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPP  1521
             T +PI    +D+ATL+YTSGTTG PKGVML+H NLLHQ+ NL       PGDR LS+LP 
Sbjct  170   TLKPITKGENDLATLIYTSGTTGQPKGVMLSHGNLLHQVRNLNAIFQPDPGDRVLSILPS  229

Query  1520  WHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTS  1341
             WH+YER+ EYF  + GC Q+YT++   K+DLK++ PQ ++ VP ++E+LY GI KQ +  
Sbjct  230   WHSYERSCEYFSLAQGCTQIYTSIRTFKQDLKQFSPQLMVGVPRLWESLYEGIQKQFSQQ  289

Query  1340  SPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLH  1161
                ++ +   FL+ S  Y  AKRI +   L      P       + L AR  + LL PLH
Sbjct  290   PAKKQKLVQFFLEKSEKYVIAKRIADNLSLDHLHASPG------ERLKARIQSLLLYPLH  343

Query  1160  LLARKLVYskihssigiskagisggg-slssHVDKFFEAIDIKLQNGYGLTESAPVVACR  984
              +  KLVYSKI  ++G        GG SL+ H+D F+E   I +  GYGLTE++PV   R
Sbjct  344   AIGDKLVYSKIRQAVGNKVKIFVSGGGSLARHLDTFYEIAGIPILVGYGLTETSPVATVR  403

Query  983   RPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAI  804
             R + N+ GS G P+  TEI +VD  + + L     G+V  +GPQVM+GYYK P AT++AI
Sbjct  404   RIDHNLRGSAGRPVLQTEISIVDLHSKEVLPTEKHGLVLIRGPQVMRGYYKKPEATEKAI  463

Query  803   DENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGS  624
               +GW ++GD+GW+           ++G +VL GRAKDTIVLS+GEN+EP  IE+A + S
Sbjct  464   SPDGWFDSGDIGWL----------TAAGDLVLTGRAKDTIVLSNGENIEPQPIEDACLRS  513

Query  623   NLIQQIVVIGQDKRRLGALVLPHKEEVLLA----AKKLSV----VDSD-----ATEVSEE  483
               I QI+++GQD++ LGAL++P+ +  +LA     +KLS+    + SD     ++++  +
Sbjct  514   PFISQIMLVGQDQKALGALIVPNLD--ILANWAQEQKLSLNLPDLHSDRSTILSSDLYSK  571

Query  482   KTSKLIHEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKE  318
             K   L  +EL++            QI    LI EPF+++NG++T T+K++R  VT  Y++
Sbjct  572   KVLDLYQQELKREVRNRPSYRTDDQIKTFELILEPFSLENGMMTQTLKIKRPVVTQRYRD  631

Query  317   QIEDLY  300
              I +++
Sbjct  632   MINEMF  637



>ref|WP_015218552.1| long-chain-fatty-acid--CoA ligase [Cyanobacterium aponinum]
 ref|YP_007160865.1| long-chain-fatty-acid--CoA ligase [Cyanobacterium aponinum PCC 
10605]
 gb|AFZ52821.1| Long-chain-fatty-acid--CoA ligase [Cyanobacterium aponinum PCC 
10605]
Length=642

 Score =   429 bits (1104),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 258/657 (39%), Positives = 384/657 (58%), Gaps = 54/657 (8%)
 Frame = -3

Query  2213  DIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADN  2034
             ++W       G+ IAL DP+  P   L+++++ K I  FA  L+ + +K  EKIALFADN
Sbjct  19    EMWDLLPSYCGDIIALSDPHSEPEVRLTYEDVAKTIKQFASALQSLDIKSGEKIALFADN  78

Query  2033  SCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSH  1854
             S RWL+ADQGI+  G  + VR   +  EELL I  HS+S  L + +     ++       
Sbjct  79    SPRWLIADQGIIINGCADAVRSPLADREELLYILEHSDSSVLVIQDVASLEKLRPELDDF  138

Query  1853  ADVRFIILLWGEKSSITSEVMDGRP--IYSYNEIIDLGNESHMALLHSQEARHQYTYEPI  1680
             + ++F++LL  E      EV    P   Y++++ + LG            A+  + + P+
Sbjct  139   S-LKFVVLLSDE------EVNRDYPHTTYNFSQFLQLG------------AQRPFIFVPV  179

Query  1679  NSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERA  1500
               D +ATL+YTSGTTG PKGVML+H NLLHQ+ +L   +    GDR LS+LP WH+YERA
Sbjct  180   EKDTLATLIYTSGTTGKPKGVMLSHRNLLHQVCHLDVILQPKKGDRILSILPSWHSYERA  239

Query  1499  AEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKLI  1320
             AEYF+ S G   +YT +   K+DLK+ +P ++I VP ++E++Y G+ KQ    S  ++ +
Sbjct  240   AEYFLLSRGTTLIYTNIRYFKQDLKKIKPHHMIGVPRLWESIYEGVQKQFRDGSKTQQKL  299

Query  1319  ALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLV  1140
                FL  S  Y +AKRI  G  L  +   PS        L A+  + LL P+H L  KL+
Sbjct  300   VNFFLATSEKYIKAKRIKNG--LDLEHLNPSSGQK----LTAKITSTLLLPVHKLGDKLI  353

Query  1139  Yskihssigiskag-isgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVL  963
             Y+K+   +G      +SGGGSL+ H+D FF+ + I L  GYGLTE++PV   RR + N++
Sbjct  354   YTKVREGVGGCIQTWVSGGGSLAKHIDNFFQIVGIPLIVGYGLTETSPVTNARRISRNIV  413

Query  962   GSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLN  783
             G+ G PI  TEIK+V+ ET + L  G KG+V  +G QVM+GYYKNP AT +AIDE GW +
Sbjct  414   GASGQPIPETEIKIVNPETRETLPQGEKGLVFIRGTQVMQGYYKNPEATTKAIDEEGWFD  473

Query  782   TGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIV  603
             +GDLGW+ P++           +V+ GRAKDTIVLS+GEN+EP  +E+A + S  I QI+
Sbjct  474   SGDLGWVTPDND----------LVITGRAKDTIVLSNGENIEPQPLEDACVRSPYIDQIM  523

Query  602   VIGQDKRRLGALVLPHKEEVL--------------LAAKKLSVVDSD--ATEVSEEKTSK  471
             V+GQD++ LGAL++P+ E +               + A +  +  SD  ++ V      +
Sbjct  524   VVGQDQKYLGALIVPNLEALQKWGEEQNRILNLPSVGANRAEIEKSDLYSSGVLSLYKQE  583

Query  470   LIHEELQKWTTGCTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             L  E   +       +I    LI EPF+IDNG++T T+K++R  +T+ Y++ I  ++
Sbjct  584   LAREVKNRPGYRIDDRISVFELILEPFSIDNGMMTQTLKIKRPVITNHYQDMINSMF  640



>ref|WP_024970666.1| long-chain fatty acid--CoA ligase [Microcystis aeruginosa]
Length=639

 Score =   429 bits (1103),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 256/666 (38%), Positives = 390/666 (59%), Gaps = 63/666 (9%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P++W   A+ F N IAL DP+  P   L+++EL ++I  FA  L+ +G+   E +AL
Sbjct  11    QSLPEVWSIVAQRFPNIIALHDPHSKPEVILTYRELYQQIQQFAAALQALGVTETENVAL  70

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             FADNS RW +ADQG M  GA N VR +++  EEL  I   S+S  L V+N +   ++   
Sbjct  71    FADNSPRWFIADQGSMAAGAANAVRSAQADAEELAYILADSDSQTLIVENKQTLGKLLAK  130

Query  1865  FHSHADVRFIILLWGEK---SSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQY  1695
                   ++ I+LL  E     +I+ + ++      + +++ +G E+              
Sbjct  131   I-PELPLKLIVLLTDEDPATGAISVQTLN------FKQLMAIGAEN--------------  169

Query  1694  TYEPIN--SDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPP  1521
             T +PI    +D+ATL+YTSGTTG PKGVML+H NLLHQ+ NL       PGDR LS+LP 
Sbjct  170   TLKPITKGENDLATLIYTSGTTGQPKGVMLSHGNLLHQVRNLNAIFQPDPGDRVLSILPS  229

Query  1520  WHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTS  1341
             WH+YER+ EYF  + GC Q+YT++   K+DLK++ PQ ++ VP ++E+LY GI KQ +  
Sbjct  230   WHSYERSCEYFSLAQGCTQIYTSIRTFKQDLKQFSPQLMVGVPRLWESLYEGIQKQFSQQ  289

Query  1340  SPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLH  1161
                ++ +   FL+ S  Y  AKRI +   L           S ++ L AR  + LL PLH
Sbjct  290   PAKKQKLVQFFLEKSEKYVIAKRIADNLSLDHLH------ASGIERLKARIQSLLLYPLH  343

Query  1160  LLARKLVY-skihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACR  984
              +  KLVY     +     K  +SGGGSL+ H+D F+E   I +  GYGLTE++PV   R
Sbjct  344   AIGDKLVYGKIRQAVGNKVKILVSGGGSLARHLDTFYEIAGIPILVGYGLTETSPVATVR  403

Query  983   RPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAI  804
             R + N+ GS G P+  TEI +VD  + + L     G+V  +GPQVM+GYYK P AT++AI
Sbjct  404   RIDHNLRGSAGRPVFQTEICIVDLHSKEVLPTEKHGLVLIRGPQVMQGYYKKPEATEKAI  463

