BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25658_g1_i1 len=1251 path=[4676:0-254 457:255-281 2520:282-357
6744:358-366 5036:367-399 2630:400-447 4148:448-457 2694:458-482
127:483-498 143:499-538 6137:539-559 6843:560-562 2797:563-571
2806:572-595 2830:596-597 2832:598-670 243:671-679 252:680-783
5410:784-815 3048:816-860 5485:861-889 3120:890-967 3198:968-999
3230:1000-1039 3270:1040-1070 3301:1071-1084 3315:1085-1111
3342:1112-1155 7082:1156-1156 7083:1157-1161 73:1162-1190
102:1191-1250]

Length=1251
                                                                      Score     E

ref|XP_004247709.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    464   1e-158   
ref|XP_009761530.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    449   2e-152   
ref|XP_006379886.1|  hypothetical protein POPTR_0008s16530g             418   1e-140   
emb|CAN66006.1|  hypothetical protein VITISV_042886                     417   3e-140   Vitis vinifera
ref|XP_002284663.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    417   4e-140   Vitis vinifera
ref|XP_007035066.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    416   1e-139   
ref|XP_011029845.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    413   2e-138   
ref|XP_010650061.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    409   5e-137   
emb|CAN67227.1|  hypothetical protein VITISV_000872                     407   3e-136   Vitis vinifera
emb|CAN80594.1|  hypothetical protein VITISV_017626                     405   2e-135   Vitis vinifera
ref|XP_010650062.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    403   1e-134   
ref|XP_007035062.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    403   2e-134   
ref|XP_006420907.1|  hypothetical protein CICLE_v10005201mg             397   3e-132   
ref|XP_011040547.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    394   3e-131   
ref|XP_006420181.1|  hypothetical protein CICLE_v10005008mg             395   1e-130   
ref|XP_006493816.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    392   2e-130   
ref|XP_002284582.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    386   3e-128   Vitis vinifera
gb|EYU32539.1|  hypothetical protein MIMGU_mgv1a008275mg                387   4e-128   
ref|XP_002317688.1|  hypothetical protein POPTR_0011s15970g             384   5e-127   Populus trichocarpa [western balsam poplar]
gb|KDP40307.1|  hypothetical protein JCGZ_02305                         383   7e-127   
ref|XP_010023986.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    383   1e-126   
ref|XP_010023982.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    382   3e-126   
ref|XP_003632020.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    391   7e-126   
ref|XP_006489566.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    380   1e-125   
ref|XP_009768587.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    379   2e-125   
ref|XP_002529300.1|  Desacetoxyvindoline 4-hydroxylase, putative        379   3e-125   Ricinus communis
gb|KDO44343.1|  hypothetical protein CISIN_1g017182mg                   379   4e-125   
gb|KDP40308.1|  hypothetical protein JCGZ_02306                         377   9e-125   
ref|XP_009600230.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    378   9e-125   
ref|XP_004309371.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    378   1e-124   
ref|XP_009379005.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    378   1e-124   
emb|CAN66433.1|  hypothetical protein VITISV_027452                     376   3e-124   Vitis vinifera
ref|XP_011091188.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    376   3e-124   
ref|XP_004309351.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    379   5e-124   
ref|XP_010262281.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    376   8e-124   
ref|XP_010262283.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    375   2e-123   
ref|XP_010026849.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    377   2e-123   
ref|XP_003532286.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    374   2e-123   
ref|XP_007035064.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    374   2e-123   
ref|XP_004246496.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    374   3e-123   
ref|XP_010650056.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    373   7e-123   
ref|XP_002315713.1|  hypothetical protein POPTR_0010s08410g             373   7e-123   Populus trichocarpa [western balsam poplar]
ref|XP_008391709.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    373   9e-123   
ref|XP_011073515.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    371   4e-122   
ref|XP_010023987.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    371   4e-122   
gb|KHN28456.1|  1-aminocyclopropane-1-carboxylate oxidase like 12       371   5e-122   
ref|NP_001241230.1|  uncharacterized protein LOC100790198               371   5e-122   
ref|XP_010274816.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    372   6e-122   
ref|XP_007035060.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    371   6e-122   
ref|XP_010650059.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    370   7e-122   
ref|XP_003628030.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    370   1e-121   
ref|XP_004511093.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    369   2e-121   
ref|XP_003628028.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    369   3e-121   
ref|XP_007035068.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    368   8e-121   
ref|XP_010672757.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    366   3e-120   
ref|XP_002276339.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    365   7e-120   Vitis vinifera
ref|XP_009591157.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    365   1e-119   
ref|XP_006341094.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    365   1e-119   
ref|XP_004491714.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    365   1e-119   
ref|XP_011030520.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    363   4e-119   
ref|XP_002315712.2|  hypothetical protein POPTR_0010s08390g             363   4e-119   Populus trichocarpa [western balsam poplar]
ref|XP_006352055.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    363   6e-119   
ref|XP_010262287.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    363   7e-119   
ref|NP_172147.2|  2-oxoglutarate-dependent dioxygenase-like protein     362   1e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010556890.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    362   1e-118   
ref|NP_001234624.1|  2-oxoglutarate-dependent dioxygenase               362   2e-118   
ref|XP_006489565.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    361   3e-118   
ref|XP_006354553.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    362   3e-118   
ref|XP_007140620.1|  hypothetical protein PHAVU_008G127500g             361   3e-118   
ref|XP_009379006.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    360   5e-118   
ref|XP_011091183.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    361   6e-118   
ref|XP_006341092.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    360   7e-118   
ref|XP_002529299.1|  Desacetoxyvindoline 4-hydroxylase, putative        370   7e-118   Ricinus communis
ref|XP_004246497.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    360   1e-117   
ref|XP_011091186.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    360   1e-117   
ref|XP_003635549.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    360   1e-117   
ref|XP_009626886.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    360   1e-117   
ref|XP_003623991.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    360   1e-117   
ref|XP_011091184.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    360   1e-117   
gb|KFK42773.1|  hypothetical protein AALP_AA1G037700                    359   1e-117   
gb|KCW60387.1|  hypothetical protein EUGRSUZ_H03103                     358   2e-117   
gb|KDO44340.1|  hypothetical protein CISIN_1g017376mg                   358   3e-117   
ref|XP_006420179.1|  hypothetical protein CICLE_v10005202mg             358   4e-117   
emb|CBI23596.3|  unnamed protein product                                358   4e-117   
gb|KDP40305.1|  hypothetical protein JCGZ_02303                         358   4e-117   
ref|XP_006367030.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    358   5e-117   
ref|XP_007035057.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    358   6e-117   
ref|XP_002529304.1|  Desacetoxyvindoline 4-hydroxylase, putative        357   6e-117   Ricinus communis
ref|XP_002889610.1|  predicted protein                                  357   7e-117   
ref|XP_003534012.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    358   7e-117   
ref|XP_004513523.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    358   7e-117   
ref|XP_009347731.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    357   8e-117   
ref|XP_008224378.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    358   9e-117   
ref|XP_006304979.1|  hypothetical protein CARUB_v10011473mg             357   1e-116   
ref|XP_006586236.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    357   1e-116   
ref|XP_010650057.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    357   1e-116   
ref|XP_010102247.1|  1-aminocyclopropane-1-carboxylate oxidase-1-...    357   1e-116   
ref|XP_011073514.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    357   1e-116   
ref|XP_003534014.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    357   1e-116   
gb|KHN22506.1|  1-aminocyclopropane-1-carboxylate oxidase like 1        357   2e-116   
ref|XP_006341091.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    357   2e-116   
ref|XP_006351987.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    356   2e-116   
ref|XP_009784072.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    356   2e-116   
ref|XP_002276308.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    355   3e-116   Vitis vinifera
gb|ABV25958.1|  D4H-like protein                                        356   4e-116   Catharanthus roseus [chatas]
ref|XP_010475400.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    355   4e-116   
ref|XP_008222545.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    355   5e-116   
ref|XP_002529305.1|  Desacetoxyvindoline 4-hydroxylase, putative        355   6e-116   Ricinus communis
gb|ACU19421.1|  unknown                                                 355   7e-116   Glycine max [soybeans]
ref|XP_004299418.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    355   7e-116   
gb|KFK42774.1|  hypothetical protein AALP_AA1G037800                    354   1e-115   
ref|XP_009347730.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    354   2e-115   
ref|XP_009119045.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    354   2e-115   
ref|XP_006418138.1|  hypothetical protein EUTSA_v10008015mg             353   2e-115   
emb|CBI23601.3|  unnamed protein product                                354   2e-115   
gb|AFK38092.1|  unknown                                                 354   2e-115   
ref|XP_010557155.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    353   3e-115   
ref|XP_008338503.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    353   3e-115   
gb|AAC49827.1|  desacetoxyvindoline 4-hydroxylase                       353   4e-115   Catharanthus roseus [chatas]
gb|AAC49826.1|  desacetoxyvindoline 4-hydroxylase                       353   4e-115   Catharanthus roseus [chatas]
ref|XP_006354512.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    353   4e-115   
ref|XP_006598206.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    353   4e-115   
ref|XP_003521041.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    353   6e-115   
ref|XP_006586237.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    353   6e-115   
ref|XP_008222546.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    353   6e-115   
ref|XP_010486415.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    352   6e-115   
ref|XP_009347727.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    353   7e-115   
ref|XP_006350684.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    352   7e-115   
ref|XP_011091187.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    352   7e-115   
ref|XP_004246493.2|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    352   8e-115   
ref|XP_010262288.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    352   1e-114   
ref|XP_007226473.1|  hypothetical protein PRUPE_ppa027196mg             352   1e-114   
ref|XP_004488811.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    352   2e-114   
gb|KEH17852.1|  2OG-Fe(II) oxygenase family oxidoreductase              352   2e-114   
sp|O04847.2|DV4H_CATRO  RecName: Full=Deacetoxyvindoline 4-hydrox...    352   2e-114   Catharanthus roseus [chatas]
ref|XP_002889500.1|  hypothetical protein ARALYDRAFT_470412             351   2e-114   
gb|KHN10894.1|  1-aminocyclopropane-1-carboxylate oxidase like 1        351   3e-114   
gb|KHN22504.1|  1-aminocyclopropane-1-carboxylate oxidase like 1        351   3e-114   
ref|XP_002284638.2|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    361   3e-114   Vitis vinifera
ref|XP_003633274.2|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    350   3e-114   
ref|XP_009619591.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    350   4e-114   
ref|XP_007140617.1|  hypothetical protein PHAVU_008G127200g             351   4e-114   
ref|XP_007035061.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    351   4e-114   
ref|XP_006354515.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    350   5e-114   
ref|XP_003609637.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    350   7e-114   
ref|XP_007140619.1|  hypothetical protein PHAVU_008G127400g             350   7e-114   
ref|XP_008365367.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    350   1e-113   
ref|XP_004247920.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    350   1e-113   
ref|XP_004236795.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    349   1e-113   
ref|XP_011029844.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    349   1e-113   
ref|XP_003591798.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    349   2e-113   
ref|XP_009765554.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    348   3e-113   
ref|XP_008224381.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    348   5e-113   
ref|XP_009599435.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    348   5e-113   
ref|XP_003548216.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    347   6e-113   
ref|XP_007152330.1|  hypothetical protein PHAVU_004G120800g             347   7e-113   
ref|XP_009119310.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    347   8e-113   
ref|XP_003596176.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    347   9e-113   
ref|XP_010671067.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    347   1e-112   
gb|AFK35571.1|  unknown                                                 347   1e-112   
ref|XP_010104048.1|  1-aminocyclopropane-1-carboxylate oxidase-3-...    348   1e-112   
ref|XP_007223277.1|  hypothetical protein PRUPE_ppa007265mg             347   1e-112   
ref|XP_006367031.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    347   1e-112   
gb|KEH22669.1|  2OG-Fe(II) oxygenase family oxidoreductase              347   1e-112   
ref|NP_180642.1|  2-oxoglutarate dependent oxygenase-like protein       346   1e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011091222.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    346   2e-112   
ref|XP_008779114.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    346   2e-112   
gb|KEH22659.1|  2OG-Fe(II) oxygenase family oxidoreductase              346   2e-112   
gb|AAD38147.1|AF139500_1  unknown                                       346   3e-112   Prunus armeniaca
ref|XP_008222541.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    347   3e-112   
ref|XP_007035072.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    346   3e-112   
ref|XP_006598207.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    346   3e-112   
ref|XP_010093417.1|  Deacetoxyvindoline 4-hydroxylase                   345   3e-112   
ref|XP_008222547.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    346   4e-112   
emb|CBI21960.3|  unnamed protein product                                355   4e-112   
ref|XP_006341093.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    345   4e-112   
ref|XP_010483594.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    345   4e-112   
ref|XP_010023981.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    345   4e-112   
ref|XP_010326756.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    346   4e-112   
ref|NP_171930.1|  1-aminocyclopropane-1-carboxylate oxidase-like 6      345   5e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004296613.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    345   6e-112   
ref|XP_006587351.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    345   7e-112   
ref|XP_004495381.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    345   7e-112   
ref|XP_006489612.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    345   1e-111   
ref|XP_007223295.1|  hypothetical protein PRUPE_ppa007267mg             344   1e-111   
ref|XP_007226673.1|  hypothetical protein PRUPE_ppa021125mg             343   2e-111   
ref|XP_006354516.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    344   2e-111   
gb|KHN22503.1|  1-aminocyclopropane-1-carboxylate oxidase like 1        347   2e-111   
gb|EYU32968.1|  hypothetical protein MIMGU_mgv1a008832mg                343   3e-111   
ref|XP_003626787.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    343   3e-111   
ref|XP_002881136.1|  hypothetical protein ARALYDRAFT_482001             343   4e-111   
ref|XP_003591799.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    343   4e-111   
gb|AET01263.2|  1-aminocyclopropane-1-carboxylate oxidase-like pr...    344   4e-111   
ref|XP_010483596.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    342   6e-111   
ref|XP_009796112.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    342   6e-111   
ref|XP_004299419.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    342   7e-111   
ref|XP_008438548.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    342   9e-111   
ref|XP_010650060.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    340   1e-110   
ref|XP_010556889.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    341   2e-110   
ref|XP_006598208.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    341   2e-110   
emb|CDY32542.1|  BnaA09g50540D                                          341   2e-110   
gb|KHG16548.1|  hypothetical protein F383_20832                         341   2e-110   
ref|XP_008224382.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    341   2e-110   
ref|XP_010442019.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    340   3e-110   
ref|XP_004297996.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    349   4e-110   
gb|ABK96309.1|  unknown                                                 340   4e-110   Populus trichocarpa x Populus deltoides
ref|XP_007099680.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    341   4e-110   
ref|XP_008224374.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    341   6e-110   
ref|XP_008438546.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    340   6e-110   
ref|XP_009118653.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    340   6e-110   
ref|XP_009619590.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    340   6e-110   
ref|XP_006282023.1|  hypothetical protein CARUB_v10028262mg             340   6e-110   
ref|XP_007221652.1|  hypothetical protein PRUPE_ppb006192mg             340   7e-110   
ref|XP_006294352.1|  hypothetical protein CARUB_v10023369mg             340   8e-110   
ref|XP_006379885.1|  hypothetical protein POPTR_0008s16530g             337   8e-110   
ref|XP_011030519.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    339   9e-110   
ref|XP_006379884.1|  hypothetical protein POPTR_0008s16530g             336   1e-109   
ref|XP_004134416.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    339   1e-109   
ref|XP_006588550.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    338   1e-109   
ref|XP_002315711.2|  hypothetical protein POPTR_0010s08380g             339   1e-109   Populus trichocarpa [western balsam poplar]
gb|KCW60401.1|  hypothetical protein EUGRSUZ_H03119                     338   1e-109   
ref|XP_010483593.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    339   1e-109   
gb|AES62052.2|  2OG-Fe(II) oxygenase family oxidoreductase              339   2e-109   
ref|XP_010469792.1|  PREDICTED: probable 2-oxoacid dependent diox...    338   2e-109   
ref|NP_200762.1|  oxidoreductase, 2OG-Fe(II) oxygenase family pro...    338   2e-109   Arabidopsis thaliana [mouse-ear cress]
emb|CAN82828.1|  hypothetical protein VITISV_043897                     350   2e-109   Vitis vinifera
ref|XP_007223369.1|  hypothetical protein PRUPE_ppa007487mg             338   2e-109   
ref|XP_002529306.1|  Desacetoxyvindoline 4-hydroxylase, putative        338   2e-109   Ricinus communis
ref|XP_010026850.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    338   3e-109   
gb|KFK42977.1|  hypothetical protein AALP_AA1G063700                    338   3e-109   
ref|XP_010481858.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    338   3e-109   
ref|XP_006279819.1|  hypothetical protein CARUB_v10028097mg             337   4e-109   
ref|XP_010455136.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    337   7e-109   
emb|CDX97789.1|  BnaC04g41500D                                          337   7e-109   
gb|AES87341.2|  2OG-Fe(II) oxygenase family oxidoreductase              337   7e-109   
gb|AES66420.2|  2OG-Fe(II) oxygenase family oxidoreductase              337   8e-109   
ref|XP_010023989.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    337   9e-109   
gb|KEH18776.1|  1-aminocyclopropane-1-carboxylate oxidase-like pr...    337   9e-109   
ref|XP_009118490.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    337   1e-108   
ref|XP_007149301.1|  hypothetical protein PHAVU_005G058800g             337   1e-108   
gb|KFK27480.1|  hypothetical protein AALP_AA8G389000                    336   1e-108   
gb|KFK31253.1|  hypothetical protein AALP_AA6G088500                    336   1e-108   
ref|XP_003626795.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    336   1e-108   
gb|EYU42211.1|  hypothetical protein MIMGU_mgv1a008992mg                336   1e-108   
ref|XP_002866335.1|  predicted protein                                  336   1e-108   
ref|XP_010274803.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    337   2e-108   
ref|XP_010671066.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    336   2e-108   
ref|XP_002866336.1|  oxidoreductase                                     336   2e-108   
ref|XP_008367169.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    336   2e-108   
ref|XP_006354513.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    336   2e-108   
ref|XP_010510283.1|  PREDICTED: probable 2-oxoacid dependent diox...    335   3e-108   
ref|XP_003596185.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    335   3e-108   
ref|XP_004296614.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    335   3e-108   
ref|XP_010494329.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    335   3e-108   
ref|XP_010026859.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    335   3e-108   
ref|XP_003628651.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    336   3e-108   
ref|XP_010475401.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    336   3e-108   
ref|NP_200761.1|  1-aminocyclopropane-1-carboxylate oxidase-like ...    335   3e-108   Arabidopsis thaliana [mouse-ear cress]
emb|CDY06221.1|  BnaA09g49820D                                          335   3e-108   
ref|XP_008372316.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    335   4e-108   
ref|XP_004134076.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    335   5e-108   
gb|EYU32538.1|  hypothetical protein MIMGU_mgv1a008409mg                335   6e-108   
ref|XP_004510134.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    334   7e-108   
emb|CDX86638.1|  BnaC08g00650D                                          334   8e-108   
ref|XP_010093410.1|  1-aminocyclopropane-1-carboxylate oxidase-3-...    335   8e-108   
ref|XP_010443713.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    334   8e-108   
ref|XP_010414213.1|  PREDICTED: probable 2-oxoacid dependent diox...    334   9e-108   
ref|XP_003596162.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    335   9e-108   
ref|XP_009119312.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    333   1e-107   
ref|XP_009118492.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    334   1e-107   
gb|KFK42982.1|  hypothetical protein AALP_AA1G064200                    333   2e-107   
ref|XP_004167606.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    334   2e-107   
emb|CBI23590.3|  unnamed protein product                                333   2e-107   
ref|XP_009141108.1|  PREDICTED: probable 2-oxoacid dependent diox...    333   2e-107   
ref|XP_008224380.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    333   2e-107   
ref|XP_004134077.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    333   2e-107   
ref|XP_004236794.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    333   2e-107   
ref|XP_010904577.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    332   3e-107   
ref|XP_004247708.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    333   3e-107   
ref|XP_009111110.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    332   3e-107   
gb|AFK38415.1|  unknown                                                 333   4e-107   
ref|XP_003596174.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    333   4e-107   
gb|AET03089.2|  2OG-Fe(II) oxygenase family oxidoreductase              333   4e-107   
ref|XP_006294467.1|  hypothetical protein CARUB_v10023479mg             332   4e-107   
ref|XP_007152329.1|  hypothetical protein PHAVU_004G120700g             333   5e-107   
ref|XP_009118527.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    332   5e-107   
ref|XP_009119044.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    332   5e-107   
emb|CDX71101.1|  BnaC03g11850D                                          332   5e-107   
gb|AFK46776.1|  unknown                                                 332   6e-107   
ref|XP_008438549.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    333   8e-107   
ref|XP_010475402.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    332   9e-107   
ref|XP_010650055.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    330   1e-106   
emb|CDY09965.1|  BnaC08g44860D                                          332   1e-106   
gb|KEH38331.1|  2OG-Fe(II) oxygenase family oxidoreductase              332   1e-106   
ref|NP_199158.1|  1-aminocyclopropane-1-carboxylate oxidase-like ...    331   1e-106   
ref|XP_007152331.1|  hypothetical protein PHAVU_004G120900g             331   1e-106   
ref|NP_001241514.1|  uncharacterized protein LOC100792296               331   1e-106   
ref|XP_007030469.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    331   1e-106   
ref|XP_007149300.1|  hypothetical protein PHAVU_005G058700g             331   1e-106   
ref|XP_010692988.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    332   2e-106   
ref|XP_010435699.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    331   2e-106   
gb|AAK68810.1|  1-aminocyclopropane-1-carboxylate oxidase               330   2e-106   
ref|XP_010672098.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    330   2e-106   
ref|XP_009802074.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    331   3e-106   
ref|XP_010026853.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    338   3e-106   
ref|XP_010455168.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    330   3e-106   
ref|XP_010457800.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    330   4e-106   
ref|XP_010457801.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    330   4e-106   
ref|XP_003596167.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    329   4e-106   
ref|XP_003596163.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    331   5e-106   
ref|XP_006420188.1|  hypothetical protein CICLE_v10005208mg             330   5e-106   
ref|XP_006587350.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    330   6e-106   
ref|XP_007223357.1|  hypothetical protein PRUPE_ppa007457mg             330   6e-106   
gb|AES66414.2|  2OG-Fe(II) oxygenase family oxidoreductase              330   7e-106   
ref|NP_172149.1|  2-oxoglutarate-dependent dioxygenase-like protein     329   8e-106   
gb|KCW60386.1|  hypothetical protein EUGRSUZ_H03102                     326   1e-105   
emb|CBI23588.3|  unnamed protein product                                326   1e-105   
ref|XP_003626788.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    328   1e-105   
ref|XP_002889611.1|  predicted protein                                  329   1e-105   
emb|CBI23594.3|  unnamed protein product                                327   1e-105   
ref|XP_010457797.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    329   1e-105   
ref|XP_010556891.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    329   2e-105   
gb|AFK38250.1|  unknown                                                 328   2e-105   
emb|CDY60666.1|  BnaA10g27780D                                          328   2e-105   
ref|XP_010025844.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    328   2e-105   
ref|XP_006489568.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    328   2e-105   
ref|XP_006489569.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    328   2e-105   
emb|CDX71105.1|  BnaC03g11890D                                          328   2e-105   
ref|XP_006354514.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    328   2e-105   
emb|CDO99213.1|  unnamed protein product                                327   3e-105   
gb|KFK31257.1|  hypothetical protein AALP_AA6G088800                    327   3e-105   
ref|XP_010556074.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    327   5e-105   
ref|XP_004167607.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    327   5e-105   
ref|XP_008354408.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    327   5e-105   
ref|XP_010457796.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    327   6e-105   
ref|XP_009131989.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    327   6e-105   
gb|AFK45613.1|  unknown                                                 326   7e-105   
ref|XP_004247706.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    327   7e-105   
ref|XP_010455146.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    327   9e-105   
ref|XP_010457799.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    327   9e-105   
ref|XP_004134415.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    327   1e-104   
ref|XP_006420186.1|  hypothetical protein CICLE_v10005211mg             327   1e-104   
emb|CDX88706.1|  BnaA03g09430D                                          326   1e-104   
emb|CDO99192.1|  unnamed protein product                                326   2e-104   
ref|XP_003626790.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    326   2e-104   
ref|XP_006299172.1|  hypothetical protein CARUB_v10015316mg             326   2e-104   
ref|XP_007223367.1|  hypothetical protein PRUPE_ppa007477mg             326   2e-104   
ref|XP_009119046.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    325   2e-104   
ref|XP_009802072.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    325   3e-104   
ref|XP_002889612.1|  hypothetical protein ARALYDRAFT_470684             325   3e-104   
ref|XP_008224473.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    326   3e-104   
ref|XP_008438545.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    325   5e-104   
ref|XP_004134075.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    325   5e-104   
ref|XP_003626775.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    325   5e-104   
ref|XP_010475404.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    324   6e-104   
ref|XP_004491807.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    324   6e-104   
ref|XP_006420182.1|  hypothetical protein CICLE_v10006571mg             324   6e-104   
ref|NP_180641.1|  2-oxoglutarate dependent oxygenase-like protein       324   7e-104   
ref|XP_010450550.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    324   8e-104   
ref|XP_003590081.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    331   8e-104   
ref|XP_009116811.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    324   8e-104   
gb|EYU25983.1|  hypothetical protein MIMGU_mgv1a020816mg                324   9e-104   
ref|XP_010512484.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    324   1e-103   
gb|AES60332.2|  1-aminocyclopropane-1-carboxylate oxidase               323   1e-103   
ref|XP_008224375.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    333   1e-103   
emb|CDY10161.1|  BnaC05g04040D                                          323   1e-103   
gb|KDO44344.1|  hypothetical protein CISIN_1g017697mg                   323   1e-103   
ref|XP_007149298.1|  hypothetical protein PHAVU_005G058500g             323   1e-103   
ref|XP_003596158.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    323   1e-103   
ref|XP_004247710.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    323   1e-103   
ref|XP_008373909.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    323   1e-103   
ref|XP_010469070.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    323   2e-103   
gb|KDO44349.1|  hypothetical protein CISIN_1g017500mg                   323   2e-103   
ref|XP_009141104.1|  PREDICTED: probable 2-oxoacid dependent diox...    323   2e-103   
emb|CAN63810.1|  hypothetical protein VITISV_030070                     322   2e-103   
emb|CBI23597.3|  unnamed protein product                                323   2e-103   
ref|XP_006417896.1|  hypothetical protein EUTSA_v10009596mg             326   3e-103   
ref|XP_007149297.1|  hypothetical protein PHAVU_005G058400g             322   4e-103   
ref|XP_006489570.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    322   4e-103   
ref|XP_010557154.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    322   4e-103   
emb|CDX88705.1|  BnaA03g09440D                                          322   4e-103   
gb|KFK42981.1|  hypothetical protein AALP_AA1G064100                    322   4e-103   
gb|KEH22083.1|  2OG-Fe(II) oxygenase family oxidoreductase              322   4e-103   
ref|XP_010023980.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    322   5e-103   
ref|XP_006489571.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    322   5e-103   
emb|CDX71103.1|  BnaC03g11870D                                          322   5e-103   
ref|XP_003529012.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    322   6e-103   
ref|XP_007035063.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    321   6e-103   
ref|XP_010521408.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    322   6e-103   
ref|XP_002529301.1|  Desacetoxyvindoline 4-hydroxylase, putative        321   7e-103   
ref|XP_009347725.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    321   8e-103   
ref|XP_010904576.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    321   9e-103   
ref|XP_004142180.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    322   9e-103   
ref|XP_010443715.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    321   1e-102   
gb|KEH32248.1|  1-aminocyclopropane-1-carboxylate oxidase-like pr...    321   1e-102   
emb|CDX88708.1|  BnaA03g09410D                                          322   1e-102   
ref|XP_009626185.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    322   1e-102   
ref|XP_010486403.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    321   2e-102   
ref|XP_006305137.1|  hypothetical protein CARUB_v10009503mg             320   2e-102   
ref|XP_003626796.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    320   2e-102   
ref|XP_010413414.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    320   3e-102   
gb|AAK44137.1|AF370322_1  putative oxidoreductase                       320   3e-102   
ref|XP_010671064.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    320   3e-102   
ref|XP_011091190.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    320   3e-102   
gb|KDP40304.1|  hypothetical protein JCGZ_02302                         320   4e-102   
ref|NP_172150.1|  2-oxoglutarate-dependent dioxygenase-like protein     320   4e-102   
ref|XP_010482010.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    319   4e-102   
ref|XP_003596159.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    320   4e-102   
ref|XP_010440899.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    319   5e-102   
ref|XP_002863651.1|  hypothetical protein ARALYDRAFT_917302             319   5e-102   
ref|NP_191699.1|  1-aminocyclopropane-1-carboxylate oxidase-like 8      319   6e-102   
ref|XP_009131992.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    319   7e-102   
ref|NP_199157.1|  1-aminocyclopropane-1-carboxylate oxidase-like ...    319   7e-102   
ref|XP_010326755.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    320   7e-102   
ref|XP_004515224.1|  PREDICTED: deacetoxyvindoline 4-hydroxylase-...    319   7e-102   
ref|XP_008438542.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    320   8e-102   
ref|XP_006292553.1|  hypothetical protein CARUB_v10018789mg             319   8e-102   
gb|KDO61181.1|  hypothetical protein CISIN_1g046780mg                   316   8e-102   
ref|XP_004491808.1|  PREDICTED: deacetoxyvindoline 4-hydroxylase-...    319   9e-102   
ref|XP_006296340.1|  hypothetical protein CARUB_v10025512mg             318   1e-101   
ref|XP_006420908.1|  hypothetical protein CICLE_v10005201mg             316   1e-101   
ref|XP_010093411.1|  1-aminocyclopropane-1-carboxylate oxidase-1-...    318   1e-101   
emb|CDY18221.1|  BnaC05g02440D                                          318   2e-101   
ref|XP_007152328.1|  hypothetical protein PHAVU_004G120600g             319   2e-101   
ref|XP_004171996.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    318   2e-101   
ref|XP_004134072.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    318   2e-101   
emb|CAN65048.1|  hypothetical protein VITISV_026363                     318   2e-101   
ref|XP_006306485.1|  hypothetical protein CARUB_v10012463mg             317   2e-101   
ref|XP_010457793.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    318   3e-101   
ref|XP_004247712.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    317   3e-101   
ref|XP_009141105.1|  PREDICTED: probable 2-oxoacid dependent diox...    317   3e-101   
ref|XP_008224379.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    317   3e-101   
ref|XP_002892212.1|  hypothetical protein ARALYDRAFT_470414             317   3e-101   
gb|KFK42979.1|  hypothetical protein AALP_AA1G063900                    317   4e-101   
ref|XP_006283978.1|  hypothetical protein CARUB_v10005101mg             317   4e-101   
ref|XP_011091193.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    317   6e-101   
ref|XP_010435700.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    317   7e-101   
ref|XP_007152332.1|  hypothetical protein PHAVU_004G121000g             317   8e-101   
emb|CDY18226.1|  BnaC05g02490D                                          316   9e-101   
emb|CDY60668.1|  BnaA10g27790D                                          315   9e-101   
ref|XP_009131991.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    316   1e-100   
ref|XP_010457792.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    316   1e-100   
ref|XP_010044588.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    316   1e-100   
ref|XP_010457795.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    316   1e-100   
gb|KHN27717.1|  1-aminocyclopropane-1-carboxylate oxidase like 1        315   1e-100   
ref|XP_007035065.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    313   2e-100   
ref|XP_010671062.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    316   2e-100   
gb|KCW88505.1|  hypothetical protein EUGRSUZ_A00890                     316   2e-100   
emb|CAA58151.1|  2A6                                                    315   2e-100   
ref|XP_008438543.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    315   3e-100   
ref|XP_007134370.1|  hypothetical protein PHAVU_010G042000g             315   3e-100   
ref|XP_009379007.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    315   3e-100   
ref|XP_009379001.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    315   3e-100   
gb|KHN10999.1|  1-aminocyclopropane-1-carboxylate oxidase like 12       313   3e-100   
ref|XP_008380113.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    315   4e-100   
emb|CDY06654.1|  BnaA10g04330D                                          323   4e-100   
ref|XP_006372518.1|  hypothetical protein POPTR_0017s02400g             315   4e-100   
emb|CDY60661.1|  BnaA10g27740D                                          313   5e-100   
ref|NP_171840.2|  1-aminocyclopropane-1-carboxylate oxidase-like 5      315   8e-100   
ref|XP_008391183.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    313   1e-99    
ref|XP_008460629.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    313   1e-99    
ref|XP_008460628.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    313   1e-99    
emb|CDO99204.1|  unnamed protein product                                321   1e-99    
ref|XP_010652359.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    313   1e-99    
ref|XP_008391186.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    313   1e-99    
emb|CBI37091.3|  unnamed protein product                                313   1e-99    
ref|XP_009761509.1|  PREDICTED: deacetoxyvindoline 4-hydroxylase-...    313   2e-99    
ref|XP_009610251.1|  PREDICTED: deacetoxyvindoline 4-hydroxylase-...    313   2e-99    
ref|XP_006494133.1|  PREDICTED: deacetoxyvindoline 4-hydroxylase-...    313   2e-99    
gb|AET01270.2|  1-aminocyclopropane-1-carboxylate oxidase-like pr...    312   2e-99    
ref|XP_009119308.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    312   2e-99    
ref|XP_010679866.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    312   3e-99    
gb|KFK37031.1|  hypothetical protein AALP_AA4G203100                    312   3e-99    
ref|XP_006354507.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    312   3e-99    
ref|XP_011038293.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    313   4e-99    
ref|NP_180115.1|  1-aminocyclopropane-1-carboxylate oxidase-like ...    311   5e-99    
ref|XP_009119545.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    311   6e-99    
dbj|BAB68392.1|  CmE8                                                   311   6e-99    
ref|XP_004134073.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    313   6e-99    
dbj|BAF00443.1|  putative 1-aminocyclopropane-1-carboxylate oxidase     310   7e-99    
ref|XP_008438547.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    311   8e-99    
ref|XP_006403236.1|  hypothetical protein EUTSA_v10003233mg             311   8e-99    
ref|NP_171933.1|  1-aminocyclopropane-1-carboxylate oxidase-like ...    310   1e-98    
ref|XP_006403237.1|  hypothetical protein EUTSA_v10003233mg             311   1e-98    
ref|XP_006279791.1|  hypothetical protein CARUB_v10027925mg             310   2e-98    
ref|XP_009141107.1|  PREDICTED: probable 2-oxoacid dependent diox...    310   2e-98    
ref|XP_006420483.1|  hypothetical protein CICLE_v10005223mg             310   2e-98    
gb|KEH17198.1|  2OG-Fe(II) oxygenase family oxidoreductase              311   2e-98    
ref|XP_003591801.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    308   2e-98    
ref|XP_002319097.2|  hypothetical protein POPTR_0013s04220g             312   2e-98    
ref|XP_010111897.1|  1-aminocyclopropane-1-carboxylate oxidase-1-...    310   2e-98    
gb|ACR10277.1|  2-oxoacid-dependent dioxygenase                         310   2e-98    
ref|XP_009132898.1|  PREDICTED: probable 2-oxoacid dependent diox...    310   2e-98    
ref|XP_010671061.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    310   2e-98    
ref|XP_006401979.1|  hypothetical protein EUTSA_v10013645mg             312   3e-98    
ref|XP_003590085.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    310   3e-98    
ref|XP_008367206.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    310   3e-98    
gb|EPS65191.1|  hypothetical protein M569_09587                         308   4e-98    
ref|XP_009626186.1|  PREDICTED: deacetoxyvindoline 4-hydroxylase-...    309   5e-98    
ref|XP_010037991.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    309   7e-98    



>ref|XP_004247709.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Solanum lycopersicum]
Length=376

 Score =   464 bits (1195),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 236/351 (67%), Positives = 288/351 (82%), Gaps = 6/351 (2%)
 Frame = +3

Query  204   MVDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEK  383
             MV + N     +DS   +EYDR+SEV  F+DSK GVKGL DAG+TK+PRIFL+   + EK
Sbjct  1     MVVSRNESIEHDDS---SEYDRKSEVHLFDDSKMGVKGLLDAGVTKLPRIFLHNEYVSEK  57

Query  384   NSAANAATPQFVIPVIDFEGL--GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKM  557
              S  +  T +F IPV+DF+GL      R +IV  IK+ACENWGFFQ+++H IP ++ +K+
Sbjct  58    KSDPDV-TSKFSIPVVDFQGLENSAAERADIVREIKNACENWGFFQIVHHEIPSSIKEKV  116

Query  558   LESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEE  737
             LE V+HFHEQD E+KK F+SRDV +KVTYNSNFDLL + TANWRD+LYC+M P+PP+PEE
Sbjct  117   LEGVRHFHEQDSEVKKEFYSRDVTRKVTYNSNFDLLKSPTANWRDTLYCVMDPNPPDPEE  176

Query  738   LPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEP  917
             +PNVCR+++I+Y +++M LG TLFELLSEAL L  DHLK M C+EGLFI GHYYP CPEP
Sbjct  177   IPNVCREVLIEYTKYIMKLGLTLFELLSEALQLKSDHLKDMECAEGLFITGHYYPACPEP  236

Query  918   DLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKF  1097
             +LTLGLS HTDSGFLT++LQDQ+GGLQV H+D WVDVPF PG+LIVNIGD++QL+TNDKF
Sbjct  237   ELTLGLSGHTDSGFLTIVLQDQIGGLQVFHKDQWVDVPFLPGALIVNIGDLMQLITNDKF  296

Query  1098  KSVHHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             KSV HRVLAK VGPRISVASFFRMHFQEG+E++ YGPIKELLSEE P IYR
Sbjct  297   KSVLHRVLAKNVGPRISVASFFRMHFQEGSESRLYGPIKELLSEENPPIYR  347



>ref|XP_009761530.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nicotiana sylvestris]
Length=377

 Score =   449 bits (1154),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 222/347 (64%), Positives = 282/347 (81%), Gaps = 5/347 (1%)
 Frame = +3

Query  216   SNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAA  395
             SNNG   ++    +EYDR+SEV++F+DSK GVKGL DAG+TK+PRIFL+   ++EK S +
Sbjct  4     SNNGRTDQNEC--SEYDRKSEVQSFDDSKVGVKGLLDAGVTKLPRIFLHNQPVIEKKSDS  61

Query  396   NAATPQFVIPVIDF--EGLGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESV  569
             + AT +F +PVID    G    +R +IV  IKDACENWGFFQ++NH IP +VM+K+LE V
Sbjct  62    DVAT-KFSLPVIDLGNSGKSAAQRADIVREIKDACENWGFFQIVNHEIPSSVMEKVLEGV  120

Query  570   QHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNV  749
             +HFHEQD E+KK F+SRDV +K TYN+NFDL  A TANWRD+ YC+MAP+PP PEE+P V
Sbjct  121   RHFHEQDSEVKKEFYSRDVTRKFTYNTNFDLHKAKTANWRDTFYCVMAPNPPRPEEIPEV  180

Query  750   CRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTL  929
             CRD+++KY ++VM LG TL +LLSEALGL+ +HL  + C+EGL ++GHYYP CPEPD TL
Sbjct  181   CRDVVVKYTDYVMKLGLTLCDLLSEALGLNPNHLNDIECAEGLLVVGHYYPACPEPDFTL  240

Query  930   GLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVH  1109
             GL+ HTDSGFLT++LQD++GGLQV H++ WVDV F PG+LIVNIGD++QL+TNDKF+SV 
Sbjct  241   GLTGHTDSGFLTIVLQDRIGGLQVFHKNQWVDVAFMPGALIVNIGDLMQLITNDKFRSVL  300

Query  1110  HRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             HRVLAK +GPRISVAS FRMHFQE +E++ YGPIKELL EE P IYR
Sbjct  301   HRVLAKNIGPRISVASLFRMHFQERSESRLYGPIKELLLEENPPIYR  347



>ref|XP_006379886.1| hypothetical protein POPTR_0008s16530g [Populus trichocarpa]
 gb|ERP57683.1| hypothetical protein POPTR_0008s16530g [Populus trichocarpa]
Length=372

 Score =   418 bits (1075),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 213/351 (61%), Positives = 268/351 (76%), Gaps = 8/351 (2%)
 Frame = +3

Query  204   MVDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEK  383
             M+ TS+    + +S ++++YDRRSE++AF+DSKAGVKGL D+G+  IP+IF+++ S  +K
Sbjct  1     MLSTSSG---KTESELKSDYDRRSELKAFDDSKAGVKGLVDSGVANIPQIFIHESSTNDK  57

Query  384   NSAANAATPQFVIPVIDFEGL--GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKM  557
              S+ +     F +PVIDF G+    + R +IV  +++AC+ WGFFQVINHGI  +V+D M
Sbjct  58    LSSGHH---NFTVPVIDFNGIHEDASLRGKIVEELREACKKWGFFQVINHGISSSVLDDM  114

Query  558   LESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEE  737
             +  V+ FHEQD E+KK FH+RD  +KV YN+NFD   A  ANWRDSLYC++AP PP PEE
Sbjct  115   INGVRRFHEQDTEVKKEFHTRDEMRKVAYNTNFDFYQAPAANWRDSLYCLVAPHPPRPEE  174

Query  738   LPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEP  917
             LP VCRDIMI Y   VMSLG  +FELLSEALGL   HLK MGC+EGL+ IGHYYP CP+P
Sbjct  175   LPAVCRDIMIDYTNKVMSLGLIIFELLSEALGLKPSHLKDMGCAEGLYFIGHYYPACPQP  234

Query  918   DLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKF  1097
             DLTLGLS HTDS FL ++LQD LGGLQVLHED W+DV   PG+LIVN+GDM QL+TN KF
Sbjct  235   DLTLGLSKHTDSAFLAVVLQDHLGGLQVLHEDQWIDVTPIPGALIVNLGDMTQLITNGKF  294

Query  1098  KSVHHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             KSV+HRV+AK  GPRIS A FFR H Q+ + ++ YGPIKELLSEE P +YR
Sbjct  295   KSVYHRVVAKNTGPRISSACFFRTHLQQESSSRVYGPIKELLSEENPPVYR  345



>emb|CAN66006.1| hypothetical protein VITISV_042886 [Vitis vinifera]
Length=373

 Score =   417 bits (1073),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 207/334 (62%), Positives = 272/334 (81%), Gaps = 4/334 (1%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVID  434
             ++YDR+SE+++F+DSK GVKGL DAGLT+IPR+F+N+    +    +  ++P+ V P++D
Sbjct  15    SDYDRKSELKSFDDSKLGVKGLLDAGLTQIPRMFINEQHKTDMTWGSRESSPESV-PILD  73

Query  435   FEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKP  608
             F+G+  +   R +I+  + +ACE WGFFQV+NHGIP++V++ M++ ++ FHEQD E KK 
Sbjct  74    FKGMDKDAALRTQIIKKVGEACEKWGFFQVVNHGIPESVLNDMIDGIRRFHEQDAETKKE  133

Query  609   FHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVM  788
             ++SRD +KKV +NSNFDL  A  ANWRDSL C+MAP+PP PE+LP VCRDI+++Y+E VM
Sbjct  134   YYSRDSQKKVRFNSNFDLYQARMANWRDSLACVMAPNPPLPEQLPAVCRDIVMEYSEQVM  193

Query  789   SLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltl  968
              LG TLFELLSEALGL+ +HLK M C+EGLF++GHYYP CPEP+LTLG SSHTDS F T+
Sbjct  194   KLGLTLFELLSEALGLNPNHLKDMECAEGLFLLGHYYPACPEPELTLGTSSHTDSDFFTI  253

Query  969   llqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRIS  1148
             LLQDQ+GGLQVLHED WVDVP  PG+L++N+GD+LQL++ND+FKS+ HRVLAK VGPRIS
Sbjct  254   LLQDQMGGLQVLHEDQWVDVPPIPGALVINMGDLLQLVSNDRFKSIFHRVLAKNVGPRIS  313

Query  1149  VASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             VASFFR   +E N ++ YGPIKELLSEE P IYR
Sbjct  314   VASFFRKSHRENN-SRLYGPIKELLSEENPPIYR  346



>ref|XP_002284663.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Vitis vinifera]
Length=373

 Score =   417 bits (1072),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 211/351 (60%), Positives = 280/351 (80%), Gaps = 7/351 (2%)
 Frame = +3

Query  204   MVDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEK  383
             MV +S+N   +  +   ++YDR+SE+++F+DSK GVKGL DAGLT+IPR+F+N+    + 
Sbjct  1     MVSSSSN---EIQAGKASDYDRKSELKSFDDSKLGVKGLLDAGLTQIPRMFINEQHKTDM  57

Query  384   NSAANAATPQFVIPVIDFEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKM  557
                +  ++P+ V P++DF+G+  +   R +I+  + +ACE WGFFQV+NHGIP++V++ M
Sbjct  58    TWGSRESSPESV-PILDFKGMDKDAALRTQIIKKVGEACEKWGFFQVVNHGIPESVLNDM  116

Query  558   LESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEE  737
             ++ ++ FHEQD E KK ++SRD +KKV +NSNFDL  A  ANWRDSL C+MAP+PP PE+
Sbjct  117   IDGIRRFHEQDAETKKEYYSRDFQKKVRFNSNFDLYQARMANWRDSLACVMAPNPPLPEQ  176

Query  738   LPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEP  917
             LP VCRDI+++Y+E VM LG TLFELLSEALGL+ +HLK M C+EGLF++GHYYP CPEP
Sbjct  177   LPAVCRDIVMEYSEQVMKLGLTLFELLSEALGLNPNHLKDMECAEGLFLLGHYYPACPEP  236

Query  918   DLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKF  1097
             +LTLG SSHTDS F T+LLQDQ+GGLQVLHED WVDVP  PG+L++N+GD+LQL++ND+F
Sbjct  237   ELTLGTSSHTDSDFFTILLQDQMGGLQVLHEDQWVDVPPIPGALVINMGDLLQLVSNDRF  296

Query  1098  KSVHHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             KS+ HRVLAK VGPRISVASFFR   +E N ++ YGPIKELLSEE P IYR
Sbjct  297   KSIFHRVLAKNVGPRISVASFFRKSHRENN-SRLYGPIKELLSEENPPIYR  346



>ref|XP_007035066.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
 gb|EOY05992.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
Length=371

 Score =   416 bits (1069),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 207/337 (61%), Positives = 254/337 (75%), Gaps = 2/337 (1%)
 Frame = +3

Query  246   IMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIP  425
             I ++ YDR+SE+ AF+D+KAGVKGL D G+ K+PRIF+++   LE+N   +A      IP
Sbjct  9     IQESSYDRKSELRAFDDTKAGVKGLVDCGMAKVPRIFIHEEYKLERNRNQDAGNSNIGIP  68

Query  426   VIDFEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFEL  599
             +ID  G+  +   R E V  + +ACE WGFFQ +NHGI    +D M+E ++ FHEQD E+
Sbjct  69    IIDLTGISEDTSLRREAVKEVGEACEKWGFFQAVNHGIAATTLDDMIEGIRRFHEQDSEV  128

Query  600   KKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAE  779
             K+  +SRD  ++V YNSNFDL  A   NWRDSL C+MAP  P PEELP VCRDI+I+Y++
Sbjct  129   KREIYSRDYTREVNYNSNFDLYGAEATNWRDSLTCVMAPRQPHPEELPTVCRDILIEYSK  188

Query  780   HVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgf  959
              VM  G TLFELLSEALGL   HLK +GC EGLF++GHYYPPCPEPDLTLG SSHTDS F
Sbjct  189   KVMKFGDTLFELLSEALGLSRSHLKDIGCGEGLFVLGHYYPPCPEPDLTLGTSSHTDSSF  248

Query  960   ltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGP  1139
              T+LLQDQ+GGLQVLHE+ WVDV    G+L+VN+GDMLQL+TNDKFKSVHHRVLA  +GP
Sbjct  249   FTVLLQDQIGGLQVLHENQWVDVTPIHGALVVNLGDMLQLITNDKFKSVHHRVLASTIGP  308

Query  1140  RISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             RIS+ASFFR H    N ++ YGPIKELLSEE P IYR
Sbjct  309   RISIASFFRTHLPPENASRQYGPIKELLSEENPPIYR  345



>ref|XP_011029845.1| PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclopropane-1-carboxylate 
oxidase homolog 1 [Populus euphratica]
Length=372

 Score =   413 bits (1061),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 212/351 (60%), Positives = 270/351 (77%), Gaps = 8/351 (2%)
 Frame = +3

Query  204   MVDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEK  383
             M+ TS+    + +S ++++YDRRSE++AF+DSKAGVKGL D+G+  IP++F+++ S  +K
Sbjct  1     MLSTSSG---KTESELKSDYDRRSELKAFDDSKAGVKGLVDSGVANIPQMFIHESSTNDK  57

Query  384   NSAANAATPQFVIPVIDFEGL--GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKM  557
             +S+ +     F +PVIDF+G+    + R +IV  +K+AC+NWGFFQVINHGI  +V+D M
Sbjct  58    SSSGHH---NFTVPVIDFDGIQEDASLRGKIVKELKEACKNWGFFQVINHGISSSVLDDM  114

Query  558   LESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEE  737
             +  V+ FHEQD E+KK F++RD  ++V YN+NFD   A  ANWRDSLYC++AP PP PEE
Sbjct  115   INGVRRFHEQDTEVKKEFYTRDEMRRVAYNTNFDFYQAPAANWRDSLYCLVAPHPPRPEE  174

Query  738   LPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEP  917
             LP V RDIMI Y   VMSLG  +FELLSEALGL   HLK MGC+EGL+ IGHYYP CP+P
Sbjct  175   LPAVXRDIMIDYTNKVMSLGLIIFELLSEALGLKPSHLKDMGCAEGLYFIGHYYPACPQP  234

Query  918   DLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKF  1097
             DLTLGLS H DS FLT++LQDQLGGLQVLHED W+DV   PG+LIVN+GDM QL+TN KF
Sbjct  235   DLTLGLSKHADSAFLTVVLQDQLGGLQVLHEDQWIDVTPIPGALIVNLGDMTQLITNGKF  294

Query  1098  KSVHHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             KSV+HRV+AK  GPRIS A FFR H Q+ + ++ YGPIKELLSEE   IYR
Sbjct  295   KSVYHRVMAKNTGPRISSACFFRTHLQQESSSRVYGPIKELLSEENQPIYR  345



>ref|XP_010650061.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Vitis vinifera]
Length=373

 Score =   409 bits (1052),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 206/333 (62%), Positives = 267/333 (80%), Gaps = 4/333 (1%)
 Frame = +3

Query  258   EYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDF  437
             +YDR+SE+++F+DSK GVKGL DAGLTKIPR+F+N     +    +  ++P+ V P+IDF
Sbjct  16    DYDRKSELKSFDDSKLGVKGLLDAGLTKIPRMFINDQHKTDMTWGSRESSPESV-PIIDF  74

Query  438   EGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPF  611
             +G+  +   R +IV  + +ACE WGFFQV+NHGIP++V++ M++ ++ FHEQD E KK +
Sbjct  75    KGVDKDAALRTQIVKKVGEACEKWGFFQVVNHGIPESVLNDMIDGIRRFHEQDAETKKEY  134

Query  612   HSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMS  791
             +SRD + KV ++SNFDL  A TANWRDSL C+MAP+PP PE+LP VCRDI+++Y+  VM 
Sbjct  135   YSRDSQNKVRFSSNFDLYQARTANWRDSLSCVMAPNPPLPEQLPAVCRDIVMEYSGQVMK  194

Query  792   LGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltll  971
             LG TLFELLSEALGL+ +HLK M C+EGLF++GHYYP CPEP+LTLG SSHTD  F T+L
Sbjct  195   LGLTLFELLSEALGLNPNHLKDMECAEGLFLLGHYYPACPEPELTLGTSSHTDPDFFTIL  254

Query  972   lqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISV  1151
             LQDQ+GGLQVLHED WVDVP  PG+L++N+GD+LQL++ND+FKS+ HRVLAK VGPRISV
Sbjct  255   LQDQMGGLQVLHEDQWVDVPPIPGALLINMGDLLQLVSNDRFKSIFHRVLAKNVGPRISV  314

Query  1152  ASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             ASFFR    E N ++ YGP+KELLSEE P IYR
Sbjct  315   ASFFRKSHAENN-SRLYGPVKELLSEENPPIYR  346



>emb|CAN67227.1| hypothetical protein VITISV_000872 [Vitis vinifera]
Length=373

 Score =   407 bits (1046),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 205/333 (62%), Positives = 266/333 (80%), Gaps = 4/333 (1%)
 Frame = +3

Query  258   EYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDF  437
             +YDR+SE+++F+DSK GVKGL DAGLTKIPR+F+N     +    +  ++P+ V P+IDF
Sbjct  16    DYDRKSELKSFDDSKLGVKGLLDAGLTKIPRMFINDQHKTDMTWGSRESSPESV-PIIDF  74

Query  438   EGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPF  611
             +G+  +   R +IV  + +ACE WGFFQV+NHGIP++V++ M++ ++ FHEQD E KK +
Sbjct  75    KGVDKDAALRTQIVKKVGEACEKWGFFQVVNHGIPESVLNDMIDGIRRFHEQDAETKKEY  134

Query  612   HSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMS  791
             +SRD + KV ++SNFDL  A  ANWRDSL C+MAP+PP PE+LP VCRDI+++Y+  VM 
Sbjct  135   YSRDSQNKVRFSSNFDLYQARMANWRDSLSCVMAPNPPLPEQLPAVCRDIVMEYSGQVMK  194

Query  792   LGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltll  971
             LG TLFELLSEALGL+ +HLK M C+EGLF++GHYYP CPEP+LTLG SSHTD  F T+L
Sbjct  195   LGLTLFELLSEALGLNPNHLKDMECAEGLFLLGHYYPACPEPELTLGTSSHTDPDFFTIL  254

Query  972   lqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISV  1151
             LQDQ+GGLQVLHED WVDVP  PG+L++N+GD+LQL++ND+FKS+ HRVLAK VGPRISV
Sbjct  255   LQDQMGGLQVLHEDQWVDVPPIPGALVINMGDLLQLVSNDRFKSIFHRVLAKNVGPRISV  314

Query  1152  ASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             ASFFR    E N ++ YGP+KELLSEE P IYR
Sbjct  315   ASFFRKSHAENN-SRLYGPVKELLSEENPPIYR  346



>emb|CAN80594.1| hypothetical protein VITISV_017626 [Vitis vinifera]
Length=373

 Score =   405 bits (1041),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/334 (61%), Positives = 267/334 (80%), Gaps = 4/334 (1%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVID  434
             ++YDR+SE+++F+DSK GVKGL DAGLTKIPR+F+N+    +    +  ++P+ V P+ID
Sbjct  15    SDYDRKSELKSFDDSKLGVKGLLDAGLTKIPRMFINEQHKTDMTWGSRESSPESV-PIID  73

Query  435   FEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKP  608
             F+G+  +   R +I+  + +ACE WGFFQV+NHGIP++V++ M++ ++ FHEQD E KK 
Sbjct  74    FKGMDKDAALRTQIIKKVGEACEKWGFFQVVNHGIPESVLNDMIDGIRRFHEQDAETKKE  133

Query  609   FHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVM  788
             ++SRD +KKV + SNFDL  A  ANWRDSL C+MAP+PP PE+LP VCRDI+++Y+  VM
Sbjct  134   YYSRDSQKKVRFISNFDLYQARMANWRDSLSCVMAPNPPLPEQLPAVCRDIVMEYSGQVM  193

Query  789   SLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltl  968
              LG TLFELLSEALGL+ +HLK M C+EGLF+ GHYYP CPEP+LTLG SSHTDS F T+
Sbjct  194   KLGLTLFELLSEALGLNPNHLKDMECAEGLFLSGHYYPACPEPELTLGTSSHTDSDFFTI  253

Query  969   llqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRIS  1148
             LLQDQ+GGLQVLHED WVDVP  PG+L++N+GD+LQL++ND+FKS+ HRVLAK VGPRIS
Sbjct  254   LLQDQMGGLQVLHEDQWVDVPPIPGALVINMGDLLQLVSNDRFKSIFHRVLAKNVGPRIS  313

Query  1149  VASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             +ASFF     + N ++ YGPIKELLSEE P IYR
Sbjct  314   LASFFNTSHPQNN-SRLYGPIKELLSEENPPIYR  346



>ref|XP_010650062.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1 [Vitis vinifera]
Length=373

 Score =   403 bits (1036),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/334 (61%), Positives = 266/334 (80%), Gaps = 4/334 (1%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVID  434
             ++YDR+SE+++F+DSK GVKGL DAGLTKIPR+F+N+    +    +  ++P+ V P+ID
Sbjct  15    SDYDRKSELKSFDDSKLGVKGLLDAGLTKIPRMFINEQHKTDMTWGSRESSPESV-PIID  73

Query  435   FEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKP  608
             F+G+  +   R +I+  + +ACE WGFFQV+NHGIP++V++ M++ ++ FHEQD E KK 
Sbjct  74    FKGMDKDAALRTQIIKKVGEACEKWGFFQVVNHGIPESVLNDMIDGIRRFHEQDAETKKE  133

Query  609   FHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVM  788
             ++SRD +KKV + SNFDL  A  ANWRDSL C+MAP+PP PE+LP VCRDI+++Y+  VM
Sbjct  134   YYSRDSQKKVRFISNFDLYQARMANWRDSLSCVMAPNPPLPEQLPAVCRDIVMEYSGQVM  193

Query  789   SLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltl  968
              LG TLFELLSEALGL+ +HLK M C+EGLF+ GHYYP CPEP+LTLG SSHTD  F T+
Sbjct  194   KLGLTLFELLSEALGLNPNHLKDMECAEGLFLSGHYYPACPEPELTLGTSSHTDPDFFTI  253

Query  969   llqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRIS  1148
             LLQDQ+GGLQVLHED WVDVP  PG+L++N+GD+LQL++ND+FKS+ HRVLAK VGPRIS
Sbjct  254   LLQDQMGGLQVLHEDQWVDVPPIPGALVINMGDLLQLVSNDRFKSIFHRVLAKNVGPRIS  313

Query  1149  VASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             +ASFF     + N ++ YGPIKELLSEE P IYR
Sbjct  314   LASFFNTSHPQNN-SRLYGPIKELLSEENPPIYR  346



>ref|XP_007035062.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
 gb|EOY05988.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
Length=374

 Score =   403 bits (1035),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 204/352 (58%), Positives = 271/352 (77%), Gaps = 8/352 (2%)
 Frame = +3

Query  204   MVDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEK  383
             MV+T   G +  D+    +YDR+SEV+AF+D+KAGVKGL D+ +TKIPRIF++++ +LEK
Sbjct  1     MVET-KTGEVHADT--NPDYDRQSEVKAFDDTKAGVKGLVDSVVTKIPRIFVDQNLVLEK  57

Query  384   NSAANAATPQFVIPVIDFEGLG--GNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKM  557
             NS+      QF +P+ID +G+      R E++  ++ ACE WGFFQV+NH IP +V+D+M
Sbjct  58    NSSC--VNYQFSVPIIDLQGITEDSTMRAEVIEQVQIACEKWGFFQVVNHEIPGSVLDEM  115

Query  558   LESVQHFHEQDFELKKPFHSRDV-KKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPE  734
             ++ ++ FHEQD E+KK F++RD  ++KV Y SN DL  +  ANWRD+L C+MAPDPP+P 
Sbjct  116   IDGIRRFHEQDTEVKKEFYTRDTTRRKVLYLSNVDLYRSKAANWRDTLGCLMAPDPPDPT  175

Query  735   ELPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPE  914
             ELP VC DI++ Y+  V++ G+TLFELLSEALGL+  +LK M C+EGL ++GHYYP CPE
Sbjct  176   ELPEVCTDIVMDYSNRVVTFGFTLFELLSEALGLNPSYLKDMDCTEGLLLMGHYYPKCPE  235

Query  915   PDLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDK  1094
             P+LT+G ++H DS  +T+LLQDQ+GGLQVLHE+ WVDVP  PG+LIVN+GD LQLL+NDK
Sbjct  236   PELTMGTTNHRDSSIITILLQDQMGGLQVLHENQWVDVPCIPGALIVNVGDFLQLLSNDK  295

Query  1095  FKSVHHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             FKSV+HRVLAK VGPRISVA F RM    GN ++  GPIKE+LSEE P IYR
Sbjct  296   FKSVNHRVLAKHVGPRISVACFLRMQANTGNASRLCGPIKEMLSEENPPIYR  347



>ref|XP_006420907.1| hypothetical protein CICLE_v10005201mg [Citrus clementina]
 gb|ESR34147.1| hypothetical protein CICLE_v10005201mg [Citrus clementina]
Length=372

 Score =   397 bits (1020),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 198/334 (59%), Positives = 266/334 (80%), Gaps = 7/334 (2%)
 Frame = +3

Query  258   EYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDF  437
             +YDR+SE++AF+D+KAGVKGL DAG+TKIPRIF++    L  + + ++   +F+IP++D 
Sbjct  16    KYDRKSELKAFDDTKAGVKGLVDAGITKIPRIFIHDQLKLSNSRSGDS---EFIIPILDL  72

Query  438   EGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPF  611
             +G+  +   R +IV  +++AC+NWGFFQ++NHGIP +++D+M++ V  FHEQD E+KK F
Sbjct  73    DGVNKDAISRAKIVKQVQNACQNWGFFQIVNHGIPVSMLDEMIDGVIGFHEQDTEVKKKF  132

Query  612   HSRDV-KKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVM  788
             ++RD  K+KV YN+NFD   A  ANWRD+L C+MAP+PP+PEELP VCRDI++ YA+   
Sbjct  133   YTRDYQKRKVLYNTNFDFYAAPAANWRDTLSCVMAPNPPDPEELPEVCRDIIVDYAKKTT  192

Query  789   SLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltl  968
              L  TLFEL+SEALGL+ + LK M C+EGLF++GHYYP CPEP+LT+G  SH DS FLT+
Sbjct  193   ELALTLFELISEALGLNANRLKDMDCAEGLFLLGHYYPTCPEPELTMGTDSHADSSFLTV  252

Query  969   llqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRIS  1148
             LLQD+LGGLQVLHE+ WV+V    G+L+VN+GDM+QL++NDKFKSV+HRVLAK VGPR+S
Sbjct  253   LLQDRLGGLQVLHENEWVNVTPIYGALVVNLGDMMQLISNDKFKSVNHRVLAKDVGPRVS  312

Query  1149  VASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             VA FFR HFQ   +A+ YGPI ELLSEE P IY+
Sbjct  313   VACFFRSHFQ-SEKARRYGPINELLSEENPPIYK  345



>ref|XP_011040547.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Populus euphratica]
Length=368

 Score =   394 bits (1013),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 201/338 (59%), Positives = 260/338 (77%), Gaps = 8/338 (2%)
 Frame = +3

Query  246   IMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFL-NKHSILEKNSAANAATPQFVI  422
             + ++ YD++ +++AF+D++AGVKGL D G+TKIP+IF+ +K S +  +S  NAA     +
Sbjct  9     VQESNYDKKKQLKAFDDTRAGVKGLIDNGMTKIPKIFVHDKRSDVSSDSDQNAA-----V  63

Query  423   PVIDFEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFE  596
             P+IDFEG+  +R  R ++V  I+DAC  WGFFQV+NHGIP +V+++M+  V  FHEQ+ E
Sbjct  64    PLIDFEGIDEDRSQRAKVVEGIRDACAEWGFFQVVNHGIPVSVLEEMISGVARFHEQESE  123

Query  597   LKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYA  776
             +KK ++SRD  +KV YNSNFDL  A  ANWRD+L C+MAP  P P++LP+ CRDIMI Y+
Sbjct  124   VKKEWYSRDYTRKVLYNSNFDLYQAPAANWRDTLSCVMAPRQPNPQDLPHACRDIMIDYS  183

Query  777   EHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSg  956
               VM L   LFELLSEALGLD ++LK + C+EGLF +GHYYP CPEPDLT G SSH+DS 
Sbjct  184   NKVMVLAQRLFELLSEALGLDPNYLKDIHCAEGLFFLGHYYPACPEPDLTFGTSSHSDSS  243

Query  957   fltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVG  1136
             FLT+LLQDQ+GGLQVLHE+ WVDV   PG+L++N+GDM QL++ND+F SV HRVLAK VG
Sbjct  244   FLTVLLQDQIGGLQVLHENQWVDVNPIPGALVINLGDMFQLISNDRFISVQHRVLAKTVG  303

Query  1137  PRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             PRISVA F R H    N ++ YGPIKELLSEE PAIYR
Sbjct  304   PRISVACFIRQHLPPENASRLYGPIKELLSEESPAIYR  341



>ref|XP_006420181.1| hypothetical protein CICLE_v10005008mg [Citrus clementina]
 gb|ESR33421.1| hypothetical protein CICLE_v10005008mg [Citrus clementina]
Length=432

 Score =   395 bits (1015),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 197/331 (60%), Positives = 258/331 (78%), Gaps = 3/331 (1%)
 Frame = +3

Query  264   DRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFEG  443
             DR+SE+EAF+DSK GVKGL D+G  K+PRIF+++ + LE  S +      F IP+IDF+ 
Sbjct  74    DRKSELEAFDDSKTGVKGLVDSGAAKVPRIFIHEQNKLEHKSGSGNCQ-NFTIPIIDFQD  132

Query  444   LG--GNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFHS  617
             +    + R EI++ ++ ACE WGFFQV+NHGIP N++++++ +V+ FHE D ++KK F+S
Sbjct  133   IDRDASARCEIIDKVRKACEKWGFFQVVNHGIPLNILEEIINAVRKFHELDADVKKEFYS  192

Query  618   RDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMSLG  797
             RD  + + YN+NF    A  ANWRD LYC+MAP PP PEELP VCR +M+ Y++ VM  G
Sbjct  193   RDETRSMIYNTNFYFYQAPAANWRDFLYCVMAPRPPNPEELPAVCRSVMMDYSKEVMKFG  252

Query  798   YTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltlllq  977
              T+FEL+SEALGL+  HLK +GC+E L++IGHYYP CPEP+LTLGLS HTDSGFLT++LQ
Sbjct  253   LTVFELMSEALGLNSSHLKDLGCAERLYLIGHYYPACPEPELTLGLSKHTDSGFLTVVLQ  312

Query  978   dqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISVAS  1157
             DQ+GGLQVLHED WVDV    GSLI+N+GDM QL++NDKFKSV+HRVLAK  GPRISVA 
Sbjct  313   DQMGGLQVLHEDDWVDVEPVSGSLILNVGDMTQLISNDKFKSVYHRVLAKNNGPRISVAC  372

Query  1158  FFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             FFR H +EGN+++ YGPI++LLS+  P IYR
Sbjct  373   FFRTHLEEGNDSRLYGPIEQLLSQISPPIYR  403



>ref|XP_006493816.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Citrus sinensis]
Length=372

 Score =   392 bits (1008),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 196/334 (59%), Positives = 266/334 (80%), Gaps = 7/334 (2%)
 Frame = +3

Query  258   EYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDF  437
             +YDR+SE++AF+D+KAGVKGL DAG+TKIPRIF++    L  + + ++   +F+IP+ID 
Sbjct  16    KYDRKSELKAFDDTKAGVKGLVDAGITKIPRIFIHDQLKLSNSRSGDS---EFIIPIIDL  72

Query  438   EGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPF  611
             +G+  +   R +IV  +++AC+NWGFFQ++NHGIP +++D+M++ V  FHEQD E+KK F
Sbjct  73    DGVNKDAISRAKIVKQVQNACQNWGFFQIVNHGIPVSILDEMIDGVIGFHEQDTEVKKKF  132

Query  612   HSRDVKKK-VTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVM  788
             ++RD +K+ V YN+NFD  VA  ANWRD+L C+MAP+PP+PEELP VCRDI++ +A+   
Sbjct  133   YTRDYQKRMVLYNTNFDFYVAPEANWRDTLSCVMAPNPPDPEELPEVCRDIIVDHAKKTT  192

Query  789   SLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltl  968
              L  TLFEL+SEALGL+ + LK M C+EGLF++GHYYP CPEP+LT+G  SH D+ FLT+
Sbjct  193   ELALTLFELISEALGLNANRLKDMDCAEGLFLLGHYYPACPEPELTMGTDSHADTSFLTV  252

Query  969   llqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRIS  1148
             LLQD+LGGLQVLHE+ WV+V    G+L+VN+GDM+QL++N KFKSV+HRVLAK VGPR+S
Sbjct  253   LLQDRLGGLQVLHENEWVNVTPIHGALVVNLGDMMQLISNGKFKSVNHRVLAKDVGPRVS  312

Query  1149  VASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             VA FFR HFQ   +A+ YGPI ELLSEE P IY+
Sbjct  313   VACFFRSHFQ-SEKARLYGPINELLSEENPPIYK  345



>ref|XP_002284582.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1 [Vitis vinifera]
Length=364

 Score =   386 bits (992),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 198/338 (59%), Positives = 260/338 (77%), Gaps = 9/338 (3%)
 Frame = +3

Query  243   SIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVI  422
             S +  +YDR SE++AF++SKAGVKGL DAG++++PRIF+     LEK S AN  T QF  
Sbjct  7     SELPGDYDRASELKAFDESKAGVKGLVDAGVSQVPRIFIQP---LEK-SRANVNT-QFKF  61

Query  423   PVIDFEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFE  596
             PVID +G+  +R  R +IV+ +++A E WGFF V+NHGIP  V+++M+  V+ F+EQD E
Sbjct  62    PVIDLQGMDTDRVQRKQIVDKVREASETWGFFNVLNHGIPVTVLEEMMNGVRRFYEQDTE  121

Query  597   LKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYA  776
             LK+ F++RDV +K+ YNSNFDL  A  A+WRD+ YC+MAP PP P++LP  CRDI+++Y 
Sbjct  122   LKQEFYTRDVSRKLVYNSNFDLYTAKAASWRDTFYCLMAPHPPNPQDLPAACRDILMEYK  181

Query  777   EHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSg  956
             E VM LG+ L EL+SEALGL+ +HLKGM C+EGL ++ HYYP CP+P+LTLG   HTD+ 
Sbjct  182   EQVMKLGFKLLELMSEALGLNPNHLKGMDCAEGLAMVCHYYPACPQPELTLGTGFHTDND  241

Query  957   fltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVG  1136
             FLT+LLQDQ+GGLQVLH+D WVDVP  PG+L++N+GD+LQL+TND+FKSV HRVLA   G
Sbjct  242   FLTVLLQDQIGGLQVLHQDQWVDVPPMPGALVINVGDLLQLITNDRFKSVEHRVLANHTG  301

