BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25652_g2_i1 len=1034 path=[4574:0-24 6334:25-204 4779:205-278
4853:279-292 4867:293-378 3031:379-385 3038:386-400 10176:401-410
3063:411-500 7612:501-527 3179:528-660 3312:661-751 3403:752-812
7372:813-845 8330:846-886 3538:887-895 3547:896-927 10342:928-937
3589:938-961 3613:962-974 3626:975-1001 10375:1002-1015
9412:1016-1033]

Length=1034
                                                                      Score     E

ref|XP_006345283.1|  PREDICTED: uncharacterized protein LOC102590501    171   8e-80   
ref|XP_009765695.1|  PREDICTED: putative late blight resistance p...    177   1e-74   
ref|XP_009765696.1|  PREDICTED: putative late blight resistance p...    177   1e-74   
ref|XP_004252073.2|  PREDICTED: putative late blight resistance p...    160   1e-73   
ref|XP_009759015.1|  PREDICTED: putative late blight resistance p...    160   4e-73   
ref|XP_009759016.1|  PREDICTED: putative late blight resistance p...    160   4e-73   
ref|XP_009631206.1|  PREDICTED: putative late blight resistance p...    167   3e-72   
ref|XP_009626592.1|  PREDICTED: putative late blight resistance p...    155   5e-72   
ref|XP_009626593.1|  PREDICTED: putative late blight resistance p...    155   5e-72   
ref|XP_009618655.1|  PREDICTED: putative late blight resistance p...    167   5e-72   
ref|XP_009803728.1|  PREDICTED: putative late blight resistance p...    169   1e-71   
ref|XP_006355462.1|  PREDICTED: putative late blight resistance p...    153   1e-71   
emb|CAB56299.1|  NBS-LRR protein                                        162   6e-71   Solanum acaule
gb|AEW48190.1|  disease resistance protein RX4                          162   7e-71   
gb|ABY61745.1|  resistance protein PSH-RGH6                             164   8e-71   Solanum tuberosum [potatoes]
ref|XP_010324491.1|  PREDICTED: putative late blight resistance p...    169   4e-70   
ref|XP_009602301.1|  PREDICTED: putative late blight resistance p...    151   4e-70   
gb|AEW48211.1|  disease resistance protein RGH1                         158   6e-70   
ref|XP_009602415.1|  PREDICTED: putative late blight resistance p...    177   2e-69   
ref|XP_009602420.1|  PREDICTED: putative late blight resistance p...    177   3e-69   
ref|XP_009602419.1|  PREDICTED: putative late blight resistance p...    177   3e-69   
gb|AEW48197.1|  disease resistance protein RGH3                         161   3e-69   
gb|AEW48201.1|  disease resistance protein RGH9                         158   3e-69   
gb|AEW48192.1|  disease resistance protein RGH3                         157   9e-69   
ref|XP_009606267.1|  PREDICTED: putative late blight resistance p...    171   1e-68   
ref|XP_009606292.1|  PREDICTED: putative late blight resistance p...    177   2e-68   
ref|XP_009606288.1|  PREDICTED: putative late blight resistance p...    177   2e-68   
ref|XP_009606270.1|  PREDICTED: putative late blight resistance p...    176   2e-68   
ref|XP_009606276.1|  PREDICTED: putative late blight resistance p...    176   2e-68   
ref|XP_009606290.1|  PREDICTED: putative late blight resistance p...    176   2e-68   
ref|XP_009606273.1|  PREDICTED: putative late blight resistance p...    176   2e-68   
ref|XP_009606280.1|  PREDICTED: putative late blight resistance p...    176   2e-68   
ref|XP_009606289.1|  PREDICTED: putative late blight resistance p...    177   2e-68   
gb|AFB17976.1|  Rx-like protein                                         159   2e-68   
ref|XP_009606271.1|  PREDICTED: putative late blight resistance p...    176   2e-68   
ref|XP_009606272.1|  PREDICTED: putative late blight resistance p...    176   3e-68   
ref|XP_009606278.1|  PREDICTED: putative late blight resistance p...    176   3e-68   
ref|XP_009606291.1|  PREDICTED: putative late blight resistance p...    176   3e-68   
ref|XP_009606281.1|  PREDICTED: putative late blight resistance p...    176   3e-68   
ref|XP_009606279.1|  PREDICTED: putative late blight resistance p...    176   3e-68   
ref|XP_009606277.1|  PREDICTED: putative late blight resistance p...    176   3e-68   
ref|XP_009606282.1|  PREDICTED: putative late blight resistance p...    176   3e-68   
gb|AAF04603.1|AF195939_1  disease resistance protein Gpa2               158   3e-68   Solanum tuberosum [potatoes]
ref|XP_009757156.1|  PREDICTED: putative late blight resistance p...    176   7e-68   
gb|AAF09256.1|AF202179_1  disease resistance protein BS2                170   9e-68   Capsicum chacoense
gb|AEW48206.1|  disease resistance protein RGH4                         155   2e-67   
gb|AAF76163.1|AF266747_1  RGC1                                          159   2e-67   Solanum tuberosum [potatoes]
gb|AEW48194.1|  disease resistance protein RGH5                         161   3e-67   
gb|AEW48191.1|  disease resistance protein RGH2                         161   3e-67   
ref|XP_009786668.1|  PREDICTED: putative late blight resistance p...    169   3e-67   
ref|XP_011088084.1|  PREDICTED: putative late blight resistance p...    167   3e-67   
ref|XP_006367916.1|  PREDICTED: putative late blight resistance p...    163   4e-67   
gb|AET22504.1|  hypothetical protein                                    152   6e-67   
gb|AEW48205.1|  disease resistance protein RGH2                         161   1e-66   
gb|AEW48214.1|  disease resistance protein RGH4                         158   2e-66   
gb|ABY61746.1|  resistance protein PSH-RGH7                             159   2e-66   Solanum tuberosum [potatoes]
ref|XP_009779880.1|  PREDICTED: putative late blight resistance p...    159   2e-66   
gb|AEW48198.1|  disease resistance protein RGH4                         158   2e-66   
ref|XP_011075662.1|  PREDICTED: putative late blight resistance p...    163   3e-66   
ref|XP_006350053.1|  PREDICTED: putative late blight resistance p...    158   3e-66   
gb|AEW48200.1|  disease resistance protein RGH7                         150   3e-66   
emb|CAB50786.1|  Rx protein                                             159   4e-66   Solanum tuberosum [potatoes]
ref|XP_009766920.1|  PREDICTED: putative late blight resistance p...    169   4e-66   
ref|XP_004251396.2|  PREDICTED: putative late blight resistance p...    152   4e-66   
gb|AEW48207.1|  disease resistance protein RGH5                         157   5e-66   
gb|AEW48216.1|  disease resistance protein RX3                          160   7e-66   
gb|AEW48210.1|  disease resistance protein RGH5                         158   9e-66   
gb|AEW48218.1|  disease resistance protein RX6                          159   9e-66   
gb|AFB17983.1|  Rx-like protein                                         160   1e-65   
ref|XP_009780928.1|  PREDICTED: putative late blight resistance p...    158   1e-65   
ref|XP_011091064.1|  PREDICTED: putative late blight resistance p...    167   1e-65   
gb|AEW48204.1|  disease resistance protein RGH1                         158   2e-65   
gb|EYU23522.1|  hypothetical protein MIMGU_mgv1a018893mg                150   3e-65   
ref|XP_011091063.1|  PREDICTED: putative late blight resistance p...    163   3e-65   
ref|XP_009595164.1|  PREDICTED: putative late blight resistance p...    162   4e-65   
gb|AEW48209.1|  disease resistance protein RGH5                         154   5e-65   
ref|XP_011072173.1|  PREDICTED: putative late blight resistance p...    152   5e-65   
gb|EYU24428.1|  hypothetical protein MIMGU_mgv1a001134mg                145   1e-64   
ref|XP_011072192.1|  PREDICTED: putative late blight resistance p...    142   1e-64   
ref|XP_011073039.1|  PREDICTED: putative late blight resistance p...    151   1e-64   
ref|XP_009766921.1|  PREDICTED: putative late blight resistance p...    164   1e-64   
gb|AEW48208.1|  disease resistance protein RGH4                         158   1e-64   
emb|CDP00691.1|  unnamed protein product                                151   4e-64   
ref|XP_006367920.1|  PREDICTED: putative late blight resistance p...    163   4e-64   
ref|XP_011072136.1|  PREDICTED: putative late blight resistance p...    156   6e-64   
ref|XP_006348816.1|  PREDICTED: putative late blight resistance p...    161   1e-63   
ref|XP_009762701.1|  PREDICTED: putative late blight resistance p...    151   2e-63   
ref|XP_010320901.1|  PREDICTED: putative late blight resistance p...    155   1e-62   
ref|XP_010320900.1|  PREDICTED: putative late blight resistance p...    155   1e-62   
ref|XP_006361239.1|  PREDICTED: putative late blight resistance p...    145   1e-62   
ref|XP_009612031.1|  PREDICTED: putative late blight resistance p...    147   2e-62   
ref|XP_006361240.1|  PREDICTED: putative late blight resistance p...    145   2e-62   
ref|XP_006348578.1|  PREDICTED: putative late blight resistance p...    150   2e-62   
ref|XP_009617727.1|  PREDICTED: putative late blight resistance p...    154   2e-62   
gb|EYU23534.1|  hypothetical protein MIMGU_mgv1a023257mg                150   4e-62   
ref|XP_011072191.1|  PREDICTED: putative late blight resistance p...    133   1e-61   
ref|XP_010244072.1|  PREDICTED: probable disease resistance RPP8-...    142   1e-61   
ref|XP_011072133.1|  PREDICTED: putative late blight resistance p...    150   2e-61   
ref|XP_010319247.1|  PREDICTED: putative late blight resistance p...    147   3e-61   
ref|XP_006346790.1|  PREDICTED: putative late blight resistance p...    148   3e-61   
ref|XP_004246080.2|  PREDICTED: putative late blight resistance p...    154   2e-60   
gb|AGX27500.1|  NBS-LRR class resistance protein Fy2-Ry2                140   2e-60   
ref|XP_004231569.2|  PREDICTED: putative late blight resistance p...    158   2e-60   
ref|XP_011070823.1|  PREDICTED: putative late blight resistance p...    139   2e-60   
gb|AAV88068.1|  NBS-LRR protein                                         134   7e-60   Ipomoea batatas [batate]
gb|EYU24163.1|  hypothetical protein MIMGU_mgv1a019941mg                151   9e-60   
gb|EYU31457.1|  hypothetical protein MIMGU_mgv1a017859mg                146   1e-59   
gb|EYU24168.1|  hypothetical protein MIMGU_mgv1a022184mg                133   2e-59   
emb|CDP10671.1|  unnamed protein product                                137   2e-59   
ref|XP_009596957.1|  PREDICTED: putative late blight resistance p...    144   3e-59   
gb|EYU31460.1|  hypothetical protein MIMGU_mgv1a020657mg                149   4e-59   
gb|EYU24355.1|  hypothetical protein MIMGU_mgv1a024375mg                146   4e-59   
gb|EYU31287.1|  hypothetical protein MIMGU_mgv1a022746mg                140   1e-58   
ref|XP_006364074.1|  PREDICTED: putative late blight resistance p...    164   1e-58   
ref|XP_010271768.1|  PREDICTED: disease resistance protein RPM1-l...    145   1e-58   
gb|EYU26873.1|  hypothetical protein MIMGU_mgv1a025130mg                139   2e-58   
emb|CDP11186.1|  unnamed protein product                                136   3e-58   
ref|XP_006363500.1|  PREDICTED: putative late blight resistance p...    134   3e-58   
gb|EYU31572.1|  hypothetical protein MIMGU_mgv1a024734mg                145   3e-58   
emb|CDP18682.1|  unnamed protein product                                130   4e-58   
gb|EYU29956.1|  hypothetical protein MIMGU_mgv1a001088mg                132   4e-58   
ref|XP_004237148.1|  PREDICTED: putative late blight resistance p...    140   5e-58   
gb|EYU24181.1|  hypothetical protein MIMGU_mgv1a025424mg                127   6e-58   
ref|XP_004238948.1|  PREDICTED: putative late blight resistance p...    134   6e-58   
emb|CAN74463.1|  hypothetical protein VITISV_032893                     140   6e-58   Vitis vinifera
emb|CDP04885.1|  unnamed protein product                                144   6e-58   
gb|KDP33396.1|  hypothetical protein JCGZ_12852                         134   8e-58   
ref|XP_010319246.1|  PREDICTED: putative late blight resistance p...    138   8e-58   
emb|CDP15598.1|  unnamed protein product                                135   8e-58   
ref|XP_010271767.1|  PREDICTED: disease resistance protein RPM1-l...    146   1e-57   
ref|XP_011072005.1|  PREDICTED: putative late blight resistance p...    127   3e-57   
emb|CDP10265.1|  unnamed protein product                                134   3e-57   
gb|EPS70521.1|  hypothetical protein M569_04260                         135   3e-57   
ref|XP_003631469.1|  PREDICTED: disease resistance protein RPM1-like    136   3e-57   
emb|CDP11163.1|  unnamed protein product                                136   4e-57   
ref|XP_009777378.1|  PREDICTED: late blight resistance protein R1...    140   4e-57   
ref|XP_009777374.1|  PREDICTED: putative late blight resistance p...    140   5e-57   
ref|XP_010271935.1|  PREDICTED: disease resistance protein RPM1-like    135   5e-57   
ref|XP_009777376.1|  PREDICTED: putative late blight resistance p...    140   5e-57   
ref|XP_006362574.1|  PREDICTED: putative late blight resistance p...    134   5e-57   
ref|XP_009763714.1|  PREDICTED: putative late blight resistance p...    152   6e-57   
emb|CDP12774.1|  unnamed protein product                                129   8e-57   
ref|XP_002273976.1|  PREDICTED: disease resistance protein RPP13        136   8e-57   Vitis vinifera
ref|XP_009802397.1|  PREDICTED: putative late blight resistance p...    133   8e-57   
ref|XP_010271762.1|  PREDICTED: disease resistance protein RPM1-l...    131   1e-56   
ref|XP_010271761.1|  PREDICTED: disease resistance protein RPM1-l...    131   1e-56   
emb|CDP15579.1|  unnamed protein product                                141   1e-56   
ref|XP_009769019.1|  PREDICTED: putative late blight resistance p...    135   2e-56   
ref|XP_009587570.1|  PREDICTED: putative late blight resistance p...    144   3e-56   
ref|XP_009587569.1|  PREDICTED: putative late blight resistance p...    144   3e-56   
ref|XP_010265610.1|  PREDICTED: disease resistance protein RPP8-like    132   3e-56   
gb|EYU21175.1|  hypothetical protein MIMGU_mgv1a021134mg                125   4e-56   
ref|XP_009618298.1|  PREDICTED: disease resistance protein RPP13-...    134   5e-56   
ref|XP_009788847.1|  PREDICTED: putative late blight resistance p...    144   5e-56   
ref|XP_009373504.1|  PREDICTED: disease resistance protein RPM1-l...    134   5e-56   
emb|CDP04724.1|  unnamed protein product                                137   7e-56   
ref|XP_006487403.1|  PREDICTED: disease resistance protein RPP13-...    139   1e-55   
ref|XP_009775077.1|  PREDICTED: putative late blight resistance p...    153   1e-55   
ref|XP_011072177.1|  PREDICTED: disease resistance RPP8-like prot...    122   1e-55   
emb|CDP10261.1|  unnamed protein product                                133   1e-55   
gb|EYU24151.1|  hypothetical protein MIMGU_mgv1a019744mg                123   1e-55   
ref|XP_010661781.1|  PREDICTED: putative disease resistance prote...    137   1e-55   
ref|XP_006355881.1|  PREDICTED: putative late blight resistance p...    139   2e-55   
emb|CDP20463.1|  unnamed protein product                                130   2e-55   
ref|XP_010319324.1|  PREDICTED: disease resistance protein RPP13-...    147   2e-55   
ref|XP_006423591.1|  hypothetical protein CICLE_v10027800mg             137   2e-55   
emb|CDP15268.1|  unnamed protein product                                144   2e-55   
ref|XP_010661778.1|  PREDICTED: putative disease resistance prote...    137   2e-55   
emb|CDP17703.1|  unnamed protein product                                129   2e-55   
ref|XP_006360836.1|  PREDICTED: disease resistance protein RPP13-...    147   3e-55   
gb|EYU28611.1|  hypothetical protein MIMGU_mgv1a025283mg                135   3e-55   
emb|CDP08423.1|  unnamed protein product                                124   3e-55   
gb|EYU24353.1|  hypothetical protein MIMGU_mgv1a022376mg                144   3e-55   
ref|XP_009588716.1|  PREDICTED: putative late blight resistance p...    137   3e-55   
emb|CDP18675.1|  unnamed protein product                                127   3e-55   
ref|XP_009776048.1|  PREDICTED: putative late blight resistance p...    131   3e-55   
emb|CDP18959.1|  unnamed protein product                                129   3e-55   
emb|CAN81725.1|  hypothetical protein VITISV_034604                     130   4e-55   Vitis vinifera
ref|XP_008373506.1|  PREDICTED: disease resistance protein RPM1-like    132   4e-55   
ref|XP_006387370.1|  hypothetical protein POPTR_1142s00200g             135   4e-55   
ref|XP_007210391.1|  hypothetical protein PRUPE_ppa000953mg             130   4e-55   
ref|XP_010661463.1|  PREDICTED: probable disease resistance RPP8-...    132   4e-55   
ref|XP_008238139.1|  PREDICTED: disease resistance protein RPM1-like    130   5e-55   
ref|XP_009783244.1|  PREDICTED: late blight resistance protein R1...    138   6e-55   
ref|XP_009783246.1|  PREDICTED: late blight resistance protein R1...    138   6e-55   
ref|XP_009777373.1|  PREDICTED: putative late blight resistance p...    130   6e-55   
ref|XP_009624787.1|  PREDICTED: putative late blight resistance p...    129   6e-55   
ref|XP_009588710.1|  PREDICTED: putative late blight resistance p...    131   7e-55   
ref|XP_009596953.1|  PREDICTED: putative late blight resistance p...    142   7e-55   
ref|XP_009777372.1|  PREDICTED: putative late blight resistance p...    130   7e-55   
emb|CDP20519.1|  unnamed protein product                                122   7e-55   
ref|XP_009588708.1|  PREDICTED: putative late blight resistance p...    131   7e-55   
ref|XP_009777371.1|  PREDICTED: putative late blight resistance p...    130   7e-55   
ref|XP_009588709.1|  PREDICTED: putative late blight resistance p...    131   7e-55   
emb|CDP21692.1|  unnamed protein product                                121   7e-55   
emb|CDP18680.1|  unnamed protein product                                124   8e-55   
emb|CDP19488.1|  unnamed protein product                                125   1e-54   
gb|ABO92985.1|  putative disease resistance protein                     142   1e-54   Solanum tuberosum [potatoes]
emb|CDP15593.1|  unnamed protein product                                131   1e-54   
sp|Q60CZ8.1|R1A10_SOLDE  RecName: Full=Putative late blight resis...    142   1e-54   Solanum demissum
gb|ABO93000.1|  putative disease resistance protein                     142   2e-54   Solanum tuberosum [potatoes]
emb|CDP05499.1|  unnamed protein product                                132   2e-54   
ref|XP_002269455.2|  PREDICTED: probable disease resistance prote...    133   2e-54   Vitis vinifera
ref|XP_006368520.1|  hypothetical protein POPTR_0001s03710g             137   2e-54   
ref|XP_009776290.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...    154   2e-54   
ref|XP_006359360.1|  PREDICTED: disease resistance protein RPP13-...    144   2e-54   
ref|XP_009612837.1|  PREDICTED: putative late blight resistance p...    144   2e-54   
ref|XP_009614428.1|  PREDICTED: putative late blight resistance p...    133   2e-54   
ref|XP_004512078.1|  PREDICTED: disease resistance RPP8-like prot...    143   2e-54   
ref|NP_001289831.1|  putative late blight resistance protein homo...    145   3e-54   
ref|XP_004248007.2|  PREDICTED: putative late blight resistance p...    145   3e-54   
gb|AHG28977.1|  NBS-LRR protein                                         142   3e-54   
ref|XP_006347944.1|  PREDICTED: putative late blight resistance p...    127   3e-54   
ref|XP_009613225.1|  PREDICTED: late blight resistance protein R1...    139   3e-54   
ref|XP_009598609.1|  PREDICTED: putative late blight resistance p...    144   3e-54   
emb|CDP20153.1|  unnamed protein product                                137   3e-54   
gb|AAF76312.1|AF220603_4  Prf                                           139   4e-54   Solanum lycopersicum
gb|ADL59395.1|  EDNR2GH5 protein                                        153   4e-54   
gb|KEH21734.1|  disease resistance protein (CC-NBS-LRR class) fam...    129   4e-54   
ref|XP_008348395.1|  PREDICTED: LOW QUALITY PROTEIN: disease resi...    135   4e-54   
gb|ADL59397.1|  EDNR2GH7 protein                                        153   4e-54   
ref|XP_009592156.1|  PREDICTED: late blight resistance protein R1...    144   5e-54   
ref|XP_004239116.1|  PREDICTED: putative late blight resistance p...    139   5e-54   
ref|XP_007032835.1|  CC-NBS-LRR class disease resistance protein,...    133   5e-54   
gb|AES95039.2|  NB-ARC domain disease resistance protein                142   5e-54   
gb|AFN86170.1|  reistance protein F variant 1.1                         144   5e-54   
ref|XP_003612081.1|  Disease resistance RPP8-like protein               142   5e-54   
ref|XP_010319291.1|  PREDICTED: disease resistance protein RPP13-...    148   5e-54   
gb|ACU65454.1|  R2-like protein                                         145   5e-54   Solanum sp. AM-3778-16
gb|ADL59392.1|  R2 late blight resistance protein                       146   6e-54   
ref|XP_009791056.1|  PREDICTED: putative late blight resistance p...    134   6e-54   
ref|NP_001234202.1|  NRC1                                               127   6e-54   
ref|XP_010320926.1|  PREDICTED: putative late blight resistance p...    139   6e-54   
ref|XP_009791054.1|  PREDICTED: putative late blight resistance p...    135   6e-54   
gb|ADL59401.1|  R2 late blight resistance protein                       145   6e-54   
emb|CDP19489.1|  unnamed protein product                                120   7e-54   
gb|ACU65455.1|  Rpi protein                                             145   7e-54   Solanum sp. ABPT
ref|XP_006367616.1|  PREDICTED: putative late blight resistance p...    139   8e-54   
ref|XP_003612687.1|  Disease resistance protein RPM1                    129   8e-54   
gb|AFN86171.1|  reistance protein F variant 1.2                         143   8e-54   
emb|CDP08024.1|  unnamed protein product                                131   9e-54   
emb|CDP08428.1|  unnamed protein product                                124   9e-54   
ref|XP_004301649.1|  PREDICTED: disease resistance protein RPM1-like    131   1e-53   
ref|XP_004248798.1|  PREDICTED: putative late blight resistance p...    125   1e-53   
ref|XP_009588714.1|  PREDICTED: putative late blight resistance p...    134   1e-53   
emb|CDP15591.1|  unnamed protein product                                129   1e-53   
gb|AAV88067.1|  NBS-LRR protein                                         122   1e-53   Ipomoea batatas [batate]
emb|CDP04754.1|  unnamed protein product                                127   1e-53   
ref|XP_009787864.1|  PREDICTED: LOW QUALITY PROTEIN: late blight ...    133   1e-53   
gb|AAF76308.1|  Prf                                                     139   1e-53   Solanum pimpinellifolium [currant tomato]
ref|XP_003612691.1|  Disease resistance protein RPP8                    125   1e-53   
gb|AAC49408.1|  PRF                                                     139   1e-53   Solanum lycopersicum
ref|XP_009804877.1|  PREDICTED: putative late blight resistance p...    133   1e-53   
ref|XP_010319316.1|  PREDICTED: putative disease resistance RPP13...    145   1e-53   
ref|XP_009770146.1|  PREDICTED: putative late blight resistance p...    137   1e-53   
ref|XP_006356447.1|  PREDICTED: uncharacterized protein LOC102594363    139   1e-53   
ref|XP_009804878.1|  PREDICTED: putative late blight resistance p...    133   2e-53   
ref|XP_009345010.1|  PREDICTED: disease resistance protein RPM1-l...    119   2e-53   
ref|XP_009345009.1|  PREDICTED: disease resistance protein RPM1-l...    119   2e-53   
ref|XP_009777473.1|  PREDICTED: putative late blight resistance p...    134   2e-53   
ref|XP_011018453.1|  PREDICTED: disease resistance protein RPM1-like    134   2e-53   
emb|CDP04753.1|  unnamed protein product                                119   2e-53   
ref|XP_009761073.1|  PREDICTED: putative late blight resistance p...    141   2e-53   
ref|XP_004239388.2|  PREDICTED: putative late blight resistance p...    137   2e-53   
ref|XP_003612695.1|  Disease resistance protein RPP8                    123   2e-53   
ref|XP_009777480.1|  PREDICTED: putative late blight resistance p...    133   2e-53   
gb|ADL59402.1|  R2 late blight resistance protein                       144   2e-53   
ref|XP_009588613.1|  PREDICTED: putative late blight resistance p...    131   2e-53   
emb|CDP11618.1|  unnamed protein product                                124   2e-53   
gb|KHN32382.1|  Disease resistance protein RPP13                        134   2e-53   
ref|XP_010320684.1|  PREDICTED: putative late blight resistance p...    137   2e-53   
ref|XP_004505810.1|  PREDICTED: probable disease resistance RPP8-...    135   3e-53   
gb|EYU23605.1|  hypothetical protein MIMGU_mgv1a026401mg                131   3e-53   
ref|XP_009620204.1|  PREDICTED: putative late blight resistance p...    133   3e-53   
gb|ADL59400.1|  R2 late blight resistance protein                       144   3e-53   
ref|XP_009777477.1|  PREDICTED: putative late blight resistance p...    133   3e-53   
ref|XP_009777479.1|  PREDICTED: putative late blight resistance p...    133   3e-53   
gb|AHB79188.1|  CC-NBS-LRR disease resistance protein                   135   4e-53   
emb|CDP20204.1|  unnamed protein product                                149   4e-53   
ref|XP_010651614.1|  PREDICTED: disease resistance protein RPM1-like    125   4e-53   
ref|XP_004512454.1|  PREDICTED: disease resistance protein RPM1-like    126   4e-53   
emb|CDP11649.1|  unnamed protein product                                119   5e-53   
ref|XP_010103502.1|  Disease resistance protein RPP8                    134   5e-53   
gb|ADL59394.1|  EDNR2GH4 protein                                        143   5e-53   
gb|ADL59393.1|  EDNR2GH3 protein                                        142   5e-53   
ref|XP_010110397.1|  Disease resistance protein RPM1                    126   5e-53   
emb|CDP11825.1|  unnamed protein product                                121   5e-53   
ref|XP_008810083.1|  PREDICTED: putative disease resistance RPP13...    139   6e-53   
ref|XP_009411156.1|  PREDICTED: putative disease resistance RPP13...    152   6e-53   
gb|ADL59396.1|  EDNR2GH6 protein                                        149   6e-53   
gb|KHN40409.1|  Disease resistance protein RPM1                         132   6e-53   
gb|EYU17781.1|  hypothetical protein MIMGU_mgv1a023021mg                128   6e-53   
emb|CDP11829.1|  unnamed protein product                                129   6e-53   
ref|XP_011076796.1|  PREDICTED: putative late blight resistance p...    128   6e-53   
ref|XP_002521806.1|  Disease resistance protein RPM1, putative          127   6e-53   
ref|XP_009782570.1|  PREDICTED: putative late blight resistance p...    131   6e-53   
ref|XP_009798793.1|  PREDICTED: putative late blight resistance p...    121   6e-53   
ref|XP_004237168.2|  PREDICTED: disease resistance protein RPP13-...    144   7e-53   
ref|XP_011076798.1|  PREDICTED: putative late blight resistance p...    128   7e-53   
emb|CDP17943.1|  unnamed protein product                                127   8e-53   
ref|XP_006357007.1|  PREDICTED: putative late blight resistance p...    129   8e-53   
emb|CDP20830.1|  unnamed protein product                                125   8e-53   
emb|CDP21728.1|  unnamed protein product                                129   8e-53   
ref|XP_010250086.1|  PREDICTED: disease resistance protein RPP8-like    128   9e-53   
ref|XP_010907229.1|  PREDICTED: LOW QUALITY PROTEIN: probable dis...    146   9e-53   
ref|XP_009763533.1|  PREDICTED: putative late blight resistance p...    132   9e-53   
ref|XP_009760599.1|  PREDICTED: late blight resistance protein R1...    135   1e-52   
ref|XP_009760600.1|  PREDICTED: late blight resistance protein R1...    134   1e-52   
gb|ACU65456.1|  R2 protein                                              143   1e-52   
emb|CDP08422.1|  unnamed protein product                                120   1e-52   
ref|XP_009760596.1|  PREDICTED: late blight resistance protein R1...    134   1e-52   
ref|XP_009760595.1|  PREDICTED: late blight resistance protein R1...    134   1e-52   
ref|XP_009760597.1|  PREDICTED: late blight resistance protein R1...    134   1e-52   
sp|Q6L406.2|R1B19_SOLDE  RecName: Full=Putative late blight resis...    134   1e-52   
ref|XP_010245031.1|  PREDICTED: probable disease resistance RPP8-...    121   1e-52   
emb|CDP04755.1|  unnamed protein product                                121   1e-52   
ref|XP_011072129.1|  PREDICTED: putative late blight resistance p...    119   2e-52   
gb|AAG31014.1|  tospovirus resistance protein B                         137   2e-52   
ref|XP_009346946.1|  PREDICTED: disease resistance protein RPM1-like    118   2e-52   
ref|XP_009774012.1|  PREDICTED: putative late blight resistance p...    125   2e-52   
ref|XP_007131450.1|  hypothetical protein PHAVU_011G014400g             129   2e-52   
ref|XP_008778031.1|  PREDICTED: putative disease resistance prote...    139   2e-52   
ref|XP_006359361.1|  PREDICTED: disease resistance protein RPP13-...    146   2e-52   
emb|CDP18040.1|  unnamed protein product                                122   2e-52   
ref|XP_006363252.1|  PREDICTED: putative late blight resistance p...    138   2e-52   
ref|XP_011072127.1|  PREDICTED: putative late blight resistance p...    117   2e-52   
gb|ADL59399.1|  HJTR2GH1 protein                                        139   2e-52   
ref|XP_010271941.1|  PREDICTED: disease resistance protein RPM1-like    124   2e-52   
ref|XP_010319547.1|  PREDICTED: disease resistance protein RPP13-...    142   2e-52   
ref|XP_006363248.1|  PREDICTED: putative late blight resistance p...    137   3e-52   
ref|XP_009614965.1|  PREDICTED: putative late blight resistance p...    120   3e-52   
emb|CDP19425.1|  unnamed protein product                                120   3e-52   
ref|XP_009618209.1|  PREDICTED: late blight resistance protein R1...    136   3e-52   
gb|KCW61558.1|  hypothetical protein EUGRSUZ_H04290                     128   3e-52   
ref|XP_006359790.1|  PREDICTED: putative late blight resistance p...    121   3e-52   
ref|XP_006360876.1|  PREDICTED: disease resistance protein RPP13-...    139   3e-52   
emb|CDP13141.1|  unnamed protein product                                124   3e-52   
ref|XP_006367614.1|  PREDICTED: putative late blight resistance p...    136   3e-52   
sp|Q6L3Z4.2|R1B12_SOLDE  RecName: Full=Putative late blight resis...    134   3e-52   
emb|CDP17701.1|  unnamed protein product                                127   3e-52   
ref|XP_010024987.1|  PREDICTED: disease resistance protein RPM1-like    128   3e-52   
ref|XP_004248043.1|  PREDICTED: putative late blight resistance p...    133   3e-52   
gb|ABO93001.1|  putative disease resistance protein                     140   4e-52   
gb|AAU93590.2|  Late blight resistance protein, putative                140   4e-52   
gb|ABO93012.1|  putative disease resistance protein                     135   4e-52   
emb|CDP15597.1|  unnamed protein product                                125   4e-52   
ref|XP_009764753.1|  PREDICTED: putative late blight resistance p...    130   4e-52   
ref|XP_006470644.1|  PREDICTED: putative disease resistance RPP13...    146   4e-52   
gb|KDO61208.1|  hypothetical protein CISIN_1g037627mg                   146   4e-52   
ref|XP_003517650.1|  PREDICTED: disease resistance protein RPM1-like    129   5e-52   
ref|XP_010319326.1|  PREDICTED: disease resistance protein RPP13-...    144   5e-52   
ref|XP_009764756.1|  PREDICTED: putative late blight resistance p...    130   5e-52   
emb|CDP21195.1|  unnamed protein product                                123   5e-52   
ref|XP_009595789.1|  PREDICTED: putative late blight resistance p...    147   5e-52   
ref|XP_009592131.1|  PREDICTED: putative late blight resistance p...    135   6e-52   
ref|XP_004309085.1|  PREDICTED: putative disease resistance prote...    132   6e-52   
ref|XP_007029822.1|  Disease resistance protein RPM1, putative is...    131   6e-52   
ref|XP_007131451.1|  hypothetical protein PHAVU_011G014500g             129   6e-52   
ref|XP_007210392.1|  hypothetical protein PRUPE_ppa000961mg             130   7e-52   
ref|XP_009411155.1|  PREDICTED: probable disease resistance RPP8-...    142   8e-52   
emb|CDP20547.1|  unnamed protein product                                130   8e-52   
ref|XP_009758685.1|  PREDICTED: late blight resistance protein R1...    131   8e-52   
ref|XP_009613904.1|  PREDICTED: LOW QUALITY PROTEIN: disease resi...    135   8e-52   
gb|AAG31015.1|  tospovirus resistance protein C                         142   9e-52   
ref|XP_008342592.1|  PREDICTED: disease resistance protein RPM1-like    127   1e-51   
ref|XP_009762970.1|  PREDICTED: putative late blight resistance p...    144   1e-51   
ref|XP_004236838.1|  PREDICTED: disease resistance protein RPP13-...    145   1e-51   
ref|XP_009800886.1|  PREDICTED: putative late blight resistance p...    134   1e-51   
emb|CDP00694.1|  unnamed protein product                                130   1e-51   
gb|ABO93011.1|  putative disease resistance protein                     130   1e-51   
ref|XP_007158212.1|  hypothetical protein PHAVU_002G133600g             132   1e-51   
gb|AES95654.2|  disease resistance protein (CC-NBS-LRR class) fam...    130   1e-51   
gb|KCW78491.1|  hypothetical protein EUGRSUZ_D02634                     124   1e-51   
emb|CDP08023.1|  unnamed protein product                                123   2e-51   
ref|XP_009587753.1|  PREDICTED: putative late blight resistance p...    130   2e-51   
ref|XP_009588135.1|  PREDICTED: putative late blight resistance p...    130   2e-51   
ref|XP_010054922.1|  PREDICTED: disease resistance protein RPM1-like    124   2e-51   
ref|XP_002528440.1|  Disease resistance protein RPP8, putative          129   2e-51   
ref|XP_009624532.1|  PREDICTED: putative late blight resistance p...    134   2e-51   
ref|XP_007158211.1|  hypothetical protein PHAVU_002G133600g             132   2e-51   
ref|XP_010663514.1|  PREDICTED: putative disease resistance prote...    115   2e-51   
emb|CDP12951.1|  unnamed protein product                                119   2e-51   
ref|XP_004300177.1|  PREDICTED: disease resistance protein RPM1-l...    127   2e-51   
ref|XP_007009194.1|  Disease resistance protein RPP8                    135   2e-51   
ref|XP_004300178.1|  PREDICTED: disease resistance protein RPM1-l...    127   2e-51   
emb|CDP10797.1|  unnamed protein product                                125   2e-51   
ref|XP_006494244.1|  PREDICTED: putative disease resistance prote...    126   2e-51   
gb|ADL59404.1|  R2 late blight resistance protein                       136   2e-51   
emb|CDP10806.1|  unnamed protein product                                128   2e-51   
sp|Q6L400.1|R1B16_SOLDE  RecName: Full=Putative late blight resis...    130   2e-51   
emb|CDP19475.1|  unnamed protein product                                117   3e-51   
emb|CDP10800.1|  unnamed protein product                                126   3e-51   
emb|CDP12547.1|  unnamed protein product                                137   3e-51   
ref|XP_006587620.1|  PREDICTED: disease resistance protein RPM1-like    131   3e-51   
gb|ADL59406.1|  SNKR2GH5 protein                                        145   3e-51   
emb|CDP05593.1|  unnamed protein product                                123   3e-51   
emb|CDP16976.1|  unnamed protein product                                116   3e-51   
ref|XP_007009190.1|  Disease resistance protein RPP8                    133   3e-51   
ref|XP_006446160.1|  hypothetical protein CICLE_v10014222mg             142   3e-51   
emb|CDP10810.1|  unnamed protein product                                123   3e-51   
gb|KDO65577.1|  hypothetical protein CISIN_1g038220mg                   125   4e-51   
gb|ADL59407.1|  SNKR2GH6 protein                                        145   4e-51   
ref|XP_010928130.1|  PREDICTED: disease resistance protein RPM1-like    118   5e-51   
ref|XP_009803436.1|  PREDICTED: putative late blight resistance p...    127   5e-51   
gb|KDP27334.1|  hypothetical protein JCGZ_20266                         120   5e-51   
gb|KCW72271.1|  hypothetical protein EUGRSUZ_E00730                     128   5e-51   
ref|XP_008238137.1|  PREDICTED: disease resistance protein RPM1-like    127   5e-51   
gb|AAG31013.1|  tospovirus resistance protein A                         130   6e-51   
gb|ACU65457.1|  Rpi protein                                             135   6e-51   
emb|CDP10807.1|  unnamed protein product                                124   6e-51   
ref|XP_009803439.1|  PREDICTED: putative late blight resistance p...    126   6e-51   
ref|XP_009373508.1|  PREDICTED: disease resistance protein RPM1-like    129   6e-51   
emb|CDP17263.1|  unnamed protein product                                115   6e-51   
emb|CDP10805.1|  unnamed protein product                                125   6e-51   
emb|CDP12950.1|  unnamed protein product                                120   6e-51   
ref|XP_007009116.1|  Disease resistance protein RPP8                    127   6e-51   
emb|CDP04756.1|  unnamed protein product                                133   6e-51   
gb|KDP27335.1|  hypothetical protein JCGZ_20267                         120   7e-51   
dbj|BAJ53255.1|  JHL25P11.7                                             120   7e-51   
ref|XP_010661992.1|  PREDICTED: putative disease resistance prote...    125   7e-51   
gb|ADL59398.1|  EDNR2GH8 protein                                        142   7e-51   
gb|ADL59408.1|  SNKR2GH7 protein                                        144   7e-51   
ref|XP_009763530.1|  PREDICTED: putative late blight resistance p...    132   8e-51   
ref|XP_009608045.1|  PREDICTED: putative late blight resistance p...    134   8e-51   
ref|XP_009797559.1|  PREDICTED: disease resistance protein RPP13-...    142   8e-51   
gb|ADL59405.1|  R2 late blight resistance protein                       136   8e-51   
emb|CDP15580.1|  unnamed protein product                                116   9e-51   
ref|XP_006356854.1|  PREDICTED: disease resistance protein RPP13-...    137   9e-51   
ref|XP_010244175.1|  PREDICTED: disease resistance protein RPM1-like    129   9e-51   
ref|XP_009608041.1|  PREDICTED: putative late blight resistance p...    134   9e-51   
emb|CDP20159.1|  unnamed protein product                                120   1e-50   
ref|XP_009763532.1|  PREDICTED: uncharacterized protein LOC104215...    132   1e-50   
ref|XP_009766585.1|  PREDICTED: late blight resistance protein R1...    130   1e-50   
emb|CDP15581.1|  unnamed protein product                                119   1e-50   
ref|XP_009374540.1|  PREDICTED: disease resistance protein RPM1-l...    116   1e-50   
emb|CDP20176.1|  unnamed protein product                                135   1e-50   
emb|CDP12798.1|  unnamed protein product                                114   1e-50   
gb|KDO39461.1|  hypothetical protein CISIN_1g036584mg                   136   1e-50   
ref|XP_010319214.1|  PREDICTED: putative late blight resistance p...    122   1e-50   
ref|XP_009768640.1|  PREDICTED: putative late blight resistance p...    137   1e-50   
ref|XP_009344868.1|  PREDICTED: disease resistance protein RPM1-like    115   1e-50   
ref|XP_009768636.1|  PREDICTED: putative late blight resistance p...    137   1e-50   
emb|CDP00592.1|  unnamed protein product                                117   1e-50   
ref|XP_008376413.1|  PREDICTED: disease resistance protein RPM1-like    115   1e-50   
ref|XP_009597665.1|  PREDICTED: disease resistance protein RPP13-...    145   1e-50   
ref|XP_007158603.1|  hypothetical protein PHAVU_002G166400g             134   1e-50   
gb|ADL59403.1|  SNKR2GH2 protein                                        137   1e-50   
ref|XP_002265617.2|  PREDICTED: disease resistance protein RPM1         124   1e-50   
ref|XP_004310236.1|  PREDICTED: probable disease resistance RPP8-...    124   1e-50   
ref|XP_009768641.1|  PREDICTED: putative late blight resistance p...    137   1e-50   
gb|AAU93588.1|  late blight resistance protein, identical               130   1e-50   
sp|Q8W1E0.1|R1A_SOLDE  RecName: Full=Late blight resistance prote...    130   2e-50   
ref|XP_008809624.1|  PREDICTED: disease resistance protein RPM1-like    119   2e-50   
ref|XP_003612696.1|  Nbs-lrr resistance protein                         127   2e-50   
emb|CDP12803.1|  unnamed protein product                                117   2e-50   
ref|XP_009596161.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...    133   2e-50   
gb|AAU95278.1|  R1                                                      140   2e-50   
ref|XP_009388233.1|  PREDICTED: probable disease resistance prote...    138   2e-50   
ref|XP_006350240.1|  PREDICTED: putative late blight resistance p...    131   2e-50   
ref|XP_009343524.1|  PREDICTED: disease resistance protein RPM1-like    114   2e-50   
ref|XP_008373504.1|  PREDICTED: disease resistance protein RPM1-like    124   2e-50   
gb|AFP82245.1|  NBS-LRR type disease resistance protein                 124   2e-50   
ref|XP_003612692.1|  Nbs-lrr resistance protein                         129   2e-50   
emb|CDP12947.1|  unnamed protein product                                125   3e-50   
ref|XP_009777062.1|  PREDICTED: putative late blight resistance p...    126   3e-50   
gb|EMS47661.1|  Disease resistance protein RPP8                         134   3e-50   
ref|XP_009777063.1|  PREDICTED: putative late blight resistance p...    126   3e-50   
gb|AAU95624.1|  R1                                                      140   3e-50   
ref|XP_009777064.1|  PREDICTED: putative late blight resistance p...    126   3e-50   
ref|XP_003598408.1|  NBS-containing resistance-like protein             120   3e-50   
ref|XP_003638210.1|  NBS-containing resistance-like protein             120   3e-50   
sp|Q6L439.2|R1A4_SOLDE  RecName: Full=Putative late blight resist...    130   3e-50   
gb|AES68659.2|  NBS-LRR type disease resistance protein                 120   4e-50   
ref|XP_009388253.1|  PREDICTED: disease resistance protein RPP13-...    137   4e-50   
ref|XP_009345346.1|  PREDICTED: disease resistance protein RPM1-like    131   4e-50   
ref|XP_003537613.1|  PREDICTED: disease resistance RPP8-like prot...    136   4e-50   
ref|XP_009349723.1|  PREDICTED: disease resistance protein RPM1-like    117   4e-50   
ref|XP_009769147.1|  PREDICTED: putative late blight resistance p...    135   4e-50   
gb|KHN41940.1|  Disease resistance RPP8-like protein 3                  136   4e-50   
emb|CDP12943.1|  unnamed protein product                                118   5e-50   
ref|XP_010245030.1|  PREDICTED: probable disease resistance prote...    119   5e-50   
emb|CDP21814.1|  unnamed protein product                                114   5e-50   
sp|Q6L3N7.1|R1C3_SOLDE  RecName: Full=Putative late blight resist...    125   5e-50   
emb|CDP11830.1|  unnamed protein product                                126   5e-50   
ref|XP_010054113.1|  PREDICTED: disease resistance protein RPM1-l...    123   5e-50   
ref|XP_010658284.1|  PREDICTED: putative disease resistance prote...    113   6e-50   
ref|XP_009787830.1|  PREDICTED: disease resistance protein RPP13-...    142   6e-50   
gb|ABO93013.1|  putative disease resistance protein                     126   6e-50   
emb|CDP11614.1|  unnamed protein product                                119   6e-50   
ref|XP_011087333.1|  PREDICTED: putative late blight resistance p...    118   6e-50   
ref|XP_002524237.1|  Disease resistance protein RPP8, putative          125   6e-50   
ref|XP_010054114.1|  PREDICTED: disease resistance protein RPM1-l...    123   6e-50   
ref|XP_008797616.1|  PREDICTED: putative disease resistance prote...    124   6e-50   
ref|XP_008238135.1|  PREDICTED: disease resistance protein RPM1-l...    119   6e-50   
emb|CDP18957.1|  unnamed protein product                                129   7e-50   
ref|XP_008238134.1|  PREDICTED: disease resistance protein RPM1-l...    119   7e-50   
ref|XP_009758240.1|  PREDICTED: putative late blight resistance p...    130   7e-50   
emb|CDP17919.1|  unnamed protein product                                122   7e-50   
emb|CBI25487.3|  unnamed protein product                                113   7e-50   
ref|XP_009758239.1|  PREDICTED: putative late blight resistance p...    130   7e-50   