Query  803   DENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGS  624
               +GW ++GD+GW+           ++G +VL GRAKDTIVLS+GEN+EP  IE+A + S
Sbjct  464   SPDGWFDSGDIGWL----------TAAGDLVLTGRAKDTIVLSNGENIEPQPIEDACLRS  513

Query  623   NLIQQIVVIGQDKRRLGALVLPHKEEVLLA----AKKLSVVDSD---------ATEVSEE  483
               I QI+++GQD++ LGAL++P+ +  +LA     +KLS+   D         ++++  +
Sbjct  514   PFISQIMLVGQDQKALGALIVPNLD--ILANWAQEQKLSLNLPDPHSDRSTILSSDLYSK  571

Query  482   KTSKLIHEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKE  318
             K   L  +EL++            QI    LI EPF+++NG++T T+K++R  VT  Y++
Sbjct  572   KVLDLYQQELKREVRNRPGYRTDDQIKTFELILEPFSLENGMMTQTLKIKRPVVTQRYRD  631

Query  317   QIEDLY  300
              I +++
Sbjct  632   MINEMF  637



>ref|WP_022607660.1| Long-chain acyl-CoA synthetase (AMP-forming) [Rubidibacter lacunae]
 gb|ERN41008.1| Long-chain acyl-CoA synthetase (AMP-forming) [Rubidibacter lacunae 
KORDI 51-2]
Length=648

 Score =   429 bits (1104),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 264/664 (40%), Positives = 393/664 (59%), Gaps = 58/664 (9%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P +W+  A ++GN  AL DP+  P   LS++++  +I  FA GL+  GL+PD K+AL
Sbjct  19    ESLPAMWELMARQYGNLAALHDPHSQPVVTLSYEQVNAQIRQFAAGLQARGLQPDAKVAL  78

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
              ADNS RWLVADQGIM  G ++VVR S++  +ELL I  HS+S AL +++    S+  E 
Sbjct  79    IADNSPRWLVADQGIMLAGGVDVVRSSQAERQELLYILEHSDSSALVIED----SKTLEK  134

Query  1865  FHSHAD---VRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQY  1695
                  D   + F++LL  E    T ++       ++ E++  G +   +L  + + R   
Sbjct  135   LRPELDTLPIAFVVLLSDESPDATQQLE----CSNFTELMAAGKDR--SLQPAAQGR---  185

Query  1694  TYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWH  1515
                    D +ATL+YTSGTTG PKGVML+H NLLHQ+  +   +   PGDR LS+LP WH
Sbjct  186   -------DRLATLIYTSGTTGKPKGVMLSHGNLLHQVEVVEAILQPKPGDRALSILPTWH  238

Query  1514  AYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSP  1335
             +YER+ EYF+FS GC Q+YT++ + K+D++  QP+Y++ VP ++E++Y GI KQI+    
Sbjct  239   SYERSCEYFLFSRGCSQIYTSLRHFKKDIQAQQPEYIVGVPRLWESIYDGIQKQISEQPA  298

Query  1334  ARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLL  1155
             +++     FL +S  Y  AKRI E   L      P      L  L A   A LL PLH L
Sbjct  299   SKQRAVKTFLDLSGRYVRAKRIAENLSLNPPNPSP------LARLVACLQALLLAPLHAL  352

Query  1154  ARKLVYskihssigiskag-isgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRP  978
               +LVY  I   +G +    +SGGGSL+ H+D FFEAI I +  GYGLTE+AP+   R P
Sbjct  353   GDRLVYRTIRQGVGGNIESFLSGGGSLARHIDDFFEAIGIPVLVGYGLTETAPITHGRIP  412

Query  977   NCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDE  798
             + N+ GS G PI  TE ++VD E+ + ++ G +G+V  +GPQVM+GYYKNP AT +AID 
Sbjct  413   SRNLRGSAGRPIPGTEARIVDPESRQPVATGQRGLVLLRGPQVMQGYYKNPDATAKAIDA  472

Query  797   NGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNL  618
             +GW ++GDLGW+               ++L GRAKDTIVL++GEN+EP  IE+A + S  
Sbjct  473   DGWFDSGDLGWVTAEDD----------LILTGRAKDTIVLTNGENIEPQPIEDACVRSTY  522

Query  617   IQQIVVIGQDKRRLGALVLPHKEEV------------LLAAKKLSVVD-SDATEVSEEKT  477
             + QIV++GQD+R LGAL++P  E +            L  A  +S    SD  ++  +  
Sbjct  523   VNQIVLVGQDQRALGALIVPDLEALQQWVQSQQPDLTLPTADAVSTGQTSDRGDLDSQPV  582

Query  476   SKLIHEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQI  312
              +L  +EL +            +I    L+ EPF+  +G +T T+K++R  V + Y++ I
Sbjct  583   QELFRQELNREVQNRPGYRIDDRITVFRLLLEPFSPASGTMTQTLKIKRPVVHERYRDII  642

Query  311   EDLY  300
             + ++
Sbjct  643   DGMF  646



>ref|WP_031293345.1| long-chain fatty acid--CoA ligase [Leptolyngbya sp. Heron Island 
J]
Length=684

 Score =   431 bits (1107),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 255/686 (37%), Positives = 393/686 (57%), Gaps = 79/686 (12%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEK---  2055
             +++P +W+   + FGN  AL+DP+  P  +L+++++ ++I  FA G++ + L P      
Sbjct  34    RSLPQMWEITEQYFGNVEALIDPHSRPAVSLTYRQVYQQIRQFAAGIQTL-LSPSSPLQT  92

Query  2054  ---------------------------IALFADNSCRWLVADQGIMTTGAINVVRGSRSS  1956
                                        +ALFADNS +WLVADQGIM  GA + VR + + 
Sbjct  93    SSQTSSQDLSLNLSLGLSQNPPQNPPIVALFADNSWQWLVADQGIMLAGAADAVRSATAD  152

Query  1955  VEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRP-  1779
              +ELL I  HS+S  L V+N +   R+ +   +   V +++LL  E+       + GRP 
Sbjct  153   RDELLYILEHSQSSGLVVENAKTLDRLGDRIWT-LPVEWVVLLSNEQPD-----LPGRPS  206

Query  1778  ---IYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLT  1608
                + +++++++LGN+  +  +++              D +ATL+YTSGTTG PKGVML+
Sbjct  207   HVKLLTFDQLLELGNQQPLQSVNT------------TPDTLATLIYTSGTTGQPKGVMLS  254

Query  1607  HENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDL  1428
             H N ++Q++ L   +  + GDR LS+LP WH++ R  EY+  S GC QVYT    LK+DL
Sbjct  255   HANFIYQLVALTAIIQPLVGDRTLSILPTWHSFGRVGEYYTLSQGCTQVYTNRRYLKQDL  314

Query  1427  KRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLT  1248
             K YQP Y++ VP ++E+++ GI K      P  +     FL IS  Y +A R ++ + L 
Sbjct  315   KTYQPAYVVGVPRLWESIFEGIQKSFRDRPPRMQAFIQSFLAISSRYIQAVRTWKHRDLR  374

Query  1247  KDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagis-gggslss  1071
                  P+    +  W    A   LL PLH L   L+Y ++  ++G +   +  GGGSL+ 
Sbjct  375   N--LHPTRAAVLRAW----ATTLLLAPLHYLGELLLYKRMQQALGGNVKQLICGGGSLAQ  428

Query  1070  HVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALS  891
             H++ FFE I I++  GYGLTE++PV++ RR   NV  + G P+  TE +VVD ET +AL 
Sbjct  429   HLEDFFEMIGIEILVGYGLTETSPVLSARRYWNNVRKASGQPLIQTEFRVVDLETRQALP  488

Query  890   PGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIV  711
              G +G+V  +GPQ+M+GYY+NP AT +AID  GW +TGD+GW+  +          G I+
Sbjct  489   AGKRGLVLTRGPQIMQGYYRNPEATAKAIDPEGWFDTGDIGWLADD----------GSII  538

Query  710   LEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEV----  543
             L GRAKDTIVLS+GEN+EP  IE+A + S+ I QIV++GQD++ LGAL++P+ E +    
Sbjct  539   LTGRAKDTIVLSNGENIEPQPIEDACLRSSFIDQIVLVGQDRKALGALIVPNLEALQAWG  598

Query  542   LLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTG-----CTFQIGPILLINEPFTIDN  378
             L  +  L + +++A         KL+ +EL +            +I    L+ EP TI+N
Sbjct  599   LAQSPPLMIGENEAIAPDNLIIHKLLRQELNREVRDRPGYRSQDEIAAFTLLPEPMTIEN  658

Query  377   GLLTPTMKVRRDKVTDLYKEQIEDLY  300
             GLLT T+K+RR+ V D Y E I+ L+
Sbjct  659   GLLTQTLKIRRNVVVDRYSEMIQGLF  684



>ref|WP_002801649.1| long-chain fatty acid--CoA ligase [Microcystis aeruginosa]
 emb|CCI35368.1| Genome sequencing data, contig C328 [Microcystis aeruginosa PCC 
9701]
Length=639

 Score =   429 bits (1103),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 255/666 (38%), Positives = 392/666 (59%), Gaps = 63/666 (9%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P++W   A+ F + IAL DP+  P   ++++EL ++I  FA  L+ +G+   E +AL
Sbjct  11    QSLPEVWSIVAQRFPDIIALHDPHSKPEVIITYRELYQQIQQFAAALQALGVTETENVAL  70