Query  1137  PRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             PR+S+A FF    Q    +K YGPIKELLSEE PA YR
Sbjct  302   PRVSIACFFSTSVQPS--SKLYGPIKELLSEENPARYR  337



>gb|EYU32539.1| hypothetical protein MIMGU_mgv1a008275mg [Erythranthe guttata]
Length=379

 Score =   387 bits (993),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 204/334 (61%), Positives = 258/334 (77%), Gaps = 6/334 (2%)
 Frame = +3

Query  252   QAEYDRRS-EVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPV  428
              + YD+   +V+ F+++K GVKGL D+G+ KIPRIFL++  +LEK S +  +  +  +PV
Sbjct  16    NSRYDKNIIDVQDFDNTKTGVKGLVDSGVEKIPRIFLHEEYMLEKKSISTKS--ELSVPV  73

Query  429   IDFEGLGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKP  608
             IDF       R +IV+ +++A E WGFFQ++NHGIP + M+K++E V+ FHE +  +KK 
Sbjct  74    IDFAACP---RDKIVDRVREASEEWGFFQIVNHGIPTSFMNKVIEDVRKFHEMEDGVKKE  130

Query  609   FHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVM  788
             ++SRD KKKV YNSNFDL +A +ANWRD+LY IMAPDPP+PE +P VCRD MI+Y+ HV 
Sbjct  131   YYSRDFKKKVLYNSNFDLHIAKSANWRDTLYLIMAPDPPKPEYIPQVCRDTMIEYSNHVK  190

Query  789   SLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltl  968
              LG  +F  LSEALGL  DHLK M C  GL++  HYYPPCPEP  TLGLSSHTDSGFLTL
Sbjct  191   KLGMEIFGFLSEALGLKSDHLKEMDCENGLYVTAHYYPPCPEPCSTLGLSSHTDSGFLTL  250

Query  969   llqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRIS  1148
             LLQDQ+GGLQVLH+D WV+VPF PGSLIVNIGD++QL+TN KFKSV+HRVLA  +GPRIS
Sbjct  251   LLQDQIGGLQVLHKDEWVNVPFCPGSLIVNIGDLMQLITNAKFKSVYHRVLANNLGPRIS  310

Query  1149  VASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             VA FFRMH QE N+++ Y PI+ELLSEE   IYR
Sbjct  311   VAFFFRMHIQETNDSRIYRPIEELLSEENRPIYR  344



>ref|XP_002317688.1| hypothetical protein POPTR_0011s15970g [Populus trichocarpa]
 gb|EEE98300.1| hypothetical protein POPTR_0011s15970g [Populus trichocarpa]
Length=368

 Score =   384 bits (985),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 194/337 (58%), Positives = 255/337 (76%), Gaps = 6/337 (2%)
 Frame = +3

Query  246   IMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIP  425
             + ++ YD+ S+++AF+D++ GVKGL D G+TKIP+IF++       + +  +A     +P
Sbjct  9     VQESNYDKESQLKAFDDTRTGVKGLIDNGITKIPKIFVHDKRSDVSSDSDQSAA----VP  64

Query  426   VIDFEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFEL  599
             +IDFEG+  +R  R ++V  ++DAC  WGFFQV+NHGIP +V+++M+  V  FHEQD E+
Sbjct  65    LIDFEGIDEDRSQRAKVVEGVRDACAEWGFFQVVNHGIPVSVLEEMIGGVARFHEQDSEV  124

Query  600   KKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAE  779
             KK ++SRD  +KV YNSNFDL  A  ANWRD+L C+MAP  P P +LP+VCRDIM  Y+ 
Sbjct  125   KKEWYSRDYTRKVLYNSNFDLYQAPAANWRDTLSCVMAPRQPNPHDLPDVCRDIMNDYSN  184

Query  780   HVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgf  959
              VM L   LFELLSEALGLD ++LK + C+EGLF +GHYYP CPEPDLT G SSH+DS F
Sbjct  185   KVMVLAQRLFELLSEALGLDPNYLKDIHCAEGLFFLGHYYPACPEPDLTFGTSSHSDSSF  244

Query  960   ltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGP  1139
             LT+L+QDQ+GGLQVLHE+ WVD+   PG+L++N+GDMLQL++ND+F SV HRVLA+ VGP
Sbjct  245   LTVLVQDQIGGLQVLHENQWVDLNPIPGALVINLGDMLQLISNDRFISVQHRVLARTVGP  304

Query  1140  RISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             RISVA F R H    N ++ YGPIKELLSEE PAIYR
Sbjct  305   RISVACFIRQHLPPENASRLYGPIKELLSEESPAIYR  341



>gb|KDP40307.1| hypothetical protein JCGZ_02305 [Jatropha curcas]
Length=374

 Score =   383 bits (984),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 193/333 (58%), Positives = 260/333 (78%), Gaps = 7/333 (2%)
 Frame = +3

Query  264   DRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFEG  443
             DR+S+++AF+D+K+GVKGL DAG++KIPRIF++  + ++  S +   T ++ IP+ID EG
Sbjct  18    DRKSQLKAFDDTKSGVKGLVDAGVSKIPRIFIHDQTQIKDKSNS---TDKYSIPIIDLEG  74

Query  444   LGGN---RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFH  614
             +      RR +I++ + DAC  WGFFQV++HGIP +V+D+M++ ++ FHEQD E+KK  +
Sbjct  75    VDNKDLIRRADIIDKVGDACRKWGFFQVVDHGIPVSVLDEMIDGIRKFHEQDDEVKKELY  134

Query  615   SRD-VKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMS  791
             SRD   KK+ +NSNFDL  A  ANWRD+L C+MAP PP+PEELP+VCR+IM+ Y+  V++
Sbjct  135   SRDFANKKIYFNSNFDLYSAPAANWRDTLSCVMAPCPPKPEELPHVCREIMMNYSNKVIA  194

Query  792   LGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltll  971
             L +TLFELLSEALGL+  +L  MGC+EGLF +GHYYP CPEP+LT+G SSH+DS FLT+L
Sbjct  195   LAHTLFELLSEALGLNRKYLNEMGCAEGLFFLGHYYPACPEPELTMGTSSHSDSSFLTVL  254

Query  972   lqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISV  1151
             LQDQ+GGLQVL ED WVDV   PG+L++N+GD+LQL++ND FKS  HRV+AK VGPRISV
Sbjct  255   LQDQIGGLQVLCEDQWVDVTPTPGALVINLGDLLQLISNDTFKSSQHRVIAKTVGPRISV  314

Query  1152  ASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             A F R H    N  + YGPIKELLSEE P +++
Sbjct  315   ACFCRHHGPSQNVPRVYGPIKELLSEENPPVFK  347



>ref|XP_010023986.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like isoform X1 [Eucalyptus grandis]
 gb|KCW60403.1| hypothetical protein EUGRSUZ_H03121 [Eucalyptus grandis]
Length=374

 Score =   383 bits (983),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 191/335 (57%), Positives = 254/335 (76%), Gaps = 5/335 (1%)
 Frame = +3

Query  261   YDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFE  440
             YDR++E+++F+DSKAGVKGL DAGLTKIPR F++ H  LE + A+ +  P   +PV+D  
Sbjct  13    YDRQAELKSFDDSKAGVKGLADAGLTKIPRFFVHDHLDLELDRASESLGPSPSVPVVDLG  72

Query  441   GLGGN----RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKP  608
             G+G       R   V ++++ACE WGFFQV+NHG+P  + ++M+E ++ FHEQD E K+ 
Sbjct  73    GVGRGWSPGERKRTVGLVREACETWGFFQVVNHGVPAALTEEMVEGIRRFHEQDLEAKRE  132

Query  609   FHSRDVK-KKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
             ++SRD   +KV YNSNFDL  A  ANWRD+L C++AP  P+P+ELP VCRD++I+Y + +
Sbjct  133   WYSRDYGGRKVLYNSNFDLYRAPAANWRDTLSCVLAPRSPDPQELPAVCRDVIIEYKDRI  192

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgflt  965
             + L  T+FELLSEALGLD  +LK + C EGLF +GHYYPPCPEPDLTLG   HTDSGFLT
Sbjct  193   LELADTIFELLSEALGLDPSYLKTIHCGEGLFFVGHYYPPCPEPDLTLGTGDHTDSGFLT  252

Query  966   lllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRI  1145
             +LLQDQ+GGLQV H++ W+DV   PG+L++N+GD++QL++NDKF SV HRVLA+ +GPRI
Sbjct  253   ILLQDQIGGLQVHHQNQWIDVSPIPGALVINLGDLMQLISNDKFISVSHRVLAQKIGPRI  312

Query  1146  SVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             SVA   R H    N ++ YGPI+ELLSEE P IYR
Sbjct  313   SVACLMRQHLPPENSSRLYGPIEELLSEENPPIYR  347



>ref|XP_010023982.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Eucalyptus grandis]
 gb|KCW60393.1| hypothetical protein EUGRSUZ_H03109 [Eucalyptus grandis]
Length=374

 Score =   382 bits (980),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 190/335 (57%), Positives = 253/335 (76%), Gaps = 5/335 (1%)
 Frame = +3

Query  261   YDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFE  440
             YDR++E+++F+DSKAGVKGL DAGLTKIPR F++ H  LE + A+ +  P   +PV+D  
Sbjct  13    YDRQAELKSFDDSKAGVKGLADAGLTKIPRFFVHDHLDLELDRASESPGPSPSVPVVDLG  72

Query  441   GLGGN----RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKP  608
             G G       R   V ++++ACE WGFFQV+NHG+P  + ++M+E ++ FHEQD E K+ 
Sbjct  73    GAGRGWSPGERKRTVGLVREACETWGFFQVVNHGVPAALTEEMVEGIRRFHEQDLEAKRE  132

Query  609   FHSRDVK-KKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
             ++SRD   +KV YNSNFDL  A  ANWRD+L C++AP  P+P+ELP VCRD++I+Y + +
Sbjct  133   WYSRDFGGRKVLYNSNFDLYQAPAANWRDTLSCVLAPRSPDPQELPAVCRDVIIEYKDRI  192

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgflt  965
             + L  T+FELLSEALGL+  +LK + C EGLF +GHYYPPCPEPDLTLG   HTDSGFLT
Sbjct  193   LELADTVFELLSEALGLESSYLKTIQCGEGLFFVGHYYPPCPEPDLTLGTGDHTDSGFLT  252

Query  966   lllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRI  1145
             +LLQDQ+GGLQV H++ W+DV   PG+L++N+GD++QL++NDKF SV HRVLA+ +GPRI
Sbjct  253   ILLQDQIGGLQVHHQNQWIDVSPIPGALVINLGDLMQLISNDKFISVSHRVLAQKIGPRI  312

Query  1146  SVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             SVA   R H    N ++ YGPI+ELLSEE P IYR
Sbjct  313   SVACLMRQHLPPENSSRLYGPIEELLSEENPPIYR  347



>ref|XP_003632020.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1 [Vitis vinifera]
Length=680

 Score =   391 bits (1004),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 193/335 (58%), Positives = 258/335 (77%), Gaps = 6/335 (2%)
 Frame = +3

Query  252   QAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVI  431
             ++ YDR+SE++AF+DS  GVKGL DAG+TKIPRIF+N+ + L+ +S      P   +P+I
Sbjct  14    ESSYDRKSELKAFDDSNLGVKGLVDAGITKIPRIFINEQNKLDMSSN----NPHLSVPII  69

Query  432   DFEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKK  605
             D E    +   R EI+N I+DAC+ WGFF VINH IP++V+ +M++ ++ FHEQD E KK
Sbjct  70    DLESFDKDAVVRAEIINQIRDACKKWGFFLVINHEIPESVLSEMIDGIRRFHEQDGEAKK  129

Query  606   PFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
              +++RD  +KVTY+SNFDL  A++ NWRD+  C +APDPP+PE+LP VCRDI+++Y +HV
Sbjct  130   EWYTRDYSRKVTYSSNFDLYQASSTNWRDTFACTLAPDPPQPEQLPAVCRDILMEYLKHV  189

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgflt  965
               LG++LFELLSEALGL  +HLK M C+EG+ ++GHYYP CPEP+LTLG SSHTD+ F+T
Sbjct  190   RRLGFSLFELLSEALGLHPNHLKNMECAEGILLLGHYYPACPEPELTLGTSSHTDADFIT  249

Query  966   lllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRI  1145
             +L+QDQ+GGLQVLHED WV++P   G+L++N+GD+LQ ++N  FKS  HRVLAK VGPRI
Sbjct  250   ILIQDQMGGLQVLHEDQWVNIPPISGALVINVGDLLQFVSNGNFKSSEHRVLAKNVGPRI  309

Query  1146  SVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             SVA FFR      N  + YGPIKELLSE+ P IYR
Sbjct  310   SVACFFRKIIPVENTTRLYGPIKELLSEDNPPIYR  344


 Score =   281 bits (720),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 151/279 (54%), Positives = 201/279 (72%), Gaps = 4/279 (1%)
 Frame = +3

Query  420   IPVIDFEGL-GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFE  596
             +PV+D  G+  G+R  EIV  ++ A E WGFFQV+NHGIP NV+++M+  ++ F+EQD E
Sbjct  377   VPVVDMSGVQKGDRHREIVEEVRIASEEWGFFQVVNHGIPSNVLEEMVNGIRVFNEQDPE  436

Query  597   LKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYA  776
             +KK ++SRD+ +KV +NSN+DL  +  ANWRD+L   +  D  +P+ELP +CR+   +Y 
Sbjct  437   VKKEYYSRDMMRKVKFNSNYDLFHSRAANWRDTLTISLTSDGLDPQELPAICREATTEYI  496

Query  777   EHVMSLGYTLFELLSEALGLDLDHLKGMGCSEG-LFIIGHYYPPCPEPDLTLGLSSHTDS  953
             +HVM LG  LFELLSEALGL  DHL+ MG +EG   ++ HYYP CPEP+LT+G S HTD 
Sbjct  497   KHVMKLGDVLFELLSEALGLKPDHLRAMGYTEGSSTMVCHYYPACPEPELTMGTSKHTDP  556

Query  954   gfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPV  1133
               LT+LLQDQ+GGLQV HE+ W +V    GSL++NIGD LQ+++N K KSV+HRV+A  V
Sbjct  557   ATLTILLQDQIGGLQVFHENQWAEVHPIAGSLVINIGDFLQVMSNGKLKSVYHRVVANHV  616

Query  1134  GPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             GPRIS A FF     E   AK  GP+KEL+SEE P +YR
Sbjct  617   GPRISTAYFFSGARTE--PAKLCGPLKELISEENPPVYR  653



>ref|XP_006489566.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Citrus sinensis]
Length=367

 Score =   380 bits (975),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 199/331 (60%), Positives = 261/331 (79%), Gaps = 3/331 (1%)
 Frame = +3

Query  264   DRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFEG  443
             DR+SE+EAF+DSK GVKGL D+G  K+PRIF+++ + LE  S +      F IP+IDF+ 
Sbjct  9     DRKSELEAFDDSKTGVKGLVDSGAAKVPRIFIHEQNKLEHKSDS-GNCQNFTIPIIDFQD  67

Query  444   LG--GNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFHS  617
             +    + R EI++ ++ ACE WGFFQV+N GIP N++++++ +V+ FHE D ++KK F+S
Sbjct  68    IDRDASARCEIIDKVRKACEKWGFFQVVNRGIPLNILEEIINAVRKFHELDADVKKEFYS  127

Query  618   RDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMSLG  797
             RD  + + YN+NFD   A+ ANWRDSLYC+MAP PP PEELP VCR +M+ Y++ VM  G
Sbjct  128   RDETRSMIYNTNFDFYQASAANWRDSLYCVMAPPPPNPEELPAVCRSVMMDYSKEVMKFG  187

Query  798   YTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltlllq  977
              T+FEL+SEALGL+  HLK +GC+E L++IGHYYP CPEP+LTLGLS HTDSGFLT++LQ
Sbjct  188   LTVFELMSEALGLNSSHLKDLGCAERLYLIGHYYPACPEPELTLGLSKHTDSGFLTVVLQ  247

Query  978   dqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISVAS  1157
             DQ+GGLQVLHED WVDV    GSLI+N+GDM QL++NDKFKSV+HRVLAK  GPRISVA 
Sbjct  248   DQMGGLQVLHEDDWVDVEPVSGSLILNVGDMTQLISNDKFKSVYHRVLAKNNGPRISVAC  307

Query  1158  FFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             FFR H +EGN+++ +GPI+ELLSE+ P IYR
Sbjct  308   FFRTHLEEGNDSRLHGPIEELLSEDSPPIYR  338



>ref|XP_009768587.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nicotiana sylvestris]
Length=362

 Score =   379 bits (974),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 194/336 (58%), Positives = 259/336 (77%), Gaps = 8/336 (2%)
 Frame = +3

Query  252   QAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVI  431
             +++YDR++E++AF+D+KAGVKGL DAG+ KIP+IF+   S  +    +N++T QF+ PVI
Sbjct  5     ESKYDRKTELKAFDDTKAGVKGLVDAGVCKIPQIFI---SPPDSTKNSNSSTEQFIFPVI  61

Query  432   DFEGL-GGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELK  602
             D +G+  G+  +R E+V   +DA E WGFFQV+NHGIP++V+++M+  V+ FHEQD E+K
Sbjct  62    DLQGIIDGDQIKRKEVVEKARDASETWGFFQVVNHGIPNDVLEEMIRGVRGFHEQDTEIK  121

Query  603   KPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEH  782
             K +++R+  KKV YNSNFDL  A   NWRD+ +CIMAP+PP PEELP +CRDI+IKY++ 
Sbjct  122   KQWYTREFTKKVVYNSNFDLYSAPATNWRDTFFCIMAPNPPSPEELPPICRDIIIKYSQE  181

Query  783   VMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfl  962
             V  LG +LFELL+EALGL+ +HL  M C +GL ++ HYYP CPEP+LTLG S H D GF+
Sbjct  182   VKKLGSSLFELLAEALGLNRNHLTDMDCDKGLSVVCHYYPACPEPELTLGASKHADDGFI  241

Query  963   tlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPR  1142
             TLLLQD +GGLQVLH++ WVDVP  PG+L+VNI D+LQL++NDKFKSV HRVLA  +GPR
Sbjct  242   TLLLQDNIGGLQVLHQNHWVDVPPTPGALVVNIADLLQLISNDKFKSVEHRVLANHIGPR  301

Query  1143  ISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             IS+A FF   F     ++ YGPIKELLSE+ P  YR
Sbjct  302   ISIACFFSTFFLAS--SRLYGPIKELLSEDNPPKYR  335



>ref|XP_002529300.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
 gb|EEF33069.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
Length=364

 Score =   379 bits (973),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 186/338 (55%), Positives = 243/338 (72%), Gaps = 7/338 (2%)
 Frame = +3

Query  249   MQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPV  428
             M   YDR+SE++AF+D+KAGVKGL D GLTKIPRIF++  S +   S++  +     IP+
Sbjct  1     MATSYDRQSELKAFDDTKAGVKGLVDGGLTKIPRIFIHDQSKINNKSSSGDSIHS--IPI  58

Query  429   IDFEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELK  602
             IDF G+  +   R++I+N ++DAC+ WGFFQVINHGIP  ++D +++ V+ FHEQD E+K
Sbjct  59    IDFNGIDSDSSVRIDIINKVRDACKKWGFFQVINHGIPAAILDDIIDGVRKFHEQDTEVK  118

Query  603   KPFHSRDVK--KKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYA  776
             K F+SR+     K  +N+NFD   +  ANWRDS+YCIMAPDPP  EELP+VCRDI+I Y+
Sbjct  119   KRFYSREQAGIAKFKFNTNFDFYQSPAANWRDSMYCIMAPDPPSSEELPDVCRDILIDYS  178

Query  777   EHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTD-S  953
               V +L   LFELLSEALGL+ ++LK +GCSEGL  +GHYYP CPEP+LT+G SSH+D S
Sbjct  179   NKVAALSNILFELLSEALGLNANYLKDIGCSEGLLFLGHYYPVCPEPELTMGTSSHSDNS  238

Query  954   gfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPV  1133
                 LL     G   +  ++ WVDV   PG+L++N+GDMLQL++NDKFKS  HRVLAK V
Sbjct  239   FLTVLLQDQSGGLQVLSCKNQWVDVNPTPGALVINLGDMLQLISNDKFKSSEHRVLAKSV  298

Query  1134  GPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIY  1247
             GPRISVA F        N ++ YGPIKELLSEE P +Y
Sbjct  299   GPRISVACFNIQLTHSKNASRLYGPIKELLSEETPPVY  336



>gb|KDO44343.1| hypothetical protein CISIN_1g017182mg [Citrus sinensis]
Length=376

 Score =   379 bits (973),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 198/331 (60%), Positives = 260/331 (79%), Gaps = 3/331 (1%)
 Frame = +3

Query  264   DRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFEG  443
             DR+SE+EAF+DSK GVKGL D+G  K+PRIF+++ + LE  S +      F IP+IDF+ 
Sbjct  18    DRKSELEAFDDSKTGVKGLVDSGAAKVPRIFIHEQNKLEHKSDS-GNCQNFTIPIIDFQD  76

Query  444   LG--GNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFHS  617
             +    + R EI++ ++ ACE WGFFQV+N GIP N++++++ +V+ FHE D ++KK F+S
Sbjct  77    IDRDASARCEIIDKVRKACEKWGFFQVVNRGIPLNILEEIINAVRKFHELDADVKKEFYS  136

Query  618   RDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMSLG  797
             RD  + + YN+NFD   A+ ANWRDSLYC+MAP PP PEELP VCR +M+ Y++ VM  G
Sbjct  137   RDETRSMIYNTNFDFYQASAANWRDSLYCVMAPPPPNPEELPAVCRSVMMDYSKEVMKFG  196

Query  798   YTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltlllq  977
              T+FEL+SEALGL+  HLK +GC+E L++IGHYYP CPEP+LTLGLS HTDSGFLT++LQ
Sbjct  197   LTVFELMSEALGLNSSHLKDLGCAERLYLIGHYYPACPEPELTLGLSKHTDSGFLTVVLQ  256

Query  978   dqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISVAS  1157
             DQ+GGLQVLHED WVDV    GSLI+N+GDM QL++NDKFKSV+HRVLAK  GPRISVA 
Sbjct  257   DQMGGLQVLHEDDWVDVEPVSGSLILNVGDMTQLISNDKFKSVYHRVLAKNNGPRISVAC  316

Query  1158  FFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             FFR H +EGN+++ YGPI++LLS+  P IYR
Sbjct  317   FFRTHLEEGNDSRLYGPIEQLLSQISPPIYR  347



>gb|KDP40308.1| hypothetical protein JCGZ_02306 [Jatropha curcas]
Length=362

 Score =   377 bits (969),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 208/337 (62%), Positives = 261/337 (77%), Gaps = 5/337 (1%)
 Frame = +3

Query  249   MQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPV  428
             M+  Y R+SE++AF+D+KAGVKGL DAG+ KIPRIF++  S +  N    +      IP+
Sbjct  1     MEYTYARKSELKAFDDTKAGVKGLADAGVAKIPRIFIHDPSKI--NDKPFSGNDMHSIPM  58

Query  429   IDFEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELK  602
             ID  G+  N   R +++N + +ACE WGFFQ+INHGIP+ ++D ML+ ++ FHEQD E+K
Sbjct  59    IDLGGIHTNASLRRQVINKLGEACEKWGFFQMINHGIPETLLDGMLDGIRRFHEQDTEVK  118

Query  603   KPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEH  782
             K F SRD KKKV YN+NFD   A  ANWRDSLYC MAP+PP PEELP VCRD MI+Y+  
Sbjct  119   KQFFSRDEKKKVFYNTNFDFYRAKEANWRDSLYCAMAPNPPNPEELPAVCRDTMIEYSSK  178

Query  783   VMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfl  962
             VM LG TLFELLSEALGL+L+HL+ +GC+EGL+ IGHYYP CPEP+LTLG+  HTDSGFL
Sbjct  179   VMDLGLTLFELLSEALGLNLNHLQDLGCAEGLYFIGHYYPACPEPNLTLGVGKHTDSGFL  238

Query  963   tlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPR  1142
             T+LLQDQLGGLQVLH+D W DV   PG+L+VN+GDM Q+L+NDKFKSV+HRVLAK VGPR
Sbjct  239   TILLQDQLGGLQVLHDDKWFDVTPIPGALVVNVGDMSQILSNDKFKSVYHRVLAKNVGPR  298

Query  1143  ISVASFFRMHFQEG-NEAKTYGPIKELLSEEKPAIYR  1250
             ISVA F R H ++G   ++ YGPIK+LLS+E P  Y+
Sbjct  299   ISVACFLRSHLEQGTTSSRLYGPIKQLLSKENPPKYK  335



>ref|XP_009600230.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nicotiana tomentosiformis]
Length=371

 Score =   378 bits (970),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 193/351 (55%), Positives = 265/351 (75%), Gaps = 10/351 (3%)
 Frame = +3

Query  207   VDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKN  386
             +D+S+N  +   S ++++YDR+ E++AF+D+KAGVKGL DAG++K+P+IF++     +K 
Sbjct  1     MDSSSNNEVF--SAIESKYDRKRELKAFDDTKAGVKGLVDAGVSKVPKIFISPSDTTKK-  57

Query  387   SAANAATPQFVIPVIDFEGL-GGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKM  557
               +N++T QF+ PV + +G+  G+  +R E+V  ++DA E WGFFQV+NHGIP +V+++M
Sbjct  58    --SNSSTEQFIFPVTNLQGIIDGDQIKRKEVVEKVRDASETWGFFQVVNHGIPSDVLEEM  115

Query  558   LESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEE  737
             +  V+ FHEQD E+KK +++R + K+V YNSNFDL  A   NWRD+ +CIMAP+PP PE+
Sbjct  116   IRGVRSFHEQDTEIKKQWYTRQLTKRVVYNSNFDLYSAPATNWRDTFFCIMAPNPPSPEQ  175

Query  738   LPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEP  917
             LP +CRDI+IKY+E V  LG  LFELL+EALGL+ +HL  M C +GL ++ HYYP CPEP
Sbjct  176   LPPICRDIIIKYSEEVKKLGSYLFELLAEALGLNRNHLSEMDCDKGLSVVCHYYPACPEP  235

Query  918   DLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKF  1097
              LTLG S H D GF+TLLLQD +GGLQVLH++ WVDVP   G+L+VNI D+LQL++NDKF
Sbjct  236   QLTLGASKHADDGFITLLLQDNIGGLQVLHQNHWVDVPLTLGALVVNIADLLQLISNDKF  295

Query  1098  KSVHHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             KSV HRVLA  +GPRIS+A FF     E   ++ YGPIKELLSE+ P  YR
Sbjct  296   KSVEHRVLANHIGPRISIACFFSTFSLES--SRLYGPIKELLSEDNPPKYR  344



>ref|XP_004309371.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like, partial [Fragaria vesca subsp. vesca]
Length=384

 Score =   378 bits (971),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 197/361 (55%), Positives = 259/361 (72%), Gaps = 8/361 (2%)
 Frame = +3

Query  180   HYSKEENIMVDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFL  359
             HYS   N+++ T+N  +LQ         DR SE++AF+D+KAGVKGL DAG+  IPRIF 
Sbjct  2     HYSLIYNLLLVTTNYYDLQTQKKTVDTSDRTSELKAFDDTKAGVKGLLDAGVKTIPRIFH  61

Query  360   NKHSILEKNSAANAATPQFVIPVIDFEG----LGGNRRVEIVNMIKDACENWGFFQVINH  527
             ++               +F IP ID +G         R E++  ++ ACE WGFFQV+NH
Sbjct  62    SRSQPNVDQREGGDDDARFSIPTIDLQGGKIQADSALRAEVMEKVRHACEKWGFFQVVNH  121

Query  528   GIPDNVMDKMLESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCI  707
             GIP NV+D+++  ++ FHEQD ELKK F++R   KKV Y+SN+DL  A++ +WRD+L C 
Sbjct  122   GIPVNVLDEVIRGIREFHEQDSELKKEFYTRTPGKKVYYHSNYDLYQASSTDWRDTLGCF  181

Query  708   MAPDPPEPEELPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFII  887
             MAP+PP+PEELP+VCRDI+I+Y++HVM +G TLFE+LSE+LGL+ +HLK M C+EGL ++
Sbjct  182   MAPNPPKPEELPSVCRDIVIEYSKHVMEVGLTLFEILSESLGLNPNHLKDMNCAEGLLLL  241

Query  888   GHYYPPCPEPDLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGD  1067
             GH YP CPEPDLT G S HTD  F+T+LLQDQ+GGLQ L+E+ WV+VP   G+L+VN+GD
Sbjct  242   GHCYPACPEPDLTFGASKHTDGTFITILLQDQVGGLQALYENQWVNVPPMYGALVVNVGD  301

Query  1068  MLQLLTNDKFKSVHHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIY  1247
             +LQL+TNDKF S+ HRV AK VGPR SVASFFR         K +GPIKELLSEE P IY
Sbjct  302   LLQLITNDKFISLAHRVRAKNVGPRTSVASFFRSE----RNTKVFGPIKELLSEENPQIY  357

Query  1248  R  1250
             +
Sbjct  358   Q  358



>ref|XP_009379005.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Pyrus x bretschneideri]
Length=374

 Score =   378 bits (970),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 193/345 (56%), Positives = 258/345 (75%), Gaps = 10/345 (3%)
 Frame = +3

Query  246   IMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQ----  413
             +  ++YDR++E++AF+DSKAGVKGL DAGL KIPRIF+++ + +  N      +P     
Sbjct  3     VTSSKYDRKTELKAFDDSKAGVKGLVDAGLAKIPRIFIHEQNKIINNHHPIGNSPSCDDS  62

Query  414   -FVIPVIDFEGL-----GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQH  575
              F  PVI  +G+        +R ++++ ++ ACE WGFFQV++HG+P +V+ +M++ ++ 
Sbjct  63    SFSTPVISLKGIVSGEEDATQRRQVIDQVRHACEKWGFFQVVDHGVPVHVLGEMIDGIRR  122

Query  576   FHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCR  755
             FHEQD  +K+  +SRD  KKV YNSNFDL  A  ANWRD+L C+MAP  P+  ELP+VCR
Sbjct  123   FHEQDQVVKEQIYSRDYAKKVYYNSNFDLYQAPAANWRDTLSCVMAPRAPDLGELPSVCR  182

Query  756   DIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGL  935
             D++I Y+E V +LG  LFELLS+ALGL+ +HLK +GC+EGL + GHYYP CPEP+LT+G 
Sbjct  183   DVVIDYSEKVKALGVALFELLSQALGLNPNHLKEVGCAEGLVLFGHYYPTCPEPELTMGT  242

Query  936   SSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHR  1115
             S HTDS FLT+LLQDQ+GGLQVLHE+ WVDV    G+L++N+GDMLQL++NDKF S +HR
Sbjct  243   SQHTDSSFLTVLLQDQIGGLQVLHENQWVDVTPIHGALVMNLGDMLQLISNDKFMSANHR  302

Query  1116  VLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             VLAK VGPRISVA FFR HF   N ++ Y PIKELLSEE P +YR
Sbjct  303   VLAKNVGPRISVACFFRQHFPPENSSRLYAPIKELLSEENPPLYR  347



>emb|CAN66433.1| hypothetical protein VITISV_027452 [Vitis vinifera]
Length=365

 Score =   376 bits (966),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 197/352 (56%), Positives = 259/352 (74%), Gaps = 17/352 (5%)
 Frame = +3

Query  204   MVDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEK  383
             MV TS +    ED      YDR SE++AF++SK GVKGL DAG++K+PR+F+     L  
Sbjct  1     MVITSISHEFPED------YDRASELKAFDESKTGVKGLVDAGVSKVPRMFIQPPDNLR-  53

Query  384   NSAANAATPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKM  557
                    T QF  PV+D +G+  +  RR +IV+M+KDA E WGFF V+NHGIP +V+++M
Sbjct  54    -----TYTTQFNFPVVDLQGMDNDPIRRNKIVDMVKDASETWGFFNVVNHGIPVSVLEEM  108

Query  558   LESVQHFHEQDFELKKPFHSRDV-KKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPE  734
             +E V  F+EQD E+KK F++RD  +KK+ YNSNFDL  A  ANWRD+ YC+MAP PP PE
Sbjct  109   MEGVLRFYEQDTEVKKQFYTRDASRKKMVYNSNFDLYTAPAANWRDTFYCLMAPHPPNPE  168

Query  735   ELPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPE  914
             ELP  CRDI+++Y + +M LG+ LFEL+SEALGL+ +HLK M C+EGL I+ HYYP CP+
Sbjct  169   ELPAACRDILMEYKDQIMRLGFKLFELISEALGLNPNHLKDMDCTEGLSILCHYYPSCPQ  228

Query  915   PDLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDK  1094
             P+LT+G + H D+ FLT+LLQDQ+GGLQVLH+  W+DVP  PG+L++N+GD+LQL+TND+
Sbjct  229   PELTMGTTKHADNDFLTVLLQDQIGGLQVLHQGQWIDVPPMPGALVINVGDLLQLITNDR  288

Query  1095  FKSVHHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             FKSV HRVLA  +GPR+SVA FF    Q    +K YGPIKELLSEE P  Y+
Sbjct  289   FKSVEHRVLANHIGPRVSVACFFSTSIQPS--SKLYGPIKELLSEENPPKYK  338



>ref|XP_011091188.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Sesamum indicum]
Length=368

 Score =   376 bits (966),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 191/331 (58%), Positives = 251/331 (76%), Gaps = 3/331 (1%)
 Frame = +3

Query  261   YDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFE  440
             YDR SE++AF+DSK+GVKGL DAG+TKIPR F+N + +    S       + + PVID  
Sbjct  11    YDRLSELKAFDDSKSGVKGLVDAGVTKIPRFFINDNDM--PGSEPCNFNSEAIFPVIDLS  68

Query  441   GLG-GNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFHS  617
             G+     R  IV+ +K+ACE WGFFQ+INH +P  VMD+M+  V+ FHEQD E+KK ++ 
Sbjct  69    GMHHAANRAGIVSRVKEACEKWGFFQIINHEMPLRVMDEMIAGVRRFHEQDAEVKKKYYG  128

Query  618   RDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMSLG  797
             RDV KK  YNSNFDL     A WRD++ C+MAP PP+P+ELP+VCRDIM +Y++HVM +G
Sbjct  129   RDVTKKFQYNSNFDLYKTRAAMWRDTITCVMAPHPPDPQELPDVCRDIMFEYSKHVMRVG  188

Query  798   YTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltlllq  977
             +T++ELLSEALGL+  +L+ +GC E  FI+GHY P CPEP+LT G+ SH D G LT+LLQ
Sbjct  189   HTVYELLSEALGLNPSYLRDIGCIESNFIVGHYSPACPEPELTFGIRSHVDFGLLTILLQ  248

Query  978   dqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISVAS  1157
             DQ+GGLQVLH++ WVDV   PGSLI+N+GD +QL++NDKFKSV HR L+K VGPRISV  
Sbjct  249   DQIGGLQVLHQNQWVDVSPLPGSLIINVGDFIQLISNDKFKSVKHRALSKRVGPRISVGV  308

Query  1158  FFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             F + ++ +G+  + YGPIKELL+EE+PAIYR
Sbjct  309   FIKPYYADGDNLRVYGPIKELLTEEEPAIYR  339



>ref|XP_004309351.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Fragaria vesca subsp. vesca]
Length=438

 Score =   379 bits (972),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 199/361 (55%), Positives = 261/361 (72%), Gaps = 8/361 (2%)
 Frame = +3

Query  180   HYSKEENIMVDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFL  359
             HYS   N+++ T+N  +LQ         DR SE++AF+D+KAGVKGL DAG+  IPRIF 
Sbjct  56    HYSLIYNLLLVTTNYYDLQTQKKTVDTSDRTSELKAFDDTKAGVKGLLDAGVKTIPRIFH  115

Query  360   NKHSILEKNSAANAATPQFVIPVIDFEG----LGGNRRVEIVNMIKDACENWGFFQVINH  527
             ++               +F IP ID +G         R E++  ++ ACE WGFFQV+NH
Sbjct  116   SRSQPNVDQREGGDDDARFSIPTIDLQGGKIQADSALRAEVMEKVRHACEKWGFFQVVNH  175

Query  528   GIPDNVMDKMLESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCI  707
             GIP NV+D+++  ++ FHEQD ELKK F++R   KKV Y+SN+DL  A++ +WRD+L C 
Sbjct  176   GIPVNVLDEVIRGIREFHEQDSELKKEFYTRTPGKKVYYHSNYDLYQASSTDWRDTLGCF  235

Query  708   MAPDPPEPEELPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFII  887
             MAP+PP+PEELP+VCRDI+I+Y++HVM +G TLFE+LSE+LGL+ +HLK M C+EGL ++
Sbjct  236   MAPNPPKPEELPSVCRDIVIEYSKHVMEVGLTLFEILSESLGLNPNHLKDMNCAEGLLLL  295

Query  888   GHYYPPCPEPDLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGD  1067
             GH YP CPEPDLT G S HTD  F+T+LLQDQ+GGLQ L+E+ WV+VP   G+L+VN+GD
Sbjct  296   GHCYPACPEPDLTFGASKHTDGTFITILLQDQVGGLQALYENQWVNVPPMYGALVVNVGD  355

Query  1068  MLQLLTNDKFKSVHHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIY  1247
             +LQL+TNDKF S+ HRV AK VGPR SVASFFR    E N  K +GPIKELLSEE P IY
Sbjct  356   LLQLITNDKFISLAHRVRAKNVGPRTSVASFFR---SERN-TKVFGPIKELLSEENPQIY  411

Query  1248  R  1250
             +
Sbjct  412   Q  412



>ref|XP_010262281.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nelumbo nucifera]
 ref|XP_010262282.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nelumbo nucifera]
Length=382

 Score =   376 bits (965),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 194/348 (56%), Positives = 257/348 (74%), Gaps = 5/348 (1%)
 Frame = +3

Query  213   TSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSA  392
              S +G      +++++YDR  E++ F+DSKAGVKGL D+GL K+PRIF++     +  S 
Sbjct  3     VSGDGGDSSGILIKSDYDRMKELKEFDDSKAGVKGLVDSGLVKVPRIFIHPPEEYDGRSV  62

Query  393   ANAATPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLES  566
             +N     F IPVID +G+G +  RR EIV  +++A E WGFFQV+NHGIP NV+D+ML+ 
Sbjct  63    SNQT--HFTIPVIDLDGIGKDAIRRREIVEEVRNASEMWGFFQVVNHGIPVNVLDEMLQG  120

Query  567   VQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPN  746
             V+ F+EQD E+KK F++RD+++++ YNSN  L  +  ANWRDS YC MAP+PP+PE+LP 
Sbjct  121   VRGFYEQDIEVKKKFYTRDLRRRLVYNSNNQLYQSPAANWRDSFYCFMAPEPPQPEDLPA  180

Query  747   VCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLT  926
             VCRDIM++Y++ V  LG  LFELLSEAL L  +HL  +GC+EG  ++ HYYP CPEP+LT
Sbjct  181   VCRDIMMEYSKQVKKLGIFLFELLSEALTLKSEHLVDIGCAEGHALLTHYYPSCPEPELT  240

Query  927   LGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSV  1106
             +G S H D+ FLT+LLQD +GGLQVL E  WVDV   PG+LIVN+GD+LQL++ND+FKSV
Sbjct  241   MGTSKHADNDFLTVLLQDNIGGLQVLREKQWVDVLPMPGALIVNVGDLLQLISNDRFKSV  300

Query  1107  HHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              HRVLA  +GPR+SVA FF     + +  K YGPIKELLSEE P IYR
Sbjct  301   EHRVLANRIGPRVSVACFFTTPVNQAS-GKLYGPIKELLSEENPPIYR  347



>ref|XP_010262283.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nelumbo nucifera]
 ref|XP_010262284.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nelumbo nucifera]
 ref|XP_010262285.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nelumbo nucifera]
 ref|XP_010262286.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nelumbo nucifera]
Length=374

 Score =   375 bits (962),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 194/348 (56%), Positives = 256/348 (74%), Gaps = 5/348 (1%)
 Frame = +3

Query  213   TSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSA  392
              S +G      +++++YDR  E+  F+DSKAGVKGL D+GL K+PRIF++     +  S 
Sbjct  3     VSGDGGDSSGVLIKSDYDRMKELMEFDDSKAGVKGLVDSGLVKVPRIFIHPPEEYDGRSV  62

Query  393   ANAATPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLES  566
             +N     F IPVID +G+G +  RR EIV  +++A E WGFFQV+NHGIP NV+D+ML+ 
Sbjct  63    SNQT--HFTIPVIDLDGIGEDAIRRREIVEEVRNASEMWGFFQVVNHGIPVNVLDEMLQG  120

Query  567   VQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPN  746
             V+ F+EQD E+KK F++RD+++++ YNSN  L  +  ANWRDS YC MAP+PP+PE+LP 
Sbjct  121   VRGFYEQDIEVKKKFYTRDLRRRLVYNSNNQLYQSPAANWRDSFYCFMAPEPPQPEDLPA  180

Query  747   VCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLT  926
             VCRDIM++Y++ V  LG  LFELLSEAL L  +HL  +GC+EG  ++ HYYP CPEP+LT
Sbjct  181   VCRDIMMEYSKQVKKLGIFLFELLSEALTLKSEHLVDIGCAEGHALLTHYYPSCPEPELT  240

Query  927   LGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSV  1106
             +G S H D+ FLT+LLQD +GGLQVL E  WVDV   PG+LIVN+GD+LQL++ND+FKSV
Sbjct  241   MGTSKHADNDFLTVLLQDNIGGLQVLREKQWVDVLPMPGALIVNVGDLLQLISNDRFKSV  300

Query  1107  HHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              HRVLA  +GPR+SVA FF     + +  K YGPIKELLSEE P IYR
Sbjct  301   EHRVLANRIGPRVSVACFFTTPVNQAS-GKLYGPIKELLSEENPPIYR  347



>ref|XP_010026849.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Eucalyptus grandis]
Length=447

 Score =   377 bits (968),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 194/335 (58%), Positives = 252/335 (75%), Gaps = 4/335 (1%)
 Frame = +3

Query  252   QAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVI  431
             + EYDR SE++AF+ S  GVKGL D+G++K+P IF++     +    ++ A   F IP++
Sbjct  88    EPEYDRESELKAFDASMTGVKGLVDSGVSKLPCIFVDHRP--QSPDCSDPAETSFSIPIV  145

Query  432   DFEGL--GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKK  605
             D +G+    ++R EIV  +  ACE+WGFFQV+NHGI   ++  +++ ++ FHEQ+ +LK+
Sbjct  146   DLQGVHEDSSKRKEIVCRVGHACEDWGFFQVVNHGIGHGILSGIIDGMRRFHEQESKLKE  205

Query  606   PFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
               +SRD  KKV +N+NFD   A  ANWRDSLYC MAP PP PEELP VCRDI+ +Y++ V
Sbjct  206   ELYSRDQSKKVIFNTNFDFHSAPVANWRDSLYCAMAPHPPSPEELPQVCRDIVREYSDKV  265

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgflt  965
             M LG T+F+LLSEALGL+  HL+ MGC+EGL++IGHYYP CPEPDLT G + HTDS FLT
Sbjct  266   MRLGLTIFKLLSEALGLNPKHLQDMGCAEGLYLIGHYYPICPEPDLTQGHTKHTDSSFLT  325

Query  966   lllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRI  1145
             +LLQDQ GGLQVLHE+ WVDV    G+L+VN+GDMLQL+TN KFKSV+HRV AK VGPRI
Sbjct  326   VLLQDQTGGLQVLHENHWVDVKPVQGALVVNLGDMLQLITNGKFKSVYHRVQAKNVGPRI  385

Query  1146  SVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             SVA FFR HF++    + YGPIKELLSEE P +YR
Sbjct  386   SVACFFRRHFEQEESPRKYGPIKELLSEENPPLYR  420



>ref|XP_003532286.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1 [Glycine max]
 gb|KHN11001.1| 1-aminocyclopropane-1-carboxylate oxidase like 1 [Glycine soja]
Length=373

 Score =   374 bits (961),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 201/358 (56%), Positives = 263/358 (73%), Gaps = 17/358 (5%)
 Frame = +3

Query  186   SKEENIMVDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNK  365
             +K  N + + SN+ N          YDR++E++AF+DSK GVKGL D+G+ KIPR+FL+ 
Sbjct  3     AKSSNQIKEESNDSN----------YDRKAEIKAFDDSKTGVKGLVDSGVKKIPRMFLSG  52

Query  366   HSILEKNSAANAATPQFVIPVIDFEGLGGNRRV--EIVNMIKDACENWGFFQVINHGIPD  539
               I E N A+++      IPVID + +  N  +  E+V  I+ AC+ WGFFQVINHGIP 
Sbjct  53    IDITE-NVASDS---NLSIPVIDLQDIHNNPALHNEVVTKIRSACQEWGFFQVINHGIPI  108

Query  540   NVMDKMLESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPD  719
             +VMD+M++ ++ FHEQD +++K F+SRD+KK + YNSN  L +   ANWRDSL C MAP+
Sbjct  109   SVMDQMIDGIRRFHEQDTDVRKQFYSRDLKKTILYNSNTSLYLDKFANWRDSLGCSMAPN  168

Query  720   PPEPEELPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYY  899
             PP+PE LP V RDI+I+Y++ +M+LG T+FELLSEALGL+  +LK M C+EGLFI GHYY
Sbjct  169   PPKPENLPTVFRDIIIEYSKEIMALGCTIFELLSEALGLNPSYLKEMNCAEGLFIQGHYY  228

Query  900   PPCPEPDLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQL  1079
             PPCPEP+LTLG S HTDS F+T++LQ QLGGLQVLHE +W +VP   G+L+VN+GD+LQL
Sbjct  229   PPCPEPELTLGTSKHTDSSFMTIVLQGQLGGLQVLHEKLWFNVPPVHGALVVNVGDILQL  288

Query  1080  LTNDKFKSVHHRVLAKPVGPRISVASFF-RMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             +TND F SV+HRVL+   GPR+SVASFF   H      +  Y PIKELLSEE PAIYR
Sbjct  289   ITNDNFVSVYHRVLSNHGGPRVSVASFFSNSHDPAKGASMVYSPIKELLSEENPAIYR  346



>ref|XP_007035064.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative isoform 1 [Theobroma cacao]
 gb|EOY05990.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative isoform 1 [Theobroma cacao]
Length=369

 Score =   374 bits (961),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 196/334 (59%), Positives = 251/334 (75%), Gaps = 6/334 (2%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVID  434
             + YDR+ E++AF+DSKAGVKGL DAG+TK+PR+F+     L    A++    QF IPVID
Sbjct  13    SNYDRKRELKAFDDSKAGVKGLVDAGVTKVPRMFIRPPDNL--RDASDTKKIQFSIPVID  70

Query  435   FEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKP  608
              EG+  N  RR EI++ ++ A E WGFFQV+NHGIP +++++M + VQ F EQD E+KK 
Sbjct  71    LEGIENNPVRRKEIIDEVRHASETWGFFQVVNHGIPSSILEEMKDGVQRFFEQDIEVKKE  130

Query  609   FHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVM  788
             F++RD  ++  Y SNFDL  +  ANWRD+ +C+MAPDPP+PEELP V RDI ++Y + V+
Sbjct  131   FYARDRVRRYRYTSNFDLYTSPFANWRDTCFCVMAPDPPKPEELPAVLRDIQLEYRKQVI  190

Query  789   SLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltl  968
              LG +LF+LLSEALGL   HL+ MGC+EGL  + HYYPPCPEP+LTLG S H+D+ FLT+
Sbjct  191   RLGSSLFKLLSEALGLKPSHLEEMGCAEGLSALCHYYPPCPEPELTLGTSKHSDNDFLTV  250

Query  969   llqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRIS  1148
             LLQDQ+GGLQVLH+D WVDVP  PG+L+VNIGD+LQL+TNDKFKSV HRVLA   GPRIS
Sbjct  251   LLQDQIGGLQVLHQDQWVDVPPVPGALVVNIGDLLQLITNDKFKSVEHRVLANREGPRIS  310

Query  1149  VASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             VA FF         ++ YGPI+ELL E  P IYR
Sbjct  311   VACFFTTGLLPS--SRLYGPIEELLLENNPPIYR  342



>ref|XP_004246496.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Solanum lycopersicum]
Length=370

 Score =   374 bits (960),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 190/336 (57%), Positives = 258/336 (77%), Gaps = 10/336 (3%)
 Frame = +3

Query  252   QAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVI  431
             ++++DR+SE++AF+D+K+GVKGL DAG++K+P+IF++       ++ +N+ T QF+ PVI
Sbjct  15    ESKHDRKSELKAFDDTKSGVKGLVDAGVSKVPQIFISP-----PDTYSNSNTGQFIFPVI  69

Query  432   DFEGLGGN---RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELK  602
             D + +  +    R +++  ++DA E WGFFQVINHG+P +VM++M+  V  FHEQD ++K
Sbjct  70    DLQDMDSHDQINRKKVIEKVRDASETWGFFQVINHGVPCDVMEEMIRGVCSFHEQDTDIK  129

Query  603   KPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEH  782
             K +++R++ K+V YNSNFDL  A   NWRD+ +CIMAP+PP PEELP +CRDI++KY+E 
Sbjct  130   KQWYTRELTKRVVYNSNFDLYNAPATNWRDTFFCIMAPNPPSPEELPPICRDIIVKYSEE  189

Query  783   VMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfl  962
             V  LG +LFELL+EALGL+ ++L  M C EGL ++ HYYP CPEP+LTLG S H D GFL
Sbjct  190   VKKLGRSLFELLAEALGLNRNYLNEMDCGEGLSVVCHYYPACPEPELTLGASKHADDGFL  249

Query  963   tlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPR  1142
             TLLLQD +GGLQVLH + WVDVP  PG+L+VNI D+LQL++NDKFKSV HRVLA  VGPR
Sbjct  250   TLLLQDHIGGLQVLHRNHWVDVPPTPGALVVNIADLLQLISNDKFKSVEHRVLANRVGPR  309

Query  1143  ISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             IS+A FF   F E   ++ YGPIKELLSEE P+ YR
Sbjct  310   ISIACFFSTFFLEA--SRLYGPIKELLSEENPSKYR  343



>ref|XP_010650056.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1 [Vitis vinifera]
Length=365

 Score =   373 bits (957),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 198/352 (56%), Positives = 258/352 (73%), Gaps = 17/352 (5%)
 Frame = +3

Query  204   MVDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEK  383
             MV TS +    ED      YDR SE++AF++SK GVKGL DAG++K+PR+F+     L  
Sbjct  1     MVITSISHEFPED------YDRASELKAFDESKTGVKGLADAGVSKVPRMFIQPPDNLR-  53

Query  384   NSAANAATPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKM  557
                    T QF  PV+D +G+  +  RR +IV+M++DA E WGFF V+NHGIP +V+++M
Sbjct  54    -----TYTTQFNFPVVDLQGMDNDPIRRNKIVDMVRDASETWGFFNVVNHGIPVSVLEEM  108

Query  558   LESVQHFHEQDFELKKPFHSRDV-KKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPE  734
             +E V+ FHEQD E+KK F++RD  +KKV YNSNFDL  A  ANWRD+ YC+MAP PP PE
Sbjct  109   MEGVRRFHEQDTEVKKQFYTRDASRKKVMYNSNFDLYTAPAANWRDTFYCLMAPHPPNPE  168

Query  735   ELPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPE  914
             ELP  CRDI+++Y + VM LG+ LFEL+SEALGL+ +HLK M C+EGL I+ HYYP CP+
Sbjct  169   ELPASCRDILMEYKDQVMRLGFKLFELISEALGLNPNHLKDMDCAEGLSILCHYYPSCPQ  228

Query  915   PDLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDK  1094
             P+LT+G + H D+ FLT+LLQDQ+GGLQVLH+  W+DVP   G+L++N+GD+LQL+TND+
Sbjct  229   PELTMGTTKHADNDFLTVLLQDQIGGLQVLHQGQWIDVPPRLGALVINVGDLLQLITNDR  288

Query  1095  FKSVHHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             FKSV HRV A  +GPR+SVA FFR   Q    +K YGPIKEL SEE P  YR
Sbjct  289   FKSVKHRVPANHIGPRVSVACFFRTSIQPS--SKLYGPIKELSSEENPPKYR  338



>ref|XP_002315713.1| hypothetical protein POPTR_0010s08410g [Populus trichocarpa]
 gb|EEF01884.1| hypothetical protein POPTR_0010s08410g [Populus trichocarpa]
Length=379

 Score =   373 bits (958),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 198/352 (56%), Positives = 257/352 (73%), Gaps = 12/352 (3%)
 Frame = +3

Query  222   NGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANA  401
             +G   E S+ +  YDR SE++AF+++KAGVKGL DAG++K+P+IF++    LE  + + +
Sbjct  4     SGRAAEISVQETSYDRGSELKAFDETKAGVKGLVDAGVSKVPQIFIHPSERLEHRTLSTS  63

Query  402   ATPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQH  575
               P  V  VID E +  +  RR  IV+ ++DA E WGFFQV+NHGIP  V+++M   V+ 
Sbjct  64    KNPVNVT-VIDLEAIDKDPIRRKGIVDKVRDASETWGFFQVVNHGIPVGVLEEMDAGVRR  122

Query  576   FHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCR  755
             F EQD E+KK F++RDV K+  YNSNFDL  A  ANWRD+ +  MAP PP+PEELP  CR
Sbjct  123   FFEQDVEVKKKFYTRDVTKRFVYNSNFDLHTAPVANWRDTFFSYMAPYPPKPEELPGACR  182

Query  756   DIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGL  935
             DIM+++++ V SLG +LF LLSEALGL  DHL+ M C+EGL +I HYYP CPEP+LTLG 
Sbjct  183   DIMMEFSKQVTSLGISLFGLLSEALGLKTDHLEKMDCAEGLALISHYYPACPEPELTLGT  242

Query  936   SSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQ-------LLTNDK  1094
             S H+D+ FLT+LLQDQ+GGLQ+LH+D WVD+P  PG+L++NIGD++Q       L++NDK
Sbjct  243   SKHSDNDFLTVLLQDQIGGLQMLHQDQWVDIPPVPGALVINIGDLMQASFSFISLISNDK  302

Query  1095  FKSVHHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             FKSV HRVLA  VGPRISVA FF   FQ    +K YGPIKELLSE  P IYR
Sbjct  303   FKSVEHRVLANRVGPRISVACFFSTSFQPS--SKLYGPIKELLSEYNPPIYR  352



>ref|XP_008391709.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Malus domestica]
Length=374

 Score =   373 bits (957),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 189/345 (55%), Positives = 257/345 (74%), Gaps = 10/345 (3%)
 Frame = +3

Query  246   IMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQ----  413
             +  ++YDR++E++AF+DSKAGVKGL DAGL KIPRIF+++ + +  N      +P     
Sbjct  3     VTSSKYDRKTELKAFDDSKAGVKGLVDAGLAKIPRIFIHEQNKIINNHHPIGHSPSCDDS  62

Query  414   -FVIPVIDFEGL-----GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQH  575
              F  PVI  +G+       ++R ++++ ++ ACE WGFFQV++HG+P +V+++M++ ++ 
Sbjct  63    SFSTPVISLKGIVSGEEDASQRRQVIDQVRHACEKWGFFQVVDHGVPVHVLEEMIDGIRR  122

Query  576   FHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCR  755
             FHEQD  +K+  +SRD  KKV YN+NFDL  A  ANWRD+L C+MAP  P+  ELP+VCR
Sbjct  123   FHEQDQVVKEEIYSRDYAKKVYYNTNFDLYQAPAANWRDTLSCVMAPRAPDLGELPSVCR  182

Query  756   DIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGL  935
             D++I Y+E V + G  LFELLS+ALGL+ +HLK +GC+EGL + GHYYP CPEP+LT+G 
Sbjct  183   DVVIDYSEKVKAXGXALFELLSQALGLNPNHLKELGCAEGLVLFGHYYPTCPEPELTMGT  242

Query  936   SSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHR  1115
             S HTDS FLT+LLQDQ+GGLQVLHE+ WVDV    G+L++N+GDM QL++NDKF S +HR
Sbjct  243   SQHTDSSFLTVLLQDQIGGLQVLHENQWVDVTPIHGALVINLGDMSQLISNDKFISANHR  302

Query  1116  VLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             VLAK VGPRISVA FFR H    N ++ Y PIKELLSEE P +YR
Sbjct  303   VLAKNVGPRISVACFFRQHLPPENSSRLYAPIKELLSEENPPVYR  347



>ref|XP_011073515.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Sesamum indicum]
Length=372

 Score =   371 bits (953),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 193/353 (55%), Positives = 262/353 (74%), Gaps = 12/353 (3%)
 Frame = +3

Query  204   MVDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILE-  380
             MV +S    +Q  +  + +YDR+SE++AFED+KAGVKGL DAG+TK+PRIF++    L  
Sbjct  1     MVVSSTAEEIQAPT--ETKYDRQSELQAFEDTKAGVKGLVDAGVTKLPRIFIHPPENLRD  58

Query  381   -KNSAANAATPQFVIPVIDFEGLG--GNRRVEIVNMIKDACENWGFFQVINHGIPDNVMD  551
              KN   N     F  P+ID +G+      R +IV+ +++A E WGFFQ++NHG+P ++++
Sbjct  59    IKNPTRNL----FDFPLIDLDGVDEDAGVREKIVDRVREASETWGFFQIVNHGVPVSMLE  114

Query  552   KMLESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEP  731
             +ML+ V+ F+EQ+ E+KK F+SRD  KKVT+N NFDL  +  ANWRD++YC+++P+P +P
Sbjct  115   EMLDGVRRFNEQETEIKKQFYSRDSTKKVTFNCNFDLFSSPAANWRDTIYCVISPNPAQP  174

Query  732   EELPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCP  911
             EELP VCRDI+I+Y++ V+ LG  LF+L+SE+LGL  DHL  M C+E L +IGHYYPPCP
Sbjct  175   EELPTVCRDIIIEYSKQVIRLGRCLFKLMSESLGLSPDHLIEMECAESLALIGHYYPPCP  234

Query  912   EPDLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTND  1091
             EPDLT G+S H+D+ F+T+LLQD LGGLQV H++ WVDVP  PG+L+VNIGD+ QL++ND
Sbjct  235   EPDLTFGISKHSDNNFITVLLQDNLGGLQVRHQNQWVDVPPLPGALVVNIGDLFQLVSND  294

Query  1092  KFKSVHHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             K KSV HRVLA   GPRISVASFF      G  +K Y P+KELLSE+ P  YR
Sbjct  295   KLKSVEHRVLASNAGPRISVASFFGR--DSGPSSKVYAPMKELLSEDDPPKYR  345



>ref|XP_010023987.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like isoform X2 [Eucalyptus grandis]
Length=374

 Score =   371 bits (953),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 187/335 (56%), Positives = 251/335 (75%), Gaps = 5/335 (1%)
 Frame = +3

Query  261   YDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFE  440
             YDR++E+++F+DSKAGVKGL DAGLTKIPR F++ H  LE + A+ +  P   +PV+D  
Sbjct  13    YDRQAELKSFDDSKAGVKGLADAGLTKIPRFFVHDHLDLELDRASESLGPSPSVPVVDLG  72

Query  441   GLGGN----RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKP  608
             G+G       R   V ++++ACE WGFFQV+NHG+P  + ++M+E ++ FHEQD E K+ 
Sbjct  73    GVGRGWSPGERKRTVGLVREACETWGFFQVVNHGVPAALTEEMVEGIRRFHEQDLEAKRE  132

Query  609   FHSRDVK-KKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
             ++SRD   +KV YNSNFDL  A  ANWRD+L  ++AP  P+P+ELP VCRD++I+Y + +
Sbjct  133   WYSRDYGGRKVLYNSNFDLYRAPAANWRDTLSRVLAPRSPDPQELPAVCRDVIIEYKDRI  192

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgflt  965
             + L  T+FELLSEALGLD  +LK + C EGLF +GHYYP CPEPDLTLG   HTDSGFLT
Sbjct  193   LELSDTIFELLSEALGLDPSYLKTIHCGEGLFFVGHYYPACPEPDLTLGTGDHTDSGFLT  252

Query  966   lllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRI  1145
             +LLQDQ+GGLQV H++ W+DV   PG+L++N+GD++QL++ND+F SV HRVLA+ +GPRI
Sbjct  253   ILLQDQIGGLQVHHQNQWIDVSPIPGALVINLGDLMQLISNDEFISVSHRVLAQKIGPRI  312

Query  1146  SVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             SVA   R H    N ++ YGPI+E LSEE P IYR
Sbjct  313   SVACLMRQHLPPENSSRLYGPIEERLSEENPPIYR  347



>gb|KHN28456.1| 1-aminocyclopropane-1-carboxylate oxidase like 12 [Glycine soja]
Length=373

 Score =   371 bits (952),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 195/346 (56%), Positives = 266/346 (77%), Gaps = 7/346 (2%)
 Frame = +3

Query  222   NGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANA  401
             N N  E+S M + YDR++EV+AF+DSKAGVKGL ++GLTKIPR+F +    + + S +++
Sbjct  5     NTNQLEES-MDSTYDRKAEVKAFDDSKAGVKGLVESGLTKIPRMFHSGRLDIIETSVSDS  63

Query  402   ATPQFVIPVIDFEGLGGNRRV--EIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQH  575
                +F IP+ID + +     +  E++  ++ AC +WGFFQVINHGIP +V+D+M++ ++ 
Sbjct  64    ---KFGIPIIDLQNIHSYPALHSEVIGKVRSACHDWGFFQVINHGIPISVLDEMIDGIRR  120

Query  576   FHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCR  755
             FHEQD +++K F+SRD+KKKV+Y SN++L     ANWRD+   ++APDPP+PEE+ +VCR
Sbjct  121   FHEQDTKVRKEFYSRDIKKKVSYYSNYNLYHDNPANWRDTFGFVVAPDPPKPEEISSVCR  180

Query  756   DIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGL  935
             DI+I+Y++ +  LG+T+FELLSEALGL+  +LK   C EGLFI+GHYYP CPEP LT+G 
Sbjct  181   DIVIEYSKKIRDLGFTIFELLSEALGLNPSYLKEFNCGEGLFILGHYYPTCPEPGLTMGT  240

Query  936   SSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHR  1115
             + HTDS F+TLLLQDQ+GGLQVLH++ WV+VP   G+L+VNIGD+LQL+TNDKF SV+HR
Sbjct  241   TKHTDSNFMTLLLQDQIGGLQVLHQNQWVNVPPLHGALVVNIGDLLQLITNDKFVSVYHR  300

Query  1116  VLAKPVGPRISVASFF-RMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             VL++  GPRISVASFF   H      +K YGPIKELLSEE P IYR
Sbjct  301   VLSQNTGPRISVASFFVNSHDPAEGTSKVYGPIKELLSEENPPIYR  346



>ref|NP_001241230.1| uncharacterized protein LOC100790198 [Glycine max]
 gb|ACU24062.1| unknown [Glycine max]
Length=375

 Score =   371 bits (952),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 195/346 (56%), Positives = 266/346 (77%), Gaps = 7/346 (2%)
 Frame = +3

Query  222   NGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANA  401
             N N  E+S M + YDR++EV+AF+DSKAGVKGL ++GLTKIPR+F +    + + S +++
Sbjct  7     NTNQLEES-MDSTYDRKAEVKAFDDSKAGVKGLVESGLTKIPRMFHSGRLDIIETSVSDS  65

Query  402   ATPQFVIPVIDFEGLGGNRRV--EIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQH  575
                +F IP+ID + +     +  E++  ++ AC +WGFFQVINHGIP +V+D+M++ ++ 
Sbjct  66    ---KFGIPIIDLQNIHSYPALHSEVIGKVRSACHDWGFFQVINHGIPISVLDEMIDGIRR  122

Query  576   FHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCR  755
             FHEQD +++K F+SRD+KKKV+Y SN++L     ANWRD+   ++APDPP+PEE+ +VCR
Sbjct  123   FHEQDTKVRKEFYSRDIKKKVSYYSNYNLYHDNPANWRDTFGFVVAPDPPKPEEISSVCR  182

Query  756   DIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGL  935
             DI+I+Y++ +  LG+T+FELLSEALGL+  +LK   C EGLFI+GHYYP CPEP LT+G 
Sbjct  183   DIVIEYSKKIRDLGFTIFELLSEALGLNPSYLKEFNCGEGLFILGHYYPTCPEPGLTMGT  242

Query  936   SSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHR  1115
             + HTDS F+TLLLQDQ+GGLQVLH++ WV+VP   G+L+VNIGD+LQL+TNDKF SV+HR
Sbjct  243   TKHTDSNFMTLLLQDQIGGLQVLHQNQWVNVPPLHGALVVNIGDLLQLITNDKFVSVYHR  302

Query  1116  VLAKPVGPRISVASFF-RMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             VL++  GPRISVASFF   H      +K YGPIKELLSEE P IYR
Sbjct  303   VLSQNTGPRISVASFFVNSHDPAEGTSKVYGPIKELLSEENPPIYR  348



>ref|XP_010274816.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nelumbo nucifera]
Length=411

 Score =   372 bits (955),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 192/332 (58%), Positives = 247/332 (74%), Gaps = 4/332 (1%)
 Frame = +3

Query  261   YDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFE  440
             YDR  E+  F+D+K+GVKGL D G+ KIPRIFL+    L++   ++       +PVID +
Sbjct  55    YDRTKELREFDDTKSGVKGLVDTGVAKIPRIFLSPPDDLKEKVVSDRTHVDVGVPVIDMK  114

Query  441   GLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFH  614
             G+  N   R EIV  ++ A E WGFFQV+NHGIP +V+ +M+E ++ FHEQD E+KK F+
Sbjct  115   GVRENPLLREEIVEKVRHASETWGFFQVVNHGIPLSVLHEMIEGIRRFHEQDIEVKKEFY  174

Query  615   SRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMSL  794
              RD  +KV +NSNFDL  +  ANWRD+L C+MAP PP  EELP VCRD +++Y++ V SL
Sbjct  175   IRDPTRKVRFNSNFDLYRSRAANWRDTLLCVMAPHPPSLEELPLVCRDAVMEYSKQVASL  234

Query  795   GYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltlll  974
             G TLFELLSEALGL+ ++L+ +GC+EG  +I HYYP CPEPDLTLG+S H+DS F TLLL
Sbjct  235   GLTLFELLSEALGLNKNYLRDIGCAEGHVLINHYYPACPEPDLTLGISKHSDSDFFTLLL  294

Query  975   qdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISVA  1154
             QD +GGLQV HED WVDV   PG+L++N+GD+LQL++ND+FKSV HRV+AK VGPRISVA
Sbjct  295   QDSIGGLQVRHEDQWVDVLPIPGALVINMGDLLQLISNDRFKSVEHRVVAKRVGPRISVA  354

Query  1155  SFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              FF  H Q     + YGPIKELLSEE P +YR
Sbjct  355   CFFGTHLQPS--TRIYGPIKELLSEENPPVYR  384



>ref|XP_007035060.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
 gb|EOY05986.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
Length=374

 Score =   371 bits (952),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 195/352 (55%), Positives = 259/352 (74%), Gaps = 7/352 (2%)
 Frame = +3

Query  201   IMVDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILE  380
             +M+  S + N +E + ++ EYDR SE++AF+++KAGVKGL DAG+ ++PRIF       E
Sbjct  1     MMITKSKSTN-EEQATLKPEYDRASELKAFDETKAGVKGLVDAGIKEVPRIFYQPRDQFE  59

Query  381   KNSAANAATPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDK  554
             K+S +     Q  IPVID EG+  N   R EIV  ++ A + WGFFQV+NHGIP +VM++
Sbjct  60    KDSVSGGT--QVSIPVIDLEGVEKNPITRKEIVQKVQIASKTWGFFQVLNHGIPVSVMEE  117

Query  555   MLESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPE  734
             M++ V+ F EQD E KK   SRD  K+V YNSNFDL  A  A WRD+++C MAP+PP+PE
Sbjct  118   MMDGVRRFFEQDVEAKKQLFSRDYTKRVVYNSNFDLYSAPAAKWRDTVFCSMAPNPPKPE  177

Query  735   ELPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPE  914
             ELP V RDI ++Y++ +M LGY LFELLSEALGL+ D+L+ + C++GL ++ HYYP CP+
Sbjct  178   ELPTVFRDITLEYSKQIMKLGYLLFELLSEALGLNPDYLRDIDCAKGLVMLCHYYPICPQ  237

Query  915   PDLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDK  1094
             P+LTLG S H D+GFLT+LLQD +GGLQVLHE+ W+DVP  PG+L++NIGD+LQL++ND 
Sbjct  238   PELTLGSSKHADNGFLTVLLQDHVGGLQVLHENHWIDVPPAPGALVINIGDLLQLISNDS  297

Query  1095  FKSVHHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
               SV HRVL   VGPR+SVASFF        +A+ YGPIKELLSEE P+ YR
Sbjct  298   CTSVAHRVLTNSVGPRVSVASFFTTALLP--DARLYGPIKELLSEENPSKYR  347



>ref|XP_010650059.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Vitis vinifera]
Length=368

 Score =   370 bits (951),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 195/342 (57%), Positives = 252/342 (74%), Gaps = 5/342 (1%)
 Frame = +3

Query  234   QEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQ  413
             Q ++ + ++ D  SE +AF+D+K GVKGL DAG+TKIPRIF++    L+       +  Q
Sbjct  3     QVEAEIGSQNDWNSETKAFDDTKLGVKGLVDAGVTKIPRIFIHPQHYLQDKLVCEDS--Q  60

Query  414   FVIPVIDFEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQ  587
             F IP ID +G+  +   R + +  I++ACE WGFFQ++NHGIP + +++ML  V+ FHEQ
Sbjct  61    FSIPTIDLQGVTSDAILRAKAIEKIQNACEKWGFFQIVNHGIPKSDLEEMLAGVRRFHEQ  120

Query  588   DFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMI  767
             D E+KK F++RD++KKV + SNFDL  A TA WRD+L  +M P  PEPE LP VCRDI +
Sbjct  121   DAEVKKEFYTRDLRKKVLFLSNFDLFQAPTATWRDTLALVMYPILPEPESLPTVCRDIAL  180

Query  768   KYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHT  947
              Y++ V  LG TLFELLS  LGL+ +HLK M C+E L  +GHYYP CPEP+LTLG S H+
Sbjct  181   AYSKQVQRLGITLFELLSVGLGLNPNHLKDMECAERLSFLGHYYPACPEPELTLGTSIHS  240