>ref|XP_006345283.1| PREDICTED: uncharacterized protein LOC102590501 [Solanum tuberosum]
Length=2691

 Score =   171 bits (434),  Expect(2) = 8e-80, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 123/183 (67%), Gaps = 4/183 (2%)
 Frame = +2

Query  2     GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLN---NEAAKIDEVTDG  172
             GGIGKTTLA+ ++  P + S FD+  W  +S++++V+++L+ LL    N   K+    + 
Sbjct  1161  GGIGKTTLAKQVFNHPSIKSRFDVRAWATISKEYNVKEILLSLLQSIINIDDKVYSRDED  1220

Query  173   ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
             ELA  LQK L+ +RYLIV+DDIWS ++W+  + CFP DN  SRILLTTRH EVA +A SS
Sbjct  1221  ELADLLQKKLKCRRYLIVIDDIWSNKAWDDTKQCFPIDNNGSRILLTTRHTEVAINA-SS  1279

Query  353   GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
              N L  +  +N +ESW+LF       +S P EL+TIG K+  KC GLPL IVVVAG+  K
Sbjct  1280  SNLLLKMNLMNSDESWNLFKSKAFANESFPPELQTIGEKIASKCQGLPLTIVVVAGLLSK  1339

Query  533   TQQ  541
             +++
Sbjct  1340  SKR  1342


 Score =   154 bits (389),  Expect(2) = 8e-80, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 108/170 (64%), Gaps = 7/170 (4%)
 Frame = +3