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             FADNS RW +ADQG M  GA N VR +++  EEL  I   S+S  L V+N +   ++   
Sbjct  71    FADNSPRWFIADQGSMAAGAANAVRSAQADAEELAYILADSDSQTLIVENNKTLGKLLAK  130

Query  1865  FHSHADVRFIILLWGEK---SSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQY  1695
                   ++ I+LL  E     +I+ + ++      + +++ +G E+              
Sbjct  131   I-PELPLKLIVLLTDEDPATGAISVQTLN------FKQLMAIGAEN--------------  169

Query  1694  TYEPI--NSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPP  1521
             T +PI  + +D+ATL+YTSGTTG PKGVML+H NLLHQ+ NL       PGDR LS+LP 
Sbjct  170   TLKPITKSENDLATLIYTSGTTGQPKGVMLSHGNLLHQVRNLNAIFQPDPGDRVLSILPS  229

Query  1520  WHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTS  1341
             WH+YER+ EYF  + GC Q+YT++   K+DLK++ PQ ++ VP ++E+LY GI KQ +  
Sbjct  230   WHSYERSCEYFSLAQGCTQIYTSIRTFKQDLKQFSPQLMVGVPRLWESLYEGIQKQFSEQ  289

Query  1340  SPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLH  1161
             S  ++ +    L+ S  Y  AKRI +   L      P       + L AR  + LL PLH
Sbjct  290   SATKQKLVRFLLEKSEKYVIAKRIADNLSLDHLHASPG------ERLKARIQSLLLYPLH  343

Query  1160  LLARKLVYskihssigiskagisggg-slssHVDKFFEAIDIKLQNGYGLTESAPVVACR  984
              +  KLVY KI  ++G     +  GG SL+ H+D F+E   I +  GYGLTE++PV   R
Sbjct  344   AIGDKLVYGKIRQAVGNKVKILVSGGGSLARHLDTFYEIAGIPILVGYGLTETSPVATVR  403

Query  983   RPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAI  804
             R + N+ GS G P+  TEI +VD ++ + L     G+V  +GPQVM+GYYK P AT++AI
Sbjct  404   RIDHNLRGSAGRPVFQTEICIVDLQSKEVLPTEKHGLVLIRGPQVMQGYYKKPEATEKAI  463

Query  803   DENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGS  624
               +GW ++GD+GW+           ++G +VL GRAKDTIVLS+GEN+EP  IE+A + S
Sbjct  464   SPDGWFDSGDIGWL----------TAAGDLVLTGRAKDTIVLSNGENIEPQPIEDACLRS  513

Query  623   NLIQQIVVIGQDKRRLGALVLPHKEEVLLA----AKKLSVVDSDA---------TEVSEE  483
               I QI+++GQD++ LGAL++P+ +  +LA     +KLS+   DA         +++  +
Sbjct  514   PFISQIMLVGQDQKALGALIVPNLD--ILANWAQEQKLSLNLPDAHSDRSTILSSDLYSK  571

Query  482   KTSKLIHEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKE  318
             K   L  +EL++            QI    LI EPF+++NG++T T+K++R  VT  Y++
Sbjct  572   KVLALYQQELKREVRNRPGYRTDDQIKTFELILEPFSLENGMMTQTLKIKRPVVTQRYRD  631

Query  317   QIEDLY  300
              I +++
Sbjct  632   MINEMF  637



>ref|WP_002782035.1| Long-chain-fatty-acid CoA ligase [Microcystis aeruginosa]
 emb|CCI16697.1| Long-chain-fatty-acid CoA ligase [Microcystis aeruginosa PCC 
9806]
Length=639

 Score =   429 bits (1103),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 253/664 (38%), Positives = 391/664 (59%), Gaps = 59/664 (9%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P++W   A+ F + IAL DP+  P   ++++EL ++I  FA  L+ +G+   E +AL
Sbjct  11    QSLPEVWSIVAQRFPDIIALHDPHSKPEVIITYRELYQQIQQFAAALQALGVTETENVAL  70

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             FADNS RW +ADQG M  GA N VR +++  EEL  I   S+S  L V+N +   ++   
Sbjct  71    FADNSPRWFIADQGSMAAGAANAVRSAQADAEELAYILADSDSQTLIVENNKTLGKLLAK  130

Query  1865  FHSHADVRFIILLWGEK---SSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQY  1695
                   ++ I+LL  E     +I+ + ++      + +++ +G E+              
Sbjct  131   I-PELPLKLIVLLTDEDPATGAISVQTLN------FKQLMAIGAEN--------------  169

Query  1694  TYEPI--NSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPP  1521
             T +PI  + +D+ATL+YTSGTTG PKGVML+H NLLHQ+ NL       PGDR LS+LP 
Sbjct  170   TLKPITKSENDLATLIYTSGTTGQPKGVMLSHGNLLHQVRNLNAIFQPEPGDRVLSILPS  229

Query  1520  WHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTS  1341
             WH+YER+ EYFI + GC Q+YT++   K+DLK++ PQ ++ VP ++E+LY GI KQ +  
Sbjct  230   WHSYERSCEYFILAQGCTQIYTSIRTFKQDLKQFSPQLMVGVPRLWESLYEGIQKQFSEQ  289

Query  1340  SPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLH  1161
             S  ++ +    L+ S  Y  AKRI +   L      P       + L AR  + LL PLH
Sbjct  290   SATKQKLVRFLLEKSEKYVIAKRIADNLSLDHLHASPG------ERLKARIQSLLLYPLH  343

Query  1160  LLARKLVY-skihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACR  984
              +  KLVY     +     K  +SGGGSL+ H+D F+E   I +  GYGLTE++PV   R
Sbjct  344   AIGDKLVYGKIRQAVGNKVKILVSGGGSLARHLDTFYEIAGIPILVGYGLTETSPVATVR  403

Query  983   RPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAI  804
             R + N+ GS G P+  TEI +VD ++ + L     G+V  +GPQVM+GYYK P AT++AI
Sbjct  404   RIDHNLRGSAGRPVFQTEICIVDLQSKEVLPTEKHGLVLIRGPQVMQGYYKKPEATEKAI  463

Query  803   DENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGS  624
               +GW ++GD+GW+           ++G +VL GRAKDTIVLS+GEN+EP  IE+A + S
Sbjct  464   SPDGWFDSGDIGWL----------TAAGDLVLTGRAKDTIVLSNGENIEPQPIEDACLRS  513

Query  623   NLIQQIVVIGQDKRRLGALVLPHKEEVLLAAKK----LSVVDSD-------ATEVSEEKT  477
               I QI+++GQD++ LGAL++P+ + +   A++    L++ DS        ++++  +K 
Sbjct  514   PFISQIMLVGQDQKALGALIVPNLDILANWAQEQKISLNLPDSHSDRSTILSSDLYSKKV  573

Query  476   SKLIHEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQI  312
               L  +EL++            QI    LI EPF+ +NG++T T+K++R  VT  Y++ I
Sbjct  574   LALYQQELKREVRNRPGYRADDQIKTFELILEPFSQENGMMTQTLKIKRPVVTQRYRDMI  633

Query  311   EDLY  300
              +++
Sbjct  634   NEMF  637



>gb|ESA34965.1| long-chain-fatty-acid-- ligase [Leptolyngbya sp. Heron Island 
J]
Length=694

 Score =   431 bits (1107),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 255/686 (37%), Positives = 392/686 (57%), Gaps = 79/686 (12%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEK---  2055
             +++P +W+   + FGN  AL+DP+  P  +L+++++ ++I  FA G++ + L P      
Sbjct  44    RSLPQMWEITEQYFGNVEALIDPHSRPAVSLTYRQVYQQIRQFAAGIQTL-LSPSSPLQT  102

Query  2054  ---------------------------IALFADNSCRWLVADQGIMTTGAINVVRGSRSS  1956
                                        +ALFADNS +WLVADQGIM  GA + VR + + 
Sbjct  103   SSQTSSQDLSLNLSLGLSQNPPQNPPIVALFADNSWQWLVADQGIMLAGAADAVRSATAD  162

Query  1955  VEELLQIYNHSESVALAVDNPEMYSRIAETFHSHADVRFIILLWGEKSSITSEVMDGRP-  1779
              +ELL I  HS+S  L V+N +   R+ +   +   V +++LL  E+       + GRP 
Sbjct  163   RDELLYILEHSQSSGLVVENAKTLDRLGDRIWT-LPVEWVVLLSNEQPD-----LPGRPS  216

Query  1778  ---IYSYNEIIDLGNESHMALLHSQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLT  1608
                + +++++++LGN+  +  +++              D +ATL+YTSGTTG PKGVML+
Sbjct  217   HVKLLTFDQLLELGNQQPLQSVNT------------TPDTLATLIYTSGTTGQPKGVMLS  264

Query  1607  HENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDL  1428
             H N ++Q++ L   +  + GDR LS+LP WH++ R  EY+  S GC QVYT    LK+DL
Sbjct  265   HANFIYQLVALTAIIQPLVGDRTLSILPTWHSFGRVGEYYTLSQGCTQVYTNRRYLKQDL  324

Query  1427  KRYQPQYLISVPLVYETLYSGILKQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLT  1248
             K YQP Y++ VP ++E+++ GI K      P  +     FL IS  Y +A R ++ + L 
Sbjct  325   KTYQPAYVVGVPRLWESIFEGIQKSFRDRPPRMQAFIQSFLAISSRYIQAVRTWKHRDLR  384