Query  948   DSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAK  1127
             D+ F+T+LLQDQLGGLQV HE+ WVDVP  PG+LIVN+GD LQLLTNDK KSVHHRV+AK
Sbjct  241   DADFMTILLQDQLGGLQVFHENQWVDVPPIPGALIVNVGDFLQLLTNDKLKSVHHRVIAK  300

Query  1128  PVGPRISVASFFRMHFQE-GNEAKTYGPIKELLSEEKPAIYR  1250
               GPRISVA FFR  F E G+  ++YGPI+ELLSEE P +Y+
Sbjct  301   QKGPRISVACFFRTEFFEPGDNLRSYGPIQELLSEENPPVYK  342



>ref|XP_003628030.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
 gb|AET02506.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=381

 Score =   370 bits (950),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 190/334 (57%), Positives = 246/334 (74%), Gaps = 7/334 (2%)
 Frame = +3

Query  261   YDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFE  440
             YDR+ E++  ++SK GVKGL DAGLTK+P+IF+  H  + +++    ++    IP+IDF 
Sbjct  17    YDRQKELKLLDESKEGVKGLVDAGLTKVPKIFI--HDKIHEHNNKQTSSTNLSIPIIDFG  74

Query  441   GLGGN----RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKP  608
              L  N     R+EI+  +K A E WGFFQV+NHGIP  V+D+M++ V  FHEQD E KK 
Sbjct  75    PLFTNTSSSSRLEIIEKVKYASEKWGFFQVVNHGIPSTVLDEMIDGVVRFHEQDTETKKE  134

Query  609   FHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVM  788
             F+SRD  K+V YN+NFDL V    NWRDSL C+M P P +P++LP VCRDI   Y+E+V 
Sbjct  135   FYSRDNGKRVYYNTNFDLYVTPAVNWRDSLSCVMGPQPLDPQKLPTVCRDITTTYSEYVK  194

Query  789   SLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltl  968
              +G  LFELLSEALGL+ ++LK + C EGLF+I HYYPPCPEP+LT+G S+H+DS FLT+
Sbjct  195   KVGTILFELLSEALGLNSNYLKDIDCVEGLFLISHYYPPCPEPELTIGASAHSDSSFLTV  254

Query  969   llqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRIS  1148
             LLQDQLGGLQV HE+ WVDV   PG+L+VN+GDM+Q++TNDKF SV HRVLA+ +GPR+S
Sbjct  255   LLQDQLGGLQVFHENQWVDVTPIPGALVVNLGDMMQIITNDKFLSVKHRVLAQSIGPRVS  314

Query  1149  VASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             VA FFR H    N  K YGPI ELL+ E P +Y+
Sbjct  315   VACFFRQHLPPEN-TKLYGPIAELLTPENPPLYK  347



>ref|XP_004511093.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
11-like [Cicer arietinum]
Length=377

 Score =   369 bits (948),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 190/332 (57%), Positives = 246/332 (74%), Gaps = 6/332 (2%)
 Frame = +3

Query  261   YDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFE  440
             YDR  E++  ++SK+GVKGL D+GL+K+P+IF++   I E N+   +      IP+IDF 
Sbjct  23    YDRYKELKLLDESKSGVKGLVDSGLSKVPKIFIHD-KIHEHNNQITST--NLNIPIIDFG  79

Query  441   GL--GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFH  614
              L    + R +I+  +K A ENWGFFQVINHGIP  V+D ML  V  FHEQD E KK F+
Sbjct  80    PLLTSSSSRFDIIEKVKYASENWGFFQVINHGIPSTVLDDMLHGVLRFHEQDTETKKEFY  139

Query  615   SRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMSL  794
             SRD+ K+  +N+NFD  V    NWRD+L C+MAP P +P+ELP++CRDI I+Y+E+V  +
Sbjct  140   SRDITKRAYFNTNFDFYVTPAVNWRDTLSCVMAPQPLDPQELPSICRDITIEYSEYVKKV  199

Query  795   GYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltlll  974
             G  LFELLSEALGL+  +LK + C+EGLF+I HYYPPCPEP+LT G S+H+DS FLT+LL
Sbjct  200   GMLLFELLSEALGLNSSYLKDIDCAEGLFVISHYYPPCPEPELTFGTSAHSDSSFLTVLL  259

Query  975   qdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISVA  1154
             QDQ+GGLQV HED WVDV   PG+L+VN+GDM+QL+TNDKF SV HRVLA+ +GPR+SVA
Sbjct  260   QDQIGGLQVFHEDQWVDVTPIPGALVVNLGDMMQLITNDKFISVKHRVLAQKLGPRVSVA  319

Query  1155  SFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              FFR H    N +K YGPI ELL+ E P +Y+
Sbjct  320   CFFRQHLPPEN-SKLYGPISELLTPENPPVYK  350



>ref|XP_003628028.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
 gb|AET02504.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=381

 Score =   369 bits (947),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 192/350 (55%), Positives = 253/350 (72%), Gaps = 12/350 (3%)
 Frame = +3

Query  222   NGNLQEDSIMQAE---YDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSA  392
             N NL+E  I Q     YDR+ E++  ++SK GVKGL DAGLTK+P+IF+  H  + +++ 
Sbjct  3     NTNLEE--IKQEHEHVYDRQKELKLLDESKEGVKGLVDAGLTKVPKIFI--HDKIHEHNN  58

Query  393   ANAATPQFVIPVIDFEGLGGN----RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKML  560
                ++    IP+IDF  L  N     R+EI+  +K A E WGFFQV+NHGIP  V+D+M+
Sbjct  59    KQTSSTNLSIPIIDFGPLFTNTSSSSRLEIIEKVKHASEKWGFFQVVNHGIPSTVLDEMI  118

Query  561   ESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEEL  740
             + V  FHEQD E+KK F+SRD+ K+  +N+NFDL V    NWRDSL C+M P P +P++L
Sbjct  119   DGVVRFHEQDTEMKKKFYSRDITKRAYFNTNFDLYVTPAVNWRDSLSCVMGPQPLDPQDL  178

Query  741   PNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPD  920
             P VCRDI +KY+++V  +G  L ELLSEALGL+ ++LK + C+EGLF+I HYYPPCPEP+
Sbjct  179   PTVCRDITVKYSDYVNKVGMILLELLSEALGLNSNYLKDIDCAEGLFLISHYYPPCPEPE  238

Query  921   LTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFK  1100
             LT G S+H+DS F T+LLQDQLGGLQV H + WVDV   PG+L++N+GDM+QL+TNDKF 
Sbjct  239   LTFGTSAHSDSSFFTVLLQDQLGGLQVFHGNQWVDVTPIPGALVINLGDMMQLITNDKFL  298

Query  1101  SVHHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             SV HRVLA  +GPRISVA FFR H    N +K YGPI ELL+ E P +Y+
Sbjct  299   SVKHRVLAPKIGPRISVACFFRQHLPPEN-SKLYGPITELLTPENPPVYK  347



>ref|XP_007035068.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
 gb|EOY05994.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
Length=371

 Score =   368 bits (944),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 194/338 (57%), Positives = 245/338 (72%), Gaps = 4/338 (1%)
 Frame = +3

Query  246   IMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIP  425
             I ++ +DR+ E++AF+D+K GVKGL DAGL  IPRIF+ +    E NS     +  F IP
Sbjct  8     IQESNFDRKKELKAFDDTKTGVKGLADAGLANIPRIFVTEQLRQENNSEPRHGS-DFCIP  66

Query  426   VIDFEGLGGNRRV--EIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFEL  599
             +ID  G+  +  +  EI+N ++DACE WGFFQV+NHGIP N +D M++ ++ FHEQD E+
Sbjct  67    IIDLTGVDEDASLHREIINKVRDACEKWGFFQVVNHGIPLNTLDDMIDGIRRFHEQDPEV  126

Query  600   KKPFHSRDVKKKVTYNSNFDLLVAATA-NWRDSLYCIMAPDPPEPEELPNVCRDIMIKYA  776
             KK  ++RD  KKV YNSN DL    TA NWRDSL   MAP  P+PEELP VCRDI+  Y 
Sbjct  127   KKGIYTRDYTKKVLYNSNPDLHRKKTAANWRDSLTFHMAPKQPDPEELPAVCRDIIFDYT  186

Query  777   EHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSg  956
               V +LG TLF+LLSEALGL   +L+  GC E  F  GHYYP CPEPDL LG +SH DS 
Sbjct  187   NKVTTLGRTLFKLLSEALGLHPTYLEESGCMEATFCFGHYYPACPEPDLALGTASHADSS  246

Query  957   fltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVG  1136
             FLT+LLQ+Q+GGLQVLHE+ W+D+P   G+L+VN+GDMLQL++N KF SV+HRVLAK +G
Sbjct  247   FLTVLLQNQIGGLQVLHENQWIDIPSVRGALVVNLGDMLQLISNGKFVSVYHRVLAKAIG  306

Query  1137  PRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             PR+SVA FFR+H    N  + YGPIK+LLSEE P IYR
Sbjct  307   PRVSVAYFFRIHLPPANPLRVYGPIKKLLSEENPPIYR  344



>ref|XP_010672757.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Beta vulgaris subsp. vulgaris]
Length=359

 Score =   366 bits (939),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 189/333 (57%), Positives = 248/333 (74%), Gaps = 11/333 (3%)
 Frame = +3

Query  261   YDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFE  440
             Y+R +E+++F++SKAGVKGL DAGL+ IPR+F++       + +++       IP+ID  
Sbjct  8     YNRTAELKSFDESKAGVKGLVDAGLSTIPRMFIHP-----TDPSSSPPKHDVSIPIIDLT  62

Query  441   GLGGN---RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPF  611
             G+  +   R+V IV  I++A E WGFFQV+NH IP  V+++MLE V+ F+EQD E+KK +
Sbjct  63    GMTNDPVLRKV-IVERIREASETWGFFQVVNHSIPIMVLEEMLEGVKRFYEQDVEVKKGY  121

Query  612   HSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMS  791
             ++RDV KKV YNSN+DL     ANWRD+ YC MAP PP P++LPN CR+I+++Y + VM 
Sbjct  122   YTRDVAKKVVYNSNYDLYTGPAANWRDTFYCFMAPQPPSPQDLPNTCREILMEYTKEVMK  181

Query  792   LGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltll  971
             LG  L ELLSEALGL  +HL  + CSEGL ++GHYYP CP+P+LTLG S H D GFLTLL
Sbjct  182   LGRVLMELLSEALGLSANHLNDIDCSEGLVVVGHYYPACPQPELTLGTSKHADDGFLTLL  241

Query  972   lqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISV  1151
             LQDQ+GGLQ+LHED W DVP  PG+L+VNIGD+LQL++ND FKSV HRVLA  +GPR+SV
Sbjct  242   LQDQIGGLQILHEDKWFDVPPVPGALVVNIGDLLQLISNDTFKSVEHRVLANRIGPRVSV  301

Query  1152  ASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             ASFF   FQ    +K YGPIK+L+SE+ P  YR
Sbjct  302   ASFFTTSFQ--GTSKIYGPIKDLVSEDNPPRYR  332



>ref|XP_002276339.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1 [Vitis vinifera]
Length=355

 Score =   365 bits (936),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 186/338 (55%), Positives = 258/338 (76%), Gaps = 6/338 (2%)
 Frame = +3

Query  243   SIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVI  422
             S +++EYDR+SE+EAF+ SK+GVKGL D GLTKIP +F++ H     ++ + +A  QF +
Sbjct  6     SGVESEYDRKSELEAFDASKSGVKGLVDGGLTKIPLMFIHPH--YNPDAKSGSAVSQFRV  63

Query  423   PVIDFEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFE  596
             P+ID +G+  N   R +I++ +++ACENWGF QV+NHGIP +V+++ML+ ++ FHEQD +
Sbjct  64    PLIDLDGVNDNATLRAKIIDQVREACENWGFLQVVNHGIPASVLEEMLDGIRGFHEQDTQ  123

Query  597   LKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYA  776
             +KK F++RD K+KV++ SNFDL  A  A W+DSL   +AP+PP P+ELP VCRDI+++Y+
Sbjct  124   MKKEFYTRDFKEKVSFVSNFDLFQATAATWKDSLSWAVAPNPPHPKELPAVCRDIVMEYS  183

Query  777   EHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSg  956
             + V  LGYTLFE+LSEALGLD++HLK M C+E +F  GHYYPPCPEP+LTLG   HTDSG
Sbjct  184   KQVKRLGYTLFEVLSEALGLDVNHLKDMECAEMMFHAGHYYPPCPEPELTLGARRHTDSG  243

Query  957   fltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVG  1136
             FLT+LLQDQ+GGLQVLH++ W+D+   PG+L++N+GD LQ++TND+FKS+ HRVL     
Sbjct  244   FLTVLLQDQVGGLQVLHQNQWIDLVPMPGALVINVGDSLQVITNDRFKSIEHRVLVNSES  303

Query  1137  PRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              R+SVAS F         +K Y PIKELLS+E P  Y+
Sbjct  304   SRVSVASAFGTTLFPS--SKLYSPIKELLSQENPPKYK  339



>ref|XP_009591157.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nicotiana tomentosiformis]
Length=365

 Score =   365 bits (936),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 188/335 (56%), Positives = 246/335 (73%), Gaps = 5/335 (1%)
 Frame = +3

Query  252   QAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVI  431
             +  YDR SE+  F+ +KAGVKGL DAG+T++PRIF        + S  +    Q  IPVI
Sbjct  7     ENSYDRTSELIVFDSTKAGVKGLVDAGVTRVPRIFYTAEDAYTEASN-DPEKSQINIPVI  65

Query  432   DFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKK  605
             D +G+  +  +R  IV  I+DA E WGFFQV+NHGIP++V+++ML  V+ F+EQD E+KK
Sbjct  66    DLDGISKDPIKRSAIVEKIRDASEVWGFFQVVNHGIPESVLEEMLNGVRRFYEQDTEVKK  125

Query  606   PFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
              +++RD  K+V YNSNFDL  AA+ANWRD+ YC M+P+PP  +ELP  CRDI+I+Y+EH+
Sbjct  126   QWYTRDNSKRVVYNSNFDLFGAASANWRDTTYCSMSPNPPTADELPEACRDILIEYSEHI  185

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgflt  965
               LG +LFELLSEALGL+  +L  +GCSEGL ++ HYYP CPEP+LTLG S H+DS F T
Sbjct  186   KKLGCSLFELLSEALGLNPSYLNDIGCSEGLAVLYHYYPACPEPELTLGTSKHSDSDFFT  245

Query  966   lllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRI  1145
             +LLQD  GGLQVLH++ WVDV    G+L+VN G++LQL++NDKFKS+ HRVLA  VGPR+
Sbjct  246   VLLQDNSGGLQVLHDNYWVDVHPLSGALVVNFGELLQLISNDKFKSIAHRVLASRVGPRV  305

Query  1146  SVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             SVA FF         ++ YGPIKELLSE+ PA YR
Sbjct  306   SVACFFTT--GHSLSSRVYGPIKELLSEDNPARYR  338



>ref|XP_006341094.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Solanum tuberosum]
Length=370

 Score =   365 bits (936),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 188/336 (56%), Positives = 251/336 (75%), Gaps = 10/336 (3%)
 Frame = +3

Query  252   QAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVI  431
             ++++DR+SE++AF+D+K+GVKGL DAG+ K+P+IF++       ++ +N+ T QF+ PVI
Sbjct  15    ESKHDRKSELKAFDDTKSGVKGLVDAGVNKVPQIFISP-----PDTHSNSTTGQFIFPVI  69

Query  432   DFEGLGGN---RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELK  602
             D + +  +    R E++  ++DA E WGFFQVINHG+P +VM +M+  V  FHEQD ++K
Sbjct  70    DLQDIDSHDQINRKELIEKVRDASETWGFFQVINHGVPCDVMAEMIRGVCSFHEQDNDIK  129

Query  603   KPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEH  782
             K +++R+  K+V YNSNFDL  A   NWRD+  CIMAP+PP PEE P +CRDI++KY+E 
Sbjct  130   KQWYTREFTKRVVYNSNFDLYSAPATNWRDTFSCIMAPNPPSPEEWPPICRDIIVKYSEE  189

Query  783   VMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfl  962
             V  LG +LFELL+EALGL+ ++L  M C +GL +  HYYP CPEP+LTLG S H D GFL
Sbjct  190   VKKLGRSLFELLAEALGLNRNYLNDMDCDKGLSVACHYYPACPEPELTLGASKHADDGFL  249

Query  963   tlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPR  1142
             TLLLQD +GGLQVLH + WVDVP  PG+L+VNI D+LQL++NDKFKSV HRVLA  VGPR
Sbjct  250   TLLLQDHIGGLQVLHRNHWVDVPPTPGALVVNIADLLQLISNDKFKSVEHRVLANRVGPR  309

Query  1143  ISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             IS+A FF   F     ++ YGPIKELLSEE P+ YR
Sbjct  310   ISIACFFSTFFLAS--SRLYGPIKELLSEENPSKYR  343



>ref|XP_004491714.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Cicer arietinum]
Length=373

 Score =   365 bits (936),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 191/348 (55%), Positives = 261/348 (75%), Gaps = 10/348 (3%)
 Frame = +3

Query  219   NNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAAN  398
             N   L+E +   + YDR++EV+AF+DSKAGVKGL D+G+ KIPR+F  K   + +N A++
Sbjct  5     NTKQLEEGN--DSTYDRKAEVKAFDDSKAGVKGLVDSGVAKIPRMFYTKKFDITENLASD  62

Query  399   AATPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQ  572
             +      +P+IDF+ +  N   RV+ ++ I+ AC  WGFFQVINHGIP  ++D+M++ ++
Sbjct  63    S---NLSVPIIDFKDVANNPALRVKAIDEIRSACHEWGFFQVINHGIPITILDEMIDGIR  119

Query  573   HFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVC  752
              FHEQD  ++K F++RD+KKKV Y SN  L     ANWRD+    ++PDP +P ++P +C
Sbjct  120   RFHEQDVNVRKEFYTRDLKKKVMYYSNVTLFSGQAANWRDTFGFAVSPDPFKPGDVPTIC  179

Query  753   RDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLG  932
             RDI+I+Y+E +  LG+T+FELLSEALGLD  +LK + C+EG FI+GHYYPPCPEP+LTLG
Sbjct  180   RDIVIEYSEKIRGLGFTIFELLSEALGLDPSYLKELNCAEGQFILGHYYPPCPEPELTLG  239

Query  933   LSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHH  1112
              + HTD  F+T+LLQDQLGGLQVLHE+ WV+VP   G+L+VNIGD+LQ++TND+F SV+H
Sbjct  240   TTKHTDGNFMTILLQDQLGGLQVLHENQWVNVPPARGALVVNIGDLLQIITNDRFVSVYH  299

Query  1113  RVLAKPVGPRISVASFFRMHFQ--EGNEAKTYGPIKELLSEEKPAIYR  1250
             RVL++ +GPRISVASFF       EG  +K YGPIKELLSEE P IY+
Sbjct  300   RVLSQNIGPRISVASFFVNSPDPIEGT-SKVYGPIKELLSEENPPIYK  346



>ref|XP_011030520.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Populus euphratica]
Length=364

 Score =   363 bits (932),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 192/338 (57%), Positives = 252/338 (75%), Gaps = 5/338 (1%)
 Frame = +3

Query  243   SIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVI  422
             +   + YDR SE++AF+D+KAGVKGL DAG+TK+PRIF +       N+   AA  +F I
Sbjct  3     TTCDSSYDRISELKAFDDTKAGVKGLVDAGITKVPRIFQHLRDD-SDNTLLVAAEGKFRI  61

Query  423   PVIDFEGL--GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFE  596
             P+ID E +  G  +R EIV+ +++A E WGFF+V+NHGIP +V+ +M + V+ FHEQD E
Sbjct  62    PMIDLEDVHKGPPQRKEIVDRVRNASETWGFFEVVNHGIPVDVLQEMKDGVRRFHEQDVE  121

Query  597   LKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYA  776
             LKK + SRD  +KV YNSNFDL  + +ANWRD+  C+MAP  P PEELP   RDI+I+Y 
Sbjct  122   LKKEYFSRDYTRKVGYNSNFDLFSSPSANWRDTFTCVMAPISPRPEELPATFRDILIEYT  181

Query  777   EHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSg  956
             + VM LG  LF+LLSEALGL+ +HLK + CS+G  I+GHYYP CP+P+LTLG + H+D+ 
Sbjct  182   KEVMKLGNLLFDLLSEALGLNPNHLKDIDCSKGHTILGHYYPACPQPELTLGTTKHSDND  241

Query  957   fltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVG  1136
             FLT+LLQD +GGLQV+H++ WVDV   PG+L++NIGD+LQL++NDKF SV HRVLA  +G
Sbjct  242   FLTVLLQDHIGGLQVMHQNHWVDVSPTPGALLINIGDLLQLISNDKFISVEHRVLANRIG  301

Query  1137  PRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             PRISVASFF  +      ++TYGPIKELLSEE P  YR
Sbjct  302   PRISVASFFSTNLNPN--SRTYGPIKELLSEESPPKYR  337



>ref|XP_002315712.2| hypothetical protein POPTR_0010s08390g [Populus trichocarpa]
 gb|EEF01883.2| hypothetical protein POPTR_0010s08390g [Populus trichocarpa]
Length=364

 Score =   363 bits (932),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 192/340 (56%), Positives = 257/340 (76%), Gaps = 9/340 (3%)
 Frame = +3

Query  243   SIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEK--NSAANAATPQF  416
             +   + YDR SE++AF+D+KAGVKGL DAG+TK+PRIF   H + +   N+   AA  +F
Sbjct  3     TTCDSSYDRISELKAFDDTKAGVKGLVDAGITKVPRIF---HHLRDDSDNTLLVAAEGKF  59

Query  417   VIPVIDFEGL--GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQD  590
              IP+ID E +  G  +R EIV+ +++A E WGFF+V+NHGIP +V+++M + V+ F+EQD
Sbjct  60    RIPMIDLEDVHKGPPQRKEIVDRVRNASETWGFFEVVNHGIPVDVLEEMKDGVRRFYEQD  119

Query  591   FELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIK  770
              ELKK + SRD  +KV YNSNFDL  + +ANWRD+  C+MAP  P PEELP   RDI+I+
Sbjct  120   VELKKEYFSRDHTRKVGYNSNFDLFSSPSANWRDTFTCVMAPISPRPEELPAAFRDILIE  179

Query  771   YAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTD  950
             Y + VM LG +LFELLSEALGL+ +HLK + CS+GL I+GHYYP CP+P+LTLG + H+D
Sbjct  180   YTKEVMKLGNSLFELLSEALGLNPNHLKDIDCSKGLTILGHYYPACPQPELTLGTTKHSD  239

Query  951   SgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKP  1130
             + FLT+LLQD +GGLQV++++ WVDVP  PG+L++NIGD+LQL++NDKF SV HRVLA  
Sbjct  240   NDFLTVLLQDHIGGLQVMYQNHWVDVPPTPGALLINIGDLLQLISNDKFISVEHRVLANR  299

Query  1131  VGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             +GPR+SVASFF  +      ++ YGPIKELLSEE P  YR
Sbjct  300   IGPRVSVASFFSTNLNPN--SRPYGPIKELLSEESPPKYR  337



>ref|XP_006352055.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Solanum tuberosum]
Length=362

 Score =   363 bits (931),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 193/348 (55%), Positives = 252/348 (72%), Gaps = 17/348 (5%)
 Frame = +3

Query  213   TSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSA  392
             TSNN         Q +YD+ SE++AF+D+K GVKGL D G+TK+P+IF++ H  LEK   
Sbjct  3     TSNN--------TQQKYDKISELKAFDDTKGGVKGLIDGGITKLPQIFIHPHDSLEKI--  52

Query  393   ANAATPQFVIPVIDFEGLGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQ  572
                    F+ P+ID + +  N + EIV  I++A E WGFFQVINHGIP  V+D+ML   +
Sbjct  53    --PKNSNFIFPLIDLQNININNK-EIVKQIQEASETWGFFQVINHGIPIPVLDEMLRGTR  109

Query  573   HFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAAT--ANWRDSLYCIMAPDPPEPEELPN  746
              FHEQ  ++KKP++SRDV +KV YN NF+L    +  A+WRDSLY +MAP+P +P+ELP 
Sbjct  110   RFHEQAIDVKKPYYSRDVARKVMYNCNFELFSEKSFAADWRDSLYSVMAPNPAKPDELPE  169

Query  747   VCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLT  926
              CR+I+I+Y+ HVM LGYTL EL SE LGL  +HLK MGC+EGL I+ +YYP CP+P+L 
Sbjct  170   TCREIIIEYSNHVMKLGYTLVELFSEGLGLKQNHLKEMGCAEGLGILCNYYPKCPQPELA  229

Query  927   LGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSV  1106
             LG S H DS F T+LLQD +GGLQVLH++ WVDVP   G+LI+NIGD+LQL++NDK+KSV
Sbjct  230   LGSSRHADSDFFTVLLQDDIGGLQVLHKNQWVDVPPIHGALIINIGDILQLISNDKYKSV  289

Query  1107  HHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              HRVLA  +GPRISVASFF     E   ++ YGPI+ELLS++ P  YR
Sbjct  290   DHRVLANTIGPRISVASFFSTGLLES--SRIYGPIEELLSKDNPPKYR  335



>ref|XP_010262287.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Nelumbo nucifera]
Length=372

 Score =   363 bits (931),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 187/334 (56%), Positives = 248/334 (74%), Gaps = 5/334 (1%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVID  434
             +++DR  E++ F+DSKAGVKGL D+G+ K+PRIF++  S+        ++  +  IPVID
Sbjct  15    SDFDRMKELKEFDDSKAGVKGLVDSGIVKVPRIFIDP-SLKSDEKLVISSEKRSTIPVID  73

Query  435   FEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKP  608
               G+  +  RR ++V+ ++ A   WGFFQV+NHGIP +V+D++L+ V+ F+EQD +++K 
Sbjct  74    LSGIHEDAVRRKDVVDQVRHASGTWGFFQVVNHGIPTSVLDEILQGVRRFNEQDVDVRKR  133

Query  609   FHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVM  788
             F+SRD KKKV YNSNF L  +A ANWRD+LYC+M+P+PP PEE+P VCRDIMI+Y+  V 
Sbjct  134   FYSRDTKKKVVYNSNFVLYQSAAANWRDTLYCVMSPNPPSPEEIPQVCRDIMIQYSGQVE  193

Query  789   SLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltl  968
              L  TL ELLSEAL L   HL  MGC+E   I+ HYYP CPEP+LT+G S H D+ F+T+
Sbjct  194   RLAVTLLELLSEALMLKPSHLVDMGCAESHAILCHYYPACPEPELTMGTSKHADNDFMTI  253

Query  969   llqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRIS  1148
             LLQDQ+GGLQVLH++ WVDVP   G+L+VNIGD+LQL++ND+ +SV HRV+A  VGPR+S
Sbjct  254   LLQDQIGGLQVLHQNHWVDVPPLRGALVVNIGDLLQLISNDRLRSVEHRVVANNVGPRVS  313

Query  1149  VASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             VA FF    QE    K YGPIKELLSEE P IYR
Sbjct  314   VACFFPTSVQES--IKRYGPIKELLSEENPPIYR  345



>ref|NP_172147.2| 2-oxoglutarate-dependent dioxygenase-like protein [Arabidopsis 
thaliana]
 sp|Q84MB3.1|ACCH1_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate oxidase homolog 
1 [Arabidopsis thaliana]
 gb|AAP21238.1| At1g06620 [Arabidopsis thaliana]
 dbj|BAE99663.1| oxidoreductase like protein [Arabidopsis thaliana]
 gb|AEE28010.1| 2-oxoglutarate-dependent dioxygenase-like protein [Arabidopsis 
thaliana]
Length=365

 Score =   362 bits (929),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 192/341 (56%), Positives = 246/341 (72%), Gaps = 7/341 (2%)
 Frame = +3

Query  237   EDSIMQ-AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQ  413
             E S+ Q A  DR + ++AF+++K GVKGL DAG+T+IP IF    + L   S    ++  
Sbjct  2     ESSLPQVAALDRSTLLKAFDETKTGVKGLIDAGITEIPSIFRAPPATL--TSPKPPSSSD  59

Query  414   FVIPVIDFEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQ  587
             F IP ID +G G +   R  +V  I DA E WGFFQVINHGIP +V++KM++ ++ FHEQ
Sbjct  60    FSIPTIDLKGGGTDSITRRSLVEKIGDAAEKWGFFQVINHGIPMDVLEKMIDGIREFHEQ  119

Query  588   DFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMI  767
             D E+KK F+SRD   K+ Y+SNFDL  +  ANWRD+L C  APDPP PE+LP  C ++MI
Sbjct  120   DTEVKKGFYSRDPASKMVYSSNFDLFSSPAANWRDTLGCYTAPDPPRPEDLPATCGEMMI  179

Query  768   KYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHT  947
             +Y++ VM LG  LFELLSEALGL+ +HLK M C+  L ++GHYYPPCP+PDLTLGL+ H+
Sbjct  180   EYSKEVMKLGKLLFELLSEALGLNTNHLKDMDCTNSLLLLGHYYPPCPQPDLTLGLTKHS  239

Query  948   DSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAK  1127
             D+ FLT+LLQD +GGLQVLH+  WVDVP  PG+L+VN+GD+LQL+TNDKF SV HRVLA 
Sbjct  240   DNSFLTILLQDHIGGLQVLHDQYWVDVPPVPGALVVNVGDLLQLITNDKFISVEHRVLAN  299

Query  1128  PVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
               GPRISVA FF  +       + YGPIKE+LSEE P  YR
Sbjct  300   VAGPRISVACFFSSYLMA--NPRVYGPIKEILSEENPPNYR  338



>ref|XP_010556890.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Tarenaya hassleriana]
Length=361

 Score =   362 bits (928),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 188/336 (56%), Positives = 245/336 (73%), Gaps = 10/336 (3%)
 Frame = +3

Query  252   QAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATP-QFVIPV  428
               E+DR  E++AF+++KAGVKGL D+G+T+IPRIF      ++  + A+   P    IP 
Sbjct  6     SGEFDRAKELKAFDETKAGVKGLVDSGITEIPRIFH-----IQPGTLADRKPPLPLAIPT  60

Query  429   IDFEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELK  602
             ID EG   +   R  +V  +++A E WGFFQVINHG+P +V+++M + V+ FHE+D E K
Sbjct  61    IDLEGAFKDEFSRKNVVEDVRNAAEKWGFFQVINHGVPLSVLEEMKDGVRRFHEEDLEAK  120

Query  603   KPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEH  782
             K + SRD   ++ YNSNFDL  + +ANWRD+L C +APDPP+PE++P+ CRD+M++Y++H
Sbjct  121   KRYFSRDYTNRLGYNSNFDLYSSPSANWRDTLSCYIAPDPPKPEDMPDSCRDVMMEYSKH  180

Query  783   VMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfl  962
             VM+LG  LFELLSEALGL+ + LK M C++GLF++ HYYPPCP+PDLTLG S HTDS F+
Sbjct  181   VMNLGNLLFELLSEALGLNPETLKDMDCAKGLFVLSHYYPPCPQPDLTLGTSKHTDSSFI  240

Query  963   tlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPR  1142
             T+LLQD +GGLQV H+D WVDVP  PG+L+VN GD LQLLTNDKF S  HRVLA   GPR
Sbjct  241   TVLLQDHIGGLQVSHQDCWVDVPPVPGALVVNFGDFLQLLTNDKFISAEHRVLANRAGPR  300

Query  1143  ISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             ISVA FF          + YGPIKELLSEE P  YR
Sbjct  301   ISVACFFSTGVLPN--PRVYGPIKELLSEENPPKYR  334



>ref|NP_001234624.1| 2-oxoglutarate-dependent dioxygenase [Solanum lycopersicum]
 dbj|BAD98961.1| 2-oxoglutarate-dependent dioxygenase [Solanum lycopersicum]
Length=364

 Score =   362 bits (928),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 184/338 (54%), Positives = 251/338 (74%), Gaps = 7/338 (2%)
 Frame = +3

Query  243   SIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVI  422
             S  Q  YD+ SE++AF+D+KAGVKGL D+G+TK+P+IF++  ++  +N   N     F+ 
Sbjct  4     SNTQQSYDKTSELKAFDDTKAGVKGLIDSGITKVPQIFIHPEAL--ENKTTNPKNTHFIF  61

Query  423   PVIDFEGLGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELK  602
             P+ID + +  N + EIV  I++A E WGFFQVINHGIP  V+D+ML   + FH+QD ++K
Sbjct  62    PLIDLQNISINNK-EIVKQIQEASETWGFFQVINHGIPVPVLDEMLRGARRFHDQDIDVK  120

Query  603   KPFHSRDVKKKVTYNSNFDLLV--AATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYA  776
             KP++SRD+ +KV YN NFDL    +  ANWRDSLY +MAP+P  PEE+P  CR+I I+Y+
Sbjct  121   KPYYSRDIARKVMYNCNFDLFSEKSLAANWRDSLYSVMAPNPATPEEIPETCREITIEYS  180

Query  777   EHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSg  956
              +VM+LGYTL EL SE LGL  +HLK MGC+EGL I+ +YYP CP+P++ +G S H D+ 
Sbjct  181   NYVMNLGYTLLELFSEGLGLKPNHLKEMGCAEGLGILCNYYPKCPQPEIAIGTSRHADND  240

Query  957   fltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVG  1136
             F T+LLQD +GGLQVLH++ WVDVP   G+L+VNIGD+LQL++NDK+KSV HRVLA  +G
Sbjct  241   FFTVLLQDDIGGLQVLHKNQWVDVPPTHGALVVNIGDILQLISNDKYKSVVHRVLANTIG  300

Query  1137  PRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             PRIS+ASFF       + ++ YGPI+ELLS++ P  YR
Sbjct  301   PRISIASFFST--GPFSTSRIYGPIEELLSKDNPPKYR  336



>ref|XP_006489565.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Citrus sinensis]
Length=360

 Score =   361 bits (926),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 187/333 (56%), Positives = 246/333 (74%), Gaps = 6/333 (2%)
 Frame = +3

Query  258   EYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDF  437
             +YDR SE++AF+D+KAGVKGL DAG+ +IPRIF      L+K         Q+  P +D 
Sbjct  5     QYDRESELKAFDDTKAGVKGLVDAGIDRIPRIFYQPTDSLDKTPVPRDV--QYTFPTVDL  62

Query  438   EGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPF  611
             +G+  +  +R EIV  ++ A E  GFFQVINHGIP + ++++ E V+ F EQDFELKK F
Sbjct  63    QGVDKDPIQRKEIVERVRKASETSGFFQVINHGIPVSFLEELKEGVRRFFEQDFELKKEF  122

Query  612   HSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMS  791
             ++RD+ K V YNSNFDL  A  ANWRD++   MAP+PP+PEE+P  CRDI+++Y + VM 
Sbjct  123   YTRDITKMVGYNSNFDLYSAPAANWRDTILFNMAPNPPKPEEMPAACRDIVMEYTKSVMK  182

Query  792   LGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltll  971
             LG+ LFELLSEALGL+ ++LKGM C+EGL ++GHYYP CP+P+LT+G + H D  F+T+L
Sbjct  183   LGHLLFELLSEALGLNPNYLKGMDCAEGLMLLGHYYPACPQPELTMGATEHADDDFVTVL  242

Query  972   lqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISV  1151
             LQD +GGLQV +++ W+DVP  PG+L++NIGD+LQL++NDKF S  HRVLA  VGPRISV
Sbjct  243   LQDHIGGLQVRYQNHWIDVPPSPGALVINIGDLLQLISNDKFISAEHRVLANRVGPRISV  302

Query  1152  ASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             ASFF    Q    +K YGPIKELLSEE P  YR
Sbjct  303   ASFFSPKRQPS--SKLYGPIKELLSEENPPKYR  333



>ref|XP_006354553.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Solanum tuberosum]
Length=382

 Score =   362 bits (928),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 206/364 (57%), Positives = 257/364 (71%), Gaps = 28/364 (8%)
 Frame = +3

Query  207   VDTSNNGNLQ-EDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEK  383
             +D +NNG  Q  DS   +EYDR+SEV+AF+DSK GVKGL DAG+TK+PRIFL+   ++EK
Sbjct  1     MDGTNNGRTQLHDS---SEYDRKSEVQAFDDSKVGVKGLLDAGITKLPRIFLHNQPVIEK  57

Query  384   NSAANAATPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKM  557
              S +NA   +  IPVIDFEGLG    ++ +IV  IKDA ENWGFFQ+++H IP  VM+K+
Sbjct  58    KSDSNAVN-KLSIPVIDFEGLGKTAVQQADIVREIKDASENWGFFQIVHHEIPSRVMEKV  116

Query  558   LESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEE  737
             LE V HFHEQD E+KK F+ RDV +K TYN+N+DL  A+TANWRD+LYC+MAP+PP    
Sbjct  117   LEGVHHFHEQDSEVKKKFYFRDVTRKFTYNTNYDLHKASTANWRDTLYCVMAPNPPRNSR  176

Query  738   LPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGL---FIIGHYY---  899
                      ++YA+   +   T  +L      +D+     +G S      F  G  +   
Sbjct  177   --------GLQYADASPTSDTTALQLYPIMHLMDMMERTLLGTSFTAVTSFESGREHSAG  228

Query  900   -------PPCPEPDLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVN  1058
                    P CPEP+ TLGLS HTDSGFLT+LLQDQ+GGLQV HE+ WVDVPF PG+LIVN
Sbjct  229   DQLQTNNPACPEPEFTLGLSGHTDSGFLTILLQDQIGGLQVFHENKWVDVPFLPGALIVN  288

Query  1059  IGDMLQLLTNDKFKSVHHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKP  1238
             IGD++QL+TNDKF SV HRVLAK VGPRISVAS FRM FQEG+E++ YGPIKELLSEE P
Sbjct  289   IGDLMQLITNDKFNSVLHRVLAKNVGPRISVASLFRMQFQEGSESRLYGPIKELLSEENP  348

Query  1239  AIYR  1250
              +YR
Sbjct  349   PMYR  352



>ref|XP_007140620.1| hypothetical protein PHAVU_008G127500g [Phaseolus vulgaris]
 gb|ESW12614.1| hypothetical protein PHAVU_008G127500g [Phaseolus vulgaris]
Length=365

 Score =   361 bits (926),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 188/344 (55%), Positives = 256/344 (74%), Gaps = 10/344 (3%)
 Frame = +3

Query  219   NNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAAN  398
             N+  L+E  I+ + YDR+ EV+ F+DSKAGV+GL ++G+TKIPR+F +++  + + SA +
Sbjct  5     NSNQLEE--IVDSTYDRKDEVKRFDDSKAGVQGLVESGVTKIPRMFHSENLDIIETSATD  62

Query  399   AATPQFVIPVIDFEGLGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHF  578
             ++     +P+ID + +      E++  I+ AC  WGFFQVINHGI  +V+D+M++ ++ F
Sbjct  63    SS---LKVPIIDLKDINSTLHTEVIEKIRSACHEWGFFQVINHGISISVLDEMIDGIRRF  119

Query  579   HEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRD  758
             HEQD E++K F+SRDVKKKV Y SN  L    +ANWRD+     APD  +PEELP+VCRD
Sbjct  120   HEQDTEIRKEFYSRDVKKKVLYYSNLSLFSGQSANWRDTFGFAAAPDQAKPEELPSVCRD  179

Query  759   IMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLS  938
             I+I+Y++ +  LG+T+FELLSEALGLD  +LK   C+EGLFI+GHYYP CPEP+LT+G +
Sbjct  180   ILIEYSKKIRDLGFTIFELLSEALGLDASYLKEFNCAEGLFILGHYYPACPEPELTMGTT  239

Query  939   SHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRV  1118
              HTDS F+TLLLQDQLGGLQVLH++ W++VP   G+L+VN+GD+LQL+TND+F SV+HRV
Sbjct  240   KHTDSNFMTLLLQDQLGGLQVLHQNQWINVPPVHGALVVNMGDLLQLITNDRFVSVYHRV  299

Query  1119  LAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             L    GPR+SVASF    F    + K Y PIKELLSEE P IYR
Sbjct  300   LPN-TGPRVSVASF----FVNSRDTKVYCPIKELLSEENPPIYR  338



>ref|XP_009379006.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Pyrus x bretschneideri]
Length=368

 Score =   360 bits (925),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 189/337 (56%), Positives = 250/337 (74%), Gaps = 12/337 (4%)
 Frame = +3

Query  264   DRRSEVEAFEDSKAGVKGLFDAGLTKIPRIF-----LNKHSILEKNSAANAATPQFVIPV  428
             DR+SEV+AF+D+K GVKGL DAG+T++PRIF     L+ H I  KNS++++   QF IPV
Sbjct  9     DRKSEVKAFDDTKEGVKGLVDAGITEVPRIFHQPPELDDHYI--KNSSSDSEARQFSIPV  66

Query  429   IDFEGL---GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFEL  599
             ID +GL      +R EIV  + +A E WGFFQ++NHGIP +V++++ + V+ F EQD ++
Sbjct  67    IDLQGLELGSPTKRNEIVAKVGEASETWGFFQIVNHGIPVDVLEEIKDGVRGFFEQDTQV  126

Query  600   KKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAE  779
             KK  ++RD  K + YNSNFDL  A   NWRD+  C +AP+P +PE+LP VCRDI+++Y++
Sbjct  127   KKELYTRDPLKPLVYNSNFDLYSAPATNWRDTFLCYVAPNPTKPEDLPQVCRDILVEYSK  186

Query  780   HVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgf  959
             HVM LG  LFELLSEALGL   HL  M C+EGL I+GHYYP CP+P+LT+G S H D+ F
Sbjct  187   HVMKLGKLLFELLSEALGLKPSHLNDMDCNEGLLILGHYYPSCPQPELTMGTSKHADNDF  246

Query  960   ltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGP  1139
             +T+LLQD +GGLQVLH+  WVDVP  PG+L+VNIGD+LQL++ND+FKS+ HRVLA  VGP
Sbjct  247   ITVLLQDHIGGLQVLHQRKWVDVPPVPGALVVNIGDLLQLISNDRFKSIQHRVLANCVGP  306

Query  1140  RISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             RISVASFF          K YGPIKEL+S++ P  Y+
Sbjct  307   RISVASFFCTGMLPS--TKLYGPIKELVSKDNPPKYK  341



>ref|XP_011091183.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X1 [Sesamum indicum]
Length=401

 Score =   361 bits (927),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 184/334 (55%), Positives = 240/334 (72%), Gaps = 5/334 (1%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVID  434
             ++ DR  E+ AF+D+KAGVKGL DAG+  +P+IFL   +   K+   + A   F IPVID
Sbjct  44    SKLDRARELRAFDDTKAGVKGLVDAGVENVPQIFLLPRNN-TKSGTGDTAKVNFTIPVID  102

Query  435   FEG--LGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKP  608
              +G  +    R EIV+ I+ A E WGFFQV+NHGIP  V+++ML  V+ F+EQD  +KK 
Sbjct  103   LQGVEIDSTLRQEIVHRIRHASETWGFFQVVNHGIPVGVLEEMLRGVRRFNEQDVGVKKQ  162

Query  609   FHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVM  788
             F++RDV +K  +NSNFDL  +  ANWRD+ +C MAP PP+P+ELP  CRDI I+Y+ HVM
Sbjct  163   FYTRDVSRKFVFNSNFDLYASPAANWRDTFFCFMAPTPPQPQELPASCRDIQIEYSRHVM  222

Query  789   SLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltl  968
             +LG  LF LLSEALGL+   L  M C+ GL  +GHYYP CP+P+LTLG S HTD GFLT+
Sbjct  223   TLGVRLFGLLSEALGLETSRLTNMDCANGLAFVGHYYPSCPQPELTLGASKHTDDGFLTV  282

Query  969   llqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRIS  1148
             +LQD +GGLQ+  E+ W+DVP  PG+L++NIGD+LQL++NDKFKSV HRVLA   GPR+S
Sbjct  283   VLQDHIGGLQIFAENQWIDVPPVPGALVINIGDLLQLISNDKFKSVEHRVLANREGPRVS  342

Query  1149  VASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             VA FF         +K YGPI++LLSE+ PA YR
Sbjct  343   VACFFSTALMP--SSKLYGPIQDLLSEDNPAKYR  374



>ref|XP_006341092.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X2 [Solanum tuberosum]
Length=364

 Score =   360 bits (924),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 187/335 (56%), Positives = 249/335 (74%), Gaps = 7/335 (2%)
 Frame = +3

Query  252   QAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVI  431
             +A+YDR++E++AF+++KAGVKGL DAG+TK+PRIF+   +I +    +N    +F  P+I
Sbjct  8     EAKYDRKAELQAFDETKAGVKGLVDAGITKVPRIFVQPSTIEDSTIHSNK---KFSFPII  64

Query  432   DFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKK  605
             DF+G+  +  +R +IV  +  A E WGFFQVINHGIP +VM++M + V  F EQD E+KK
Sbjct  65    DFDGIKEDLIKRKKIVQEVGQASETWGFFQVINHGIPSHVMEEMKDGVIRFFEQDTEVKK  124

Query  606   PFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
              +++RD  K   YNSNFDL  A   NWRD+   I+AP PP PE LP+VCRD++++Y   V
Sbjct  125   QWYTRDFIKVFQYNSNFDLFGAPVTNWRDTFTAIIAPTPPNPEILPSVCRDVLLEYTNQV  184

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgflt  965
             + LG TLF +LSEA+GL+ +HLK MGC+EGL  +GHYYP CP+P+LTLG S H D+ FLT
Sbjct  185   IKLGDTLFGILSEAIGLEPNHLKDMGCAEGLMALGHYYPECPQPELTLGTSKHADNDFLT  244

Query  966   lllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRI  1145
             +LLQD +GGLQVLH++ WVDVP  PG+L+VNIGD+LQL++NDKFKSV HRVLA  VGPR+
Sbjct  245   VLLQDNIGGLQVLHQNHWVDVPPTPGALVVNIGDILQLISNDKFKSVDHRVLANKVGPRV  304

Query  1146  SVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             S+A FF  +F      + YGPIKEL+SE  P  YR
Sbjct  305   SLACFFMTNFVP--TQRLYGPIKELISEHNPPKYR  337



>ref|XP_002529299.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
 gb|EEF33068.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
Length=652

 Score =   370 bits (949),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 199/335 (59%), Positives = 254/335 (76%), Gaps = 6/335 (2%)
 Frame = +3

Query  252   QAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVI  431
             + +YDR+SE++ F+D+KAGVKGL DAG+TKIPRIF++     +          +  IP+I
Sbjct  11    EIKYDRKSELKIFDDTKAGVKGLVDAGVTKIPRIFIHD----KITDTPFEGNDKHTIPII  66

Query  432   DFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKK  605
             D +G+  +   R E+++ +++ACE WGFFQ+INHGIP  VMD+M++ ++ FHEQ+ E+KK
Sbjct  67    DLKGIDKDPSLRREVIDKLREACEKWGFFQLINHGIPATVMDEMIDGMRRFHEQETEVKK  126

Query  606   PFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
              F +RD  +KV YN+NFD   A  ANWRDSLYC MAP+PP PEELP VCRDIM+ Y+  V
Sbjct  127   HFFTRDETRKVIYNTNFDFYQAKAANWRDSLYCSMAPNPPNPEELPPVCRDIMMDYSNKV  186

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgflt  965
             MSLG  LFELLSEALGL  +HLK MGC+EGL+ IGHYYP CPEP LTLG + HTDS FLT
Sbjct  187   MSLGLKLFELLSEALGLRPNHLKDMGCAEGLYFIGHYYPACPEPGLTLGATKHTDSAFLT  246

Query  966   lllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRI  1145
             +LLQD LGGLQVLHED W DV    G L+VN+GD+ QL++NDKFKSV+HRVLAK VGPRI
Sbjct  247   ILLQDILGGLQVLHEDQWFDVTPVAGGLVVNLGDLSQLISNDKFKSVYHRVLAKDVGPRI  306

Query  1146  SVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             S+A FFR HF E   ++ + PIK+LLS++ P +YR
Sbjct  307   SIACFFRTHFAERTSSRIFAPIKQLLSKDNPPVYR  341


 Score =   273 bits (699),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 143/278 (51%), Positives = 203/278 (73%), Gaps = 4/278 (1%)
 Frame = +3

Query  420   IPVIDFEGLGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFEL  599
             +PVID +GL  ++R +IV+ +++A E WGFF V+NHGIP +++  M+++V+ F+EQD ++
Sbjct  373   LPVIDLDGLLTDQRRKIVDQVRNASEEWGFFHVVNHGIPSSLLSNMIDAVRKFNEQDIDV  432

Query  600   KKPFHSRDVKKKVTYNSNFDLLVAATANWRDSL-YCIMAPDPPEPEELPNVCRDIMIKYA  776
             KK F+SRD  ++V +NSN+DL  +  A+WRD+L   ++  D  +P ELP +CRD  +++ 
Sbjct  433   KKEFYSRDTSRRVRFNSNYDLFQSERADWRDTLSVSMLRSDHIDPNELPAICRDEALEFI  492

Query  777   EHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSg  956
             E +  +G TLFELLSEALGL  +HL  + C +G  ++ HYYP CPEP+L +G++ HTD+ 
Sbjct  493   EQIGKIGDTLFELLSEALGLKPNHLNSIECHKGRTLVCHYYPACPEPELAMGVTKHTDNT  552

Query  957   fltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVG  1136
             FLT+L++D+ GGLQVLH++ WVDV   PGSL+VNIGD+LQ+++NDKFKS  HRVL   V 
Sbjct  553   FLTVLVEDETGGLQVLHDNQWVDVQPIPGSLVVNIGDLLQIVSNDKFKSNVHRVLPSKV-  611

Query  1137  PRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             PRISV  FF         A+ YGPIKELLSEE PA Y+
Sbjct  612   PRISVIGFFAGRV--APPARLYGPIKELLSEENPAKYK  647



>ref|XP_004246497.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Solanum lycopersicum]
Length=370

 Score =   360 bits (923),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 184/335 (55%), Positives = 247/335 (74%), Gaps = 7/335 (2%)
 Frame = +3

Query  252   QAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVI  431
             +A+YDR++E++AF+++K GVKGL D G+TK+PR+F+    I +    +N    +F  P+I
Sbjct  14    EAKYDRKAELQAFDETKTGVKGLVDTGITKVPRMFVQPSRIEDSTIHSNK---KFSFPII  70

Query  432   DFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKK  605
             D +G+  N  +R  IV  +  A E WGFFQVINHGIP +++++M + V  F EQD E KK
Sbjct  71    DLDGIKENSIKRKNIVQEVGQASETWGFFQVINHGIPSHLLEEMKDGVLSFFEQDTEEKK  130

Query  606   PFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
              +++RD+ K  T+NSNFDL  A   NWRD+     AP PP+PEELP+VCRD++++Y   V
Sbjct  131   QWYTRDLTKVFTFNSNFDLFGAPVTNWRDTFTATTAPIPPKPEELPSVCRDVLLEYTNQV  190

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgflt  965
             M LG TLFE+L+EA+GL+ +HLK MGC+EGL  +GHYYP CP+P+LTLG S H D+ FLT
Sbjct  191   MKLGDTLFEILAEAIGLEPNHLKDMGCAEGLMALGHYYPACPQPELTLGTSKHADNDFLT  250

Query  966   lllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRI  1145
             +LLQD +GGLQVLH++ WVDVP  PG+L+VNIGD+LQL+TNDKFKSV HRVLA  VGPR+
Sbjct  251   VLLQDNVGGLQVLHQNHWVDVPPTPGALVVNIGDILQLITNDKFKSVDHRVLANKVGPRV  310

Query  1146  SVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             S+A FF  +F      + YGPIKEL+SE+ P  YR
Sbjct  311   SLACFFMTNFVATQ--RLYGPIKELISEQNPPNYR  343



>ref|XP_011091186.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Sesamum indicum]
Length=374

 Score =   360 bits (924),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 195/346 (56%), Positives = 253/346 (73%), Gaps = 8/346 (2%)
 Frame = +3

Query  219   NNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAAN  398
             NN N    +  +  YDR+SE++AF+D+KAGVKGL DAG+T++PRIF +    LE  +  +
Sbjct  5     NNINGGNQAATEPNYDRQSELKAFDDTKAGVKGLVDAGITRVPRIFHHPPQNLENITKKS  64

Query  399   AATPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQ  572
                 +F  PVID +G+  +  +R EI++ I DA E WGFFQVINHGI  + +++M++ V+
Sbjct  65    ----EFRFPVIDLDGVNHDCLKRKEIIDRILDASETWGFFQVINHGIDVSTLEEMVDGVR  120

Query  573   HFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVC  752
              FHE D E KK +HSRD  KK+ YNSNFDL  +  A+WRDS  CIMAPDPP+P+ELP+ C
Sbjct  121   RFHE-DTETKKQYHSRDFTKKMIYNSNFDLFSSPAASWRDSFNCIMAPDPPQPDELPSSC  179

Query  753   RDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLG  932
             R+I++KY++ VM LG TLF+LLSEALGL  DHL  + C++ L + GHYYPPCPEP LTLG
Sbjct  180   REILMKYSDQVMELGITLFKLLSEALGLHPDHLIDIDCAQTLAVFGHYYPPCPEPQLTLG  239

Query  933   LSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHH  1112
                H+D GFLT+LLQD LGGLQVLH++ WVDVP  PG+L+VNI D+LQL++NDK KSV H
Sbjct  240   TPKHSDYGFLTVLLQDNLGGLQVLHQNQWVDVPPLPGALVVNIADLLQLISNDKLKSVEH  299

Query  1113  RVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             RVL    GPRISVA+FF      G  ++ YGPIKELLS++ P  YR
Sbjct  300   RVLVSRSGPRISVAAFFGRD-TCGVNSREYGPIKELLSDKNPPKYR  344



>ref|XP_003635549.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Vitis vinifera]
Length=368

 Score =   360 bits (923),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 185/337 (55%), Positives = 256/337 (76%), Gaps = 8/337 (2%)
 Frame = +3

Query  249   MQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLN-KHSILEKNSAANAATPQFVIP  425
             M +EYDR+SE+ AF+DSKAGVKGL DAG+ KIPR+F++ +H++ EK+ + NA   Q  IP
Sbjct  10    MDSEYDRKSELIAFDDSKAGVKGLVDAGVAKIPRMFIHPQHNLREKSVSTNA---QLRIP  66

Query  426   VIDFEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFEL  599
             +ID EG+  +   R +I++ +++ACE WG FQ++NHGI   V+++M++ ++ F+EQD E+
Sbjct  67    IIDLEGVNSDAILRAKIIDKVRNACEIWGIFQIVNHGILKCVLEEMIKGIRRFNEQDTEV  126

Query  600   KKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAE  779
             KK F++RD  KKVT+ SNFDL  A  A W+DS  CI+AP+PP+P ++P VCRDI+++Y++
Sbjct  127   KKEFYTRDFSKKVTFVSNFDLFQAPAATWKDSFSCIIAPNPPDPTDMPAVCRDIIMEYSK  186

Query  780   HVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgf  959
              V  L  TLFEL++EALGL+ +HLK M C+EGLF++ HYYP CPEP+LT+G  +HTD  F
Sbjct  187   QVKMLANTLFELVAEALGLNSNHLKDMECAEGLFLVSHYYPACPEPELTMGTKTHTDPTF  246

Query  960   ltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGP  1139
             LT+LLQDQ+GGLQVLHE  WV+V   PG+L++N GD+LQL++ND F+S  HRVLA   GP
Sbjct  247   LTVLLQDQVGGLQVLHEKQWVNVNPVPGALVINTGDLLQLVSNDMFRSAKHRVLANHKGP  306

Query  1140  RISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             R+SVASFF         +K YGPIKELLSE+ P  Y+
Sbjct  307   RVSVASFFSPFSLPS--SKLYGPIKELLSEDNPPKYK  341



>ref|XP_009626886.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Nicotiana tomentosiformis]
Length=372

 Score =   360 bits (923),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 190/352 (54%), Positives = 255/352 (72%), Gaps = 11/352 (3%)
 Frame = +3

Query  207   VDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKN  386
             +D SN    Q  +  Q  YD++SE++AF+D+KAGVKGL D G+TK+PRIF++  + LE  
Sbjct  1     MDVSNTK--QNLATSQPNYDKQSELKAFDDTKAGVKGLIDVGITKVPRIFIHPEA-LENP  57

Query  387   SAANAATPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKML  560
             S+    +  F+ P+ID + +  +  +  EIV+ I+DA E WGFFQVINHGIP +V+D+ML
Sbjct  58    SSPKITS--FIFPLIDLQNMNKDPIKHKEIVSKIRDAAETWGFFQVINHGIPVSVLDEML  115

Query  561   ESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLV--AATANWRDSLYCIMAPDPPEPE  734
                + FHEQ+ ++KKP++SRDV +KV YN NFDL    A  ANWRDSLY +MAP P +PE
Sbjct  116   RGARRFHEQEIDVKKPYYSRDVARKVMYNCNFDLFSEKALAANWRDSLYSVMAPTPAKPE  175

Query  735   ELPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPE  914
             ELP  CR+I+I+Y++HVM LG  L ELLSE +GL  +HLK M C+EGL I+ +YYP CP+
Sbjct  176   ELPETCREIVIEYSDHVMKLGCNLLELLSEGVGLKPNHLKEMDCAEGLGILCNYYPACPQ  235

Query  915   PDLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDK  1094
             P+L +G S H D+ F T+LLQD  GGLQV H++ WVDVP  PG+L++NIGD+LQL++NDK
Sbjct  236   PELAIGTSRHADNDFFTVLLQDDFGGLQVFHQNHWVDVPPTPGALVINIGDILQLISNDK  295

Query  1095  FKSVHHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             +KS+ HRVL   VGPRIS+ASFF         ++ YGPI+ELLSE+ P  YR
Sbjct  296   YKSIEHRVLTNKVGPRISIASFFGT--GPLASSRIYGPIEELLSEDNPPKYR  345



>ref|XP_003623991.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
 gb|AES80209.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=373

 Score =   360 bits (923),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 191/348 (55%), Positives = 265/348 (76%), Gaps = 10/348 (3%)
 Frame = +3

Query  219   NNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAAN  398
             N+  L+E S     YDR +EV+AF+DSK GVKGL D+G++KIPR+F  +   + +++A++
Sbjct  5     NSNQLKESS--DFTYDREAEVKAFDDSKVGVKGLVDSGVSKIPRMFYTRKLEISESTASD  62

Query  399   AATPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQ  572
             +   +  IP++D + +  N  +RVE+++ I+ AC  WGFFQVINH IP  V+D+M++ + 
Sbjct  63    S---KLSIPIVDLKDIHINPAQRVEVIDQIRSACHEWGFFQVINHEIPIIVLDEMIDGIC  119

Query  573   HFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVC  752
              FHEQD +++K F++RD+KKKV+Y SN  L     ANWRD+    +APDP  P+E+P +C
Sbjct  120   RFHEQDADVRKEFYTRDLKKKVSYYSNVRLFNGQGANWRDTFGFAIAPDPFNPDEVPQIC  179

Query  753   RDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLG  932
             RDI+I+Y++ + +LG+T+FELLSEALGL+  +LK  GC+EGLF +GH+YP CPEP+LT+G
Sbjct  180   RDIVIEYSQKIKNLGFTIFELLSEALGLNPSYLKEFGCAEGLFTLGHFYPTCPEPELTMG  239

Query  933   LSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHH  1112
              ++HTDS F+TLLLQDQLGGLQVLHED WV+VP   G+L+VNIGD+LQL++NDKF SV H
Sbjct  240   STAHTDSTFMTLLLQDQLGGLQVLHEDKWVNVPPVHGALVVNIGDLLQLISNDKFVSVLH  299

Query  1113  RVLAKPVGPRISVASFFRMHFQ--EGNEAKTYGPIKELLSEEKPAIYR  1250
             RVL++ +GPRISVASFF       EG  +K YGPIKEL+SEE PAIY+
Sbjct  300   RVLSQNIGPRISVASFFLNSRDPIEGT-SKIYGPIKELISEENPAIYK  346



>ref|XP_011091184.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X2 [Sesamum indicum]
Length=373

 Score =   360 bits (923),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 184/334 (55%), Positives = 240/334 (72%), Gaps = 5/334 (1%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVID  434
             ++ DR  E+ AF+D+KAGVKGL DAG+  +P+IFL   +   K+   + A   F IPVID
Sbjct  16    SKLDRARELRAFDDTKAGVKGLVDAGVENVPQIFLLPRNN-TKSGTGDTAKVNFTIPVID  74

Query  435   FEG--LGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKP  608
              +G  +    R EIV+ I+ A E WGFFQV+NHGIP  V+++ML  V+ F+EQD  +KK 
Sbjct  75    LQGVEIDSTLRQEIVHRIRHASETWGFFQVVNHGIPVGVLEEMLRGVRRFNEQDVGVKKQ  134

Query  609   FHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVM  788
             F++RDV +K  +NSNFDL  +  ANWRD+ +C MAP PP+P+ELP  CRDI I+Y+ HVM
Sbjct  135   FYTRDVSRKFVFNSNFDLYASPAANWRDTFFCFMAPTPPQPQELPASCRDIQIEYSRHVM  194

Query  789   SLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltl  968
             +LG  LF LLSEALGL+   L  M C+ GL  +GHYYP CP+P+LTLG S HTD GFLT+
Sbjct  195   TLGVRLFGLLSEALGLETSRLTNMDCANGLAFVGHYYPSCPQPELTLGASKHTDDGFLTV  254

Query  969   llqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRIS  1148
             +LQD +GGLQ+  E+ W+DVP  PG+L++NIGD+LQL++NDKFKSV HRVLA   GPR+S
Sbjct  255   VLQDHIGGLQIFAENQWIDVPPVPGALVINIGDLLQLISNDKFKSVEHRVLANREGPRVS  314

Query  1149  VASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             VA FF         +K YGPI++LLSE+ PA YR
Sbjct  315   VACFFSTALMP--SSKLYGPIQDLLSEDNPAKYR  346



>gb|KFK42773.1| hypothetical protein AALP_AA1G037700 [Arabis alpina]
Length=358

 Score =   359 bits (922),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 191/336 (57%), Positives = 248/336 (74%), Gaps = 7/336 (2%)
 Frame = +3

Query  249   MQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIF-LNKHSILEKNSAANAATPQFVIP  425
             M  E+D  +E +AF+++KAGVKGL DA +T+IPRIF L + ++ +K  + +A+   F IP
Sbjct  1     MVIEFDSYNERKAFDETKAGVKGLVDAQITEIPRIFRLPQGTLSDKKPSVSAS--DFAIP  58

Query  426   VIDFEGLGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKK  605
             +IDF  L  +R   +V  +KDA E WGFFQVINHG+P +V +++ + V  FHE+D E+KK
Sbjct  59    IIDFADLAASRE-SMVEKVKDAAEKWGFFQVINHGVPLSVFEEIKDGVVRFHEEDIEVKK  117

Query  606   PFHSRDVKKKVTYNSNFDLLVAATA-NWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEH  782
              + +RD  K+  YNSNFDL  +++  NWRDS  C +APDPP PEELP  CRD MI+Y++H
Sbjct  118   SYFTRDAAKRFVYNSNFDLYSSSSCVNWRDSFACYLAPDPPNPEELPIACRDAMIEYSKH  177

Query  783   VMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfl  962
             +MSLG  LF+LLSEALGL+ + LK M C +GL ++ HYYPPCP+PDLTLG S+H+D+ FL
Sbjct  178   MMSLGDLLFKLLSEALGLNSEKLKSMDCMKGLLMLCHYYPPCPQPDLTLGTSNHSDNSFL  237

Query  963   tlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPR  1142
             T+LLQDQ+GGLQV HED WVDV   PG+L++NIGD LQL+TNDKF SV HRVLA   GPR
Sbjct  238   TILLQDQIGGLQVFHEDCWVDVSPLPGALVINIGDFLQLITNDKFISVEHRVLANKAGPR  297

Query  1143  ISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             ISVASFF     +   +  YGPIKELLSEE P  Y+
Sbjct  298   ISVASFFSTSMLQN--STVYGPIKELLSEENPPKYK  331



>gb|KCW60387.1| hypothetical protein EUGRSUZ_H03103 [Eucalyptus grandis]
Length=344

 Score =   358 bits (918),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 185/318 (58%), Positives = 239/318 (75%), Gaps = 4/318 (1%)
 Frame = +3

Query  303   AGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFEGL--GGNRRVEIVN  476
              GVKGL D+G++K+P IF++     +    ++ A   F IP++D +G+    ++R EIV 
Sbjct  2     TGVKGLVDSGVSKLPCIFVDHRP--QSPDCSDPAETSFSIPIVDLQGVHEDSSKRKEIVC  59

Query  477   MIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFHSRDVKKKVTYNSNF  656
              +  ACE+WGFFQV+NHGI   ++  +++ ++ FHEQ+ +LK+  +SRD  KKV +N+NF
Sbjct  60    RVGHACEDWGFFQVVNHGIGHGILSGIIDGMRRFHEQESKLKEELYSRDQSKKVIFNTNF  119

Query  657   DLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMSLGYTLFELLSEALGL  836
             D   A  ANWRDSLYC MAP PP PEELP VCRDI+ +Y++ VM LG T+F+LLSEALGL
Sbjct  120   DFHSAPVANWRDSLYCAMAPHPPSPEELPQVCRDIVREYSDKVMRLGLTIFKLLSEALGL  179

Query  837   DLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltlllqdqlgglqvlHEDV  1016
             +  HL+ MGC+EGL++IGHYYP CPEPDLT G + HTDS FLT+LLQDQ GGLQVLHE+ 
Sbjct  180   NPKHLQDMGCAEGLYLIGHYYPICPEPDLTQGHTKHTDSSFLTVLLQDQTGGLQVLHENH  239

Query  1017  WVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISVASFFRMHFQEGNEAK  1196
             WVDV    G+L+VN+GDMLQL+TN KFKSV+HRV AK VGPRISVA FFR HF++    +
Sbjct  240   WVDVKPVQGALVVNLGDMLQLITNGKFKSVYHRVQAKNVGPRISVACFFRRHFEQEESPR  299

Query  1197  TYGPIKELLSEEKPAIYR  1250
              YGPIKELLSEE P +YR
Sbjct  300   KYGPIKELLSEENPPLYR  317



>gb|KDO44340.1| hypothetical protein CISIN_1g017376mg [Citrus sinensis]
Length=372

 Score =   358 bits (920),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 187/348 (54%), Positives = 253/348 (73%), Gaps = 6/348 (2%)
 Frame = +3

Query  213   TSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSA  392
              +N+ +  + ++    YDR SE++AF+++KAGVKGL DAG+ +IPRIF      L+K   
Sbjct  2     AANSTSETQATMELNHYDRESELKAFDNTKAGVKGLVDAGIDRIPRIFYLPTDCLDKTPV  61

Query  393   ANAATPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLES  566
                   Q++ P +D +G+  +  +R EIV  ++ A E  GFFQVINHGIP ++++++ E 
Sbjct  62    PRDV--QYIFPTVDLQGVDKDPIQRKEIVERVRKASETSGFFQVINHGIPVSILEELKEG  119

Query  567   VQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPN  746
             V+ F EQDFELKK F++RD+ K V YNSNFDL  A  ANWRD++   MAP+PP+PEE+P 
Sbjct  120   VRRFFEQDFELKKEFYTRDITKMVGYNSNFDLYSAPAANWRDTILFNMAPNPPKPEEMPA  179

Query  747   VCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLT  926
              CRDI+++Y + VM LG  LFELLSEALGL+ ++LKGM C+EGL ++GHYYP CP+P+LT
Sbjct  180   ACRDIVMEYTKSVMKLGPLLFELLSEALGLNPNYLKGMDCAEGLLLLGHYYPACPQPELT  239

Query  927   LGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSV  1106
             +G + H D  F+T+LLQD +GGLQV +++ W+DVP  PG+L++NIGD+LQL++NDKF S 
Sbjct  240   MGATEHADDDFVTVLLQDHIGGLQVCYQNHWIDVPPSPGALVINIGDLLQLISNDKFISA  299

Query  1107  HHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              HRVLA  VGPRISVASFF    Q    +K YGPIKELLSEE P  YR
Sbjct  300   EHRVLANRVGPRISVASFFSPKRQPS--SKLYGPIKELLSEENPPKYR  345



>ref|XP_006420179.1| hypothetical protein CICLE_v10005202mg [Citrus clementina]
 gb|ESR33419.1| hypothetical protein CICLE_v10005202mg [Citrus clementina]
Length=372

 Score =   358 bits (920),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 187/348 (54%), Positives = 253/348 (73%), Gaps = 6/348 (2%)
 Frame = +3

Query  213   TSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSA  392
              +N+ +  + ++    YDR SE++AF+++KAGVKGL DAG+ +IPRIF      L+K   
Sbjct  2     AANSTSETQATMELNHYDRESELKAFDNTKAGVKGLVDAGIDRIPRIFYLPTDCLDKTPV  61

Query  393   ANAATPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLES  566
                   Q++ P +D +G+  +  +R EIV  ++ A E  GFFQVINHGIP ++++++ E 
Sbjct  62    PRDV--QYIFPTVDLQGVDKDPIQRKEIVERVRKASETSGFFQVINHGIPVSILEEVKEG  119

Query  567   VQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPN  746
             V+ F EQDFELKK F++RD+ K V YNSNFDL  A  ANWRD++   MAP+PP+PEE+P 
Sbjct  120   VRRFFEQDFELKKEFYTRDITKMVGYNSNFDLYSAPAANWRDTILFNMAPNPPKPEEMPA  179

Query  747   VCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLT  926
              CRDI+++Y + VM LG  LFELLSEALGL+ ++LKGM C+EGL ++GHYYP CP+P+LT
Sbjct  180   ACRDIVMEYTKSVMKLGPLLFELLSEALGLNPNYLKGMDCAEGLLLLGHYYPACPQPELT  239

Query  927   LGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSV  1106
             +G + H D  F+T+LLQD +GGLQV +++ W+DVP  PG+L++NIGD+LQL++NDKF S 
Sbjct  240   MGATEHADDDFVTVLLQDHIGGLQVCYQNHWIDVPPSPGALVINIGDLLQLISNDKFISA  299

Query  1107  HHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              HRVLA  VGPRISVASFF    Q    +K YGPIKELLSEE P  YR
Sbjct  300   EHRVLANRVGPRISVASFFSPKRQPS--SKLYGPIKELLSEENPPKYR  345