Query  522   FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
               SK  +T EEW+N  +   S V T D  EQC R+L LSYNYLP  LKAC+LY  I P+D
Sbjct  1336  LLSKSKRTKEEWENVAENIKSFV-TKDPDEQCLRVLGLSYNYLPNDLKACLLYFGIFPED  1394

Query  702   EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNG-KIKTCRV  878
               I VKRLVRLWIAEGF++L    +LEE A   LQDL DR L+ + KR  +G KIKTCR+
Sbjct  1395  SEISVKRLVRLWIAEGFLKL--EGDLEEEAKNRLQDLVDRCLVLVSKRSADGRKIKTCRI  1452

Query  879   HDIVHEFCVREAIKEKLLNVDNKQHPSCGELQQEGCRWLNFWPKKIPDLD  1028
             HD+VHE C+REA  +  L + N +    G + + GC+W++    +  D D
Sbjct  1453  HDLVHELCLREAQSQNFLFIRNDK---TGSVPRVGCQWISIQKSQQTDDD  1499


 Score =   171 bits (434),  Expect(2) = 9e-80, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 123/183 (67%), Gaps = 4/183 (2%)
 Frame = +2

Query  2     GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLN---NEAAKIDEVTDG  172
             GGIGKTTLA+ ++  P + S FD+  W  +S++++V+++L+ LL    N   K+    + 
Sbjct  1965  GGIGKTTLAKQVFNHPSIKSRFDVRAWATISKEYNVKEILLSLLQSIINIDDKVYSRDED  2024

Query  173   ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
             ELA  LQK L+ +RYLIV+DDIWS ++W+  + CFP DN  SRILLTTRH EVA +A SS
Sbjct  2025  ELADLLQKKLKCRRYLIVIDDIWSNKAWDDTKQCFPIDNNGSRILLTTRHTEVAINA-SS  2083

Query  353   GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
              N L  +  +N +ESW+LF       +S P EL+TIG K+  KC GLPL IVVVAG+  K
Sbjct  2084  SNLLLKMNLMNSDESWNLFKSKAFANESFPPELQTIGEKIASKCQGLPLTIVVVAGLLSK  2143

Query  533   TQQ  541
             +++
Sbjct  2144  SKR  2146


 Score =   154 bits (389),  Expect(2) = 9e-80, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 109/170 (64%), Gaps = 7/170 (4%)
 Frame = +3

Query  522   FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
               SK  +T EEW+N  +   S V T D  EQC R+L LSYNYLP  LKAC+LY  I P+D
Sbjct  2140  LLSKSKRTKEEWENVAENIKSFV-TKDPDEQCLRVLGLSYNYLPNDLKACLLYFGIFPED  2198

Query  702   EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNG-KIKTCRV  878
               I VKRLVRLWIAEGF++L    +LEE A   LQDL DR L+ + KR  +G KIKTCR+
Sbjct  2199  SEISVKRLVRLWIAEGFLKL--EGDLEEEAKNRLQDLVDRCLVLVSKRSADGRKIKTCRI  2256

Query  879   HDIVHEFCVREAIKEKLLNVDNKQHPSCGELQQEGCRWLNFWPKKIPDLD  1028
             HD+VHE C+REA  +  L + N +    G + + GC+W++    +  D++
Sbjct  2257  HDLVHELCLREAQSQNFLFIRNDK---TGSVPRVGCQWISIQKSQQTDVE  2303


 Score =   135 bits (340),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 107/183 (58%), Gaps = 34/183 (19%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVT---DG  172
            GGIGKTTLA+ ++ D  + SHFD+  W  +SQ+H+V+ +LV LL++   K D V    + 
Sbjct  277  GGIGKTTLAKEVFNDAFIRSHFDVRAWATISQEHNVKDILVSLLHSTKEKDDTVNTEDES  336

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            +LA  LQK L+ +RYLIVLDD+WS ++W        DDN    I                
Sbjct  337  KLADMLQKSLKSRRYLIVLDDMWSDKAW--------DDNISLPI----------------  372

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
                   G +   ESWDLF  +    ++LP E ET+G+++VD+C GLPL IVVVAG++ K
Sbjct  373  -------GLMGPVESWDLFKSAAFVNEALPSEFETVGKQIVDQCQGLPLTIVVVAGLWSK  425

Query  533  TQQ  541
            +++
Sbjct  426  SKR  428


 Score =   117 bits (292),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 92/142 (65%), Gaps = 4/142 (3%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
             +SK  +T+E W +  K   S V T D  EQC  +L LSYN+L   LK C+LY  I P+D
Sbjct  422  LWSKSKRTIEVWGSVAKDVKSFV-TNDPDEQCLHVLGLSYNHLTSDLKPCLLYFGIFPED  480

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFN-GKIKTCRV  878
              + VKRLVRLWIAEGF++    ++LE VA   LQDL DR L+ + ++  +  +++ C+V
Sbjct  481  SEVSVKRLVRLWIAEGFLKF--EKDLEGVAEKCLQDLIDRCLVLVSEKSLDETRVRYCKV  538

Query  879  HDIVHEFCVREAIKEKLLNVDN  944
            H++++E C+REA ++ L  +++
Sbjct  539  HNLIYELCLREAQRQSLFVMND  560



>ref|XP_009765695.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=896

 Score =   177 bits (448),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 118/178 (66%), Gaps = 4/178 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN---EAAKIDEVTDG  172
            GGIGK+T A  ++ DP + S FD+  W  VS  + +RKML+ LL +    A ++DE TDG
Sbjct  183  GGIGKSTFANKMFSDPSILSFFDVRGWITVSMNYSLRKMLLTLLQDTVGAAKELDEKTDG  242

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA  LQK L+G+RYLIV+DD+WS  +W+ ++LCFP++N RSRILLTTR  +VA  A SS
Sbjct  243  ELADHLQKSLKGRRYLIVVDDMWSREAWDDVRLCFPENNNRSRILLTTRDMKVAQYA-SS  301

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
               L  + FL  +ESW LFC+   G +  P E E + ++VV  C GLPL I VVAG  
Sbjct  302  PKDLFPMRFLEPKESWHLFCQKVFGNKDCPTEYENVAKEVVSNCKGLPLMISVVAGTL  359


 Score =   132 bits (332),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 102/163 (63%), Gaps = 9/163 (6%)
 Frame = +3

Query  540   KTVEEWQNFEKQTNSLVVTTDLSE--QCSRILTLSYNYLPLHLKACILYLSIVPKDEAII  713
             KT++EW    K   S++ + DL +   CSR+L LSY +LP +LK+C LY  + PK   I 
Sbjct  363   KTMDEWI---KVAQSVISSVDLDDYQHCSRVLGLSYTHLPSYLKSCFLYFGVFPKASEIS  419

Query  714   VKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVH  893
             VK+L RLWIAEG +EL  SE LE+VA   L  L D+SL+ + K+  + KIKTCR+HD++H
Sbjct  420   VKKLTRLWIAEGLLELKGSEGLEQVAANILHVLIDKSLVVVSKQSLDDKIKTCRIHDLLH  479

Query  894   EFCVREAIKEKLLNVDNKQHPSCGELQQEGCRWLNFWPKKIPD  1022
             + C+REA  E LL V  +       +  +G RW++  P++  D
Sbjct  480   DLCLREAESENLLYVACR---GSTRVSSQG-RWVSVNPERGYD  518



>ref|XP_009765696.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=882

 Score =   177 bits (448),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 118/178 (66%), Gaps = 4/178 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN---EAAKIDEVTDG  172
            GGIGK+T A  ++ DP + S FD+  W  VS  + +RKML+ LL +    A ++DE TDG
Sbjct  183  GGIGKSTFANKMFSDPSILSFFDVRGWITVSMNYSLRKMLLTLLQDTVGAAKELDEKTDG  242

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA  LQK L+G+RYLIV+DD+WS  +W+ ++LCFP++N RSRILLTTR  +VA  A SS
Sbjct  243  ELADHLQKSLKGRRYLIVVDDMWSREAWDDVRLCFPENNNRSRILLTTRDMKVAQYA-SS  301

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
               L  + FL  +ESW LFC+   G +  P E E + ++VV  C GLPL I VVAG  
Sbjct  302  PKDLFPMRFLEPKESWHLFCQKVFGNKDCPTEYENVAKEVVSNCKGLPLMISVVAGTL  359


 Score =   132 bits (331),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 102/163 (63%), Gaps = 9/163 (6%)
 Frame = +3

Query  540   KTVEEWQNFEKQTNSLVVTTDLSE--QCSRILTLSYNYLPLHLKACILYLSIVPKDEAII  713
             KT++EW    K   S++ + DL +   CSR+L LSY +LP +LK+C LY  + PK   I 
Sbjct  363   KTMDEWI---KVAQSVISSVDLDDYQHCSRVLGLSYTHLPSYLKSCFLYFGVFPKASEIS  419

Query  714   VKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVH  893
             VK+L RLWIAEG +EL  SE LE+VA   L  L D+SL+ + K+  + KIKTCR+HD++H
Sbjct  420   VKKLTRLWIAEGLLELKGSEGLEQVAANILHVLIDKSLVVVSKQSLDDKIKTCRIHDLLH  479

Query  894   EFCVREAIKEKLLNVDNKQHPSCGELQQEGCRWLNFWPKKIPD  1022
             + C+REA  E LL V  +       +  +G RW++  P++  D
Sbjct  480   DLCLREAESENLLYVACR---GSTRVSSQG-RWVSVNPERGYD  518



>ref|XP_004252073.2| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=917

 Score =   160 bits (405),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 117/183 (64%), Gaps = 4/183 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLN---NEAAKIDEVTDG  172
            GGIGKTTLA+ ++  P + S FD+  W  + ++++V+++L+ LL    N   K+    + 
Sbjct  186  GGIGKTTLAKQVFNHPSIQSRFDVRAWATICKEYNVKEILLSLLQSIINIDDKVYSRDEA  245

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA  LQK L+ +RYLIV+DDIW  ++W+  + CFP DN  SRILLTTRH EVA  A SS
Sbjct  246  ELADLLQKKLKCRRYLIVIDDIWCYKAWDDTRQCFPIDNNGSRILLTTRHTEVAIYASSS  305

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
               L  +  +N +ESW+L        +S   ELETIG K+  KC GLPL IVVVAG+  K
Sbjct  306  NLHL-KMNLMNADESWNLLKSKAFANESFTPELETIGEKIASKCQGLPLTIVVVAGLLSK  364

Query  533  TQQ  541
            +++
Sbjct  365  SKR  367


 Score =   145 bits (365),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 103/160 (64%), Gaps = 7/160 (4%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK  +T EEW+N  +   S V T D +EQC R+L LSYNYLP  LKAC+LY  I P+D
Sbjct  361  LLSKSKRTKEEWENVAENIKSFV-TKDPNEQCLRVLGLSYNYLPNELKACLLYFGIFPED  419

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGK-IKTCRV  878
              I VKRLVRLWIAEGF++L    + EE A   LQDL DR L+ + +R  +G+ +KTCR+
Sbjct  420  SEISVKRLVRLWIAEGFLKL--EGDFEEEAKNRLQDLVDRCLVLVSQRSADGRNVKTCRI  477

Query  879  HDIVHEFCVREAIKEKLLNVDNKQHPSCGELQQEGCRWLN  998
            HD+VHE C+REA  +  L + N +      + Q G RW++
Sbjct  478  HDLVHELCLREAQSQNFLFIRNDK---TEYVPQVGYRWIS  514



>ref|XP_009759015.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana sylvestris]
Length=921

 Score =   160 bits (405),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 115/181 (64%), Gaps = 5/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTD----  169
            GGIGKTTLA  +Y DP + SHFDI     VS ++  R +L+ LL + + K  E  D    
Sbjct  175  GGIGKTTLANKIYSDPFIMSHFDIRAKATVSLEYRARNVLLGLLFSISGKTYEFYDQQDV  234

Query  170  GELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADS  349
            G+LA +LQK L+G RYL+V+DDIW+T +W+ I+LCF D N  SRILLTTR+ +VA+ A S
Sbjct  235  GQLADRLQKLLKGGRYLVVIDDIWTTEAWDDIKLCFSDCNNGSRILLTTRNVDVAEYA-S  293

Query  350  SGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFF  529
            SG     +  LN  ESW+L C      +    E + IG+++  KC GLPLAI V+AG+  
Sbjct  294  SGKPPFQMRLLNSNESWNLLCGKVFEKEYFSLEFDIIGKEIALKCGGLPLAITVIAGLLS  353

Query  530  K  532
            K
Sbjct  354  K  354


 Score =   143 bits (361),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 100/146 (68%), Gaps = 4/146 (3%)
 Frame = +3

Query  528  SKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEA  707
            SK+ K + EWQ+     +S VV+TD+  QC R+L LSY+YLP HLK C LY +I P+DE 
Sbjct  353  SKIGKALHEWQSVADNVSS-VVSTDVDAQCMRVLALSYHYLPNHLKPCFLYFAIFPEDEL  411

Query  708  IIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDI  887
            I V +LV LW AEGF+++   +++EEVA  Y++DL DRSLI I   +F+GKI++C +HD+
Sbjct  412  IFVDKLVELWAAEGFLKVEEMKSIEEVAEKYIKDLIDRSLIFIHNLNFDGKIESCGMHDV  471

Query  888  VHEFCVREAIKEKLLNV---DNKQHP  956
              E C+REA     +NV   ++ Q+P
Sbjct  472  TRELCLREARNVNFVNVIGENDDQNP  497



>ref|XP_009759016.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X2 [Nicotiana sylvestris]
Length=883

 Score =   160 bits (405),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 115/181 (64%), Gaps = 5/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTD----  169
            GGIGKTTLA  +Y DP + SHFDI     VS ++  R +L+ LL + + K  E  D    
Sbjct  175  GGIGKTTLANKIYSDPFIMSHFDIRAKATVSLEYRARNVLLGLLFSISGKTYEFYDQQDV  234

Query  170  GELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADS  349
            G+LA +LQK L+G RYL+V+DDIW+T +W+ I+LCF D N  SRILLTTR+ +VA+ A S
Sbjct  235  GQLADRLQKLLKGGRYLVVIDDIWTTEAWDDIKLCFSDCNNGSRILLTTRNVDVAEYA-S  293

Query  350  SGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFF  529
            SG     +  LN  ESW+L C      +    E + IG+++  KC GLPLAI V+AG+  
Sbjct  294  SGKPPFQMRLLNSNESWNLLCGKVFEKEYFSLEFDIIGKEIALKCGGLPLAITVIAGLLS  353

Query  530  K  532
            K
Sbjct  354  K  354


 Score =   143 bits (360),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 100/146 (68%), Gaps = 4/146 (3%)
 Frame = +3

Query  528  SKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEA  707
            SK+ K + EWQ+     +S VV+TD+  QC R+L LSY+YLP HLK C LY +I P+DE 
Sbjct  353  SKIGKALHEWQSVADNVSS-VVSTDVDAQCMRVLALSYHYLPNHLKPCFLYFAIFPEDEL  411

Query  708  IIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDI  887
            I V +LV LW AEGF+++   +++EEVA  Y++DL DRSLI I   +F+GKI++C +HD+
Sbjct  412  IFVDKLVELWAAEGFLKVEEMKSIEEVAEKYIKDLIDRSLIFIHNLNFDGKIESCGMHDV  471

Query  888  VHEFCVREAIKEKLLNV---DNKQHP  956
              E C+REA     +NV   ++ Q+P
Sbjct  472  TRELCLREARNVNFVNVIGENDDQNP  497



>ref|XP_009631206.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=905

 Score =   167 bits (424),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 120/200 (60%), Gaps = 26/200 (13%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAA---KIDEVTDG  172
            GGIGK+T A+ ++ DP + S FDI  W VVS+ + +RKML+ LL N      + D+ +DG
Sbjct  184  GGIGKSTFAKRIFFDPSILSFFDIRAWIVVSKDYSIRKMLLSLLQNAIGVDEEADKKSDG  243

Query  173  E----------------------LAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDD  286
            E                      LA +LQK L+G+RYLIV+DDIWS  +W+ ++LCFP++
Sbjct  244  EQPNRLQKSDGDLEDGLQKIDDALADRLQKSLKGRRYLIVVDDIWSREAWDDVRLCFPEN  303

Query  287  NCRSRILLTTRHKEVADSADSSGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGR  466
            N RSRILLTTR  +VA  A SS   L  + FL  +ESW LFC+   G +  P E E + +
Sbjct  304  NNRSRILLTTRDMKVAQYA-SSPKDLFPMRFLEPKESWHLFCQKVFGKKDCPTEFENVAK  362

Query  467  KVVDKCHGLPLAIVVVAGVF  526
            +VV  C GLPL I VVAG  
Sbjct  363  EVVSNCKGLPLMISVVAGTL  382


 Score =   133 bits (334),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 101/163 (62%), Gaps = 9/163 (6%)
 Frame = +3

Query  540   KTVEEWQNFEKQTNSLVVTTDLSE--QCSRILTLSYNYLPLHLKACILYLSIVPKDEAII  713
             KT++ W    K   S++ + DL +   CSR+L LSYN+LP +LKAC LY  + PK   I 
Sbjct  386   KTMDGWI---KVAQSVISSVDLDDYQHCSRVLGLSYNHLPSYLKACFLYFGVFPKASEIS  442

Query  714   VKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVH  893
             VK+L RLWIAEG +EL  SE L +VA   L DL D+SL+ + K+  + KIKTCR+HD++H
Sbjct  443   VKKLTRLWIAEGLLELKGSEGLGQVAANILHDLIDKSLVVVSKQSLDDKIKTCRIHDLLH  502

Query  894   EFCVREAIKEKLLNVDNKQHPSCGELQQEGCRWLNFWPKKIPD  1022
             + C+RE   E LL V    +     +  +G RW++  P++  D
Sbjct  503   DLCLREGESENLLYV---AYLGSRRVSSQG-RWVSVNPERGYD  541



>ref|XP_009626592.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana tomentosiformis]
Length=920

 Score =   155 bits (393),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 114/181 (63%), Gaps = 5/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTD----  169
            GGIGKTTLA  +Y  P + SHFDI     VS ++  R +L+ LL + + K  E       
Sbjct  174  GGIGKTTLANKIYTHPFIMSHFDIRAKATVSLEYRARNVLLGLLFSISVKTYEFYGQQDV  233

Query  170  GELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADS  349
            G+LA +LQK L+G RYL+V+DDIW+T +W+ I+LCF D N  SRILLTTR+ +VA+ A S
Sbjct  234  GQLADRLQKLLKGGRYLVVIDDIWTTEAWDDIKLCFSDCNNGSRILLTTRNVDVAEYA-S  292

Query  350  SGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFF  529
            SG   + +  LN  ESW+L C      +    E + IG+++  KC GLPLAI V+AG+  
Sbjct  293  SGKPPYQMRLLNSNESWNLLCGKVFEKEYFSLEFDIIGKEIALKCGGLPLAITVIAGLLS  352

Query  530  K  532
            K
Sbjct  353  K  353


 Score =   144 bits (363),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 101/148 (68%), Gaps = 4/148 (3%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK+ K ++EWQ+  +  +S VV+TD+  QC R+L LSY+YLP HLK C LY +I P+D
Sbjct  350  LLSKIGKALDEWQSVAENVSS-VVSTDVDAQCMRVLALSYHYLPNHLKPCFLYFAIFPED  408

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
            E I V +L+ LW AEGF+++   +++E+VA  YL+DL DRSLI I    F+GKI++C +H
Sbjct  409  ELIFVSKLMELWAAEGFLKVEEMKSIEQVAEKYLKDLIDRSLISIHSLSFDGKIESCGMH  468

Query  882  DIVHEFCVREAIKEKLLNV---DNKQHP  956
            D+  E C+REA     +NV   ++ Q+P
Sbjct  469  DVTRELCLREAQNVNFVNVIGENDDQNP  496



>ref|XP_009626593.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X2 [Nicotiana tomentosiformis]
Length=879

 Score =   155 bits (393),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 114/181 (63%), Gaps = 5/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTD----  169
            GGIGKTTLA  +Y  P + SHFDI     VS ++  R +L+ LL + + K  E       
Sbjct  174  GGIGKTTLANKIYTHPFIMSHFDIRAKATVSLEYRARNVLLGLLFSISVKTYEFYGQQDV  233

Query  170  GELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADS  349
            G+LA +LQK L+G RYL+V+DDIW+T +W+ I+LCF D N  SRILLTTR+ +VA+ A S
Sbjct  234  GQLADRLQKLLKGGRYLVVIDDIWTTEAWDDIKLCFSDCNNGSRILLTTRNVDVAEYA-S  292

Query  350  SGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFF  529
            SG   + +  LN  ESW+L C      +    E + IG+++  KC GLPLAI V+AG+  
Sbjct  293  SGKPPYQMRLLNSNESWNLLCGKVFEKEYFSLEFDIIGKEIALKCGGLPLAITVIAGLLS  352

Query  530  K  532
            K
Sbjct  353  K  353


 Score =   144 bits (363),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 101/148 (68%), Gaps = 4/148 (3%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK+ K ++EWQ+  +  +S VV+TD+  QC R+L LSY+YLP HLK C LY +I P+D
Sbjct  350  LLSKIGKALDEWQSVAENVSS-VVSTDVDAQCMRVLALSYHYLPNHLKPCFLYFAIFPED  408

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
            E I V +L+ LW AEGF+++   +++E+VA  YL+DL DRSLI I    F+GKI++C +H
Sbjct  409  ELIFVSKLMELWAAEGFLKVEEMKSIEQVAEKYLKDLIDRSLISIHSLSFDGKIESCGMH  468

Query  882  DIVHEFCVREAIKEKLLNV---DNKQHP  956
            D+  E C+REA     +NV   ++ Q+P
Sbjct  469  DVTRELCLREAQNVNFVNVIGENDDQNP  496



>ref|XP_009618655.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618657.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618658.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618659.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=870

 Score =   167 bits (423),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 120/180 (67%), Gaps = 3/180 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEV---TDG  172
            GGIGKTT A  +Y DP++ S FD      VSQ+  VR++L+ LLN+  +   E+   +DG
Sbjct  164  GGIGKTTFATRIYYDPVIVSRFDTRPMVTVSQEFYVRRLLLGLLNSITSIPREICNESDG  223

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            +LA +L+K L+G+RYLI +DDIWST +W+ ++LCFPDD   SRILLTTR+ EVA+ A  +
Sbjct  224  QLADRLRKGLKGRRYLIFIDDIWSTEAWDDMKLCFPDDGNGSRILLTTRNTEVAEYASMN  283

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
                H +  L+ +ESW+LF       + L  E E IG++VV KC GLPL I++VAG+  K
Sbjct  284  EPPFHRMRLLSFDESWNLFHSKVFTKKGLSSEFEKIGKEVVKKCQGLPLTIIIVAGLLSK  343


 Score =   132 bits (333),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 96/144 (67%), Gaps = 3/144 (2%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK++  VE W N  +  NSL+      +QCSR++ LSY +LP H+KAC LY  +  +D
Sbjct  340  LLSKIHSLVE-WGNVAEDVNSLLYECP-DKQCSRLIDLSYRHLPHHIKACFLYFGVFQED  397

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHF-NGKIKTCRV  878
              I VKRLV+LW+AEGF+E+   +NLEEVA   L+DL DRSL+   K    NGKIKTC++
Sbjct  398  TEINVKRLVKLWVAEGFLEVEKDKNLEEVAKKCLEDLIDRSLVFADKGSTRNGKIKTCKM  457