Query  1247  KDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKLVYskihssigiskagis-gggslss  1071
                  P+    +  W    A   LL PLH L   L+Y ++  ++G +   +  GGGSL+ 
Sbjct  385   N--LHPTRAAVLRAW----ATTLLLAPLHYLGELLLYKRMQQALGGNVKQLICGGGSLAQ  438

Query  1070  HVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALS  891
             H++ FFE I I++  GYGLTE++PV++ RR   NV  + G P+  TE +VVD ET +AL 
Sbjct  439   HLEDFFEMIGIEILVGYGLTETSPVLSARRYWNNVRKASGQPLIQTEFRVVDLETRQALP  498

Query  890   PGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIV  711
              G +G+V  +GPQ+M+GYY+NP AT +AID  GW +TGD+GW+             G I+
Sbjct  499   AGKRGLVLTRGPQIMQGYYRNPEATAKAIDPEGWFDTGDIGWLA----------DDGSII  548

Query  710   LEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEV----  543
             L GRAKDTIVLS+GEN+EP  IE+A + S+ I QIV++GQD++ LGAL++P+ E +    
Sbjct  549   LTGRAKDTIVLSNGENIEPQPIEDACLRSSFIDQIVLVGQDRKALGALIVPNLEALQAWG  608

Query  542   LLAAKKLSVVDSDATEVSEEKTSKLIHEELQKWTTG-----CTFQIGPILLINEPFTIDN  378
             L  +  L + +++A         KL+ +EL +            +I    L+ EP TI+N
Sbjct  609   LAQSPPLMIGENEAIAPDNLIIHKLLRQELNREVRDRPGYRSQDEIAAFTLLPEPMTIEN  668

Query  377   GLLTPTMKVRRDKVTDLYKEQIEDLY  300
             GLLT T+K+RR+ V D Y E I+ L+
Sbjct  669   GLLTQTLKIRRNVVVDRYSEMIQGLF  694



>ref|WP_016515700.1| Long-chain-fatty-acid--CoA ligase FadD15 [Microcystis aeruginosa]
 gb|EPF21796.1| Long-chain-fatty-acid--CoA ligase FadD15 [Microcystis aeruginosa 
SPC777]
Length=639

 Score =   429 bits (1102),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 256/666 (38%), Positives = 390/666 (59%), Gaps = 63/666 (9%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P++W   A+ F N IAL DP+  P   L+++EL ++I  FA  L+ +G+   E +AL
Sbjct  11    QSLPEVWSIVAQRFPNIIALHDPHSKPEVILTYRELYQQIQQFAAALQALGVTETENVAL  70

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             FADNS RW +ADQG M  GA N VR +++  EEL  I   S+S  L V+N +   ++   
Sbjct  71    FADNSPRWFIADQGSMAAGAANAVRSAQADAEELAYILADSDSQTLIVENKQTLGKLLAK  130

Query  1865  FHSHADVRFIILLWGEK---SSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQY  1695
                   ++ I+LL  E     +I+ + ++      + +++ +G E+              
Sbjct  131   I-PELPLKLIVLLTDEDPATGAISVQTLN------FKQLMAIGAEN--------------  169

Query  1694  TYEPINS--DDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPP  1521
             T +PI    +D+ATL+YTSGTTG PKGVML+H NLLHQ+ NL       PGDR LS+LP 
Sbjct  170   TLKPITKGENDLATLIYTSGTTGQPKGVMLSHGNLLHQVRNLNAIFQPDPGDRVLSILPS  229

Query  1520  WHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTS  1341
             WH+YER+ EYF  + GC Q+YT++   K+DLK++ PQ ++ VP ++E+LY GI KQ +  
Sbjct  230   WHSYERSCEYFSLAQGCTQIYTSIRTFKQDLKQFSPQLMVGVPRLWESLYEGIQKQFSEQ  289

Query  1340  SPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLH  1161
             S  ++ +    L+ S  Y  AKRI +   L           S ++ L AR  + LL PLH
Sbjct  290   SATKQKLVRFLLEKSEKYVIAKRIADNLSLDHLH------ASGIERLKARIQSLLLYPLH  343

Query  1160  LLARKLVY-skihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACR  984
              +  KLVY     +     K  +SGGGSL+ H+D F+E   I +  GYGLTE++PV   R
Sbjct  344   AIGDKLVYGKIRQAVGNKVKILVSGGGSLARHLDTFYEIAGIPILVGYGLTETSPVATVR  403

Query  983   RPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAI  804
             R + N+ GS G P+  TEI +VD  + + L     G+V  +GPQVM+GYYK P AT++AI
Sbjct  404   RIDHNLRGSAGRPVFQTEICIVDLHSKEVLPTEKHGLVLIRGPQVMQGYYKKPEATEKAI  463

Query  803   DENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGS  624
               +GW ++GD+GW+           ++G +VL GRAKDTIVLS+GEN+EP  IE+A + S
Sbjct  464   SPDGWFDSGDIGWL----------TAAGDLVLTGRAKDTIVLSNGENIEPQPIEDACLRS  513

Query  623   NLIQQIVVIGQDKRRLGALVLPHKEEVLLA----AKKLSVVDSD---------ATEVSEE  483
               I QI+++GQD++ LGAL++P+ +  +LA     +KLS+   D         ++++  +
Sbjct  514   PFISQIMLVGQDQKALGALIVPNLD--ILANWAQEQKLSLNLPDPHSDRSTILSSDLYSK  571

Query  482   KTSKLIHEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKE  318
             K   L  +EL++            QI    LI EPF+++NG++T T+K++R  VT  Y++
Sbjct  572   KVLDLYQQELKREVRNRPGYRTDDQIKTFELILEPFSLENGMMTQTLKIKRPVVTQRYRD  631

Query  317   QIEDLY  300
              I +++
Sbjct  632   MINEMF  637



>ref|WP_002755702.1| long-chain fatty acid--CoA ligase [Microcystis aeruginosa]
 emb|CCH93752.1| Genome sequencing data, contig C328 [Microcystis aeruginosa PCC 
9432]
Length=639

 Score =   429 bits (1102),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 254/664 (38%), Positives = 389/664 (59%), Gaps = 59/664 (9%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P++W   A+ F N IAL DP+  P   L+++EL ++I  FA  L+ +G+   E +AL
Sbjct  11    QSLPEVWSIVAQRFPNIIALHDPHSKPEVILTYRELYQQIQQFAAALQALGVTETENVAL  70

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             FADNS RW +ADQG M  GA N VR +++  EEL  I   S+S  L V+N +   ++   
Sbjct  71    FADNSPRWFIADQGSMAAGAANAVRSAQADAEELAYILADSDSQTLIVENKQTLGKLLAK  130

Query  1865  FHSHADVRFIILLWGEK---SSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQY  1695
                   ++ I+LL  E     +I+ + ++      + +++ +G E+              
Sbjct  131   I-PELPLKLIVLLTDEDPATGAISVQTLN------FKQLMAIGAEN--------------  169

Query  1694  TYEPIN--SDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPP  1521
             T +PI    +D+ATL+YTSGTTG PKGVML+H NLLHQ+ NL       PGDR LS+LP 
Sbjct  170   TLKPITKGENDLATLIYTSGTTGQPKGVMLSHGNLLHQVRNLNAIFQPDPGDRVLSILPS  229

Query  1520  WHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTS  1341
             WH+YER+ EYF  + GC Q+YT++   K+DLK++ PQ ++ VP ++E+LY GI KQ +  
Sbjct  230   WHSYERSCEYFSLAQGCTQIYTSIRTFKQDLKQFSPQLMVGVPRLWESLYEGIQKQFSQQ  289

Query  1340  SPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLH  1161
                ++ +   FL+ S  Y  AKRI +   L           S ++ L AR  + LL PLH
Sbjct  290   PAKKQKLVQFFLEKSEKYVIAKRIADNLSLDHLH------ASGIERLKARIQSLLLYPLH  343

Query  1160  LLARKLVY-skihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACR  984
              +  KLVY     +     K  +SGGGSL+ H+D F+E   I +  GYGLTE++PV   R
Sbjct  344   AIGDKLVYGKIRQAVGNKVKILVSGGGSLARHLDTFYEIAGIPILVGYGLTETSPVATVR  403

Query  983   RPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAI  804
             R + N+ GS G P+  TEI +VD  + + L     G+V  +GPQVM+GYYK P AT++AI
Sbjct  404   RIDHNLRGSAGRPVFQTEICIVDLHSKEVLPTEKHGLVLIRGPQVMQGYYKKPEATEKAI  463

Query  803   DENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGS  624
               +GW ++GD+GW+           ++G +VL GRAKDTIVLS+GEN+EP  IE+A + S
Sbjct  464   SPDGWFDSGDIGWL----------TAAGDLVLTGRAKDTIVLSNGENIEPQPIEDACLRS  513

Query  623   NLIQQIVVIGQDKRRLGALVLPHKEEVL--LAAKKLSVVDSD---------ATEVSEEKT  477
               I QI+++GQD++ LGAL++P+ + +   +  +KLS+   D         ++++  +K 
Sbjct  514   PFISQIMLVGQDQKALGALIVPNLDILANWVQEQKLSLNLPDPHSDRSTILSSDLYSKKV  573