>emb|CBI23596.3| unnamed protein product [Vitis vinifera]
Length=359

 Score =   358 bits (918),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 184/337 (55%), Positives = 255/337 (76%), Gaps = 8/337 (2%)
 Frame = +3

Query  249   MQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLN-KHSILEKNSAANAATPQFVIP  425
             M +EYDR+SE+ AF+DSKAGVKGL DAG+ KIPR+F++ +H++ EK+ + NA   Q  IP
Sbjct  1     MDSEYDRKSELIAFDDSKAGVKGLVDAGVAKIPRMFIHPQHNLREKSVSTNA---QLRIP  57

Query  426   VIDFEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFEL  599
             +ID EG+  +   R +I++ +++ACE WG FQ++NHGI  +V+++M++ ++ F+EQD E+
Sbjct  58    IIDLEGVNSDAILRAKIIDKVRNACEIWGIFQIVNHGILKSVLEEMIKGIRRFNEQDTEV  117

Query  600   KKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAE  779
             KK F++RD  KKV + SNFDL  A  A W+DS  CI+ P+PP+P ++P VCRDI+++Y++
Sbjct  118   KKEFYTRDSSKKVKFVSNFDLFQAPAATWKDSFSCIINPNPPDPTDMPAVCRDIIMEYSK  177

Query  780   HVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgf  959
              V  L  TLFEL++EALGL+ +HLK M C+EGLF++ HYYP CPEP+LT+G  +HTD  F
Sbjct  178   QVKMLANTLFELVAEALGLNSNHLKDMECAEGLFLVSHYYPACPEPELTMGTKTHTDPTF  237

Query  960   ltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGP  1139
             LT+LLQDQ+GGLQVLHE  WV+V   PG+L++N GD+LQL++ND F+S  HRVLA   GP
Sbjct  238   LTVLLQDQVGGLQVLHEKQWVNVNPVPGALVINTGDLLQLVSNDMFRSAKHRVLANHKGP  297

Query  1140  RISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             R+SVASFF         +K YGPIKELLSEE P  Y+
Sbjct  298   RVSVASFFSP--SSLPPSKLYGPIKELLSEENPPKYK  332



>gb|KDP40305.1| hypothetical protein JCGZ_02303 [Jatropha curcas]
Length=372

 Score =   358 bits (919),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 194/339 (57%), Positives = 244/339 (72%), Gaps = 5/339 (1%)
 Frame = +3

Query  240   DSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFV  419
             DS + +EY R SE++AF+++KAGVKGL DAG+T +PRIF N      K S   AA  +F 
Sbjct  2     DSTIDSEYCRTSELKAFDETKAGVKGLVDAGITVVPRIFHNPPDDSHKISHT-AADAKFT  60

Query  420   IPVIDFEGL--GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDF  593
              P++D EG+  G   R EIV+ +++A E WGFFQVINHGIP ++M+ M + ++ F+EQD 
Sbjct  61    FPIVDLEGVHKGLASRKEIVDRLRNASETWGFFQVINHGIPMSLMEHMKDGIRRFYEQDI  120

Query  594   ELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKY  773
             +LKK F SRD+ +KV YNSN  L  + + NWRDS    MAPD P PEELP VCRDI++++
Sbjct  121   DLKKEFFSRDLTRKVVYNSNLHLYASPSVNWRDSTLFRMAPDTPIPEELPAVCRDILMEF  180

Query  774   AEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDS  953
             +  VM LG  L EL+SEALGLD  HLK M C+EG  I+GHYYP CP+P+LT+G S H DS
Sbjct  181   SMEVMKLGNLLLELMSEALGLDPSHLKDMNCNEGFVIMGHYYPACPQPELTMGASKHADS  240

Query  954   gfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPV  1133
             GF T+LLQD +GGLQVLH++ W DVP  PG+L+VNIGD LQL+TNDKF SV HRVLA  V
Sbjct  241   GFFTVLLQDHVGGLQVLHQNQWTDVPPVPGALVVNIGDFLQLITNDKFVSVEHRVLANRV  300

Query  1134  GPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             GPRIS A FF     +  + + YGPIKELLS E PA YR
Sbjct  301   GPRISAACFFTPTIMQ--KPRVYGPIKELLSAENPANYR  337



>ref|XP_006367030.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Solanum tuberosum]
Length=368

 Score =   358 bits (919),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 182/338 (54%), Positives = 248/338 (73%), Gaps = 8/338 (2%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIF----LNKHSILEKNSAANAATPQFVI  422
             A YDR  +++AF+D+KAGVKGL D+G+  IP IF    L ++ +  KN  +++      I
Sbjct  2     ANYDRAKDLKAFDDTKAGVKGLVDSGIVHIPEIFVTSALTENELSAKNLDSDSNVVNVQI  61

Query  423   PVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFE  596
             PVID +G+ G+  RR  IV  + +AC+ WGFFQV+NHG+P +VMD+M+  V+ F+EQ  E
Sbjct  62    PVIDLKGMNGDDFRRRRIVEEVGEACKTWGFFQVLNHGVPQHVMDEMISGVKSFNEQSNE  121

Query  597   LKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYA  776
              K  F+SRD  KKV +NSNFDL  +  ANWRDSL C+MAP+PP  +ELP  CR+ +++Y+
Sbjct  122   KKMEFYSRDNLKKVKFNSNFDLYSSKAANWRDSLTCVMAPNPPTKDELPEACREELLQYS  181

Query  777   EHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSg  956
             EHV  LG+T+FELL+EALGL  +HL  M C++G FII HYYPPCPEP+ TLG++ HTD  
Sbjct  182   EHVRKLGHTIFELLAEALGLKPNHLLDMDCAKGQFIISHYYPPCPEPNKTLGITKHTDPD  241

Query  957   fltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVG  1136
             F T+LLQDQ+GGLQ+ H++ W+D+    G+L++N+GD+LQLL+NDKFKS  HRVL+K +G
Sbjct  242   FFTILLQDQIGGLQINHQNQWIDIHPVTGALVINLGDLLQLLSNDKFKSAEHRVLSKQIG  301

Query  1137  PRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             PRIS+A FF   FQ  +    YGPIKELLS+E  A+Y+
Sbjct  302   PRISIACFFTTQFQPFD--TLYGPIKELLSDENHALYK  337



>ref|XP_007035057.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
 gb|EOY05983.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
Length=371

 Score =   358 bits (918),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 193/347 (56%), Positives = 248/347 (71%), Gaps = 8/347 (2%)
 Frame = +3

Query  216   SNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAA  395
             +N G +Q  S  + EYDR SEV+AF+D+KAGVKGL DAG T++PR+F       EK S  
Sbjct  4     ANTGEVQTTS--KPEYDRASEVKAFDDTKAGVKGLVDAGATEVPRMFHQPPDKFEKTSVP  61

Query  396   NAATPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESV  569
               A  Q  IPVI+ + +  +   R EIV  ++DA + WGFFQ+INHGIP  V++ M  SV
Sbjct  62    GDA--QVRIPVINLDRVKEDPITRKEIVEEVRDASKKWGFFQIINHGIPVGVLEDMKHSV  119

Query  570   QHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNV  749
             + F EQD E++K F++RD  K V YN NFDL  A  ANWRDS++C MAPDPP+ EELP  
Sbjct  120   RRFFEQDVEVRKQFYTRDNMKTVVYNCNFDLHTAPAANWRDSVFCTMAPDPPKLEELPES  179

Query  750   CRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTL  929
              RDIM++Y+  +MSLGY LFEL+SEALGL+ DHL  + C++GL ++ HYYP CP+P+LTL
Sbjct  180   FRDIMVEYSNRLMSLGYLLFELISEALGLNPDHLVKIDCAKGLGVLCHYYPACPQPELTL  239

Query  930   GLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVH  1109
             G S H DS FLT+LLQD +G LQVLH + W+DVP  PG+L+VNIGD+LQL++ND+  SV 
Sbjct  240   GASKHADSDFLTVLLQDHVGALQVLHGNQWIDVPPTPGALVVNIGDLLQLISNDRLLSVE  299

Query  1110  HRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             HRVLA  VGPR+SVA FF   F+     + YGPIKELL+E+ P  YR
Sbjct  300   HRVLANSVGPRVSVAGFFVTGFRPN--PRLYGPIKELLTEDNPPKYR  344



>ref|XP_002529304.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
 gb|EEF33073.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
Length=363

 Score =   357 bits (917),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 197/341 (58%), Positives = 246/341 (72%), Gaps = 10/341 (3%)
 Frame = +3

Query  240   DSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATP--Q  413
             +S    EY R SE++AF+D+KAGVKGL DAG+TKIPRIF      LEKNS     TP  +
Sbjct  2     NSTFNPEYCRSSELKAFDDTKAGVKGLVDAGITKIPRIFYQSPDSLEKNSP----TPDTK  57

Query  414   FVIPVIDFEGL--GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQ  587
             F  PVID + +  G   R EIV+ +++A E WGFFQV+NHGIP +V+++M + +  F EQ
Sbjct  58    FRFPVIDLKDVEDGAVSRKEIVDGVRNASETWGFFQVVNHGIPASVLEEMKDGLLKFFEQ  117

Query  588   DFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMI  767
             D ELKK F+SRD+ KKV YNSNFDL  A  ANWRD++   M PDPP+PEE+P   R I++
Sbjct  118   DTELKKGFYSRDLTKKVGYNSNFDLYSAPAANWRDTIAFQMVPDPPKPEEMPAAFRHILV  177

Query  768   KYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHT  947
             +Y++ V  LG  LF+LLSEALGL  +HLK M C +GLFI+GHYYP CPEP+LTLG S H 
Sbjct  178   EYSKEVRKLGSVLFDLLSEALGLKPNHLKDMDCDKGLFILGHYYPACPEPELTLGTSKHA  237

Query  948   DSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAK  1127
             D+ FLT+LLQD +GGLQVLH++ W DVP  PG+L+VNIGD+LQL++NDKF S  HRVLA 
Sbjct  238   DNDFLTVLLQDDIGGLQVLHQNQWTDVPPTPGALVVNIGDLLQLISNDKFISAEHRVLAN  297

Query  1128  PVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
               GPR+SVA FF         ++ YGPIKELLSEE P  YR
Sbjct  298   YKGPRVSVACFFSTALFP--VSRLYGPIKELLSEENPPKYR  336



>ref|XP_002889610.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65869.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=362

 Score =   357 bits (917),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 188/335 (56%), Positives = 241/335 (72%), Gaps = 6/335 (2%)
 Frame = +3

Query  246   IMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIP  425
             I  A  +R ++++AF+++K GVKGL DAG+ +IP IF    + L   S    ++ +F IP
Sbjct  7     ITVAAINRSTQLKAFDETKTGVKGLVDAGIAEIPSIFRAPPATL--TSPKPPSSSEFTIP  64

Query  426   VIDFEGLGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKK  605
              ID +G GG RR  +V  I DA E WGFFQVINHGIP +V++K  E ++ FHEQD ++KK
Sbjct  65    TIDLKG-GGTRR-SLVEKIGDAAEKWGFFQVINHGIPMDVLEKKKEGIREFHEQDTQVKK  122

Query  606   PFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
              F+SRD   KV Y+SNFDL  +  ANWRD+L C  APDPP PE+LP  C ++MI+Y++ V
Sbjct  123   GFYSRDPASKVVYSSNFDLFSSPAANWRDTLGCYTAPDPPRPEDLPAACGEMMIEYSKEV  182

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgflt  965
             M LG  LFELLSEALGL+  HLK M C+  L ++GHYYPPCP+PDLTLGL+ H D+ FLT
Sbjct  183   MKLGKLLFELLSEALGLNTSHLKDMDCTNSLLLLGHYYPPCPQPDLTLGLTKHFDNSFLT  242

Query  966   lllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRI  1145
             +LLQD +GGLQVLH+  WVDVP  PG+L+VN+GD+LQ +TNDKFKSV HRVLA   GPRI
Sbjct  243   ILLQDHIGGLQVLHDQYWVDVPPVPGALVVNVGDLLQHITNDKFKSVEHRVLANVAGPRI  302

Query  1146  SVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             SVA FF  +       + YGPIK++LSE+ P  YR
Sbjct  303   SVACFFSSYLMA--NPRVYGPIKDILSEQNPPKYR  335



>ref|XP_003534012.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X1 [Glycine max]
 ref|XP_006587352.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X2 [Glycine max]
Length=375

 Score =   358 bits (918),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 191/351 (54%), Positives = 253/351 (72%), Gaps = 5/351 (1%)
 Frame = +3

Query  204   MVDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEK  383
             MV TS N +  E S   + YDR +EV+AF+++K GVKGLFD+G+T IPRIF   H+ +E 
Sbjct  1     MVATSTNQSELETSKKDSTYDRIAEVKAFDETKLGVKGLFDSGITNIPRIF--HHAKVED  58

Query  384   NSAANAATPQFVIPVIDFEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKM  557
             ++        F +P+ID + +  N   RV+ ++ I+ AC+ WGFFQV+NHGI  +++D+M
Sbjct  59    HTETMPNDSNFSVPIIDLQDIDTNSSLRVKALDKIRSACKEWGFFQVVNHGIAVDLLDEM  118

Query  558   LESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEE  737
             +  ++ FHEQD E++K F+SRD+ KKV Y SN  L     ANWRD++     PDPP PEE
Sbjct  119   ICGIRRFHEQDAEVRKSFYSRDMNKKVRYFSNGTLYRDPAANWRDTIAFFRTPDPPNPEE  178

Query  738   LPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEP  917
             +P+VCRDI+I Y+E V +LG+T+FEL SEALGL   +LK +   +G F++ HYYPPCPEP
Sbjct  179   IPSVCRDIVIGYSEKVRALGFTIFELFSEALGLHSSYLKELDSVDGQFLLCHYYPPCPEP  238

Query  918   DLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKF  1097
             +LT+G S HTD  F+T+LLQDQ+GGLQVLH++ WVDVP   GSL+VNIGD LQL+TND F
Sbjct  239   ELTMGTSKHTDISFMTILLQDQMGGLQVLHQNQWVDVPPVHGSLVVNIGDFLQLITNDMF  298

Query  1098  KSVHHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              SV+HRVL+   GPRISVASFF   FQ+ +  K  GPIKELLSE+ P IYR
Sbjct  299   LSVYHRVLSSHTGPRISVASFFTKSFQQSS-LKVVGPIKELLSEDNPPIYR  348



>ref|XP_004513523.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Cicer arietinum]
Length=373

 Score =   358 bits (918),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 189/355 (53%), Positives = 260/355 (73%), Gaps = 15/355 (4%)
 Frame = +3

Query  204   MVDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEK  383
             MV   N   L+E +   + YDR++EV+AF+DSKAGV+GL ++G+TKIPR+F +  S +  
Sbjct  1     MVVVENTKQLEEGN--DSTYDRKAEVKAFDDSKAGVRGLIESGVTKIPRMFYSNESNITN  58

Query  384   NSAANAATPQFVIPVIDFEGLGGNRRV----EIVNMIKDACENWGFFQVINHGIPDNVMD  551
             N ++N       +P+ID + +  N  +    E+++ I+ AC+ WGFFQVINHGIP +V+D
Sbjct  59    NLSSNT------VPIIDLKDIHKNINLTLGEEVISQIRSACKEWGFFQVINHGIPIHVLD  112

Query  552   KMLESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEP  731
             +M + ++ FHEQD +++K F++RD+KKK+ Y SN  L     ANWRD++ C MAP+PP  
Sbjct  113   EMRDGIRRFHEQDVDVRKQFYTRDLKKKILYCSNTSLFRDKYANWRDTIGCSMAPNPPNS  172

Query  732   EELPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCP  911
             EELP V RDI+I+Y++ +M LG T+ ELLS ALGLD  +LK + C EGLFI GHYYPPCP
Sbjct  173   EELPQVFRDIIIEYSKKIMELGSTILELLSMALGLDPSYLKELNCLEGLFIQGHYYPPCP  232

Query  912   EPDLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTND  1091
             EP+LT+G + HTDS F+T++LQDQ+GGLQVLHE+ W +VP   G+L+VNIGD+LQL++ND
Sbjct  233   EPELTMGTTKHTDSDFMTIVLQDQIGGLQVLHENQWFNVPPVHGALVVNIGDLLQLISND  292

Query  1092  KFKSVHHRVLAKPVGPRISVASFFRMHF--QEGNEAKTYGPIKELLSEEKPAIYR  1250
              F SV+HRVL+   GPR+SVASFF   +   EG+ +K Y PIKELLS+E P IYR
Sbjct  293   NFVSVYHRVLSNHKGPRVSVASFFLNSYDPSEGS-SKVYSPIKELLSQENPQIYR  346



>ref|XP_009347731.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Pyrus x bretschneideri]
Length=366

 Score =   357 bits (917),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 183/331 (55%), Positives = 250/331 (76%), Gaps = 4/331 (1%)
 Frame = +3

Query  264   DRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFEG  443
             DR SE++AF+++K GVKGL D+G+TK+P IF +K   ++    A+    Q  IP+ID + 
Sbjct  11    DRISELKAFDETKGGVKGLLDSGITKLPSIFHSKQLSVDDRKVASDDV-QLSIPIIDLKN  69

Query  444   LGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFHS  617
             +  +   R E++  ++ A E WGFF VINHGI D+V+D+M++ ++ FHEQD ELKK  +S
Sbjct  70    IHIDSVLRAEVIEKVRYASEKWGFFAVINHGISDDVLDRMIDGMRRFHEQDAELKKKLYS  129

Query  618   RDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMSLG  797
             R+  KKV Y+SN+DL  A  ANWRD+  C MAPDPP PEE+P+VCR+I+I+Y+E VM L 
Sbjct  130   RESGKKVLYSSNYDLYHAQEANWRDTFSCYMAPDPPTPEEMPSVCREIVIEYSEKVMKLA  189

Query  798   YTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltlllq  977
             +TLFEL SEALGL+ + LK MGC+EG F++GHYYP CPEP +TLG S HTD  F+++LLQ
Sbjct  190   HTLFELFSEALGLNPNKLKDMGCAEGQFLLGHYYPACPEPKITLGTSKHTDGTFISVLLQ  249

Query  978   dqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISVAS  1157
             DQ+GGLQVL+++ WV+VP   G+L++NIGD+LQL+TN +F SV+HRV+A+ VGPRISV  
Sbjct  250   DQIGGLQVLYDNQWVNVPPKKGALVINIGDLLQLITNGRFISVYHRVIAQKVGPRISVPI  309

Query  1158  FFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             FFR + Q G ++  YGPIKELLS+  P IY+
Sbjct  310   FFRPYVQ-GGKSYAYGPIKELLSDGNPQIYK  339



>ref|XP_008224378.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Prunus mume]
Length=378

 Score =   358 bits (918),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 186/341 (55%), Positives = 248/341 (73%), Gaps = 3/341 (1%)
 Frame = +3

Query  234   QEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQ  413
             ++D  ++A  DR SE++AF+ +KAGVKGL D GLTKIP IF +            +   Q
Sbjct  12    EDDHELEANSDRMSELKAFDAAKAGVKGLLDTGLTKIPSIFYSSSRPSFDEKKLQSDDVQ  71

Query  414   FVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQ  587
             F +P+ID  G+  +      +V  ++ A E WGFFQV+NHG+P +++D+M++ ++ FHEQ
Sbjct  72    FSVPIIDLRGIQNDAVSHARVVEKVRHASEKWGFFQVVNHGVPVDILDQMIDGIRRFHEQ  131

Query  588   DFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMI  767
             D E+KK F+SRD  KKV Y SN+ L  ++ ANWRD+  C +APDPP+ EELP+VCR+++ 
Sbjct  132   DSEVKKEFYSRDFGKKVYYMSNYHLYQSSEANWRDTFVCYVAPDPPKQEELPSVCRELVN  191

Query  768   KYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHT  947
             +Y++ VM LG TLFELLSEALGL+ + L+ M C E L  +GHYYP CPE +LT+G S HT
Sbjct  192   EYSKQVMDLGSTLFELLSEALGLNPNQLEDMNCGEALLHLGHYYPACPELELTMGTSKHT  251

Query  948   DSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAK  1127
             D  F+T+LLQDQ+GGLQVLHE+ WV+VP   GSL+VNIGD++QL+TNDKF SV HRV+ K
Sbjct  252   DGSFITILLQDQVGGLQVLHENQWVNVPPKQGSLVVNIGDLMQLITNDKFISVDHRVIVK  311

Query  1128  PVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
               GPR+SVASFFR +   GN +K YGPIKELLSE+ P IYR
Sbjct  312   NAGPRVSVASFFRPYVLTGN-SKVYGPIKELLSEDVPQIYR  351



>ref|XP_006304979.1| hypothetical protein CARUB_v10011473mg [Capsella rubella]
 gb|EOA37877.1| hypothetical protein CARUB_v10011473mg [Capsella rubella]
Length=365

 Score =   357 bits (916),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 188/334 (56%), Positives = 242/334 (72%), Gaps = 6/334 (2%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVID  434
             A  DR ++++AF+++K GVKGL DAG++++P IF    + L   S    ++ +F IP ID
Sbjct  9     AATDRSTQLKAFDETKTGVKGLVDAGISEVPAIFRAPPATL--TSPKPPSSSEFTIPTID  66

Query  435   FEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKP  608
              +G G +   R  +V MI DA E WGFFQVINHGIP +V++KM E V+ FHEQD E+KK 
Sbjct  67    LKGGGADSITRRSLVEMIGDAPEKWGFFQVINHGIPLDVLEKMKEGVREFHEQDTEVKKG  126

Query  609   FHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVM  788
             F+SRD   K+ Y+SNFDL  +  ANWRD+L C  APDPP  E+LP  C ++MI+Y++ VM
Sbjct  127   FYSRDPASKMVYSSNFDLFSSQAANWRDTLGCYTAPDPPRQEDLPAACGEMMIEYSKEVM  186

Query  789   SLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltl  968
              LG  LFELLSEALGL+ +H K + C+  L ++GHYYPPCP+PDLTLGL+ H+D+ FLTL
Sbjct  187   KLGELLFELLSEALGLNTNHFKDIDCTNSLLLLGHYYPPCPQPDLTLGLTKHSDNSFLTL  246

Query  969   llqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRIS  1148
             LLQD +GGLQVLH+  WVDVP  PG+L+VN+GD+LQL+TNDKF SV HRVLA   GPRIS
Sbjct  247   LLQDHIGGLQVLHDQYWVDVPPVPGALVVNVGDLLQLITNDKFISVEHRVLANEDGPRIS  306

Query  1149  VASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             VA FF  +       + YGPIKELLSE+ P  YR
Sbjct  307   VACFFSSYLMA--NPRVYGPIKELLSEQNPPKYR  338



>ref|XP_006586236.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
12-like [Glycine max]
Length=373

 Score =   357 bits (917),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 193/353 (55%), Positives = 260/353 (74%), Gaps = 11/353 (3%)
 Frame = +3

Query  204   MVDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIF-LNKHSILE  380
             MV T+ N   Q    + + YDR++E +AF+DSKAGV+GL ++G+TKIPR+F   K  ++E
Sbjct  1     MVVTNTN---QLGETIDSTYDRKAEKKAFDDSKAGVRGLVESGVTKIPRMFHAGKLDVIE  57

Query  381   KNSAANAATPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDK  554
              + +      +  IP+ID + +  N     +++  I+ AC  WGFFQVINHGIP +V+D+
Sbjct  58    TSPSHT----KLSIPIIDLKDIHSNPALHTQVMGKIRSACHEWGFFQVINHGIPISVLDE  113

Query  555   MLESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPE  734
             M+  ++ FHEQD E++K F++RD+KKKV Y SN  L      NWRD+    +APDP +PE
Sbjct  114   MIGGIRRFHEQDAEVRKEFYTRDLKKKVLYYSNISLYSDQPVNWRDTFGFGVAPDPAKPE  173

Query  735   ELPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPE  914
             E+P+VCRDI+I+Y++ +  LG+T+FELLSEALGL+  +LK + C+EGLFI+GHYYP CPE
Sbjct  174   EIPSVCRDIVIEYSKKIRDLGFTMFELLSEALGLNPSYLKELNCAEGLFILGHYYPACPE  233

Query  915   PDLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDK  1094
             P+LT+G + HTDS F+TLLLQDQLGGLQVLH++ WV+VP   G+L+VNIGD+LQL+TNDK
Sbjct  234   PELTMGTTKHTDSNFMTLLLQDQLGGLQVLHQNQWVNVPPVHGALVVNIGDLLQLITNDK  293

Query  1095  FKSVHHRVLAKPVGPRISVASFF-RMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             F SV+HRVL++  GPRISVASFF   H      +K YGPIKELLSEE P IYR
Sbjct  294   FVSVYHRVLSQNTGPRISVASFFVNSHDPVEGTSKMYGPIKELLSEENPPIYR  346



>ref|XP_010650057.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Vitis vinifera]
 emb|CAN62402.1| hypothetical protein VITISV_000986 [Vitis vinifera]
Length=367

 Score =   357 bits (916),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 185/335 (55%), Positives = 246/335 (73%), Gaps = 10/335 (3%)
 Frame = +3

Query  252   QAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVI  431
             QA+ DR  E++AF+++KAGVKGL DAG++++PRIF+      +          +F  PVI
Sbjct  14    QADCDRLGELKAFDETKAGVKGLVDAGVSQVPRIFI------QPPDDFTTGDTKFSFPVI  67

Query  432   DFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKK  605
             D + +  +  RR EIV+M++DA E WGFF V+NHGI   V+++M + V+ F+EQD E+KK
Sbjct  68    DLQDMNTDPARRKEIVDMVRDASETWGFFNVVNHGISVTVLEEMKDGVRRFYEQDTEVKK  127

Query  606   PFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
              ++SRD+++KV YNSNFDL  A  ANWRD+ Y +MAP PP+P+ELP   RDI+I+Y + V
Sbjct  128   QYYSRDLERKVVYNSNFDLYKAPAANWRDTFYFLMAPQPPDPQELPPAFRDILIEYKDEV  187

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgflt  965
             M LG+ L EL+SEALGL  +HLK M C+EGL ++ HYYP CP+P+LT+G + H D+ FLT
Sbjct  188   MKLGFKLLELISEALGLKANHLKDMDCAEGLAMLCHYYPACPQPELTMGTTKHADNDFLT  247

Query  966   lllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRI  1145
             +LLQD++GGLQVLH+D WVDVP  PG+L++NIGD+LQL+TND+FKSV HRVLA   GPR+
Sbjct  248   VLLQDEIGGLQVLHQDQWVDVPPMPGALVINIGDLLQLITNDRFKSVEHRVLASHKGPRV  307

Query  1146  SVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             SVA FF          K YGPIKELLSEE P  YR
Sbjct  308   SVACFFSTALLPS--LKLYGPIKELLSEENPPKYR  340



>ref|XP_010102247.1| 1-aminocyclopropane-1-carboxylate oxidase-1-like protein [Morus 
notabilis]
 gb|EXB93190.1| 1-aminocyclopropane-1-carboxylate oxidase-1-like protein [Morus 
notabilis]
Length=372

 Score =   357 bits (916),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 187/344 (54%), Positives = 244/344 (71%), Gaps = 5/344 (1%)
 Frame = +3

Query  228   NLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIF-LNKHSILEKNSAANAA  404
             N Q++S    +Y+R   ++AF+D+KAGVKGL DAG++ IP  F +    +       +  
Sbjct  4     NPQQNSESATDYERAKSLKAFDDAKAGVKGLVDAGISTIPPFFVMPPEDLSSSQRPGDLG  63

Query  405   TPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHF  578
              P+F +P ID +   G+   R +IV  I+ ACE WGFFQV+NHGIP ++MD+MLE V+ F
Sbjct  64    FPRFKVPTIDLKHTHGDFLWRKQIVEEIRCACETWGFFQVVNHGIPQDIMDQMLEGVRRF  123

Query  579   HEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRD  758
             +EQ  E K   +SRD  KKV +NSNFDL  A  ANWRD+L C MAP+PP+PEE P  CRD
Sbjct  124   NEQSNEAKMEIYSRDKMKKVRFNSNFDLYKAKAANWRDTLLCAMAPNPPQPEEYPAACRD  183

Query  759   IMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLS  938
             IM +Y+EHV  LG  L++L+S+AL LD +HL+ MGC++G     HYYP CPEPD TLG +
Sbjct  184   IMKQYSEHVEKLGEILYQLISQALELDPNHLEDMGCAKGHVFFCHYYPACPEPDRTLGHA  243

Query  939   SHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRV  1118
              HTD  FLT+LLQD +GGLQVLH++ WVDVP   G+L++NIGD+LQL++NDKFKS+ HRV
Sbjct  244   KHTDPSFLTILLQDHIGGLQVLHQNRWVDVPPVRGALVINIGDLLQLISNDKFKSIEHRV  303

Query  1119  LAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             LAK  GPRIS A FF  HFQE +  K YGPIKELL ++ P +Y+
Sbjct  304   LAKSAGPRISAACFFTTHFQESD--KLYGPIKELLKDDNPPLYK  345



>ref|XP_011073514.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Sesamum indicum]
Length=372

 Score =   357 bits (916),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 192/348 (55%), Positives = 252/348 (72%), Gaps = 11/348 (3%)
 Frame = +3

Query  216   SNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAA  395
             SN   + +D      +DR SE++AF+++KAGVKGL DAG T +PRIF +     E ++AA
Sbjct  6     SNTQTISDDQ----NFDRASELKAFDETKAGVKGLVDAGTTTVPRIFFSPPD--EFDNAA  59

Query  396   NAATPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESV  569
             + +T    IPV+D +G+  +  RR +IV+ ++ A E WGFFQV+NHG+P +V+D+MLE V
Sbjct  60    DVSTLGVSIPVLDLDGIDKDPGRRRDIVHRVRQASETWGFFQVVNHGVPVSVLDEMLEGV  119

Query  570   QHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNV  749
             + F+EQD E+KK +++RD  + V YNSNFDL  AA+ANWRD+ YC MAP  P PEELP  
Sbjct  120   RRFYEQDTEVKKKWYTRDGSETVVYNSNFDLYRAASANWRDTTYCNMAPRLPCPEELPEA  179

Query  750   CRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTL  929
             CRDIM++Y++H+  LG  LFELLSEALGL+ DHL  +GCSEGL ++ HYYP CPEP+ TL
Sbjct  180   CRDIMLEYSKHITRLGRFLFELLSEALGLNPDHLNNLGCSEGLAVLYHYYPACPEPEKTL  239

Query  930   GLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVH  1109
             G S H D  FLT+LLQD +GGLQVL +++WVD+P   G+L+VN+GD+LQL++NDKFKS  
Sbjct  240   GASKHADYDFLTVLLQDNIGGLQVLFQNLWVDIPPLSGALVVNVGDLLQLISNDKFKSSQ  299

Query  1110  HRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEE-KPAIYR  1250
             HRVLA   GPR+SVA FF          K YGPI+ELLSEE  P  YR
Sbjct  300   HRVLANRGGPRVSVACFFTTGLMP--STKLYGPIQELLSEEDNPPKYR  345



>ref|XP_003534014.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Glycine max]
Length=375

 Score =   357 bits (916),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 190/351 (54%), Positives = 254/351 (72%), Gaps = 5/351 (1%)
 Frame = +3

Query  204   MVDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEK  383
             MV TS N +  E S   + YDR +EV+AF+++K GVKGLFD+G+TKIPR+F   H+ +E 
Sbjct  1     MVATSTNQSELETSKKDSTYDRIAEVKAFDETKLGVKGLFDSGITKIPRMF--HHAKVED  58

Query  384   NSAANAATPQFVIPVIDFEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKM  557
             ++        F +P+ID + +  N   RV+ ++ I+ AC+ WGFFQV+NHGI  +++D+M
Sbjct  59    HTETMPNDSNFSVPIIDLQDIDTNSSLRVKALDKIRSACKEWGFFQVVNHGIAVDLLDEM  118

Query  558   LESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEE  737
             +  ++ FHEQD E++K F+SRD+ KKV Y SN  L     ANWRD++     PDPP PEE
Sbjct  119   ICGIRRFHEQDVEVRKSFYSRDMNKKVRYFSNGTLYRDPAANWRDTIAFFRTPDPPNPEE  178

Query  738   LPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEP  917
             +P+VCRDI+I Y+E V +LG+T+FEL SEALGL   +LK +   +G F++ HYYPPCPEP
Sbjct  179   IPSVCRDIVIGYSEKVRALGFTIFELFSEALGLHSSYLKELDSVDGQFLLCHYYPPCPEP  238

Query  918   DLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKF  1097
             +LT+G S HTD  F+T+LLQDQ+GGLQVLH++ WVDVP   GSL+VNIGD LQL++ND F
Sbjct  239   ELTMGTSKHTDISFMTILLQDQMGGLQVLHQNQWVDVPPVHGSLVVNIGDFLQLISNDMF  298

Query  1098  KSVHHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              SV+HRVL+   GPRISVASFF   FQ+ +  K  GPIKELLSE+ P IYR
Sbjct  299   VSVYHRVLSSHTGPRISVASFFANSFQQSS-LKVVGPIKELLSEDNPPIYR  348



>gb|KHN22506.1| 1-aminocyclopropane-1-carboxylate oxidase like 1 [Glycine soja]
Length=375

 Score =   357 bits (916),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 190/351 (54%), Positives = 254/351 (72%), Gaps = 5/351 (1%)
 Frame = +3

Query  204   MVDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEK  383
             MV TS N +  E S   + YDR +EV+AF+++K GVKGLFD+G+TKIPR+F   H+ +E 
Sbjct  1     MVATSTNQSELETSKKDSTYDRIAEVKAFDETKLGVKGLFDSGITKIPRMF--HHAKVED  58

Query  384   NSAANAATPQFVIPVIDFEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKM  557
             ++        F +P+ID + +  N   RV+ ++ I+ AC+ WGFFQV+NHGI  +++D+M
Sbjct  59    HTETMPNDSNFSVPIIDLQDIDTNSSLRVKALDKIRSACKEWGFFQVVNHGIAVDLLDEM  118

Query  558   LESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEE  737
             +  ++ FHEQD E++K F+SRD+ KKV Y SN  L     ANWRD++     PDPP PEE
Sbjct  119   ICGIRRFHEQDAEVRKSFYSRDMNKKVRYFSNGTLYRDPAANWRDTIAFFRTPDPPNPEE  178

Query  738   LPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEP  917
             +P+VCRDI+I Y+E V +LG+T+FEL SEALGL   +LK +   +G F++ HYYPPCPEP
Sbjct  179   IPSVCRDIVIGYSEKVRALGFTIFELFSEALGLHSSYLKELDSVDGQFLLCHYYPPCPEP  238

Query  918   DLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKF  1097
             +LT+G S HTD  F+T+LLQDQ+GGLQVLH++ WVDVP   GSL+VNIGD LQL++ND F
Sbjct  239   ELTMGTSKHTDISFMTILLQDQMGGLQVLHQNQWVDVPPVHGSLVVNIGDFLQLISNDMF  298

Query  1098  KSVHHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              SV+HRVL+   GPRISVASFF   FQ+ +  K  GPIKELLSE+ P IYR
Sbjct  299   VSVYHRVLSSHTGPRISVASFFANSFQQSS-LKVVGPIKELLSEDNPPIYR  348



>ref|XP_006341091.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X1 [Solanum tuberosum]
Length=370

 Score =   357 bits (915),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 184/335 (55%), Positives = 248/335 (74%), Gaps = 7/335 (2%)
 Frame = +3

Query  252   QAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVI  431
             +A+YDR++E++AF+++KAGVKGL D G+TK+PR+F+   +I +    +N    +F  P+I
Sbjct  14    EAKYDRKAELQAFDETKAGVKGLVDTGITKVPRMFVQPSNIEDSKIHSNK---KFSFPII  70

Query  432   DFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKK  605
             DF+G+  +  +R  IV  +  A E WGFFQVINHGIP +V+++M + V  F EQD E KK
Sbjct  71    DFDGIKEDPIKRKNIVQEVSQASETWGFFQVINHGIPSHVLEEMKDGVISFFEQDTEEKK  130

Query  606   PFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
              +++RD+ K  T+NSNFDL  A   NWRD+     AP PP+PEELP+VCRD++++Y   V
Sbjct  131   QWYTRDLTKVFTFNSNFDLFGAPVTNWRDTFTATTAPIPPKPEELPSVCRDVLLEYTNQV  190

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgflt  965
             + LG TLF +LSEA+GL+ +HLK MGC+EGL  +GHYYP CP+P+LTLG S H D+ FLT
Sbjct  191   IKLGDTLFGILSEAIGLEPNHLKDMGCAEGLMALGHYYPECPQPELTLGTSKHADNDFLT  250

Query  966   lllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRI  1145
             +LLQD +GGLQVLH++ WVDVP  PG+L+VNIGD+LQL++NDKFKSV HRVLA  VGPR+
Sbjct  251   VLLQDNIGGLQVLHQNHWVDVPPTPGALVVNIGDILQLISNDKFKSVDHRVLANKVGPRV  310

Query  1146  SVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             S+A FF  +F      + YGPIKEL+SE  P  YR
Sbjct  311   SLACFFMTNFVPTQ--RLYGPIKELISEHNPPKYR  343



>ref|XP_006351987.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Solanum tuberosum]
Length=364

 Score =   356 bits (914),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 185/338 (55%), Positives = 247/338 (73%), Gaps = 7/338 (2%)
 Frame = +3

Query  243   SIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVI  422
             S  Q  YD+ SE++AF+D+KAGVKGL D G+TK+P+IF++  ++ +K    N     F+ 
Sbjct  4     SNTQQNYDKISELKAFDDTKAGVKGLIDGGITKVPQIFIHPEALEKK--TINPKNTHFIF  61

Query  423   PVIDFEGLGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELK  602
             P+ID + +  N + EIV  I++A E WGFFQVINHGIP  V+D+ML     FHEQD ++K
Sbjct  62    PLIDLQNINLNNK-EIVKQIQEASETWGFFQVINHGIPVPVLDEMLRGSLRFHEQDIDVK  120

Query  603   KPFHSRDVKKKVTYNSNFDLLV--AATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYA  776
             KP++SRDV +KV YN NFDL    +  ANWRDSLY +MAP+P  PEE+P  CR+I I+Y+
Sbjct  121   KPYYSRDVARKVMYNCNFDLFSEKSLAANWRDSLYSVMAPNPANPEEIPETCREITIEYS  180

Query  777   EHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSg  956
              +VM+LGYTL EL SE LGL  +HLK MGC+EGL I+ +YYP CP+P++ +G S H D+ 
Sbjct  181   NYVMNLGYTLLELFSEGLGLKPNHLKEMGCAEGLGILCNYYPKCPQPEVAIGTSRHADND  240

Query  957   fltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVG  1136
             F T+LLQD +GGLQV H++ WVDVP   G+L+VNIGD+LQL++NDK+KSV HRVLA  +G
Sbjct  241   FFTVLLQDDIGGLQVFHKNQWVDVPPTHGALVVNIGDILQLISNDKYKSVVHRVLANKIG  300

Query  1137  PRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             PRIS+ASFF         ++ YGPI+ELLS++ P  YR
Sbjct  301   PRISIASFFST--GPFATSRIYGPIEELLSKDNPPKYR  336



>ref|XP_009784072.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nicotiana sylvestris]
Length=361

 Score =   356 bits (914),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 189/332 (57%), Positives = 240/332 (72%), Gaps = 8/332 (2%)
 Frame = +3

Query  261   YDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFE  440
             YDR SE+ AF+ +KAGVKGL DAG+ K+PRIF          S  +    Q  IPVID +
Sbjct  9     YDRTSELIAFDSTKAGVKGLVDAGVEKVPRIFYTPEDAYTVASN-DPEKSQINIPVIDLD  67

Query  441   GLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFH  614
             G+  +  +R  IV  I+   E WGFFQV+NHGIP++V+ +ML  V+ F+EQD E+KK ++
Sbjct  68    GISKDPIKRSAIVEKIR---EVWGFFQVVNHGIPESVLQEMLNGVRRFYEQDTEVKKRWY  124

Query  615   SRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMSL  794
             +RD  K+V YNSNFDL  AA+ANWRD+ YC MAPDPP  +ELP  CRDI+I+Y+EH+  L
Sbjct  125   TRDTSKRVVYNSNFDLFGAASANWRDTTYCSMAPDPPTADELPEACRDILIEYSEHIKKL  184

Query  795   GYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltlll  974
             G +LFELLSEALGL   +L  +GCSEGL ++ HYYP CPEP+LTLG S H+DS F T+LL
Sbjct  185   GCSLFELLSEALGLKPSYLNDIGCSEGLAVLYHYYPACPEPELTLGTSKHSDSDFFTVLL  244

Query  975   qdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISVA  1154
             QD  GGLQVLH++ WVDV    G+L+VN G++LQL++NDKFKS+ HRVLA  VGPR+SVA
Sbjct  245   QDNSGGLQVLHDNYWVDVHPLSGALVVNFGELLQLISNDKFKSIAHRVLASRVGPRVSVA  304

Query  1155  SFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              FF         ++ YGPIKELLSE+ PA YR
Sbjct  305   CFFTT--GHSLSSRVYGPIKELLSEDNPARYR  334



>ref|XP_002276308.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1 [Vitis vinifera]
Length=353

 Score =   355 bits (912),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 181/333 (54%), Positives = 250/333 (75%), Gaps = 6/333 (2%)
 Frame = +3

Query  258   EYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDF  437
             EYDR+SE++AF+DSK+GVKGL D G+TKIP +F+  H     ++ + +A  QF +P+ID 
Sbjct  9     EYDRKSELKAFDDSKSGVKGLLDGGMTKIPLMFI--HPRYNPDAKSESAVSQFRVPLIDL  66

Query  438   EGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPF  611
             +G+  N   R +I++ ++ ACENWGFFQV+NHGIP +V+++M++ ++ FHEQD ++KK F
Sbjct  67    DGVKDNATVRAKIIDQVRGACENWGFFQVVNHGIPASVLEEMIDGIRGFHEQDTQMKKEF  126

Query  612   HSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMS  791
             ++RD K KV++ SNFDL  A  A W+DSL   M P+PP+P E P VCRDI+ +Y++ V  
Sbjct  127   YTRDFKDKVSFVSNFDLFEATAATWKDSLSWPMVPNPPDPTEFPAVCRDIVTEYSKQVKR  186

Query  792   LGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltll  971
             LGYTLFELLSE LGL ++HLK  GC+E +F +GHYYPPCPEP+LTLG S H DSGFLT+L
Sbjct  187   LGYTLFELLSEGLGLHVNHLKDTGCAEVIFHVGHYYPPCPEPELTLGASRHADSGFLTVL  246

Query  972   lqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISV  1151
             LQDQ+GGLQVLH++ W+D+   PG+L++N+G  LQ++TND+FKS+ HRVLA  V  R+S+
Sbjct  247   LQDQVGGLQVLHQNQWIDLVPMPGALVINVGFSLQVITNDRFKSIEHRVLANRVSSRVSM  306

Query  1152  ASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             AS F         +K Y PIKELL++E P  Y+
Sbjct  307   ASAFGTTLFP--SSKLYSPIKELLTQENPPKYK  337



>gb|ABV25958.1| D4H-like protein [Catharanthus roseus]
 gb|ADV69113.1| desacetoxyvindoline-4-hydroxylase-like protein [Catharanthus 
roseus]
Length=372

 Score =   356 bits (913),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 191/338 (57%), Positives = 245/338 (72%), Gaps = 6/338 (2%)
 Frame = +3

Query  249   MQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFV--I  422
             M+   +   E++AF+D+KAGVK L D+G+T+IPRIFL+  + L++ S+ +   P+F   I
Sbjct  1     MKELNNSEEELKAFDDTKAGVKALVDSGITEIPRIFLDHPTNLDQISSKDRE-PKFKKNI  59

Query  423   PVIDFEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFE  596
             PVID +G+  N   R EIV  I++A E WGFFQ++NHGIP  VMD M+  ++ FHEQD E
Sbjct  60    PVIDLDGISTNSEIRREIVEKIREASEKWGFFQIVNHGIPQEVMDDMIVGIRRFHEQDNE  119

Query  597   LKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYA  776
             +KK F++RD  K   Y SNF L      NWRD+  C MAP  P P++LP++CRDIM+KY 
Sbjct  120   IKKQFYTRDRTKSFRYTSNFVLNPKIACNWRDTFECTMAPHQPNPQDLPDICRDIMMKYI  179

Query  777   EHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSg  956
              +  +LG TLFELLSEALGL  + LK M C EG+ ++GHYYP CP+P+LTLG S HTD+G
Sbjct  180   SYTRNLGLTLFELLSEALGLKSNRLKDMHCDEGVELVGHYYPACPQPELTLGTSKHTDTG  239

Query  957   fltlllqdqlgglqvlHED-VWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPV  1133
             FLT+L QDQ+GGLQVL+E+  WVDVPF PG+LI+NIGD LQ+++NDKFKS  HRVLA   
Sbjct  240   FLTMLQQDQIGGLQVLYENHQWVDVPFIPGALIINIGDFLQIISNDKFKSAPHRVLANKN  299

Query  1134  GPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIY  1247
             GPRIS AS F  +F E  E + YGPIKELLSEE P IY
Sbjct  300   GPRISTASVFMPNFLESAEVRLYGPIKELLSEENPPIY  337



>ref|XP_010475400.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Camelina sativa]
Length=362

 Score =   355 bits (912),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 187/332 (56%), Positives = 240/332 (72%), Gaps = 7/332 (2%)
 Frame = +3

Query  264   DRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFEG  443
             DR  +++AF+D+K GVKGL DAG++++P IF      L   S    ++ +F IP ID +G
Sbjct  8     DRLIQLKAFDDTKTGVKGLVDAGISEVPAIFRAPPVTLA--SPKPPSSSEFTIPTIDLKG  65

Query  444   ---LGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFH  614
                 G   R  +V  I+DA E WGFFQV+NHGIP +V++KM + ++ FHEQD E+KK F+
Sbjct  66    GRGAGSITRRNLVEKIRDAAEKWGFFQVVNHGIPLDVLEKMKKGIREFHEQDTEVKKGFY  125

Query  615   SRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMSL  794
             SRD   K+ Y+SNFDL  ++ ANWRD+L C  APDPP PE+LP  C + MI+Y++ VM L
Sbjct  126   SRDPASKMVYSSNFDLFSSSAANWRDTLGCYTAPDPPRPEDLPATCGETMIEYSKEVMKL  185

Query  795   GYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltlll  974
             G  LFELLSEALGL+ +HLKGM C+  L ++GHYYPPCP+PDLTLGL+ H+D+ FLTLLL
Sbjct  186   GELLFELLSEALGLNTNHLKGMDCTNSLLLLGHYYPPCPQPDLTLGLTKHSDNSFLTLLL  245

Query  975   qdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISVA  1154
             QD +GGLQVLH+  WVDVP  PG+L+VN+GD+LQL+TNDKF SV HRVLA   GPRISVA
Sbjct  246   QDHIGGLQVLHDQYWVDVPPVPGALVVNVGDLLQLITNDKFISVEHRVLANEDGPRISVA  305

Query  1155  SFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              FF  +       + YGPIKE LSE+ P  YR
Sbjct  306   CFFSSYMMA--NPRLYGPIKEHLSEQNPPKYR  335



>ref|XP_008222545.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X1 [Prunus mume]
Length=370

 Score =   355 bits (912),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 186/333 (56%), Positives = 244/333 (73%), Gaps = 5/333 (2%)
 Frame = +3

Query  261   YDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFE  440
             YDR+SE++AF+D+K GVKGL DAG+T +P IF         N+  ++   QF +PVID E
Sbjct  13    YDRKSELKAFDDTKEGVKGLVDAGITVVPTIFHQPPDQYSINNNFDSEATQFSVPVIDLE  72

Query  441   GLGGNR---RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPF  611
             GL  +R   R EIV  + +A E WGFFQ+ NHGIP +V++++ + V+ FHEQD ++KK F
Sbjct  73    GLEFDRPTKRKEIVTKVGEASETWGFFQIANHGIPIDVLEEIKDGVRGFHEQDTQVKKQF  132

Query  612   HSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMS  791
             ++RD  K V YNSNFDL  A  +NWRD+  C MAP+P +PE++P V RDI+I+Y++ VM 
Sbjct  133   YTRDHFKPVVYNSNFDLHRAPASNWRDTFMCYMAPNPTKPEDMPEVFRDILIEYSKQVMK  192

Query  792   LGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltll  971
             LG  LFELLSEALGL   H+  + CS GL ++GHYYP CP+P+LTLG S H DS F+T+L
Sbjct  193   LGKLLFELLSEALGLKPSHMNDIDCSLGLVLVGHYYPSCPQPELTLGTSKHADSDFITVL  252

Query  972   lqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISV  1151
             LQD +GGLQVLH++ W+DVP  PG+L+VNIGD+LQL++N++FKSV HRVLA  VGPR+SV
Sbjct  253   LQDHIGGLQVLHQNKWIDVPPVPGALVVNIGDLLQLISNERFKSVQHRVLANHVGPRVSV  312

Query  1152  ASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             ASFF    Q     + YGPIKELLSE+ P  YR
Sbjct  313   ASFFTTGMQP--LGRLYGPIKELLSEDNPPKYR  343



>ref|XP_002529305.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
 gb|EEF33074.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
Length=363

 Score =   355 bits (911),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 191/339 (56%), Positives = 248/339 (73%), Gaps = 6/339 (2%)
 Frame = +3

Query  240   DSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFV  419
             +S + +EY R SE++AF+D+KAGVKGL DAG+ ++PRIF      L+  + ++   P F 
Sbjct  2     NSPVDSEYCRTSELKAFDDTKAGVKGLVDAGIIEVPRIFHLSSDHLD--NISHTVDPMFN  59

Query  420   IPVIDFEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDF  593
              P ID EG+  +   R EIV+ ++ A E WGFF+V+NHGIP +V+++M E V+ FHEQD 
Sbjct  60    FPRIDLEGVNKDSILRKEIVDKVRHASETWGFFEVVNHGIPVSVLEEMKEGVKRFHEQDV  119

Query  594   ELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKY  773
             ELKK F+SRD  KKV YNSNFDL  +  ANWRDS++  M PDPP+PEELP  CRDI+++Y
Sbjct  120   ELKKEFYSRDYTKKVLYNSNFDLYSSPFANWRDSIFFQMIPDPPKPEELPAACRDILMEY  179

Query  774   AEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDS  953
             ++ V  LG  L EL SEALGL  +HLK M C+EGL I+G+YYP C +P++TLG S H DS
Sbjct  180   SKEVRKLGDLLLELFSEALGLSPNHLKDMECNEGLLIVGNYYPACRQPEITLGASGHADS  239

Query  954   gfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPV  1133
              F T+LLQD +GGLQVLH++ W++VP  P +L+VNIGD++QL+TNDKF SV HRVLA  V
Sbjct  240   DFFTVLLQDHIGGLQVLHQNEWINVPSTPDALVVNIGDLIQLITNDKFISVEHRVLANCV  299

Query  1134  GPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             GPRISVASFF       + ++ YGPIKELLSEE P  YR
Sbjct  300   GPRISVASFFTTTLI--STSRLYGPIKELLSEENPPKYR  336



>gb|ACU19421.1| unknown [Glycine max]
Length=373

 Score =   355 bits (911),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 192/353 (54%), Positives = 259/353 (73%), Gaps = 11/353 (3%)
 Frame = +3

Query  204   MVDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIF-LNKHSILE  380
             MV T+ N   Q    + + YDR++E +AF+DSKAGV+GL ++G+TK PR+F   K  ++E
Sbjct  1     MVVTNTN---QLGETIDSTYDRKAEKKAFDDSKAGVRGLVESGVTKFPRMFHAGKLDVIE  57

Query  381   KNSAANAATPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDK  554
              + +      +  IP+ID + +  N     +++  I+ AC  WGFFQVINHGIP +V+D+
Sbjct  58    TSPSHT----KLSIPIIDLKDIHSNPALHTQVMGKIRSACHEWGFFQVINHGIPISVLDE  113

Query  555   MLESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPE  734
             M+  ++ FHEQD E++K F++RD+KKKV Y SN  L      NWRD+    +APDP +PE
Sbjct  114   MIGGIRRFHEQDAEVRKEFYTRDLKKKVLYYSNISLYSDQPVNWRDTFGFGVAPDPAKPE  173

Query  735   ELPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPE  914
             E+P+VCRDI+I+Y++ +  LG+T+FELLSEALGL+  +LK + C+EGLFI+GHYYP CPE
Sbjct  174   EIPSVCRDIVIEYSKKIRDLGFTMFELLSEALGLNPSYLKELNCAEGLFILGHYYPACPE  233

Query  915   PDLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDK  1094
             P+LT+G + HTDS F+TLLLQDQLGGLQVLH++ WV+VP   G+L+VNIGD+LQL+TNDK
Sbjct  234   PELTMGTTKHTDSNFMTLLLQDQLGGLQVLHQNQWVNVPPVHGALVVNIGDLLQLITNDK  293

Query  1095  FKSVHHRVLAKPVGPRISVASFF-RMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             F SV+HRVL++  GPRISVASFF   H      +K YGPIKELLSEE P IYR
Sbjct  294   FVSVYHRVLSQNTGPRISVASFFVNSHDPVEGTSKMYGPIKELLSEENPPIYR  346



>ref|XP_004299418.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Fragaria vesca subsp. vesca]
Length=360

 Score =   355 bits (910),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 183/333 (55%), Positives = 241/333 (72%), Gaps = 8/333 (2%)
 Frame = +3

Query  264   DRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFEG  443
             DR SE++AF+D+KAGVKGL DAG+  IPRIF ++               +F IP ID +G
Sbjct  6     DRTSELKAFDDTKAGVKGLLDAGVATIPRIFHSRSQPNVDQREGGDDDARFSIPTIDLQG  65

Query  444   ----LGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPF  611
                      R E++  ++ ACE WGFFQV+NHGIP NV+D+++  ++ FHEQD  LKK F
Sbjct  66    GKIEADSALRAEVMEKVRHACEKWGFFQVVNHGIPVNVLDEVIRRIREFHEQDSVLKKEF  125

Query  612   HSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMS  791
             ++R   KKV Y+SN+DL  A++ +WRD+L C MAP+PP+PEELP+VC DI+I+Y++HVM 
Sbjct  126   YTRTPGKKVYYHSNYDLYQASSTDWRDTLGCFMAPNPPKPEELPSVCSDIVIEYSKHVME  185

Query  792   LGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltll  971
             LG TLFE+LSE+LGL+ ++LK M C+EGL ++GH YP CPEP+LT G S HTD  F+T+L
Sbjct  186   LGLTLFEILSESLGLNPNYLKDMNCAEGLLLLGHCYPACPEPELTFGASKHTDGTFITIL  245

Query  972   lqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISV  1151
             LQDQ+GGLQ L+E+ WV+VP   G+L+VN+GD+LQL+TNDKF S+ HRV A   GPR SV
Sbjct  246   LQDQVGGLQALYENRWVNVPPMHGALVVNVGDLLQLITNDKFVSLAHRVRANNAGPRTSV  305

Query  1152  ASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             ASFFR         K +GPI ELLSEE P IY+
Sbjct  306   ASFFRSE----RNTKVFGPINELLSEENPQIYQ  334



>gb|KFK42774.1| hypothetical protein AALP_AA1G037800 [Arabis alpina]
Length=361

 Score =   354 bits (909),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 187/332 (56%), Positives = 239/332 (72%), Gaps = 4/332 (1%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVID  434
              ++D  SE +AF+++KAGVKGL DA +T+IPRIF +    L+ N   N +   F +P+ID
Sbjct  7     TQFDSYSERKAFDETKAGVKGLVDAQITEIPRIFHDPLGTLD-NKQPNVSASDFAVPIID  65

Query  435   FEGLGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFH  614
             F GL  +R   +V  IKDA E WGFFQVINHGIP  V+ ++ + V+ FHE+D E+KK + 
Sbjct  66    FAGLNMSRE-SVVEKIKDAAEKWGFFQVINHGIPLAVLKEIKDGVRRFHEEDLEVKKSYF  124

Query  615   SRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMSL  794
             SRD  KK  Y+SNF+L  ++T NWRD+    M P+PP+PEELP  CRD +++Y++HVMSL
Sbjct  125   SRDFTKKFVYHSNFNLYSSSTINWRDTFGTYMDPNPPKPEELPEACRDGVMEYSKHVMSL  184

Query  795   GYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltlll  974
             G  LFELLSEALGL  + LK  GC +G+ ++ HYYPPCP+PDLTLG S H+D+ F+T+LL
Sbjct  185   GGLLFELLSEALGLSSEMLKSKGCMKGVLMLSHYYPPCPQPDLTLGTSKHSDNSFITILL  244

Query  975   qdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISVA  1154
             QDQ+GGLQVLH+D WVDV   PG+L++NIGD LQL+TNDKF SV HRVLA   GPRISVA
Sbjct  245   QDQIGGLQVLHQDSWVDVSPLPGALVINIGDFLQLITNDKFISVQHRVLANEAGPRISVA  304

Query  1155  SFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             SF             YGP+KELLSEE P  YR
Sbjct  305   SFLSTSMHPN--LTVYGPMKELLSEENPPKYR  334



>ref|XP_009347730.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Pyrus x bretschneideri]
Length=364

 Score =   354 bits (908),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 189/334 (57%), Positives = 246/334 (74%), Gaps = 9/334 (3%)
 Frame = +3

Query  264   DRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFL--NKHSILEKNSAANAATPQFVIPVIDF  437
             DR SE++AF+D+KAGVKGL DAG TKIPRIF   ++H   +  + A        IPVID 
Sbjct  7     DRISELKAFDDTKAGVKGLLDAGFTKIPRIFYCPSRH---DHETEATGEKATLSIPVIDL  63

Query  438   EGLGGN---RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKP  608
             +G+  N    R  +++ ++ A E WGFFQV+NHGIP  V+++M++ V+ FHE D ELKK 
Sbjct  64    QGIHQNDPASRPRVIDEVRVASEKWGFFQVVNHGIPVEVLNRMIDGVREFHELDIELKKE  123

Query  609   FHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVM  788
             F+SRD  +KV + SN D+  +  ANW+D+L C +APDPP+PEELP+VCR+I+  Y++ VM
Sbjct  124   FYSRDFARKVFFMSNRDMYHSLEANWKDTLVCYVAPDPPKPEELPSVCREIVNDYSKQVM  183

Query  789   SLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltl  968
              LG+ LFELLSEALGL+ +HLK M C+EGL  + HYYP CPEPDLTLG   HTD  F+T+
Sbjct  184   DLGFILFELLSEALGLNSNHLKNMDCAEGLIQLCHYYPACPEPDLTLGTGKHTDGTFITI  243

Query  969   llqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRIS  1148
             LLQDQ GGLQVL+++ WV+VP   G+LIVNIGD LQL+ NDK+ SV HRV++K VGPRIS
Sbjct  244   LLQDQTGGLQVLYDNRWVNVPPKEGALIVNIGDFLQLMANDKYTSVPHRVISKSVGPRIS  303

Query  1149  VASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             VASFFR +   G ++K Y PIKEL++EE P  YR
Sbjct  304   VASFFRPYVVAG-KSKAYAPIKELVTEENPQFYR  336



>ref|XP_009119045.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1 [Brassica rapa]
Length=363

 Score =   354 bits (908),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 182/331 (55%), Positives = 240/331 (73%), Gaps = 6/331 (2%)
 Frame = +3

Query  264   DRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFEG  443
             DR  +++AF+++K GVKGL +AG+++IP IF    + ++  +  +++  QF IP ID +G
Sbjct  10    DRSVQLKAFDETKTGVKGLVEAGISEIPAIFRAPPATIKTPTPPSSS--QFTIPTIDLQG  67

Query  444   --LGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFHS  617
                    R  +V  I DA E WGFFQVINHGIP +V+++M E V+ FHE D E++K F+S
Sbjct  68    GSTDSTSRRSLVEKIGDAAERWGFFQVINHGIPLDVLERMKEGVREFHELDPEVRKGFYS  127

Query  618   RDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMSLG  797
             RD   K+ Y+SNFDL  +  ANWRD+L C  APDPP PE+LP  C ++MI+Y++ VM +G
Sbjct  128   RDPSNKLVYSSNFDLYSSPAANWRDTLGCYTAPDPPRPEDLPAACGEVMIEYSKEVMKVG  187

Query  798   YTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltlllq  977
               LFELLSEALGL+ +HLK M C+  L ++GHYYPPCP+PDLTLGL+ H+D+ FLT+LLQ
Sbjct  188   KMLFELLSEALGLNTNHLKDMDCTNSLLLLGHYYPPCPQPDLTLGLTKHSDNSFLTVLLQ  247

Query  978   dqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISVAS  1157
             D +GGLQVLH+  WVDVP  PG+L++N+GD+LQL+TN KF SV HRVLA   GPRISVA 
Sbjct  248   DNVGGLQVLHDQYWVDVPPVPGALVINVGDLLQLITNGKFISVEHRVLANGAGPRISVAC  307

Query  1158  FFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             FF  +       + YGPIKELLSEE P IYR
Sbjct  308   FFSSYLMA--NPRVYGPIKELLSEENPPIYR  336



>ref|XP_006418138.1| hypothetical protein EUTSA_v10008015mg [Eutrema salsugineum]
 gb|ESQ36491.1| hypothetical protein EUTSA_v10008015mg [Eutrema salsugineum]
Length=360

 Score =   353 bits (907),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 187/336 (56%), Positives = 242/336 (72%), Gaps = 5/336 (1%)
 Frame = +3

Query  249   MQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPV  428
             M  E+D  SE +AF+++KAGVKGL DA +T+IPRIF +    L  +  A  A  +F IP+
Sbjct  1     MATEFDSYSERKAFDETKAGVKGLVDAQITEIPRIFHDPLGTL-NDKKAPVANSEFAIPI  59

Query  429   IDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELK  602
             IDF G+ G+   R  +V  +KDA E WGFFQVINHG+P  V++++ + V+ FHE+D E+K
Sbjct  60    IDFTGVHGDAASREAVVKKVKDAAEKWGFFQVINHGVPLTVLEEIKDGVRKFHEEDIEVK  119

Query  603   KPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEH  782
             K + SRD  KK  Y+SNF+L  +++ NWRD+    M P PP+PEE+P  CR+ +++Y++H
Sbjct  120   KSYFSRDFSKKFVYHSNFNLYSSSSINWRDTFGIYMDPKPPQPEEIPEACREGVLEYSKH  179

Query  783   VMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfl  962
             VMSLG  LFELLSEALGL  D LK  GC +G+ ++ HYYPPCP+P LTLG S H+D+ FL
Sbjct  180   VMSLGGLLFELLSEALGLSSDTLKSKGCMKGVLMLSHYYPPCPQPKLTLGTSKHSDNSFL  239

Query  963   tlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPR  1142
             T+LLQDQ+GGLQVLH+D WVDV   PG+L++NIGD LQL+TND+F SV HRVLA   GPR
Sbjct  240   TVLLQDQIGGLQVLHQDCWVDVTPTPGALVINIGDFLQLVTNDRFISVQHRVLANKAGPR  299

Query  1143  ISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             ISVASFF            YGP+KELLSEE PA YR
Sbjct  300   ISVASFFSTSMHPN--PTVYGPMKELLSEENPAKYR  333



>emb|CBI23601.3| unnamed protein product [Vitis vinifera]
Length=387

 Score =   354 bits (909),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 177/264 (67%), Positives = 221/264 (84%), Gaps = 1/264 (0%)
 Frame = +3

Query  459   RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFHSRDVKKKV  638
             R +I+  + +ACE WGFFQV+NHGIP++V++ M++ ++ FHEQD E KK ++SRD +KKV
Sbjct  57    RTQIIKKVGEACEKWGFFQVVNHGIPESVLNDMIDGIRRFHEQDAETKKEYYSRDFQKKV  116

Query  639   TYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMSLGYTLFELL  818
              +NSNFDL  A  ANWRDSL C+MAP+PP PE+LP VCRDI+++Y+E VM LG TLFELL
Sbjct  117   RFNSNFDLYQARMANWRDSLACVMAPNPPLPEQLPAVCRDIVMEYSEQVMKLGLTLFELL  176

Query  819   SEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltlllqdqlgglq  998
             SEALGL+ +HLK M C+EGLF++GHYYP CPEP+LTLG SSHTDS F T+LLQDQ+GGLQ
Sbjct  177   SEALGLNPNHLKDMECAEGLFLLGHYYPACPEPELTLGTSSHTDSDFFTILLQDQMGGLQ  236

Query  999   vlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISVASFFRMHFQ  1178
             VLHED WVDVP  PG+L++N+GD+LQL++ND+FKS+ HRVLAK VGPRISVASFFR   +
Sbjct  237   VLHEDQWVDVPPIPGALVINMGDLLQLVSNDRFKSIFHRVLAKNVGPRISVASFFRKSHR  296

Query  1179  EGNEAKTYGPIKELLSEEKPAIYR  1250
             E N ++ YGPIKELLSEE P IYR
Sbjct  297   ENN-SRLYGPIKELLSEENPPIYR  319



>gb|AFK38092.1| unknown [Lotus japonicus]
Length=373

 Score =   354 bits (908),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 186/339 (55%), Positives = 246/339 (73%), Gaps = 6/339 (2%)
 Frame = +3

Query  240   DSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFV  419
             +  ++   DR  E++AF+++KAGVKGL D G+TKIP +F +      K  A+N+   + V
Sbjct  12    EGTVKVNSDRLRELQAFDETKAGVKGLIDEGITKIPSLFHHPPDKFVK--ASNSDKTEHV  69

Query  420   IPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDF  593
             IPVID   +G +   R E+++ I++ACE WGFFQV NHGI  +V+++M E V+ F+EQD 
Sbjct  70    IPVIDLANVGKDPSEREEVISKIREACETWGFFQVANHGIHVSVLEEMKEGVRRFYEQDA  129

Query  594   ELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKY  773
             E+KK  +SRD K+ V YNSN+DL  +   +WRD+  C +AP+PP+PE+LP  CRDI+++Y
Sbjct  130   EVKKELYSRDQKRPVVYNSNYDLYSSPALSWRDTFVCDLAPNPPKPEDLPVACRDILLEY  189

Query  774   AEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDS  953
               +VM LG  LFELLSEALGL  +HLK M C+EGLF + HYYP CPEPDLT+G + H+D 
Sbjct  190   GTNVMRLGIVLFELLSEALGLHPNHLKDMSCTEGLFSLCHYYPACPEPDLTMGTTKHSDG  249

Query  954   gfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPV  1133
              FLT+LLQD +GGLQVL++D WVD+P  PG+L+VNIGD+LQL+TND+ KSV HRVLA  +
Sbjct  250   SFLTVLLQDHIGGLQVLYQDNWVDIPPVPGALVVNIGDLLQLITNDRLKSVEHRVLANRI  309

Query  1134  GPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             GPRISVA FFR   Q  +  K YGPIKEL SE  P  YR
Sbjct  310   GPRISVAMFFRSGLQ--SSTKLYGPIKELSSENNPPKYR  346



>ref|XP_010557155.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Tarenaya hassleriana]
Length=370

 Score =   353 bits (907),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 184/336 (55%), Positives = 245/336 (73%), Gaps = 7/336 (2%)
 Frame = +3

Query  258   EYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHS-ILEKNSAANAATPQFVIPVID  434
             EYDR S+++AF+D+K GVKGL DAG+ +IPRIF +  + +++    ++ + PQ  IP ID
Sbjct  10    EYDRESDLKAFDDAKTGVKGLVDAGIVEIPRIFRHPSANLIDAKPLSSVSPPQLTIPTID  69

Query  435   FEGL---GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKK  605
              +G+     N R  +V+ I++A E WGFFQVINHGIP +V+++M + V  FHEQD E+KK
Sbjct  70    LDGMLHGDSNTRKNLVDNIREAAEKWGFFQVINHGIPSHVLEEMNDGVVRFHEQDPEVKK  129

Query  606   PFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
              F++RD  KKV YNSNFDL  +  A WRD+  C ++PDPP  E++P  CRDIM+++ + V
Sbjct  130   GFYTRDPTKKVVYNSNFDLYSSPAATWRDTFGCYLSPDPPRLEDMPTTCRDIMMEFGKGV  189

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgflt  965
             M +   LFELLSEALGL  +HLK M C++ L ++ HYYPPCP+PDLTLGLS H+D+ FLT
Sbjct  190   MKVAELLFELLSEALGLMPNHLKDMDCAKALLMLCHYYPPCPQPDLTLGLSKHSDNSFLT  249

Query  966   lllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAK-PVGPR  1142
             ++LQD  GGLQVLH D WVDVP  PG+L+VN+GD+LQL+TNDKF S  HRVLAK   GPR
Sbjct  250   VVLQDNNGGLQVLHGDNWVDVPPVPGALVVNVGDLLQLITNDKFISAEHRVLAKRGNGPR  309

Query  1143  ISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              SVA FF  +      ++ YGP+KEL+SE+ PA YR
Sbjct  310   TSVACFFSTYLMP--NSRLYGPMKELVSEQNPAKYR  343



>ref|XP_008338503.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Malus domestica]
Length=371

 Score =   353 bits (907),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 182/342 (53%), Positives = 237/342 (69%), Gaps = 10/342 (3%)
 Frame = +3

Query  243   SIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFL-----NKHSILEKNSAANAAT  407
             +++   YDR+SEV+AF+D+K GVKGL DAG+T++PRIF      + H  +   S+ + AT
Sbjct  7     NVVPTIYDRKSEVKAFDDTKEGVKGLVDAGITEVPRIFYQPPEPDDHYSINITSSDSQAT  66

Query  408   PQFVIPVIDFEGLGG-NRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHE  584
              QF IPVID E LG   +R EIV  + +A E WGFFQ+ NHGI   V++++ + V+ F+E
Sbjct  67    -QFSIPVIDLECLGSPTKRKEIVAKVGEASETWGFFQIENHGISAGVLEEIKDGVRGFYE  125

Query  585   QDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIM  764
             QD  +KK  ++R+  + V Y+SNFDL  A   NWRDS  C MAP+PP+PE+LP VCRDI+
Sbjct  126   QDTRVKKELYTRNHFRPVIYHSNFDLYTAPATNWRDSFMCYMAPNPPKPEDLPEVCRDIL  185

Query  765   IKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSH  944
             ++Y++ VM LG  LFELLSEALGL   HL  + CSEGL +IGHYYP CP+P+LTLG S H
Sbjct  186   VEYSKQVMKLGKLLFELLSEALGLKPSHLLDIDCSEGLQVIGHYYPACPQPELTLGTSKH  245