Query  879  HDIVHEFCVREAIKEKLLNVDNKQ  950
            HD++H FC+REA +E  L V  K+
Sbjct  458  HDLLHGFCLREAQRENFLRVIQKK  481



>ref|XP_009803728.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=1076

 Score =   169 bits (429),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 120/181 (66%), Gaps = 5/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVT----D  169
            GGIGKTTLA  +Y DP + S FDI     +SQ+H VR +L+ LL++   K DE      D
Sbjct  342  GGIGKTTLANRIYCDPFIVSRFDIRAKATLSQEHCVRNVLLRLLSSTRGKTDECYEEQDD  401

Query  170  GELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADS  349
            G+LA +LQK L+GKRYL+V+DDIW+T +W+ I+LCFPD N   RILLTTR+ EVA+ A S
Sbjct  402  GQLADRLQKLLKGKRYLVVIDDIWTTEAWDDIKLCFPDCNNGGRILLTTRNVEVAEYA-S  460

Query  350  SGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFF  529
            SG   + +  +N +ESW+L  K     +    E E IG+++  KC GLPLAI V+AG+  
Sbjct  461  SGKPPYHMRLMNFDESWNLLHKKVFEKEYFSPEFEKIGKRIASKCGGLPLAIAVIAGLLS  520

Query  530  K  532
            K
Sbjct  521  K  521


 Score =   129 bits (324),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 98/148 (66%), Gaps = 4/148 (3%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK+ K ++EWQ+  +  +S VV+T++  QC  +L LSY++LP HLK C LY +I P+D
Sbjct  518  LLSKMGKALDEWQSVAENVSS-VVSTNIDVQCMTVLALSYHHLPHHLKPCFLYFAIFPED  576

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
            E I V +L+ LW +EGF+++   +++EEVA   L++L DRSLI I    F+G+I++C +H
Sbjct  577  ELIFVDKLMELWASEGFLKVGEMKSIEEVAKKCLKELIDRSLICIHNLSFDGEIESCWMH  636

Query  882  DIVHEFCVREAIKEKLLNV---DNKQHP  956
            D++ E C+REA     +NV    N Q P
Sbjct  637  DVIRELCLREARNMNFVNVLRAKNGQTP  664



>ref|XP_006355462.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=545

 Score =   153 bits (386),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 111/167 (66%), Gaps = 4/167 (2%)
 Frame = +2

Query  35   LYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNE---AAKIDEVTDGELAGKLQKCLR  205
            ++ DP V S F +  W  +S+ + +RKML+ LL +      ++D+V+DG+LA +LQK L+
Sbjct  1    MFYDPSVLSFFGVRGWITMSKDYTLRKMLLCLLQDAIGVKGELDKVSDGDLADRLQKSLK  60

Query  206  GKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNRLHTLGFLN  385
             +RYLIV+DDIWST +W+ I+LCFP++N RSRILLTTR   VA  A S  +    + FL 
Sbjct  61   SRRYLIVVDDIWSTEAWDDIRLCFPENNNRSRILLTTRDMNVAQYASSPKDPF-PMRFLE  119

Query  386  QEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
             EESW+LFC+   G +  P E + + + VV+ C GLPL I VVAG+ 
Sbjct  120  PEESWNLFCQKAFGKKDCPNEFDNVAKVVVESCKGLPLMISVVAGLL  166


 Score =   145 bits (366),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 99/155 (64%), Gaps = 2/155 (1%)
 Frame = +3

Query  537  NKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIV  716
            +KT++EW     Q+ SL+V  D  + CSR+L LSY +LP HLK C LY  + PK   I V
Sbjct  168  SKTLDEWMKV-AQSMSLLVNLDDYQHCSRVLALSYKHLPSHLKTCFLYFGVFPKAREISV  226

Query  717  KRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHE  896
            K+L+RLW+AEG +EL   E LE+VA   L DL D++L+ + +R+  G IK CR+HD++H+
Sbjct  227  KKLIRLWVAEGLIELKGLEGLEKVAANLLHDLIDKNLLVVSRRNLTGSIKACRIHDLLHD  286

Query  897  FCVREAIKEKLLNVDNKQHPSCG-ELQQEGCRWLN  998
             C+REA  E+LL        S G E   EGC W++
Sbjct  287  LCLREAEGERLLYSYVIYRESFGPEFPPEGCHWMS  321



>emb|CAB56299.1| NBS-LRR protein [Solanum acaule]
Length=938

 Score =   162 bits (410),  Expect(2) = 6e-71, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 122/181 (67%), Gaps = 6/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA  LY DP + S FDI     VSQ++ VR +L+ LL+  +   DE  D +LA
Sbjct  172  GGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTS---DE-PDDQLA  227

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +LQK L+G+RYL+V+DDIW+T++W+GI+LCFPD    SRILLTTR+ EVA+ A SSG  
Sbjct  228  DRLQKHLKGRRYLVVIDDIWTTKAWDGIKLCFPDCYKGSRILLTTRNVEVAEYA-SSGKP  286

Query  362  LHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             H +  +N +ESW+L  K  F    S   E E IG+++  KC GLPLAI V+AG+  K  
Sbjct  287  PHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKIS  346

Query  539  Q  541
            +
Sbjct  347  K  347


 Score =   134 bits (336),  Expect(2) = 6e-71, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 96/154 (62%), Gaps = 3/154 (2%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK++KT++EWQN  +  +S VV+TDL  +C R+L LSY++LP HLK C LY +I  +D
Sbjct  341  LLSKISKTLDEWQNVAENVSS-VVSTDLEAKCMRVLALSYHHLPSHLKPCFLYFAIFAED  399

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
            E I V +LV LW  EGF+     +++EEVA   + +L DRSLI I    F+GKI++C +H
Sbjct  400  ERISVTKLVELWAVEGFLNEEEGKSIEEVAETCINELVDRSLISIHNLSFDGKIESCGMH  459

Query  882  DIVHEFCVREAIKEKLLNV--DNKQHPSCGELQQ  977
            D+  E C+REA     +NV        SC +  Q
Sbjct  460  DVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQ  493



>gb|AEW48190.1| disease resistance protein RX4 [Solanum albicans]
Length=909

 Score =   162 bits (410),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 122/181 (67%), Gaps = 6/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA  LY DP + S FDI     VSQ++ VR +L+ LL+  +   DE  D +LA
Sbjct  172  GGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTS---DE-PDDQLA  227

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +LQK L+G+RYL+V+DDIW+T++W+GI+LCFPD    SRILLTTR+ EVA+ A SSG  
Sbjct  228  DRLQKHLKGRRYLVVIDDIWTTKAWDGIKLCFPDCYKGSRILLTTRNVEVAEYA-SSGKP  286

Query  362  LHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             H +  +N +ESW+L  K  F    S   E E IG+++  KC GLPLAI V+AG+  K  
Sbjct  287  PHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKIS  346

Query  539  Q  541
            +
Sbjct  347  K  347


 Score =   134 bits (336),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 96/154 (62%), Gaps = 3/154 (2%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK++KT++EWQN  +  +S VV+TDL  +C R+L LSY++LP HLK C LY +I  +D
Sbjct  341  LLSKISKTLDEWQNVAENVSS-VVSTDLEAKCMRVLALSYHHLPSHLKPCFLYFAIFAED  399

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
            E I V +LV LW  EGF+     +++EEVA   + +L DRSLI I    F+GKI++C +H
Sbjct  400  ERISVTKLVELWAVEGFLNEEEGKSIEEVAETCINELVDRSLISIHNLSFDGKIESCGMH  459

Query  882  DIVHEFCVREAIKEKLLNV--DNKQHPSCGELQQ  977
            D+  E C+REA     +NV        SC +  Q
Sbjct  460  DVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQ  493



>gb|ABY61745.1| resistance protein PSH-RGH6 [Solanum tuberosum]
Length=873

 Score =   164 bits (414),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 118/181 (65%), Gaps = 6/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA  LY DP +   FDI     VSQ++ VR +L  LL    + I +  D +LA
Sbjct  172  GGIGKTTLATKLYSDPCIMPRFDIRAKATVSQEYCVRNVLQGLL----SSISDEPDDQLA  227

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +LQK L+G+RYL+V+DDIW+T +W+ I+LCFPD N  SRILLTTR+ EVA+ A SSG  
Sbjct  228  DRLQKHLKGRRYLVVIDDIWTTETWDDIKLCFPDCNNGSRILLTTRNVEVAEYA-SSGKP  286

Query  362  LHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             H +  +N EESW+L  K  F    S   E E IG+++  KC GLPLAI V+AG+  K  
Sbjct  287  PHHMRLMNFEESWNLLYKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKIS  346

Query  539  Q  541
            +
Sbjct  347  K  347


 Score =   132 bits (331),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 95/152 (63%), Gaps = 3/152 (2%)
 Frame = +3

Query  528  SKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEA  707
            SK++KT++EWQN  +  +S VV+TDL  QC R+L LSY++LP HLK+C LY +I  +DE 
Sbjct  343  SKISKTLDEWQNVAENVSS-VVSTDLEAQCMRVLALSYHHLPSHLKSCFLYFAIFAEDEQ  401

Query  708  IIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDI  887
            I V  LV LW  EGF+     +++EEVA   + +L DRSLI I    F+G+I+ C +HD+
Sbjct  402  IYVNNLVELWGVEGFLNEEEGKSIEEVAETCINELVDRSLISIHNLSFDGEIERCGMHDV  461

Query  888  VHEFCVREAIKEKLLNV--DNKQHPSCGELQQ  977
              E C+REA     +NV        SC +  Q
Sbjct  462  TRELCLREARNMNFVNVIRGKSDQNSCAQSMQ  493



>ref|XP_010324491.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=875

 Score =   169 bits (427),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 114/182 (63%), Gaps = 10/182 (5%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLN---------NEAAKI  154
            GGIGK+T A+ L+ DP V   FD+  W  VS+ +  RKML+ LL          N   + 
Sbjct  177  GGIGKSTFAKKLFSDPSVVGFFDVRGWITVSKDYSSRKMLISLLQDATGVKVEINPQYQE  236

Query  155  DEVTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVA  334
             EV + ELA +LQK  +GKRYLIV+DDIWST +W+ I   FP++N RSRILLTTR  EVA
Sbjct  237  VEVINAELADRLQKSFKGKRYLIVVDDIWSTEAWDDISQWFPENNNRSRILLTTRSMEVA  296

Query  335  DSADSSGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVV  514
              A S  N    + FL+ EESW+LFC+     +  P E E++G+ VV+ C GLPL I VV
Sbjct  297  RHASSPKNPFQ-MRFLDPEESWNLFCQKAFSKKDCPAEFESVGKVVVENCKGLPLMISVV  355

Query  515  AG  520
            AG
Sbjct  356  AG  357


 Score =   124 bits (312),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 92/154 (60%), Gaps = 3/154 (2%)
 Frame = +3

Query  540   KTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVK  719
             +T+ EW    +  +SLV   D  ++CS +L LSYN+LP  LK C LY  +  K   I V+
Sbjct  363   RTLNEWNEVAQSVSSLVNLDDY-QRCSGVLALSYNHLPPDLKVCFLYFGVFKKASEISVE  421

Query  720   RLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEF  899
              L+RLW+AEG  +L    +LE+ A   L DL DRSLI + K   +GKIKTCR+HD++H+ 
Sbjct  422   NLIRLWMAEGLFKLRGIRDLEKEACSLLHDLIDRSLIVVCKHSLDGKIKTCRIHDLLHDL  481

Query  900   CVREAIKEKLLNVDNKQHPSCGELQQEGCRWLNF  1001
             C+RE+  E LL V N    +    Q    RW++F
Sbjct  482   CLRESESESLLYVSNPSLSATNIPQDR--RWVSF  513



>ref|XP_009602301.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X4 [Nicotiana tomentosiformis]
 ref|XP_009602302.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X4 [Nicotiana tomentosiformis]
Length=871

 Score =   151 bits (382),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 115/182 (63%), Gaps = 11/182 (6%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN----EAAKIDEVTD  169
            GGIGK+T A+ ++  P V S FDI  W  VS+ +  RKML+ LL +    +   +D+  D
Sbjct  178  GGIGKSTFAKKIFAHPPVLSFFDICGWITVSEDYSYRKMLLGLLKDVNIGKEEDLDKKND  237

Query  170  GELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADS  349
             +LA  L++ L G+RYLIV+DDIWS  +W+ I+LC PDD  RSR+LLTTR  EVA  A S
Sbjct  238  SDLAVCLKQSLMGRRYLIVVDDIWSKNAWDEIRLCLPDDGKRSRVLLTTRDVEVAQYASS  297

Query  350  SGN--RLHTLGFLNQEESWDLF-CKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAG  520
            S +  ++H LG    ++SW+LF  K+F G +  P E E +G+ V   C GLPL I VVA 
Sbjct  298  SKDPFKMHLLG---PDDSWNLFQQKAFAG-KGFPIEFEDVGKDVAKNCKGLPLMIAVVAK  353

Query  521  VF  526
            + 
Sbjct  354  IL  355


 Score =   142 bits (357),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 107/168 (64%), Gaps = 7/168 (4%)
 Frame = +3

Query  540   KTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVK  719
             +T+EEW+   ++ +SL    D  +QCS +L LSYN+LP +LK C LY  + PK   I ++
Sbjct  359   RTLEEWRKVAERVSSLA-EVDAYQQCSGVLALSYNHLPSYLKGCFLYFGLFPKASEISME  417

Query  720   RLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEF  899
             +L+RLWIAEG +++   + LEEVA  +L  L D+SL+ + KR  +GKI TC +HD+VH+F
Sbjct  418   KLIRLWIAEGLLKVKGMKGLEEVAASHLNFLIDKSLVIVSKRSMDGKIMTCMIHDLVHDF  477

Query  900   CVREAIKEKLLNVDNKQHPSCGELQQEGCRWLN------FWPKKIPDL  1025
             C++EA  + LL + N        +  EGCRW++      ++ ++ PDL
Sbjct  478   CLKEADSQNLLYIVNTDIDGPLWVIPEGCRWVSQQSMGFYFHRRFPDL  525



>gb|AEW48211.1| disease resistance protein RGH1 [Solanum hougasii]
Length=814

 Score =   158 bits (400),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 120/182 (66%), Gaps = 6/182 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA  LY DP + S FDI     VSQ++ VR +L+ LL+  +   DE  D +LA
Sbjct  72   GGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTS---DE-PDDQLA  127

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +LQK L+G+RYL+V+DDIW+T +W+ I+LCFPD    SRILLTTR+ EVA+ A SSG  
Sbjct  128  DRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCINGSRILLTTRNVEVAEYA-SSGKP  186

Query  362  LHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             H +  +N +ESW+L  K  F    S   E E IG+++  KC GLPLAI V+AG+  K  
Sbjct  187  PHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKIS  246

Query  539  QN  544
            + 
Sbjct  247  KT  248


 Score =   134 bits (337),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 97/154 (63%), Gaps = 3/154 (2%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK++KT++EWQN  +  +S VV+TDL  +C R+L LSY++LP HLK C LY +I  +D
Sbjct  241  LLSKISKTLDEWQNVAENVSS-VVSTDLEAKCMRVLALSYHHLPSHLKPCFLYFAIFAED  299

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
            E I V +LV LW  EGF+     +++EEVA   + +L DRSLI I K  F+G+I++C +H
Sbjct  300  EQISVTKLVELWAVEGFLNEEEGKSIEEVAETCINELVDRSLISIHKLSFDGEIQSCGMH  359

Query  882  DIVHEFCVREAIKEKLLNV--DNKQHPSCGELQQ  977
            D+  E C+REA     +NV        SC +  Q
Sbjct  360  DVTRELCLREAQNMNFVNVIRGKSDQNSCAQSMQ  393



>ref|XP_009602415.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602416.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602417.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602418.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=935

 Score =   177 bits (448),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 126/183 (69%), Gaps = 4/183 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAK--IDEVTD-G  172
            GGIGKTTLA+ +++D  + SHFD+  W  +S++H+V+ +LV LL +   K  I  + D  
Sbjct  197  GGIGKTTLAKDVFDDVTIRSHFDVRAWATISKEHNVKDILVSLLRSTKEKDGIIHIEDET  256

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            EL   LQK L+GKRYLIVLDDIW   +W+ ++LCFP +N  SRILLTTR+ EVA SA + 
Sbjct  257  ELPLMLQKSLKGKRYLIVLDDIWKNEAWDDVRLCFPSENKGSRILLTTRNIEVACSAGTE  316

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
               L  L F+N +ESW+LF    P  ++LP E ET+G+++V+KC GLPL  VVVAG+  K
Sbjct  317  NLSLR-LDFMNPDESWNLFKSIIPANEALPSEFETVGKQIVEKCQGLPLTTVVVAGLLSK  375

Query  533  TQQ  541
             ++
Sbjct  376  CKR  378


 Score =   114 bits (284),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 86/142 (61%), Gaps = 8/142 (6%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK  +T+E W+N  K   S V   D  +QC  +L LSYN+L   LK C+LY  I P+D
Sbjct  372  LLSKCKRTIEVWKNVAKDVKSFV-KNDRDKQCQHVLGLSYNHLTSDLKPCLLYFGIFPED  430

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQI-QKRHFNGKIKTCRV  878
              I VKRLVRLW AEGF++       EE A   LQ+L DR L+ + +K  +  KI++C+V
Sbjct  431  SEISVKRLVRLWTAEGFLK------SEEEAEKCLQELIDRCLVLVSRKSRYETKIRSCKV  484

Query  879  HDIVHEFCVREAIKEKLLNVDN  944
            HD+++E C+REA K     +++
Sbjct  485  HDLIYELCLREAEKRTFFVIND  506



>ref|XP_009602420.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana tomentosiformis]
Length=916

 Score =   177 bits (448),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 126/183 (69%), Gaps = 4/183 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAK--IDEVTD-G  172
            GGIGKTTLA+ +++D  + SHFD+  W  +S++H+V+ +LV LL +   K  I  + D  
Sbjct  197  GGIGKTTLAKDVFDDVTIRSHFDVRAWATISKEHNVKDILVSLLRSTKEKDGIIHIEDET  256

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            EL   LQK L+GKRYLIVLDDIW   +W+ ++LCFP +N  SRILLTTR+ EVA SA + 
Sbjct  257  ELPLMLQKSLKGKRYLIVLDDIWKNEAWDDVRLCFPSENKGSRILLTTRNIEVACSAGTE  316

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
               L  L F+N +ESW+LF    P  ++LP E ET+G+++V+KC GLPL  VVVAG+  K
Sbjct  317  NLSLR-LDFMNPDESWNLFKSIIPANEALPSEFETVGKQIVEKCQGLPLTTVVVAGLLSK  375

Query  533  TQQ  541
             ++
Sbjct  376  CKR  378


 Score =   114 bits (285),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 86/142 (61%), Gaps = 8/142 (6%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK  +T+E W+N  K   S V   D  +QC  +L LSYN+L   LK C+LY  I P+D
Sbjct  372  LLSKCKRTIEVWKNVAKDVKSFV-KNDRDKQCQHVLGLSYNHLTSDLKPCLLYFGIFPED  430

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQI-QKRHFNGKIKTCRV  878
              I VKRLVRLW AEGF++       EE A   LQ+L DR L+ + +K  +  KI++C+V
Sbjct  431  SEISVKRLVRLWTAEGFLK------SEEEAEKCLQELIDRCLVLVSRKSRYETKIRSCKV  484

Query  879  HDIVHEFCVREAIKEKLLNVDN  944
            HD+++E C+REA K     +++
Sbjct  485  HDLIYELCLREAEKRTFFVIND  506



>ref|XP_009602419.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=929

 Score =   177 bits (448),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 126/183 (69%), Gaps = 4/183 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAK--IDEVTD-G  172
            GGIGKTTLA+ +++D  + SHFD+  W  +S++H+V+ +LV LL +   K  I  + D  
Sbjct  197  GGIGKTTLAKDVFDDVTIRSHFDVRAWATISKEHNVKDILVSLLRSTKEKDGIIHIEDET  256

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            EL   LQK L+GKRYLIVLDDIW   +W+ ++LCFP +N  SRILLTTR+ EVA SA + 
Sbjct  257  ELPLMLQKSLKGKRYLIVLDDIWKNEAWDDVRLCFPSENKGSRILLTTRNIEVACSAGTE  316

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
               L  L F+N +ESW+LF    P  ++LP E ET+G+++V+KC GLPL  VVVAG+  K
Sbjct  317  NLSLR-LDFMNPDESWNLFKSIIPANEALPSEFETVGKQIVEKCQGLPLTTVVVAGLLSK  375

Query  533  TQQ  541
             ++
Sbjct  376  CKR  378


 Score =   114 bits (284),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 86/142 (61%), Gaps = 8/142 (6%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK  +T+E W+N  K   S V   D  +QC  +L LSYN+L   LK C+LY  I P+D
Sbjct  372  LLSKCKRTIEVWKNVAKDVKSFV-KNDRDKQCQHVLGLSYNHLTSDLKPCLLYFGIFPED  430

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQI-QKRHFNGKIKTCRV  878
              I VKRLVRLW AEGF++       EE A   LQ+L DR L+ + +K  +  KI++C+V
Sbjct  431  SEISVKRLVRLWTAEGFLK------SEEEAEKCLQELIDRCLVLVSRKSRYETKIRSCKV  484

Query  879  HDIVHEFCVREAIKEKLLNVDN  944
            HD+++E C+REA K     +++
Sbjct  485  HDLIYELCLREAEKRTFFVIND  506



>gb|AEW48197.1| disease resistance protein RGH3 [Solanum x edinense]
Length=933

 Score =   161 bits (407),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 119/181 (66%), Gaps = 6/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA  LY DP + S FDI     VSQ++ VR +++ LL++    I    D +LA
Sbjct  172  GGIGKTTLATKLYSDPYIMSRFDIRTKVTVSQEYCVRNVILGLLSS----ISNEPDDQLA  227

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +LQK L+G+RYL+V+DDIW+T +W+ I+ CFPD N  SRILLTTR+ EVA+ A SSG  
Sbjct  228  DRLQKNLKGRRYLVVIDDIWTTEAWDDIKQCFPDCNNGSRILLTTRNVEVAEYA-SSGKP  286

Query  362  LHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             H +  +N +ESW+L  K  F    S   E E IG+++  KC GLPLAI V+AG+  K  
Sbjct  287  PHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKIS  346

Query  539  Q  541
            +
Sbjct  347  K  347


 Score =   129 bits (324),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 94/154 (61%), Gaps = 3/154 (2%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK++KT++EWQN  +  +S VV+TDL  +C R+L LSY++LP HLK C LY +I  +D
Sbjct  341  LLSKISKTLDEWQNVAENVSS-VVSTDLEAKCMRVLALSYHHLPSHLKPCFLYFAIFAED  399

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
            E I V  LV LW  EGF+     +++EEVA   + +L DRSLI I    F+G+I+ C +H
Sbjct  400  EQIYVSELVELWAVEGFLNEEAGKSIEEVAETCINELVDRSLISIHNLSFDGEIERCGMH  459

Query  882  DIVHEFCVREAIKEKLLNV--DNKQHPSCGELQQ  977
            D+  E C++EA     +NV        SC +  Q
Sbjct  460  DVTRELCLKEARNMNFVNVIRGKSDQNSCAQSMQ  493



>gb|AEW48201.1| disease resistance protein RGH9 [Solanum x edinense]
Length=838

 Score =   158 bits (399),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 120/181 (66%), Gaps = 6/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA  LY DP + S FDI     VSQ++ VR +L+ LL+  +   DE  D +LA
Sbjct  72   GGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTS---DE-PDDQLA  127

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +LQK L+G+RYL+V+DDIW+T +W+ I+LCFPD    SRILLTTR+ EVA+ A SSG  
Sbjct  128  DRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCINGSRILLTTRNVEVAEYA-SSGKP  186

Query  362  LHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             H +  +N +ESW+L  K  F    S   E E IG+++  KC GLPLAI V+AG+  K  
Sbjct  187  PHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKIS  246