Query  476   SKLIHEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQI  312
               L  +EL++            QI    LI EPF+++NG++T T+K++R  VT  Y++ I
Sbjct  574   LDLYQQELKREVRNRPGYRTDDQIKTFELILEPFSLENGMMTQTLKIKRPVVTQRYRDMI  633

Query  311   EDLY  300
              +++
Sbjct  634   NEMF  637



>ref|WP_002740553.1| AMP-binding enzyme family protein [Microcystis aeruginosa]
 emb|CAO88497.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gb|ELS50079.1| AMP-binding enzyme family protein [Microcystis aeruginosa DIANCHI905]
Length=639

 Score =   428 bits (1100),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 257/666 (39%), Positives = 392/666 (59%), Gaps = 63/666 (9%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P++W   A+ F N IAL DP+  P   ++++EL ++I  FA  L+ +G+   E +AL
Sbjct  11    QSLPEVWSIVAQRFPNIIALHDPHSKPEVIITYRELYQQIQQFAAALQALGVTETENVAL  70

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             FADNS RW +ADQG M  GA N VR +++  EEL  I   S+S  L V+N +   ++   
Sbjct  71    FADNSPRWFIADQGSMAAGAANAVRSAQADAEELAYILADSDSQTLIVENNKTLGKLLAK  130

Query  1865  FHSHADVRFIILLWGEK---SSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQY  1695
                   ++ I+LL  E     +I+ + ++      + +++ +G E+              
Sbjct  131   I-PELPLKLIVLLTDEDPATGAISVQTLN------FKQLMAIGAEN--------------  169

Query  1694  TYEPINS--DDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPP  1521
             T +PI    +D+ATL+YTSGTTG PKGVML+H NLLHQ+ NL       PGDR LS+LP 
Sbjct  170   TLKPITKGENDLATLIYTSGTTGQPKGVMLSHGNLLHQVRNLNAIFQPDPGDRVLSILPS  229

Query  1520  WHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTS  1341
             WH+YER+ EYF  + GC Q+YT++   K+DLK++ PQ ++ VP ++E+LY GI KQ +  
Sbjct  230   WHSYERSCEYFSLAQGCTQIYTSIRTFKQDLKQFSPQLMVGVPRLWESLYEGIQKQFSEQ  289

Query  1340  SPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLH  1161
             S  ++ +    L+ S  Y  AKRI +   L           S ++ L AR  + LL PLH
Sbjct  290   SATKQKLVRFLLEKSEKYVIAKRIADNLSLDHLH------ASGIERLKARIQSLLLYPLH  343

Query  1160  LLARKLVYskihssigiskagisggg-slssHVDKFFEAIDIKLQNGYGLTESAPVVACR  984
              +  KLVYSKI  ++G     +  GG SL+ H+D F+E   I +  GYGLTE++PV   R
Sbjct  344   AIGDKLVYSKIRQAVGNKVKILVSGGGSLARHLDTFYEIAGIPILVGYGLTETSPVATVR  403

Query  983   RPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAI  804
             R + N+ GS G P+  TEI +VD  + + L     G+V  +GPQVM+GYYK P AT++AI
Sbjct  404   RIDHNLRGSAGRPVFQTEICIVDLHSKEVLPTEKHGLVLIRGPQVMQGYYKKPEATEKAI  463

Query  803   DENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGS  624
               +GW ++GD+GW+           ++G +VL GRAKDTIVLS+GEN+EP  IE+A + S
Sbjct  464   SPDGWFDSGDIGWL----------TAAGDLVLTGRAKDTIVLSNGENIEPQPIEDACLRS  513

Query  623   NLIQQIVVIGQDKRRLGALVLPHKEEVLLA----AKKLSVVDSDA---------TEVSEE  483
               I QI+++GQD++ LGAL++P+ +  +LA     +KLS+   DA         +++  +
Sbjct  514   PFISQIMLVGQDQKALGALIVPNLD--ILANWAHEQKLSLNLPDAHSDRSTILSSDLYSK  571

Query  482   KTSKLIHEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKE  318
             K   L  +EL++            QI    LI EPF+++NG++T T+K++R  VT  Y++
Sbjct  572   KVLALYQQELKREVRNRPGYRTDDQIKTFELILEPFSLENGMMTQTLKIKRLVVTQRYRD  631

Query  317   QIEDLY  300
              I +++
Sbjct  632   MINEMF  637



>ref|WP_002737027.1| AMP-binding enzyme family protein [Microcystis aeruginosa]
 gb|ELP54447.1| AMP-binding enzyme family protein [Microcystis aeruginosa TAIHU98]
Length=639

 Score =   428 bits (1100),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 256/666 (38%), Positives = 392/666 (59%), Gaps = 63/666 (9%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P++W   A+ F N IAL DP+  P   L+++EL ++I  FA  L+ +G+   E +AL
Sbjct  11    QSLPEVWSIVAQRFPNIIALHDPHSKPEVILTYRELYQQIQQFAAALQALGVTETENVAL  70

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             FADNS RW +ADQG M  GA N VR +++  EEL  I   S+S  L V+N +   ++   
Sbjct  71    FADNSPRWFIADQGSMAAGAANAVRSAQADAEELAYILADSDSQTLIVENNKTLGKLLAK  130

Query  1865  FHSHADVRFIILLWGEK---SSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQY  1695
                   ++ I+LL  E     +I+ + ++      + +++ +G E+              
Sbjct  131   I-PELPLKLIVLLTDEDPATGAISVQTLN------FKQLMAIGAEN--------------  169

Query  1694  TYEPI--NSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPP  1521
             T +PI  + +D+ATL+YTSGTTG PKGVML+H NLLHQ+ NL       PGDR LS+LP 
Sbjct  170   TLKPITKSENDLATLIYTSGTTGQPKGVMLSHGNLLHQVRNLNAIFQPDPGDRVLSILPS  229

Query  1520  WHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTS  1341
             WH+YER+ EYF  + GC Q+YT++   K+DLK++ PQ ++ VP ++E+LY GI KQ +  
Sbjct  230   WHSYERSCEYFSLAQGCTQIYTSIRTFKQDLKQFSPQLMVGVPRLWESLYEGIQKQFSEQ  289

Query  1340  SPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLH  1161
             S  ++ +    L+ S  Y  AKRI +   L           S ++ L AR  + LL PLH
Sbjct  290   SATKQKLVRFLLEKSENYVIAKRIADNLSLDHLH------ASGIERLKARIQSLLLYPLH  343

Query  1160  LLARKLVYskihssigiskagisggg-slssHVDKFFEAIDIKLQNGYGLTESAPVVACR  984
              +  KLVY KI  ++G     +  GG SL+ H+D F+E   I +  GYGLTE++PV   R
Sbjct  344   AIGDKLVYGKIRQAVGNKVKILVSGGGSLARHLDTFYEIAGIPILVGYGLTETSPVATVR  403

Query  983   RPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAI  804
             R + N+ GS G P+  TEI +VD  + + L     G+V  +GPQVM+GYYK P AT++AI
Sbjct  404   RIDHNLRGSAGRPVFQTEICIVDLHSKEVLPTEKHGLVLIRGPQVMQGYYKKPEATEKAI  463

Query  803   DENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGS  624
               +GW ++GD+GW+           ++G +VL GRAKDTIVLS+GEN+EP  IE+A + S
Sbjct  464   SPDGWFDSGDIGWLT----------AAGDLVLTGRAKDTIVLSNGENIEPQPIEDACLRS  513

Query  623   NLIQQIVVIGQDKRRLGALVLPHKEEVLLA----AKKLSVVDSD---------ATEVSEE  483
               I QI+++GQD++ LGAL++P+ +  +LA     +KLS+   D         ++++  +
Sbjct  514   PFISQIMLVGQDQKALGALIVPNLD--ILANWAQEQKLSLNLPDPHSDRSTILSSDLYSK  571

Query  482   KTSKLIHEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKE  318
             K   L  +EL++            QI    LI EPF+++NG++T T+K++R  VT  Y++
Sbjct  572   KVLDLYQQELKREVRNRPGYRTDDQIKTFELILEPFSLENGMMTQTLKIKRPVVTQRYRD  631

Query  317   QIEDLY  300
              I +++
Sbjct  632   MINEMF  637



>ref|WP_009626371.1| Long-chain-fatty-acid--CoA ligase [Pseudanabaena biceps]
 gb|ELS33497.1| Long-chain-fatty-acid--CoA ligase [Pseudanabaena biceps PCC 7429]
Length=625

 Score =   427 bits (1098),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 256/653 (39%), Positives = 378/653 (58%), Gaps = 61/653 (9%)
 Frame = -3

Query  2210  IWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADNS  2031
             +W+  A    + IAL DP+  PP  +S+++  ++I +F  GLR +G+   +K+AL ADNS
Sbjct  16    LWEQGANNHPDAIALHDPHAKPPVRISYRDAFEQINAFGAGLRALGVNFGDKVALIADNS  75

Query  2030  CRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAETFHSHA  1851
              RWL+ADQGI+  GA N  R S++   ELL I  HS+SVA+ V+N     ++    H+  
Sbjct  76    PRWLIADQGILAIGAANATRSSQAERSELLYIIEHSDSVAIVVENLATLKKLEPELHT-L  134

Query  1850  DVRFIILLWGEKSSITSEVMDGRPIYSYNEII------DLGNESHMALLHSQEARHQYTY  1689
              VR IILL  E     +        Y++ +II      DLGN                  
Sbjct  135   PVRQIILLSDETPPEGA--------YNFQQIITKGLGLDLGNP-----------------  169