Query  945   TDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLA  1124
              DS     +L     G   +H + W+DVP  PG+L+VNIGD+LQL++ND+F+SV HRVLA
Sbjct  246   ADS-DFLTILLQDHIGGLQVHHNRWIDVPPVPGALVVNIGDLLQLISNDRFRSVEHRVLA  304

Query  1125  KPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
                GPRISVASFF         A+ YGPIKELLSEE P  YR
Sbjct  305   NRAGPRISVASFFITGLLPS--ARLYGPIKELLSEENPPKYR  344



>gb|AAC49827.1| desacetoxyvindoline 4-hydroxylase, partial [Catharanthus roseus]
Length=382

 Score =   353 bits (907),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 184/337 (55%), Positives = 250/337 (74%), Gaps = 6/337 (2%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVID  434
             +E +   E++AF+++KAGVKG+ D G+TKIPRIF+++   L++ S     +    IPVI+
Sbjct  18    SEEESLRELKAFDETKAGVKGIVDTGITKIPRIFIDQPKNLDRISVCRGKS-DIKIPVIN  76

Query  435   FEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKP  608
               GL  N   R EIV  I +A E +GFFQ++NHGIP +VMDKM++ V+ FHEQD ++K+ 
Sbjct  77    LNGLSSNSEIRREIVEKIGEASEKYGFFQIVNHGIPQDVMDKMVDGVRKFHEQDDQIKRQ  136

Query  609   FHSRD-VKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
             ++SRD   K   Y+SN+ L+     NWRD++ CIM  + P+P+E P+VCRDI++KY+ +V
Sbjct  137   YYSRDRFNKNFLYSSNYVLIPGIACNWRDTMECIMNSNQPDPQEFPDVCRDILMKYSNYV  196

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgflt  965
              +LG  LFELLSEALGL  +HL+ M C+EGL ++GHYYP CP+P+LT G S H+DSGFLT
Sbjct  197   RNLGLILFELLSEALGLKPNHLEEMDCAEGLILLGHYYPACPQPELTFGTSKHSDSGFLT  256

Query  966   lllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRI  1145
             +L+QDQ+GGLQ+L E+ W+DVPF PG+L++NI D+LQL+TNDKFKSV HRVLA  VGPRI
Sbjct  257   ILMQDQIGGLQILLENQWIDVPFIPGALVINIADLLQLITNDKFKSVEHRVLANKVGPRI  316

Query  1146  SVASFF--RMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             SVA  F  +   QEG   + YGPIKEL+SEE P IY+
Sbjct  317   SVAVAFGIKTQTQEGVSPRLYGPIKELISEENPPIYK  353



>gb|AAC49826.1| desacetoxyvindoline 4-hydroxylase, partial [Catharanthus roseus]
Length=386

 Score =   353 bits (907),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 184/337 (55%), Positives = 250/337 (74%), Gaps = 6/337 (2%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVID  434
             +E +   E++AF+++KAGVKG+ D G+TKIPRIF+++   L++ S     +    IPVI+
Sbjct  22    SEEESLRELKAFDETKAGVKGIVDTGITKIPRIFIDQPKNLDRISVCRGKS-DIKIPVIN  80

Query  435   FEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKP  608
               GL  N   R EIV  I +A E +GFFQ++NHGIP +VMDKM++ V+ FHEQD ++K+ 
Sbjct  81    LNGLSSNSEIRREIVEKIGEASEKYGFFQIVNHGIPQDVMDKMVDGVRKFHEQDDQIKRQ  140

Query  609   FHSRD-VKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
             ++SRD   K   Y+SN+ L+     NWRD++ CIM  + P+P+E P+VCRDI++KY+ +V
Sbjct  141   YYSRDRFNKNFLYSSNYVLIPGIACNWRDTMECIMNSNQPDPQEFPDVCRDILMKYSNYV  200

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgflt  965
              +LG  LFELLSEALGL  +HL+ M C+EGL ++GHYYP CP+P+LT G S H+DSGFLT
Sbjct  201   RNLGLILFELLSEALGLKPNHLEEMDCAEGLILLGHYYPACPQPELTFGTSKHSDSGFLT  260

Query  966   lllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRI  1145
             +L+QDQ+GGLQ+L E+ W+DVPF PG+L++NI D+LQL+TNDKFKSV HRVLA  VGPRI
Sbjct  261   ILMQDQIGGLQILLENQWIDVPFIPGALVINIADLLQLITNDKFKSVEHRVLANKVGPRI  320

Query  1146  SVASFF--RMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             SVA  F  +   QEG   + YGPIKEL+SEE P IY+
Sbjct  321   SVAVAFGIKTQTQEGVSPRLYGPIKELISEENPPIYK  357



>ref|XP_006354512.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Solanum tuberosum]
Length=375

 Score =   353 bits (906),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 185/337 (55%), Positives = 252/337 (75%), Gaps = 11/337 (3%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVID  434
               YDR SE++AF+D+KAGVKG+ DAG+T++PRIF+    I E     ++   +F+ PVID
Sbjct  16    GSYDRMSELKAFDDTKAGVKGIVDAGITEVPRIFVQPTKIEE---CVSSCETKFIFPVID  72

Query  435   FEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKP  608
              EG+  +  +  +IV+ ++DA E WGFFQV+NHGIP +VM+ ML+  + F EQD ++KK 
Sbjct  73    LEGINKDPIKHKQIVDKVRDASETWGFFQVVNHGIPLSVMEVMLQGTRRFFEQDVDIKKQ  132

Query  609   FHSRDVKKKVTYNSNFDLL---VAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAE  779
             +++RD  KKV + SNFDL    V AT NWRDS++C+MAP+ P PEELP  CR+I+++++ 
Sbjct  133   YYTRDNTKKVVHVSNFDLYSPSVPAT-NWRDSIFCLMAPNHPSPEELPIACREILMEFSN  191

Query  780   HVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgf  959
             HVM+LG +LFELLSE LGLD  HL  + CSEGL ++GHYYP CP+P+LT+G + H+D+ F
Sbjct  192   HVMTLGKSLFELLSEGLGLDPSHLNNIDCSEGLRVLGHYYPACPQPELTIGTNKHSDNDF  251

Query  960   ltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGP  1139
             +T+LLQDQ+GGLQVLH+  W+DVP  PG+L+VNIGD+LQL++NDK+ SV HRVL+  VGP
Sbjct  252   ITVLLQDQIGGLQVLHKTQWIDVPPTPGALVVNIGDLLQLISNDKYLSVEHRVLSNKVGP  311

Query  1140  RISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             RISVA FF  +      +K YGPI ELLSE+ P  YR
Sbjct  312   RISVACFF--YTGSMPSSKLYGPITELLSEDNPPKYR  346



>ref|XP_006598206.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Glycine max]
Length=371

 Score =   353 bits (906),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 187/336 (56%), Positives = 243/336 (72%), Gaps = 6/336 (2%)
 Frame = +3

Query  249   MQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPV  428
             M+   DR  E++AF+D+KAGVKGL D G+ KIPR+F   H   E   A+     ++ IPV
Sbjct  13    MELNPDRLGELKAFDDTKAGVKGLVDEGVAKIPRLF--HHPPDEFVRASKLGNTEYTIPV  70

Query  429   IDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELK  602
             ID E +G +   R EI+  I++A E WGFFQV+NHGIP  V++ + + VQ FHEQD E K
Sbjct  71    IDLEEVGKDPSSRQEIIGRIREASERWGFFQVVNHGIPVTVLEDLKDGVQRFHEQDIEEK  130

Query  603   KPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEH  782
             K  ++RD  K + YNSNFDL  +   NWRDS  C +AP+PP+PE+LP VCRDI+++Y  +
Sbjct  131   KELYTRDHMKPLVYNSNFDLYSSPALNWRDSFMCYLAPNPPKPEDLPVVCRDILLEYGTY  190

Query  783   VMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfl  962
             VM LG  LFELLSEALGL  DHLK +GC+EGL  + HYYP CPEPDLTLG + H+D+ FL
Sbjct  191   VMKLGIALFELLSEALGLHPDHLKDLGCAEGLISLCHYYPACPEPDLTLGTTKHSDNCFL  250

Query  963   tlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPR  1142
             T+LLQD +GGLQVL++++W+D+   PG+L+VNIGD+LQL+TND+FKSV HRV A  +GPR
Sbjct  251   TVLLQDHIGGLQVLYQNMWIDITPEPGALVVNIGDLLQLITNDRFKSVEHRVQANLIGPR  310

Query  1143  ISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             ISVA FF    +  +  K YGPIKELL+E+ P  YR
Sbjct  311   ISVACFFSEGLK--SSPKPYGPIKELLTEDNPPKYR  344



>ref|XP_003521041.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1 [Glycine max]
Length=378

 Score =   353 bits (906),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 185/348 (53%), Positives = 248/348 (71%), Gaps = 6/348 (2%)
 Frame = +3

Query  216   SNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAA  395
             S N  +   + +  +YDR SE++AF+D++ GV GL DAG+TKIP IF N  +     S  
Sbjct  4     SGNNEVLVTTKVVVDYDRASELKAFDDTQDGVMGLTDAGVTKIPLIFHNPKNSHHDESDD  63

Query  396   NAATPQFVIPVIDFEGLG---GNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLES  566
              + + Q  +P ID  G+      R+V +V  I+ ACE WGFFQV+NHGIP +V+++M   
Sbjct  64    GSGSTQLSVPSIDLVGVAEDPATRKV-VVEKIRQACETWGFFQVVNHGIPLSVLEEMKSG  122

Query  567   VQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPN  746
             V  F+EQD E+K+  ++RD  + + YNSNFDL  +  ANWRD+ YC MAP PP+PE+LP+
Sbjct  123   VNRFYEQDSEVKRELYTRDPLRPLVYNSNFDLFTSPAANWRDTFYCFMAPHPPKPEDLPS  182

Query  747   VCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLT  926
             VCRDI+++YA+ V  LG  LFELLSEAL L+ ++L  +GC+EGL ++ H YP CPEP+LT
Sbjct  183   VCRDILLEYAKEVKKLGSVLFELLSEALELNPNYLNDIGCNEGLTLVCHCYPACPEPELT  242

Query  927   LGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSV  1106
             LG + HTD+ F+T+LLQD +GGLQVLHE+ WVDV   PG+L++NIGD+LQL+TNDKFKSV
Sbjct  243   LGATKHTDNDFITVLLQDHIGGLQVLHENRWVDVSPVPGALVINIGDLLQLITNDKFKSV  302

Query  1107  HHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              HRV+A  VGPR+SVASFF    Q     K YGPIK+L+SE+ P  YR
Sbjct  303   EHRVVANRVGPRVSVASFFSTSLQPS--TKLYGPIKDLVSEDNPPKYR  348



>ref|XP_006586237.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
12-like [Glycine max]
Length=379

 Score =   353 bits (906),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 185/355 (52%), Positives = 258/355 (73%), Gaps = 10/355 (3%)
 Frame = +3

Query  207   VDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKN  386
             ++  N   L+++  M + YDR++EV+AF+DSKAGVKGL ++G+TKIPR+F +    L+  
Sbjct  1     MEVKNTNQLEKN--MDSTYDRKAEVKAFDDSKAGVKGLVESGVTKIPRMFHSGKLDLDII  58

Query  387   SAANAATPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKML  560
               +   + + +IP+IDF+ +  N   R E++  I+ AC  WGFFQVINHGIP +V+D+M+
Sbjct  59    ETSGGDS-KLIIPIIDFKDIHSNPALRSEVIGKIRSACHEWGFFQVINHGIPISVLDEMI  117

Query  561   ESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEEL  740
             + ++ FHEQD E +K F++RD KKKV Y SN  L      NWRD++   ++PDPP+PE +
Sbjct  118   DGIRRFHEQDTEARKEFYTRDSKKKVVYFSNLGLHSGNPVNWRDTIGFAVSPDPPKPEHI  177

Query  741   PNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPD  920
             P+VCRDI+I+Y + +  +G+T+FELLSEALGL+  +L  + C EGLF +G+YYP CPEP+
Sbjct  178   PSVCRDIVIEYTKKIRDVGFTIFELLSEALGLNSSYLNELSCGEGLFTVGNYYPACPEPE  237

Query  921   LTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFK  1100
             LT+G + HTD  F+TLLLQDQ+GGLQVLH++ WV++P   G+L+VN+GD+LQL+TNDKF 
Sbjct  238   LTMGAAKHTDGNFMTLLLQDQIGGLQVLHQNQWVNLPPVHGALVVNVGDLLQLITNDKFV  297

Query  1101  SVHHRVLAKPVGPRISVASFFRMHFQEGNE-----AKTYGPIKELLSEEKPAIYR  1250
             SV HRVL+K   PRISVASFF   F   ++      K YGPIKEL+SEE P IYR
Sbjct  298   SVCHRVLSKKTCPRISVASFFGTFFGHSDDPVEGLQKLYGPIKELISEENPPIYR  352



>ref|XP_008222546.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X2 [Prunus mume]
Length=370

 Score =   353 bits (905),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 185/333 (56%), Positives = 243/333 (73%), Gaps = 5/333 (2%)
 Frame = +3

Query  261   YDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFE  440
             YDR+SE++AF+D+K GVKGL DAG+T +P IF         N+  ++   QF +PVID E
Sbjct  13    YDRKSELKAFDDTKEGVKGLVDAGITVVPTIFHQPPDQYSINNNFDSEATQFSVPVIDLE  72

Query  441   GLGGNR---RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPF  611
             GL  +R   R EIV  + +A E WGFFQ+ NHGIP +V++++ + V+ FHEQD ++KK F
Sbjct  73    GLEFDRPTKRKEIVTKVGEASETWGFFQIANHGIPIDVLEEIKDGVRGFHEQDTQVKKQF  132

Query  612   HSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMS  791
             ++RD  K V YNSNFDL  A  +NWRD+  C MAP+P +PE++P V RDI+I+Y++ VM 
Sbjct  133   YTRDHFKPVVYNSNFDLHRAPASNWRDTFMCYMAPNPTKPEDMPEVFRDILIEYSKQVMK  192

Query  792   LGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltll  971
             LG  LFELLSEALGL   H+  + CS GL ++GHYYP CP+P+LTLG S H DS F+T+L
Sbjct  193   LGKLLFELLSEALGLKPSHMNDIDCSLGLVLVGHYYPSCPQPELTLGTSKHADSDFITVL  252

Query  972   lqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISV  1151
             LQD +GGLQVLH++ W+DVP  PG+L+VNIGD+LQL++N++FKSV HRVLA  VGPR+SV
Sbjct  253   LQDHIGGLQVLHQNKWIDVPPVPGALVVNIGDLLQLISNERFKSVQHRVLANHVGPRVSV  312

Query  1152  ASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             ASFF          + YGPIKELLSE+ P  YR
Sbjct  313   ASFFSTGMLP--LGRLYGPIKELLSEDNPPKYR  343



>ref|XP_010486415.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Camelina sativa]
Length=362

 Score =   352 bits (904),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 187/332 (56%), Positives = 239/332 (72%), Gaps = 7/332 (2%)
 Frame = +3

Query  264   DRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFEG  443
             DR  +++AF+D+K GVKGL DAG++++P IF      L   S    ++ +F IP ID +G
Sbjct  8     DRSIQLKAFDDTKTGVKGLVDAGISEVPAIFRAPPVTLA--SPKPPSSSEFTIPTIDLKG  65

Query  444   LGGN---RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFH  614
              GG     R  +V  I+DA E WGFFQV+NHGIP +V++KM E ++ FHEQD E+KK F+
Sbjct  66    GGGADSITRRNLVEKIRDAAEKWGFFQVVNHGIPLDVLEKMKEGIREFHEQDTEVKKGFY  125

Query  615   SRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMSL  794
             SRD   K+ Y+SNFDL  ++ ANWRD+L C  APDPP  E+LP  C ++MI+Y++ VM L
Sbjct  126   SRDPASKMVYSSNFDLFSSSAANWRDTLGCYTAPDPPRQEDLPATCGEMMIEYSKEVMKL  185

Query  795   GYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltlll  974
             G  LFELLSEALGL+ +HLK M C+  L ++GHYYPPCP+PDLTLGL+ H+D+ FLTLLL
Sbjct  186   GELLFELLSEALGLNTNHLKDMDCTNSLLLLGHYYPPCPQPDLTLGLTKHSDNSFLTLLL  245

Query  975   qdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISVA  1154
             QD +GGLQVLH   WVDVP  PG+L+VN+GD+LQL+TNDKF SV HRVLA   GPRISVA
Sbjct  246   QDHIGGLQVLHGQYWVDVPPVPGALVVNVGDLLQLITNDKFISVEHRVLANEDGPRISVA  305

Query  1155  SFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              FF  +       + YGPIKELLSE+    YR
Sbjct  306   CFFSSYLMA--NPRLYGPIKELLSEQNHPKYR  335



>ref|XP_009347727.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Pyrus x bretschneideri]
Length=370

 Score =   353 bits (905),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 189/342 (55%), Positives = 246/342 (72%), Gaps = 12/342 (4%)
 Frame = +3

Query  252   QAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIF-----LNKHSILEKNSAANAATPQF  416
                YDR+SEV+AF+++K GVKGL DAG+T++PRIF      + H  +  +S+ + AT QF
Sbjct  5     NTNYDRKSEVKAFDETKEGVKGLVDAGITEVPRIFHRPPESDDHYHINNSSSDSEAT-QF  63

Query  417   VIPVIDFEGL----GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHE  584
              IPVID +GL       +R EIV  + +A E WGFFQ+INH IP  V++++ + V+ F E
Sbjct  64    SIPVIDLQGLDRLDSPTKRKEIVAKVGEASETWGFFQIINHEIPVGVLEEIKDGVRGFFE  123

Query  585   QDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIM  764
              D ++KK  ++RD  K + YNSNFDL  A   NWRD+  C +AP+P +PE+LP VCRDI+
Sbjct  124   LDTQVKKELYTRDPFKPLIYNSNFDLYSAPVTNWRDTFMCYVAPNPTKPEDLPQVCRDIL  183

Query  765   IKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSH  944
             ++Y+  VM LG  LFELLSEALGL   H+  + CSEGL I+GHYYPPCP+P+LT+G SSH
Sbjct  184   VEYSMQVMKLGRLLFELLSEALGLKPSHMNDIDCSEGLVILGHYYPPCPQPELTIGTSSH  243

Query  945   TDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLA  1124
              D+ FLT+LLQD +GGLQVLH+  WVDVP  PG+L+VNIGD+LQL++ND+FKS+ HRVLA
Sbjct  244   ADNDFLTILLQDHIGGLQVLHQSKWVDVPLVPGALVVNIGDLLQLISNDRFKSIQHRVLA  303

Query  1125  KPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
               VGPRISVASFF          K YGPIKELLSE+ P  Y+
Sbjct  304   NRVGPRISVASFFCTGMLP--LTKLYGPIKELLSEDNPPKYK  343



>ref|XP_006350684.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X1 [Solanum tuberosum]
Length=361

 Score =   352 bits (904),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 184/332 (55%), Positives = 243/332 (73%), Gaps = 8/332 (2%)
 Frame = +3

Query  261   YDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFE  440
             YDRRSE+ AF++++AGVKGL DAG+ K+P+IF         +   N    QF IPVID +
Sbjct  9     YDRRSELIAFDNTQAGVKGLVDAGVKKVPKIFYTPQDAYSNDPEKN----QFSIPVIDLD  64

Query  441   GLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFH  614
             G+  +  +  EI+  I+DA E WGFFQV+NHGI  +V+++ML  V+ F+EQD E+KK ++
Sbjct  65    GISKDPIQHKEIIEKIRDASEVWGFFQVVNHGISQSVLEEMLNGVRRFYEQDTEVKKQWY  124

Query  615   SRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMSL  794
             +RD  KKV YNSNFDL  +A+A WRD+ YC MAP PP  +ELP+ CRDI+I+Y E V  L
Sbjct  125   TRDTSKKVVYNSNFDLFKSASAYWRDTTYCNMAPLPPSADELPDACRDILIEYTEQVKKL  184

Query  795   GYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltlll  974
             G +LFELLSEALGL+  +L  +GCSEGL ++ H YP  PEP+LTLG   H+DS FLT+LL
Sbjct  185   GRSLFELLSEALGLNPSYLNDIGCSEGLAVLYHCYPASPEPELTLGAGKHSDSDFLTVLL  244

Query  975   qdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISVA  1154
             QD LGGLQV+H++ WVD+P   G+L+VN+G++LQL++NDK KS+ HRVLA  VGPR+SVA
Sbjct  245   QDHLGGLQVIHKNYWVDIPPVSGALVVNVGELLQLISNDKLKSIAHRVLASGVGPRVSVA  304

Query  1155  SFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             SFF         ++ YGPIKELLS++ PA YR
Sbjct  305   SFFTT--GHSLSSRVYGPIKELLSKDNPARYR  334



>ref|XP_011091187.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Sesamum indicum]
Length=365

 Score =   352 bits (904),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 180/338 (53%), Positives = 244/338 (72%), Gaps = 6/338 (2%)
 Frame = +3

Query  243   SIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVI  422
             S  +A YDR SE++AF+D+K GVKGL D+G+T++PRIF+   +  +KN     +  Q   
Sbjct  5     SQTEANYDRASELKAFDDTKTGVKGLVDSGITQVPRIFITPRNDSDKN--LKPSDSQLKF  62

Query  423   PVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFE  596
             P+ID E +  +  R  ++V+ ++DA   WGFFQVINHGIP +V+++ML+ V+ F+EQD E
Sbjct  63    PIIDLENIDEDPIRHKKVVDEVRDASGTWGFFQVINHGIPGSVLEEMLDGVRKFYEQDPE  122

Query  597   LKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYA  776
              +K +++RD K+ V YNSNFDL  A  ANWRD+ +C MAP PP PEELP VCRDIM +Y 
Sbjct  123   ERKKWYTRDRKRSVVYNSNFDLYSAPAANWRDTFFCKMAPHPPSPEELPAVCRDIMFEYT  182

Query  777   EHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSg  956
             + V+ LG +LF+LLSEALGLD +HL  M C++GL ++ HYYP CP+P+LT+G S H DS 
Sbjct  183   KQVLKLGTSLFKLLSEALGLDANHLGDMKCADGLALLCHYYPFCPQPELTMGASQHADSD  242

Query  957   fltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVG  1136
             FLT+LL D + GLQVL+++ W DVP  PGSL+VN+GD+LQL++ND+  S  HRVLA  V 
Sbjct  243   FLTVLLNDNVTGLQVLYQNQWFDVPSVPGSLVVNVGDLLQLISNDRLISSEHRVLANNVR  302

Query  1137  PRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              R+SVA FFR    + +E   YGPI+ELLSE+ P  YR
Sbjct  303   SRVSVACFFRSDIDKSDE--LYGPIQELLSEDNPPKYR  338



>ref|XP_004246493.2| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Solanum lycopersicum]
Length=367

 Score =   352 bits (904),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 185/342 (54%), Positives = 248/342 (73%), Gaps = 6/342 (2%)
 Frame = +3

Query  231   LQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATP  410
             + + +I   +Y+R +E++AF+ +KAGVKGL DAG+TK+PR+F+    I    S  N    
Sbjct  3     VMKTNIHVEKYERMAELQAFDKTKAGVKGLVDAGITKVPRMFIQPSMIEHSRSENNNKLI  62

Query  411   QFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHE  584
             +F  P+ID +G+  +  ++  IV  +  A E+WGFFQVINHGIP +VMD M + V  F E
Sbjct  63    EF--PIIDLDGIKEDPIKQKNIVQEVGHASESWGFFQVINHGIPSHVMDAMKDGVTRFFE  120

Query  585   QDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIM  764
             QD E+KK +++RD+ K+ T+NSNFDL  A   NWRD+    +AP P +PE+LP+VCRDI+
Sbjct  121   QDTEVKKQWYTRDLNKEFTFNSNFDLFRAPVTNWRDTFRATIAPIPLKPEQLPSVCRDIL  180

Query  765   IKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSH  944
             ++Y   VM LG TLFEL+SEA+GL+ +HLK MGC+EGL  +G YYP CP+P+LTLG S H
Sbjct  181   LEYTNQVMKLGETLFELVSEAVGLEPNHLKDMGCAEGLLALGQYYPACPQPELTLGTSKH  240

Query  945   TDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLA  1124
              D+ FLT+LLQD +GGLQVLH+  WVDVP  PG+L+VNIGD+LQL+TNDKFKSV HRVLA
Sbjct  241   ADNDFLTVLLQDNIGGLQVLHQSHWVDVPPTPGALVVNIGDLLQLITNDKFKSVDHRVLA  300

Query  1125  KPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
               VGPR+S+A FF  +    +  + YGPIKEL+SE+ P  YR
Sbjct  301   NKVGPRVSLACFFMTNCMTTH--RMYGPIKELISEQNPPKYR  340



>ref|XP_010262288.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Nelumbo nucifera]
Length=375

 Score =   352 bits (904),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 180/334 (54%), Positives = 243/334 (73%), Gaps = 4/334 (1%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVID  434
             ++YDR  E++ F+D+KAGVKGL D+G+ K+PRIF++     ++    ++   +  +PVID
Sbjct  15    SDYDRMKELKEFDDTKAGVKGLVDSGIVKVPRIFIDPSLKSDEKLVISSDEKRSTVPVID  74

Query  435   FEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKP  608
               G+  +  RR ++V+ ++ A E WGFFQV+NHGIP +V+D+ML+ V+ F+EQD E++K 
Sbjct  75    LNGIHEDAVRRKDVVDQVRHASETWGFFQVVNHGIPTSVLDEMLQGVRRFNEQDVEVRKR  134

Query  609   FHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVM  788
             F+SRD  KKV YNSNF L  +A  NWRD+ +C+M+P+PP PEE+P VCRDIMIKY+  V 
Sbjct  135   FYSRDTNKKVVYNSNFVLYQSAAVNWRDTFHCLMSPNPPSPEEIPQVCRDIMIKYSGQVE  194

Query  789   SLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltl  968
              L  TL  LLSEAL L   HL  +GC+E   I  HYYP CP+P+LTLG S H D+ F+T+
Sbjct  195   RLAVTLLALLSEALMLKPSHLVDIGCAESHAIACHYYPACPQPELTLGTSKHADNDFITI  254

Query  969   llqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRIS  1148
             LLQD +GGLQVLH++ W+DV    G+L+VNIG +LQ+++ND+FKSV HRV+AK +GPR+S
Sbjct  255   LLQDLIGGLQVLHQNHWLDVTPLRGALVVNIGCVLQIISNDRFKSVEHRVVAKNIGPRVS  314

Query  1149  VASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             VA FF    QE    K YGPIKELLSEE P IYR
Sbjct  315   VACFFPTTIQES--IKKYGPIKELLSEENPPIYR  346



>ref|XP_007226473.1| hypothetical protein PRUPE_ppa027196mg [Prunus persica]
 gb|EMJ27672.1| hypothetical protein PRUPE_ppa027196mg [Prunus persica]
Length=369

 Score =   352 bits (902),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 188/335 (56%), Positives = 244/335 (73%), Gaps = 6/335 (2%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVID  434
               YDR+SE++AF+D+K GVKGL DAG+T +PRIF         N+  + AT QF +PVID
Sbjct  11    TNYDRKSELKAFDDTKEGVKGLVDAGITVVPRIFHQPPDQYSINNFDSEAT-QFSVPVID  69

Query  435   FEGLGGNR---RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKK  605
              EGL   R   R EIV  + +A E WGFFQ++NHGIP +V++++ + V+ F+EQD ++KK
Sbjct  70    LEGLEFGRPTKRKEIVTKVGEASETWGFFQIVNHGIPIDVLEEIKDGVRGFYEQDTQVKK  129

Query  606   PFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
              F++RD  K V YNSNFDL  A   NWRD+  C MAP+P + E++P V RDI+I+Y++ V
Sbjct  130   QFYTRDHFKPVVYNSNFDLHRAPACNWRDTFMCYMAPNPTKAEDMPEVFRDILIEYSKQV  189

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgflt  965
             M LG  LFELLSEALGL   HL  + CS GL ++GHYYP CP+P+LTLG S H DS F+T
Sbjct  190   MKLGKLLFELLSEALGLKPSHLNDIDCSLGLVLVGHYYPSCPQPELTLGTSKHADSDFIT  249

Query  966   lllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRI  1145
             +LLQD +GGLQVLH++ W+DVP  PG+L+VNIGD+LQL++N++FKSV HRVLA  VGPR+
Sbjct  250   VLLQDHIGGLQVLHQNKWIDVPPVPGALVVNIGDLLQLISNERFKSVEHRVLANRVGPRV  309

Query  1146  SVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             SVASFF    Q     + YGPIKELLSE+ P  YR
Sbjct  310   SVASFFTTGMQP--LERLYGPIKELLSEDNPPKYR  342



>ref|XP_004488811.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Cicer arietinum]
Length=373

 Score =   352 bits (902),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 187/332 (56%), Positives = 248/332 (75%), Gaps = 8/332 (2%)
 Frame = +3

Query  267   RRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQF-VIPVIDFEG  443
             R  E++AF+D+KAGVKGL D G+ KIP +F +     EK  A N++  Q  +IPVIDF  
Sbjct  19    RLHELKAFDDTKAGVKGLVDEGVIKIPTLFHHPPDKFEK--ATNSSNTQHNLIPVIDFAN  76

Query  444   LGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFHS  617
             +G +   R EI++ +K+A E WGFFQ++NHGIP +V++ M + V  F+EQDFE+KK  +S
Sbjct  77    IGKDSITRQEIISKVKEASETWGFFQLVNHGIPLSVLEDMKDGVLRFYEQDFEVKKELYS  136

Query  618   RDVKKKVTYNSNFDLLVAATA-NWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMSL  794
             RD  + + YNSNFDL   + A NWRD+  C +AP+ P+PE+ P VCRDI+++Y EH+M L
Sbjct  137   RDQTRSLIYNSNFDLYSNSPALNWRDTFACHLAPNTPKPEDFPVVCRDILLEYGEHIMKL  196

Query  795   GYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltlll  974
             G T+FELLSEALGLD DH+K +GCSEG+ ++ HYYP CPEP+LT+G + H+D+ FLTLLL
Sbjct  197   GMTVFELLSEALGLDKDHVKNLGCSEGIMLLCHYYPACPEPELTMGTTKHSDNSFLTLLL  256

Query  975   qdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISVA  1154
             QD +GGLQVLH+D W D+P  P +L+VNIGD+LQL+TNDKFKSV HRVLA  +GPRISVA
Sbjct  257   QDHIGGLQVLHKDKWFDIPPIPEALVVNIGDLLQLVTNDKFKSVEHRVLANSIGPRISVA  316

Query  1155  SFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              FF    +  ++ K YGPIKELLS++ P  YR
Sbjct  317   CFFMADHR--SKEKLYGPIKELLSQDNPPRYR  346



>gb|KEH17852.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=373

 Score =   352 bits (902),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 189/348 (54%), Positives = 256/348 (74%), Gaps = 10/348 (3%)
 Frame = +3

Query  219   NNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAAN  398
             N   L+E +   + YDR +EV+AF+DSK GVKGL ++G++KIPR+F   H+   + S  +
Sbjct  5     NTNQLEETT--NSTYDREAEVKAFDDSKVGVKGLVESGVSKIPRMF---HTGKMEISEDS  59

Query  399   AATPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQ  572
             A+  +  IP+ID + +  N  RRVE++  I+ AC  WGFFQ+INH IP NV+D+M++ + 
Sbjct  60    ASESKLSIPIIDLKDIHNNPARRVEVIGQIQSACHEWGFFQIINHEIPINVLDEMIDGIS  119

Query  573   HFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVC  752
              FHEQD  ++K F++RD+ KKV Y SN  L     ANWRD+    +AP   +P+E+P +C
Sbjct  120   KFHEQDANVRKDFYTRDLNKKVMYYSNVLLFSGKPANWRDTFGFAIAPHSFKPDEVPPIC  179

Query  753   RDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLG  932
             RDI+I+Y++ + +LG+ +FELLSEALG +  +LK  GC+EGLF +GH+YPPCPEP+LT+G
Sbjct  180   RDIVIEYSQKIKNLGFKIFELLSEALGFNPSYLKEFGCAEGLFTLGHFYPPCPEPELTMG  239

Query  933   LSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHH  1112
              + HTDS F+TLLLQDQLGGLQVLHED WV++P   G+L+VNIGD+LQL+TNDKF SV H
Sbjct  240   STKHTDSTFMTLLLQDQLGGLQVLHEDKWVNIPPIHGALVVNIGDLLQLITNDKFVSVFH  299

Query  1113  RVLAKPVGPRISVASFFRMHFQ--EGNEAKTYGPIKELLSEEKPAIYR  1250
             RVL++ +GPRISVASFF       EG  +K YGPIKELLSEE P IY+
Sbjct  300   RVLSQNIGPRISVASFFLDSRDPIEGT-SKVYGPIKELLSEENPPIYK  346



>sp|O04847.2|DV4H_CATRO RecName: Full=Deacetoxyvindoline 4-hydroxylase [Catharanthus 
roseus]
 gb|AAB97311.1| desacetoxyvindoline-4-hydroxylase [Catharanthus roseus]
Length=401

 Score =   352 bits (904),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 184/337 (55%), Positives = 250/337 (74%), Gaps = 6/337 (2%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVID  434
             +E +   E++AF+++KAGVKG+ D G+TKIPRIF+++   L++ S     +    IPVI+
Sbjct  37    SEEESLRELKAFDETKAGVKGIVDTGITKIPRIFIDQPKNLDRISVCRGKS-DIKIPVIN  95

Query  435   FEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKP  608
               GL  N   R EIV  I +A E +GFFQ++NHGIP +VMDKM++ V+ FHEQD ++K+ 
Sbjct  96    LNGLSSNSEIRREIVEKIGEASEKYGFFQIVNHGIPQDVMDKMVDGVRKFHEQDDQIKRQ  155

Query  609   FHSRD-VKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
             ++SRD   K   Y+SN+ L+     NWRD++ CIM  + P+P+E P+VCRDI++KY+ +V
Sbjct  156   YYSRDRFNKNFLYSSNYVLIPGIACNWRDTMECIMNSNQPDPQEFPDVCRDILMKYSNYV  215

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgflt  965
              +LG  LFELLSEALGL  +HL+ M C+EGL ++GHYYP CP+P+LT G S H+DSGFLT
Sbjct  216   RNLGLILFELLSEALGLKPNHLEEMDCAEGLILLGHYYPACPQPELTFGTSKHSDSGFLT  275

Query  966   lllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRI  1145
             +L+QDQ+GGLQ+L E+ W+DVPF PG+L++NI D+LQL+TNDKFKSV HRVLA  VGPRI
Sbjct  276   ILMQDQIGGLQILLENQWIDVPFIPGALVINIADLLQLITNDKFKSVEHRVLANKVGPRI  335

Query  1146  SVASFF--RMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             SVA  F  +   QEG   + YGPIKEL+SEE P IY+
Sbjct  336   SVAVAFGIKTQTQEGVSPRLYGPIKELISEENPPIYK  372



>ref|XP_002889500.1| hypothetical protein ARALYDRAFT_470412 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65759.1| hypothetical protein ARALYDRAFT_470412 [Arabidopsis lyrata subsp. 
lyrata]
Length=361

 Score =   351 bits (900),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 187/331 (56%), Positives = 237/331 (72%), Gaps = 5/331 (2%)
 Frame = +3

Query  264   DRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFEG  443
             D  SE +AF+++K GVKGL DA +T+IPRIF     +   +   + +   F IP IDFEG
Sbjct  7     DSYSERKAFDETKTGVKGLVDAHITEIPRIFRLPQGVFLSDKKTSVSASDFAIPTIDFEG  66

Query  444   LGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFHSRD  623
             L  +R  +IV  IKDA  NWGFFQVINHG+P NV+++  E V+ FHE+D E+KK + +RD
Sbjct  67    LHVSRD-DIVEKIKDAASNWGFFQVINHGVPLNVLEESQEVVRRFHEEDPEVKKTYFTRD  125

Query  624   VKKKVTYNSNFDLLVAATA-NWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMSLGY  800
               K+  YNSNFDL  +++  NWRDS  C MAPDPP PEELP  CRD M +Y++H+M LG 
Sbjct  126   AAKRFVYNSNFDLYSSSSCVNWRDSFACYMAPDPPNPEELPVACRDAMFEYSKHMMRLGD  185

Query  801   TLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltlllqd  980
              LFELLSEALGL  D LK M C +GL ++ HYYPPCP+PDLT+G ++H+D+ FLT+LLQD
Sbjct  186   LLFELLSEALGLRSDKLKSMDCMKGLLLLCHYYPPCPQPDLTIGTNNHSDNSFLTILLQD  245

Query  981   qlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLA-KPVGPRISVAS  1157
             Q+GGLQ+ H+D WVDV   PG+L++N+GD LQL+TNDKF SV HRVLA +   PRISVAS
Sbjct  246   QIGGLQIHHQDCWVDVSPIPGALVINMGDFLQLITNDKFISVEHRVLANRAATPRISVAS  305

Query  1158  FFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             FF         +  YGPIKE+LSEE P  YR
Sbjct  306   FFSTSMLPN--STVYGPIKEILSEENPPKYR  334



>gb|KHN10894.1| 1-aminocyclopropane-1-carboxylate oxidase like 1 [Glycine soja]
Length=378

 Score =   351 bits (901),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 184/348 (53%), Positives = 248/348 (71%), Gaps = 6/348 (2%)
 Frame = +3

Query  216   SNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAA  395
             S+N  +   + +  +YDR SE++AF+D++ GV GL DAG+TKIP IF N  +     S  
Sbjct  4     SDNNEVLVTTKVVVDYDRASELKAFDDTQDGVMGLTDAGVTKIPLIFHNPKNSHHDESDD  63

Query  396   NAATPQFVIPVIDFEGLG---GNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLES  566
              + + Q  +P ID  G+      R+V +V  I+ ACE WGFFQV+NHGIP +V+++M   
Sbjct  64    GSGSTQLSVPSIDLVGVAEDPATRKV-VVEKIRQACETWGFFQVVNHGIPLSVLEEMKSG  122

Query  567   VQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPN  746
             V  F+EQD E+K+  ++RD  + + YNSNFDL  +  ANWRD+ YC MAP PP+PE+LP+
Sbjct  123   VNRFYEQDSEVKRELYTRDPLRPLVYNSNFDLFTSPAANWRDTFYCFMAPHPPKPEDLPS  182

Query  747   VCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLT  926
             VCRDI+++YA+ V  LG  LFELLSEAL L+ ++L  +GC+EGL ++ H YP CPEP+LT
Sbjct  183   VCRDILLEYAKEVKKLGSVLFELLSEALELNPNYLNDIGCNEGLTLVCHCYPACPEPELT  242

Query  927   LGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSV  1106
             LG + HTD+ F+T+LLQD +GGLQVLHE+ WVDV   PG+L++NIGD+LQL+TNDKFKSV
Sbjct  243   LGATKHTDNDFITVLLQDHIGGLQVLHENRWVDVSPVPGALVINIGDLLQLITNDKFKSV  302

Query  1107  HHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              HRV+A  VGPR+SVASF     Q     K YGPIK+L+SE+ P  YR
Sbjct  303   EHRVVANRVGPRVSVASFVSTSLQPS--TKLYGPIKDLVSEDNPPKYR  348



>gb|KHN22504.1| 1-aminocyclopropane-1-carboxylate oxidase like 1 [Glycine soja]
Length=371

 Score =   351 bits (900),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 190/351 (54%), Positives = 252/351 (72%), Gaps = 9/351 (3%)
 Frame = +3

Query  204   MVDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEK  383
             MV TS N +  E S   + YDR +EV+AF+++K GVKGLFD+G+T IPRIF   H+ +E 
Sbjct  1     MVATSTNQSELETSKKDSTYDRIAEVKAFDETKLGVKGLFDSGITNIPRIF--HHAKVED  58

Query  384   NSAANAATPQFVIPVIDFEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKM  557
             ++        F +P+ID + +  N   RV+ ++ I+ AC+ WGFFQV+NHGI  +++D+M
Sbjct  59    HTETMPNDSNFSVPIIDLQDIDTNSSLRVKALDKIRSACKEWGFFQVVNHGIAVDLLDEM  118

Query  558   LESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEE  737
             +  ++ FHEQD E++K F+SRD+ KKV Y SN  L     ANWRDS+     PDPP PEE
Sbjct  119   ICGIRRFHEQDAEVRKSFYSRDMNKKVRYFSNGTLYRDPAANWRDSI----VPDPPYPEE  174

Query  738   LPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEP  917
             +P VCRDI+I Y+E V +LG+T+FEL SEALGL   +L  +   +G +++ HYYPPCPEP
Sbjct  175   IPAVCRDIVIGYSEKVRALGFTIFELFSEALGLHSSYLNELDSVDGQYLLCHYYPPCPEP  234

Query  918   DLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKF  1097
             +LT+G S HTD  F+T+LLQDQ+GGLQVLH++ WVDVP   GSL+VNIGD+LQL+TND F
Sbjct  235   ELTMGTSKHTDISFMTILLQDQMGGLQVLHQNQWVDVPPVHGSLVVNIGDLLQLITNDMF  294

Query  1098  KSVHHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              SV+HRVL+   GPRISVASFF   FQ+ +  K  GPIKELLSE+ P IYR
Sbjct  295   LSVYHRVLSSHTGPRISVASFFTKSFQQSS-LKVVGPIKELLSEDNPPIYR  344



>ref|XP_002284638.2| PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclopropane-1-carboxylate 
oxidase homolog 1 [Vitis vinifera]
Length=681

 Score =   361 bits (926),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 187/333 (56%), Positives = 251/333 (75%), Gaps = 10/333 (3%)
 Frame = +3

Query  258   EYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDF  437
             +YDR SE++AF++SK GVKGL DAG++K+PR+F     I   +++ +  T QF  PVID 
Sbjct  12    DYDRASELKAFDESKEGVKGLVDAGVSKVPRMF-----IRPPDNSRDCNT-QFKFPVIDL  65

Query  438   EGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPF  611
              G+  +  RR +IV M+++A E WG F V+NHGIP +V+++M++ V  F+EQD E+KK F
Sbjct  66    HGMDSDPIRRKKIVEMVREASETWGLFTVVNHGIPVSVLEEMMDGVHRFYEQDNEVKKEF  125

Query  612   HSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMS  791
             ++RD+ +KV YNSNFDL V+  ANWRD+ YC+MAP P  P+ELP  CRDI+++Y E VM 
Sbjct  126   YTRDLTRKVIYNSNFDLYVSKAANWRDTFYCLMAPHPLNPQELPATCRDILMEYKEQVMR  185

Query  792   LGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltll  971
             LG  L EL+SEA+GL+ +HLK M C+EGL I+ HYYP CP+P+LT+G + H+D+ FLT+L
Sbjct  186   LGLKLLELMSEAIGLNPNHLKDMDCAEGLAILCHYYPACPQPELTMGTTKHSDNDFLTIL  245

Query  972   lqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISV  1151
             LQDQ+GGLQVLH+D WVDVP  PG+L++N+GD+LQL+TND+FKSV HRVLA   GPR+SV
Sbjct  246   LQDQIGGLQVLHQDQWVDVPPEPGALVINVGDLLQLITNDRFKSVEHRVLANRRGPRVSV  305

Query  1152  ASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             A FF         +K YGPIKELLS+E P  YR
Sbjct  306   ACFFSTSHLPS--SKLYGPIKELLSKENPPKYR  336


 Score =   336 bits (862),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 169/285 (59%), Positives = 221/285 (78%), Gaps = 5/285 (2%)
 Frame = +3

Query  405   TPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHF  578
             T QF  PV+D +G+  +  RR +IV+M+KDA E WGFF V+NHGIP +V+++M+E V  F
Sbjct  372   TTQFNFPVVDLQGMDNDPIRRNKIVDMVKDASETWGFFNVVNHGIPVSVLEEMMEGVLRF  431

Query  579   HEQDFELKKPFHSRDV-KKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCR  755
             +EQD E+KK F++RD  +KK+ YNSNFDL  A  ANWRD+ YC+MAP PP PEELP  CR
Sbjct  432   YEQDTEVKKQFYTRDASRKKMVYNSNFDLYTAPAANWRDTFYCLMAPHPPNPEELPAACR  491

Query  756   DIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGL  935
             DI+++Y + +M LG+ LFEL+SEALGL+ +HLK M C+EGL I+ HYYP CP+P+LT+G 
Sbjct  492   DILMEYKDQIMRLGFKLFELISEALGLNPNHLKDMDCTEGLSILCHYYPSCPQPELTMGT  551

Query  936   SSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHR  1115
             + H D+ FLT+LLQDQ+GGLQVLH+  W+DVP  PG+L++N+GD+LQL+TND+FKSV HR
Sbjct  552   TKHADNDFLTVLLQDQIGGLQVLHQGQWIDVPPMPGALVINVGDLLQLITNDRFKSVEHR  611

Query  1116  VLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             VLA  +GPR+SVA FF    Q    +K YGPIKELLSEE P  Y+
Sbjct  612   VLANHIGPRVSVACFFSTSIQPS--SKLYGPIKELLSEENPPKYK  654



>ref|XP_003633274.2| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Vitis vinifera]
Length=357

 Score =   350 bits (899),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 181/340 (53%), Positives = 252/340 (74%), Gaps = 8/340 (2%)
 Frame = +3

Query  243   SIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVI  422
             S ++ E+DR+ E++AF+DSK+GVKGL DAG+TKIP +F+  H     N+ + +A  QF +
Sbjct  6     SGVEVEHDRKRELKAFDDSKSGVKGLVDAGITKIPPMFI--HPQYNLNAKSGSAVSQFRV  63

Query  423   PVIDFEGL--GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFE  596
             P++D +G+      R +I++ +++ACENWGFFQ +NHGIP +V+++M++ ++ FHEQD +
Sbjct  64    PLVDLDGINDSATLRAKIIDQVREACENWGFFQAVNHGIPASVLEEMIDGIRGFHEQDTQ  123

Query  597   LKKP-FHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKY  773
             +KK  F+ RD K+KV+Y SNFDL  A  A W+D L   MAP PP+P ELP VCRDI+++Y
Sbjct  124   VKKEYFYKRDFKEKVSYFSNFDLCQATVATWKDCLSWAMAPSPPDPTELPAVCRDIVMEY  183

Query  774   AEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDS  953
             ++ V  LG TLFELLSEALGLD++ LK M C+E +F  GHYYPPCPEP+LTLG   HTDS
Sbjct  184   SKQVKRLGCTLFELLSEALGLDVNRLKDMECAEMIFPAGHYYPPCPEPELTLGARRHTDS  243

Query  954   gfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPV  1133
              FLT+LLQDQ+GGLQVLH++ W+D    PG+L++N+GD LQ++TND+FKS+ HRVL   V
Sbjct  244   RFLTVLLQDQVGGLQVLHQNQWIDASPMPGALVINVGDSLQVITNDRFKSIEHRVLVNRV  303

Query  1134  GPRISVASFFRMHFQEGNEAKTYGPIKE-LLSEEKPAIYR  1250
              PR+SVAS F  +      +K Y PIKE L+++E P  Y+
Sbjct  304   SPRVSVASAFGTNLFPS--SKLYSPIKESLVTQENPPKYK  341



>ref|XP_009619591.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X2 [Nicotiana tomentosiformis]
Length=362

 Score =   350 bits (899),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 185/341 (54%), Positives = 245/341 (72%), Gaps = 16/341 (5%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKN-------SAANAATPQ  413
             AEYDR  E++AF+++KAGVKGL D G+  IP  F+   +  E N       S  NA    
Sbjct  2     AEYDRAKELKAFDNTKAGVKGLLDTGVVHIPEFFVTPGAENEFNAKNINLCSDVNAQ---  58

Query  414   FVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQ  587
               IPVIDF+ +  N  +R +IV  I++ACE WGFFQV+NHGIP +VMD+M++ VQ F+EQ
Sbjct  59    --IPVIDFKNMKENDFQRRKIVEQIREACETWGFFQVLNHGIPQHVMDEMIKGVQRFNEQ  116

Query  588   DFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMI  767
               E K  F+SRD  KKV +NSNFDL  +  ANWRD+L C+MAP+PP  +ELP  CR  ++
Sbjct  117   PNEQKMEFYSRDNLKKVKFNSNFDLYQSKAANWRDTLACVMAPNPPRSDELPVTCRKELL  176

Query  768   KYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHT  947
             +Y+EHV  LG+T+FELL+EALGL  +HL  M C++G FI+ HYYPPCPEP+ TLG++ HT
Sbjct  177   EYSEHVRKLGHTIFELLAEALGLKPNHLLEMECAKGHFILSHYYPPCPEPNKTLGITKHT  236

Query  948   DSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAK  1127
             D  F T+LLQD +GGLQ+ H++ W+D+    G+L++N+GD+LQLL+NDKFKS  HRVL+K
Sbjct  237   DPDFFTILLQDHIGGLQINHQNHWIDIHPVTGALVINLGDLLQLLSNDKFKSAEHRVLSK  296

Query  1128  PVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              +GPRISVA FF   FQ  +  + YGPIKELLS+E P  Y+
Sbjct  297   QIGPRISVACFFTTQFQPFD--RLYGPIKELLSDENPPKYK  335



>ref|XP_007140617.1| hypothetical protein PHAVU_008G127200g [Phaseolus vulgaris]
 gb|ESW12611.1| hypothetical protein PHAVU_008G127200g [Phaseolus vulgaris]
Length=372

 Score =   351 bits (900),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 187/342 (55%), Positives = 253/342 (74%), Gaps = 7/342 (2%)
 Frame = +3

Query  234   QEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQ  413
             Q +  M + YDR++E++AF+++K+GVKGL D+G+ +IPR+F +   I E N+ +++   +
Sbjct  8     QIEEAMDSSYDRKAEIKAFDETKSGVKGLVDSGVKRIPRMFHSGIDITE-NTGSDS---K  63

Query  414   FVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQ  587
               +PVID E +  N   R E V  I+ AC+ WGFFQVINHGIP  VMD M++ ++ FHEQ
Sbjct  64    LSVPVIDLESIHNNPALRKEAVTKIRSACQEWGFFQVINHGIPIPVMDDMIDGIRRFHEQ  123

Query  588   DFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMI  767
             D +++K F SRD+K K+ Y SN +L     ANWRD++ C MAP+PP+PEELP V  DI+ 
Sbjct  124   DADVRKQFFSRDLKSKILYCSNTNLYKDKFANWRDTVGCSMAPNPPKPEELPAVFGDIIT  183

Query  768   KYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHT  947
             +Y++  ++LG T+FELLSEALGL   +L+ + C+EGLFI GHYYPPCP+P+LTLG S HT
Sbjct  184   EYSKKAIALGCTIFELLSEALGLKPSYLEELNCAEGLFIQGHYYPPCPQPELTLGTSKHT  243

Query  948   DSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAK  1127
             D+ F+T+LLQDQLGGLQ+LHE+ W++VP   G L+VNIGD+LQL+TND F SV+HRVLA 
Sbjct  244   DTAFITILLQDQLGGLQILHENQWLNVPPVHGGLVVNIGDVLQLMTNDNFVSVYHRVLAN  303

Query  1128  PVGPRISVASFF-RMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
               GPR+SVASFF   H  +   +K YGPIKELLSE  P +YR
Sbjct  304   HGGPRVSVASFFTNSHDPDKGMSKVYGPIKELLSENNPPMYR  345



>ref|XP_007035061.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Theobroma cacao]
 gb|EOY05987.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Theobroma cacao]
Length=371

 Score =   351 bits (900),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 187/336 (56%), Positives = 243/336 (72%), Gaps = 6/336 (2%)
 Frame = +3

Query  249   MQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPV  428
             ++ EYDR  E++AF+D+KAGVKGL DAG+ ++PRIF +     EK S +     Q  IPV
Sbjct  13    LKPEYDRTIELKAFDDTKAGVKGLVDAGIKEVPRIFQHPPDQSEKISVSGVT--QVRIPV  70

Query  429   IDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELK  602
             ID EG+  +   R EIV  ++DA +  GFFQV+NHGIP +V+++M +  + F EQD E+K
Sbjct  71    IDLEGVKKDPGTRQEIVEKVRDASKTLGFFQVVNHGIPLSVLEEMKDGARRFFEQDLEVK  130

Query  603   KPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEH  782
             K FH+RD  K+V YNSNFDL  +  ANWRD++  +MAPDPP PEELP V RDIM++Y++ 
Sbjct  131   KQFHTRDYTKRVAYNSNFDLYNSPAANWRDTVSSLMAPDPPMPEELPEVIRDIMMEYSKQ  190

Query  783   VMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfl  962
             VM LGY LFELLSEALGL  DHL+ M C++GL ++ HYYP C  P+LTLG + H D+ FL
Sbjct  191   VMHLGYLLFELLSEALGLHPDHLRDMDCAKGLVMLSHYYPACSRPELTLGATKHADNDFL  250

Query  963   tlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPR  1142
             T+LLQD +GGLQV HE+ WVDVP  PG+L++NIGD+L+L++ND F SV HRVLA  VG R
Sbjct  251   TVLLQDHIGGLQVFHENQWVDVPPTPGALVINIGDLLKLISNDAFVSVEHRVLANSVGAR  310

Query  1143  ISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             +SVA FF        + + YGPIKELLSE+ P  YR
Sbjct  311   VSVACFFSTF--RLPDLRPYGPIKELLSEDNPPKYR  344



>ref|XP_006354515.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Solanum tuberosum]
Length=373

 Score =   350 bits (899),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 177/340 (52%), Positives = 252/340 (74%), Gaps = 8/340 (2%)
 Frame = +3

Query  243   SIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVI  422
             + +Q  YD+ SE++AF+D+KAG+KGL DAG+TK+PRIF+      ++  +++    QF+ 
Sbjct  11    TTIQKSYDKMSELKAFDDTKAGIKGLVDAGITKVPRIFMLPPK--DRLESSDTCETQFIF  68

Query  423   PVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFE  596
             PVID EG+  +  +  EIV+ ++DA E WGFFQV+NHGIP +V+++ML+  + F EQD E
Sbjct  69    PVIDLEGISKDPIKHKEIVDKVRDASETWGFFQVVNHGIPVSVLEEMLQGTRRFFEQDIE  128

Query  597   LKKPFHSRDVKKKVTYNSNFDLLVAA--TANWRDSLYCIMAPDPPEPEELPNVCRDIMIK  770
             +K  +++RD+ KKV ++ NFDL   +   ANWRD+L C+MAP+PP PEE P  CR+I+I+
Sbjct  129   VKNQYYTRDITKKVVHSCNFDLYSPSVPAANWRDTLSCLMAPNPPSPEEFPAACREILIE  188

Query  771   YAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTD  950
             +++H+M LG ++FELLSE LGL+  HL  +GC+EGL ++GHYYP CP+P+LT+G S H+D
Sbjct  189   FSDHIMKLGKSVFELLSEGLGLNPSHLNDIGCAEGLAVLGHYYPACPQPELTMGTSKHSD  248

Query  951   SgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKP  1130
             +GF+T+LLQD +GGLQVLH++ WVDVP  PG+++VNIGD+LQL++NDK+ SV HRVL   
Sbjct  249   NGFITVLLQDHIGGLQVLHQNQWVDVPPTPGAIVVNIGDLLQLISNDKYISVEHRVLTNK  308

Query  1131  VGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             +  RISVA FF         +  YGPI ELLSE+ P  YR
Sbjct  309   LSSRISVACFFGT--GPLPSSNFYGPITELLSEDNPPKYR  346



>ref|XP_003609637.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
 gb|AES91834.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=373

 Score =   350 bits (898),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 186/348 (53%), Positives = 260/348 (75%), Gaps = 10/348 (3%)
 Frame = +3

Query  219   NNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAAN  398
             N   L+E +   + YDR++EV+AF+DS+AGV GL ++G++KIPR F      + +NS  +
Sbjct  5     NTNQLEEAT--DSTYDRKAEVKAFDDSRAGVNGLVESGVSKIPRFFHAGKLDIGENSTCD  62

Query  399   AATPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQ  572
             +   +  +P++D + +  N  +RV++++ I+ AC  WGFFQVINH IP  V+D+M++ ++
Sbjct  63    S---KLSVPIVDLKDIHNNPAQRVDVIHQIRSACHEWGFFQVINHEIPITVLDEMIDGIR  119

Query  573   HFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVC  752
              FHEQD +++K F++RD+KKKV Y SN  L     ANWRD+    +AP P +PEE+P +C
Sbjct  120   SFHEQDADVRKEFYTRDLKKKVMYYSNVHLFSGQAANWRDTFGFAVAPHPFKPEEVPPIC  179

Query  753   RDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLG  932
             RDI+I+Y++ +  LG+T+FELLSEALGL+  +LK + C+EGLFI+GH YPPCPEP+LT+G
Sbjct  180   RDIVIEYSQKIKELGFTIFELLSEALGLNSSYLKELNCAEGLFILGHCYPPCPEPELTMG  239

Query  933   LSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHH  1112
              + HTDS F+TLLLQDQLGGLQVLH+D WV+VP   G+L+VN+GD+LQL+TND F SV+H
Sbjct  240   TTKHTDSNFMTLLLQDQLGGLQVLHKDKWVNVPPVHGALVVNVGDLLQLITNDNFVSVYH  299

Query  1113  RVLAKPVGPRISVASFFRMHFQ--EGNEAKTYGPIKELLSEEKPAIYR  1250
             RVL+  +GPRISVASFF       EG ++K YGPIKELLSEE P IY+
Sbjct  300   RVLSHNIGPRISVASFFVNSPDPIEG-KSKVYGPIKELLSEENPPIYK  346



>ref|XP_007140619.1| hypothetical protein PHAVU_008G127400g [Phaseolus vulgaris]
 gb|ESW12613.1| hypothetical protein PHAVU_008G127400g [Phaseolus vulgaris]
Length=372

 Score =   350 bits (898),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 188/342 (55%), Positives = 252/342 (74%), Gaps = 7/342 (2%)
 Frame = +3

Query  234   QEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQ  413
             Q +  M + YDR++E++AF+++K+GVKGL D+G+ ++PR+F +   I E N+ +++   +
Sbjct  8     QIEEAMDSSYDRKAEIKAFDETKSGVKGLLDSGVKRVPRMFHSGIDITE-NTGSDS---K  63

Query  414   FVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQ  587
               +PVID E +  N   R E V  I+ AC+ WGFFQVINHGIP  VMD M++ ++ FHEQ
Sbjct  64    LNVPVIDLESIHNNPALRKEAVTKIRSACQEWGFFQVINHGIPIPVMDDMIDGIRRFHEQ  123

Query  588   DFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMI  767
             D +++K F SRD+K K+ Y SN +L     ANWRD++ C MAP+PP+PEELP V  DI+ 
Sbjct  124   DADVRKQFFSRDLKSKILYYSNNNLSKDKFANWRDTVGCSMAPNPPKPEELPAVFGDIIT  183

Query  768   KYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHT  947
             +Y++  M+LG T+FELLSEALGL   +LK + C+EGLFI GHYYPPCP+P+LTLG S HT
Sbjct  184   EYSKKAMALGCTIFELLSEALGLKPSYLKELNCAEGLFIQGHYYPPCPQPELTLGTSKHT  243

Query  948   DSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAK  1127
             D+ F+T+LLQDQLGGLQ+LHE+ W++VP     L+VNIGD+LQL+TND F SV HRVLA 
Sbjct  244   DTAFITILLQDQLGGLQILHENQWLNVPPVHRGLVVNIGDILQLITNDNFVSVFHRVLAN  303

Query  1128  PVGPRISVASFF-RMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
               GPR+SVASFF   H  +   +K YGPIKELLSEE P +YR
Sbjct  304   HGGPRVSVASFFTNSHDPDKGMSKVYGPIKELLSEENPPMYR  345



>ref|XP_008365367.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Malus domestica]
Length=370

 Score =   350 bits (897),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 190/342 (56%), Positives = 244/342 (71%), Gaps = 12/342 (4%)
 Frame = +3

Query  252   QAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIF-----LNKHSILEKNSAANAATPQF  416
                YDR+SEV AF+++K GVKGL DAG+T+IPRIF      + H  +   S+ + AT +F
Sbjct  5     NTNYDRKSEVNAFDETKEGVKGLVDAGITEIPRIFHRPPESDDHYHINSPSSDSEAT-RF  63

Query  417   VIPVIDFEGL----GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHE  584
              IPVID +GL       +R EIV  + +A E WGFFQ++NHGIP  V++++ + V+ F E
Sbjct  64    SIPVIDLQGLDRFDSPTKRKEIVAKVGEASETWGFFQIVNHGIPVGVLEEIKDGVRGFFE  123

Query  585   QDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIM  764
              D ++KK  ++RD  K V YNSNFDL  A   NWRD+  C +AP+P +PE+LP VCRDI+
Sbjct  124   LDTQVKKELYTRDPFKPVIYNSNFDLYSAPVTNWRDTFMCYVAPNPTKPEDLPQVCRDIL  183

Query  765   IKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSH  944
             ++Y+  VM LG  LFELLSEALGL   HL  + CSEGL I+GHYYP CP+P+LT+G S+H
Sbjct  184   VEYSMQVMKLGRLLFELLSEALGLKPSHLNDIDCSEGLVILGHYYPACPQPELTMGTSNH  243

Query  945   TDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLA  1124
              D+ FLT+LLQD +GGLQVLH+  WVD+P  PG+L+VNIGD+LQL++NDKFKS+ HRVLA
Sbjct  244   ADNDFLTILLQDHIGGLQVLHQGKWVDIPPVPGALVVNIGDLLQLISNDKFKSIQHRVLA  303

Query  1125  KPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
               VGPRISVASFF          K YGPIKELLSE+ P  YR
Sbjct  304   NYVGPRISVASFFCTGMLP--STKLYGPIKELLSEDNPPKYR  343



>ref|XP_004247920.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
isoform X2 [Solanum lycopersicum]
Length=375

 Score =   350 bits (897),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 185/337 (55%), Positives = 252/337 (75%), Gaps = 11/337 (3%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVID  434
               YDR SE++AF+D+KAGVKG+ DAG+T++PRIF+    I E     N  T +F+ PVID
Sbjct  16    GSYDRMSELKAFDDTKAGVKGIVDAGITEVPRIFVQPTKIEE--CVRNCET-KFIFPVID  72

Query  435   FEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKP  608
              EG+  +  +  EIV+ ++DA E WGFFQV+NHGIP +VM++ML+  + F EQ  ++KK 
Sbjct  73    LEGIDKDPIKHKEIVDRVRDASETWGFFQVVNHGIPLSVMEEMLQGTRRFFEQHVDIKKQ  132

Query  609   FHSRDVKKKVTYNSNFDLL---VAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAE  779
             +++RD  KK+ + SNFDL    V AT NWRDS++C+MAP+ P PEELP  CR+I+++++ 
Sbjct  133   YYTRDNTKKIVHVSNFDLYSPSVPAT-NWRDSIFCLMAPNHPSPEELPTACREILMEFSN  191

Query  780   HVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgf  959
             HVM+LG +LFELLSE LGL+  HL  + C+EGL ++GHYYP CP+P+LT+G + H+D+ F
Sbjct  192   HVMTLGKSLFELLSEGLGLNPSHLNDIDCAEGLRVLGHYYPACPQPELTIGTNKHSDNDF  251

Query  960   ltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGP  1139
             +T+LLQDQ+GGLQVLHE  W+DVP  PG+L+VNIGD+LQL++NDK+ SV HRVL+  VGP
Sbjct  252   ITVLLQDQIGGLQVLHETQWIDVPPTPGALVVNIGDLLQLISNDKYLSVEHRVLSNKVGP  311

Query  1140  RISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             RISVA FF  +       K YGPIKELLS++ P  YR
Sbjct  312   RISVACFF--YTGSLPTTKLYGPIKELLSDDSPPKYR  346



>ref|XP_004236795.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Solanum lycopersicum]
Length=368

 Score =   349 bits (896),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 178/338 (53%), Positives = 246/338 (73%), Gaps = 8/338 (2%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFV----I  422
             A YDR  +++AF+D+KAGVKGL D+G+  IP IF+    I  + SA N  +   +    I
Sbjct  2     ANYDRAKDLKAFDDTKAGVKGLVDSGIVHIPEIFVTPTLIENEFSAENLDSDSNIVNVQI  61

Query  423   PVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFE  596
             PVID +G+  +  RR  IV  + +AC++WGFFQV+NHG+P +VMD+M+  V+ F+EQ  E
Sbjct  62    PVIDLKGMNEDDFRRTRIVEEVGEACKSWGFFQVVNHGVPQHVMDEMISGVKKFNEQSSE  121

Query  597   LKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYA  776
              K  F+SRD  KKV +NSNFDL  +   NWRDSL C+MAP+PP  +ELP  CR+ +++Y+
Sbjct  122   KKMEFYSRDNLKKVKFNSNFDLYSSKATNWRDSLACVMAPNPPTNDELPQACREELLQYS  181

Query  777   EHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSg  956
             +HV  LG+T+FELL+EALGL  +HL G+ C+ G FI+ HYYPPCPEP+ TLG++ HTD  
Sbjct  182   QHVRKLGHTIFELLAEALGLKPNHLLGLDCARGHFILCHYYPPCPEPNKTLGITKHTDPD  241

Query  957   fltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVG  1136
             F T+LLQDQ+GGLQ+ H++ W+D+    G+L++N+GD++QLL+NDKFKS  HRVL+K +G
Sbjct  242   FFTILLQDQIGGLQINHQNQWIDIHPVTGALVINLGDLMQLLSNDKFKSAEHRVLSKHIG  301

Query  1137  PRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             PRIS+A FF   FQ  +    YGPIKELLS+E  A+Y+
Sbjct  302   PRISIACFFTTQFQPFD--TLYGPIKELLSDENHALYK  337



>ref|XP_011029844.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Populus euphratica]
Length=359

 Score =   349 bits (895),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 177/316 (56%), Positives = 239/316 (76%), Gaps = 4/316 (1%)
 Frame = +3

Query  309   VKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFEGLGG--NRRVEIVNMI  482
             +KGL DAG+TKIPR+F+++  +  +++ A    P F IP+IDFEG     NRR  I+  +
Sbjct  17    LKGLVDAGVTKIPRMFIHEQCVKLEDAPA-FHEPNFSIPIIDFEGWNEDENRRRNIIQKL  75

Query  483   KDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDL  662
               AC+ WGFFQ++NHGIP ++ +++++ +  FH QD E+KK F+SRD  +KV YNSNFDL
Sbjct  76    GSACKKWGFFQMVNHGIPRSIQEEVIDGIHRFHHQDVEVKKEFYSRDYTRKVLYNSNFDL  135

Query  663   LVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDL  842
                  A+WRD+L C+MAP PP PEELP VCRDI+I Y++ +M+LG +LFE+LSEALGL+ 
Sbjct  136   YQVPAASWRDTLTCVMAPSPPNPEELPPVCRDILIDYSKRIMTLGNSLFEMLSEALGLEP  195

Query  843   DHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWV  1022
             +HLK +GC+EGL+++GH YP CPEP+LT+G + H DSGFLTLLLQDQ+GGLQVLHE+ W+
Sbjct  196   NHLKDIGCAEGLYVLGHCYPACPEPELTMGTTKHADSGFLTLLLQDQIGGLQVLHENQWI  255

Query  1023  DVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISVASFFRMHFQEGNEAKTY  1202
             +V   PG+L+VN+GD+ QL++NDKF S  HRV+A+ VGPR SVA  FR +       + Y
Sbjct  256   NVSPMPGALVVNVGDLFQLISNDKFVSATHRVVARNVGPRTSVACLFRQNLLP-ETLRLY  314

Query  1203  GPIKELLSEEKPAIYR  1250
             GPIKELLSEE P +YR
Sbjct  315   GPIKELLSEENPPVYR  330



>ref|XP_003591798.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
 gb|AES62049.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=374

 Score =   349 bits (895),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 185/344 (54%), Positives = 248/344 (72%), Gaps = 6/344 (2%)
 Frame = +3

Query  234   QEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGL--TKIPRIFLNKHSILEKNSAANA-A  404
             +E+    + YDR +EV+AFE+SK GVKGL ++G+  TKIPR+F   +  L  NS   +  
Sbjct  5     EENKSSTSTYDRVAEVKAFEESKVGVKGLLESGICVTKIPRMFHYPNLNLNMNSTHESDP  64

Query  405   TPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHF  578
             + +F +P+ID + +  N     E+++ I+ AC  WG FQVINHGIPD+V+D+M+  ++ F
Sbjct  65    SSKFNVPIIDLQNIHTNPCLHAEVLDKIRSACREWGCFQVINHGIPDSVLDEMISGIRRF  124

Query  579   HEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRD  758
             HEQ+ E +KPF++RD  KKV Y SN  L     ANWRD++   ++PDPP PEE+P VCRD
Sbjct  125   HEQEAEERKPFYTRDTSKKVRYFSNGSLFKNHAANWRDTISFYVSPDPPNPEEIPQVCRD  184

Query  759   IMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLS  938
             I+I+Y++ V  LG+T FE+ SEALGLD  +LK +    G FI  HYYPPCPEP+LT+G S
Sbjct  185   IVIEYSKKVRDLGFTFFEIFSEALGLDPSYLKKLASPNGHFIACHYYPPCPEPELTMGAS  244

Query  939   SHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRV  1118
             +HTD  F+T+LLQD++GGLQVLH++ W+DVP   GSLIVNIGD+LQL+TND F SV+HRV
Sbjct  245   NHTDGDFMTILLQDRIGGLQVLHQNQWIDVPPVHGSLIVNIGDLLQLVTNDMFTSVYHRV  304

Query  1119  LAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             L+K +GPRIS+ASFF     +G  +K  GPI ELLSEE P IYR
Sbjct  305   LSKNIGPRISIASFFVNSLSKGT-SKVVGPINELLSEENPPIYR  347



>ref|XP_009765554.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nicotiana sylvestris]
Length=359

 Score =   348 bits (892),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 182/334 (54%), Positives = 241/334 (72%), Gaps = 5/334 (1%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVID  434
             A+YDR  E++AF+D K GVKGL DAG+  IP  F+      E N+          IP+ID
Sbjct  2     ADYDRAKELKAFDDKKTGVKGLVDAGIVHIPEFFVTTAIENEFNAKNLDLCFNVQIPIID  61