Query  539  Q  541
            +
Sbjct  247  K  247


 Score =   132 bits (332),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 96/154 (62%), Gaps = 3/154 (2%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK++KT++EWQN  +  +S VV+TDL  +C R+L LSY++LP HLK C LY +I  +D
Sbjct  241  LLSKISKTLDEWQNVAENVSS-VVSTDLEAKCMRVLALSYHHLPSHLKPCFLYFAIFAED  299

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
            E I V +LV LW  EGF+     +++EEVA   + +L DRSLI I    F+G+I++C +H
Sbjct  300  EQISVTKLVELWAVEGFLNEEEGKSIEEVAETCINELVDRSLISIHNLSFDGEIQSCGMH  359

Query  882  DIVHEFCVREAIKEKLLNV--DNKQHPSCGELQQ  977
            D+  E C+REA     +NV        SC +  Q
Sbjct  360  DVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQ  393



>gb|AEW48192.1| disease resistance protein RGH3 [Solanum chacoense]
Length=932

 Score =   157 bits (397),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 119/181 (66%), Gaps = 6/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA  LY DP + S FDI     VSQ++ VR +L+ LL+  +   DE  D +LA
Sbjct  173  GGIGKTTLATKLYTDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTS---DE-PDYQLA  228

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +LQK L+G+RYL+V+DDIW+T +W+ I+ CFPD    SRILLTTR+ EVA+ A SSG  
Sbjct  229  DRLQKHLKGRRYLVVIDDIWTTEAWDNIKPCFPDCYNGSRILLTTRNVEVAEYA-SSGKP  287

Query  362  LHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             H +  +N +ESW+L  K  F    S   E E IG+++  KC GLPLAI V+AG+  K  
Sbjct  288  PHNMRLMNFDESWNLLHKMIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKIS  347

Query  539  Q  541
            +
Sbjct  348  K  348


 Score =   131 bits (330),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 95/152 (63%), Gaps = 3/152 (2%)
 Frame = +3

Query  528  SKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEA  707
            SK++KT++EW+N  +  +S VV+TDL  +C R+L LSY++LP HLK C LY +I  +DE 
Sbjct  344  SKISKTLDEWKNVAENVSS-VVSTDLEAKCMRVLALSYHHLPSHLKPCFLYFAIFAEDER  402

Query  708  IIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDI  887
            I V +LV LW  EGF+     +++EEVA   + +L DRSLI I    F+GKI+ C +HD+
Sbjct  403  IYVNKLVELWAVEGFLNEEEGKSIEEVAETCINELVDRSLISIHNLSFDGKIERCGMHDV  462

Query  888  VHEFCVREAIKEKLLNV--DNKQHPSCGELQQ  977
              E C+REA     +NV        SC +  Q
Sbjct  463  TRELCLREARNMNFVNVIRGKSDQNSCAQSMQ  494



>ref|XP_009606267.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=927

 Score =   171 bits (433),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 122/181 (67%), Gaps = 2/181 (1%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTD-GEL  178
            GGIGKTTLA+ +Y D  + SHFD+  W  VS  H+++++L+ LL +       + D  EL
Sbjct  182  GGIGKTTLAKEVYNDVSIRSHFDVRAWATVSSHHNIKEILLSLLRSRMGDTFYMEDEAEL  241

Query  179  AGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGN  358
            A  LQK L+ +RYLIV+DD+WS+++W+ ++ CFP +N  SRILLTTR  +VA  A +   
Sbjct  242  ADMLQKSLKSRRYLIVMDDMWSSKAWDDVRQCFPSENNESRILLTTRDTDVACYAGTENF  301

Query  359  RLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             L  + F++  ESW+LF  +    + LP E ETIG+++VDKC GLPL IVVVAG+  K++
Sbjct  302  SLQ-MSFMDPYESWNLFKSAAFANEELPSEYETIGKQIVDKCQGLPLTIVVVAGLLSKSE  360

Query  539  Q  541
            +
Sbjct  361  R  361


 Score =   117 bits (293),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 91/141 (65%), Gaps = 4/141 (3%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK  +T+E+W+N  +   S V T D  +QC  +L LSYN+L  +LKAC+LY    P+D
Sbjct  355  LLSKSERTIEDWENIAQDVMSFV-TNDPDKQCLHVLGLSYNHLTSNLKACLLYFGAFPED  413

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQI-QKRHFNGKIKTCRV  878
              I VKRLVRLWIAEGF++L   ++ E  A   L+DL DR LI + +K+    +IK+C+V
Sbjct  414  REISVKRLVRLWIAEGFLKL--EKDFEGEAAKCLKDLVDRCLILVCEKKWDETEIKSCKV  471

Query  879  HDIVHEFCVREAIKEKLLNVD  941
            HD+++E C+REA  +  +  D
Sbjct  472  HDLIYELCLREAQSQNFIMND  492



>ref|XP_009606292.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X16 [Nicotiana tomentosiformis]
Length=957

 Score =   177 bits (448),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 128/183 (70%), Gaps = 4/183 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVT---DG  172
            GGIGKTTLA+ +++D  + SHFD+  W  VS +H+V+++L+ LL++     D+     + 
Sbjct  179  GGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEP  238

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA  L+K L+GKRYLIVLDDIW +++W+ ++LCFP +N  SRILLTTR  EVA  A + 
Sbjct  239  ELADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTE  298

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
               L  + F++ +ESW+LF  +    ++LP E E IG+++VDKC GLPL IVVVAG+  K
Sbjct  299  NLSLQ-MDFMHPDESWNLFRSAASANEALPSEFEAIGKQIVDKCQGLPLTIVVVAGILSK  357

Query  533  TQQ  541
            +++
Sbjct  358  SER  360


 Score =   111 bits (277),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 81/130 (62%), Gaps = 4/130 (3%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             SK  +T+E+W+N  K   S V   D  E C  +L LSYN+L   LKAC+LY  I P+D 
Sbjct  355  LSKSERTIEDWENVAKDVKSFV-KNDPDELCLHVLGLSYNHLTSDLKACLLYFGIFPEDS  413

Query  705  AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFN-GKIKTCRVH  881
             I VKRLVRLW A GF++L   ++LE  A   L DL DR L+ +     +  KIK+C+VH
Sbjct  414  EISVKRLVRLWTAGGFLKL--EKDLEGEAEKCLHDLIDRCLVLVNNISLDESKIKSCKVH  471

Query  882  DIVHEFCVRE  911
            D+++E C+RE
Sbjct  472  DLIYELCLRE  481



>ref|XP_009606288.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X12 [Nicotiana tomentosiformis]
Length=974

 Score =   177 bits (448),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 128/183 (70%), Gaps = 4/183 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVT---DG  172
            GGIGKTTLA+ +++D  + SHFD+  W  VS +H+V+++L+ LL++     D+     + 
Sbjct  179  GGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEP  238

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA  L+K L+GKRYLIVLDDIW +++W+ ++LCFP +N  SRILLTTR  EVA  A + 
Sbjct  239  ELADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTE  298

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
               L  + F++ +ESW+LF  +    ++LP E E IG+++VDKC GLPL IVVVAG+  K
Sbjct  299  NLSLQ-MDFMHPDESWNLFRSAASANEALPSEFEAIGKQIVDKCQGLPLTIVVVAGILSK  357

Query  533  TQQ  541
            +++
Sbjct  358  SER  360


 Score =   110 bits (276),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 81/130 (62%), Gaps = 4/130 (3%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             SK  +T+E+W+N  K   S V   D  E C  +L LSYN+L   LKAC+LY  I P+D 
Sbjct  355  LSKSERTIEDWENVAKDVKSFV-KNDPDELCLHVLGLSYNHLTSDLKACLLYFGIFPEDS  413

Query  705  AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFN-GKIKTCRVH  881
             I VKRLVRLW A GF++L   ++LE  A   L DL DR L+ +     +  KIK+C+VH
Sbjct  414  EISVKRLVRLWTAGGFLKL--EKDLEGEAEKCLHDLIDRCLVLVNNISLDESKIKSCKVH  471

Query  882  DIVHEFCVRE  911
            D+++E C+RE
Sbjct  472  DLIYELCLRE  481



>ref|XP_009606270.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=1055

 Score =   176 bits (447),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 128/183 (70%), Gaps = 4/183 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVT---DG  172
            GGIGKTTLA+ +++D  + SHFD+  W  VS +H+V+++L+ LL++     D+     + 
Sbjct  179  GGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEP  238

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA  L+K L+GKRYLIVLDDIW +++W+ ++LCFP +N  SRILLTTR  EVA  A + 
Sbjct  239  ELADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTE  298

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
               L  + F++ +ESW+LF  +    ++LP E E IG+++VDKC GLPL IVVVAG+  K
Sbjct  299  NLSLQ-MDFMHPDESWNLFRSAASANEALPSEFEAIGKQIVDKCQGLPLTIVVVAGILSK  357

Query  533  TQQ  541
            +++
Sbjct  358  SER  360


 Score =   111 bits (277),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 81/130 (62%), Gaps = 4/130 (3%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             SK  +T+E+W+N  K   S V   D  E C  +L LSYN+L   LKAC+LY  I P+D 
Sbjct  355  LSKSERTIEDWENVAKDVKSFV-KNDPDELCLHVLGLSYNHLTSDLKACLLYFGIFPEDS  413

Query  705  AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFN-GKIKTCRVH  881
             I VKRLVRLW A GF++L   ++LE  A   L DL DR L+ +     +  KIK+C+VH
Sbjct  414  EISVKRLVRLWTAGGFLKL--EKDLEGEAEKCLHDLIDRCLVLVNNISLDESKIKSCKVH  471

Query  882  DIVHEFCVRE  911
            D+++E C+RE
Sbjct  472  DLIYELCLRE  481



>ref|XP_009606276.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X5 [Nicotiana tomentosiformis]
Length=1036

 Score =   176 bits (447),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 128/183 (70%), Gaps = 4/183 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVT---DG  172
            GGIGKTTLA+ +++D  + SHFD+  W  VS +H+V+++L+ LL++     D+     + 
Sbjct  179  GGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEP  238

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA  L+K L+GKRYLIVLDDIW +++W+ ++LCFP +N  SRILLTTR  EVA  A + 
Sbjct  239  ELADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTE  298

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
               L  + F++ +ESW+LF  +    ++LP E E IG+++VDKC GLPL IVVVAG+  K
Sbjct  299  NLSLQ-MDFMHPDESWNLFRSAASANEALPSEFEAIGKQIVDKCQGLPLTIVVVAGILSK  357

Query  533  TQQ  541
            +++
Sbjct  358  SER  360


 Score =   111 bits (277),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 81/130 (62%), Gaps = 4/130 (3%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             SK  +T+E+W+N  K   S V   D  E C  +L LSYN+L   LKAC+LY  I P+D 
Sbjct  355  LSKSERTIEDWENVAKDVKSFV-KNDPDELCLHVLGLSYNHLTSDLKACLLYFGIFPEDS  413

Query  705  AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFN-GKIKTCRVH  881
             I VKRLVRLW A GF++L   ++LE  A   L DL DR L+ +     +  KIK+C+VH
Sbjct  414  EISVKRLVRLWTAGGFLKL--EKDLEGEAEKCLHDLIDRCLVLVNNISLDESKIKSCKVH  471

Query  882  DIVHEFCVRE  911
            D+++E C+RE
Sbjct  472  DLIYELCLRE  481



>ref|XP_009606290.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X14 [Nicotiana tomentosiformis]
Length=971

 Score =   176 bits (447),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 128/183 (70%), Gaps = 4/183 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVT---DG  172
            GGIGKTTLA+ +++D  + SHFD+  W  VS +H+V+++L+ LL++     D+     + 
Sbjct  179  GGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEP  238

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA  L+K L+GKRYLIVLDDIW +++W+ ++LCFP +N  SRILLTTR  EVA  A + 
Sbjct  239  ELADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTE  298

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
               L  + F++ +ESW+LF  +    ++LP E E IG+++VDKC GLPL IVVVAG+  K
Sbjct  299  NLSLQ-MDFMHPDESWNLFRSAASANEALPSEFEAIGKQIVDKCQGLPLTIVVVAGILSK  357

Query  533  TQQ  541
            +++
Sbjct  358  SER  360


 Score =   111 bits (277),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 81/130 (62%), Gaps = 4/130 (3%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             SK  +T+E+W+N  K   S V   D  E C  +L LSYN+L   LKAC+LY  I P+D 
Sbjct  355  LSKSERTIEDWENVAKDVKSFV-KNDPDELCLHVLGLSYNHLTSDLKACLLYFGIFPEDS  413

Query  705  AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFN-GKIKTCRVH  881
             I VKRLVRLW A GF++L   ++LE  A   L DL DR L+ +     +  KIK+C+VH
Sbjct  414  EISVKRLVRLWTAGGFLKL--EKDLEGEAEKCLHDLIDRCLVLVNNISLDESKIKSCKVH  471

Query  882  DIVHEFCVRE  911
            D+++E C+RE
Sbjct  472  DLIYELCLRE  481



>ref|XP_009606273.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
 ref|XP_009606275.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
Length=1038

 Score =   176 bits (447),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 128/183 (70%), Gaps = 4/183 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVT---DG  172
            GGIGKTTLA+ +++D  + SHFD+  W  VS +H+V+++L+ LL++     D+     + 
Sbjct  179  GGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEP  238

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA  L+K L+GKRYLIVLDDIW +++W+ ++LCFP +N  SRILLTTR  EVA  A + 
Sbjct  239  ELADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTE  298

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
               L  + F++ +ESW+LF  +    ++LP E E IG+++VDKC GLPL IVVVAG+  K
Sbjct  299  NLSLQ-MDFMHPDESWNLFRSAASANEALPSEFEAIGKQIVDKCQGLPLTIVVVAGILSK  357

Query  533  TQQ  541
            +++
Sbjct  358  SER  360


 Score =   110 bits (276),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 81/130 (62%), Gaps = 4/130 (3%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             SK  +T+E+W+N  K   S V   D  E C  +L LSYN+L   LKAC+LY  I P+D 
Sbjct  355  LSKSERTIEDWENVAKDVKSFV-KNDPDELCLHVLGLSYNHLTSDLKACLLYFGIFPEDS  413

Query  705  AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFN-GKIKTCRVH  881
             I VKRLVRLW A GF++L   ++LE  A   L DL DR L+ +     +  KIK+C+VH
Sbjct  414  EISVKRLVRLWTAGGFLKL--EKDLEGEAEKCLHDLIDRCLVLVNNISLDESKIKSCKVH  471

Query  882  DIVHEFCVRE  911
            D+++E C+RE
Sbjct  472  DLIYELCLRE  481



>ref|XP_009606280.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X9 [Nicotiana tomentosiformis]
Length=1013

 Score =   176 bits (447),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 128/183 (70%), Gaps = 4/183 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVT---DG  172
            GGIGKTTLA+ +++D  + SHFD+  W  VS +H+V+++L+ LL++     D+     + 
Sbjct  179  GGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEP  238

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA  L+K L+GKRYLIVLDDIW +++W+ ++LCFP +N  SRILLTTR  EVA  A + 
Sbjct  239  ELADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTE  298

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
               L  + F++ +ESW+LF  +    ++LP E E IG+++VDKC GLPL IVVVAG+  K
Sbjct  299  NLSLQ-MDFMHPDESWNLFRSAASANEALPSEFEAIGKQIVDKCQGLPLTIVVVAGILSK  357

Query  533  TQQ  541
            +++
Sbjct  358  SER  360


 Score =   111 bits (277),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 81/130 (62%), Gaps = 4/130 (3%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             SK  +T+E+W+N  K   S V   D  E C  +L LSYN+L   LKAC+LY  I P+D 
Sbjct  355  LSKSERTIEDWENVAKDVKSFV-KNDPDELCLHVLGLSYNHLTSDLKACLLYFGIFPEDS  413

Query  705  AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFN-GKIKTCRVH  881
             I VKRLVRLW A GF++L   ++LE  A   L DL DR L+ +     +  KIK+C+VH
Sbjct  414  EISVKRLVRLWTAGGFLKL--EKDLEGEAEKCLHDLIDRCLVLVNNISLDESKIKSCKVH  471

Query  882  DIVHEFCVRE  911
            D+++E C+RE
Sbjct  472  DLIYELCLRE  481



>ref|XP_009606289.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X13 [Nicotiana tomentosiformis]
Length=974

 Score =   177 bits (448),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 128/183 (70%), Gaps = 4/183 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVT---DG  172
            GGIGKTTLA+ +++D  + SHFD+  W  VS +H+V+++L+ LL++     D+     + 
Sbjct  179  GGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEP  238

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA  L+K L+GKRYLIVLDDIW +++W+ ++LCFP +N  SRILLTTR  EVA  A + 
Sbjct  239  ELADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTE  298

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
               L  + F++ +ESW+LF  +    ++LP E E IG+++VDKC GLPL IVVVAG+  K
Sbjct  299  NLSLQ-MDFMHPDESWNLFRSAASANEALPSEFEAIGKQIVDKCQGLPLTIVVVAGILSK  357

Query  533  TQQ  541
            +++
Sbjct  358  SER  360


 Score =   110 bits (276),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 81/130 (62%), Gaps = 4/130 (3%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             SK  +T+E+W+N  K   S V   D  E C  +L LSYN+L   LKAC+LY  I P+D 
Sbjct  355  LSKSERTIEDWENVAKDVKSFV-KNDPDELCLHVLGLSYNHLTSDLKACLLYFGIFPEDS  413

Query  705  AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFN-GKIKTCRVH  881
             I VKRLVRLW A GF++L   ++LE  A   L DL DR L+ +     +  KIK+C+VH
Sbjct  414  EISVKRLVRLWTAGGFLKL--EKDLEGEAEKCLHDLIDRCLVLVNNISLDESKIKSCKVH  471

Query  882  DIVHEFCVRE  911
            D+++E C+RE
Sbjct  472  DLIYELCLRE  481



>gb|AFB17976.1| Rx-like protein, partial [Solanum acaule]
Length=350

 Score =   159 bits (403),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 121/182 (66%), Gaps = 6/182 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA  LY DP + S FDI     VSQ++ VR +L+ LL+  +   DE  D +LA
Sbjct  49   GGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTS---DE-PDDQLA  104

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +LQ+ L+G+RYL+V+DDIW+T++W+GI+LCFPD    SR LLTTR+ EVA+ A SSG  
Sbjct  105  DRLQEHLKGRRYLVVIDDIWTTKAWDGIKLCFPDCYKGSRTLLTTRNVEVAEYA-SSGKP  163

Query  362  LHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             H +  +N +ESW+L  K  F    S   E E IG+++  KC GLPLAI V+AG+  K  
Sbjct  164  PHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKIS  223

Query  539  QN  544
            + 
Sbjct  224  KT  225


 Score =   128 bits (321),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 87/131 (66%), Gaps = 1/131 (1%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK++KT++EWQN  +  +S VV+TDL  +C R+L LSY++LP HLK C LY +I  +D
Sbjct  218  LLSKISKTLDEWQNVAENVSS-VVSTDLEAKCMRVLALSYHHLPSHLKPCFLYFAIFAED  276

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
            E I V +LV LW  EGF+     +++EEVA   + +L DRSLI I    F G I++C +H
Sbjct  277  EQISVTKLVELWAVEGFLNEEEGKSIEEVAETCINELVDRSLIFIHNFSFRGTIESCGMH  336

Query  882  DIVHEFCVREA  914
            D+  E C+REA
Sbjct  337  DVTRELCLREA  347



>ref|XP_009606271.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=1049

 Score =   176 bits (447),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 128/183 (70%), Gaps = 4/183 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVT---DG  172
            GGIGKTTLA+ +++D  + SHFD+  W  VS +H+V+++L+ LL++     D+     + 
Sbjct  179  GGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEP  238

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA  L+K L+GKRYLIVLDDIW +++W+ ++LCFP +N  SRILLTTR  EVA  A + 
Sbjct  239  ELADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTE  298

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
               L  + F++ +ESW+LF  +    ++LP E E IG+++VDKC GLPL IVVVAG+  K
Sbjct  299  NLSLQ-MDFMHPDESWNLFRSAASANEALPSEFEAIGKQIVDKCQGLPLTIVVVAGILSK  357

Query  533  TQQ  541
            +++
Sbjct  358  SER  360


 Score =   111 bits (277),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 81/130 (62%), Gaps = 4/130 (3%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             SK  +T+E+W+N  K   S V   D  E C  +L LSYN+L   LKAC+LY  I P+D 
Sbjct  355  LSKSERTIEDWENVAKDVKSFV-KNDPDELCLHVLGLSYNHLTSDLKACLLYFGIFPEDS  413

Query  705  AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFN-GKIKTCRVH  881
             I VKRLVRLW A GF++L   ++LE  A   L DL DR L+ +     +  KIK+C+VH
Sbjct  414  EISVKRLVRLWTAGGFLKL--EKDLEGEAEKCLHDLIDRCLVLVNNISLDESKIKSCKVH  471

Query  882  DIVHEFCVRE  911
            D+++E C+RE
Sbjct  472  DLIYELCLRE  481



>ref|XP_009606272.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana tomentosiformis]
Length=1039

 Score =   176 bits (447),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 128/183 (70%), Gaps = 4/183 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVT---DG  172
            GGIGKTTLA+ +++D  + SHFD+  W  VS +H+V+++L+ LL++     D+     + 
Sbjct  179  GGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEP  238

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA  L+K L+GKRYLIVLDDIW +++W+ ++LCFP +N  SRILLTTR  EVA  A + 
Sbjct  239  ELADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTE  298

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
               L  + F++ +ESW+LF  +    ++LP E E IG+++VDKC GLPL IVVVAG+  K
Sbjct  299  NLSLQ-MDFMHPDESWNLFRSAASANEALPSEFEAIGKQIVDKCQGLPLTIVVVAGILSK  357

Query  533  TQQ  541
            +++
Sbjct  358  SER  360


 Score =   111 bits (277),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 81/130 (62%), Gaps = 4/130 (3%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             SK  +T+E+W+N  K   S V   D  E C  +L LSYN+L   LKAC+LY  I P+D 
Sbjct  355  LSKSERTIEDWENVAKDVKSFV-KNDPDELCLHVLGLSYNHLTSDLKACLLYFGIFPEDS  413

Query  705  AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFN-GKIKTCRVH  881
             I VKRLVRLW A GF++L   ++LE  A   L DL DR L+ +     +  KIK+C+VH
Sbjct  414  EISVKRLVRLWTAGGFLKL--EKDLEGEAEKCLHDLIDRCLVLVNNISLDESKIKSCKVH  471

Query  882  DIVHEFCVRE  911
            D+++E C+RE
Sbjct  472  DLIYELCLRE  481



>ref|XP_009606278.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X7 [Nicotiana tomentosiformis]
Length=1031

 Score =   176 bits (447),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 128/183 (70%), Gaps = 4/183 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVT---DG  172
            GGIGKTTLA+ +++D  + SHFD+  W  VS +H+V+++L+ LL++     D+     + 
Sbjct  179  GGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEP  238

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA  L+K L+GKRYLIVLDDIW +++W+ ++LCFP +N  SRILLTTR  EVA  A + 
Sbjct  239  ELADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTE  298

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
               L  + F++ +ESW+LF  +    ++LP E E IG+++VDKC GLPL IVVVAG+  K
Sbjct  299  NLSLQ-MDFMHPDESWNLFRSAASANEALPSEFEAIGKQIVDKCQGLPLTIVVVAGILSK  357

Query  533  TQQ  541
            +++
Sbjct  358  SER  360


 Score =   111 bits (277),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 81/130 (62%), Gaps = 4/130 (3%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             SK  +T+E+W+N  K   S V   D  E C  +L LSYN+L   LKAC+LY  I P+D 
Sbjct  355  LSKSERTIEDWENVAKDVKSFV-KNDPDELCLHVLGLSYNHLTSDLKACLLYFGIFPEDS  413