Query  1688  EPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAY  1509
              PI  D +ATL+YTSGTT  PKGVMLTH N L +I      + +   ++ LS+LP WH+Y
Sbjct  170   -PIQRDTLATLIYTSGTTARPKGVMLTHGNFLFEIEGAQAVLKLKVSEKVLSILPTWHSY  228

Query  1508  ERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPAR  1329
             ER  EYFIFS GC Q+YT +  +K+DL+ ++P Y+++VP ++E++Y G+ KQ      ++
Sbjct  229   ERTFEYFIFSQGCTQIYTNLRTIKKDLREHKPDYMVAVPRLWESIYEGVQKQFREQPNSK  288

Query  1328  KLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLAR  1149
             + +   FLK S  Y  AKR+ +G  L      P    S+ D L A  I   L  +H L  
Sbjct  289   QRLVDFFLKASQKYITAKRVIQG--LNVANLSP----SLGDKLKASVIVLSLWAVHKLGH  342

Query  1148  KLVYskihssigiska-gisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNC  972
             KLVY K+  + G +    +SGGGS++ H++ F+E + I++  GYGLTE++P+   RRPN 
Sbjct  343   KLVYQKVREATGGNFKYIVSGGGSIAEHLEDFYEIVGIEILGGYGLTETSPITHVRRPNR  402

Query  971   NVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENG  792
             N+ G  G P+  TE ++VD  +   L  G +G+V  +GPQVM+GYYKNP AT +AID  G
Sbjct  403   NIRGGDGQPLIKTETRIVDISSRADLPVGQQGLVLIRGPQVMQGYYKNPEATAKAIDPQG  462

Query  791   WLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQ  612
             W +TGDLG++ P +           +++ GRAKDTIVLS+GEN+EP  IE+A + SN I 
Sbjct  463   WFDTGDLGYVSPWND----------LIITGRAKDTIVLSNGENIEPQPIEDACIRSNYID  512

Query  611   QIVVIGQDKRRLGALVLPHKEEVLLAAKKLSVVDSDATEV----SEEKTSKLIHEELQKW  444
             Q+V++GQD+++LG L++P+     L A  L   DS+  ++    ++ K   L  EE+ + 
Sbjct  513   QVVLVGQDQKQLGLLIVPNLSA--LEAAGLIAPDSNLADILPALNDPKIRSLYREEINRE  570

Query  443   TTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
                        +IG    + EPFTIDNG LT T K+RR+ V + Y++ I  ++
Sbjct  571   VQNRPGYSVNDRIGVFEFLPEPFTIDNGFLTQTFKIRRNIVFERYQDIIVKMF  623



>ref|WP_008203626.1| long-chain fatty acid--CoA ligase [Microcystis sp. T1-4]
 emb|CCI33307.1| Long-chain-fatty-acid CoA ligase [Microcystis sp. T1-4]
Length=639

 Score =   427 bits (1098),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 257/666 (39%), Positives = 392/666 (59%), Gaps = 63/666 (9%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P++W   A+ F N IAL DP+  P   L+++EL ++I  FA  L+ +G+   E +AL
Sbjct  11    QSLPEVWSIVAQRFPNIIALHDPHSKPEVILTYRELYQQIQQFAAALQALGVTETENVAL  70

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             FADNS RW +ADQG M  GA N VR +++  EEL  I   S+S  L V+N +   ++  T
Sbjct  71    FADNSPRWFIADQGSMAAGAANAVRSAQADAEELAYILADSDSQTLIVENNKTLGKLL-T  129

Query  1865  FHSHADVRFIILLWGEK---SSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQY  1695
                   ++ I+LL  E     +I+ + ++      + +++ +G E+              
Sbjct  130   KIPELPLKLIVLLTDEDPATGAISVQTLN------FKQLMAIGAEN--------------  169

Query  1694  TYEPI--NSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPP  1521
             T +PI  + +D+ATL+YTSGTTG PKGVML+H NLLHQ+ NL       PGDR LS+LP 
Sbjct  170   TLKPITKSENDLATLIYTSGTTGQPKGVMLSHGNLLHQVRNLNAIFQPEPGDRVLSILPS  229

Query  1520  WHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTS  1341
             WH+YER+ EYF  + GC Q+YT++   K+DLK++ PQ ++ VP ++E+LY GI KQ +  
Sbjct  230   WHSYERSCEYFSLAQGCTQIYTSIRTFKQDLKQFSPQLMVGVPRLWESLYEGIQKQFSEQ  289

Query  1340  SPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLH  1161
             S  ++ +    L+ S  Y  AKRI +   L      P       + L AR  + LL PLH
Sbjct  290   SATKQKLVRFLLEKSEKYVIAKRIADNLSLDHLHASPG------ERLKARIQSLLLYPLH  343

Query  1160  LLARKLVY-skihssigiskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACR  984
              +  KLVY     +     K  +SGGGSL+ H+D F+E   I +  GYGLTE++PV   R
Sbjct  344   AIGDKLVYGKIRQAVGNKVKILVSGGGSLARHLDTFYEIAGIPILVGYGLTETSPVATVR  403

Query  983   RPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAI  804
             R + N+ GS G P+  TEI +VD  + + L     G+V  +GPQVM+GYYK P AT++AI
Sbjct  404   RIDHNLRGSAGRPVFQTEICIVDLHSKEVLPTEKHGLVLIRGPQVMQGYYKKPEATEKAI  463

Query  803   DENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGS  624
               +GW ++GD+GW+           ++G +VL GRAKDTIVLS+GEN+EP  IE+A + S
Sbjct  464   SPDGWFDSGDIGWL----------TAAGDLVLTGRAKDTIVLSNGENIEPQPIEDACLRS  513

Query  623   NLIQQIVVIGQDKRRLGALVLPHKEEVLLA----AKKLSV----VDSD-----ATEVSEE  483
               I QI+++GQD++ LGAL++P+ +  +LA     +K+S+    + SD     ++++  +
Sbjct  514   PFISQIMLVGQDQKALGALIVPNLD--ILANWAQEQKISLNLPDLHSDRSTILSSDLYSK  571

Query  482   KTSKLIHEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKE  318
             K   L  +EL++            QI    LI EPF+ +NG++T T+K++R  VT  Y++
Sbjct  572   KVLALYQQELKREVRNRPGYRTDDQIKTFELILEPFSQENGMMTQTLKIKRPVVTQRYRD  631

Query  317   QIEDLY  300
              I +++
Sbjct  632   MINEMF  637



>ref|WP_029633861.1| long-chain fatty acid--CoA ligase [[Scytonema hofmanni] UTEX 
B 1581]
Length=658

 Score =   428 bits (1100),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 252/661 (38%), Positives = 381/661 (58%), Gaps = 54/661 (8%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +T+P+IW   A+  G+ +AL DP+  P   ++ ++L ++I  FA GL+ +G+K  ++I L
Sbjct  32    ETLPEIWDLVAKRCGDSVALHDPHSKPEVVITHRQLLEKIQQFATGLQGLGVKVGDRITL  91

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
              ADNS RW +ADQGI+  G ++ +R S++  EELL I  +S S AL V++ +   ++ + 
Sbjct  92    IADNSPRWFIADQGILMAGGVDALRSSQAEKEELLFIIANSGSTALVVEDLKTLKKLRDR  151

Query  1865  FHSHADVRFIILLWGEK--SSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYT  1692
              +    ++ +ILL  E   S  T +V++                   + L  + A H   
Sbjct  152   LND-LPIQLVILLSDETPPSEETLKVLN------------------FSQLMERSANHTLQ  192

Query  1691  YEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHA  1512
                   +D+ATL+YTSGTTG PKGVML++ NL+HQI      V    GD  LS+LP WH 
Sbjct  193   PARQKRNDLATLMYTSGTTGKPKGVMLSYGNLMHQITTFGTVVQPEIGDIVLSILPSWHV  252

Query  1511  YERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPA  1332
             YER  EY++ S GC QVYT + + K+DL++++P Y++ VP ++E++Y G+ KQ       
Sbjct  253   YERTVEYYLLSQGCTQVYTNLRSFKKDLQQFKPNYMLGVPRLWESIYEGVQKQFREQPEN  312

Query  1331  RKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLA  1152
             ++ +    L IS  Y +A+RI E   L           S +D L A   A+ L PLH L 
Sbjct  313   KQRLINSLLAISDQYIKARRIAENLSLDH------LHASGIDRLSASIQASALFPLHALG  366

Query  1151  RKLVYskihssigiskagisgggsls-sHVDKFFEAIDIKLQNGYGLTESAPVVACRRPN  975
              KLVY+K+  + G     +  GG     H+D FFE I +++  GYGLTE++PV   RR  
Sbjct  367   EKLVYNKVREATGGKIKQMISGGGALPKHIDNFFEIIGVEILQGYGLTETSPVTNVRRTW  426

Query  974   CNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDEN  795
              N+ GS G P+  TE K+VD ET K L  G KG+V  KGPQ+M+GYY+NP AT +AID  
Sbjct  427   RNLRGSSGQPLPGTENKIVDLETRKPLPIGEKGLVLLKGPQIMQGYYQNPEATAKAIDSE  486

Query  794   GWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLI  615
             GW ++GDLGW+ P             +VL GRAKDTIVLS+GEN+EP  IE+A + S  I
Sbjct  487   GWFDSGDLGWVTPEKD----------LVLTGRAKDTIVLSNGENIEPQPIEDACVRSPYI  536