Query  435   FEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKP  608
             F+ +  N  +R +IV  I++ACE WGFFQV+NHGIP +VMD+M+E V+ F+EQ  E KK 
Sbjct  62    FKNIEENDFQRRKIVEQIREACETWGFFQVLNHGIPQHVMDEMIEGVKRFNEQSNE-KKE  120

Query  609   FHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVM  788
             F+SRD  KKV +NSNFDL  +  ANWRD+L CIMAP+PP  +ELP+ CR  +++Y+EHV 
Sbjct  121   FYSRDNLKKVKFNSNFDLYQSKAANWRDTLGCIMAPNPPRSDELPDACRKELLEYSEHVR  180

Query  789   SLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltl  968
              LG T+FELL+EALGL  +HL  M C++G FI+ HYYPPCPEP+ TLG++ HTD  F T+
Sbjct  181   ELGITIFELLAEALGLKPNHLLEMECAKGHFILSHYYPPCPEPNKTLGITKHTDPDFFTI  240

Query  969   llqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRIS  1148
             LLQD +GGLQ+ H++ W+D+    G+L++N+GD+LQLL+NDKFKS  HRVL+K +GPRIS
Sbjct  241   LLQDHIGGLQIYHQNQWIDIHPVTGALVINLGDLLQLLSNDKFKSAEHRVLSKHIGPRIS  300

Query  1149  VASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             VA FF   FQ  +  + YGPI ELLS+E P  Y+
Sbjct  301   VACFFTTQFQPFD--RLYGPINELLSDENPPKYK  332



>ref|XP_008224381.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Prunus mume]
Length=370

 Score =   348 bits (892),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 185/333 (56%), Positives = 239/333 (72%), Gaps = 5/333 (2%)
 Frame = +3

Query  261   YDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFE  440
             YDR+ E+ AF+D+K GVKGL DAG+T +P IF         N+  ++   QF +PVID E
Sbjct  13    YDRKRELRAFDDTKEGVKGLVDAGITVVPIIFHQPPDQYSTNNNFDSEATQFSVPVIDLE  72

Query  441   GLGGNR---RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPF  611
             GL  +R   R EIV  + +A E WGFFQ++NHGIP +V+ ++ + V+ F+EQD ++KK F
Sbjct  73    GLEFDRPTKRKEIVTKVGEASETWGFFQIVNHGIPIDVLGEIKDGVRGFYEQDTQVKKQF  132

Query  612   HSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMS  791
             ++RD  K V YNSNFDL  A   NWRDS  C MAP+P EPE++P V RDI+I+Y++ VM 
Sbjct  133   YTRDHFKPVVYNSNFDLHRAPATNWRDSFMCYMAPNPTEPEDMPEVFRDILIEYSKQVMK  192

Query  792   LGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltll  971
             LG  LFELLSEALGL   HL  + CS GL  +GHYYP CP+P+LTLG S H D+ F+T+L
Sbjct  193   LGKLLFELLSEALGLKPSHLNDIDCSLGLVHVGHYYPSCPQPELTLGTSKHADNDFITVL  252

Query  972   lqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISV  1151
             LQD +GGLQVLH++ W+DVP  PG+L+VNIGD+LQL++N++FKSV HRVLA  VGPR+SV
Sbjct  253   LQDHIGGLQVLHQNKWIDVPPVPGALVVNIGDLLQLISNERFKSVEHRVLANRVGPRVSV  312

Query  1152  ASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             ASFF          + YGPIKELLSE+ P  YR
Sbjct  313   ASFFSTGMLP--LGRLYGPIKELLSEDNPPKYR  343



>ref|XP_009599435.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Nicotiana tomentosiformis]
Length=384

 Score =   348 bits (893),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 189/350 (54%), Positives = 246/350 (70%), Gaps = 11/350 (3%)
 Frame = +3

Query  213   TSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSA  392
              SN   +Q++      YD+ SE++AF+D+KAGVKGL DAG+T++PRIF++         +
Sbjct  15    VSNTQQIQDN--FPQNYDKNSELKAFDDTKAGVKGLVDAGITEVPRIFIHPEG---SGKS  69

Query  393   ANAATPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLES  566
              +     F+ P+ID E +  +  +  EIV  I DA E WGFFQVINHGIP +V+D+ML  
Sbjct  70    PSLEEKHFIFPLIDLENMNNDPVKHKEIVQKIGDASETWGFFQVINHGIPVSVLDEMLRG  129

Query  567   VQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLV--AATANWRDSLYCIMAPDPPEPEEL  740
              + F EQD E+KK ++ RD  ++V YNSNFDL    A   NW DSLY  M P P +PEEL
Sbjct  130   SRRFFEQDIEVKKQYYHRDYTQRVVYNSNFDLYSPKAIAVNWSDSLYSTMGPAPLDPEEL  189

Query  741   PNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPD  920
             P  CR+I+++Y+ HVM +G TL ELLSE LGL   HLK MGCSEGL I+ +YYP CP+P+
Sbjct  190   PEACREIIMEYSHHVMKMGCTLLELLSECLGLKPSHLKEMGCSEGLSILCNYYPACPQPE  249

Query  921   LTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFK  1100
             L +GLS HTD+ F T+LLQD LGGLQVLH++ WVDVP  PG+L++NIGD+LQL++NDK+K
Sbjct  250   LAVGLSKHTDNDFFTVLLQDDLGGLQVLHQNQWVDVPPTPGALVINIGDVLQLISNDKYK  309

Query  1101  SVHHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             SV HR L+K VGPRIS+ASFF         +K YGPI+ELLSE+ P  YR
Sbjct  310   SVEHRALSKKVGPRISIASFFSS--GPLPSSKLYGPIEELLSEDNPPKYR  357



>ref|XP_003548216.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X1 [Glycine max]
Length=369

 Score =   347 bits (891),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 185/332 (56%), Positives = 240/332 (72%), Gaps = 5/332 (2%)
 Frame = +3

Query  261   YDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNS--AANAATPQFVIPVID  434
             Y+R  E++AF++SKAGVKGL D+G+TK+P+IF+     L      + N A  QF IPVID
Sbjct  12    YNRLQELKAFDESKAGVKGLVDSGITKLPKIFVRPPEDLAAADPVSDNPAGAQFTIPVID  71

Query  435   FEGLGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFH  614
              +GL G R   +V  ++ A E  GFFQV+NHGIP  V+++ + +V  FHE   ELK  ++
Sbjct  72    LDGLTGERS-GVVAGVRRAAETMGFFQVVNHGIPLKVLEETMAAVHEFHELPQELKAEYY  130

Query  615   SRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMSL  794
             SR+  KKV Y SNFDL  +  ANWRD+L+C+M PDP +P+ELP +CRD+ ++Y+  V  L
Sbjct  131   SREQMKKVKYGSNFDLYQSKYANWRDTLFCVMGPDPLDPQELPPICRDVAMEYSRQVQLL  190

Query  795   GYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltlll  974
             G  LF LLSEALGLD DHL+GM C++G  I+ HYYP CPEP+LT+G + H+D  FLT+LL
Sbjct  191   GRVLFGLLSEALGLDPDHLEGMDCAKGHSILFHYYPSCPEPELTMGTTRHSDPDFLTILL  250

Query  975   qdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISVA  1154
             QD +GGLQVL    WVDVP  PG+L+VNIGD+LQL++NDKFKSV HRVLA  +GPR+SVA
Sbjct  251   QDHIGGLQVLGPYGWVDVPPVPGALVVNIGDLLQLISNDKFKSVEHRVLANRIGPRVSVA  310

Query  1155  SFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              FF +H       + YGPIKELLSEEKP +YR
Sbjct  311   CFFTLHLYP--TTRIYGPIKELLSEEKPPVYR  340



>ref|XP_007152330.1| hypothetical protein PHAVU_004G120800g [Phaseolus vulgaris]
 gb|ESW24324.1| hypothetical protein PHAVU_004G120800g [Phaseolus vulgaris]
Length=373

 Score =   347 bits (891),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 189/347 (54%), Positives = 248/347 (71%), Gaps = 7/347 (2%)
 Frame = +3

Query  216   SNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAA  395
             +N  NL+ ++     YDR +EV+AF+D+K GVKG  D+GLTKIPR+F   H  L+ N  +
Sbjct  4     TNTNNLESEASNSFTYDRAAEVKAFDDTKLGVKGQLDSGLTKIPRMF---HHELDINEIS  60

Query  396   NAATPQFVIPVIDFEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESV  569
                + +  +P+ID + +  N   R E+V+ ++ AC+ WGFFQVINHGI   V+++M+  +
Sbjct  61    KGDS-KLSVPIIDLQDIDTNSSLRAEVVDKVRSACKKWGFFQVINHGIGVEVLNEMICGI  119

Query  570   QHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNV  749
             + FHEQD E++K F+SRD  KKV Y SN +L     ANWRD++   + PDPP PEE+P V
Sbjct  120   RRFHEQDSEVRKTFYSRDSNKKVKYFSNVNLSRGKGANWRDTISFFLTPDPPSPEEIPIV  179

Query  750   CRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTL  929
             CRDI+I+Y++ V  LGYT+FEL SEALGL+  +LK +  ++G F +GHYYP CPEP+LTL
Sbjct  180   CRDIVIEYSKKVRMLGYTMFELFSEALGLNPSYLKELDSADGQFHLGHYYPACPEPELTL  239

Query  930   GLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVH  1109
             G S HTDS F+T+LL+DQ+GGLQVLHE+ WVDV    GSL+VNIGD LQL+TN  F SV+
Sbjct  240   GTSKHTDSSFMTILLEDQMGGLQVLHENQWVDVHPVHGSLVVNIGDFLQLITNGMFMSVY  299

Query  1110  HRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             HRVLAK  GPRISVASFF      G  +K  GP+KELLSEE P IYR
Sbjct  300   HRVLAKHTGPRISVASFFINTALHGT-SKVVGPMKELLSEENPPIYR  345



>ref|XP_009119310.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
6-like [Brassica rapa]
Length=355

 Score =   347 bits (889),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 188/333 (56%), Positives = 239/333 (72%), Gaps = 8/333 (2%)
 Frame = +3

Query  258   EYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDF  437
             E D  +E +AF+++KAGVKGL DA +T++P IF   H  L     + +A+    IPVID 
Sbjct  2     EIDSYNERKAFDETKAGVKGLVDAHITEVPHIFRLPHGTLPDKKPSVSAS---AIPVIDL  58

Query  438   EGLGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFHS  617
               +  +R   IV  +KDA E WGFFQVINHG+P +V++++   V+ FHEQD E+KK + +
Sbjct  59    ADVHVSRE-GIVKKVKDAAETWGFFQVINHGVPLSVIEEIKGGVRRFHEQDLEVKKSYFT  117

Query  618   RDVKKKVTYNSNFDLLVAAT--ANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMS  791
             RDV K V YNSNFDL   ++   NWRDS  C MAPDPP P+E+P  CRD MI+Y++HVM+
Sbjct  118   RDVTKSVVYNSNFDLYNPSSLCVNWRDSFVCCMAPDPPNPDEIPLACRDAMIEYSKHVMT  177

Query  792   LGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltll  971
             LG  LFELLSE+LGL  + LK M C +GL +IGHYYPPCP+PDLT G S H+DS F+T+L
Sbjct  178   LGGFLFELLSESLGLHSEMLKSMDCMKGLNMIGHYYPPCPQPDLTFGTSQHSDSSFITIL  237

Query  972   lqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISV  1151
             LQDQ+GGLQ+LH+D WVDV   PG+L++NIGD LQ++TNDKFKSV HRVLA   GPRISV
Sbjct  238   LQDQIGGLQILHKDSWVDVSPLPGALVINIGDFLQIITNDKFKSVEHRVLANRAGPRISV  297

Query  1152  ASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             A FF  +      +  YGPIKELLSEE P  Y+
Sbjct  298   AGFFSTNMLP--NSTVYGPIKELLSEENPPKYK  328



>ref|XP_003596176.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
 gb|AES66427.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
Length=367

 Score =   347 bits (890),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 185/331 (56%), Positives = 239/331 (72%), Gaps = 6/331 (2%)
 Frame = +3

Query  264   DRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFEG  443
             DR  E++AF+++KAGVKGL D G+ KIP +F   H   +   + N+   + +IPVIDF  
Sbjct  14    DRLQELKAFDETKAGVKGLVDQGILKIPALF--HHPPDKYGKSTNSTNTEHIIPVIDFLN  71

Query  444   LGG--NRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFHS  617
             +G   N R EI+  IK+A E WGFFQV+NHGIP NV++ M + V  F EQD E+KK  ++
Sbjct  72    IGKDPNTRQEIITKIKEASETWGFFQVVNHGIPINVLEDMKDGVIRFFEQDTEVKKEMYT  131

Query  618   RDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMSLG  797
             RD  + + YNSNFDL  +   NWRD+L   MAP+ P+PE+LP VCRDI ++Y EHVM LG
Sbjct  132   RDQTRPLVYNSNFDLYSSPALNWRDTLALKMAPNAPKPEDLPVVCRDIFLEYGEHVMKLG  191

Query  798   YTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltlllq  977
               LFELLSEALGL  +HLK + CSEG  ++ HYYP CPEP LT+G + H+DS FLT+LLQ
Sbjct  192   IVLFELLSEALGLHPNHLKDLDCSEGNLLLCHYYPACPEPHLTMGTAKHSDSSFLTVLLQ  251

Query  978   dqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISVAS  1157
             D +GGLQVLH+  W+DVP  P +L++NIGD+LQL+TND+FKSV HRVLA  +GPR+SVAS
Sbjct  252   DHIGGLQVLHKGKWIDVPPIPEALVINIGDVLQLITNDRFKSVEHRVLANTIGPRVSVAS  311

Query  1158  FFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             FFR   +   + K YGPIKE+LSE+ P  YR
Sbjct  312   FFRAGPRA--QEKLYGPIKEILSEDNPPRYR  340



>ref|XP_010671067.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Beta vulgaris subsp. vulgaris]
Length=371

 Score =   347 bits (890),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 180/343 (52%), Positives = 242/343 (71%), Gaps = 8/343 (2%)
 Frame = +3

Query  237   EDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATP--  410
             + +    +YDR+SE+++F++SK GVKGL D+GL+K+PR+F+N       +   N A P  
Sbjct  5     QSTTTNNQYDRKSELQSFDESKLGVKGLIDSGLSKVPRMFVNDLDHNYPDHEPNNAKPKT  64

Query  411   QFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHE  584
             +F IP ID EG+  +  +   +V  I DAC NWGFFQV+NHGIP +++D +++ V+ FHE
Sbjct  65    EFTIPTIDLEGIENDPEKLNNVVKEIGDACVNWGFFQVVNHGIPQDIVDDVIDGVRRFHE  124

Query  585   QDFELKKPFHSRDVK-KKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDI  761
              D E+KK  ++RDV  KK  Y SN+ L      NWRD++   MAPDPP+PEELP VCRDI
Sbjct  125   DDVEVKKQHYTRDVHGKKFFYFSNYYLYTGPVTNWRDTITAFMAPDPPQPEELPLVCRDI  184

Query  762   MIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSS  941
             M +Y++ V  L +TLFEL+S ALGL  +HL  M C+E L ++GHYYPPCPEPD+ +G   
Sbjct  185   MFEYSKRVTKLCHTLFELISGALGLSPNHLNDMDCAEHLMLLGHYYPPCPEPDVAIGFGK  244

Query  942   HTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVL  1121
             H D+  LT+L+QDQ+GGLQV H+D  VDVP  PG+L++N GD+LQL+TNDK KSV+HRV 
Sbjct  245   HADNDVLTVLIQDQVGGLQVWHQDQLVDVPHIPGALVINTGDLLQLITNDKIKSVYHRVK  304

Query  1122  AKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             +  VGPR SVA+FF+    +    + YGPIKELLSEE P IYR
Sbjct  305   STNVGPRTSVAAFFK---PQPTNTRDYGPIKELLSEENPPIYR  344



>gb|AFK35571.1| unknown [Lotus japonicus]
Length=366

 Score =   347 bits (890),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 179/328 (55%), Positives = 244/328 (74%), Gaps = 8/328 (2%)
 Frame = +3

Query  273   SEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFEGLGG  452
             SE +AF+++KAGVKGL DAG+ KIP  F ++H   E+  A+N+     V+PVID   +  
Sbjct  18    SERKAFDETKAGVKGLVDAGVKKIPTFFHHQHDKFEQ--ASNSG--DHVVPVIDLANIDK  73

Query  453   N--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFHSRDV  626
             +   R E+VN +++A E WGFFQ++NHGIP +V++++ + VQ F+EQD E+ K F++R+ 
Sbjct  74    DPSLRQEVVNQLREASETWGFFQIVNHGIPLSVLEEIKDGVQRFYEQDTEVTKEFYTRER  133

Query  627   KKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMSLGYTL  806
              K   YNSNFD+  +   NWRD+  C +APDPP+PE+LP VCRDI+++Y +H+M+LG  L
Sbjct  134   YKSFIYNSNFDIYSSPALNWRDTFLCYLAPDPPKPEDLPQVCRDILLEYGKHIMNLGTLL  193

Query  807   FELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltlllqdql  986
             FEL SEALGL+ +HLK MGC EGL+ + HYYP CPEP+LTLG + H+D+ FLT+LLQD +
Sbjct  194   FELFSEALGLNPNHLKDMGCLEGLYALCHYYPACPEPELTLGTTKHSDNDFLTVLLQDHI  253

Query  987   gglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISVASFFR  1166
             GGLQV ++D W+DV   PG+L+VN+GD LQL+TND+FKSV H+VLA   GPRISVA FF 
Sbjct  254   GGLQVRYQDKWIDVTPVPGALVVNVGDFLQLITNDRFKSVEHQVLANHAGPRISVACFFS  313

Query  1167  MHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
               F+    +K YGPIKELLS++ PA YR
Sbjct  314   TAFRL--PSKLYGPIKELLSKDNPAKYR  339



>ref|XP_010104048.1| 1-aminocyclopropane-1-carboxylate oxidase-3-like protein [Morus 
notabilis]
 gb|EXB98149.1| 1-aminocyclopropane-1-carboxylate oxidase-3-like protein [Morus 
notabilis]
Length=392

 Score =   348 bits (892),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 184/356 (52%), Positives = 249/356 (70%), Gaps = 22/356 (6%)
 Frame = +3

Query  243   SIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVI  422
             S  +A+ DR  E++AF+ +KAGVKGL D+G+T+IPRIF +      K ++ +    +  I
Sbjct  12    SSYKAKGDRLGELKAFDKTKAGVKGLVDSGITEIPRIFYHPSDHNLKQNSVSGDHTKSNI  71

Query  423   PVIDFEGLGGN----RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQD  590
             PVID  GL  N     R EIV  +++A E WGFFQ++NHGIP++V++ M++ V+ FHEQ+
Sbjct  72    PVIDLGGLISNDAVQARKEIVERVREASETWGFFQIVNHGIPESVLEDMIDGVRRFHEQE  131

Query  591   FELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIK  770
              E KK F +RD+ + V YNSNFDL    + NWRDS  C MAP+ P  EE+P +CRDI+I+
Sbjct  132   TEAKKTFFTRDLTRAVIYNSNFDLYSGISTNWRDSFVCTMAPNAPNLEEMPIICRDILIE  191

Query  771   YAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTD  950
             Y++ VM +G  +FELL+EALGL+ ++L  +GC+EGL I+GHYYP CP+P+LTLG + H D
Sbjct  192   YSKQVMKVGTLVFELLTEALGLNPNYLNAIGCAEGLMILGHYYPACPQPELTLGTTKHAD  251

Query  951   SgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQ----------------LL  1082
             + F+T+LLQD +GGLQVLH++ W+DVP  PG+L+VNIGD+LQ                L+
Sbjct  252   NDFVTVLLQDHIGGLQVLHDNDWIDVPPQPGALVVNIGDLLQASVFDLLYSFVFTNFKLI  311

Query  1083  TNDKFKSVHHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             +NDKFKS+ HRVLA  VGPRISVASFF  +       K YGPIKELLSE+ P  YR
Sbjct  312   SNDKFKSIEHRVLASRVGPRISVASFFSTNLLP--TTKLYGPIKELLSEDNPPKYR  365



>ref|XP_007223277.1| hypothetical protein PRUPE_ppa007265mg [Prunus persica]
 gb|EMJ24476.1| hypothetical protein PRUPE_ppa007265mg [Prunus persica]
Length=375

 Score =   347 bits (890),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 195/356 (55%), Positives = 250/356 (70%), Gaps = 15/356 (4%)
 Frame = +3

Query  204   MVDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIF---LNKHSI  374
             MV TS N   +  SI  A YDR+SEV+ F+D+K GVKGL DAG+TK+PRIF   ++++ I
Sbjct  1     MVATSTN---EVPSI--ANYDRKSEVKTFDDTKEGVKGLVDAGITKVPRIFHLPVDQYPI  55

Query  375   LEKNSAANAATPQFVIPVIDFEGL----GGNRRVEIVNMIKDACENWGFFQVINHGIPDN  542
                  +    T Q  IPVID EGL       +R EIV  + +A E WGFFQ+ NH IP +
Sbjct  56    NNTCDSEPTKT-QLRIPVIDLEGLEYDYNPTKRKEIVAKVGEASETWGFFQIANHDIPVD  114

Query  543   VMDKMLESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDP  722
             V++++   V+ F EQD E+KK  ++RD  + V YNSNFDL  A   NWRD+  C MAP+P
Sbjct  115   VLEEIKNGVRGFFEQDTEVKKEHYTRDRFRPVIYNSNFDLYSAPATNWRDTFLCNMAPNP  174

Query  723   PEPEELPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYP  902
             P+PE+LP VCRDI+++Y++HVM LG  LFELLSEALGL   HL  M CS GL I+GHYYP
Sbjct  175   PKPEDLPQVCRDILVEYSKHVMKLGKLLFELLSEALGLKPSHLNDMDCSLGLQILGHYYP  234

Query  903   PCPEPDLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLL  1082
             PCP+P+LTLG S H D+ F+T+LLQD +GGLQVLH++ W+DV   PG+L+VNIGD+LQL+
Sbjct  235   PCPQPELTLGTSKHADNDFITVLLQDHIGGLQVLHQNNWIDVLPVPGALVVNIGDLLQLI  294

Query  1083  TNDKFKSVHHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             +ND+F+SV HRVLA    PR+SVASFF   F      + YGPIKELLSE+    YR
Sbjct  295   SNDRFRSVQHRVLANRSDPRVSVASFFSTGFLA--LPRIYGPIKELLSEDNLPKYR  348



>ref|XP_006367031.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Solanum tuberosum]
Length=364

 Score =   347 bits (889),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 179/337 (53%), Positives = 245/337 (73%), Gaps = 12/337 (4%)
 Frame = +3

Query  264   DRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFL------NKHSILEKNSAANAATPQFVIP  425
             +R  E++AF+DSKAGVKGL D+G+  IP IF+      N+ S    NS ++A   Q  IP
Sbjct  5     NRAKELKAFDDSKAGVKGLVDSGIVHIPEIFVTPSVTENEFSAENLNSCSDAVNAQ--IP  62

Query  426   VIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFEL  599
             +ID EG+  +  RR  IV  + +AC+ WGFFQV+NHG+P +VMD+M+  ++ FHEQ  ++
Sbjct  63    IIDIEGINEDDFRRRRIVEEVGEACKTWGFFQVVNHGVPQHVMDEMIGGIRSFHEQPNDI  122

Query  600   KKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAE  779
             K+ F+S D  KKV +NSNFDL  A  ANWRD+L C+MAP+PP  +ELP  CR+ +++Y++
Sbjct  123   KREFYSMDPMKKVMFNSNFDLYQAQVANWRDTLACLMAPNPPTNDELPQACREELLQYSQ  182

Query  780   HVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgf  959
             HV  LG+T+FELL+EALGL  +HL  M C++G FII HYYPPCPEP+ TLG++ HTD  F
Sbjct  183   HVRKLGHTIFELLAEALGLKPNHLLDMDCAKGQFIISHYYPPCPEPNKTLGITKHTDPNF  242

Query  960   ltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGP  1139
              T+LLQDQ+GGLQ+ H++ W+D+    G+L++N+GD+LQLL+NDKFKS  HRVLAK +GP
Sbjct  243   FTILLQDQIGGLQINHQNQWIDIHPVTGALVINLGDLLQLLSNDKFKSAEHRVLAKHIGP  302

Query  1140  RISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             RIS+A FF       +    YGPIKELLS+E  A+Y+
Sbjct  303   RISIACFFTTQLLPFD--TLYGPIKELLSDENHALYK  337



>gb|KEH22669.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=373

 Score =   347 bits (889),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 186/348 (53%), Positives = 258/348 (74%), Gaps = 10/348 (3%)
 Frame = +3

Query  219   NNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAAN  398
             N   L+E +   + YDR++EV+ F+DSKAGV+GL + G++KIPRIF      + +NSA++
Sbjct  5     NTNQLEEST--NSTYDRKTEVKNFDDSKAGVRGLVEHGVSKIPRIFHTGKLDIGENSASD  62

Query  399   AATPQFVIPVIDFEGL--GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQ  572
             +   +  +P++D + +     +RVE++  I+ AC   GFFQVINH IP +V+D+M+  ++
Sbjct  63    S---KLSVPIVDLKDIHIDQAQRVEVIEQIQSACHVGGFFQVINHDIPIDVLDEMIHGIR  119

Query  573   HFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVC  752
              FHEQD +++K F++RD+KKKV Y SN  L     ANWRD++   +AP P +P ELP++C
Sbjct  120   SFHEQDVDVRKEFYTRDLKKKVMYFSNGTLFSGQAANWRDTIGFAVAPHPFKPNELPSIC  179

Query  753   RDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLG  932
             RD +IKY++ +  LG+ +FELLSEALGLD D+LK + C EGLFI GHYYP CPEP+LT+G
Sbjct  180   RDSVIKYSQKIRDLGFIIFELLSEALGLDRDYLKELNCCEGLFIQGHYYPACPEPELTMG  239

Query  933   LSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHH  1112
              + HTD+ F+TLLLQDQLGGLQVLH D WV+VP   G+L+VN+GD+LQL++ND+F SV+H
Sbjct  240   TAKHTDTSFITLLLQDQLGGLQVLHGDKWVNVPPIHGALVVNVGDLLQLISNDRFVSVYH  299

Query  1113  RVLAKPVGPRISVASFFRMHFQ--EGNEAKTYGPIKELLSEEKPAIYR  1250
             RVL++ +GPRISVASFF    +  EG  +K YGPIKELLSEE P IY+
Sbjct  300   RVLSQNIGPRISVASFFVNSREPIEGT-SKVYGPIKELLSEENPPIYK  346



>ref|NP_180642.1| 2-oxoglutarate dependent oxygenase-like protein [Arabidopsis 
thaliana]
 gb|AAC20719.1| putative dioxygenase [Arabidopsis thaliana]
 gb|AEC08447.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase-like protein 
[Arabidopsis thaliana]
Length=362

 Score =   346 bits (888),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 190/339 (56%), Positives = 246/339 (73%), Gaps = 9/339 (3%)
 Frame = +3

Query  249   MQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPV  428
             M+A YDR SEV+AF++ K GVKGL DAG+T+IPRIF + H  L  ++   ++T   VIP 
Sbjct  1     MEATYDRASEVKAFDELKIGVKGLLDAGVTQIPRIFHHPHLNLTDSNLLLSST-TMVIPT  59

Query  429   IDFEGLGGNR----RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFE  596
             ID +G   +     R  ++ MI+DA E +GFFQVINHGI ++VM+KM + ++ FHEQD +
Sbjct  60    IDLKGGVFDEYTVTRESVIAMIRDAVERFGFFQVINHGISNDVMEKMKDGIRGFHEQDSD  119

Query  597   LKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYA  776
             ++K F++RDV K V YNSNFDL  + +ANWRD+L C MAPD PE E+LP++C +IM++YA
Sbjct  120   VRKKFYTRDVTKTVKYNSNFDLYSSPSANWRDTLSCFMAPDVPETEDLPDICGEIMLEYA  179

Query  777   EHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSg  956
             + VM LG  +FELLSEALGL+ +HLK M C++GL ++ HYYPPCPEP LT G S H+D  
Sbjct  180   KRVMKLGELIFELLSEALGLNPNHLKEMDCTKGLLMLSHYYPPCPEPGLTFGTSPHSDRS  239

Query  957   fltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLA-KPV  1133
             FLT+LLQD +GGLQV     WVDVP  PG+L+VN+GD+LQL+TND+F SV HRVLA K  
Sbjct  240   FLTILLQDHIGGLQVRQNGYWVDVPPVPGALLVNLGDLLQLMTNDQFVSVEHRVLANKGE  299

Query  1134  GPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              PRISVASFF          + YGPIKELLSE+    YR
Sbjct  300   KPRISVASFF---VHPLPSLRVYGPIKELLSEQNLPKYR  335



>ref|XP_011091222.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Sesamum indicum]
Length=365

 Score =   346 bits (888),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 181/344 (53%), Positives = 249/344 (72%), Gaps = 9/344 (3%)
 Frame = +3

Query  225   GNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAA  404
             G  +  +  + ++DR SE++AF++ KAGVKGL DAG+TK+PRIF ++    ++  A +  
Sbjct  2     GTGEPAATKEQDFDRLSELKAFDEMKAGVKGLVDAGITKVPRIFYSQTDGFDRAPADD--  59

Query  405   TPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHF  578
                F IP+ID + +  N   R  +V+ ++DA   WGFFQV+NHGIP +V+++MLE V+ F
Sbjct  60    ---FAIPLIDIDAVEKNPSLRTSVVDRVRDASGKWGFFQVVNHGIPGSVLEEMLEGVRRF  116

Query  579   HEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRD  758
             +EQD E+KK +++RD  K V YNSN++L  A + +WRD+ Y  MAP PP+PE+LP  CRD
Sbjct  117   YEQDAEVKKQWYTRDGLKTVVYNSNYNLYAAESVDWRDTTYICMAPTPPDPEDLPLECRD  176

Query  759   IMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLS  938
             I+++Y++ V  LG  LFELLSEAL L+ +HLK +GC++GL ++ HYYPPCPEP+LTLG S
Sbjct  177   IIVEYSKQVTKLGRYLFELLSEALNLNPNHLKNIGCADGLGVLYHYYPPCPEPELTLGAS  236

Query  939   SHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRV  1118
             +HTD  FLT+LLQD +GGLQVL+ + W D+P  PG+L+VNIGD+LQL++ND FKS  HRV
Sbjct  237   AHTDIDFLTVLLQDHIGGLQVLYNNQWFDIPPVPGALVVNIGDLLQLVSNDNFKSGLHRV  296

Query  1119  LAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             LA P GPR+SVA FF          K YGPIKELLS++ P  YR
Sbjct  297   LASPAGPRLSVACFFTTGLIP--SPKVYGPIKELLSDDNPPKYR  338



>ref|XP_008779114.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Phoenix dactylifera]
Length=363

 Score =   346 bits (888),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 185/335 (55%), Positives = 242/335 (72%), Gaps = 7/335 (2%)
 Frame = +3

Query  249   MQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANA--ATPQFVI  422
             M  + DR   ++AF+++KAGVKGL DAG+ KIP  F      L+  + +N+  AT +  I
Sbjct  1     MSIDDDRAGAMKAFDETKAGVKGLVDAGIRKIPPFFFQPPDHLDGINPSNSDGATARLQI  60

Query  423   PVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFE  596
             PVID  G   +  RR E+V  ++ A E  GFFQV+NHG+P  V+D+ML  V+ F+E   E
Sbjct  61    PVIDLRGSDSDSARRKEVVAEVRRASETLGFFQVVNHGVPAPVLDEMLAGVRTFNEAAAE  120

Query  597   LKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYA  776
             +K+ +++RD  KKV +NSNFDL  A  ANWRD+++C MAP+PP P+ELP  CR+I ++YA
Sbjct  121   VKREYYTRDPAKKVQFNSNFDLYQAPAANWRDTMFCAMAPEPPRPDELPLACREITLQYA  180

Query  777   EHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSg  956
              H+  +G  LFELLSEALGL+ DHL  M C++GL ++ HYYPPCPEP LTLG+S H+D  
Sbjct  181   NHIQKVGIFLFELLSEALGLNRDHLNEMECAKGLGVVAHYYPPCPEPHLTLGISKHSDPD  240

Query  957   fltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLA-KPV  1133
             FLT+LLQDQ+GGLQV+H++ W+DVP  PG+LIVNIGD+LQL++ND+ KSV HRVLA K V
Sbjct  241   FLTILLQDQIGGLQVVHQNQWIDVPPLPGALIVNIGDLLQLISNDRLKSVEHRVLANKSV  300

Query  1134  GPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKP  1238
              PRISVA FF  HF      K YGPIKELLS E+P
Sbjct  301   DPRISVACFFSTHFYPST--KLYGPIKELLSNERP  333



>gb|KEH22659.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=373

 Score =   346 bits (888),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 181/347 (52%), Positives = 259/347 (75%), Gaps = 9/347 (3%)
 Frame = +3

Query  222   NGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANA  401
             N N  E S   + YDR +EV+AF+DSKAGV+GL ++G++KIP++F N+   +   S  ++
Sbjct  5     NSNQVEKS-TNSTYDRYNEVKAFDDSKAGVRGLVESGVSKIPQMFHNEMLDIATKSICDS  63

Query  402   ATPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQH  575
                +  IP+ID +G+  N   R E++  I+ AC  WGFFQVINH IP NV+D+M+  +++
Sbjct  64    ---KLNIPIIDLKGIDINPTLREEVIGKIRSACHEWGFFQVINHEIPINVLDEMIHGIRN  120

Query  576   FHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCR  755
             FHEQD  ++K F++RD+++KV Y SN  L  +  A+WRD++  ++APDP +PEE+P +CR
Sbjct  121   FHEQDVNVRKEFYTRDLREKVVYFSNTTLFTSQAADWRDTVGFVVAPDPFKPEEIPPICR  180

Query  756   DIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGL  935
             DI+I+Y++ +  LG+ +FELLSEA+GLD  +LK + C+EG++I+GHY+PPCPEP+LT+G+
Sbjct  181   DIVIEYSQKISDLGFRIFELLSEAVGLDPSYLKELKCAEGIYIMGHYFPPCPEPELTMGV  240

Query  936   SSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHR  1115
               HTD  F+TLLLQDQ+GGL+VLHE+ WV VP   G+L+VN+GD+LQL+TNDKF SVHHR
Sbjct  241   GKHTDGNFMTLLLQDQIGGLEVLHENSWVKVPPTHGALVVNVGDLLQLITNDKFVSVHHR  300

Query  1116  VLAKPVGPRISVASFFRMHFQ--EGNEAKTYGPIKELLSEEKPAIYR  1250
             VL+  +GPRISVA+FF       EG  +K +GPIKEL+SE  P IY+
Sbjct  301   VLSPNIGPRISVATFFLSSRDPIEG-ASKVFGPIKELISEANPPIYK  346



>gb|AAD38147.1|AF139500_1 unknown [Prunus armeniaca]
Length=370

 Score =   346 bits (887),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 186/339 (55%), Positives = 241/339 (71%), Gaps = 10/339 (3%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIF---LNKHSILEKNSAANAATPQFVIP  425
             A YDR+SEV+ F+D+K GVKGL DAG+TK+PRIF   ++++ I     +    T Q  IP
Sbjct  8     ANYDRKSEVKTFDDTKEGVKGLVDAGITKVPRIFHLPVDQYPINNTCDSEPTKT-QLRIP  66

Query  426   VIDFEGL----GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDF  593
             VID EGL       +R E V  + +A E WGFFQ+ NHGIP +V++++   V+ F EQD 
Sbjct  67    VIDLEGLEYDNSPTKRKETVAKVGEASETWGFFQIANHGIPVDVLEEIKNGVRGFFEQDT  126

Query  594   ELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKY  773
             E+KK +++RD  + V YNSNFDL  A   NWRD+  C MAP+PP+PE+LP VCRDI+++Y
Sbjct  127   EVKKKYYTRDRFRPVIYNSNFDLYSAPATNWRDTFLCNMAPNPPKPEDLPQVCRDILVEY  186

Query  774   AEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDS  953
             ++ VM LG  LFELLSEALGL   HL  M CS GL I+GHYYPPCP+P+LTLG S H D+
Sbjct  187   SKQVMKLGKLLFELLSEALGLKPSHLNDMDCSLGLQILGHYYPPCPQPELTLGTSKHADN  246

Query  954   gfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPV  1133
              F+T+LLQD +GGLQVLH++ W+DV   PG+L+VNIGD+LQL++ND+F+SV HRVLA   
Sbjct  247   DFITVLLQDHIGGLQVLHQNTWIDVLPVPGALVVNIGDLLQLISNDRFRSVEHRVLANRA  306

Query  1134  GPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              PR+SVA FF   F      + YGPIKELLSE+    YR
Sbjct  307   CPRVSVACFFSTGFLA--LPRIYGPIKELLSEDNLPKYR  343



>ref|XP_008222541.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Prunus mume]
 ref|XP_008222544.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Prunus mume]
Length=411

 Score =   347 bits (891),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 187/339 (55%), Positives = 242/339 (71%), Gaps = 10/339 (3%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIF---LNKHSILEKNSAANAATPQFVIP  425
             A YDR+SEV+ F+D+K GVKGL DAG+TK+PRIF   ++++ I     +    T Q  IP
Sbjct  49    ANYDRKSEVKTFDDTKEGVKGLVDAGITKVPRIFHLPVDQYPINNTCDSEPTKT-QLRIP  107

Query  426   VIDFEGL----GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDF  593
             VID EGL       +R E V  + +A E WGFFQ+ NHGIP +V++++   V+ F EQD 
Sbjct  108   VIDLEGLEYDNSPTKRKETVAKVGEASETWGFFQIANHGIPVDVLEEIKNGVRGFFEQDT  167

Query  594   ELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKY  773
             E+KK +++RD  + V YNSNFDL  A   NWRD+  C MAP+PP+PE+LP VCRDI+++Y
Sbjct  168   EVKKKYYTRDRFRPVIYNSNFDLYSAPATNWRDTFLCNMAPNPPKPEDLPQVCRDILVEY  227

Query  774   AEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDS  953
             ++ VM LG  LFELLSEALGL   HL  M CS GL I+GHYYPPCP+P+LTLG S H D+
Sbjct  228   SKQVMKLGKLLFELLSEALGLKPSHLNDMDCSLGLRILGHYYPPCPQPELTLGSSKHADN  287

Query  954   gfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPV  1133
              F+T+LLQD +GGLQVLH++ W+DV   PG+L+VNIGD+LQL++ND+F+SV HRVLA   
Sbjct  288   DFITVLLQDHIGGLQVLHQNKWIDVLPVPGALVVNIGDLLQLISNDRFRSVEHRVLANRA  347

Query  1134  GPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              PR+SVASFF   F      + YGPIKELLSE+    YR
Sbjct  348   CPRVSVASFFSTGFLA--LPRIYGPIKELLSEDNLPKYR  384



>ref|XP_007035072.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY05998.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 1 [Theobroma cacao]
Length=369

 Score =   346 bits (887),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 182/344 (53%), Positives = 247/344 (72%), Gaps = 8/344 (2%)
 Frame = +3

Query  225   GNLQEDSIMQ--AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAAN  398
              +L EDS  +    YDR  E++AF++SK+GVKGL D G+TKIPRIF       ++NS   
Sbjct  3     ASLAEDSCTENLTTYDRFQELKAFDESKSGVKGLVDTGITKIPRIFSRPKE--DRNSVKP  60

Query  399   AATPQFVIPVIDFEGLGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHF  578
               T QF IPVID E +  NR  E++  ++ A  + GFFQV+NHG+P  V+D+ML + + F
Sbjct  61    ICT-QFSIPVIDLENIE-NRCDEVIAGVQKAAGDVGFFQVVNHGVPQRVLDEMLAAARGF  118

Query  579   HEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRD  758
             HE   E+K+ +++R+   KV Y SNFDL  ++ ANWRD+L+C+M P+P +P+ELP VCRD
Sbjct  119   HELPREVKEGYYTRETMTKVKYGSNFDLYQSSYANWRDTLFCVMGPEPLDPQELPLVCRD  178

Query  759   IMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLS  938
             I ++Y++ +  LG TL+ELLSEALGL  DHL G+ C +G  ++ HYYP CPEP+LT+G +
Sbjct  179   ITMEYSKQIHKLGTTLYELLSEALGLKPDHLLGLDCPKGHCLLSHYYPACPEPELTMGTT  238

Query  939   SHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRV  1118
              H+D  FLT+LLQD +GGLQV H++ W+DVP  PG+L+VNIGD+LQL++N+KFKSV HRV
Sbjct  239   KHSDPDFLTILLQDHIGGLQVFHQNQWIDVPSVPGALVVNIGDLLQLISNEKFKSVEHRV  298

Query  1119  LAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             LA  +GPR+SVA FF  H       + YGPIKELLSEE P +YR
Sbjct  299   LANHIGPRVSVACFFTPHLYPS--TRIYGPIKELLSEENPPVYR  340



>ref|XP_006598207.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Glycine max]
 gb|KHN27715.1| Deacetoxyvindoline 4-hydroxylase [Glycine soja]
Length=374

 Score =   346 bits (887),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 188/353 (53%), Positives = 250/353 (71%), Gaps = 9/353 (3%)
 Frame = +3

Query  204   MVDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEK  383
             MV TS N  L+  ++  + YDR+SE++ F++SK GV+GL + G+TK+PR+F  +HS L  
Sbjct  1     MVATSTN-ELEAGTV--SRYDRKSEIKVFDESKTGVQGLVENGVTKVPRMFYCEHSNL-S  56

Query  384   NSAANAATPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKM  557
             +     +   F IP ID  G+  +   R  +V  ++ ACE WGFFQV NHGIP  V+D+M
Sbjct  57    DGLTTESNSNFTIPSIDLTGINDDPILRDAVVGKVRYACEKWGFFQVTNHGIPTQVLDEM  116

Query  558   LESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEE  737
             ++    FHEQD +++K +++RD+ +KV Y SNF L    +A+WRD+L    AP+ P  EE
Sbjct  117   IKGTGRFHEQDAKVRKEYYTRDMSRKVIYLSNFSLYQDPSADWRDTLAFFWAPNSPNDEE  176

Query  738   LPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEP  917
             LP VCRDI+ +Y+  VM+L  TLFELLSEALGLD  HLK MGC EGL  + HYYP CPEP
Sbjct  177   LPAVCRDIVPEYSTKVMALASTLFELLSEALGLDRFHLKEMGCDEGLLHLCHYYPACPEP  236

Query  918   DLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKF  1097
             +LT+G S HTD  F+T+LLQDQ+GGLQ+LHE+ W+DVP   G+L+VNIGD+LQL+TN+KF
Sbjct  237   ELTMGTSRHTDGNFMTILLQDQMGGLQILHENQWIDVPAAHGALVVNIGDLLQLVTNEKF  296

Query  1098  KSVHHRVLAKPVGPRISVASFFRMHFQ--EGNEAKTYGPIKELLSEEKPAIYR  1250
              SV HRVLA   GPR S+ASFFR+  Q  EG  ++ +GPIKELLSE  P +YR
Sbjct  297   ISVQHRVLANHQGPRTSIASFFRIGDQSPEG-LSRVFGPIKELLSEHNPPVYR  348



>ref|XP_010093417.1| Deacetoxyvindoline 4-hydroxylase [Morus notabilis]
 gb|EXB54023.1| Deacetoxyvindoline 4-hydroxylase [Morus notabilis]
Length=366

 Score =   345 bits (886),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 182/350 (52%), Positives = 255/350 (73%), Gaps = 16/350 (5%)
 Frame = +3

Query  213   TSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSA  392
             ++N+G +  ++    +YDR SE+ AF+D+K GVKGL +AG+++IPR+F++    L +   
Sbjct  2     STNSGEVMTEN--HTKYDRESELRAFDDAKTGVKGLVEAGVSRIPRVFIHDKDKLGEIKL  59

Query  393   ANAATPQFVIPVIDFEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLES  566
             A+  + ++ IP+I+ EG+  +   R EIV+ +++ACE WG FQVINHGI  N +D+M+E 
Sbjct  60    ASGDS-KYSIPIINIEGVNKSATIRKEIVDEVREACEKWGCFQVINHGISSNTLDEMIEG  118

Query  567   VQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPN  746
             ++ FHEQD E++K F++R+  +K +YN+NFD   ++ A WRD++YC MAP+PP PE+LP 
Sbjct  119   IRRFHEQDPEIRKKFYTREYTEKFSYNTNFDFYRSSAATWRDTIYCSMAPNPPNPEDLPQ  178

Query  747   VCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLT  926
             +CRDIM+ Y+E + SLG+TL ELLSEALGL+ +HL  M C++G F  G+YYP CP+PDLT
Sbjct  179   LCRDIMMAYSEKIRSLGFTLLELLSEALGLNPNHLGDMDCAKGQFFAGNYYPACPQPDLT  238

Query  927   LGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSV  1106
             LG++ HTDS F+ +LLQDQ+GGLQVLH+  WV+V   PGSLI+        ++N KFKSV
Sbjct  239   LGIAKHTDSAFMNVLLQDQIGGLQVLHQHQWVNVTPTPGSLII--------ISNGKFKSV  290

Query  1107  HHRVLAKPVGPRISVASFFR--MHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              HRVLA+  GPRISVAS FR   H QE    + YGPIKELLSEE P IY+
Sbjct  291   CHRVLAQNGGPRISVASVFRNTEHDQESG-PRVYGPIKELLSEEYPPIYK  339



>ref|XP_008222547.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Prunus mume]
Length=375

 Score =   346 bits (887),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 187/340 (55%), Positives = 242/340 (71%), Gaps = 12/340 (4%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIF---LNKHSILEK-NSAANAATPQFVI  422
             A YDR+SEV+ F+D+K GVKGL DAG+TK+PRIF   ++++ I    +S      P+  I
Sbjct  13    ANYDRKSEVKTFDDTKEGVKGLVDAGITKVPRIFHHPVDQYPINNTCDSEPTKTRPR--I  70

Query  423   PVIDFEGL----GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQD  590
             PVID EGL       +R EIV  + +A E WGFFQ+ NHGIP +V++++   V+ F EQD
Sbjct  71    PVIDLEGLEYDNNPTKRKEIVAKVGEASETWGFFQIANHGIPVDVLEEIKNGVRGFFEQD  130

Query  591   FELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIK  770
              E+KK  ++RD  + V YNSNFDL  A   NWRD+  C MAP+PP+PE+LP VCRDI+++
Sbjct  131   TEVKKELYTRDYSRPVIYNSNFDLYSALATNWRDTFLCNMAPNPPKPEDLPQVCRDILVE  190

Query  771   YAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTD  950
             Y++ VM LG  LFELLSEALGL   HL  M CS GL I+GHYYPPCP+P+LTLG S HTD
Sbjct  191   YSKQVMKLGKLLFELLSEALGLKPSHLNDMDCSLGLQILGHYYPPCPQPELTLGASKHTD  250

Query  951   SgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKP  1130
               F+T++LQD +GGLQVLH++ W+DV   PG+L+VNIGD+LQL++ND+F+SV HRVLA  
Sbjct  251   DDFITVVLQDHIGGLQVLHQNKWIDVLPVPGALVVNIGDLLQLISNDRFRSVEHRVLANR  310

Query  1131  VGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              GPR+SVA FF   F      +  GPIKELLSE+    YR
Sbjct  311   AGPRVSVACFFNTGFLA--LPRICGPIKELLSEDNLPKYR  348



>emb|CBI21960.3| unnamed protein product [Vitis vinifera]
Length=678

 Score =   355 bits (912),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 181/333 (54%), Positives = 250/333 (75%), Gaps = 6/333 (2%)
 Frame = +3

Query  258   EYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDF  437
             EYDR+SE++AF+DSK+GVKGL D G+TKIP +F+  H     ++ + +A  QF +P+ID 
Sbjct  9     EYDRKSELKAFDDSKSGVKGLLDGGMTKIPLMFI--HPRYNPDAKSESAVSQFRVPLIDL  66

Query  438   EGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPF  611
             +G+  N   R +I++ ++ ACENWGFFQV+NHGIP +V+++M++ ++ FHEQD ++KK F
Sbjct  67    DGVKDNATVRAKIIDQVRGACENWGFFQVVNHGIPASVLEEMIDGIRGFHEQDTQMKKEF  126

Query  612   HSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMS  791
             ++RD K KV++ SNFDL  A  A W+DSL   M P+PP+P E P VCRDI+ +Y++ V  
Sbjct  127   YTRDFKDKVSFVSNFDLFEATAATWKDSLSWPMVPNPPDPTEFPAVCRDIVTEYSKQVKR  186

Query  792   LGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltll  971
             LGYTLFELLSE LGL ++HLK  GC+E +F +GHYYPPCPEP+LTLG S H DSGFLT+L
Sbjct  187   LGYTLFELLSEGLGLHVNHLKDTGCAEVIFHVGHYYPPCPEPELTLGASRHADSGFLTVL  246

Query  972   lqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISV  1151
             LQDQ+GGLQVLH++ W+D+   PG+L++N+G  LQ++TND+FKS+ HRVLA  V  R+S+
Sbjct  247   LQDQVGGLQVLHQNQWIDLVPMPGALVINVGFSLQVITNDRFKSIEHRVLANRVSSRVSM  306

Query  1152  ASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             AS F         +K Y PIKELL++E P  Y+
Sbjct  307   ASAFGTTLFPS--SKLYSPIKELLTQENPPKYK  337


 Score =   336 bits (861),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 172/317 (54%), Positives = 238/317 (75%), Gaps = 6/317 (2%)
 Frame = +3

Query  306   GVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFEGLGGNR--RVEIVNM  479
             G +GL D GLTKIP +F++ H     ++ + +A  QF +P+ID +G+  N   R +I++ 
Sbjct  350   GKRGLVDGGLTKIPLMFIHPH--YNPDAKSGSAVSQFRVPLIDLDGVNDNATLRAKIIDQ  407

Query  480   IKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFD  659
             +++ACENWGF QV+NHGIP +V+++ML+ ++ FHEQD ++KK F++RD K+KV++ SNFD
Sbjct  408   VREACENWGFLQVVNHGIPASVLEEMLDGIRGFHEQDTQMKKEFYTRDFKEKVSFVSNFD  467

Query  660   LLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLD  839
             L  A  A W+DSL   +AP+PP P+ELP VCRDI+++Y++ V  LGYTLFE+LSEALGLD
Sbjct  468   LFQATAATWKDSLSWAVAPNPPHPKELPAVCRDIVMEYSKQVKRLGYTLFEVLSEALGLD  527

Query  840   LDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltlllqdqlgglqvlHEDVW  1019
             ++HLK M C+E +F  GHYYPPCPEP+LTLG   HTDSGFLT+LLQDQ+GGLQVLH++ W
Sbjct  528   VNHLKDMECAEMMFHAGHYYPPCPEPELTLGARRHTDSGFLTVLLQDQVGGLQVLHQNQW  587

Query  1020  VDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISVASFFRMHFQEGNEAKT  1199
             +D+   PG+L++N+GD LQ++TND+FKS+ HRVL      R+SVAS F         +K 
Sbjct  588   IDLVPMPGALVINVGDSLQVITNDRFKSIEHRVLVNSESSRVSVASAFGTTLFPS--SKL  645

Query  1200  YGPIKELLSEEKPAIYR  1250
             Y PIKELLS+E P  Y+
Sbjct  646   YSPIKELLSQENPPKYK  662



>ref|XP_006341093.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Solanum tuberosum]
Length=367

 Score =   345 bits (886),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 181/335 (54%), Positives = 246/335 (73%), Gaps = 6/335 (2%)
 Frame = +3

Query  252   QAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVI  431
             +A+Y+R +E++AF+ +KAGVKGL DAG+ K+P +F+    + +     N    +F  P+I
Sbjct  10    EAKYERMAELQAFDKTKAGVKGLVDAGIIKVPSMFVQPLKVEDWRCHNNNKFIKF--PII  67

Query  432   DFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKK  605
             D +G+  +  +R  IV  +  A E+WGFFQVINHGIP +VM+ M + V  F EQD E+KK
Sbjct  68    DLDGIMEDPIKRKNIVQEVGHASESWGFFQVINHGIPSHVMEAMKDGVTRFFEQDTEVKK  127

Query  606   PFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
              +++RD+ K+ T+NSNFDL  A   NWRD+    +AP PP+PE+LP+VC+DI+++Y   V
Sbjct  128   QWYTRDLTKEFTFNSNFDLFRAPVTNWRDTFRATIAPIPPKPEQLPSVCKDILLEYTNQV  187

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgflt  965
             M+LG TLFEL+SEA+GL+ +HLK MGC+EGL  IG YYP CP+P+LTLG S H D+ FLT
Sbjct  188   MTLGDTLFELVSEAIGLEPNHLKDMGCAEGLLAIGQYYPACPQPELTLGTSKHADNDFLT  247

Query  966   lllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRI  1145
             +LLQD +GGLQVLH++ WVDVP  PG+L+VNIGD+LQL+TNDKFKSV HRVLA  VG R+
Sbjct  248   VLLQDNIGGLQVLHQNHWVDVPPTPGALVVNIGDLLQLITNDKFKSVDHRVLANKVGTRV  307

Query  1146  SVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             S+A FF  +    +  + YGPIKEL+SE+ P  YR
Sbjct  308   SMACFFMTNCVTTH--RLYGPIKELISEQNPPKYR  340



>ref|XP_010483594.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
11-like isoform X2 [Camelina sativa]
Length=366

 Score =   345 bits (886),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 185/335 (55%), Positives = 239/335 (71%), Gaps = 7/335 (2%)
 Frame = +3

Query  258   EYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDF  437
             E+DR  E +AF+++K GVKGL DA +T+IPRIF +    L  +   + +     IP+IDF
Sbjct  8     EFDRYIERKAFDETKEGVKGLVDAKITQIPRIFYHPQDAL-TDKKPSVSVSDLEIPIIDF  66

Query  438   EGL--GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPF  611
               +      R  +V  ++ A E WGFFQV+NHG+P NV++++ ++V+ FHE D E+KK +
Sbjct  67    ASVHVDTTSREAVVEKVRSAAETWGFFQVVNHGVPLNVIEEIKDAVRRFHEDDPEVKKSY  126

Query  612   HSRD-VKKKVTYNSNFDLLVAA-TANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
             +SRD  K K  Y+SNFDL  ++ +  WRDS+ C MAPDPP PEELP  CRD +IKY +HV
Sbjct  127   YSRDFTKNKFAYSSNFDLYSSSPSLTWRDSISCYMAPDPPTPEELPETCRDAVIKYTKHV  186

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgflt  965
             +SLG  LFELLSEALGL  + LK M C + L +I HYYPPCP+PDLTLG+S H+D+ FLT
Sbjct  187   LSLGDLLFELLSEALGLKSEILKSMDCLKSLLMICHYYPPCPQPDLTLGISKHSDNSFLT  246

Query  966   lllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRI  1145
             +LLQD +GGLQ+LH+D W+DV   PG+L+VNIGD LQL+TNDKF SV HRVLA   GPRI
Sbjct  247   VLLQDDIGGLQILHQDSWIDVSPLPGALVVNIGDFLQLITNDKFISVEHRVLANTRGPRI  306

Query  1146  SVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             SVASFF    +E   +  YGP+KELLSEE P  YR
Sbjct  307   SVASFFSSSIREN--STVYGPMKELLSEENPPKYR  339



>ref|XP_010023981.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Eucalyptus grandis]
 gb|KCW60389.1| hypothetical protein EUGRSUZ_H03105 [Eucalyptus grandis]
Length=371

 Score =   345 bits (886),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 181/333 (54%), Positives = 245/333 (74%), Gaps = 6/333 (2%)
 Frame = +3

Query  258   EYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDF  437
             +YDR  E +AF++SKAGVKGL DAG+T++PRIF++    L+  SA  ++   F +P++D 
Sbjct  15    KYDRMREKKAFDESKAGVKGLVDAGITEVPRIFVDHPENLQ--SALASSNGHFHVPIVDL  72

Query  438   EGL--GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPF  611
               +    +RR E+VN ++ A + WGFFQV+NHGIP  V+++ML+ V+ FHEQ  E K+ F
Sbjct  73    ADIVKDPSRRKEVVNEVRSASKTWGFFQVVNHGIPTTVLEEMLDGVRRFHEQGAEEKRRF  132

Query  612   HSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMS  791
             +SRD    V Y+SNF+L     ANWRD+L+C+MAP+ PE E+LP VCRDIM+++++ VM+
Sbjct  133   YSRDFTTSVAYHSNFNLYKTEAANWRDTLFCVMAPNAPEAEDLPAVCRDIMLEFSKRVMN  192

Query  792   LGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltll  971
             LG TLFELLSEALGL  +HLK M C++GL ++  YYP CP+P+LT+G S HTDS FLT+L
Sbjct  193   LGITLFELLSEALGLKPNHLKDMECAKGLVLLNQYYPKCPQPELTMGTSRHTDSDFLTVL  252

Query  972   lqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISV  1151
             LQD +GGLQVL+++ W+DV   PG+LIVNIGD+LQL++ND FKS  HRV+A  +GPR SV
Sbjct  253   LQDHVGGLQVLYQNQWIDVSPVPGALIVNIGDLLQLISNDIFKSSEHRVVANNMGPRASV  312

Query  1152  ASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             A FF  +       K YGPIKEL+SE  P  YR
Sbjct  313   ACFF--YTATPPSPKLYGPIKELISEGDPPKYR  343



>ref|XP_010326756.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
isoform X1 [Solanum lycopersicum]
Length=379

 Score =   346 bits (887),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 186/341 (55%), Positives = 253/341 (74%), Gaps = 15/341 (4%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVID  434
               YDR SE++AF+D+KAGVKG+ DAG+T++PRIF+    I E     N  T +F+ PVID
Sbjct  16    GSYDRMSELKAFDDTKAGVKGIVDAGITEVPRIFVQPTKIEE--CVRNCET-KFIFPVID  72

Query  435   FEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKP  608
              EG+  +  +  EIV+ ++DA E WGFFQV+NHGIP +VM++ML+  + F EQ  ++KK 
Sbjct  73    LEGIDKDPIKHKEIVDRVRDASETWGFFQVVNHGIPLSVMEEMLQGTRRFFEQHVDIKKQ  132

Query  609   FHSRDVKKKVTYNSNFDLL---VAATANWRDSLYCIMAPDPPEPEELP----NVCRDIMI  767
             +++RD  KK+ + SNFDL    V AT NWRDS++C+MAP+ P PEELP    N CR+I++
Sbjct  133   YYTRDNTKKIVHVSNFDLYSPSVPAT-NWRDSIFCLMAPNHPSPEELPTACSNCCREILM  191

Query  768   KYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHT  947
             +++ HVM+LG +LFELLSE LGL+  HL  + C+EGL ++GHYYP CP+P+LT+G + H+
Sbjct  192   EFSNHVMTLGKSLFELLSEGLGLNPSHLNDIDCAEGLRVLGHYYPACPQPELTIGTNKHS  251

Query  948   DSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAK  1127
             D+ F+T+LLQDQ+GGLQVLHE  W+DVP  PG+L+VNIGD+LQL++NDK+ SV HRVL+ 
Sbjct  252   DNDFITVLLQDQIGGLQVLHETQWIDVPPTPGALVVNIGDLLQLISNDKYLSVEHRVLSN  311

Query  1128  PVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              VGPRISVA FF  +       K YGPIKELLS++ P  YR
Sbjct  312   KVGPRISVACFF--YTGSLPTTKLYGPIKELLSDDSPPKYR  350



>ref|NP_171930.1| 1-aminocyclopropane-1-carboxylate oxidase-like 6 [Arabidopsis 
thaliana]
 sp|P93824.1|ACCH6_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate oxidase homolog 
6 [Arabidopsis thaliana]
 gb|AAB70442.1| Similar to Arabidopsis 2A6 (gb|X83096). EST gb|T76913 comes from 
this gene [Arabidopsis thaliana]
 gb|AAK93598.1| putative 1-aminocyclopropane-1-carboxylate oxidase [Arabidopsis 
thaliana]
 gb|AAM45017.1| putative 1-aminocyclopropane-1-carboxylate oxidase [Arabidopsis 
thaliana]
 gb|AAN31842.1| putative 1-aminocyclopropane-1-carboxylate oxidase [Arabidopsis 
thaliana]
 dbj|BAE98490.1| putative 1-aminocyclopropane-1-carboxylate oxidase [Arabidopsis 
thaliana]
 gb|AEE27687.1| 1-aminocyclopropane-1-carboxylate oxidase-like 6 [Arabidopsis 
thaliana]
Length=360

 Score =   345 bits (885),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 188/334 (56%), Positives = 243/334 (73%), Gaps = 8/334 (2%)
 Frame = +3

Query  258   EYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIF-LNKHSILEKNSAANAATPQFVIPVID  434
             E+D  SE +AF+++K GVKGL DA +T+IPRIF L + S+ +K      +T  F IP+ID
Sbjct  5     EFDSYSERKAFDETKTGVKGLIDAHITEIPRIFCLPQGSLSDKKPFV--STTDFAIPIID  62

Query  435   FEGLGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFH  614
             FEGL  +R  +IV  IKDA  NWGFFQVINHG+P NV+ ++ + V+ FHE+  E+KK + 
Sbjct  63    FEGLHVSRE-DIVGKIKDAASNWGFFQVINHGVPLNVLQEIQDGVRRFHEEAPEVKKTYF  121

Query  615   SRDVKKKVTYNSNFDLLVAATA-NWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMS  791
             +RD  K+  YNSNFDL  +++  NWRDS  C MAPDPP PE+LP  CR  M +Y++H+M 
Sbjct  122   TRDATKRFVYNSNFDLYSSSSCVNWRDSFACYMAPDPPNPEDLPVACRVAMFEYSKHMMR  181

Query  792   LGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltll  971
             LG  LFELLSEALGL  D LK M C +GL ++ HYYPPCP+PDLT+G ++H+D+ FLT+L
Sbjct  182   LGDLLFELLSEALGLRSDKLKSMDCMKGLLLLCHYYPPCPQPDLTIGTNNHSDNSFLTIL  241

Query  972   lqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLA-KPVGPRIS  1148
             LQDQ+GGLQ+ H+D WVDV   PG+L++N+GD LQL+TNDK  SV HRVLA +   PRIS
Sbjct  242   LQDQIGGLQIFHQDCWVDVSPIPGALVINMGDFLQLITNDKVISVEHRVLANRAATPRIS  301

Query  1149  VASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             VASFF    +    +  YGPIKELLSEE P+ YR
Sbjct  302   VASFFSTSMRPN--STVYGPIKELLSEENPSKYR  333



>ref|XP_004296613.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Fragaria vesca subsp. vesca]
Length=362

 Score =   345 bits (884),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 183/337 (54%), Positives = 240/337 (71%), Gaps = 4/337 (1%)
 Frame = +3

Query  246   IMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIP  425
             ++   YDR+SEV+AF+D+K GVKGL DAG+T++PRIF ++      N + +    Q  IP
Sbjct  1     MVATNYDRKSEVKAFDDTKEGVKGLVDAGVTEVPRIFHHQPDEYSINDSNDPEETQISIP  60

Query  426   VIDFEGL-GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELK  602
             VID EGL    ++ EIV  + +A E WGFFQ++NHGIP +V++++   V  F EQD E+K
Sbjct  61    VIDLEGLLDSTKQKEIVAKVGEASETWGFFQIVNHGIPVDVLEEVKHGVHRFFEQDTEVK  120

Query  603   KPFHSRD-VKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAE  779
             K  + RD  +  V YNSNFDL  A   NWRD+  C MAP P +PE+LP VCR+I+++Y++
Sbjct  121   KQLYGRDHFRNPVIYNSNFDLYSAPATNWRDTFMCYMAPTPTKPEDLPEVCRNILVEYSD  180

Query  780   HVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgf  959
              VM LG  LFELLSEALGL   +L  + CSEGL ++ HYYPPCP+P+LTLG + H D+ F
Sbjct  181   QVMKLGKLLFELLSEALGLKPTYLNDIDCSEGLVLLSHYYPPCPQPELTLGTTKHADNSF  240

Query  960   ltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGP  1139
             LT+LLQD +GGLQVLH++ W+DVP  PG+L+VNIGD+LQL++ND+FKSV H+VLA   GP
Sbjct  241   LTVLLQDHIGGLQVLHQNKWIDVPPVPGALVVNIGDLLQLISNDRFKSVEHKVLANCRGP  300

Query  1140  RISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             R+S ASFF          K YGPIKELLSEE P  YR
Sbjct  301   RVSNASFFCTGMLP--LPKLYGPIKELLSEENPPKYR  335



>ref|XP_006587351.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Glycine max]
 gb|KHN47484.1| 1-aminocyclopropane-1-carboxylate oxidase like 1 [Glycine soja]
Length=361

 Score =   345 bits (884),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 177/336 (53%), Positives = 245/336 (73%), Gaps = 6/336 (2%)
 Frame = +3

Query  249   MQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPV  428
             ++A  DR++EV+AF+DSK GVKG+ D+G+TKIP +F   H  L+    +   +  F IP+
Sbjct  3     LEAVNDRKAEVQAFDDSKTGVKGVLDSGVTKIPTMF---HVKLDSTHTSPTHS-NFTIPI  58

Query  429   IDFEGLGGNRRV--EIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELK  602
             ID + +  N  +  E+V+ ++ A + WGFFQVINHG+P  V+D+M+  ++ FHEQD E +
Sbjct  59    IDLQNINSNSTLHAEVVDQLRSASQKWGFFQVINHGVPVEVLDEMISGIRRFHEQDAEAR  118

Query  603   KPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEH  782
             KPF+SRD  KKV Y SN  L       WRD++   + PDPP P+++P VCRDI+ +Y++ 
Sbjct  119   KPFYSRDSSKKVRYFSNGKLFRDMAGTWRDTIAFDVNPDPPNPQDIPAVCRDIVAEYSKQ  178

Query  783   VMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfl  962
             V +LG T+FELLSEALGLD  +L+ M C++ L+++G YYP CPEP+LT+G+S HTD  F+
Sbjct  179   VKALGTTIFELLSEALGLDPSYLEEMDCTKALYVMGQYYPKCPEPELTMGISKHTDCDFI  238

Query  963   tlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPR  1142
             T+LLQDQ+GGLQVLHE+ WV+ P   G+L+VNIGD+LQL+TNDKF SV+HRVL + +GPR
Sbjct  239   TILLQDQIGGLQVLHENHWVNAPPVRGALVVNIGDILQLMTNDKFISVYHRVLLRNMGPR  298

Query  1143  ISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             ISVA+FF         +K+YGPIKELLSEE P +YR
Sbjct  299   ISVATFFMNFTISKCTSKSYGPIKELLSEENPPVYR  334



>ref|XP_004495381.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Cicer arietinum]
Length=365

 Score =   345 bits (884),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 186/334 (56%), Positives = 247/334 (74%), Gaps = 11/334 (3%)
 Frame = +3

Query  261   YDRRSEVEAFEDSKAGVKGLFDAGL--TKIPRIFLNKHSILEKNSAANAATPQFVIPVID  434
             YDR++EV+AFEDSK GVKGL ++G   TKIP +F +    L   S++      F++P+ID
Sbjct  12    YDRKAEVQAFEDSKLGVKGLLESGTCTTKIPLMFHSPKLNLNHTSSS------FIVPIID  65

Query  435   FEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKP  608
              + +  N    VE+V+ I+ AC+ WGFFQV+NHGI  +V+D+M+  +  FHEQ+ + +K 
Sbjct  66    LQDIHTNTCLHVEVVDKIRSACKEWGFFQVVNHGIEVSVLDEMISGICRFHEQEADARKV  125

Query  609   FHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVM  788
             F++RD  KKV Y SN  L     ANWRDS+   ++PDPP PEE+P+VCRDI+I+Y++ V 
Sbjct  126   FYTRDKNKKVRYFSNGSLFQDPAANWRDSIAFFISPDPPSPEEIPHVCRDIVIEYSKKVR  185

Query  789   SLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltl  968
             +LG+T+FEL SEALGL+  +LK +   EG F++GHYYP CPEP+LT+G S HTDS F+T+
Sbjct  186   ALGFTIFELFSEALGLESCYLKQLVSEEGQFLLGHYYPACPEPELTMGTSKHTDSDFMTI  245

Query  969   llqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRIS  1148
             LLQDQ+GGLQVLH++ WVDVP   GSL+VNIGD+LQLLTND F SV+HRVL+K  GPRIS
Sbjct  246   LLQDQIGGLQVLHQNRWVDVPPVYGSLVVNIGDILQLLTNDMFTSVYHRVLSKHTGPRIS  305

Query  1149  VASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             +ASFF     EG ++K  GPIKELLSEE P IY+
Sbjct  306   IASFFVNSSSEG-KSKVVGPIKELLSEENPPIYK  338



>ref|XP_006489612.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
12-like [Citrus sinensis]
Length=403

 Score =   345 bits (886),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 184/343 (54%), Positives = 246/343 (72%), Gaps = 12/343 (3%)
 Frame = +3

Query  249   MQAE----YDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQF  416
             +QAE    YDR SE++AF+D+KAGVKGL DA + K+PRIF  + S++  NS  ++   Q 
Sbjct  3     LQAETDSNYDRESELKAFDDTKAGVKGLVDARVAKVPRIFECEQSVVNLNSGNSS---QL  59

Query  417   VIPVIDFEGLGG--NRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQD  590
              +P ID EG+    N R EI+N +K+A E WGFFQVI+HGIP +V++ + + ++ FHE D
Sbjct  60    RVPTIDPEGIHKDPNTRTEIINKVKNASEEWGFFQVISHGIPLSVLNDIKDGIRKFHELD  119

Query  591   FELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIK  770
              E KK  +SRD  ++V YNSNFDL  A  A WRD++ C ++P PP P EL +VCRD +++
Sbjct  120   TETKKKLYSRDPTQRVFYNSNFDLYQAPLAGWRDTILCHLSPHPPSPVELLDVCRDAVME  179

Query  771   YAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTD  950
             Y  HV+ LG+T+FELLSEA GL   HL  M C EGL ++GHYYP CPEP+ TLG + HTD
Sbjct  180   YRTHVLRLGHTMFELLSEAFGLSSSHLNDMDCEEGLLLLGHYYPACPEPEFTLGTTQHTD  239

Query  951   SgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQ---LLTNDKFKSVHHRVL  1121
               F+T+LLQDQ+GGLQVLHE+ W+DV    G+LI+NIG+ LQ   L++NDKF S +HRVL
Sbjct  240   GSFITILLQDQVGGLQVLHENQWIDVRPTDGALIMNIGNFLQESSLISNDKFISANHRVL  299