Query  705  AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFN-GKIKTCRVH  881
             I VKRLVRLW A GF++L   ++LE  A   L DL DR L+ +     +  KIK+C+VH
Sbjct  414  EISVKRLVRLWTAGGFLKL--EKDLEGEAEKCLHDLIDRCLVLVNNISLDESKIKSCKVH  471

Query  882  DIVHEFCVRE  911
            D+++E C+RE
Sbjct  472  DLIYELCLRE  481



>ref|XP_009606291.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X15 [Nicotiana tomentosiformis]
Length=959

 Score =   176 bits (447),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 128/183 (70%), Gaps = 4/183 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVT---DG  172
            GGIGKTTLA+ +++D  + SHFD+  W  VS +H+V+++L+ LL++     D+     + 
Sbjct  179  GGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEP  238

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA  L+K L+GKRYLIVLDDIW +++W+ ++LCFP +N  SRILLTTR  EVA  A + 
Sbjct  239  ELADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTE  298

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
               L  + F++ +ESW+LF  +    ++LP E E IG+++VDKC GLPL IVVVAG+  K
Sbjct  299  NLSLQ-MDFMHPDESWNLFRSAASANEALPSEFEAIGKQIVDKCQGLPLTIVVVAGILSK  357

Query  533  TQQ  541
            +++
Sbjct  358  SER  360


 Score =   110 bits (276),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 81/130 (62%), Gaps = 4/130 (3%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             SK  +T+E+W+N  K   S V   D  E C  +L LSYN+L   LKAC+LY  I P+D 
Sbjct  355  LSKSERTIEDWENVAKDVKSFV-KNDPDELCLHVLGLSYNHLTSDLKACLLYFGIFPEDS  413

Query  705  AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFN-GKIKTCRVH  881
             I VKRLVRLW A GF++L   ++LE  A   L DL DR L+ +     +  KIK+C+VH
Sbjct  414  EISVKRLVRLWTAGGFLKL--EKDLEGEAEKCLHDLIDRCLVLVNNISLDESKIKSCKVH  471

Query  882  DIVHEFCVRE  911
            D+++E C+RE
Sbjct  472  DLIYELCLRE  481



>ref|XP_009606281.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X10 [Nicotiana tomentosiformis]
Length=992

 Score =   176 bits (447),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 128/183 (70%), Gaps = 4/183 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVT---DG  172
            GGIGKTTLA+ +++D  + SHFD+  W  VS +H+V+++L+ LL++     D+     + 
Sbjct  179  GGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEP  238

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA  L+K L+GKRYLIVLDDIW +++W+ ++LCFP +N  SRILLTTR  EVA  A + 
Sbjct  239  ELADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTE  298

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
               L  + F++ +ESW+LF  +    ++LP E E IG+++VDKC GLPL IVVVAG+  K
Sbjct  299  NLSLQ-MDFMHPDESWNLFRSAASANEALPSEFEAIGKQIVDKCQGLPLTIVVVAGILSK  357

Query  533  TQQ  541
            +++
Sbjct  358  SER  360


 Score =   110 bits (276),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 81/130 (62%), Gaps = 4/130 (3%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             SK  +T+E+W+N  K   S V   D  E C  +L LSYN+L   LKAC+LY  I P+D 
Sbjct  355  LSKSERTIEDWENVAKDVKSFV-KNDPDELCLHVLGLSYNHLTSDLKACLLYFGIFPEDS  413

Query  705  AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFN-GKIKTCRVH  881
             I VKRLVRLW A GF++L   ++LE  A   L DL DR L+ +     +  KIK+C+VH
Sbjct  414  EISVKRLVRLWTAGGFLKL--EKDLEGEAEKCLHDLIDRCLVLVNNISLDESKIKSCKVH  471

Query  882  DIVHEFCVRE  911
            D+++E C+RE
Sbjct  472  DLIYELCLRE  481



>ref|XP_009606279.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X8 [Nicotiana tomentosiformis]
Length=1017

 Score =   176 bits (447),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 128/183 (70%), Gaps = 4/183 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVT---DG  172
            GGIGKTTLA+ +++D  + SHFD+  W  VS +H+V+++L+ LL++     D+     + 
Sbjct  179  GGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEP  238

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA  L+K L+GKRYLIVLDDIW +++W+ ++LCFP +N  SRILLTTR  EVA  A + 
Sbjct  239  ELADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTE  298

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
               L  + F++ +ESW+LF  +    ++LP E E IG+++VDKC GLPL IVVVAG+  K
Sbjct  299  NLSLQ-MDFMHPDESWNLFRSAASANEALPSEFEAIGKQIVDKCQGLPLTIVVVAGILSK  357

Query  533  TQQ  541
            +++
Sbjct  358  SER  360


 Score =   110 bits (276),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 81/130 (62%), Gaps = 4/130 (3%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             SK  +T+E+W+N  K   S V   D  E C  +L LSYN+L   LKAC+LY  I P+D 
Sbjct  355  LSKSERTIEDWENVAKDVKSFV-KNDPDELCLHVLGLSYNHLTSDLKACLLYFGIFPEDS  413

Query  705  AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFN-GKIKTCRVH  881
             I VKRLVRLW A GF++L   ++LE  A   L DL DR L+ +     +  KIK+C+VH
Sbjct  414  EISVKRLVRLWTAGGFLKL--EKDLEGEAEKCLHDLIDRCLVLVNNISLDESKIKSCKVH  471

Query  882  DIVHEFCVRE  911
            D+++E C+RE
Sbjct  472  DLIYELCLRE  481



>ref|XP_009606277.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X6 [Nicotiana tomentosiformis]
Length=1032

 Score =   176 bits (447),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 128/183 (70%), Gaps = 4/183 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVT---DG  172
            GGIGKTTLA+ +++D  + SHFD+  W  VS +H+V+++L+ LL++     D+     + 
Sbjct  179  GGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEP  238

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA  L+K L+GKRYLIVLDDIW +++W+ ++LCFP +N  SRILLTTR  EVA  A + 
Sbjct  239  ELADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTE  298

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
               L  + F++ +ESW+LF  +    ++LP E E IG+++VDKC GLPL IVVVAG+  K
Sbjct  299  NLSLQ-MDFMHPDESWNLFRSAASANEALPSEFEAIGKQIVDKCQGLPLTIVVVAGILSK  357

Query  533  TQQ  541
            +++
Sbjct  358  SER  360


 Score =   111 bits (277),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 81/130 (62%), Gaps = 4/130 (3%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             SK  +T+E+W+N  K   S V   D  E C  +L LSYN+L   LKAC+LY  I P+D 
Sbjct  355  LSKSERTIEDWENVAKDVKSFV-KNDPDELCLHVLGLSYNHLTSDLKACLLYFGIFPEDS  413

Query  705  AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFN-GKIKTCRVH  881
             I VKRLVRLW A GF++L   ++LE  A   L DL DR L+ +     +  KIK+C+VH
Sbjct  414  EISVKRLVRLWTAGGFLKL--EKDLEGEAEKCLHDLIDRCLVLVNNISLDESKIKSCKVH  471

Query  882  DIVHEFCVRE  911
            D+++E C+RE
Sbjct  472  DLIYELCLRE  481



>ref|XP_009606282.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606283.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606284.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606286.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606287.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
Length=981

 Score =   176 bits (447),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 128/183 (70%), Gaps = 4/183 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVT---DG  172
            GGIGKTTLA+ +++D  + SHFD+  W  VS +H+V+++L+ LL++     D+     + 
Sbjct  179  GGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEP  238

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA  L+K L+GKRYLIVLDDIW +++W+ ++LCFP +N  SRILLTTR  EVA  A + 
Sbjct  239  ELADMLRKSLKGKRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVACYAGTE  298

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
               L  + F++ +ESW+LF  +    ++LP E E IG+++VDKC GLPL IVVVAG+  K
Sbjct  299  NLSLQ-MDFMHPDESWNLFRSAASANEALPSEFEAIGKQIVDKCQGLPLTIVVVAGILSK  357

Query  533  TQQ  541
            +++
Sbjct  358  SER  360


 Score =   110 bits (276),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 81/130 (62%), Gaps = 4/130 (3%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             SK  +T+E+W+N  K   S V   D  E C  +L LSYN+L   LKAC+LY  I P+D 
Sbjct  355  LSKSERTIEDWENVAKDVKSFV-KNDPDELCLHVLGLSYNHLTSDLKACLLYFGIFPEDS  413

Query  705  AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFN-GKIKTCRVH  881
             I VKRLVRLW A GF++L   ++LE  A   L DL DR L+ +     +  KIK+C+VH
Sbjct  414  EISVKRLVRLWTAGGFLKL--EKDLEGEAEKCLHDLIDRCLVLVNNISLDESKIKSCKVH  471

Query  882  DIVHEFCVRE  911
            D+++E C+RE
Sbjct  472  DLIYELCLRE  481



>gb|AAF04603.1|AF195939_1 disease resistance protein Gpa2 [Solanum tuberosum]
 emb|CAB55838.1| NBS-LRR protein [Solanum tuberosum subsp. andigenum]
Length=912

 Score =   158 bits (399),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 121/181 (67%), Gaps = 6/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA  LY DP + S FDI     VSQ++ VR +L+ LL+  +   DE  D +LA
Sbjct  172  GGIGKTTLAAKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTS---DE-PDYQLA  227

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +LQK L+G+RYL+V+DDIW+T +W+ I+LCFPD +  SRILLTTR+ EVA+ A SSG  
Sbjct  228  DQLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCDNGSRILLTTRNVEVAEYA-SSGKP  286

Query  362  LHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             H +  +N +ESW+L  K  F    S   E E IG+++  KC GLPLAI ++AG+  K  
Sbjct  287  PHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITLIAGLLSKIS  346

Query  539  Q  541
            +
Sbjct  347  K  347


 Score =   129 bits (324),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 93/154 (60%), Gaps = 3/154 (2%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK++KT++EWQN  +   S VV+TDL  +C R+L LSY++LP HLK C LY +I  +D
Sbjct  341  LLSKISKTLDEWQNVAENVRS-VVSTDLEAKCMRVLALSYHHLPSHLKPCFLYFAIFAED  399

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
            E I V +LV LW  EGF+     +++EEVA   + +L DRSLI I    F+G+ + C +H
Sbjct  400  ERIYVNKLVELWAVEGFLNEEEGKSIEEVAETCINELVDRSLISIHNVSFDGETQRCGMH  459

Query  882  DIVHEFCVREAIKEKLLNV--DNKQHPSCGELQQ  977
            D+  E C+REA     +NV        SC +  Q
Sbjct  460  DVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQ  493



>ref|XP_009757156.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=886

 Score =   176 bits (445),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 126/183 (69%), Gaps = 4/183 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAK--IDEVTD-G  172
            GGIGKTTLA+ +++D  + SHFD+  W  +S++H+V+ +LV LL +   K  I  + D  
Sbjct  154  GGIGKTTLAKDVFDDVTIRSHFDVRAWATISKEHNVKDILVSLLRSTKEKDGIIHIEDEA  213

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            +LA  LQK L+GKRYLIVLDDIW   +W+ ++LCFP +N  SRILLTTR+  VA SA + 
Sbjct  214  KLADMLQKSLKGKRYLIVLDDIWKNEAWDDVRLCFPSENKGSRILLTTRNTGVACSAGTE  273

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
               L  L F+N +ESW+LF  + P   +LP E ET+G+++V++C GLPL  VVVAG+  K
Sbjct  274  NLSLR-LDFMNPDESWNLFKSTIPANDALPPEFETVGKQIVERCQGLPLTTVVVAGLLSK  332

Query  533  TQQ  541
             ++
Sbjct  333  CKR  335


 Score =   110 bits (275),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 86/142 (61%), Gaps = 8/142 (6%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK  +T+E W++  K   S V   D  +QC  +L LSYN+L   LK C+LY  I P++
Sbjct  329  LLSKCKRTIEVWKDVAKDVKSFV-KNDRDKQCQHVLGLSYNHLTSDLKPCLLYFGIFPEN  387

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQI-QKRHFNGKIKTCRV  878
              I VKRLVRLW AEGF++       EE A   LQ+L DR L+ + +K  +  KI++C+V
Sbjct  388  SEISVKRLVRLWTAEGFLK------SEEEAEKCLQELIDRFLVLVSRKSRYETKIRSCKV  441

Query  879  HDIVHEFCVREAIKEKLLNVDN  944
            HD+++E C+REA K     +++
Sbjct  442  HDLIYELCLREAEKRTFFVIND  463



>gb|AAF09256.1|AF202179_1 disease resistance protein BS2 [Capsicum chacoense]
Length=905

 Score =   170 bits (430),  Expect(2) = 9e-68, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 121/179 (68%), Gaps = 5/179 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVT---DG  172
            GGIGKTTLA+ +Y D  +   FD+  W  +SQ+H+ +++L+ LL++     D V    + 
Sbjct  183  GGIGKTTLAKEVYNDESILCRFDVHAWATISQQHNKKEILLGLLHSTIKMDDRVKMIGEA  242

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFP-DDNCRSRILLTTRHKEVADSADS  349
            ELA  LQK L+ KRYLIVLDDIWS   W+G++ CFP +DN  SRILLTTR+ EVA  A  
Sbjct  243  ELADMLQKSLKRKRYLIVLDDIWSCEVWDGVRRCFPTEDNAGSRILLTTRNDEVACYAGV  302

Query  350  SGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
                L  + F++Q+ESW LF  +    ++LP+E ET+G+++ D+CHGLPL IVVVAG+ 
Sbjct  303  ENFSLR-MSFMDQDESWSLFKSAAFSSEALPYEFETVGKQIADECHGLPLTIVVVAGLL  360


 Score =   115 bits (289),  Expect(2) = 9e-68, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 95/152 (63%), Gaps = 8/152 (5%)
 Frame = +3

Query  531  KLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAI  710
            K  +T+E+W+   K   S V T D  E+CSR+L LSY++L   LK C+L+  I P+D  I
Sbjct  361  KSKRTIEDWKTVAKDVKSFV-TNDPDERCSRVLGLSYDHLTSDLKTCLLHFGIFPEDSDI  419

Query  711  IVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNG-KIKTCRVHDI  887
             VK L+R W+AEGF++L N  +LE      LQ+L DR L+ + KR  +G KI++C+VHD+
Sbjct  420  PVKNLMRSWMAEGFLKLEN--DLEGEVEKCLQELVDRCLVLVSKRSRDGTKIRSCKVHDL  477

Query  888  VHEFCVREAIKEKLLNVD----NKQHPSCGEL  971
            +++ CVRE  +E +  ++    +  +P C  L
Sbjct  478  IYDLCVREVQRENIFIMNDIVLDVSYPECSYL  509



>gb|AEW48206.1| disease resistance protein RGH4 [Solanum fernandezianum]
Length=932

 Score =   155 bits (392),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 119/182 (65%), Gaps = 6/182 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA  LY DP + S FDI     VSQ++ VR +L+ LL+  +   DE  D +LA
Sbjct  172  GGIGKTTLATKLYSDPCIMSRFDIRAKATVSQEYCVRNVLLGLLSLTS---DE-PDDQLA  227

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +LQK L+G+RYL+V+DDIW+T +W+ I+LCFPD    SRI LTTR+ EVA+ A SSG  
Sbjct  228  DRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCINGSRIHLTTRNVEVAEYA-SSGKP  286

Query  362  LHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             H +  +N +ESW+L  K  F    S   E E IG+++  KC GLPLAI V+AG+  K  
Sbjct  287  PHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKIS  346

Query  539  QN  544
            + 
Sbjct  347  KT  348


 Score =   129 bits (324),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 94/152 (62%), Gaps = 3/152 (2%)
 Frame = +3

Query  528  SKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEA  707
            SK++KT++EWQN  +  +S VV+TDL  +C R+L LSY++LP HLK C LY +I  +DE 
Sbjct  343  SKISKTLDEWQNVAENVSS-VVSTDLEAKCMRVLALSYHHLPSHLKPCFLYFAIFTEDEE  401

Query  708  IIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDI  887
            I V +LV LW  EGF+     +++EEVA   + +L DRSLI I    F G I++C +HD+
Sbjct  402  IYVNKLVELWAVEGFLNEEEGKSIEEVATTCINELIDRSLIFIHNFSFRGTIESCGMHDV  461

Query  888  VHEFCVREAIKEKLLNV--DNKQHPSCGELQQ  977
              E C+REA     +NV        SC +  Q
Sbjct  462  TRELCLREARNMNFVNVIRGKSDQNSCAQSMQ  493



>gb|AAF76163.1|AF266747_1 RGC1 [Solanum tuberosum]
Length=933

 Score =   159 bits (402),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 120/181 (66%), Gaps = 6/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA  LY DP + S FDI     VSQ++ VR + + LL+  +   DE  D +LA
Sbjct  172  GGIGKTTLAAKLYSDPYIMSRFDIRAKATVSQEYCVRNVFLGLLSLTS---DE-PDDQLA  227

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +LQK L+G+RYL+V+DDIW+T +W+ I+LCFPD    SRILLTTR+ EVA++A SSG  
Sbjct  228  DRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAENA-SSGKP  286

Query  362  LHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             H +  +N +ESW+L  K  F    S   E E IG+++  KC GLPLAI V+AG+  K  
Sbjct  287  PHHMRIMNFDESWNLLHKKIFETEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKMG  346

Query  539  Q  541
            Q
Sbjct  347  Q  347


 Score =   125 bits (314),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 91/152 (60%), Gaps = 3/152 (2%)
 Frame = +3

Query  528  SKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEA  707
            SK+ + +++WQ   +  +S VV+TD   QC R+L LSY++LP HLK C LY +I  +DE 
Sbjct  343  SKMGQRLDKWQRIAENVSS-VVSTDPEAQCMRVLALSYHHLPSHLKPCFLYFAIFAEDEE  401

Query  708  IIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDI  887
            I V +LV LW  EGF+     +++EEV    + +L DRSLI I    F+GKI+ C +HD+
Sbjct  402  IYVNKLVDLWAVEGFLNEEEGKSIEEVPETCINELVDRSLISIHNLSFDGKIERCEMHDV  461

Query  888  VHEFCVREAIKEKLLNV--DNKQHPSCGELQQ  977
              E C+REA     +NV   N    SC +  Q
Sbjct  462  TRELCLREARNMNFVNVIRGNSDQNSCAQSMQ  493



>gb|AEW48194.1| disease resistance protein RGH5 [Solanum chacoense]
Length=914

 Score =   161 bits (408),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 118/181 (65%), Gaps = 6/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA  LY DP + S FDI     VSQ++ VR +L  LL++    I +  D +LA
Sbjct  172  GGIGKTTLATKLYSDPCIMSRFDIRAKATVSQEYCVRNVLQGLLSS----ISDEPDDQLA  227

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +LQK L+G RYL+V+DDIW+T +W+ I+LCFPD    SRILLTTR+ EVA+ A SSG  
Sbjct  228  ARLQKHLKGGRYLVVIDDIWTTEAWDDIKLCFPDRYNGSRILLTTRNVEVAEYA-SSGKP  286

Query  362  LHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             H +  +N +ESW+L  K  F    S   E E IG+++  KC GLPLAI V+AG+  K  
Sbjct  287  HHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKIG  346

Query  539  Q  541
            Q
Sbjct  347  Q  347


 Score =   122 bits (307),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 92/154 (60%), Gaps = 3/154 (2%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK+ + ++EWQ   +  +S VV+TD   +C R+L LSY++LP HLK C LY +I  +D
Sbjct  341  LLSKIGQRLDEWQRIAENVSS-VVSTDPEAKCMRVLALSYHHLPSHLKPCFLYFAIFAED  399

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
            E I V +LV LW AEGF+     +++EEVA   + +L DRSLI I    F+G+I+ C +H
Sbjct  400  ELIDVNKLVELWAAEGFLNEEEGKSIEEVAETCINELVDRSLISIHFWSFDGEIERCGMH  459

Query  882  DIVHEFCVREAIKEKLLNV--DNKQHPSCGELQQ  977
            D+  E C+REA     +NV        SC +  Q
Sbjct  460  DVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQ  493



>gb|AEW48191.1| disease resistance protein RGH2 [Solanum chacoense]
Length=914

 Score =   161 bits (408),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 118/181 (65%), Gaps = 6/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA  LY DP + S FDI     VSQ++ VR +L  LL++    I +  D +LA
Sbjct  172  GGIGKTTLATKLYSDPCIMSRFDIRAKATVSQEYCVRNVLQGLLSS----ISDEPDDQLA  227

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +LQK L+G RYL+V+DDIW+T +W+ I+LCFPD    SRILLTTR+ EVA+ A SSG  
Sbjct  228  ARLQKHLKGGRYLVVIDDIWTTEAWDDIKLCFPDRYNGSRILLTTRNVEVAEYA-SSGKP  286

Query  362  LHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             H +  +N +ESW+L  K  F    S   E E IG+++  KC GLPLAI V+AG+  K  
Sbjct  287  HHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKIG  346

Query  539  Q  541
            Q
Sbjct  347  Q  347


 Score =   122 bits (307),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 92/154 (60%), Gaps = 3/154 (2%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK+ + ++EWQ   +  +S VV+TD   +C R+L LSY++LP HLK C LY +I  +D
Sbjct  341  LLSKIGQRLDEWQRIAENVSS-VVSTDPEAKCMRVLALSYHHLPSHLKPCFLYFAIFAED  399

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
            E I V +LV LW AEGF+     +++EEVA   + +L DRSLI I    F+G+I+ C +H
Sbjct  400  ELIDVNKLVELWAAEGFLNEEEGKSIEEVAETCINELVDRSLISIHFWSFDGEIERCGMH  459

Query  882  DIVHEFCVREAIKEKLLNV--DNKQHPSCGELQQ  977
            D+  E C+REA     +NV        SC +  Q
Sbjct  460  DVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQ  493



>ref|XP_009786668.1| PREDICTED: putative late blight resistance protein homolog R1B-17, 
partial [Nicotiana sylvestris]
Length=898

 Score =   169 bits (428),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 121/181 (67%), Gaps = 2/181 (1%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTD-GEL  178
            GGIGKTTLA+ +Y D  + SHFD+  W  VS  H+V+++L+ LL +       + D  EL
Sbjct  182  GGIGKTTLAKEVYNDVSIRSHFDVRAWATVSSHHNVKEILLSLLRSRMGDTFYMEDEAEL  241

Query  179  AGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGN  358
            A  LQK L+ +RYLIV+DD+WS+++W+ ++ CFP +N  SR+LLTTR  +VA  A +   
Sbjct  242  ADMLQKSLKSRRYLIVMDDMWSSKAWDDVRQCFPSENNESRVLLTTRDTDVACYAGTENF  301

Query  359  RLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             L  + F++  ESW+LF  +    + LP E E IG+++VDKC GLPL IVVVAG+  K++
Sbjct  302  SLQ-MSFMDPYESWNLFKSAAFANEELPSEYEIIGKQIVDKCQGLPLTIVVVAGLLSKSE  360

Query  539  Q  541
            +
Sbjct  361  R  361


 Score =   114 bits (286),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 90/141 (64%), Gaps = 4/141 (3%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK  +T+E+W+N  +   S V T D  +QC  +L LSYN+L  +LKAC+LY    P+D
Sbjct  355  LLSKSERTIEDWENVAQDVMSFV-TNDPDKQCLHVLGLSYNHLTSNLKACLLYFGAFPED  413

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLI-QIQKRHFNGKIKTCRV  878
              I VKRLVRLW+AEGF++L   ++ E  A   L+DL DR LI   +K+    +IK+C+V
Sbjct  414  REISVKRLVRLWLAEGFLKL--EKDFEGEAEKCLKDLVDRCLILACEKKWDETEIKSCKV  471