Query  614   QQIVVIGQDKRRLGALVLPHKEEVLLAAK----KLSVVDSDATEVSEEK-------TSKL  468
              Q++++GQD+R +GAL++P+ E +   A+    +  + D + TE + +K       +  L
Sbjct  537   DQMMLVGQDQRSVGALIVPNLEALQKWAESQNLEFCIEDDNVTETTSQKINLESKMSQDL  596

Query  467   IHEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDL  303
               +EL +            +IG   LI EPF+I+NG++T T+K+RR  V + Y++ I+ +
Sbjct  597   FRQELNREVQNRPGYRADDRIGQFKLILEPFSIENGMMTQTLKIRRHVVMERYRDIIDGM  656

Query  302   Y  300
             +
Sbjct  657   F  657



>ref|WP_033334433.1| long-chain fatty acid--CoA ligase, partial [Scytonema hofmanni]
Length=684

 Score =   429 bits (1102),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 271/688 (39%), Positives = 395/688 (57%), Gaps = 82/688 (12%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKP------  2064
             +++P+IW+   E FG  IAL+D +  P   L++ +L ++I  FA GL+ +G++P      
Sbjct  32    QSMPEIWRLVQERFGQTIALMDSHAEPEVVLTYSQLYQQIQLFAAGLQALGVQPGVGEAG  91

Query  2063  --DEKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPE  1890
                  +ALFADNS RWL+ADQGIMT GA+NVVR S+++ EELL I   S+S AL V+N  
Sbjct  92    VKSPHVALFADNSPRWLIADQGIMTAGAVNVVRSSQAAWEELLYILIDSDSTALVVENCA  151

Query  1889  MYSRIAETFHSHAD---VRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLH  1719
                ++    + H D   +R ++LL  E      E +    I +Y  +I  G+       +
Sbjct  152   TLKKL----YPHLDALPIRLVVLLSDEDPD-EKETLK---ILNYQMLIAAGSN------Y  197

Query  1718  SQEARHQYTYEPINSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRF  1539
             SQ+  +Q      N D +ATL+YTSGTTG PKGVML H NLLHQI      +   PG   
Sbjct  198   SQKTVNQ------NRDTLATLIYTSGTTGKPKGVMLNHGNLLHQITTFGVAIQPQPGACV  251

Query  1538  LSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGIL  1359
             LS+LPPWH YER  EYF  S GC Q+YT     K+DLK++QP Y+  VP +++ +Y  + 
Sbjct  252   LSVLPPWHIYERTMEYFFLSQGCTQIYTNNRYFKQDLKKFQPNYVAGVPRLWDYIYERVQ  311

Query  1358  KQINTSSPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAA  1179
             KQ     P ++ +    L  S  Y EA+R+ +   L    + P  L+S++  +   A  +
Sbjct  312   KQFREQPPNKQRLINFLLTNSQYYIEARRMVQRLALNHLYRSP--LLSLIAGIQTVARWS  369

Query  1178  LLCPLHLLARKLVYskihssi-giskagisgggslssHVDKFFEAIDIKLQNGYGLTESA  1002
                 LH LA++LVY ++ S+I G  +  ISGG SL+ H++ FFE + I++  GYGLTE++
Sbjct  370   ----LHALAKQLVYRQVRSTIGGQIEQVISGGASLAMHLENFFEILGIEILVGYGLTETS  425

Query  1001  PVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPF  822
             PV++ RR   N+ GS G PI  TEIK+VD ET + L  G  G+V  +GPQVM+GYYKNP 
Sbjct  426   PVISVRRRWRNLRGSAGQPIPGTEIKIVDIETRQPLPVGQCGLVLVRGPQVMQGYYKNPE  485

Query  821   ATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIE  642
             AT  AID  GW +TGDLGW+  +            +VL GRAKDTIVL++GEN+EP  IE
Sbjct  486   ATANAIDLAGWFDTGDLGWLTLDSD----------LVLTGRAKDTIVLTNGENIEPQPIE  535

Query  641   EAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEV--LLAAKKLSV----------------  516
             +A + S  I QI+++GQD+R LGAL++P++E +   LA+  L +                
Sbjct  536   DACLRSPYIYQIMLVGQDRRSLGALIVPNREALQQWLASHNLYLRLGEQSSSLRNGNQGA  595

Query  515   ----------------VDSDATEVSEEKTSKLIHEELQKWTTGCTFQIGPILLINEPFTI  384
                             +D ++  + +    +LI E   + +      I  + LI EPF+I
Sbjct  596   KLTCSYEYPDCHSTEGIDLNSKIIYDLFRQELIREVQNQPSFRSNNIISSLRLIPEPFSI  655

Query  383   DNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             +NG++T TMK+RR  V + Y + IE+++
Sbjct  656   ENGMMTQTMKIRRSVVIERYHDIIENMF  683



>ref|WP_014407070.1| long-chain fatty acid--CoA ligase [Synechocystis sp. PCC 6803]
 ref|YP_005382210.1| long-chain-fatty-acid CoA ligase [Synechocystis sp. PCC 6803 
substr. GT-I]
 ref|YP_005385380.1| long-chain-fatty-acid CoA ligase [Synechocystis sp. PCC 6803 
substr. PCC-P]
 ref|YP_005408087.1| long-chain-fatty-acid CoA ligase [Synechocystis sp. PCC 6803 
substr. PCC-N]
 ref|YP_005650401.1| long-chain-fatty-acid CoA ligase [Synechocystis sp. PCC 6803]
 dbj|BAK49196.1| long-chain-fatty-acid CoA ligase [Synechocystis sp. PCC 6803]
 dbj|BAL28195.1| long-chain-fatty-acid CoA ligase [Synechocystis sp. PCC 6803 
substr. GT-I]
 dbj|BAL31365.1| long-chain-fatty-acid CoA ligase [Synechocystis sp. PCC 6803 
substr. PCC-N]
 dbj|BAL34534.1| long-chain-fatty-acid CoA ligase [Synechocystis sp. PCC 6803 
substr. PCC-P]
Length=636

 Score =   427 bits (1097),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 254/658 (39%), Positives = 379/658 (58%), Gaps = 56/658 (9%)
 Frame = -3

Query  2213  DIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIALFADN  2034
             DIW    E F + +AL D + +PP  L++ +L +EI +FA GL+ +G+ P + +A+FADN
Sbjct  15    DIWAITGENFADIVALNDRHSHPPVTLTYAQLREEITAFAAGLQSLGVTPHQHLAIFADN  74

Query  2033  SCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIA---ETF  1863
             S RW +ADQG M  GA+N VR +++  +ELL I   S S  L  +N +  S++A   ET 
Sbjct  75    SPRWFIADQGSMLAGAVNAVRSAQAERQELLYILEDSNSRTLIAENRQTLSKLALDGETI  134

Query  1862  HSHADVRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQYTYEP  1683
                 D++ IILL  E+ +  S +    P Y++ +++ LG            A    T  P
Sbjct  135   ----DLKLIILLTDEEVAEDSAI----PQYNFAQVMALG------------AGKIPTPVP  174

Query  1682  INSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPPWHAYER  1503
                +D+ATL+YTSGTTG PKGVML+H NLLHQ+  L   +   PGD+ LS+LP WH+ ER
Sbjct  175   RQEEDLATLIYTSGTTGQPKGVMLSHGNLLHQVRELDSVIIPRPGDQVLSILPCWHSLER  234

Query  1502  AAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTSSPARKL  1323
             +AEYF+ S GC   YT++ + K D+K  +P +++ VP ++E+LY G+ K     SP ++ 
Sbjct  235   SAEYFLLSRGCTMNYTSIRHFKGDVKDIKPHHIVGVPRLWESLYEGVQKTFREKSPGQQK  294

Query  1322  IALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLHLLARKL  1143
             +   F  IS  Y  AKRI     L           S +  L AR  A +L PLH L  K+
Sbjct  295   LINFFFGISQKYILAKRIANNLSLNHLH------ASAIARLVARCQALVLSPLHYLGDKI  348

Query  1142  VYskihssi-giskagisgggslssHVDKFFEAIDIKLQNGYGLTESAPVVACRRPNCNV  966
             VY K+  +  G  +  ISGGG+L+ H+D F+E   I +  GYGLTE+APV   R    N+
Sbjct  349   VYHKVRQAAGGRLETLISGGGALARHLDDFYEITSIPVLVGYGLTETAPVTNARVHKHNL  408

Query  965   LGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAIDENGWL  786
               S G PI  TEI++VD ET + L P ++G+V  +GPQVM+GYY  P AT + +D+ GW 
Sbjct  409   RYSSGRPIPFTEIRIVDMETKEDLPPETQGLVLIRGPQVMQGYYNKPEATAKVLDQEGWF  468

Query  785   NTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGSNLIQQI  606
             ++GDLGW+ P +           ++L GRAKDTIVLS+GENVEP  IE+A + S  I QI
Sbjct  469   DSGDLGWVTPQND----------LILTGRAKDTIVLSNGENVEPQPIEDACLRSAYIDQI  518

Query  605   VVIGQDKRRLGALVLPHKE-----------EVLLAAKKLSVVDSDATEVSEEKTSKLIHE  459
             +++GQD++ LGAL++P+ +           ++ +     S     A+ + + +   L+  
Sbjct  519   MLVGQDQKSLGALIVPNFDALQKWAETKNLQITVPEPSASSEGMQASGLYDPQVVGLMRS  578