Query  1122  AKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              K VG R+SVA FFR    +G+ ++ YGP+K+LLS+E P IYR
Sbjct  300   VKDVGSRVSVACFFRPEAHKGDSSRVYGPVKDLLSDENPPIYR  342



>ref|XP_007223295.1| hypothetical protein PRUPE_ppa007267mg [Prunus persica]
 gb|EMJ24494.1| hypothetical protein PRUPE_ppa007267mg [Prunus persica]
Length=375

 Score =   344 bits (883),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 182/338 (54%), Positives = 238/338 (70%), Gaps = 8/338 (2%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANA--ATPQFVIPV  428
               YDR+SEV+ F+D+K GVKGL DAG+T++PRIF         N+  ++     Q  IPV
Sbjct  13    TNYDRKSEVKTFDDTKEGVKGLVDAGITQVPRIFHQPVDQYPINNTCDSEPTKTQLRIPV  72

Query  429   IDFEGL----GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFE  596
             ID EGL       +R EIV  +++A E WGFFQ+ NHGIP +V++++   V+ F EQD E
Sbjct  73    IDLEGLEYDNNPTKRKEIVAKVREASETWGFFQIANHGIPVDVLEEITNGVRGFFEQDTE  132

Query  597   LKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYA  776
             +KK  ++RD  + V YNSNFDL  A   NWRDS  C MAP+PP+PE+LP VCRDI+++Y+
Sbjct  133   VKKELYTRDYFRPVIYNSNFDLYSAPATNWRDSFLCNMAPNPPKPEDLPQVCRDILVEYS  192

Query  777   EHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSg  956
             + VM LG  LF+LLSEALGL   HL  M CS GL ++ +YYPPCP+P+LTLG S H D  
Sbjct  193   KQVMKLGKLLFQLLSEALGLKPSHLNDMDCSLGLQVLCNYYPPCPQPELTLGASKHADDD  252

Query  957   fltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVG  1136
             F+T++LQD +GGLQVLH++ W+DV   PG+L+VNIGD+LQL++ND+F+SV HRVLA   G
Sbjct  253   FITVVLQDHIGGLQVLHQNKWIDVLPVPGALVVNIGDLLQLISNDRFRSVEHRVLANRAG  312

Query  1137  PRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             PR+SVASFF   F      + YGPIKELLSE+    YR
Sbjct  313   PRVSVASFFTTGFLA--LPQIYGPIKELLSEDNLPKYR  348



>ref|XP_007226673.1| hypothetical protein PRUPE_ppa021125mg [Prunus persica]
 gb|EMJ27872.1| hypothetical protein PRUPE_ppa021125mg [Prunus persica]
Length=346

 Score =   343 bits (880),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 185/335 (55%), Positives = 240/335 (72%), Gaps = 5/335 (1%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVID  434
               YDR+SE++AF+D+K GVKGL DAG+T++PRIF         NS  ++   QF IP+ID
Sbjct  7     TNYDRQSELKAFDDTKEGVKGLVDAGITEVPRIFHQPPDQYIINSNFDSEATQFSIPLID  66

Query  435   FEGL---GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKK  605
              EGL      +R EIV  + +A E WGFFQ+ NHGIP  V+++M +SV+ F EQD  +KK
Sbjct  67    LEGLEFDSPTKRNEIVAKVGEASETWGFFQISNHGIPVGVLEEMKDSVRGFFEQDTHVKK  126

Query  606   PFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
              F++RD  K V YNSNFDL  A   +WRD+  C MAP+P +PEE+P V RDI+I+Y++ +
Sbjct  127   QFYNRDPLKPVGYNSNFDLYRAPATSWRDTFRCYMAPNPAKPEEMPEVFRDILIEYSKQI  186

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgflt  965
             M LG  LFELLSEALGL   HL  + CSEGL ++ +YYP CP+P+LTLG S H DS FLT
Sbjct  187   MRLGKLLFELLSEALGLTPSHLNDIDCSEGLVLLCNYYPACPQPELTLGTSKHADSYFLT  246

Query  966   lllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRI  1145
             +LLQD +GGLQVLH++ W+DVP  PG+L+VN+GD+LQL++N++FKSV HRVLA  VGPR+
Sbjct  247   VLLQDHIGGLQVLHKNKWIDVPPVPGALVVNVGDLLQLISNERFKSVEHRVLANRVGPRV  306

Query  1146  SVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             SVASFF          K YGPIKEL+S + P  YR
Sbjct  307   SVASFFTTGMLP--LKKLYGPIKELVSGDNPPKYR  339



>ref|XP_006354516.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Solanum tuberosum]
Length=382

 Score =   344 bits (883),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 182/340 (54%), Positives = 242/340 (71%), Gaps = 8/340 (2%)
 Frame = +3

Query  243   SIMQAEYDRRSEVEAFEDSKAGVKGLFDAG-LTKIPRIFLNKHSILEKNSAANAATPQFV  419
             + +Q  YD+ SE++AF+D+KAGVKGL DAG  T++PRIF++    +  +S       +FV
Sbjct  18    ATLQPNYDKHSELKAFDDTKAGVKGLVDAGNSTEVPRIFVHPRESIHDSSGFTEK--EFV  75

Query  420   IPVIDFEGLGGN-RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFE  596
              PVID EG+    R  EIV+ ++DA E WGFFQV+NHGIP  V+++ML+  + F EQD E
Sbjct  76    FPVIDLEGIDNPMRHKEIVDKVRDASETWGFFQVVNHGIPLPVLEEMLQGARRFFEQDVE  135

Query  597   LKKPFHSRDVKKKVTYNSNFDLLVAA--TANWRDSLYCIMAPDPPEPEELPNVCRDIMIK  770
             +KK +++RD  KKV + SNFDL   +   A+WRDSLYC M P+PP PEE P  CR+I+I+
Sbjct  136   IKKQYYTRDTTKKVAHVSNFDLFSPSVPAASWRDSLYCFMCPNPPSPEEFPTACREILIE  195

Query  771   YAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTD  950
             +++ +M LGY+LFELLSE LGL+  HLK M C+EGL I  HYYP CP+P+LT+G   H+D
Sbjct  196   FSKKMMKLGYSLFELLSEGLGLNPCHLKDMNCAEGLSIAQHYYPACPQPELTIGTRQHSD  255

Query  951   SgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKP  1130
               F+T+LLQD +GGLQV H++ W+DVP  PG+L+VNIGD+LQL++NDK+ SV HRVL+  
Sbjct  256   CVFITVLLQDDIGGLQVRHQNQWIDVPPTPGALVVNIGDLLQLISNDKYISVEHRVLSNK  315

Query  1131  VGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             VGPRISV  FF          + YGPIKEL SE  P  YR
Sbjct  316   VGPRISVPCFFST--GAFPSPRIYGPIKELSSECNPPKYR  353



>gb|KHN22503.1| 1-aminocyclopropane-1-carboxylate oxidase like 1 [Glycine soja]
Length=485

 Score =   347 bits (891),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 188/351 (54%), Positives = 253/351 (72%), Gaps = 9/351 (3%)
 Frame = +3

Query  204   MVDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEK  383
             MV TS N +  E S   + YDR +EV+AF+++K GVKGLFD+G+TKIPR+F   H+ +E 
Sbjct  1     MVATSTNQSELETSKKDSTYDRIAEVKAFDETKLGVKGLFDSGITKIPRMF--HHAKVED  58

Query  384   NSAANAATPQFVIPVIDFEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKM  557
             ++        F IP+ID + +  N   RV+ ++ I+ AC+ WGFFQV+NHGI  +++D+M
Sbjct  59    HTETTPNDSNFSIPIIDLQDIDTNSSLRVKALDKIRSACKEWGFFQVVNHGIAVDLLDEM  118

Query  558   LESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEE  737
             +  ++ FHEQD E++K F+SRD+ KKV Y SN  L     ANWRDS+     PDPP PEE
Sbjct  119   ICGIRRFHEQDAEVRKSFYSRDMNKKVRYFSNGTLYRDPAANWRDSI----VPDPPYPEE  174

Query  738   LPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEP  917
             +P VCRDI+I Y+E V +LG+T+FEL SEALGL   +L  +   +G +++ HYYPPCPEP
Sbjct  175   IPAVCRDIVIGYSEKVRALGFTIFELFSEALGLHSSYLNELDSVDGQYLLCHYYPPCPEP  234

Query  918   DLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKF  1097
             +LT+G S HTD  F+T+LLQDQ+GGLQVLH++ WVDVP   GSL+VNIGD+LQL+TND F
Sbjct  235   ELTMGTSKHTDISFMTILLQDQMGGLQVLHQNQWVDVPPVHGSLVVNIGDLLQLITNDMF  294

Query  1098  KSVHHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              SV+HRVL++  GPRISVASFF  +    + +K  GPIKELLSE+ P +YR
Sbjct  295   VSVYHRVLSRYTGPRISVASFF-ANSSPQSSSKVVGPIKELLSEDNPPVYR  344


 Score =   129 bits (323),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 79/114 (69%), Gaps = 0/114 (0%)
 Frame = +3

Query  576  FHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCR  755
            FHEQD E++K F+SRD+ KKV Y SN  L     ANWRDS+   + PDPP PEE+P VCR
Sbjct  370  FHEQDAEVRKSFYSRDMNKKVRYFSNNSLYRDPAANWRDSIGFFLTPDPPNPEEIPAVCR  429

Query  756  DIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEP  917
            +I+I+Y+E + +LG+T+FEL  EALGL   +L  +   +G +++ H YPPC  P
Sbjct  430  NIVIEYSEKIRALGFTIFELFLEALGLHSSYLNELDSVDGRYLLCHCYPPCKYP  483



>gb|EYU32968.1| hypothetical protein MIMGU_mgv1a008832mg [Erythranthe guttata]
Length=361

 Score =   343 bits (879),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 181/335 (54%), Positives = 241/335 (72%), Gaps = 4/335 (1%)
 Frame = +3

Query  246   IMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIP  425
             + + +YDR  E+++F+++KAGVKGL D+G+  IPRIF         N+ A+A    + IP
Sbjct  4     VRETKYDRAGELKSFDETKAGVKGLVDSGVETIPRIFRLPEE-YSTNTTAHANESNYDIP  62

Query  426   VIDFEGLGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKK  605
             VID E  G +R+V  V+ I+ A E +GFFQV+NHGIP  V+++ML  V+ F+E D E KK
Sbjct  63    VIDLEKEGIDRKV-TVDKIRHASEKYGFFQVVNHGIPVGVLEEMLCGVRRFNEMDAEAKK  121

Query  606   PFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
              +++RDV +K  YNSN DL    T NWRD+    MAP+PP+PEELP  CRDI I+Y+ HV
Sbjct  122   VYYTRDVTRKFVYNSNSDLYSVPTVNWRDTFLSFMAPNPPKPEELPASCRDIQIEYSRHV  181

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgflt  965
             M+LG+ LF LLSEALGL+   L  MGC++GL  +GHYYP CP+P+LTLG ++HTD  FLT
Sbjct  182   MNLGFRLFGLLSEALGLESSRLAEMGCTDGLTFVGHYYPACPQPELTLGATNHTDDAFLT  241

Query  966   lllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRI  1145
             +LLQDQ+GGLQV  +++W+D+P   G+L++NIGD+LQL++NDKFKSV HRVLA   GPR+
Sbjct  242   VLLQDQIGGLQVFLDNMWIDIPPVHGALVINIGDLLQLISNDKFKSVEHRVLANREGPRM  301

Query  1146  SVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             SVA FF         +K YGPIKELLSE+ P  YR
Sbjct  302   SVACFFSTSLMPS--SKIYGPIKELLSEDNPPKYR  334



>ref|XP_003626787.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
Length=364

 Score =   343 bits (879),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 182/333 (55%), Positives = 245/333 (74%), Gaps = 6/333 (2%)
 Frame = +3

Query  258   EYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDF  437
             +YDR SE++AF+++K GVKGL DA +T IPR+F   H   + ++++++ + + VIP ID 
Sbjct  6     DYDRASELKAFDETKDGVKGLVDASVTSIPRMF--HHEFDKDSTSSSSNSHKLVIPSIDL  63

Query  438   EGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPF  611
               +  +  RR  +V  I++A E WGFFQ++NHGI  +V+D+M   V  F EQD E+K+  
Sbjct  64    VDIHQDPTRRKIVVEKIREASETWGFFQIVNHGIEVSVLDEMKNGVVRFFEQDSEVKREL  123

Query  612   HSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMS  791
             ++RD  K + YNSNFDL  +  A WRD+ YC MAP+ P PE+LP+VCRDIM++Y + VM 
Sbjct  124   YTRDPVKPLVYNSNFDLYSSPAATWRDTFYCFMAPNSPNPEDLPSVCRDIMLEYTKQVMK  183

Query  792   LGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltll  971
             LG  LFELLSEALGLD ++L  M C+EGL ++ HYYP CPEP+LTLG++ HTD+ F+T+L
Sbjct  184   LGNLLFELLSEALGLDPNYLNEMRCNEGLALVCHYYPSCPEPELTLGITKHTDNDFITVL  243

Query  972   lqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISV  1151
             LQD +GGLQVL E+ WVDV   PG+L++NIGD+LQL+TNDKFKSV HRV+A  VGPR+SV
Sbjct  244   LQDHIGGLQVLRENSWVDVSPVPGALVINIGDLLQLITNDKFKSVEHRVVANHVGPRVSV  303

Query  1152  ASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             ASF+   FQ     K YGPIKEL+SE+ P  YR
Sbjct  304   ASFYSTSFQPS--TKLYGPIKELVSEDNPPKYR  334



>ref|XP_002881136.1| hypothetical protein ARALYDRAFT_482001 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57395.1| hypothetical protein ARALYDRAFT_482001 [Arabidopsis lyrata subsp. 
lyrata]
Length=362

 Score =   343 bits (879),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 186/339 (55%), Positives = 246/339 (73%), Gaps = 9/339 (3%)
 Frame = +3

Query  249   MQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPV  428
             M+A+ DR SEV+AF++ K GVKGL D G+T+IPRIF + H  L  ++   ++T   VIP 
Sbjct  1     MEAKNDRASEVKAFDEMKIGVKGLVDTGVTQIPRIFHHPHLNLTDSNLLLSST-TMVIPT  59

Query  429   IDFEG----LGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFE  596
             ID +G         R  ++ MI+DA E +GFFQVINHGIP +VM+KM + ++ FHEQD +
Sbjct  60    IDLKGGVFDESTVMRENVIAMIRDAVEKFGFFQVINHGIPIDVMEKMKDGIRGFHEQDSD  119

Query  597   LKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYA  776
             ++K F++RD+ KKV YNSNFDL  + +ANWRD+L C M+PD P+ E+LP++C +IM++Y+
Sbjct  120   VRKKFYTRDITKKVKYNSNFDLYSSPSANWRDTLSCFMSPDVPKTEDLPDICGEIMLEYS  179

Query  777   EHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSg  956
             + VM LG  +FELLSEALGL+ +HLK M C++GL ++ HYYPPCPEPDLT G S H+D  
Sbjct  180   KRVMKLGELIFELLSEALGLNPNHLKEMDCTKGLLMLSHYYPPCPEPDLTFGTSQHSDRS  239

Query  957   fltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLA-KPV  1133
             FLT+LLQD +G LQVL    WVDVP  PG+L+VN+GD+LQL+TNDKF SV HRVLA +  
Sbjct  240   FLTILLQDHIGELQVLQNGYWVDVPPVPGALLVNLGDLLQLMTNDKFLSVEHRVLANRGE  299

Query  1134  GPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              PRISVASFF          + YGPIKELLS++    YR
Sbjct  300   EPRISVASFF---VHPLPSLRVYGPIKELLSDQNLPKYR  335



>ref|XP_003591799.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
 gb|AES62050.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
 gb|AFK34307.1| unknown [Medicago truncatula]
Length=370

 Score =   343 bits (880),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 183/344 (53%), Positives = 250/344 (73%), Gaps = 7/344 (2%)
 Frame = +3

Query  231   LQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGL--TKIPRIFLNKHSILEKNSAANAA  404
             L+  +   + YDR +EV+AFE+SK GVKGL ++G+  TKIPR+F + +  L  +  + A+
Sbjct  3     LEASNGSSSTYDRTAEVKAFEESKTGVKGLLESGIWTTKIPRMFHSPNLNLNSDHESEAS  62

Query  405   TPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHF  578
             + +F +P+ID + +  +     E++  I+ AC+ WGFFQVINHGIP  V+D+M+  ++ F
Sbjct  63    S-KFSVPIIDLQDINTDPCLHAEVLEKIRSACKEWGFFQVINHGIPVIVLDEMISGIRRF  121

Query  579   HEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRD  758
             HEQD + +KPF++RD  KKV Y SN  L     ANWRDSL   ++P+PP+PEE+P VCRD
Sbjct  122   HEQDADARKPFYTRDKSKKVRYFSNGSLFTDPAANWRDSLSFFVSPNPPDPEEIPQVCRD  181

Query  759   IMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLS  938
             I+I+Y++ V +LG T+FEL SEALGL   +LK +    G F++ HYYPPCPEP+LT+G S
Sbjct  182   IVIEYSKKVRALGLTIFELFSEALGLHPSYLKDLALDYGQFLLCHYYPPCPEPELTMGTS  241

Query  939   SHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRV  1118
              HTD  F+T+LLQDQ+GGLQVLH++ WV VP   GSL+VNIGD+LQL+TND F SV+HRV
Sbjct  242   KHTDIDFMTILLQDQIGGLQVLHQNQWVHVPPLHGSLVVNIGDLLQLVTNDMFTSVYHRV  301

Query  1119  LAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             L+K +GPR+S+ASFF    +    +K  GPIKELLSEE PAIYR
Sbjct  302   LSKHIGPRVSIASFFANSVEVS--SKVLGPIKELLSEENPAIYR  343



>gb|AET01263.2| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
Length=400

 Score =   344 bits (882),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 182/333 (55%), Positives = 245/333 (74%), Gaps = 6/333 (2%)
 Frame = +3

Query  258   EYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDF  437
             +YDR SE++AF+++K GVKGL DA +T IPR+F   H   + ++++++ + + VIP ID 
Sbjct  42    DYDRASELKAFDETKDGVKGLVDASVTSIPRMF--HHEFDKDSTSSSSNSHKLVIPSIDL  99

Query  438   EGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPF  611
               +  +  RR  +V  I++A E WGFFQ++NHGI  +V+D+M   V  F EQD E+K+  
Sbjct  100   VDIHQDPTRRKIVVEKIREASETWGFFQIVNHGIEVSVLDEMKNGVVRFFEQDSEVKREL  159

Query  612   HSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMS  791
             ++RD  K + YNSNFDL  +  A WRD+ YC MAP+ P PE+LP+VCRDIM++Y + VM 
Sbjct  160   YTRDPVKPLVYNSNFDLYSSPAATWRDTFYCFMAPNSPNPEDLPSVCRDIMLEYTKQVMK  219

Query  792   LGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltll  971
             LG  LFELLSEALGLD ++L  M C+EGL ++ HYYP CPEP+LTLG++ HTD+ F+T+L
Sbjct  220   LGNLLFELLSEALGLDPNYLNEMRCNEGLALVCHYYPSCPEPELTLGITKHTDNDFITVL  279

Query  972   lqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISV  1151
             LQD +GGLQVL E+ WVDV   PG+L++NIGD+LQL+TNDKFKSV HRV+A  VGPR+SV
Sbjct  280   LQDHIGGLQVLRENSWVDVSPVPGALVINIGDLLQLITNDKFKSVEHRVVANHVGPRVSV  339

Query  1152  ASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             ASF+   FQ     K YGPIKEL+SE+ P  YR
Sbjct  340   ASFYSTSFQPS--TKLYGPIKELVSEDNPPKYR  370



>ref|XP_010483596.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
11-like isoform X3 [Camelina sativa]
Length=369

 Score =   342 bits (878),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 187/337 (55%), Positives = 244/337 (72%), Gaps = 8/337 (2%)
 Frame = +3

Query  258   EYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLN-KHSILEKNSAANAATPQFVIPVID  434
             E+DR  E +AF+++K GVKGL DA +T+IPRIF + + ++ +K  +         IP +D
Sbjct  8     EFDRYIERKAFDETKEGVKGLVDAKITQIPRIFYHPQDALTDKKPSPKPLKHLLSIPTLD  67

Query  435   FEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQ-DFELKK  605
             F  +G +   R  +V  +K A ENWGFFQVINHG+P +V++++ ++V+ FHE+ D E+KK
Sbjct  68    FANIGVDTASREAVVEKVKYAVENWGFFQVINHGVPLDVLEEIKDAVRRFHEEEDHEVKK  127

Query  606   PFHSRD-VKKKVTYNSNFDLLVAA-TANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAE  779
              ++SRD  K K  Y+SNFDL  ++ +  WRDS+ C MAPDPP PEELP  CRD +IKY +
Sbjct  128   SYYSRDFTKNKFAYSSNFDLYSSSPSLTWRDSISCYMAPDPPTPEELPETCRDAVIKYTK  187

Query  780   HVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgf  959
             HV+SLG  LFELLSEALGL  + LK M C + L +I HYYPPCP+PDLTLG+S H+D+ F
Sbjct  188   HVLSLGDLLFELLSEALGLKSEILKSMDCLKSLLMICHYYPPCPQPDLTLGISKHSDNSF  247

Query  960   ltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGP  1139
             LT+LLQD +GGLQ+LH+D W+DV   PG+L+VNIGD LQL+TNDKF SV HRVLA   GP
Sbjct  248   LTVLLQDDIGGLQILHQDSWIDVSPLPGALVVNIGDFLQLITNDKFISVEHRVLANTRGP  307

Query  1140  RISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             RISVASFF    +E   +  YGP+KELLSEE P  YR
Sbjct  308   RISVASFFSSSIREN--STVYGPMKELLSEENPPKYR  342



>ref|XP_009796112.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Nicotiana sylvestris]
Length=365

 Score =   342 bits (878),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 189/337 (56%), Positives = 249/337 (74%), Gaps = 9/337 (3%)
 Frame = +3

Query  252   QAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVI  431
             Q  YD++SE++AF+D+KAGVKGL DAG+TK+PRIF++  ++   +S       +F+ P+I
Sbjct  7     QQNYDKQSELKAFDDTKAGVKGLIDAGITKVPRIFIHPEALENPSSPRKT---RFIFPLI  63

Query  432   DFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKK  605
             D + +  N  +  EIVN I+DA E WGFFQVINHGIP +V+D+ML   + FHEQ+ ++KK
Sbjct  64    DLQNINKNPIKHKEIVNKIRDASETWGFFQVINHGIPVSVLDEMLRGARRFHEQEIDVKK  123

Query  606   PFHSRDVKKKVTYNSNFDLLV--AATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAE  779
             P++SRDV +KV YN NFDL    A  ANWRDSLY +MAP+  +PEELP  CR+I+I+Y++
Sbjct  124   PYYSRDVARKVMYNCNFDLFSEKALAANWRDSLYSVMAPNSAKPEELPETCREIVIEYSD  183

Query  780   HVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgf  959
             HVM LG  L ELLSE LGL  +HLK M C+EGL I+ +YYP CP+P+L +G S H D+ F
Sbjct  184   HVMKLGCNLLELLSEGLGLKPNHLKEMDCAEGLGILCNYYPACPQPELAIGTSRHADNDF  243

Query  960   ltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGP  1139
              T+LLQD  GGLQV H++ WVDVP   G+L++NIGD+LQL++NDK+KS+ HRVLA  VGP
Sbjct  244   FTVLLQDDFGGLQVFHQNHWVDVPPIHGALVINIGDILQLISNDKYKSIEHRVLANKVGP  303

Query  1140  RISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             RISVASFF         ++ YGPIKELLSE+ P  YR
Sbjct  304   RISVASFFGT--GPLASSRIYGPIKELLSEDNPPKYR  338



>ref|XP_004299419.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Fragaria vesca subsp. vesca]
Length=369

 Score =   342 bits (878),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 183/337 (54%), Positives = 242/337 (72%), Gaps = 10/337 (3%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIF---LNKHSILEKNSAANAATPQFVIP  425
               YDR+SE++AF+D+K GVKGL DAG+T++PRIF    +++SI + N        Q  IP
Sbjct  11    TNYDRKSELKAFDDTKEGVKGLVDAGVTEVPRIFHHQPDEYSIYDFNDPEET---QISIP  67

Query  426   VIDFEGL-GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELK  602
             VID +GL    ++ EIV  + +A E WGFFQ++NHGIP +V++++   V+ F EQD E+K
Sbjct  68    VIDLDGLLDSTKQKEIVAKVGEASETWGFFQIVNHGIPVDVLEEVKNGVRRFFEQDTEVK  127

Query  603   KPFHSRD-VKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAE  779
             K  + RD  +  V YNSNFDL  A   NWRD+  C MAP P +PE+LP VCRDI+++Y++
Sbjct  128   KQLYGRDHFRNPVIYNSNFDLYSAPATNWRDTFMCYMAPTPTKPEDLPEVCRDILVEYSD  187

Query  780   HVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgf  959
              VM LG  LFELLSEALGL   +L  + C+EG+  +GHYYPPCP+P+LTLG + H D+ F
Sbjct  188   QVMKLGKLLFELLSEALGLKPTYLNDIDCTEGILFLGHYYPPCPQPELTLGATKHADNAF  247

Query  960   ltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGP  1139
             LT+LLQD +GGLQVLH++ W+DVP  PG+L+VNIGD+LQL++ND+FKSV H+VLA   GP
Sbjct  248   LTVLLQDHIGGLQVLHQNKWIDVPPVPGALVVNIGDLLQLISNDRFKSVEHKVLANRRGP  307

Query  1140  RISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             R+S+ASFF          K YGPIKELLSEE P  YR
Sbjct  308   RVSIASFFCTGMLP--LPKLYGPIKELLSEENPPKYR  342



>ref|XP_008438548.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Cucumis melo]
Length=382

 Score =   342 bits (878),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 184/355 (52%), Positives = 252/355 (71%), Gaps = 11/355 (3%)
 Frame = +3

Query  201   IMVDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILE  380
             +   T N  NL   S     Y R +++ AF+D+KAGVKGL DAG+T+IPRIF   +    
Sbjct  3     VAASTVNRLNLTPLSKADENYHRPTDLRAFDDTKAGVKGLVDAGITEIPRIF---YRPPP  59

Query  381   KNSAANAATP--QFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVM  548
             +N  ++  +P  Q  IPVID + +  N  +R + ++ +++A E  GFFQ+INHGIP NV+
Sbjct  60    ENYDSDNISPETQVQIPVIDLDQINKNPLKRKDTIDRVREASEKLGFFQLINHGIPTNVL  119

Query  549   DKMLESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPE  728
             ++M ++V+ F+EQ+ E KK +++RD  K + YNSNFDL  AA  NWRDS   I AP P  
Sbjct  120   EEMKDAVRRFNEQETESKKQYYTRDPTKPLIYNSNFDLYSAAITNWRDSFGYISAPSPHN  179

Query  729   PEELPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPC  908
             P++LP +CRD+++ Y++ VM +G  LFELLSEALGL+ ++LK + C+EGL ++ HYYPPC
Sbjct  180   PQDLPEICRDVLVDYSKRVMEIGNLLFELLSEALGLNPNYLKDIDCNEGLALVCHYYPPC  239

Query  909   PEPDLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTN  1088
             P+P+L +G S HTDS F+T+LLQD +GGLQ+ +ED WVDVP   G+L+VNIGD++QL+TN
Sbjct  240   PQPNLAIGTSEHTDSDFITVLLQDHIGGLQIRYEDNWVDVPPVAGALVVNIGDLMQLITN  299

Query  1089  DKFKSVHHRVLAKPVGPRISVASFFR-MHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             DKFKSV HRVLA   GPR+SVA  F  +HF     +K Y PIKEL+SEE PAIYR
Sbjct  300   DKFKSVKHRVLANKEGPRVSVAGVFSTLHFP---TSKLYRPIKELISEENPAIYR  351



>ref|XP_010650060.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Vitis vinifera]
Length=339

 Score =   340 bits (873),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 177/333 (53%), Positives = 251/333 (75%), Gaps = 8/333 (2%)
 Frame = +3

Query  249   MQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLN-KHSILEKNSAANAATPQFVIP  425
             ++++YDR  E++AF+DSK GVKGL DAGL KIPR+F++ +H++ EK+   ++ +    IP
Sbjct  8     IESKYDRIIELKAFDDSKLGVKGLVDAGLAKIPRMFIHPQHNLYEKSGPIDSHSN---IP  64

Query  426   VIDFEGLGGNRRV--EIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFEL  599
             +ID EG+  +  +  +I+N ++ ACENWG FQ++NHGI + ++++M+E ++ FHEQD E+
Sbjct  65    IIDLEGVKNDVTLHAKIINEVQKACENWGIFQIVNHGISEGILEEMIEGIRRFHEQDAEV  124

Query  600   KKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAE  779
             KK +++RD  KKV + SNFDL  A++A+WRD+L   + P+PP+P +LP VCRDI+++Y++
Sbjct  125   KKEYYTRDFTKKVIFLSNFDLFQASSASWRDALLSTITPNPPDPIQLPLVCRDIVVEYSK  184

Query  780   HVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgf  959
              V  LGYTL ELLSEALGL+ +H K M  ++  F +  YYP CPEP+LTLG   HTD  F
Sbjct  185   QVKHLGYTLLELLSEALGLEPNHFKNMEFAKQGFFLAQYYPSCPEPELTLGTKRHTDPNF  244

Query  960   ltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGP  1139
             LT++LQDQ+GGLQ+LHE+ W+DVP  PG+L++N GD+LQ++TN +FKSV HRVLA+  GP
Sbjct  245   LTIVLQDQVGGLQILHENHWMDVPPIPGALVINTGDVLQIVTNGRFKSVEHRVLAQHEGP  304

Query  1140  RISVASFFRMHFQEGNEAKTYGPIKELLSEEKP  1238
             RISVASFF   F     +K Y PIKELLSEE P
Sbjct  305   RISVASFFNSCFPPS--SKVYTPIKELLSEENP  335



>ref|XP_010556889.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
11-like [Tarenaya hassleriana]
Length=364

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 195/335 (58%), Positives = 241/335 (72%), Gaps = 5/335 (1%)
 Frame = +3

Query  252   QAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVI  431
               EYDR SE++AF+++KAGVKGL D  +T+IPRIF      L+    + A  P   IP I
Sbjct  6     SGEYDRASELKAFDETKAGVKGLVDTAITEIPRIFHLPPGTLDDKKPSPAPNPNLAIPTI  65

Query  432   DFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKK  605
             D EG+  +   R  +V+ ++ A E WGFFQV+NHG+P  V+++M + V+ FHE D E KK
Sbjct  66    DLEGVDKDVTLRKSVVDKVRHAAEKWGFFQVVNHGVPFRVLEEMKDGVRRFHE-DGESKK  124

Query  606   PFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
              F SRD  KKV YNSNFDL ++  ANWRD+L C M+PDPP+PEE+P  CRDI+I+Y+ HV
Sbjct  125   RFFSRDFTKKVVYNSNFDLYISPFANWRDTLACYMSPDPPKPEEIPEACRDIIIEYSNHV  184

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgflt  965
             M+LG  L ELLSEALGL+ D LK M C++GL  + HYYPPCP+PDLTLG S H+D+ FLT
Sbjct  185   MNLGILLLELLSEALGLNSDSLKEMDCAKGLITLCHYYPPCPQPDLTLGTSKHSDNSFLT  244

Query  966   lllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRI  1145
             LLLQD +GGLQVLH D WVDVP  PG+LIVN GD LQL+TNDKF SV HRVLA   GPR+
Sbjct  245   LLLQDHIGGLQVLHRDCWVDVPPLPGALIVNFGDFLQLITNDKFISVEHRVLANRAGPRV  304

Query  1146  SVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             SVA FF    +    ++ YGPIKELLSEE P  YR
Sbjct  305   SVACFFSTSVR--TSSRVYGPIKELLSEENPPKYR  337



>ref|XP_006598208.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Glycine max]
Length=368

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 175/334 (52%), Positives = 245/334 (73%), Gaps = 8/334 (2%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVID  434
             + YDR+SE++AF+DSK GV+GL + G+TK+P +F +++S L  +    A+  +  IP+ID
Sbjct  15    SSYDRKSEIKAFDDSKTGVQGLVENGVTKVPLMFYSENSNL-NDGVTGASYSKISIPIID  73

Query  435   FEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKP  608
               G+  +   R  +V  ++ ACE WGFFQVINHGIP +V+D+M++    FH+QD +++K 
Sbjct  74    LTGIHDDPILRDHVVGKVRYACEKWGFFQVINHGIPTHVLDEMIKGTCRFHQQDAKVRKE  133

Query  609   FHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVM  788
             +++R+V +KV Y SN+ L    +A+WRD+L   +AP PPE EE P VCRDI+ +Y++ +M
Sbjct  134   YYTREVSRKVAYLSNYTLFEDPSADWRDTLAFSLAPHPPEAEEFPAVCRDIVNEYSKKIM  193

Query  789   SLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltl  968
             +L Y LFELLSEALGL+  +LK M C+EG  ++ HYYP CPEP+LT+G + H+D   +T+
Sbjct  194   ALAYALFELLSEALGLNRFYLKEMDCAEGQLLLCHYYPACPEPELTMGNTKHSDGNTITI  253

Query  969   llqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRIS  1148
             LLQDQ+GGLQVLH+  W+DVP   G+L+VNIGD++QL+TNDKF SV HRVLAK  GPRIS
Sbjct  254   LLQDQIGGLQVLHDSQWIDVPPMHGALVVNIGDIMQLMTNDKFISVQHRVLAKDQGPRIS  313

Query  1149  VASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             VASFFR        ++ +GPIKELLSEE P +YR
Sbjct  314   VASFFRTGI-----SRVFGPIKELLSEEHPPVYR  342



>emb|CDY32542.1| BnaA09g50540D [Brassica napus]
Length=359

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 183/332 (55%), Positives = 236/332 (71%), Gaps = 5/332 (2%)
 Frame = +3

Query  258   EYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDF  437
             ++D  +E +AF+++K GVKGL DA +T++PRIF      L  +   + ++    IP+IDF
Sbjct  5     DFDSYNERKAFDETKEGVKGLVDAHITEVPRIFRLPQGTL-SDKKPSLSSSNLAIPIIDF  63

Query  438   EGLGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFHS  617
               +  +R   +V  IKDA E WGFFQV+NHG+P +V+++M + V+ F EQD E+KK + S
Sbjct  64    ADIHVSRP-RVVEKIKDAAEKWGFFQVVNHGVPLSVLEEMRDGVRRFFEQDLEVKKSYFS  122

Query  618   RDVKKKVTYNSNFDLLVA-ATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMSL  794
             R+  KK  YNSNFDL  + A  NWRDS  C M+PDPP PEELP VCRD  I++ +H+MSL
Sbjct  123   REATKKFVYNSNFDLYSSTACVNWRDSFACYMSPDPPTPEELPVVCRDATIEHWKHMMSL  182

Query  795   GYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltlll  974
             G  LFELLSEALGL  D LK M C +GLF+I HYYPPCP PDLT+G + H+D+ FLT+LL
Sbjct  183   GDLLFELLSEALGLSFDRLKSMDCMKGLFMICHYYPPCPRPDLTIGTNHHSDNSFLTILL  242

Query  975   qdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISVA  1154
             QDQ+GGLQ+LH+D WVDV   PG+L++NIGD +QL+TNDKF S  HRVL+     RISVA
Sbjct  243   QDQVGGLQILHQDCWVDVSPIPGALVINIGDFMQLITNDKFISAEHRVLSNRTETRISVA  302

Query  1155  SFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             SFF  +      +  YGPIKELLSEE P IYR
Sbjct  303   SFFTTNLLPN--STVYGPIKELLSEENPPIYR  332



>gb|KHG16548.1| hypothetical protein F383_20832 [Gossypium arboreum]
Length=370

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 177/330 (54%), Positives = 238/330 (72%), Gaps = 5/330 (2%)
 Frame = +3

Query  261   YDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFE  440
             YDR  E++AF+DSK+GVKGL DAG+TKIPRIF      +E + +      QF IPV+D E
Sbjct  17    YDRFQELKAFDDSKSGVKGLVDAGITKIPRIFCRPK--VEDHDSVKPIPTQFTIPVVDLE  74

Query  441   GLGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFHSR  620
              +   R  E+V  I+ A    GFFQV+NHG+P +V+++ML + + FHE   E+KK +++R
Sbjct  75    NIK-TRSDEVVEGIRKAGGEIGFFQVVNHGVPQSVLEEMLAAARGFHELPSEVKKSYYTR  133

Query  621   DVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMSLGY  800
             +  KKV Y SNFDL  +  ANWRD+L+C+M P+P  P++LP VCRDI ++Y++ +  LG 
Sbjct  134   EKTKKVIYGSNFDLYESRFANWRDTLFCVMGPEPLHPQQLPLVCRDITMEYSKQIHKLGT  193

Query  801   TLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltlllqd  980
             TLF+LLS+A+GL  DHL G+ CS+G  ++ HYYP CPEP+LTLG + H+D  FLT+LLQD
Sbjct  194   TLFKLLSKAIGLTPDHLIGLDCSKGHCLLSHYYPACPEPELTLGTAKHSDPDFLTILLQD  253

Query  981   qlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISVASF  1160
              +GGLQV H++ W DVPF PG+L+VNIGD+LQL++NDK KSV H+VLA   GPR+SVA F
Sbjct  254   HIGGLQVFHQNQWFDVPFLPGALVVNIGDLLQLISNDKLKSVEHQVLANEKGPRVSVACF  313

Query  1161  FRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             F  H       + YGPIKELLS+E P +YR
Sbjct  314   FTPHLYPST--RIYGPIKELLSKENPPLYR  341



>ref|XP_008224382.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Prunus mume]
Length=375

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 189/355 (53%), Positives = 244/355 (69%), Gaps = 13/355 (4%)
 Frame = +3

Query  204   MVDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEK  383
             MV TS N   +  SI    YDR+SEV+ F+D+K GVKGL DA +T++PRIF         
Sbjct  1     MVATSTN---EVPSI--TNYDRKSEVKTFDDTKEGVKGLVDARITQVPRIFHQPVDQYPI  55

Query  384   NSAANA--ATPQFVIPVIDFEGL----GGNRRVEIVNMIKDACENWGFFQVINHGIPDNV  545
             N+  ++     Q  IPVID EGL       +R EIV  + +A E WGFFQ+ NHGIP +V
Sbjct  56    NNTCDSEPTKTQLKIPVIDLEGLEYDNNPTKRKEIVAKVGEASETWGFFQIANHGIPVDV  115

Query  546   MDKMLESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPP  725
             ++++   V+ F EQD E+KK  ++RD  + V YNSNFDL  A   NWRDS  C MAP+PP
Sbjct  116   LEEIKNGVRGFFEQDTEVKKELYTRDYFRPVIYNSNFDLYSAPATNWRDSFLCNMAPNPP  175

Query  726   EPEELPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPP  905
             +PE+LP VCRDI+++Y+  VM LG  LF+LLSEALGL   HL  M CS GL ++ +YYPP
Sbjct  176   KPEDLPQVCRDILVEYSNQVMKLGKLLFQLLSEALGLKPSHLNDMDCSLGLQVLCNYYPP  235

Query  906   CPEPDLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLT  1085
             CP+P+LTLG S HTD  F+T++LQD +GGLQVLH++ W+DV   PG+L+VNIGD+LQL++
Sbjct  236   CPQPELTLGASKHTDDDFITVVLQDHIGGLQVLHQNKWIDVLPVPGALVVNIGDLLQLIS  295

Query  1086  NDKFKSVHHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             ND+F+SV HRVLA   GPR+SVASFF   F      + YGPIKELLSE+    YR
Sbjct  296   NDRFRSVEHRVLANRAGPRVSVASFFTTGFLA--LPQIYGPIKELLSEDNLPKYR  348



>ref|XP_010442019.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
10-like [Camelina sativa]
Length=364

 Score =   340 bits (873),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 180/339 (53%), Positives = 235/339 (69%), Gaps = 7/339 (2%)
 Frame = +3

Query  249   MQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPV  428
             M  + DR +++  F  +  GVKGL DA +T++PRIF    S L  N A+N +     +P+
Sbjct  1     MADKTDRMNDLTTFISTNTGVKGLVDAEITEVPRIFHVPSSTLSNNRASNISDLNLTVPI  60

Query  429   IDFEGLGGN-----RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDF  593
             ID   +  +      R  +V  IKDA ENWGFFQVINHG+P   +++M + V+ FHE+D 
Sbjct  61    IDLGEITNDIDVTSSRNNVVLKIKDAAENWGFFQVINHGVPLTFLEEMKQGVRKFHEEDP  120

Query  594   ELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKY  773
             E+KK + S D+ K+  YN+NFDL  ++  NWRDS  C +APDPP PE++P  CR  +I+Y
Sbjct  121   EVKKQYMSSDLNKRFLYNNNFDLYHSSPMNWRDSFTCYIAPDPPNPEDIPVACRGAVIEY  180

Query  774   AEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDS  953
              +HVM LG  +F+LLSEALGLD + LK M C +GLF++ HYYPPCP+PDLTLG+S HTD+
Sbjct  181   TKHVMELGDLIFQLLSEALGLDSEILKRMDCLKGLFMVCHYYPPCPQPDLTLGISKHTDN  240

Query  954   gfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPV  1133
              F TLLLQDQ+GGLQVLH+D WVDVP  PG+L+VNIGD +QL+TNDKF SV HRV A   
Sbjct  241   SFFTLLLQDQIGGLQVLHQDYWVDVPPVPGALVVNIGDFMQLITNDKFLSVEHRVRANRD  300

Query  1134  GPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             GPRIS+A FF         +  YGPI+ELLS+E PA Y+
Sbjct  301   GPRISIACFFSSSLSPN--STVYGPIRELLSDENPAKYK  337



>ref|XP_004297996.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Fragaria vesca subsp. vesca]
Length=637

 Score =   349 bits (896),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 183/334 (55%), Positives = 238/334 (71%), Gaps = 4/334 (1%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVID  434
               YDR+ E++AF+D+K GVKGL DAG+T+IPRIF +       +   +    Q  IPVID
Sbjct  279   TNYDRKHELKAFDDTKEGVKGLVDAGITEIPRIFYHPPDECSNDYTFDHEESQHSIPVID  338

Query  435   FEGL-GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPF  611
              EGL    +R EIV  + +A E WGFFQ+ NHGIP +V+++M + V  FHEQD E+KK F
Sbjct  339   LEGLFDPTKRKEIVAAVGEASETWGFFQIENHGIPFDVLEEMKKGVLGFHEQDTEVKKQF  398

Query  612   HSRD-VKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVM  788
             ++RD     V YNSNFDL  A   NWRDS  C MAP PP+ E+LP VCR+I+++Y++ VM
Sbjct  399   YTRDHSSSPVIYNSNFDLYSAPATNWRDSFLCYMAPIPPKIEDLPEVCREILVEYSKQVM  458

Query  789   SLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltl  968
              LG  LFELLSEALGL   HL  + CSEGL ++GHYYPPCP+P+LT+G S H D+ F+++
Sbjct  459   KLGKLLFELLSEALGLKPSHLNDIDCSEGLLVLGHYYPPCPQPELTMGTSKHADNNFMSV  518

Query  969   llqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRIS  1148
             LLQD +GGLQV H++ W+DVP  PG+L+VNIGD++QL++ND FKSV HRV+A   GPR+S
Sbjct  519   LLQDDIGGLQVFHQNKWIDVPHVPGALVVNIGDLIQLISNDIFKSVEHRVMANRRGPRVS  578

Query  1149  VASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             VASFF    +     K +GPIKELLSE+ P  YR
Sbjct  579   VASFFSTGVRPS--TKLFGPIKELLSEDNPPKYR  610


 Score =   167 bits (424),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 124/164 (76%), Gaps = 2/164 (1%)
 Frame = +3

Query  759   IMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLS  938
             I+++Y+  V+ LG  LF+LLSE+LGL   HL  + CSEGL +IGHYYP CP+P+LTLG S
Sbjct  66    ILVEYSNQVIKLGKLLFKLLSESLGLKRSHLNDIDCSEGLLVIGHYYPACPQPELTLGTS  125

Query  939   SHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRV  1118
              H D+ F+T+LLQD +GGLQVLH + W+DVP  PGSL+VNIGD LQL++NDKFKSV HRV
Sbjct  126   KHADNTFITILLQDNIGGLQVLHHNKWIDVPPVPGSLVVNIGDFLQLISNDKFKSVEHRV  185

Query  1119  LAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             LA   GPRISVA FF     +   AK YGPIKELLSEE P  YR
Sbjct  186   LANCRGPRISVAGFFSTGLLQ--LAKLYGPIKELLSEENPPKYR  227


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +3

Query  240  DSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFV  419
            D      YDR+  ++AF+D+K GVKGL DAG+T+IPRIF +       N+A+++   Q  
Sbjct  6    DDDFSTSYDRKHALKAFDDTKEGVKGLADAGITEIPRIFYHPPDEYSINNASDSDEAQVK  65

Query  420  IPV  428
            I V
Sbjct  66   ILV  68



>gb|ABK96309.1| unknown [Populus trichocarpa x Populus deltoides]
Length=370

 Score =   340 bits (873),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 179/335 (53%), Positives = 240/335 (72%), Gaps = 5/335 (1%)
 Frame = +3

Query  249   MQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKN--SAANAATPQFVI  422
             + A YDR  E+ +F++SK GVKGL DAG+TK+PR F+     +  +  +       QF I
Sbjct  11    VSATYDRDQEIRSFDESKCGVKGLVDAGITKLPRFFIRPPEDIAADYINTGEWINTQFTI  70

Query  423   PVIDFEGLGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELK  602
             PVID + +  +RR E V  +K A E  GFFQV+NHG+ + V+++MLE+V+ FHEQ  E+K
Sbjct  71    PVIDLKNMD-SRRAEAVAGVKRAAEEVGFFQVVNHGMENRVLEEMLEAVRGFHEQPREVK  129

Query  603   KPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEH  782
             + ++SR++ +KVTY SNFDL  A  ANWRD+L+C+M PDP +P+ELP V RDI+++Y+  
Sbjct  130   EEYYSREMTRKVTYVSNFDLYKAKYANWRDTLFCVMGPDPLDPQELPLVSRDIIMEYSNK  189

Query  783   VMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfl  962
             V  L   LFELLSEALGL  DHLK M C +G  ++ HYYP CPEP+L +G + H+D  FL
Sbjct  190   VCKLATVLFELLSEALGLKSDHLKEMDCVKGHALLSHYYPACPEPELAMGTTKHSDPDFL  249

Query  963   tlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPR  1142
             T+LLQD +GGLQ+ H++ W+DVP   G+L+VNIGD+LQL++NDKFKSV HRV+A  +GPR
Sbjct  250   TILLQDDIGGLQIFHQNHWIDVPPVHGALVVNIGDLLQLISNDKFKSVEHRVVANHIGPR  309

Query  1143  ISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIY  1247
             +SVASFF  H       + YGPIKELLSEE P IY
Sbjct  310   VSVASFFTPHLYPST--RLYGPIKELLSEENPPIY  342



>ref|XP_007099680.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
 gb|EOY20344.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
Length=386

 Score =   341 bits (874),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 178/337 (53%), Positives = 244/337 (72%), Gaps = 6/337 (2%)
 Frame = +3

Query  252   QAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVI  431
             ++ YDR  EV+AF++SKAGVKGL DAG++ IP +F +K + +        +  +  IP++
Sbjct  15    KSNYDREKEVKAFDESKAGVKGLVDAGVSTIPPMFKHKKNGMPDFPVCTNSNIE--IPIV  72

Query  432   DFEGLG--GNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKK  605
             DF+ +    + R +I++ +++AC  WGFFQ+INHGIP +++D M+  ++ FHEQD E+KK
Sbjct  73    DFDDIDKDASLRTKIIDQVRNACGKWGFFQLINHGIPASILDDMINGIRRFHEQDLEVKK  132

Query  606   PFHSRDVK-KKVTYNSNFDLLVAATANWRDSLYCIMA-PDPPEPEELPNVCRDIMIKYAE  779
              +++RD K K V YNSNF+LL A  A WRD+L  I     PP+PEELP  CRDIMIKY +
Sbjct  133   GYYTRDYKTKNVLYNSNFNLLEAPAACWRDTLTFITGLHRPPKPEELPATCRDIMIKYTD  192

Query  780   HVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgf  959
              +M LG T+ ELLSEALGL    L  MGC++ +F   HYYP CPEP LT+G ++H DSGF
Sbjct  193   EIMKLGKTICELLSEALGLKPSQLNDMGCADDIFAPCHYYPACPEPQLTMGATTHADSGF  252

Query  960   ltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGP  1139
             +T+LLQDQ+GGLQVLH++ W+DV   PG+++VN+GD++QL++NDKF S +HRVLAK  GP
Sbjct  253   ITILLQDQIGGLQVLHDNQWIDVTPVPGAVVVNVGDLIQLISNDKFISAYHRVLAKKEGP  312

Query  1140  RISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             R+SVA  FR H    N ++ YGPIKELLSEE P +YR
Sbjct  313   RVSVACIFRSHHHPENSSRLYGPIKELLSEENPPVYR  349



>ref|XP_008224374.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Prunus mume]
Length=403

 Score =   341 bits (875),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 179/346 (52%), Positives = 250/346 (72%), Gaps = 5/346 (1%)
 Frame = +3

Query  219   NNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLN--KHSILEKNSA  392
              N  ++  S   A  DR  +++AF++SK+GVKG+ D G+TKIP IF+   + S  +K S+
Sbjct  32    KNRCMKMISGYTANGDRLQQLKAFDESKSGVKGIVDKGITKIPPIFVRPPEFSGCDKPSS  91

Query  393   ANAATPQFVIPVIDFEGLGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQ  572
              +    QF +PV+D     G RR ++V  ++ A E  GFFQV+NHGIP  V+D+ML + +
Sbjct  92    GHRTRTQFSVPVVDLTDTVG-RRADVVAGVRRAAETVGFFQVVNHGIPKRVLDEMLAAAR  150

Query  573   HFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVC  752
              FHE   E+K  ++SR++ +KV + SNFDL  +  ANWRDSL+C+M P+P +P+ELP +C
Sbjct  151   GFHELHREVKSEYYSRELLRKVKFGSNFDLYQSRFANWRDSLFCVMGPEPLDPQELPLIC  210

Query  753   RDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLG  932
             RDI ++Y+E+V  +G TLFELLSEALGL  DHL G+ C++G  I+ HYYPPCPEP+LT+G
Sbjct  211   RDITMEYSENVHKMGVTLFELLSEALGLKPDHLIGLDCAKGHLILSHYYPPCPEPELTMG  270

Query  933   LSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHH  1112
              S H+D  FLT+LLQDQ+GGLQVL+E+ W+DVP  PG+L+VNIGD+LQL++ND+FKSV H
Sbjct  271   TSKHSDPDFLTILLQDQIGGLQVLYENQWIDVPPVPGALVVNIGDLLQLVSNDRFKSVEH  330

Query  1113  RVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             +VLA   GPR+S+A F   H       + YGPIKELLSE++P +Y+
Sbjct  331   QVLANHAGPRVSIACFLTPHLHPST--RLYGPIKELLSEDRPPVYK  374



>ref|XP_008438546.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Cucumis melo]
Length=374

 Score =   340 bits (872),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 181/351 (52%), Positives = 251/351 (72%), Gaps = 10/351 (3%)
 Frame = +3

Query  204   MVDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEK  383
             M   ++  NL   S     + R +E++AF+D+KAGVKGL DA +T+IPRIF   H   E 
Sbjct  1     MAVAASGINLTPLSKADDNFHRPTELKAFDDTKAGVKGLVDANITEIPRIFY--HPPEEV  58

Query  384   NSAANAATPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKM  557
             +SA         IP+ID EG+G +  +R  I++ I+DA E  GFFQ+INHGIP +V++++
Sbjct  59    DSAET----HIHIPLIDLEGVGDDSLKRKHIIDQIRDASEELGFFQLINHGIPTSVLEEI  114

Query  558   LESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEE  737
              +SV+ FHEQD E+KK +++RD  K   YNSNFDL  A T NWRD+   + AP+PP P+E
Sbjct  115   RDSVRRFHEQDTEVKKQYYTRDFMKPFIYNSNFDLYSAPTTNWRDTFSYVSAPNPPNPQE  174

Query  738   LPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEP  917
             LP +CRDIM+ +++ VM +G  + ELLSEALGL+ ++L  +GCS+GL  + HYYPPCP+P
Sbjct  175   LPEICRDIMVDFSKWVMEIGKLVLELLSEALGLNPNYLDNIGCSDGLAFVYHYYPPCPQP  234

Query  918   DLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKF  1097
              LT+G+S H+D+ F+T+LLQD +GGLQ+ H++ W+DV    G+L+VNIGD++QL+TND+F
Sbjct  235   KLTIGISEHSDTDFITVLLQDLVGGLQIRHQNKWIDVRPVAGALVVNIGDLMQLITNDRF  294

Query  1098  KSVHHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             +SV+HRVL+   GPRISVA  F       +  K YGPIKELLS+EKPAIYR
Sbjct  295   ESVNHRVLSSHEGPRISVAGVFSTMVSPSD--KFYGPIKELLSKEKPAIYR  343



>ref|XP_009118653.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
6-like [Brassica rapa]
Length=359

 Score =   340 bits (871),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 182/332 (55%), Positives = 236/332 (71%), Gaps = 5/332 (2%)
 Frame = +3

Query  258   EYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDF  437
             ++D  +E +AF+++K GVKGL DA +T++PRIF      L  +   + ++    IP+IDF
Sbjct  5     DFDSYNERKAFDETKEGVKGLVDAHITEVPRIFRLPQGTLS-DKKPSLSSSNLAIPIIDF  63

Query  438   EGLGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFHS  617
               +  +R   +V  IKDA E WGFFQV+NHG+P +V+++M + V+ F EQD E+KK + S
Sbjct  64    ADIHVSRP-RVVEKIKDAAEKWGFFQVVNHGVPLSVLEEMRDGVRRFFEQDLEVKKSYFS  122

Query  618   RDVKKKVTYNSNFDLLVA-ATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMSL  794
             R+  KK  YNSNFDL  + A  NWRDS  C M+PDPP PEELP VCRD  I++ +H+MSL
Sbjct  123   REATKKFVYNSNFDLYSSTACVNWRDSFACYMSPDPPTPEELPVVCRDATIEHWKHMMSL  182

Query  795   GYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltlll  974
             G  LFELLSEALGL  D LK M C +GLF+I HYYPPCP PDLT+G + H+D+ FLT+LL
Sbjct  183   GDLLFELLSEALGLSFDRLKSMDCMKGLFMICHYYPPCPRPDLTIGTNHHSDNSFLTILL  242

Query  975   qdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISVA  1154
             QDQ+GGLQ+LH+D WVDV   PG+L++NIGD +QL+TNDKF S  HRVL+     RISVA
Sbjct  243   QDQVGGLQILHQDCWVDVSPIPGALVINIGDFMQLITNDKFISAEHRVLSNRTETRISVA  302

Query  1155  SFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             SFF  +      +  YGPIKELLS+E P IYR
Sbjct  303   SFFTTNLLPN--STVYGPIKELLSQENPPIYR  332



>ref|XP_009619590.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X1 [Nicotiana tomentosiformis]
Length=378

 Score =   340 bits (872),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 185/357 (52%), Positives = 245/357 (69%), Gaps = 32/357 (9%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKN-------SAANAATPQ  413
             AEYDR  E++AF+++KAGVKGL D G+  IP  F+   +  E N       S  NA    
Sbjct  2     AEYDRAKELKAFDNTKAGVKGLLDTGVVHIPEFFVTPGAENEFNAKNINLCSDVNAQ---  58

Query  414   FVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQ  587
               IPVIDF+ +  N  +R +IV  I++ACE WGFFQV+NHGIP +VMD+M++ VQ F+EQ
Sbjct  59    --IPVIDFKNMKENDFQRRKIVEQIREACETWGFFQVLNHGIPQHVMDEMIKGVQRFNEQ  116

Query  588   DFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMI  767
               E K  F+SRD  KKV +NSNFDL  +  ANWRD+L C+MAP+PP  +ELP  CR  ++
Sbjct  117   PNEQKMEFYSRDNLKKVKFNSNFDLYQSKAANWRDTLACVMAPNPPRSDELPVTCRKELL  176

Query  768   KYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHT  947
             +Y+EHV  LG+T+FELL+EALGL  +HL  M C++G FI+ HYYPPCPEP+ TLG++ HT
Sbjct  177   EYSEHVRKLGHTIFELLAEALGLKPNHLLEMECAKGHFILSHYYPPCPEPNKTLGITKHT  236

Query  948   DSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQ----------------L  1079
             D  F T+LLQD +GGLQ+ H++ W+D+    G+L++N+GD+LQ                L
Sbjct  237   DPDFFTILLQDHIGGLQINHQNHWIDIHPVTGALVINLGDLLQEVTGSRRENSLLQKCRL  296

Query  1080  LTNDKFKSVHHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             L+NDKFKS  HRVL+K +GPRISVA FF   FQ  +  + YGPIKELLS+E P  Y+
Sbjct  297   LSNDKFKSAEHRVLSKQIGPRISVACFFTTQFQPFD--RLYGPIKELLSDENPPKYK  351



>ref|XP_006282023.1| hypothetical protein CARUB_v10028262mg [Capsella rubella]
 gb|EOA14921.1| hypothetical protein CARUB_v10028262mg [Capsella rubella]
Length=366

 Score =   340 bits (871),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 188/337 (56%), Positives = 244/337 (72%), Gaps = 10/337 (3%)
 Frame = +3

Query  258   EYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIF-LNKHSILEKNSAANAATPQFVIPVID  434
             E+D  +E +AF+++K GVKGL DA +T+IPRIF + K ++ EK  +A+ A     IP ID
Sbjct  7     EFDCYTERKAFDETKEGVKGLIDAKITEIPRIFHIPKDTLPEKKPSASVA--DLAIPTID  64

Query  435   FEGLG--GNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQ-DFELKK  605
             F  +G     R  +V  +K A ENWGFFQVINHG+P +V++ + ++V+ FHE+ D  +KK
Sbjct  65    FASIGVDAASREIVVEKVKYAVENWGFFQVINHGVPLDVLEDIKDAVRRFHEEEDHAVKK  124

Query  606   PFHSRD-VKKKVTYNSNFDLLVAA-TANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAE  779
              ++S D  K K  Y+SNFDL  ++ +  WRDS+ C MAPDPP PEELP  CRD MI+Y++
Sbjct  125   SYYSLDFTKNKFAYSSNFDLYSSSPSLTWRDSISCYMAPDPPTPEELPETCRDAMIEYSK  184

Query  780   HVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgf  959
             HV+SLG  LFELLSEALGL  + LK M C + L +I HYYPPCP+PDLTLG+S H+D+ F
Sbjct  185   HVLSLGDLLFELLSEALGLKYEILKSMDCLKSLLLICHYYPPCPQPDLTLGISKHSDNSF  244

Query  960   ltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGP  1139
             LT+LLQD +GGLQ+LH+D WVDV   PG+L+VNIGD LQL+TNDKF SV HRVLA   GP
Sbjct  245   LTVLLQDNIGGLQILHQDSWVDVSPLPGALVVNIGDFLQLITNDKFISVEHRVLANTRGP  304

Query  1140  RISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             RISVASFF    +E   +  YGP+KEL+SE+ P  YR
Sbjct  305   RISVASFFSSSIREN--STVYGPMKELVSEDNPPKYR  339



>ref|XP_007221652.1| hypothetical protein PRUPE_ppb006192mg [Prunus persica]
 gb|EMJ22851.1| hypothetical protein PRUPE_ppb006192mg [Prunus persica]
Length=366

 Score =   340 bits (871),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 173/334 (52%), Positives = 247/334 (74%), Gaps = 5/334 (1%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSIL--EKNSAANAATPQFVIPV  428
             A  DR  +++AF++SK+GVKG+ D G+TK+P IF+        +K ++ +    QF +PV
Sbjct  7     ANGDRLQQLKAFDESKSGVKGIVDKGITKVPPIFVRPPEFCGGDKPNSGHRTRTQFSVPV  66

Query  429   IDFEGLGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKP  608
             +D     G +R ++V  ++ A E  GFFQV+NHGIP  V+D+ML + + FHE   E+K  
Sbjct  67    VDLADTVG-QRADVVAGVRRAAETVGFFQVVNHGIPKRVLDEMLAAARGFHELPREVKSE  125

Query  609   FHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVM  788
             ++SR++ +KV + SNFDL  +  ANWRDSL+C+M+P+P +P+ELP +CRDI ++Y+E+V 
Sbjct  126   YYSRELLRKVKFGSNFDLYQSRFANWRDSLFCVMSPEPLDPQELPLICRDITMEYSENVH  185

Query  789   SLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltl  968
              +G TLFELLSEALGL  DHL G+ C++G  ++ HYYPPCPEP+LT+G S H+D  FLT+
Sbjct  186   KMGVTLFELLSEALGLKPDHLIGLDCAKGHLVLSHYYPPCPEPELTMGTSKHSDPDFLTI  245

Query  969   llqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRIS  1148
             LLQDQ+GGLQVL+E+ W+DVP  PG+L+VNIGD+LQL++ND+FKSV H+VLA   GPR+S
Sbjct  246   LLQDQIGGLQVLYENQWIDVPPVPGALVVNIGDLLQLVSNDRFKSVEHQVLANHAGPRVS  305

Query  1149  VASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             +A FF +H       + YGPIKELLSE++P +Y+
Sbjct  306   IACFFTLHLHP--STRLYGPIKELLSEDRPPVYK  337



>ref|XP_006294352.1| hypothetical protein CARUB_v10023369mg, partial [Capsella rubella]
 gb|EOA27250.1| hypothetical protein CARUB_v10023369mg, partial [Capsella rubella]
Length=396

 Score =   340 bits (873),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 187/343 (55%), Positives = 246/343 (72%), Gaps = 8/343 (2%)
 Frame = +3

Query  234   QEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQ  413
             +++  M A YDR SEV+AF+++K GVKGL DAG   IPRIF + H  L  ++   ++T  
Sbjct  31    RKEKKMDATYDRTSEVKAFDETKIGVKGLVDAGFAHIPRIFHHPHLNLTDSNPLLSST-T  89

Query  414   FVIPVIDFEG---LGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHE  584
              VIP ID +G        R  +  MIK+A E +GFFQVINHG+  +V++KM + ++ FHE
Sbjct  90    MVIPTIDLKGGVFESTVTRKSVTAMIKEAVERYGFFQVINHGVSLDVLEKMKDGIRGFHE  149

Query  585   QDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIM  764
             QD ++++ F++RDV KKV YNSNFDL  + +ANWRD+L C M+PD P+ E+LP +C +IM
Sbjct  150   QDSDVRRKFYTRDVTKKVKYNSNFDLYSSPSANWRDTLSCFMSPDVPKTEDLPEICGEIM  209

Query  765   IKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSH  944
             ++Y++ VM LG  +FELLSEALGL+ +HLK M C++GL ++ HYYPPCPEPDLT G S H
Sbjct  210   LEYSKRVMELGELIFELLSEALGLNPNHLKEMDCTKGLLMLSHYYPPCPEPDLTFGTSQH  269

Query  945   TDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLA  1124
             +D  FLT+LLQD +GGLQVL +  WVDVP  PG+L+VN+GD+LQL+TNDKF SV HRVLA
Sbjct  270   SDRSFLTILLQDHIGGLQVLQDGYWVDVPPVPGALLVNLGDLLQLITNDKFVSVEHRVLA  329

Query  1125  -KPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              K   PRISVASFF          + YGPIKELLSE+    YR
Sbjct  330   NKGEEPRISVASFF---VHPLPSLRVYGPIKELLSEQNLPKYR  369



>ref|XP_006379885.1| hypothetical protein POPTR_0008s16530g [Populus trichocarpa]
 gb|ERP57682.1| hypothetical protein POPTR_0008s16530g [Populus trichocarpa]
Length=291

 Score =   337 bits (863),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 175/293 (60%), Positives = 222/293 (76%), Gaps = 8/293 (3%)
 Frame = +3

Query  204   MVDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEK  383
             M+ TS+    + +S ++++YDRRSE++AF+DSKAGVKGL D+G+  IP+IF+++ S  +K
Sbjct  1     MLSTSSG---KTESELKSDYDRRSELKAFDDSKAGVKGLVDSGVANIPQIFIHESSTNDK  57

Query  384   NSAANAATPQFVIPVIDFEGL--GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKM  557
              S+ +     F +PVIDF G+    + R +IV  +++AC+ WGFFQVINHGI  +V+D M
Sbjct  58    LSSGHH---NFTVPVIDFNGIHEDASLRGKIVEELREACKKWGFFQVINHGISSSVLDDM  114

Query  558   LESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEE  737
             +  V+ FHEQD E+KK FH+RD  +KV YN+NFD   A  ANWRDSLYC++AP PP PEE
Sbjct  115   INGVRRFHEQDTEVKKEFHTRDEMRKVAYNTNFDFYQAPAANWRDSLYCLVAPHPPRPEE  174

Query  738   LPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEP  917
             LP VCRDIMI Y   VMSLG  +FELLSEALGL   HLK MGC+EGL+ IGHYYP CP+P
Sbjct  175   LPAVCRDIMIDYTNKVMSLGLIIFELLSEALGLKPSHLKDMGCAEGLYFIGHYYPACPQP  234

Query  918   DLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQ  1076
             DLTLGLS HTDS FL ++LQD LGGLQVLHED W+DV   PG+LIVN+GDM Q
Sbjct  235   DLTLGLSKHTDSAFLAVVLQDHLGGLQVLHEDQWIDVTPIPGALIVNLGDMTQ  287



>ref|XP_011030519.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
2-like [Populus euphratica]
Length=370

 Score =   339 bits (870),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 178/335 (53%), Positives = 240/335 (72%), Gaps = 5/335 (1%)
 Frame = +3

Query  249   MQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKN--SAANAATPQFVI  422
             + A YDR  E+++F++SK GVKGL DAG+TK+PR F+     +  +  +       QF I
Sbjct  11    VSATYDRYREIKSFDESKCGVKGLVDAGITKLPRFFIRSPEDIAADDINTGEWINTQFTI  70

Query  423   PVIDFEGLGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELK  602
             PVID + +  +RR E V  +K A E  GFFQV+NHG+ + V+++MLE+V+ FHEQ  E+K
Sbjct  71    PVIDLKNMD-SRRAEAVAGVKRAAEEVGFFQVVNHGMENRVLEEMLEAVRGFHEQPREVK  129

Query  603   KPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEH  782
             + ++SR++ +KV Y SNFDL  +  ANWRD+L+C+M PDP +P+ELP V RDIM++Y+  
Sbjct  130   EEYYSREMMRKVKYVSNFDLYKSKYANWRDTLFCVMGPDPLDPQELPLVARDIMMEYSNK  189

Query  783   VMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfl  962
             V  L   LFELLSEALGL  DHLK M C +G  ++ HYYP CPEP+L +G + H+D  FL
Sbjct  190   VCKLATVLFELLSEALGLKSDHLKEMDCVKGHALLSHYYPACPEPELAMGTTKHSDPDFL  249

Query  963   tlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPR  1142
             T+LLQD +GGLQ+ H++ W+DVP   G+L+VNIGD+LQL++NDKFKSV HRV+A  +GPR
Sbjct  250   TILLQDNIGGLQIFHQNHWIDVPPVHGALVVNIGDLLQLISNDKFKSVEHRVVANHIGPR  309

Query  1143  ISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIY  1247
             +SVASFF  H       + YGPIKELLSEE P IY
Sbjct  310   VSVASFFTPHLYPS--TRLYGPIKELLSEENPPIY  342



>ref|XP_006379884.1| hypothetical protein POPTR_0008s16530g [Populus trichocarpa]
 gb|ERP57681.1| hypothetical protein POPTR_0008s16530g [Populus trichocarpa]
Length=291

 Score =   336 bits (862),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 175/294 (60%), Positives = 222/294 (76%), Gaps = 8/294 (3%)
 Frame = +3

Query  204   MVDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEK  383
             M+ TS+    + +S ++++YDRRSE++AF+DSKAGVKGL D+G+  IP+IF+++ S  +K
Sbjct  1     MLSTSSG---KTESELKSDYDRRSELKAFDDSKAGVKGLVDSGVANIPQIFIHESSTNDK  57

Query  384   NSAANAATPQFVIPVIDFEGL--GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKM  557
              S+ +     F +PVIDF G+    + R +IV  +++AC+ WGFFQVINHGI  +V+D M
Sbjct  58    LSSGHH---NFTVPVIDFNGIHEDASLRGKIVEELREACKKWGFFQVINHGISSSVLDDM  114

Query  558   LESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEE  737
             +  V+ FHEQD E+KK FH+RD  +KV YN+NFD   A  ANWRDSLYC++AP PP PEE
Sbjct  115   INGVRRFHEQDTEVKKEFHTRDEMRKVAYNTNFDFYQAPAANWRDSLYCLVAPHPPRPEE  174

Query  738   LPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEP  917
             LP VCRDIMI Y   VMSLG  +FELLSEALGL   HLK MGC+EGL+ IGHYYP CP+P
Sbjct  175   LPAVCRDIMIDYTNKVMSLGLIIFELLSEALGLKPSHLKDMGCAEGLYFIGHYYPACPQP  234

Query  918   DLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQL  1079
             DLTLGLS HTDS FL ++LQD LGGLQVLHED W+DV   PG+LIVN+GDM Q 
Sbjct  235   DLTLGLSKHTDSAFLAVVLQDHLGGLQVLHEDQWIDVTPIPGALIVNLGDMTQF  288



>ref|XP_004134416.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Cucumis sativus]
 ref|XP_004167603.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Cucumis sativus]
 gb|KGN56875.1| hypothetical protein Csa_3G135720 [Cucumis sativus]
Length=374

 Score =   339 bits (870),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 180/351 (51%), Positives = 246/351 (70%), Gaps = 10/351 (3%)
 Frame = +3

Query  204   MVDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEK  383
             M   ++  NL   S     + R +E++AF+D+KAGVKGL DA + +IPRIF +       
Sbjct  1     MAVAASGINLTPLSKADENFHRPTELKAFDDTKAGVKGLVDAKVNEIPRIFYHP------  54