Query  879  HDIVHEFCVREAIKEKLLNVD  941
            HD+++E C+REA  +  +  D
Sbjct  472  HDLIYELCLREAQSQNFIMND  492



>ref|XP_011088084.1| PREDICTED: putative late blight resistance protein homolog R1A-10, 
partial [Sesamum indicum]
Length=602

 Score =   167 bits (424),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 120/178 (67%), Gaps = 4/178 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN---EAAKIDEVTDG  172
            GGIGKTTL+R LY D L+   FD   W VVSQ + V  + + L+N+   + +++ E +  
Sbjct  11   GGIGKTTLSRNLYNDRLIEDRFDTRAWVVVSQDYHVEDVFMVLVNSTGKDGSEVHEKSAE  70

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA +L K L+G+RYLIV+DD+W T++W+ ++  FPDDN  SR++LTTR  EVA  A+  
Sbjct  71   ELADRLYKNLKGRRYLIVMDDVWDTKAWDDVKRFFPDDNNSSRVILTTRESEVAVYAN-P  129

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
            G+ +H +  L+ E SWDL  ++  G +  P+ELE IGR++ + C GLPLAIVV+ G+ 
Sbjct  130  GSSIHHMSLLSPEASWDLLRETVFGQEDGPYELEKIGREIAENCRGLPLAIVVIGGLL  187


 Score =   116 bits (290),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = +3

Query  549  EEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLV  728
            E W++  +   S +   D  +Q   IL+LSYN L  HLK C LY+ + P+D  I V +L+
Sbjct  194  ENWEHIAQDVYSAMARND-GDQFMEILSLSYNSLSHHLKPCFLYMGVFPEDYEIFVSQLI  252

Query  729  RLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVR  908
            + W+AEGF++    ++LEE+A  YL DL +RSL+++++R  NG+IKT  +HD++ E C+R
Sbjct  253  KQWVAEGFIKPRTPKSLEELAEDYLSDLINRSLVEVRRRKHNGEIKTLIIHDMLRELCLR  312

Query  909  EAIKEKLLNVDNKQ  950
            +A  EK L +   Q
Sbjct  313  KARDEKFLQIMKSQ  326



>ref|XP_006367916.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006367917.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006367918.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X3 [Solanum tuberosum]
 ref|XP_006367919.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X4 [Solanum tuberosum]
Length=493

 Score =   163 bits (412),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 120/184 (65%), Gaps = 5/184 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEV----TD  169
            GGIGKTTLAR +Y+D L++ HF +  WT VSQ+ D R++ + +L +  A  DEV    T+
Sbjct  177  GGIGKTTLARRVYDDSLIAYHFYVRAWTNVSQEFDTREIFLGILRSIGAVNDEVERNSTN  236

Query  170  GELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADS  349
             +LA ++ + L+G++YLIVLDD+WS  +W+ ++  FPDD+  SRI+LTTR  +VA  A  
Sbjct  237  EQLAERVYRSLKGRKYLIVLDDMWSIEAWQHVRRSFPDDHNGSRIVLTTRLADVASCA-C  295

Query  350  SGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFF  529
            S N LH + FL+ EESW L      G  S   ELE IGR +V +C GLPLA+V + G+  
Sbjct  296  SVNSLHQMRFLSMEESWTLLRDKVFGNGSYSPELEKIGRYIVHQCQGLPLAVVAIGGLLS  355

Query  530  KTQQ  541
            K  +
Sbjct  356  KMSK  359


 Score =   120 bits (301),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 95/142 (67%), Gaps = 2/142 (1%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK++K    W+N  ++  SL+ T+D ++ C  IL+LSYN+LP +LKAC LY+ +  + 
Sbjct  353  LLSKMSKETSSWENVAEKVGSLM-TSDTTD-CLNILSLSYNHLPQYLKACFLYMGVFAEI  410

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
              I V +L++LWIAEGFV+ +N +NLE+VA   L++L DRSL+ + K     KIKTC++H
Sbjct  411  REIPVWKLIKLWIAEGFVKKVNHKNLEDVAEENLRELVDRSLVLVGKHTSLRKIKTCKMH  470

Query  882  DIVHEFCVREAIKEKLLNVDNK  947
            D+V + C+REA  E  ++   +
Sbjct  471  DLVRDMCLREAKYENFIHFKTR  492



>gb|AET22504.1| hypothetical protein [Solanum lycopersicum]
 gb|AET22505.1| hypothetical protein [Solanum pimpinellifolium]
Length=886

 Score =   152 bits (384),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 116/183 (63%), Gaps = 7/183 (4%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLL---NNEAAKIDEVTDG  172
            GGIGKTTLA+ +Y D L+  HF +  W  VS+++ VR ML+DLL   +  A  +DE+ + 
Sbjct  188  GGIGKTTLAKRIYHDKLIEEHFYVRAWITVSERYKVRNMLLDLLVCTSKVAFIMDEMENE  247

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            EL  +L K L+G+RYLIV+DD+W T +W+ ++  FP+DN  SR+++T+R  +VA   +  
Sbjct  248  ELGERLYKSLKGQRYLIVMDDVWYTEAWDDVRRYFPNDNNGSRVMVTSRIMKVARYINPL  307

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPF---ELETIGRKVVDKCHGLPLAIVVVAGV  523
             N  H + FL  EESW L  K   G+        E+E IG ++  KC GLPLAIV+VAG+
Sbjct  308  -NPPHQMRFLTVEESWKLLQKKIFGLDDPSCCDDEMERIGMEISKKCKGLPLAIVMVAGI  366

Query  524  FFK  532
              K
Sbjct  367  LSK  369


 Score =   130 bits (328),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 93/144 (65%), Gaps = 1/144 (1%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             SK + T  +W +  +  +S  VT + S     IL LSYN+LP HLKAC LY+   P+D 
Sbjct  367  LSKESATASKWSDIAENIHSSFVTEE-SRPFLDILALSYNHLPRHLKACFLYMGAFPEDV  425

Query  705  AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHD  884
             + V RL+RLWIAEGF++L + + LE V   YLQ+L DRSLI + KR ++ ++KTC +HD
Sbjct  426  EVPVWRLIRLWIAEGFIKLESPKTLEFVGQEYLQELIDRSLIIVSKRSYDNRVKTCSIHD  485

Query  885  IVHEFCVREAIKEKLLNVDNKQHP  956
            I+  FC  EA +EKLL+V  +  P
Sbjct  486  ILRNFCQEEAKQEKLLHVVRRLEP  509



>gb|AEW48205.1| disease resistance protein RGH2 [Solanum fernandezianum]
Length=873

 Score =   161 bits (407),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 118/181 (65%), Gaps = 6/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA  LY DP + S FDI     VSQ++ VR +L  LL++    I +  D +LA
Sbjct  172  GGIGKTTLAAKLYSDPCIMSRFDIRAKATVSQEYCVRNVLHGLLSS----ISDEPDDQLA  227

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +LQK L+G+RYL+V+DDIW+T  W+ I+LCFPD    SRI LTTR+ EVA+ A SSG  
Sbjct  228  DRLQKHLKGRRYLVVIDDIWTTEGWDDIKLCFPDCYNGSRIFLTTRNVEVAEYA-SSGKP  286

Query  362  LHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
            LH +  +N +ESW+L  K  F    S   E E IG+++  KC GLPLAI V+AG+  K  
Sbjct  287  LHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKMG  346

Query  539  Q  541
            Q
Sbjct  347  Q  347


 Score =   120 bits (302),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 91/152 (60%), Gaps = 3/152 (2%)
 Frame = +3

Query  528  SKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEA  707
            SK+ + ++EWQ   +  +S  V+TD   QC R+L LSY++LP HLK C LY ++  +DE 
Sbjct  343  SKMGQRLDEWQRIAENVSS-AVSTDPEAQCIRVLALSYHHLPSHLKPCFLYFAVFAEDER  401

Query  708  IIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDI  887
            I V ++V LW  EGF+     +++EEVA   + +L DRSLI I    F+G+I++C +HD+
Sbjct  402  IYVNKIVELWAVEGFLNEEEGKSIEEVATTCINELIDRSLIFIHNFSFHGRIESCGMHDV  461

Query  888  VHEFCVREAIKEKLLNV--DNKQHPSCGELQQ  977
              E C+REA     +NV        SC +  Q
Sbjct  462  TRELCLREARNMNFVNVIRGKSDQNSCAQSMQ  493



>gb|AEW48214.1| disease resistance protein RGH4 [Solanum leptophyes x Solanum 
sparsipilum]
Length=878

 Score =   158 bits (399),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 117/181 (65%), Gaps = 6/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGK TLA  LY DP + S FDI     VSQ++ VR +L  LL++    I +  D +LA
Sbjct  172  GGIGKATLAAKLYSDPCIMSRFDIRAKATVSQEYCVRNVLQGLLSS----ISDEPDDQLA  227

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +LQK L+G+RYL+V+DDIW+T +W+ I+LCFPD    SRI LTTR+ EVA+ A SSG  
Sbjct  228  DRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRIFLTTRNVEVAEYA-SSGKP  286

Query  362  LHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             H +  +N +ESW+L  K  F    S   E E IG+++  KC GLPLAI V+AG+  K  
Sbjct  287  PHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKMG  346

Query  539  Q  541
            Q
Sbjct  347  Q  347


 Score =   123 bits (309),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 92/152 (61%), Gaps = 3/152 (2%)
 Frame = +3

Query  528  SKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEA  707
            SK+ + ++EWQ   +   SLVV+TD   QC R+L LSY++LP HLK C LY ++  +DE 
Sbjct  343  SKMGQRLDEWQRIAENV-SLVVSTDPEAQCIRVLALSYHHLPSHLKPCFLYFAVFAEDER  401

Query  708  IIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDI  887
            I V +LV LW  EGF+     +++EEVA   + +L DRSLI I    F+G+I++C +HD+
Sbjct  402  IYVNKLVELWAVEGFLNEEEGKSIEEVATTCINELIDRSLIFIHNFGFHGRIESCGMHDM  461

Query  888  VHEFCVREAIKEKLLNV--DNKQHPSCGELQQ  977
              E C+REA     +NV        SC +  Q
Sbjct  462  TRELCLREARNMNFVNVIRGKSDQNSCAQSMQ  493



>gb|ABY61746.1| resistance protein PSH-RGH7 [Solanum tuberosum]
Length=930

 Score =   159 bits (402),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 119/181 (66%), Gaps = 6/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA  LY DP + S FDI     VSQ++ VR +L+ LL+  +   DE  D +LA
Sbjct  172  GGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTS---DE-PDYQLA  227

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +LQK L+G+RYL+V+DDIW+T +W+ I+LCFPD    SRILLTTR+ EVA+ A SSG  
Sbjct  228  DRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAEYA-SSGKP  286

Query  362  LHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             H +  +N  ESW+L  K  F    S   E E IG+++  KC GLPLAI V+AG+  K  
Sbjct  287  PHHMRLMNSIESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKMG  346

Query  539  Q  541
            Q
Sbjct  347  Q  347


 Score =   122 bits (305),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 89/154 (58%), Gaps = 3/154 (2%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK+ + ++EWQ   +  +S VV+TD   QC R+L LSY++LP HLK C LY +I  +D
Sbjct  341  LLSKMGQRLDEWQRIAENVSS-VVSTDPEAQCMRVLALSYHHLPSHLKPCFLYFAIFAED  399

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
            E I V  LV LW  EGF+     +++EEVA   + +L DRSLI I    F+GK + C +H
Sbjct  400  ERIYVHELVELWPVEGFLNEEEGKSIEEVAETCINELVDRSLISIHNLSFDGKRQRCGMH  459

Query  882  DIVHEFCVREAIKEKLLNV--DNKQHPSCGELQQ  977
            D+  E C+REA     +NV        SC +  Q
Sbjct  460  DVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQ  493



>ref|XP_009779880.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=862

 Score =   159 bits (401),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 119/201 (59%), Gaps = 29/201 (14%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLN----NEAAKIDEVTD  169
            GGIGK+T A+ ++ DP + S FD+  W VVS+ +++RKML+ LL     NE A  D  +D
Sbjct  129  GGIGKSTFAKRIFSDPSIVSFFDVRGWIVVSKDYNIRKMLLSLLKDVGMNEEA--DSKSD  186

Query  170  GEL----------------------AGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPD  283
            GEL                      A +LQK L+G+RYLIV+DDIWST +W+ I+L FPD
Sbjct  187  GELSNCLQKSDGELEDGLQKIDDALADRLQKSLKGRRYLIVVDDIWSTEAWDEIKLWFPD  246

Query  284  DNCRSRILLTTRHKEVADSADSSGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIG  463
            ++ RSRILLTTR   VA  A S  N    +  L  +ESW LFC+   G +  P E+E + 
Sbjct  247  NSNRSRILLTTRDMNVAQYA-SFPNDPFPMRLLKPKESWHLFCQKAFGKKGCPTEVENVA  305

Query  464  RKVVDKCHGLPLAIVVVAGVF  526
            R +V+ C GLPL I VVAG  
Sbjct  306  RVIVENCQGLPLIISVVAGTL  326


 Score =   122 bits (306),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 100/158 (63%), Gaps = 8/158 (5%)
 Frame = +3

Query  540   KTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVK  719
             KT+E W+   +  +SLV   D  E+CS +L  SY+YLP HLKAC LY    PK   I VK
Sbjct  330   KTLETWREVAQNVSSLVNLDDY-ERCSGVLASSYSYLPSHLKACFLYFGAFPKANEISVK  388

Query  720   RLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEF  899
             +L+RLW+AEG +EL   + LE++    L DL D+SL+ + KR  +GK KTCR+HD++H+ 
Sbjct  389   KLIRLWVAEGLLELKGLKELEKLGSSLLHDLIDKSLVVVSKRSLDGKTKTCRIHDLLHDL  448

Query  900   CVREAIKEKLLNVDN----KQHPSCGELQQEGCRWLNF  1001
             C+REA KE LL V N    K H +   +  +G RWL+ 
Sbjct  449   CLREAEKENLLYVVNPPISKGHRT---VFPKGRRWLSL  483



>gb|AEW48198.1| disease resistance protein RGH4 [Solanum x edinense]
Length=901

 Score =   158 bits (400),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 117/182 (64%), Gaps = 6/182 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA  LY DP + S FDI     VSQ++ VR +++ LL      I +  D +LA
Sbjct  172  GGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVILGLL----PSISDEPDDQLA  227

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +LQK L+G+RYL+V+DDIW+T +W+ I+LCFPD    SRILLTTR+ EVA+ A  SG  
Sbjct  228  DRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAECA-RSGKP  286

Query  362  LHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             H +  +N +ESW+L  K  F    S   E E IG+++  KC GLPLAI V+AG+  K  
Sbjct  287  PHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKIS  346

Query  539  QN  544
            + 
Sbjct  347  KT  348


 Score =   122 bits (306),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 87/137 (64%), Gaps = 1/137 (1%)
 Frame = +3

Query  528  SKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEA  707
            SK++KT+  WQ   +  +S VV+TDL  +C R+L LSY++LP HLK C LY +I  +DE 
Sbjct  343  SKISKTLGVWQYVAENVSS-VVSTDLEAKCMRVLALSYHHLPSHLKPCFLYFAIFAEDEQ  401

Query  708  IIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDI  887
            I V +LV LW  EGF+     +++EEVA   + +L DRSLI I    F G I++C +HD+
Sbjct  402  IYVNKLVELWAVEGFLNEEEGKSIEEVATTCINELIDRSLIFIHNFSFRGTIESCGMHDV  461

Query  888  VHEFCVREAIKEKLLNV  938
              E C+REA     +NV
Sbjct  462  TRELCLREARNMNFVNV  478



>ref|XP_011075662.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=738

 Score =   163 bits (413),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 115/174 (66%), Gaps = 4/174 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNE---AAKIDEVTDG  172
            GGIGKTTLAR  Y+D  +  HFD   W  VSQ++ +R++LV LL++      K+ + T+ 
Sbjct  54   GGIGKTTLARQAYDDSYIVYHFDTRAWVTVSQEYSLRQVLVGLLDSAKILTEKMYDKTEE  113

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA  L K L G+RYLIV+DDIW T+ W+ ++  FP+D  RSRILLTTR  +VA  ADS 
Sbjct  114  ELADCLYKGLVGRRYLIVMDDIWDTQIWDAVRRFFPNDCNRSRILLTTRLSDVALYADSF  173

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVV  514
               LH + FL + ESW+LFCK   G +  P ELE IG+ +   C GLPLAIVV+
Sbjct  174  SP-LHKMQFLKEGESWNLFCKKVFGEKDCPRELEDIGKAIARNCGGLPLAIVVI  226


 Score =   117 bits (293),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 83/121 (69%), Gaps = 2/121 (2%)
 Frame = +3

Query  582  SLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVEL  761
            ++VV  D  +QC  IL LSYN LP  L+AC LY+++ P+D  I V +L+RLW AEGF++ 
Sbjct  222  AIVVIDD--DQCLEILGLSYNRLPQRLRACFLYMAVFPEDYEIPVAKLIRLWAAEGFLKP  279

Query  762  INSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLLNVD  941
              S++LE++A  YL DL +R+LI + +R  NGKI+TC +HD++   C R A KEK L + 
Sbjct  280  NASKSLEDLAEEYLDDLIERNLILVSRRSANGKIRTCNIHDLLRNLCSRNARKEKFLYMV  339

Query  942  N  944
            N
Sbjct  340  N  340



>ref|XP_006350053.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=901

 Score =   158 bits (400),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 117/182 (64%), Gaps = 6/182 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA  LY DP + S FDI     VSQ++ VR +++ LL      I +  D +LA
Sbjct  172  GGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVILGLL----PSISDEPDDQLA  227

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +LQK L+G+RYL+V+DDIW+T +W+ I+LCFPD    SRILLTTR+ EVA+ A  SG  
Sbjct  228  DRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAECA-RSGKP  286

Query  362  LHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             H +  +N +ESW+L  K  F    S   E E IG+++  KC GLPLAI V+AG+  K  
Sbjct  287  PHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKIS  346

Query  539  QN  544
            + 
Sbjct  347  KT  348


 Score =   122 bits (306),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 87/137 (64%), Gaps = 1/137 (1%)
 Frame = +3

Query  528  SKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEA  707
            SK++KT+  WQ   +  +S VV+TDL  +C R+L LSY++LP HLK C LY +I  +DE 
Sbjct  343  SKISKTLGVWQYVAENVSS-VVSTDLEAKCMRVLALSYHHLPSHLKPCFLYFAIFAEDEQ  401

Query  708  IIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDI  887
            I V +LV LW  EGF+     +++EEVA   + +L DRSLI I    F G I++C +HD+
Sbjct  402  IYVNKLVELWAVEGFLNEEEGKSIEEVATTCINELIDRSLIFIHNFSFRGTIESCGMHDV  461

Query  888  VHEFCVREAIKEKLLNV  938
              E C+REA     +NV
Sbjct  462  TRELCLREARNMNFVNV  478



>gb|AEW48200.1| disease resistance protein RGH7 [Solanum x edinense]
Length=908

 Score =   150 bits (380),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 118/182 (65%), Gaps = 6/182 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA  LY D  + S FDI     VSQ++ VR +L+ LL+  +   DE  D +LA
Sbjct  172  GGIGKTTLATKLYSDLCIMSRFDIRAKATVSQEYCVRNVLLGLLSLTS---DE-PDYQLA  227

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +LQK L+G+RYL+V+DDIW+T +W+ I+LC PD    SRILLTTR+ EVA+ A SSG  
Sbjct  228  DRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCLPDCINGSRILLTTRNVEVAEYA-SSGKP  286

Query  362  LHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             H +  +N +ESW+L  K  F    S   E E IG+++  KC GLPLAI V+AG+  K  
Sbjct  287  PHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKIS  346

Query  539  QN  544
            + 
Sbjct  347  KT  348


 Score =   129 bits (325),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 94/154 (61%), Gaps = 3/154 (2%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK++KT++EWQN  +  +S VV+TDL  +C R+L LSY++LP HLK C LY +I  +D
Sbjct  341  LLSKISKTLDEWQNVAENVSS-VVSTDLEAKCMRVLALSYHHLPSHLKPCFLYFAIFAED  399

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
            E I V +LV LW  EGF+     +++EEVA   + +L DRSLI I    F G I++C +H
Sbjct  400  EEIYVNKLVELWAVEGFLNEEEGKSIEEVATTCINELIDRSLIFIHNFSFRGTIESCGMH  459

Query  882  DIVHEFCVREAIKEKLLNV--DNKQHPSCGELQQ  977
            D+  E C+REA     +NV        SC +  Q
Sbjct  460  DVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQ  493



>emb|CAB50786.1| Rx protein [Solanum tuberosum]
Length=937

 Score =   159 bits (403),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 120/181 (66%), Gaps = 6/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA  LY DP + S FDI     VSQ++ VR +L+ LL+  +   DE  D +LA
Sbjct  172  GGIGKTTLATKLYSDPCIMSRFDIRAKATVSQEYCVRNVLLGLLSLTS---DE-PDDQLA  227

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +LQK L+G+RYL+V+DDIW+T +W+ I+LCFPD    SRILLTTR+ EVA+ A SSG  
Sbjct  228  DRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAEYA-SSGKP  286

Query  362  LHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             H +  +N +ESW+L  K  F    S   E E IG+++  KC GLPLAI V+AG+  K  
Sbjct  287  PHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKMG  346

Query  539  Q  541
            Q
Sbjct  347  Q  347


 Score =   120 bits (302),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 89/154 (58%), Gaps = 3/154 (2%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK+ + ++EWQ   +  +S VV+TD   QC R+L LSY++LP HLK C LY +I  +D
Sbjct  341  LLSKMGQRLDEWQRIGENVSS-VVSTDPEAQCMRVLALSYHHLPSHLKPCFLYFAIFTED  399

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
            E I V  LV LW  EGF+     +++EEVA   + +L DRSLI I    F G I++C +H
Sbjct  400  EQISVNELVELWPVEGFLNEEEGKSIEEVATTCINELIDRSLIFIHNFSFRGTIESCGMH  459

Query  882  DIVHEFCVREAIKEKLLNV--DNKQHPSCGELQQ  977
            D+  E C+REA     +NV        SC +  Q
Sbjct  460  DVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQ  493



>ref|XP_009766920.1| PREDICTED: putative late blight resistance protein homolog R1B-16, 
partial [Nicotiana sylvestris]
Length=872

 Score =   169 bits (427),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 126/185 (68%), Gaps = 7/185 (4%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLL----NNEAAKIDEVTD  169
            GGIGKTTLA+ ++ D  + SHFD+  W  +S +++V+ + V LL      +  ++    +
Sbjct  148  GGIGKTTLAKEVFNDASIRSHFDVRAWATISSQYNVKDIYVSLLLFTKETKDERVHMKDE  207

Query  170  GELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADS  349
              LA  LQK L+GKRYLIV+DD+W++++W+ ++ CFP ++  SRILLTTR+ EVA  A  
Sbjct  208  AMLADMLQKSLKGKRYLIVMDDMWNSKAWDDVRQCFPSEDKGSRILLTTRNTEVACYA-G  266

Query  350  SGNRLHTLGFLNQEESWDLF-CKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
            +GN    + F+N +ESW LF C  F  + SLP E ETIG+ +VDKC GLPL+I+VVAG+ 
Sbjct  267  TGNLSLQMDFMNPDESWKLFKCTGFADV-SLPHEFETIGKHIVDKCQGLPLSIIVVAGLL  325

Query  527  FKTQQ  541
             K+++
Sbjct  326  SKSKR  330


 Score =   111 bits (277),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 89/140 (64%), Gaps = 4/140 (3%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK  +T+E+W+   +   S V T D  +QC  +L LSYN+L   LKAC+LY  I P+D
Sbjct  324  LLSKSKRTLEDWKIVARDVMSFV-TDDPDKQCLHVLGLSYNHLTNDLKACLLYFGIFPED  382