Query  458   ELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKEQIEDLY  300
             EL +            QI     I  PF+++NG++T T+K++R  VT  Y+  I++++
Sbjct  579   ELHREVRDRPGYRADDQIKDFRFIPAPFSLENGMMTQTLKLKRPVVTQTYQHLIDEMF  636



>dbj|GAL91805.1| long-chain-fatty-acid--CoA ligase [Microcystis aeruginosa NIES-44]
Length=639

 Score =   426 bits (1096),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 255/666 (38%), Positives = 392/666 (59%), Gaps = 63/666 (9%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPDEKIAL  2046
             +++P++W   A+ F N IAL DP+  P   L+++EL ++I  FA  L+ +G+   E +AL
Sbjct  11    QSLPEVWSIVAQRFPNIIALHDPHSKPEVILTYRELYQQIQQFAAALQALGVTETENVAL  70

Query  2045  FADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMYSRIAET  1866
             FADNS RW +ADQG M  GA N VR +++  EEL  I   S+S  L V+N +   ++   
Sbjct  71    FADNSPRWFIADQGSMAAGAANAVRSAQADAEELAYILADSDSQTLIVENNQTLGKLLAK  130

Query  1865  FHSHADVRFIILLWGEK---SSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQEARHQY  1695
                   ++ I+LL  E     +I+ + ++      + +++ +G E+              
Sbjct  131   I-PELPLKLIVLLTDEDPATGAISVQTLN------FKQLMAIGAEN--------------  169

Query  1694  TYEPI--NSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRFLSMLPP  1521
             T +PI  + +D+ATL+YTSGTTG PKGVML+H NLLHQ+ NL       PGDR LS+LP 
Sbjct  170   TLKPITKSENDLATLIYTSGTTGQPKGVMLSHGNLLHQVRNLNAIFQPDPGDRVLSILPS  229

Query  1520  WHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGILKQINTS  1341
             WH+YER+ EYF  + GC Q+YT++   K+DLK++ PQ ++ VP ++E+LY GI KQ +  
Sbjct  230   WHSYERSCEYFSLAQGCTQIYTSIRTFKQDLKQFSPQLMVGVPRLWESLYEGIQKQFSEQ  289

Query  1340  SPARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAIAALLCPLH  1161
             S  ++ +    L+ S  Y  AKRI +   L      P       + L AR  + LL PLH
Sbjct  290   SATKQKLVRFLLEKSENYVIAKRIADNLSLDHLHASPG------ERLKARIQSLLLYPLH  343

Query  1160  LLARKLVYskihssigiskagisggg-slssHVDKFFEAIDIKLQNGYGLTESAPVVACR  984
              +  KLVY KI  ++G     +  GG SL+ H+D F+E   I +  GYGLTE++PV   R
Sbjct  344   AIGDKLVYGKIRQAVGNKVKILVSGGGSLARHLDTFYEIAGIPILVGYGLTETSPVATVR  403

Query  983   RPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKNPFATKQAI  804
             R + N+ GS G P+  TEI +VD  + + L     G+V  +GPQVM+GYYK P AT++AI
Sbjct  404   RIDHNLRGSAGRPVFQTEICIVDLHSKEVLPTEKHGLVLIRGPQVMQGYYKKPEATEKAI  463

Query  803   DENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSEIEEAAMGS  624
               +GW ++GD+GW+           ++G +VL GRAKDTIVLS+GEN+EP  IE+A + S
Sbjct  464   SPDGWFDSGDIGWLT----------AAGDLVLTGRAKDTIVLSNGENIEPQPIEDACLRS  513

Query  623   NLIQQIVVIGQDKRRLGALVLPHKEEVLLA----AKKLSV----VDSD-----ATEVSEE  483
               I QI+++GQD++ LGAL++P+ +  +LA     +K+S+    + SD     ++++  +
Sbjct  514   PFISQIMLVGQDQKALGALIVPNLD--ILANWAQEQKISLNLPDLHSDRSTILSSDLYSK  571

Query  482   KTSKLIHEELQKWTTG-----CTFQIGPILLINEPFTIDNGLLTPTMKVRRDKVTDLYKE  318
             K   +  +EL++            QI    LI EPF+ +NG++T T+K++R  VT  Y++
Sbjct  572   KVLDIYQQELKREVRNRPGYRADDQIKTFELILEPFSQENGMMTQTLKIKRPVVTQRYRD  631

Query  317   QIEDLY  300
              I +++
Sbjct  632   MINEMF  637



>ref|WP_017712353.1| hypothetical protein [Prochlorothrix hollandica]
Length=666

 Score =   427 bits (1098),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 268/678 (40%), Positives = 399/678 (59%), Gaps = 81/678 (12%)
 Frame = -3

Query  2225  KTVPDIWKTAAEEFGNCIALVDPYHNPPTNLSFKELEKEIVSFAEGLRVIGLKPD-----  2061
             + +P+IW  AA+ F N +AL  P+  P   L++ EL ++I +FA GL+ +G+        
Sbjct  32    QCLPEIWPIAAQYFTNIVALQAPHLKPAFQLTYGELAQQIQTFAAGLQSLGIHSTPADIL  91

Query  2060  -EKIALFADNSCRWLVADQGIMTTGAINVVRGSRSSVEELLQIYNHSESVALAVDNPEMY  1884
              ++IALFADNS RW +ADQG+MT G  N VR  ++  +ELL I +HSE+V L V+N    
Sbjct  92    PQRIALFADNSPRWFIADQGMMTAGTANAVRSHQADRDELLYILSHSEAVGLVVENQATL  151

Query  1883  SRIAETFHSHAD---VRFIILLWGEKSSITSEVMDGRPIYSYNEIIDLGNESHMALLHSQ  1713
              ++     SH D   ++FI+LL  E    T   + G  + +++++++ G           
Sbjct  152   KKL----QSHLDPSSLKFILLLTDE----TPIPLPGTEVLNFSQLLERG-----------  192

Query  1712  EARHQYTYEPI--NSDDVATLVYTSGTTGNPKGVMLTHENLLHQILNLWDPVPVVPGDRF  1539
                  YT +P+  +   +ATL+YTSGTTG PKGVML+H NLLHQI      V    GD+ 
Sbjct  193   ---QGYTLQPVIQHRGTLATLIYTSGTTGQPKGVMLSHGNLLHQITTAGTIVQPEVGDKA  249

Query  1538  LSMLPPWHAYERAAEYFIFSLGCEQVYTTVINLKEDLKRYQPQYLISVPLVYETLYSGIL  1359
             LS+LP WH+YER+ EYF+ S GC Q+YT++  +K+DLK Y P++++SVP ++E++Y G  
Sbjct  250   LSILPTWHSYERSVEYFLLSQGCTQIYTSIRQVKKDLKTYAPEFMVSVPRIWESVYEGAQ  309

Query  1358  KQINTSSP--ARKLIALLFLKISFAYKEAKRIYEGKCLTKDQKQPSYLVSVLDWLWARAI  1185
             +Q   S P   RKLIA  F  +S  + +AKR ++   L  +Q QP+ L  +   L A A 
Sbjct  310   QQFQ-SQPDRKRKLIATCF-GLSETFIKAKRTWQRHNL--EQWQPNPLAQLKAGLQALA-  364

Query  1184  AALLCPLHLLARKLVYskihssigiskagisgggslss-HVDKFFEAIDIKLQNGYGLTE  1008
                L PLH LA +L+Y ++ ++ G +   +  GG   + H++ F+E + I L  GYGLTE
Sbjct  365   ---LWPLHGLATQLIYKQVKAATGGNLKQVISGGGSLAPHLELFYEIVGIDLLVGYGLTE  421

Query  1007  SAPVVACRRPNCNVLGSIGPPIRHTEIKVVDAETDKALSPGSKGIVKAKGPQVMKGYYKN  828
             +AP+++ RR   NV GS G  +  TE+KVVD ET   L P  +G+V AKGPQVM+GY++N
Sbjct  422   TAPILSARRSWRNVRGSSGLLMPGTELKVVDLETRHPLPPHQRGLVLAKGPQVMQGYFQN  481

Query  827   PFATKQAIDENGWLNTGDLGWIVPNHSIGRSRNSSGFIVLEGRAKDTIVLSSGENVEPSE  648
             P AT +AID   W +TGDLG++           + G +VL GRAKDTIVLS+GEN+EP  
Sbjct  482   PEATAKAIDGQDWFDTGDLGYV----------TAQGDVVLTGRAKDTIVLSNGENIEPQP  531

Query  647   IEEAAMGSNLIQQIVVIGQDKRRLGALVLPHKEEVL-------LAAKKLSVVDSDAT---  498
             IE+A + S  + QI+++GQD++ L ALV+P+   +        LA      +D+  T   
Sbjct  532   IEDACLRSPYVDQIMLLGQDEKALAALVVPNVANLRAWATSQNLALDLPETLDTPPTADQ  591

Query  497   --EVSEEKTSKLIHEELQKWTTG----------CTFQIGPILLINEPFTIDNGLLTPTMK  354
                ++ +    L+ +EL +               TFQ+     ++EPFT+ NGLLT T+K
Sbjct  592   IAALNGDAVVALLRQELAREVKDRPSYRPDDRINTFQV-----LSEPFTMTNGLLTQTLK  646

Query  353   VRRDKVTDLYKEQIEDLY  300
             VRR  V + Y++ I DL+
Sbjct  647   VRRPLVQERYQDLIRDLF  664



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8506225923558