Query  384   NSAANAATPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKM  557
                 ++A     IP+ID EG+G +  +R  I+  I+DA E  GFFQ+INHGIP +V+++M
Sbjct  55    PEDVHSAQTHIHIPLIDLEGVGNDSLKRKHIIEQIRDASEELGFFQLINHGIPTSVLEEM  114

Query  558   LESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEE  737
              +SV+ FHEQD E KK +++RD  K   YNSNFDL  A T NWRD+   + AP+PP P+E
Sbjct  115   RDSVRRFHEQDTEDKKQYYTRDFMKPFIYNSNFDLYTAPTTNWRDTFSYVCAPNPPNPQE  174

Query  738   LPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEP  917
             LP +CRDIM+ Y++ VM +G  + ELLSEALGL+ ++L  +GC++GL  + HYYPPCP+P
Sbjct  175   LPEICRDIMVDYSKWVMEIGKLVLELLSEALGLNPNYLDNIGCNDGLAFVYHYYPPCPQP  234

Query  918   DLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKF  1097
              LT G+S H+D+ F+T+LLQD +GGLQ+ H++ W+DV    G+L+VNIGD++QL+TND+F
Sbjct  235   KLTTGISEHSDTDFITVLLQDHIGGLQIRHDNKWIDVHPVAGALVVNIGDLMQLITNDRF  294

Query  1098  KSVHHRVLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             KSV+HRVLA   GPRISVA  F       +  K YGPIKEL+SEEKPAIYR
Sbjct  295   KSVNHRVLASHEGPRISVAGVFSTMVSPSD--KLYGPIKELVSEEKPAIYR  343



>ref|XP_006588550.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X1 [Glycine max]
 ref|XP_006588551.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X2 [Glycine max]
 gb|KHN00305.1| 1-aminocyclopropane-1-carboxylate oxidase like 1 [Glycine soja]
Length=357

 Score =   338 bits (868),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/334 (52%), Positives = 238/334 (71%), Gaps = 7/334 (2%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVID  434
             A+ DR  E++AF+D+K GVKGL DAG+TKIPRIF +     +K  A++     + IPVID
Sbjct  2     ADSDREKELKAFDDTKLGVKGLVDAGITKIPRIFHHPPDNFKK--ASDLGYKDYTIPVID  59

Query  435   FEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKP  608
                +  +   R  +V  IK+A E WGFFQ++NHGIP + +++M++ V  F EQD E+KK 
Sbjct  60    LASIREDLRERERVVERIKEASETWGFFQIVNHGIPVSTLEEMVDGVLRFFEQDSEVKKE  119

Query  609   FHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVM  788
             F++R+++    Y SN++L   A   W+DS YC +AP+ P+PE+LP VCRDI+++Y+  V+
Sbjct  120   FYTRELRP-FFYTSNYNLYTTAPTTWKDSFYCNLAPNAPKPEDLPAVCRDILVEYSNEVL  178

Query  789   SLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltl  968
              LG  LFELLSEALGLD  +L  +GC+EGLF   HYYP CPEP+LT+G + H+D  F+T+
Sbjct  179   KLGTLLFELLSEALGLDPTYLTNIGCTEGLFAFSHYYPACPEPELTMGTAKHSDMDFITV  238

Query  969   llqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRIS  1148
             LLQ  +GGLQV H+D+W+D+P   G+L+VNIGD LQL++NDKFKS  HRVLA P+GPR+S
Sbjct  239   LLQGHIGGLQVFHKDMWIDLPPLTGALVVNIGDFLQLISNDKFKSAQHRVLANPIGPRVS  298

Query  1149  VASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             +A FF         ++ YGPIKELLSE+ PA YR
Sbjct  299   IACFFSTGLNP--TSRIYGPIKELLSEDNPAKYR  330



>ref|XP_002315711.2| hypothetical protein POPTR_0010s08380g [Populus trichocarpa]
 gb|EEF01882.2| hypothetical protein POPTR_0010s08380g [Populus trichocarpa]
Length=370

 Score =   339 bits (869),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 178/335 (53%), Positives = 239/335 (71%), Gaps = 5/335 (1%)
 Frame = +3

Query  249   MQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKN--SAANAATPQFVI  422
             + A YDR  E+ +F++SK GVKGL DAG+TK+PR F+     +  +  +       QF I
Sbjct  11    VSATYDRYQEIRSFDESKCGVKGLVDAGITKVPRFFIRPPEDIAADDINTGEWINTQFTI  70

Query  423   PVIDFEGLGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELK  602
             PVID + +  +RR E V  +K A E  GFFQV+NHG+ + V+++MLE+V+ FHEQ  E+K
Sbjct  71    PVIDLKNMD-SRRAEAVAGVKRAAEEVGFFQVVNHGMENRVLEEMLEAVRGFHEQPREVK  129

Query  603   KPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEH  782
             + ++SR++ +KV Y SNFDL  +  ANWRD+L+C+M PDP +P+ELP V RDIM++Y+  
Sbjct  130   EEYYSREMTRKVKYVSNFDLYKSKYANWRDTLFCVMGPDPLDPQELPLVSRDIMMEYSNK  189

Query  783   VMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfl  962
             V  L   LFELLSEALGL  DHLK M C +G  ++ HYYP CPEP+L +G + H+D  FL
Sbjct  190   VCKLATVLFELLSEALGLKSDHLKEMDCVKGHALLSHYYPACPEPELAMGTTKHSDPDFL  249

Query  963   tlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPR  1142
             T+LLQD +GGLQ+ H++ W+DVP   G+L+VNIGD+LQL++NDKFKSV HRV+A  +GPR
Sbjct  250   TILLQDDIGGLQIFHQNHWIDVPPVHGALVVNIGDLLQLISNDKFKSVEHRVVANHIGPR  309

Query  1143  ISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIY  1247
             +SVASFF  H       + YGPIKELLSEE P IY
Sbjct  310   VSVASFFTPHLYPST--RLYGPIKELLSEENPPIY  342



>gb|KCW60401.1| hypothetical protein EUGRSUZ_H03119 [Eucalyptus grandis]
Length=353

 Score =   338 bits (867),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 179/331 (54%), Positives = 237/331 (72%), Gaps = 18/331 (5%)
 Frame = +3

Query  261   YDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFE  440
             YDR++E+++F+D KAGVKGL DAGLTKIPR F++ H  LE + A+    P   IPV+DF 
Sbjct  13    YDRQAELKSFDDLKAGVKGLADAGLTKIPRFFVHDHLDLELDRASELPRPSPSIPVVDFG  72

Query  441   GLGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFHSR  620
             G G                  G+  V+NHG+P  + ++M+E ++ FHEQD E K+ ++SR
Sbjct  73    GAGR-----------------GWSPVVNHGVPAALTEEMVEGIRRFHEQDLEAKREWYSR  115

Query  621   DVK-KKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMSLG  797
             D   +KV YNSNFDL  A  ANWRD+L  ++AP  P+P+ELP VCRD++I+Y + ++ L 
Sbjct  116   DYGGRKVLYNSNFDLYRAPAANWRDTLSRVLAPRSPDPQELPAVCRDVIIEYKDRILELS  175

Query  798   YTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltlllq  977
              T+FELLSEALGLD  +LK + C EGLF +GHYYP CPEPDLTLG   HTDSGFLT+LLQ
Sbjct  176   DTIFELLSEALGLDPSYLKTIHCGEGLFFVGHYYPACPEPDLTLGTGDHTDSGFLTILLQ  235

Query  978   dqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISVAS  1157
             DQ+GGLQV H++ W+DV   PG+L++N+GD++QL++ND+F SV HRVLA+ +GPRISVA 
Sbjct  236   DQIGGLQVHHQNQWIDVSPIPGALVINLGDLMQLISNDEFISVSHRVLAQKIGPRISVAC  295

Query  1158  FFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
               R H    N ++ YGPI+E LSEE P IYR
Sbjct  296   LMRQHLPPENSSRLYGPIEERLSEENPPIYR  326



>ref|XP_010483593.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
11-like isoform X1 [Camelina sativa]
Length=366

 Score =   339 bits (869),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 187/334 (56%), Positives = 239/334 (72%), Gaps = 8/334 (2%)
 Frame = +3

Query  264   DRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFEG  443
             D  SE +AF+++K GVKGL DA +T+IPRIF      L  N   + +     IP +DF  
Sbjct  9     DPYSERKAFDETKEGVKGLIDAKITEIPRIFHIPKETL-PNKKPSVSVSDLSIPTLDFAN  67

Query  444   LGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQ-DFELKKPFH  614
             +G +   R  +V  +K A ENWGFFQVINHG+P +V++++ ++V+ FHE+ D E+KK ++
Sbjct  68    IGVDTASREAVVEKVKYAVENWGFFQVINHGVPLDVLEEIKDAVRRFHEEEDHEVKKSYY  127

Query  615   SRD-VKKKVTYNSNFDLLVAA-TANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVM  788
             SRD  K K  Y+SNFDL  ++ +  WRDS+ C MAPDPP PEELP  CRD +IKY +HV+
Sbjct  128   SRDFTKNKFAYSSNFDLYSSSPSLTWRDSISCYMAPDPPTPEELPETCRDAVIKYTKHVL  187

Query  789   SLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltl  968
             SLG  LFELLSEALGL  + LK M C + L +I HYYPPCP+PDLTLG+S H+D+ FLT+
Sbjct  188   SLGDLLFELLSEALGLKSEILKSMDCLKSLLMICHYYPPCPQPDLTLGISKHSDNSFLTV  247

Query  969   llqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRIS  1148
             LLQD +GGLQ+LH+D W+DV   PG+L+VNIGD LQL+TNDKF SV HRVLA   GPRIS
Sbjct  248   LLQDDIGGLQILHQDSWIDVSPLPGALVVNIGDFLQLITNDKFISVEHRVLANTRGPRIS  307

Query  1149  VASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             VASFF    +E   +  YGP+KELLSEE P  YR
Sbjct  308   VASFFSSSIREN--STVYGPMKELLSEENPPKYR  339



>gb|AES62052.2| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=378

 Score =   339 bits (869),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 179/345 (52%), Positives = 246/345 (71%), Gaps = 8/345 (2%)
 Frame = +3

Query  240   DSIMQAEYDRRSEVEAFEDSKAGVKGLFDAG--LTKIPRIFLNKHSILEKNSAANA----  401
             +S   + Y+R +EV+AF++SKAGVKGL ++G  +TKIPR+F    S L+ N+        
Sbjct  7     NSSTTSTYNRIAEVKAFDESKAGVKGLVESGTCVTKIPRMFHFPKSSLKNNTHETILQID  66

Query  402   ATPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQH  575
             ++ +  +P+ID + +  N    VE+V+ I+ AC+ WGFFQVINHGIP +V+D+M  +++ 
Sbjct  67    SSSKLCVPIIDLQDMNTNPCLHVEVVDKIRSACKEWGFFQVINHGIPVSVLDEMTSAIRR  126

Query  576   FHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCR  755
             FHEQ+ + +KPF++RD  KKV Y SN  L     ANWRD++    +PDPP PEE+P VCR
Sbjct  127   FHEQEVDARKPFYTRDTSKKVRYFSNGTLFRDPAANWRDTIAFFTSPDPPNPEEIPQVCR  186

Query  756   DIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGL  935
             DI+I+Y++ V +LG T+FEL SEALGL   +L  +  + G F++ HYYP CPEP+LT+G 
Sbjct  187   DIVIEYSKKVRALGLTIFELYSEALGLHPSYLTKLLSTYGQFLLCHYYPACPEPELTMGT  246

Query  936   SSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHR  1115
             S HTD  F+T+LLQDQ+GG QVLH++ WVDVP   GSL+VN+GD++QL+TND F SV+HR
Sbjct  247   SKHTDIDFMTILLQDQIGGFQVLHQNQWVDVPPLHGSLVVNVGDLMQLITNDMFTSVYHR  306

Query  1116  VLAKPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             VL+K +GPRIS+ASFF     E   +K   PIKELLSEE P IYR
Sbjct  307   VLSKNIGPRISIASFFVNPSSEEVTSKVVAPIKELLSEENPPIYR  351



>ref|XP_010469792.1| PREDICTED: probable 2-oxoacid dependent dioxygenase [Camelina 
sativa]
Length=359

 Score =   338 bits (867),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 188/338 (56%), Positives = 243/338 (72%), Gaps = 10/338 (3%)
 Frame = +3

Query  249   MQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPV  428
             M   YDR  EV+AF++ K GVKGL DAG+T+IPRIF + H+    N   +++T    IP 
Sbjct  1     MVGNYDRTGEVKAFDEMKIGVKGLMDAGITQIPRIFHHPHATF-TNPKPSSST--LKIPT  57

Query  429   IDFEGL---GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFEL  599
             ID  G        R  ++  +KDA EN+GFFQVINHGIP +VM+KM + ++ FHEQD ++
Sbjct  58    IDLGGCVFESTVMRESVITKVKDAVENFGFFQVINHGIPVDVMEKMKDGIRGFHEQDSDV  117

Query  600   KKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAE  779
             KK F+SRD+ KKV YN+NF L  +  ANWRD+L  +MAPD  + E+LP VCR+IM++Y++
Sbjct  118   KKTFYSRDITKKVKYNTNFGLYSSQAANWRDTLTMVMAPDVSQVEDLPAVCREIMLEYSK  177

Query  780   HVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgf  959
              +M LG T+FELLSEALGL+ +HLK + C + L ++ HYYPPCPEPD T G+SSHTD  F
Sbjct  178   RMMKLGETIFELLSEALGLNPNHLKELDCDKSLSLLSHYYPPCPEPDRTFGISSHTDISF  237

Query  960   ltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLA-KPVG  1136
             +T+LLQD +GGLQVLH+  W+DVP  P +LIVN+GD+LQL+TNDKF SV HRVLA +   
Sbjct  238   ITILLQDHIGGLQVLHDGYWIDVPPNPEALIVNLGDLLQLITNDKFVSVEHRVLANRGEE  297

Query  1137  PRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             PRIS ASFF MH     +   YGPIKELLSE+ P  YR
Sbjct  298   PRISSASFF-MHTIPNEQV--YGPIKELLSEQNPPKYR  332



>ref|NP_200762.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
 sp|Q9LTH7.1|ACH12_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate oxidase homolog 
12 [Arabidopsis thaliana]
 gb|AAL11609.1|AF424616_1 AT5g59540/f2o15_200 [Arabidopsis thaliana]
 dbj|BAA97488.1| leucoanthocyanidin dioxygenase-like protein [Arabidopsis thaliana]
 gb|ABD85166.1| At5g59540 [Arabidopsis thaliana]
 dbj|BAE98386.1| 1-aminocyclopropane-1-carboxylate oxidase - like protein [Arabidopsis 
thaliana]
 gb|AED97202.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
Length=366

 Score =   338 bits (868),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 186/335 (56%), Positives = 238/335 (71%), Gaps = 7/335 (2%)
 Frame = +3

Query  258   EYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDF  437
             E+D   E +AF+++K GVKGL DA +T++PRIF ++  IL  N   +A+     IP+IDF
Sbjct  8     EFDPYIERKAFDETKQGVKGLVDAKITEVPRIFHHRQDIL-TNKKPSASVSDLEIPIIDF  66

Query  438   EGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPF  611
               +  +   R  IV  +K A ENWGFFQVINH IP NV++++ + V+ FHE+D E+KK F
Sbjct  67    ASVHADTASREAIVEKVKYAVENWGFFQVINHSIPLNVLEEIKDGVRRFHEEDPEVKKSF  126

Query  612   HSRDV-KKKVTYNSNFDLLVAA-TANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
              SRD   KK  YNSNFDL  ++ + NWRDS  C +APDPP PEE+P  CRD M +Y++HV
Sbjct  127   FSRDAGNKKFVYNSNFDLYSSSPSVNWRDSFSCYIAPDPPAPEEIPETCRDAMFEYSKHV  186

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgflt  965
             +S G  LFELLSEALGL    L+ M C + L +I HYYPPCP+PDLTLG++ H+D+ FLT
Sbjct  187   LSFGGLLFELLSEALGLKSQTLESMDCVKTLLMICHYYPPCPQPDLTLGITKHSDNSFLT  246

Query  966   lllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRI  1145
             LLLQD +GGLQ+LH+D WVDV    G+L+VNIGD LQL+TNDKF SV HRVLA   GPRI
Sbjct  247   LLLQDNIGGLQILHQDSWVDVSPIHGALVVNIGDFLQLITNDKFVSVEHRVLANRQGPRI  306

Query  1146  SVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             SVASFF    +    ++ YGP+KEL+SEE P  YR
Sbjct  307   SVASFFSSSMRPN--SRVYGPMKELVSEENPPKYR  339



>emb|CAN82828.1| hypothetical protein VITISV_043897 [Vitis vinifera]
Length=740

 Score =   350 bits (898),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 181/340 (53%), Positives = 252/340 (74%), Gaps = 8/340 (2%)
 Frame = +3

Query  243   SIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVI  422
             S ++ E+DR+ E++AF+DSK+GVKGL DAG+TKIP +F+  H     N+ + +A  QF +
Sbjct  389   SGVEVEHDRKRELKAFDDSKSGVKGLVDAGITKIPPMFI--HPQYNLNAKSGSAVSQFRV  446

Query  423   PVIDFEGL--GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFE  596
             P++D +G+      R +I++ +++ACENWGFFQ +NHGIP +V+++M++ ++ FHEQD +
Sbjct  447   PLVDLDGINDSATLRAKIIDQVREACENWGFFQAVNHGIPASVLEEMIDGIRGFHEQDTQ  506

Query  597   LKKP-FHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKY  773
             +KK  F+ RD K+KV+Y SNFDL  A  A W+D L   MAP PP+P ELP VCRDI+++Y
Sbjct  507   VKKEYFYKRDFKEKVSYFSNFDLCQATVATWKDCLSWAMAPSPPDPTELPAVCRDIVMEY  566

Query  774   AEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDS  953
             ++ V  LG TLFELLSEALGLD++ LK M C+E +F  GHYYPPCPEP+LTLG   HTDS
Sbjct  567   SKQVKRLGCTLFELLSEALGLDVNRLKDMECAEMIFPAGHYYPPCPEPELTLGARRHTDS  626

Query  954   gfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPV  1133
              FLT+LLQDQ+GGLQVLH++ W+D    PG+L++N+GD LQ++TND+FKS+ HRVL   V
Sbjct  627   RFLTVLLQDQVGGLQVLHQNQWIDASPMPGALVINVGDSLQVITNDRFKSIEHRVLVNRV  686

Query  1134  GPRISVASFFRMHFQEGNEAKTYGPIKE-LLSEEKPAIYR  1250
              PR+SVAS F  +      +K Y PIKE L+++E P  Y+
Sbjct  687   SPRVSVASAFGTNLFPS--SKLYSPIKESLVTQENPPKYK  724


 Score =   325 bits (832),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 175/338 (52%), Positives = 242/338 (72%), Gaps = 26/338 (8%)
 Frame = +3

Query  243   SIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVI  422
             S +++EYDR+SE+EAF+ SK+GVKGL D GLTKIP +F++ H     ++ + +A  QF +
Sbjct  51    SGVESEYDRKSELEAFDASKSGVKGLVDGGLTKIPLMFIHPH--YNPDAKSGSAVSQFRV  108

Query  423   PVIDFEGLGGNR--RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFE  596
             P+ID +G+  N   R +I++ +++ACENWGF QV+NHGIP +V+++ML+ ++ FHEQD +
Sbjct  109   PLIDLDGVNDNATLRAKIIDQVREACENWGFLQVVNHGIPASVLEEMLDGIRGFHEQDTQ  168

Query  597   LKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYA  776
             +KK F++RD K+K T            A W+DSL   +AP+PP P+ELP VCRDI+++Y+
Sbjct  169   MKKEFYTRDFKEKAT-----------AATWKDSLSWAVAPNPPHPKELPAVCRDIVMEYS  217

Query  777   EHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSg  956
             + V  LGYTLFE+LSEALGLD++HLK M C+E +F  GHYYPPCPEP+LTLG   HTDSG
Sbjct  218   KQVKRLGYTLFEVLSEALGLDVNHLKDMECAEMMFHAGHYYPPCPEPELTLGARRHTDSG  277

Query  957   fltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVG  1136
             FLT+LLQDQ+GGLQVLH++ W+D+   PG+L++         TND+FKS+ HRVL     
Sbjct  278   FLTVLLQDQVGGLQVLHQNQWIDLVPMPGALVI---------TNDRFKSIEHRVLVNSES  328

Query  1137  PRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              R+SVAS F         +K Y PIKELLS+E P  Y+
Sbjct  329   SRVSVASAFGTTLFPS--SKLYSPIKELLSQENPPKYK  364



>ref|XP_007223369.1| hypothetical protein PRUPE_ppa007487mg [Prunus persica]
 gb|EMJ24568.1| hypothetical protein PRUPE_ppa007487mg [Prunus persica]
Length=366

 Score =   338 bits (867),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 183/335 (55%), Positives = 236/335 (70%), Gaps = 5/335 (1%)
 Frame = +3

Query  255   AEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVID  434
               YDR+SE++AF+D+K GVKGL DA +T++PRIF         NS  ++   QF IP+ID
Sbjct  7     TNYDRQSELKAFDDTKEGVKGLVDARITEVPRIFHQPPDQYIINSNFDSEATQFSIPLID  66

Query  435   FEGL---GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKK  605
              EGL      +R EIV  + +A E WGFFQ+ NHGIP  V+++M +SV+ F EQD  +KK
Sbjct  67    LEGLEFDSPTKRNEIVAKVGEASETWGFFQISNHGIPVGVLEEMKDSVRGFFEQDTHVKK  126

Query  606   PFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
              F++RD  K V YNSNFDL  A   NWRD+  C MAP+P +PE++P V RDI+I+Y++ V
Sbjct  127   QFYNRDPLKPVGYNSNFDLYRAPATNWRDTFRCYMAPNPAKPEDMPEVFRDILIEYSKQV  186

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgflt  965
             M LG  LFELLSEALGL   +L  + CS GL + GHYYP CP+P+LT+G S H D+ FLT
Sbjct  187   MKLGKLLFELLSEALGLKPSYLNDIDCSLGLLLGGHYYPSCPQPELTMGASKHADNDFLT  246

Query  966   lllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRI  1145
             +LLQD +GGLQVLH++ W+DVP  PG+L+VNIGD+LQ+L+ND+FKS  HRVLA  VGPR+
Sbjct  247   VLLQDHIGGLQVLHQNKWIDVPPMPGALVVNIGDLLQVLSNDRFKSAEHRVLANRVGPRV  306

Query  1146  SVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             SV  FF          + YGPIKELLSE+ P  YR
Sbjct  307   SVPCFFTTGMLP--LERLYGPIKELLSEDNPPKYR  339



>ref|XP_002529306.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
 gb|EEF33075.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
Length=377

 Score =   338 bits (868),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 186/340 (55%), Positives = 243/340 (71%), Gaps = 12/340 (4%)
 Frame = +3

Query  258   EYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDF  437
             EYDR SE++AF+++K GVKGL DAG+TK+PRIF   H   +  S+A A   QF IP+ID 
Sbjct  16    EYDRNSELKAFDETKLGVKGLIDAGVTKVPRIFHKPHDYPDDISSA-AEDAQFRIPIIDL  74

Query  438   EG--LGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPF  611
             E   +      + V  I++A E WGFFQ+INHGI  ++M++M+  V+ F EQD E+KK F
Sbjct  75    EAVEMDSTTHEKAVEEIRNAAETWGFFQIINHGIDLSIMEEMINGVRRFFEQDSEVKKKF  134

Query  612   HSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMS  791
             +SR+  K   Y SNFDL  +  A+WRD+  C +AP+  +PEELP VCRDI ++Y++ V  
Sbjct  135   YSREAGKSFMYVSNFDLYFSKFASWRDTFSCNIAPNTVKPEELPEVCRDITLEYSKKVRR  194

Query  792   LGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltll  971
             +G  LFELLSEALGL  + L+ M C+EGL ++ HYYPPCPEP+LT G   HTD GFLT+L
Sbjct  195   VGIFLFELLSEALGLKPNRLREMECTEGLVVLCHYYPPCPEPELTTGTVGHTDPGFLTVL  254

Query  972   lqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDML-------QLLTNDKFKSVHHRVLAKP  1130
             LQDQ+GGLQVLH++ WVD+P  PG+L+VN+ DML       QL++NDKFKS  HRVL+  
Sbjct  255   LQDQIGGLQVLHQNKWVDIPPVPGALVVNLADMLQAIIPNFQLISNDKFKSSMHRVLSNR  314

Query  1131  VGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             +GPRISVASFF   FQ+   +K +GPIKELLSE+ P IYR
Sbjct  315   IGPRISVASFFSTGFQKS--SKLFGPIKELLSEDNPPIYR  352



>ref|XP_010026850.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Eucalyptus grandis]
 gb|KCW60392.1| hypothetical protein EUGRSUZ_H03108 [Eucalyptus grandis]
Length=371

 Score =   338 bits (867),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 179/333 (54%), Positives = 244/333 (73%), Gaps = 6/333 (2%)
 Frame = +3

Query  258   EYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDF  437
             +YDR SE++ F++ KAGVKGL DAG+T++PRIF++    L+  SA  ++   F +P++D 
Sbjct  15    KYDRISEIKDFDELKAGVKGLVDAGITEVPRIFVDHPENLQ--SALASSNGHFHVPIVDL  72

Query  438   EGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPF  611
               +  +  RR E+VN ++ A + WGFFQV+NHGIP  V+++ML+ V+ FHEQ  E KK F
Sbjct  73    AEIVKDPSRRKEVVNEVRSASKTWGFFQVVNHGIPTTVLEEMLDGVRRFHEQGAEEKKRF  132

Query  612   HSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMS  791
             +SRD    V Y+SNF+L     ANWRD+L+C+MAP+  E E+LP VC DIM+++++ VM+
Sbjct  133   YSRDFTTSVAYHSNFNLYKTEAANWRDTLFCVMAPNALEAEDLPAVCGDIMLEFSKRVMN  192

Query  792   LGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltll  971
             LG TLFELLSEALGL  +HLK M C++GL ++  YYP CP+P+LT+G S HTDS FLT+L
Sbjct  193   LGTTLFELLSEALGLKPNHLKDMECAKGLVLLNQYYPKCPQPELTMGTSRHTDSDFLTVL  252

Query  972   lqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISV  1151
             LQD +GGLQVL+++ W+DV   PG+LIVNIGD+LQL++ND FKS  HRV+A  +GPR+SV
Sbjct  253   LQDHVGGLQVLYQNQWIDVSPVPGALIVNIGDLLQLISNDIFKSSEHRVVANNMGPRVSV  312

Query  1152  ASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             A FF  +       K YGPIKEL+SE  P  YR
Sbjct  313   ACFF--YTATPPSPKLYGPIKELISEGDPPKYR  343



>gb|KFK42977.1| hypothetical protein AALP_AA1G063700 [Arabis alpina]
Length=363

 Score =   338 bits (866),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 186/339 (55%), Positives = 242/339 (71%), Gaps = 6/339 (2%)
 Frame = +3

Query  240   DSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFV  419
             +S      DR S+++AF+D+K GVKGL DAG++ IP IFL     L   S    ++ QF 
Sbjct  2     ESTHNVALDRSSQLKAFDDTKTGVKGLVDAGISSIPDIFLAPPVTL--TSPKPPSSSQFT  59

Query  420   IPVIDFEGL--GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDF  593
             IP ID +G       R ++V  I DA E WGFFQV+NHGI  +V++ M + ++ FHEQD 
Sbjct  60    IPTIDLKGGTDSTTTRSDLVEKIGDAAEKWGFFQVVNHGISLDVLEMMRDGIREFHEQDP  119

Query  594   ELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKY  773
             E+KK F+SRD K K+ Y+SNFDL  +  ANWRD+L C  APDPP+PE+LP VC ++MI+Y
Sbjct  120   EVKKGFYSRDPKSKMVYSSNFDLFSSPAANWRDTLGCYTAPDPPKPEDLPAVCGEMMIEY  179

Query  774   AEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDS  953
             ++ VM LG  LFELLSE+LGL  ++LK M C+  L ++GHYYPPCP+PDLTLGLS H+D+
Sbjct  180   SKEVMKLGKLLFELLSESLGLSTNYLKDMDCTNSLLLLGHYYPPCPQPDLTLGLSKHSDN  239

Query  954   gfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPV  1133
              FLT+LLQD +GGLQVLH+  WVDVP  PG+L++N+GD+LQL+TN KF SV HRVLA   
Sbjct  240   SFLTVLLQDHIGGLQVLHDQYWVDVPPVPGALVINVGDLLQLITNGKFISVEHRVLANET  299

Query  1134  GPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             GPRISVA FF  +    +  + YGP+KELLSE+ P  YR
Sbjct  300   GPRISVACFFSSYLMAND--RVYGPVKELLSEQNPPKYR  336



>ref|XP_010481858.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
10-like isoform X1 [Camelina sativa]
 ref|XP_010481859.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
10-like isoform X2 [Camelina sativa]
Length=362

 Score =   338 bits (866),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 179/337 (53%), Positives = 234/337 (69%), Gaps = 5/337 (1%)
 Frame = +3

Query  249   MQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPV  428
             M  + DR +++  F  +  GVKGL DA +T++PRIF    S L  N  ++ +     +P+
Sbjct  1     MADKTDRMNDLTTFISTNTGVKGLVDAEITEVPRIFHVPSSTLSNNRPSDISEDDLTVPI  60

Query  429   IDFEGLGGN---RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFEL  599
             ID   +  +    R  +V+ IKDA E WGFFQVINHG+P  V+++M + V+ FHE+D E+
Sbjct  61    IDLGEISNDVTSARNSVVSKIKDAAEKWGFFQVINHGVPLTVLEEMKQGVRKFHEEDPEV  120

Query  600   KKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAE  779
             KK + S D+ K+  YN+NFDL  ++  NWRDS  C +APDPP PE++P  CR  +I+Y +
Sbjct  121   KKQYMSSDLNKRFLYNNNFDLYHSSPMNWRDSFTCYIAPDPPNPEDIPVACRGAVIEYTK  180

Query  780   HVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgf  959
             HVM LG  LF+LLSEALGLD + LK M C +GLF++ HYYPPCP+PDLTLG+S HTD+ F
Sbjct  181   HVMELGDLLFQLLSEALGLDSEILKRMDCLKGLFMVCHYYPPCPQPDLTLGISKHTDNSF  240

Query  960   ltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGP  1139
              TLLLQDQ+GGLQVLH+D WVDVP   G+L+VNIGD +QL+TNDKF SV HRV A   GP
Sbjct  241   FTLLLQDQIGGLQVLHQDYWVDVPPVSGALVVNIGDFMQLITNDKFLSVEHRVRANRDGP  300

Query  1140  RISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             RIS+A FF         +  YGPIKELLS+E PA Y+
Sbjct  301   RISIACFFSSSLSPN--STVYGPIKELLSDENPAKYK  335



>ref|XP_006279819.1| hypothetical protein CARUB_v10028097mg [Capsella rubella]
 gb|EOA12717.1| hypothetical protein CARUB_v10028097mg [Capsella rubella]
Length=364

 Score =   337 bits (865),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 181/335 (54%), Positives = 241/335 (72%), Gaps = 9/335 (3%)
 Frame = +3

Query  258   EYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDF  437
             E++R  E +AF+++K GVKG+ DA +T++PRIF +    L   +    +     IPVIDF
Sbjct  8     EFERYIERKAFDETKEGVKGIVDAKITQVPRIFHHPQDTL---TDKKPSVSDLEIPVIDF  64

Query  438   EGL--GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPF  611
               +      R  +V  ++ A ENWGFFQV+NHG+P NV++++ ++V+ FHE D E+KK +
Sbjct  65    ASVHVDTASREAVVEKVRSAAENWGFFQVLNHGVPLNVLEEIQDAVRRFHEDDPEVKKLY  124

Query  612   HSRD-VKKKVTYNSNFDLLVAATA-NWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
              SRD  K K  YNSNFDL  ++++ NWRDS+ C +APDPP PEELP+ CRD M++Y++HV
Sbjct  125   FSRDPTKNKFIYNSNFDLYSSSSSVNWRDSIECYIAPDPPAPEELPDTCRDAMLEYSKHV  184

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgflt  965
             +SLG  LFEL SEALGL  + LK M C + L +I HYYPPCP+PDLTLG+S H+D+ FLT
Sbjct  185   LSLGGLLFELFSEALGLKSETLKCMDCLKTLLMICHYYPPCPQPDLTLGISKHSDNSFLT  244

Query  966   lllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRI  1145
             +LLQD +GGLQ+LH+D WVDV   PG+L++NIGD LQL+TNDKF SV HRVLA   GPRI
Sbjct  245   VLLQDNIGGLQILHQDSWVDVSPLPGALVINIGDFLQLITNDKFVSVEHRVLANRKGPRI  304

Query  1146  SVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             SVASFF    +    ++ YGP+KEL+SEE P  YR
Sbjct  305   SVASFFSSSIRPN--SRVYGPMKELVSEENPPKYR  337



>ref|XP_010455136.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
11 [Camelina sativa]
Length=365

 Score =   337 bits (864),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 184/335 (55%), Positives = 239/335 (71%), Gaps = 9/335 (3%)
 Frame = +3

Query  261   YDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFE  440
             +D  +E +AF+++K GVKGL DA +T+IPRIF      L  N   + +     IP IDF 
Sbjct  8     FDPYTERKAFDETKEGVKGLIDAKITEIPRIFHVPKDTL-PNKKPSVSVSDLAIPTIDFA  66

Query  441   GLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQ-DFELKKPF  611
              +G +   R  +V  ++ A ENWGFFQVINHG+P +V++++ ++V+ FHE+ D E+KK +
Sbjct  67    SIGVDTPSREAVVEKVRYAVENWGFFQVINHGVPLDVLEEIKDAVRRFHEEEDHEVKKSY  126

Query  612   HSRD-VKKKVTYNSNFDLLVAA-TANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
             +S D  K K  Y+SNFDL  ++ +  WRDS+ C MAPDPP PEELP  CRD MI+Y +H+
Sbjct  127   YSLDFTKNKFAYSSNFDLYSSSPSLTWRDSISCFMAPDPPTPEELPETCRDAMIEYTKHM  186

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgflt  965
             +S GY LFELLSEALGL  + LK M C + L +I HYYPPCP+PDLTLG+S H+D+ FLT
Sbjct  187   LSFGYLLFELLSEALGLKSEILKSMDCLKSLLMICHYYPPCPQPDLTLGISKHSDNSFLT  246

Query  966   lllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRI  1145
             +LLQD +GGLQ+LH+D WVDV   PG+L+VNIGD LQL+TNDKF SV HRVLA   GPRI
Sbjct  247   VLLQDDIGGLQILHQDSWVDVSPLPGALVVNIGDFLQLITNDKFISVEHRVLANTRGPRI  306

Query  1146  SVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             SVASFF    +E +    YGP+KEL+SEE P  YR
Sbjct  307   SVASFFSSSIRENS---VYGPMKELVSEENPPKYR  338



>emb|CDX97789.1| BnaC04g41500D [Brassica napus]
Length=361

 Score =   337 bits (864),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 187/340 (55%), Positives = 243/340 (71%), Gaps = 12/340 (4%)
 Frame = +3

Query  249   MQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQ--FVI  422
             M+A+YDR +EV+AF++ K GVKGL DAG+++IPRIF + H     ++A N   P    +I
Sbjct  1     MEAKYDRATEVKAFDEMKLGVKGLVDAGISEIPRIFHHSHLT---STAPNPLLPSSTMMI  57

Query  423   PVIDFEGLGGNRRV---EIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDF  593
             P ID  G   N  V    ++  IK+A E +GFFQ INHGIP  VMDKM + V  FHEQD 
Sbjct  58    PTIDLGGGVFNSTVTRESVIPKIKEAVERYGFFQAINHGIPVEVMDKMKDRVCGFHEQDS  117

Query  594   ELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKY  773
             +++K  ++RD  KKVTYNSNFDL  + +ANWRD+L C M+PD P  E+LP +C +IM++Y
Sbjct  118   DVRKKLYTRDNTKKVTYNSNFDLYSSPSANWRDTLSCFMSPDVPRTEDLPEICGEIMLEY  177

Query  774   AEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDS  953
             ++ VM LG  +FELLSEALG+D +HLK M C++GL ++ HYYPPCPEPDLT G S H+D 
Sbjct  178   SKQVMELGELIFELLSEALGMDPNHLKEMDCTKGLLMLSHYYPPCPEPDLTFGTSQHSDR  237

Query  954   gfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLA-KP  1130
              FLT+LLQD +GGLQVL +  WVDVP  P +L++N+GD LQL+TNDKF SV HRVLA + 
Sbjct  238   SFLTILLQDHIGGLQVLQDGCWVDVPPVPRALLINLGDFLQLITNDKFLSVEHRVLANRG  297

Query  1131  VGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
               PR+SVASFF +H       + YGP+KELLSE+ P  YR
Sbjct  298   DEPRVSVASFF-VHLLPS--FRVYGPMKELLSEQNPPKYR  334



>gb|AES87341.2| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=373

 Score =   337 bits (865),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 182/350 (52%), Positives = 250/350 (71%), Gaps = 10/350 (3%)
 Frame = +3

Query  207   VDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKN  386
             V TSN  +  +DS     YDR +EV+AF+DSK GV+GL + G+TKIPR+F +  + + +N
Sbjct  3     VKTSNLTHETDDST----YDRNAEVKAFDDSKLGVRGLMERGVTKIPRMFYSGEANIIEN  58

Query  387   SAANAATPQFVIPVIDFEGLG--GNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKML  560
             S  N+      +P+ID + +    +RRVE++N I+ AC+ WGFF+VINHGIP NV+D+ +
Sbjct  59    SINNS---MLSVPIIDLKDIHIYPSRRVEVINQIRTACKEWGFFKVINHGIPINVLDETI  115

Query  561   ESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEEL  740
             + ++ FHEQD E++K F++RD++KK+ Y S   L     ANWRDS+ C M P+PP+ EEL
Sbjct  116   DGIRRFHEQDPEVRKQFYNRDMEKKIVYLSTISLYRDKFANWRDSVGCFMTPNPPKYEEL  175

Query  741   PNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPD  920
             P V RDI+I+Y++ + +LG T+ EL SE LGLDL +LK     +GLFI GHYYPPCPEP+
Sbjct  176   PEVFRDIIIEYSKKITTLGGTILELFSETLGLDLSYLKERNYLDGLFIQGHYYPPCPEPE  235

Query  921   LTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFK  1100
             LT+G S HTD  F+T++LQ+QLGGLQVL ++ W DV    G L+VNIGD+LQL++ND F 
Sbjct  236   LTMGTSEHTDPSFMTIVLQEQLGGLQVLRDNQWFDVAPAHGGLVVNIGDLLQLVSNDNFS  295

Query  1101  SVHHRVLAKPVGPRISVASFF-RMHFQEGNEAKTYGPIKELLSEEKPAIY  1247
             SV+HRVL+   GPR+SVA+FF   H  +   +K YGPIK+L SEE P IY
Sbjct  296   SVYHRVLSNHKGPRVSVAAFFGTSHDLDKASSKIYGPIKDLFSEENPPIY  345



>gb|AES66420.2| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=372

 Score =   337 bits (864),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 180/332 (54%), Positives = 227/332 (68%), Gaps = 7/332 (2%)
 Frame = +3

Query  264   DRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFEG  443
             DR  E++AF+++KAGVKGL D G+ KIP +F   H   +   A N+   Q +IPVIDF  
Sbjct  18    DRLQELKAFDETKAGVKGLVDQGILKIPTLF--HHPPDKYGKATNSTNTQHIIPVIDFAN  75

Query  444   LGG--NRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFHS  617
             +    N R EI+  IK+A E WGFFQVINHGIP NV++ M + V+ F EQD E+KK  ++
Sbjct  76    IDKDPNTRQEIITKIKEASETWGFFQVINHGIPLNVLEDMKDGVKRFFEQDTEVKKEMYT  135

Query  618   RDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMSLG  797
             RD  + + YNSNFDL  +   NWRD+  C  A +  + E+LP VCRDI+++Y   +M LG
Sbjct  136   RDRTRPLVYNSNFDLYRSPALNWRDTFICDFAVNASKLEDLPVVCRDILMEYGTCLMKLG  195

Query  798   YTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTD-Sgfltlll  974
               LFELLSEALGL  +HLK + C EG  IIGHYYP CPEPDLT+G + H+D S    LL 
Sbjct  196   RVLFELLSEALGLHPNHLKDLDCCEGNMIIGHYYPACPEPDLTMGTTKHSDVSFLTVLLQ  255

Query  975   qdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISVA  1154
                +GGLQVLH+D W+DVP  PG+L+VNIGD+LQL+TNDKFKSV HRVLA  +GPRISVA
Sbjct  256   DRIIGGLQVLHQDKWIDVPPVPGALVVNIGDLLQLITNDKFKSVEHRVLANGIGPRISVA  315

Query  1155  SFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              FF+   +     K YGPI ELLSE  P  Y+
Sbjct  316   CFFKAGLRA--HKKLYGPITELLSENNPPRYK  345



>ref|XP_010023989.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Eucalyptus grandis]
 gb|KCW60402.1| hypothetical protein EUGRSUZ_H03120 [Eucalyptus grandis]
Length=371

 Score =   337 bits (864),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 177/333 (53%), Positives = 243/333 (73%), Gaps = 6/333 (2%)
 Frame = +3

Query  258   EYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDF  437
             +YDR  E++ F++S AGVKGL DAG+T++PRIF++    L+  SA  ++   F +P++D 
Sbjct  15    KYDRMREIKDFDESMAGVKGLVDAGITEVPRIFVDHPENLQ--SALASSNGHFHVPIVDL  72

Query  438   EGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPF  611
               +  +  RR E+VN ++ A + WGFFQV+NHGIP  V+++ML+ V+ FHEQ  E K+ F
Sbjct  73    ADIVKDPSRRKEVVNEVRSASKTWGFFQVVNHGIPTTVLEEMLDGVRRFHEQGAEEKRRF  132

Query  612   HSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMS  791
             +SRD    V Y+SNF+L     ANWRD+L+C+MAP+  E E+LP VC DIM+++++ VM+
Sbjct  133   YSRDFTTSVAYHSNFNLYKTEAANWRDTLFCVMAPNALEAEDLPAVCGDIMLEFSKRVMN  192

Query  792   LGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltll  971
             LG TLFELLSEALGL  +HLK M C++GL ++  YYP CP+P+LT+G S HTDS FLT+L
Sbjct  193   LGTTLFELLSEALGLKPNHLKDMECAKGLVLLNQYYPKCPQPELTMGTSRHTDSDFLTVL  252

Query  972   lqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISV  1151
             LQD +GGLQVL+++ W+DV   PG+LIVNIGD+LQL++ND FKS  HRV+A  +GPR+SV
Sbjct  253   LQDHVGGLQVLYQNQWIDVSPVPGALIVNIGDLLQLISNDIFKSSEHRVVANNMGPRVSV  312

Query  1152  ASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             A FF  +       K YGPIKEL+SE  P  YR
Sbjct  313   ACFF--YTATPPSPKLYGPIKELISEGDPPKYR  343



>gb|KEH18776.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
Length=364

 Score =   337 bits (863),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 177/329 (54%), Positives = 240/329 (73%), Gaps = 10/329 (3%)
 Frame = +3

Query  273   SEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFEGLGG  452
             +E +AF+++KAGVKGL D GL KIP +F ++    E      A     VIP+ID   +  
Sbjct  16    NERKAFDETKAGVKGLVDGGLNKIPTLFHHQPDKYEL-----AYNTSHVIPIIDLADIDN  70

Query  453   NR---RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFHSRD  623
                    +IV+ +K+ACE WGFFQV+NHGIP +V++++ + V+ F+EQD E+KK  ++RD
Sbjct  71    KDPSIHQKIVDKVKEACETWGFFQVVNHGIPLSVLEELKDGVKRFYEQDTEVKKDLYTRD  130

Query  624   VKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMSLGYT  803
               K   YNSNFD+  +   NWRD+  C +APD P+PE++P VCRDI+++Y +H+ +LG  
Sbjct  131   RHKSFIYNSNFDIYSSPALNWRDTFTCYLAPDTPKPEDIPVVCRDILLEYGKHMRNLGTL  190

Query  804   LFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltlllqdq  983
             LFEL SEALGL+ +HLK + C+EGL  +GHYYPPCPEP+LT+G + H+D+ FLT+LLQD 
Sbjct  191   LFELCSEALGLNPNHLKDIDCAEGLLALGHYYPPCPEPELTVGTTKHSDNDFLTVLLQDH  250

Query  984   lgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISVASFF  1163
             +GGLQVL++D W+D+   PG+LIVN+GD+LQL+TNDKFKSV HRVLA  VGPRISVA FF
Sbjct  251   IGGLQVLYQDKWIDITPVPGALIVNVGDLLQLITNDKFKSVEHRVLANNVGPRISVACFF  310

Query  1164  RMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
                 +  + +K YGPIKELLSE+ P IYR
Sbjct  311   CTGHR--SSSKLYGPIKELLSEDNPPIYR  337



>ref|XP_009118490.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like isoform X1 [Brassica rapa]
Length=365

 Score =   337 bits (863),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 178/341 (52%), Positives = 242/341 (71%), Gaps = 8/341 (2%)
 Frame = +3

Query  240   DSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFV  419
             +++  A +DR SE++AF+++K GVKGL +AG++++PRIF   HS L+ ++    ++    
Sbjct  2     ETMKIASFDRVSELKAFDETKTGVKGLVEAGVSEVPRIF--HHSSLKLSNPKPLSSDFTT  59

Query  420   IPVIDFEG---LGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQD  590
             IP  D  G       +R  +V  IK+A E WGFFQVINHG+P ++++KM + V+ FHEQ 
Sbjct  60    IPTFDLGGRVFADETKRKNVVQGIKEASEKWGFFQVINHGVPLDLLEKMKDGVRGFHEQL  119

Query  591   FELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIK  770
              E++K ++ RD  KK  Y SNFDL  +  ANWRD+  C +APDPP+PE+LP +CRD+M++
Sbjct  120   PEVRKQYYGRDFSKKFMYLSNFDLFSSPAANWRDTFSCTIAPDPPKPEDLPEICRDVMLE  179

Query  771   YAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTD  950
             Y +HVM+LG  LFE+LSEALGLD ++L  M CS+GL ++ HYYPPCPEPDLTLG + H+D
Sbjct  180   YTKHVMNLGQFLFEMLSEALGLDPNYLNEMDCSKGLHMLNHYYPPCPEPDLTLGTTQHSD  239

Query  951   SgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLA-K  1127
             S FLT+LL DQ+ GLQV  E  W DVP  PG+LI+NIGD+LQL+TNDKF S+ HRVLA K
Sbjct  240   SSFLTVLLPDQIEGLQVNREGHWYDVPHVPGALIINIGDLLQLITNDKFISLEHRVLANK  299

Query  1128  PVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
                 R+S+A FF    +     + YGPIKEL+SEE P  YR
Sbjct  300   ARQARVSIACFFTTGLRPN--PRLYGPIKELVSEENPPRYR  338



>ref|XP_007149301.1| hypothetical protein PHAVU_005G058800g [Phaseolus vulgaris]
 gb|ESW21295.1| hypothetical protein PHAVU_005G058800g [Phaseolus vulgaris]
Length=374

 Score =   337 bits (863),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 181/352 (51%), Positives = 251/352 (71%), Gaps = 7/352 (2%)
 Frame = +3

Query  204   MVDTSNNGNLQEDSIMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEK  383
             MV TS     + +S +   YDRRSE+ AF+ SKAGV+GL + G+  +P IF ++ S L +
Sbjct  1     MVATSTE---ELESGIVPSYDRRSELNAFDASKAGVQGLVENGVRNVPPIFHSRSSNLSE  57

Query  384   NSAANAATPQFVIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKM  557
             +    + + +F IP ID  G+  +   R ++V  ++ AC+NWGFFQV NHGIP +V+++M
Sbjct  58    DFTTESNS-KFTIPTIDLTGIHEDPTLRDDVVRKVRYACQNWGFFQVQNHGIPTHVLNEM  116

Query  558   LESVQHFHEQDFELKKPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEE  737
             ++++  FHEQD +++K +++RD+ KKV Y SNF L    + +WRD+L   +AP+PP+ EE
Sbjct  117   IKAICRFHEQDAKVRKTYYTRDLTKKVMYLSNFSLYQDPSTDWRDTLTFFLAPNPPKAEE  176

Query  738   LPNVCRDIMIKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEP  917
             LP VCRDI+ +Y+  VM L  TLFEL+SEALGLD  HLK M   EGL ++GHYYP CPEP
Sbjct  177   LPEVCRDIVPEYSTKVMELASTLFELVSEALGLDRLHLKEMQYEEGLLLMGHYYPACPEP  236

Query  918   DLTLGLSSHTDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKF  1097
             +LT+G + HTD  F+T+LLQDQ+GGLQ+LHE+ W+DVP   G+L+VNIGD+LQ+++NDKF
Sbjct  237   ELTMGTTKHTDGDFMTILLQDQMGGLQILHENQWIDVPAMDGALVVNIGDLLQVVSNDKF  296

Query  1098  KSVHHRVLAKPVGPRISVASFFRMHFQEGNE-AKTYGPIKELLSEEKPAIYR  1250
              SV HRVLA  +GPR S+ASFF +  Q     +K  GPIKELLSE  P +YR
Sbjct  297   ISVQHRVLANNLGPRTSIASFFGIGDQSPQGLSKVIGPIKELLSENNPPVYR  348



>gb|KFK27480.1| hypothetical protein AALP_AA8G389000 [Arabis alpina]
Length=364

 Score =   336 bits (862),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 187/335 (56%), Positives = 237/335 (71%), Gaps = 9/335 (3%)
 Frame = +3

Query  258   EYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDF  437
             E+D  +E +AF+++K GVKGL DA +TKIPRIF   H     ++    +     IP+IDF
Sbjct  8     EFDTYTERKAFDETKEGVKGLVDANITKIPRIF---HIPQGSSTDKKHSVSDLEIPIIDF  64

Query  438   E--GLGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPF  611
                 L    R  +V  I+ A E WGFFQVINHGIP NV++++ + V+ FHE D E+KK +
Sbjct  65    GYVHLDKASREAVVEKIRYAAEKWGFFQVINHGIPLNVLEEIKDGVRRFHEDDPEVKKLY  124

Query  612   HSRD-VKKKVTYNSNFDLLVAA-TANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
              SRD  KKK  YNSNFDL  ++ + NWRD++ C M PDPP PEELP  CRD + +Y++HV
Sbjct  125   FSRDSAKKKFVYNSNFDLYSSSKSVNWRDTITCYMTPDPPTPEELPVTCRDAIYEYSKHV  184

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgflt  965
             MSLG  LFELLSEALGL+ D LK M C + L +I HYYPPCP+PDLTLG+S H+D+ FLT
Sbjct  185   MSLGGLLFELLSEALGLESDILKSMDCLKTLLMISHYYPPCPQPDLTLGISKHSDNSFLT  244

Query  966   lllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRI  1145
             +LLQD +GGLQ+LH+D WVDV    G+LI+NIGD+LQL+TND+F SV HRVLA   GPRI
Sbjct  245   VLLQDNIGGLQILHQDSWVDVSPLHGALIINIGDILQLITNDRFVSVEHRVLANRQGPRI  304

Query  1146  SVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             SVASFF    +    +  YGP+KEL+SEE P  YR
Sbjct  305   SVASFFSSSIRPN--STIYGPMKELVSEENPPKYR  337



>gb|KFK31253.1| hypothetical protein AALP_AA6G088500 [Arabis alpina]
Length=363

 Score =   336 bits (862),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 183/334 (55%), Positives = 239/334 (72%), Gaps = 7/334 (2%)
 Frame = +3

Query  261   YDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFE  440
             YDR SE++AF+D K GVKGL D G+T+IPRIF + H  +  N     ++ + +IP ID +
Sbjct  6     YDRASELKAFDDMKVGVKGLVDTGITQIPRIFHHPHLNITLNPNPLLSSKKMMIPTIDLQ  65

Query  441   GL---GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPF  611
             G        R  ++  I++A EN+GFFQ INHGIP ++++KM + V+ FHEQD E++K F
Sbjct  66    GGLFDSTVTRESVIVKIREAVENFGFFQAINHGIPLDLLEKMKDGVRGFHEQDSEVRKKF  125

Query  612   HSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMS  791
             +SRD  K V YNSNFDL  + + NWRD+L C M PD P+ EELP +C +IM++Y++ VM 
Sbjct  126   YSRDNTKTVRYNSNFDLYSSPSTNWRDTLSCFMFPDLPKAEELPEICGEIMLEYSKGVMK  185

Query  792   LGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltll  971
             L   +FELLSEALGL+ +HLK M C++GLF++ HYYPPCPEPD T G S H+D  FLT+L
Sbjct  186   LAELIFELLSEALGLNPNHLKEMDCTKGLFMLSHYYPPCPEPDRTFGTSQHSDRSFLTIL  245

Query  972   lqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLA-KPVGPRIS  1148
             LQD +GGLQVLH+D WVDVP   G+L+VN+GD+LQL++NDKF SV HRVLA +   PRIS
Sbjct  246   LQDHIGGLQVLHDDYWVDVPPVSGALLVNLGDILQLISNDKFVSVEHRVLANRGEKPRIS  305

Query  1149  VASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             VASFF          + YGPI+ELLSEE P  YR
Sbjct  306   VASFF---VHPLPSLRVYGPIEELLSEENPPKYR  336



>ref|XP_003626795.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
 gb|AET01271.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
Length=364

 Score =   336 bits (862),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 180/329 (55%), Positives = 238/329 (72%), Gaps = 10/329 (3%)
 Frame = +3

Query  273   SEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDFEGLGG  452
             SE  AF+++KAGVKGL DAG+ KIP +F   H   +K   AN  +   VIPVID + +  
Sbjct  16    SERIAFDETKAGVKGLVDAGVKKIPTLF---HHQPDKYEEANNTS--HVIPVIDLKDIDN  70

Query  453   NR---RVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPFHSRD  623
                     IV+ IK+ACE WGFFQV+NHGIP +V++++ + V+ F+EQ  E KK  ++RD
Sbjct  71    QDPSIHQGIVDNIKEACETWGFFQVVNHGIPLSVLEELKDGVKRFYEQATEAKKSLYTRD  130

Query  624   VKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHVMSLGYT  803
             + +   YNSNFD+  +   NWRDS  C +APD P+PE+ P VCRD++++Y + VM+LG  
Sbjct  131   MNRSFVYNSNFDIYSSPALNWRDSFACYLAPDTPKPEDFPAVCRDVILEYGKQVMNLGTL  190

Query  804   LFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfltlllqdq  983
             LFEL+SEALGL+ +HLK MGC+EGL  + HYYPPCPEP+LT+G + H+D+ FLT+LLQD 
Sbjct  191   LFELMSEALGLNPNHLKDMGCAEGLIALCHYYPPCPEPELTVGTTKHSDNDFLTVLLQDH  250

Query  984   lgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRISVASFF  1163
             +GGLQVL+ED W+D+    G+LIVN+GD+LQL+TNDKFKSV HRVLA  VGPRISVA FF
Sbjct  251   IGGLQVLYEDKWIDITPVSGALIVNVGDLLQLITNDKFKSVVHRVLANQVGPRISVACFF  310

Query  1164  RMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
                 +    +K YGP+KELLSE+ P  YR
Sbjct  311   STALKAS--SKLYGPMKELLSEDNPPKYR  337



>gb|EYU42211.1| hypothetical protein MIMGU_mgv1a008992mg [Erythranthe guttata]
Length=356

 Score =   336 bits (861),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 183/335 (55%), Positives = 242/335 (72%), Gaps = 9/335 (3%)
 Frame = +3

Query  246   IMQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIP  425
             + + +Y+R  E+++F+++KAGVKGL D+G+ KIPRIF      + K  + NA    F IP
Sbjct  4     VRETKYNRAEELKSFDETKAGVKGLVDSGVEKIPRIFH-----VPKEYSTNANEANFDIP  58

Query  426   VIDFEGLGGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKK  605
             VID  G G +++ E V  I+ A E +GFFQV+NHGIP  V+++ML  ++ F+E D   KK
Sbjct  59    VIDL-GQGVDQK-ESVEKIRHASERYGFFQVVNHGIPVCVLEEMLCGIRRFNELDAGAKK  116

Query  606   PFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
              +++RDV +K  YNSNFDL  A  ANWRD+ +  MAP+PP+PEELP  CRDI I+Y+ HV
Sbjct  117   LYYTRDVTRKFVYNSNFDLYSAPAANWRDTFFSYMAPNPPKPEELPASCRDIQIEYSRHV  176

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgflt  965
             MSLG+ LF LLSEALGL+   L  MGC++GL  +GHYYP CP+P+LTLG S HTD GFLT
Sbjct  177   MSLGFRLFGLLSEALGLESSRLFEMGCTDGLTFLGHYYPACPQPELTLGASKHTDDGFLT  236

Query  966   lllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRI  1145
             +LLQDQ+GGLQV   ++W+D+P   G+L++NIGD+LQL++NDKFKSV HRVLA   GPR+
Sbjct  237   VLLQDQIGGLQVFLNNMWIDIPPVHGALVINIGDLLQLISNDKFKSVEHRVLANRKGPRM  296

Query  1146  SVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             SVA FF         +K YGPIKELLS++ P  YR
Sbjct  297   SVACFFSTSMMP--SSKIYGPIKELLSKDNPPKYR  329



>ref|XP_002866335.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42594.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=364

 Score =   336 bits (862),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 187/336 (56%), Positives = 239/336 (71%), Gaps = 10/336 (3%)
 Frame = +3

Query  258   EYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDF  437
             E+DR +E +AF+++K GVKGL +A +T+IPRIF   H   +       +     IP IDF
Sbjct  7     EFDRYTERKAFDETKEGVKGLINAKITEIPRIF---HVPQDTLPDKKPSVSDLEIPTIDF  63

Query  438   EGL--GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQ-DFELKKP  608
               +      R E+V  +K A ENWGFFQVINHG+P NV++++ + V+ FHE+ D E+KK 
Sbjct  64    ASVYVDEESREEVVEKVKYAVENWGFFQVINHGVPLNVLEEIKDGVRRFHEEEDPEVKKS  123

Query  609   FHSRD-VKKKVTYNSNFDLLVAA-TANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEH  782
             ++S D  K K  Y+SNFDL  ++ +  WRDS+ C MAPDPP PEELP  CRD MI+Y++H
Sbjct  124   YYSLDFTKNKFAYSSNFDLYSSSPSLTWRDSISCYMAPDPPTPEELPETCRDAMIEYSKH  183

Query  783   VMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfl  962
             V+SLG  LFELLSEALGL  + LK M C + L +I HYYPPCP+PDLTLG+S H+D+ FL
Sbjct  184   VLSLGDFLFELLSEALGLKSEILKSMDCLKSLLMICHYYPPCPQPDLTLGISKHSDNSFL  243

Query  963   tlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPR  1142
             T+LLQD +GGLQ+LH+D WVDV   PG+L+VNIGD LQL+TNDKF SV HRVLA   GPR
Sbjct  244   TVLLQDNIGGLQILHQDSWVDVSPLPGALVVNIGDFLQLITNDKFISVEHRVLANTRGPR  303

Query  1143  ISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             ISVASFF    +E   +  YGP+KEL+SEE P  YR
Sbjct  304   ISVASFFSSSIREN--STVYGPMKELVSEENPPKYR  337



>ref|XP_010274803.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X1 [Nelumbo nucifera]
Length=380

 Score =   337 bits (863),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 185/336 (55%), Positives = 243/336 (72%), Gaps = 6/336 (2%)
 Frame = +3

Query  249   MQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPV  428
             + ++YDR  E++ F++SKAGVKGL D+GL K+PRIF+      ++ S  +   P   IPV
Sbjct  15    VTSDYDRTKELKEFDESKAGVKGLVDSGLVKVPRIFIRPSDKTDQKSNTSEIHPT-TIPV  73

Query  429   IDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELK  602
             ID   +  +  R  EIV  I+ A E WGFFQV+NHGIP +++D+MLE V+ F+EQD E+K
Sbjct  74    IDLGSIHEDAIRHEEIVGQIRHASETWGFFQVVNHGIPASLLDEMLEGVRRFYEQDNEVK  133

Query  603   KPFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEH  782
             K F++RD+ ++V YNSNFDL  +  ANWRD+ YC MAP+PP PEELP  CRDIM++Y+  
Sbjct  134   KRFYTRDISRRVVYNSNFDLYQSPAANWRDTFYCKMAPNPPNPEELPEACRDIMMEYSRQ  193

Query  783   VMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgfl  962
             V  L  TL +L+SEAL L+   L  MGC+E   I+ HYYP CPEP+LT+G S H D+  +
Sbjct  194   VARLAATLLQLVSEALTLEPKRLIDMGCAESEAILCHYYPACPEPELTMGTSKHADNDVV  253

Query  963   tlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPR  1142
             T+LLQD +GGLQVLH++ WVDVP  PG+L+VN+GD+LQL++ND+FKSV HRVLAK +GPR
Sbjct  254   TILLQDHIGGLQVLHKNHWVDVPPMPGALVVNVGDLLQLISNDRFKSVDHRVLAKRIGPR  313

Query  1143  ISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             +SVASFF       +    YGPIKELLSEE P IYR
Sbjct  314   VSVASFFP---SREDSTHIYGPIKELLSEENPPIYR  346



>ref|XP_010671066.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Beta vulgaris subsp. vulgaris]
Length=371

 Score =   336 bits (862),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 170/341 (50%), Positives = 238/341 (70%), Gaps = 16/341 (5%)
 Frame = +3

Query  258   EYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATP----QFVIP  425
             EYDR  E++AF+++K GVKGL   GLTK+P IF+N     E N      TP    QF IP
Sbjct  7     EYDRNIEIKAFDETKLGVKGLAATGLTKVPSIFINHQ---EHNRNNKQHTPDSKSQFTIP  63

Query  426   VIDFEGLG--GNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFEL  599
              ID  G+    ++  ++V+ I DAC+ WGFFQVINHGIP  V+D +++ V+ FHE+D E+
Sbjct  64    TIDLAGIDIDSDKFKKVVDEIWDACKEWGFFQVINHGIPQEVLDGVMDGVRRFHEEDDEV  123

Query  600   KKPFHSRDV---KKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIK  770
             KK +++RD+     +  Y SN+ L      NWRD+++  MAP PP+PEELP  CRD++ +
Sbjct  124   KKQYYTRDITISSMRFAYFSNYYLFKGPVTNWRDTMWASMAPYPPQPEELPIACRDVLFE  183

Query  771   YAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTD  950
             YA+HV  +G+TL E++S  LGL+  HLK + C++ L ++G+YYPPCPEPDL +G S H D
Sbjct  184   YAKHVTKVGHTLLEMISMGLGLNPTHLKDIDCAQELMLLGNYYPPCPEPDLAIGFSKHAD  243

Query  951   Sgfltlllqdqlgglqvl-HEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAK  1127
             +  LT+L+QD+  G   + H++ WVDVP  PG+L++N GD+LQL+TNDK KSV+HRV+A+
Sbjct  244   NDVLTILIQDKQIGGLQVWHQNQWVDVPHVPGALVINTGDVLQLITNDKMKSVYHRVVAQ  303

Query  1128  PVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
              VGPRIS+ +FF+ H    +  + +GPIKELLSEEKP IYR
Sbjct  304   GVGPRISLGAFFKPH---THNPRLFGPIKELLSEEKPPIYR  341



>ref|XP_002866336.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42595.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=365

 Score =   336 bits (861),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 185/335 (55%), Positives = 238/335 (71%), Gaps = 7/335 (2%)
 Frame = +3

Query  258   EYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAATPQFVIPVIDF  437
             E+D   E +AF+++K GVKGL DA +T++PRIF +   IL  +   +       IP+IDF
Sbjct  7     EFDPYIERKAFDETKQGVKGLVDAKITQVPRIFHHPQDIL-TDKKPSVCVSDLEIPIIDF  65

Query  438   EGL--GGNRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKKPF  611
               +      R  +V  +K A ENWGFFQVINHGIP NV++++ ++V+ FHE+D E+KK +
Sbjct  66    ASVHVDTASREAVVEKVKYAVENWGFFQVINHGIPLNVLEEIKDAVRRFHEEDPEVKKLY  125

Query  612   HSRD-VKKKVTYNSNFDLLVAA-TANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
              SRD   KK  YNSNFDL  ++ + NWRDS  C +APDPP PEE+P  CRD M +Y++HV
Sbjct  126   FSRDDANKKFVYNSNFDLYGSSPSVNWRDSFSCYIAPDPPAPEEIPETCRDAMFEYSKHV  185

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHTDSgflt  965
             +SLG  LFELLSEALGL  + LK M C + L +I HYYPPCP+PDLTLG++ H+D+ FLT
Sbjct  186   LSLGGLLFELLSEALGLKSETLKSMDCLKTLLMICHYYPPCPQPDLTLGITKHSDNSFLT  245

Query  966   lllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPRI  1145
             LLLQD +GGLQ+LH+D WVDV    G+L+VNIGD LQL+TNDKF SV HRVLA   GPRI
Sbjct  246   LLLQDNIGGLQILHQDSWVDVSHLHGALVVNIGDFLQLITNDKFVSVEHRVLANRQGPRI  305

Query  1146  SVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             SVASFF    +    ++ YGP+KEL+SEE P  YR
Sbjct  306   SVASFFSSSMRPN--SRVYGPMKELVSEENPPKYR  338



>ref|XP_008367169.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Malus domestica]
Length=375

 Score =   336 bits (861),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 173/336 (51%), Positives = 226/336 (67%), Gaps = 8/336 (2%)
 Frame = +3

Query  261   YDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFLNKHSILEKNSAANAAT----PQFVIPV  428
             YDR+SEV+AF++++ GVKGL DAG+ ++PRIF     + ++ S  N +T     QF IP+
Sbjct  13    YDRKSEVKAFDETREGVKGLVDAGVAEVPRIFHQPPQLDDQYSINNTSTDSEATQFSIPL  72

Query  429   IDFEGLGG-NRRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQDFELKK  605
             ID E  G   +R EIV  + +A E WGFFQ+ NHGIP  V++ + + V+ F+EQD  +KK
Sbjct  73    IDLEDHGNPTKRNEIVAKVGEASETWGFFQIXNHGIPVXVLEXIKDGVRGFYEQDTRVKK  132

Query  606   PFHSRDVKKKVTYNSNFDLLVAATANWRDSLYCIMAPDPPEPEELPNVCRDIMIKYAEHV  785
              F++RD  K + YNSNFDL  +   NWRD+  C MAP PP+PE+LP VCRD++I+Y++ V
Sbjct  133   EFYTRDHSKPLFYNSNFDLYSSXATNWRDTFKCYMAPXPPKPEDLPEVCRDVLIEYSKRV  192

Query  786   MSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSHT-DSgfl  962
             M LG  LFELLSEALGL   HL  + CS+GL ++GHYYP CP+P+LTLG S H  DS   
Sbjct  193   MELGKLLFELLSEALGLKPSHLNXIDCSKGLQVLGHYYPACPQPELTLGTSKHADDSFLT  252

Query  963   tlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLAKPVGPR  1142
              LL     G   V  +  W+DVP  PG+L VNIGD+LQL++ND+FKSV HRV A   GPR
Sbjct  253   VLLQDHIGGLQXVXRQXKWIDVPPVPGALXVNIGDLLQLISNDRFKSVEHRVXANREGPR  312

Query  1143  ISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
             IS+ASFF            YGPIKEL+SE+ P  YR
Sbjct  313   ISIASFFSTGLLPF--TNLYGPIKELVSEDNPPKYR  346



>ref|XP_006354513.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Solanum tuberosum]
Length=373

 Score =   336 bits (861),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 185/342 (54%), Positives = 252/342 (74%), Gaps = 16/342 (5%)
 Frame = +3

Query  249   MQAEYDRRSEVEAFEDSKAGVKGLFDAGLTKIPRIFL----NKHSILEKNSAANAATPQF  416
             ++  YD+ SE++AF+D+KAGVKGL DAG+TKIP+IF+    N+  + + N        QF
Sbjct  13    VEKSYDKMSELKAFDDTKAGVKGLVDAGITKIPQIFILPPKNRPELSDTNET------QF  66

Query  417   VIPVIDFEGLGGN--RRVEIVNMIKDACENWGFFQVINHGIPDNVMDKMLESVQHFHEQD  590
             + PVID EG+  +  +  EI + ++DA E WGFFQV+NHGIP +V+++ML+  + F EQD
Sbjct  67    IFPVIDLEGIDEDSIKHKEIADKVRDASETWGFFQVVNHGIPTSVLEEMLQGTRQFFEQD  126

Query  591   FELKKPFHSRDVKKKVTYNSNFDLLVAA--TANWRDSLYCIMAPDPPEPEELPNVCRDIM  764
              E+KK  +SRD  K+V + SNFDL   +   ANWRD+L+C+MAPDPP P+ELP  C +I+
Sbjct  127   VEIKKQHYSRDSTKRVIHTSNFDLYSPSVPAANWRDTLFCLMAPDPPSPQELPTACGEIL  186

Query  765   IKYAEHVMSLGYTLFELLSEALGLDLDHLKGMGCSEGLFIIGHYYPPCPEPDLTLGLSSH  944
             ++Y++ VM LG++L ELLSE LGLD  HLK M C+EGL I+GHYYP CP+P+L +G + H
Sbjct  187   MEYSKDVMKLGFSLLELLSEGLGLDRCHLKDMDCAEGLGILGHYYPACPQPELAIGTNKH  246

Query  945   TDSgfltlllqdqlgglqvlHEDVWVDVPFFPGSLIVNIGDMLQLLTNDKFKSVHHRVLA  1124
             +D+ F+T+L+QD +GGLQVLH++ WVDVP  PG+L+VNIGD+LQL++NDK+ SV HRVLA
Sbjct  247   SDNDFITVLIQDHIGGLQVLHQNQWVDVPPTPGALVVNIGDLLQLISNDKYISVEHRVLA  306

Query  1125  KPVGPRISVASFFRMHFQEGNEAKTYGPIKELLSEEKPAIYR  1250
               VGPRISVA FF  +      +K YGPI ELLSE+ P  YR
Sbjct  307   NKVGPRISVACFF--YTGSMPSSKLYGPITELLSEDNPPKYR  346



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3165861689260