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFN-GKIKTCRV  878
              I VK+LV LW+AEGF++L N  +L+  A   LQDL DR L+ + K+  +  KI++C+V
Sbjct  383  SEIPVKKLVSLWMAEGFLKLEN--DLQGEAEKCLQDLIDRCLVLVCKKSLDETKIRSCKV  440

Query  879  HDIVHEFCVREAIKEKLLNV  938
            HD+V+ FC+RE   E   ++
Sbjct  441  HDLVYGFCLREVQNEIFFSL  460



>ref|XP_004251396.2| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
 gb|AET22503.1| hypothetical protein [Solanum lycopersicum]
Length=888

 Score =   152 bits (385),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 116/185 (63%), Gaps = 9/185 (5%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLL---NNEAAKIDEVTDG  172
            GGIGKTTLA+ +Y D L+  HF +  W  VS+++ VR ML+DLL   +  A  +DE+ + 
Sbjct  188  GGIGKTTLAKRIYHDKLIEEHFYVRAWITVSERYKVRNMLLDLLVCTSKVAFIMDEMENE  247

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            EL  +L K L+G+RYLIV+DD+W T +W+ ++  FP+DN  SR+++T+R  +VA   +  
Sbjct  248  ELGERLYKSLKGQRYLIVMDDVWYTEAWDDVRRYFPNDNNGSRVMVTSRIMKVARYINPL  307

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGI-----QSLPFELETIGRKVVDKCHGLPLAIVVVA  517
             N  H + FL  EESW L  K   G+          E+E IG ++  KC GLPLAIV+VA
Sbjct  308  -NPPHQMRFLTVEESWKLLQKKIFGLDDPSCCCCDDEMERIGMEISKKCKGLPLAIVMVA  366

Query  518  GVFFK  532
            G+  K
Sbjct  367  GILSK  371


 Score =   127 bits (319),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 92/144 (64%), Gaps = 1/144 (1%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             SK + T  +W +  +  +S  VT + S     IL LSYN+L  HLKAC LY+   P+D 
Sbjct  369  LSKESATASKWSDIAENIHSSFVTEE-SRPFLDILALSYNHLSRHLKACFLYMGAFPEDV  427

Query  705  AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHD  884
             + V RL+RLWIAEGF++L + + LE V   YLQ+L DRSLI + KR ++ ++KTC +HD
Sbjct  428  EVPVWRLIRLWIAEGFIKLESPKTLEFVGQEYLQELIDRSLIIVSKRSYDNRVKTCSIHD  487

Query  885  IVHEFCVREAIKEKLLNVDNKQHP  956
            I+  FC  EA +EKLL+V  +  P
Sbjct  488  ILRNFCQEEAKQEKLLHVVRRLEP  511



>gb|AEW48207.1| disease resistance protein RGH5 [Solanum fernandezianum]
Length=912

 Score =   157 bits (398),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 119/181 (66%), Gaps = 6/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA  LY DP + S FDI     VSQ++ VR +L+ LL+  +   DE  D  LA
Sbjct  172  GGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTS---DE-PDYHLA  227

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +L+K L+G+RYL+V+DDIW+T +W+ I+LCFPD    SRILLTTR+ EVA+ A SSG  
Sbjct  228  DRLRKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAEYA-SSGKP  286

Query  362  LHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             H +  +N +ESW+L  K  F    S   E E IG+++  KC GLPLAI V+AG+  K  
Sbjct  287  PHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKIG  346

Query  539  Q  541
            Q
Sbjct  347  Q  347


 Score =   122 bits (306),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 86/139 (62%), Gaps = 1/139 (1%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK+ + ++EWQ   +  +S VV+TD   QC R+L LSY++LP HLK C LY +I  +D
Sbjct  341  LLSKIGQRLDEWQRIAENVSS-VVSTDPEAQCMRVLALSYHHLPSHLKPCFLYFAIFAED  399

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
            E I V +LV LW  EGF+     +++EEVA   + +L DRSLI I    F G I++C +H
Sbjct  400  EQIYVNKLVELWAVEGFLNEEEGKSIEEVATTCINELIDRSLIFIHNFSFRGTIESCGMH  459

Query  882  DIVHEFCVREAIKEKLLNV  938
            D+  E C+REA     +NV
Sbjct  460  DVTRELCLREARNMNFVNV  478



>gb|AEW48216.1| disease resistance protein RX3 [Solanum leptophyes x Solanum 
sparsipilum]
Length=937

 Score =   160 bits (405),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 119/181 (66%), Gaps = 6/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA  LY DP + S FDI     VSQ++ VR +L+ LL++    I +  D +LA
Sbjct  172  GGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLALLSS----ISDEPDDQLA  227

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +LQK L+G+RYL+V+DDIW+T +W+ I+LCFPD    SRILLTTR+ EVA+ A SSG  
Sbjct  228  DRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAEYA-SSGKP  286

Query  362  LHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             H +  +  +ESW+L  K  F    S   E E IG+++  KC GLPLAI V+AG+  K  
Sbjct  287  PHHMRLMKFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKMG  346

Query  539  Q  541
            Q
Sbjct  347  Q  347


 Score =   119 bits (297),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 88/154 (57%), Gaps = 3/154 (2%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK+ + ++EWQ   +  +S VV+TD   QC R+L LSY++LP HLK C LY +I  +D
Sbjct  341  LLSKMGQRLDEWQRIGENVSS-VVSTDPEAQCMRVLALSYHHLPSHLKPCFLYFAIFTED  399

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
            E I V  LV LW  EGF+     +++EEV    + +L DRSLI I    F G I++C +H
Sbjct  400  EQISVNELVELWPVEGFLNEEEGKSIEEVTTTCINELIDRSLIFIHNFSFRGTIESCGMH  459

Query  882  DIVHEFCVREAIKEKLLNV--DNKQHPSCGELQQ  977
            D+  E C+REA     +NV        SC +  Q
Sbjct  460  DVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQ  493



>gb|AEW48210.1| disease resistance protein RGH5 [Solanum huancabambense]
Length=904

 Score =   158 bits (399),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 118/181 (65%), Gaps = 6/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA  LY DP + S FDI     VSQ++ VR +L  LL++    I +  D +LA
Sbjct  172  GGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLQGLLSS----ISDEPDDQLA  227

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +LQK L+G+RYL+V+DDIW+T +W+ I+LCFPD    SRILLTTR+ EVA+ A SSG  
Sbjct  228  DRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCINGSRILLTTRNVEVAEYA-SSGKP  286

Query  362  LHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             H +  +N +ESW+L  K  F        E E IG+++  KC GLPLAI V+AG+  K  
Sbjct  287  PHHMRLMNFDESWNLLHKMIFEKEGFYSPEFENIGKQIALKCGGLPLAITVIAGLLSKIG  346

Query  539  Q  541
            Q
Sbjct  347  Q  347


 Score =   121 bits (303),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 90/152 (59%), Gaps = 3/152 (2%)
 Frame = +3

Query  528  SKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEA  707
            SK+ + +++WQ   +  +S VV+TD   QC R+L LSY++LP HLK C LY +I  +DE 
Sbjct  343  SKIGQRLDKWQRIAENVSS-VVSTDPEAQCMRVLALSYHHLPSHLKPCFLYFAIFAEDEE  401

Query  708  IIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDI  887
            I V +LV LW  EGF+     +++EEVA   + +L DRSLI I    F G I++C +HD+
Sbjct  402  IYVNKLVELWAVEGFLNEEEGKSIEEVATTCINELIDRSLIFIHNFSFRGTIESCGMHDV  461

Query  888  VHEFCVREAIKEKLLNV--DNKQHPSCGELQQ  977
              E C+REA     +NV        SC +  Q
Sbjct  462  TRELCLREARNMNFVNVIRGKSDQNSCAQSMQ  493



>gb|AEW48218.1| disease resistance protein RX6 [Solanum hondelmannii]
Length=937

 Score =   159 bits (403),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 120/181 (66%), Gaps = 6/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA  LY DP + S FDI     VSQ++ VR +L+ LL+  +   DE  D +LA
Sbjct  172  GGIGKTTLATKLYSDPCIMSRFDIRAKATVSQEYCVRNVLLGLLSLTS---DE-PDDQLA  227

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +LQK L+G+RYL+V+DDIW+T +W+ I+LCFPD    SRILLTTR+ EVA+ A SSG  
Sbjct  228  DRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAEYA-SSGKP  286

Query  362  LHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             H +  +N +ESW+L  K  F    S   E E IG+++  KC GLPLAI V+AG+  K  
Sbjct  287  PHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKMG  346

Query  539  Q  541
            Q
Sbjct  347  Q  347


 Score =   119 bits (298),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 88/154 (57%), Gaps = 3/154 (2%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK+ + ++EWQ   +  +S  V+TD   QC R+L LSY++LP HLK C LY +I  +D
Sbjct  341  LLSKMGQRLDEWQRIGENVSS-AVSTDPEAQCMRVLALSYHHLPSHLKPCFLYFAIFTED  399

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
            E I V  LV LW  EGF+     +++EEVA   + +L DRSLI I    F G I++C +H
Sbjct  400  EQISVNELVELWPVEGFLNEEEGKSIEEVATTCINELIDRSLIFIHNFSFRGTIESCGMH  459

Query  882  DIVHEFCVREAIKEKLLNV--DNKQHPSCGELQQ  977
            D+  E C+REA     +NV        SC +  Q
Sbjct  460  DVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQ  493



>gb|AFB17983.1| Rx-like protein, partial [Solanum chacoense]
Length=350

 Score =   160 bits (404),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 120/181 (66%), Gaps = 6/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA  LY DP + S FDI     VSQ++ VR +L+ LL+  +   DE  D +LA
Sbjct  49   GGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTS---DE-PDDQLA  104

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +LQK L+G+RYL+V+DDIWST +W+ I+LCFPD    SRILLTTR+ EVA+ A SSG  
Sbjct  105  DRLQKHLKGRRYLVVIDDIWSTEAWDDIKLCFPDCINGSRILLTTRNVEVAEYA-SSGKP  163

Query  362  LHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             H +  +N +ESW+L  K  F    S   E E IG+++  KC GLPLAI V+AG+  K  
Sbjct  164  PHHMRLMNFDESWNLLHKMIFDKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKIG  223

Query  539  Q  541
            Q
Sbjct  224  Q  224


 Score =   119 bits (297),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 83/131 (63%), Gaps = 1/131 (1%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK+ + ++EWQ   +   SLVV+TD   QC R+L LSY++LP HLK C LY +I  +D
Sbjct  218  LLSKIGQRLDEWQRIAENV-SLVVSTDPEAQCMRVLALSYHHLPSHLKPCFLYFAIFAED  276

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
            E I V +LV LW  EGF+     +++EEVA   + +L DRSLI I    F G+I++C +H
Sbjct  277  EEIYVNKLVELWAVEGFLNEEEGKSIEEVATTCINELIDRSLIFIHNFSFRGRIESCGMH  336

Query  882  DIVHEFCVREA  914
            D+  E  +REA
Sbjct  337  DVTRELYLREA  347



>ref|XP_009780928.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009780934.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=935

 Score =   158 bits (400),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 115/180 (64%), Gaps = 4/180 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEV---TDG  172
            GGIGKTTLA  LY DP + S FDI     +SQ++  R +L+ LL+  + + +E     DG
Sbjct  175  GGIGKTTLANKLYSDPFIMSRFDIRAKVTISQEYCKRNVLLGLLSPISGRTNEYFEQDDG  234

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            +LA +LQK L+G+RY I++DDIW++ +W+ I+LCFP+    SRILLTTR+ EVA  A SS
Sbjct  235  QLADQLQKLLKGRRYFILIDDIWTSEAWDDIKLCFPEYTNGSRILLTTRNVEVAKYA-SS  293

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
            GN    +  L+  ESWDL  K          E E IG+++  KC GLPLAI V+AG+  K
Sbjct  294  GNPPCQMRLLDFNESWDLLHKKVFEKDCFSLEFEKIGKEIASKCGGLPLAITVIAGLLSK  353


 Score =   120 bits (301),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 91/131 (69%), Gaps = 1/131 (1%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK+ K ++EWQ+  ++ +S+V +TD+  QC R+L LSY++L  HLKAC LY +I P+D
Sbjct  350  LLSKIGKALDEWQSVAEKVSSMV-STDVDVQCMRVLALSYHHLLHHLKACFLYFAIFPED  408

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
              I V  L+ LW AEGF++L   +++EEVA   L+DL DRSLI I     +G++K CR+H
Sbjct  409  AEIYVDELLDLWAAEGFLKLEEMKSIEEVAEKCLKDLIDRSLISIHYVTGDGRVKFCRIH  468

Query  882  DIVHEFCVREA  914
            D++ E C++EA
Sbjct  469  DVIRELCLKEA  479



>ref|XP_011091064.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=856

 Score =   167 bits (422),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 114/179 (64%), Gaps = 5/179 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKI-DEV---TD  169
            GGIGKTTLAR LY DPLV SHFD   W V+SQ +DVR +L+ LL     K+ DEV    +
Sbjct  177  GGIGKTTLARNLYNDPLVVSHFDTRAWIVISQDYDVRAILLGLLGCIVGKLTDEVLQKNN  236

Query  170  GELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADS  349
             +LA  L K L G+RYL+VLDDIWST +W+ I++ FP +N RSRI+LTTR   VA+  D 
Sbjct  237  SQLAVALYKNLTGRRYLVVLDDIWSTDAWDNIKMFFPGNNNRSRIVLTTRESNVANYVDL  296

Query  350  SGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
            S +  H +  L   ESW+L  +   G  + P E E IGR +   C GLPLAI V+ G+ 
Sbjct  297  SSS-YHQMHLLTNSESWNLLHQKVFGEDNCPPEFEKIGRSIASYCGGLPLAIHVIGGLL  354


 Score =   111 bits (278),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 85/132 (64%), Gaps = 2/132 (2%)
 Frame = +3

Query  555  WQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRL  734
            W++      + +   D  EQ   +L LSYN+LP HLK C LY+   P+D  I   +L+R+
Sbjct  364  WEHVADDVRAAIAGKD--EQFYNVLALSYNHLPYHLKPCFLYMGAFPEDHEIRASKLIRI  421

Query  735  WIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREA  914
            W+AEGF++    ++LEE+A   L+ LADR+L+ +++   NGK KT  +HD++ + CV++A
Sbjct  422  WVAEGFLKSNGDKSLEEIAEENLRVLADRNLLMVREWKSNGKAKTYGIHDLLRDLCVKKA  481

Query  915  IKEKLLNVDNKQ  950
             ++K L+V N+Q
Sbjct  482  AEDKFLHVKNRQ  493



>gb|AEW48204.1| disease resistance protein RGH1 [Solanum fernandezianum]
Length=897

 Score =   158 bits (400),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 120/181 (66%), Gaps = 6/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA  LY DP + S FDI     VSQ++ VR +L+ LL++ +   DE  D +LA
Sbjct  172  GGIGKTTLAAKLYSDPCIMSRFDIRAKATVSQEYYVRNVLLALLSSTS---DE-PDDQLA  227

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +LQK L+G+RYL+V+DDIW+T +W+ I+LCFPD    SRILLTTR+ E+A+ A SSG  
Sbjct  228  DRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCINGSRILLTTRNVELAEYA-SSGKP  286

Query  362  LHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             H +  +N  ESW+L  K  F    S   E E IG+++  KC GLPLAI V+AG+  K  
Sbjct  287  PHHMRLMNIIESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKMG  346

Query  539  Q  541
            Q
Sbjct  347  Q  347


 Score =   119 bits (299),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 90/152 (59%), Gaps = 3/152 (2%)
 Frame = +3

Query  528  SKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEA  707
            SK+ + +++WQ   +  +S VV+TD   QC R+L LSY++LP HLK C LY +I  +DE 
Sbjct  343  SKMGQRLDKWQRIAENVSS-VVSTDPEAQCMRVLALSYHHLPSHLKPCFLYFAIFAEDER  401

Query  708  IIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDI  887
            I VK+LV LW  EGF+     +++EEVA   + +L DRSLI I    F+ + + C +HD+
Sbjct  402  IYVKKLVELWAVEGFLNEEEGKSIEEVAETCINELVDRSLISIHSWRFDVETQRCGMHDV  461

Query  888  VHEFCVREAIKEKLLNV--DNKQHPSCGELQQ  977
              E C+REA     +NV        SC +  Q
Sbjct  462  TRELCLREARNMNFVNVIRGKSDQNSCAQSMQ  493



>gb|EYU23522.1| hypothetical protein MIMGU_mgv1a018893mg, partial [Erythranthe 
guttata]
Length=805

 Score =   150 bits (379),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 115/175 (66%), Gaps = 6/175 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA+  YE  L+  HFDI  W  VSQK++V+++L+ LL+ ++ + DE   G+  
Sbjct  50   GGIGKTTLAQNAYEHSLILHHFDIRTWVTVSQKYNVKQLLLQLLSRQSCETDEHLLGQ--  107

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +L K L G+RYLIV+DDIWS  + + +   FPD+N  SRI++TTR   VA   DS    
Sbjct  108  -ELHKMLWGRRYLIVIDDIWSIEASDEVSRFFPDNNNGSRIVVTTRISNVATHFDS---L  163

Query  362  LHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
            L  L FL++ +SWDLFC+   G    P ELE IG+++V KC GLPLAI V+ G+ 
Sbjct  164  LFELSFLDENQSWDLFCRKTFGEAGCPSELEDIGKEIVKKCKGLPLAISVIGGLL  218


 Score =   127 bits (318),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 90/134 (67%), Gaps = 1/134 (1%)
 Frame = +3

Query  537  NKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIV  716
            NKT + W+N  K   S ++ +   E C  IL+LSYNYLP HLK C LY+ I P+D+ I V
Sbjct  222  NKTQKYWKNISKNLIS-ILNSGKDENCLSILSLSYNYLPAHLKPCFLYMGIFPEDDVIRV  280

Query  717  KRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHE  896
             RL+ LW+AEGF++   S++LEE+A GY+ DL DR+LI   K   +G+IK C++HD++ +
Sbjct  281  SRLIELWVAEGFIKSNESQSLEEIAQGYVNDLIDRNLILKHKPGSDGRIKFCKIHDLLRD  340

Query  897  FCVREAIKEKLLNV  938
              ++ A K+K + V
Sbjct  341  LSLKVAQKDKFICV  354



>ref|XP_011091063.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=730

 Score =   163 bits (412),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 114/179 (64%), Gaps = 5/179 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKID----EVTD  169
            GGIGKTTLAR LY D L+ SHFD   W V+SQ +DVR +L+ LL     K+     +  +
Sbjct  52   GGIGKTTLARNLYNDRLIISHFDTCAWIVISQDYDVRAILLGLLACIVGKLTDDMLQQKN  111

Query  170  GELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADS  349
             +LA  L K L G RYL+VLDD+WSTR+W+ +++ FPD+N RSRILLTTR K VA+   S
Sbjct  112  SQLAVTLYKSLTGIRYLVVLDDMWSTRAWDDVRMFFPDNNNRSRILLTTREKNVANYVGS  171

Query  350  SGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
            S ++ H +  LN+ ESW+L  +   G    P E E I R +   C GLPLAI V+ G+ 
Sbjct  172  S-SQYHQMRLLNKFESWNLLHQKVFGEDKCPPEFEKIERNIASDCGGLPLAIHVIGGLL  229


 Score =   114 bits (285),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 94/154 (61%), Gaps = 9/154 (6%)
 Frame = +3

Query  555   WQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRL  734
             W+      +S +   D  EQ   IL LSYNYL  HLK+C L++   P+D  I   +LVR+
Sbjct  239   WERVADDISSAMAEKD--EQFYNILALSYNYLSYHLKSCFLFMGAFPEDHEIRASKLVRI  296

Query  735   WIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREA  914
             W+AEGF+E    ++LEE+A   L+ L DR+L+ +++R  NGK K+  +HD++ + CV++A
Sbjct  297   WVAEGFLESNGDKSLEEIAEENLKVLVDRNLVMVRERKSNGKAKSYSIHDLLRDLCVKKA  356

Query  915   IKEKLLNVDNKQHPSCGELQQEGCRWLNFWPKKI  1016
              K+K L+V N Q  +  E        L+++P+++
Sbjct  357   AKDKFLHVKNWQVHNVPE-------GLSYFPRRV  383



>ref|XP_009595164.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana tomentosiformis]
 ref|XP_009595165.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana tomentosiformis]
Length=875

 Score =   162 bits (411),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 123/181 (68%), Gaps = 2/181 (1%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTD-GEL  178
            GGIGKTTLA+ ++ D  + SHFD+  W  +SQ++DV+++L+ LL +       + D  +L
Sbjct  183  GGIGKTTLAKDVFNDVSIRSHFDVRAWATISQQYDVKEILLSLLRSTMGYTFYMGDEADL  242

Query  179  AGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGN  358
            A  LQK L+ KRYLIV+DD+WS+++W+ ++ CFP  +  SRILLTTR  E+A  A  + N
Sbjct  243  ADMLQKSLKSKRYLIVMDDMWSSKAWDEVKQCFPTQSNGSRILLTTRDTELACYA-GTKN  301

Query  359  RLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
                +GF++  ESW+LF ++    + L  E ETIG+++ +KC GLPL IVVVAG+  +++
Sbjct  302  LSFEMGFMDPNESWNLFVRAAFANEGLASEFETIGKQIANKCQGLPLTIVVVAGLLSRSK  361

Query  539  Q  541
            +
Sbjct  362  R  362


 Score =   114 bits (284),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 85/131 (65%), Gaps = 4/131 (3%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              S+  +T+++W+   K   S V   D  EQC  +L LSYN+L   LKAC+LY  I  +D
Sbjct  356  LLSRSKRTIKDWEEIAKDVMSFV-RNDPDEQCLHVLGLSYNHLTSDLKACLLYFGIFSED  414

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNG-KIKTCRV  878
              I VK+LVRLWIA GF++L   ++LE  A   LQDL DR L+ + K+  +G KI++C+V
Sbjct  415  SDISVKKLVRLWIAAGFLKL--GKDLEGEAKKCLQDLIDRCLVLVSKKSMDGTKIRSCKV  472

Query  879  HDIVHEFCVRE  911
            HD+++E C+RE
Sbjct  473  HDLIYELCLRE  483



>gb|AEW48209.1| disease resistance protein RGH5 [Solanum huancabambense]
Length=908

 Score =   154 bits (390),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 118/181 (65%), Gaps = 6/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA  LY DP + S FDI     VSQ++ VR +L+ LL+  +   DE  D +LA
Sbjct  172  GGIGKTTLAAKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTS---DE-PDYQLA  227

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +LQK L+G+RYL+V+DDIW+T +W+ I+ CFPD    SRILLTTR+ EVA+ A SSG  
Sbjct  228  DRLQKHLKGRRYLVVIDDIWTTEAWDDIKPCFPDCINGSRILLTTRNVEVAEYA-SSGKP  286

Query  362  LHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             H +  +  +ESW+L  K  F    S   E E IG+++  KC GLPLAI V+AG+  K  
Sbjct  287  PHHMRLMKFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKMG  346

Query  539  Q  541
            Q
Sbjct  347  Q  347


 Score =   122 bits (306),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 90/152 (59%), Gaps = 3/152 (2%)
 Frame = +3

Query  528  SKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEA  707
            SK+ + ++EWQ   +  +S VV+TD   QC R+L LSY++LP HLK C LY +I  +DE 
Sbjct  343  SKMGQRLDEWQRIAENVSS-VVSTDPEAQCMRVLALSYHHLPSHLKPCFLYFAIFAEDEW  401

Query  708  IIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDI  887
            I V +LV LW  EGF+     +++EEVA   + +L DRSLI I    F G I++C +HD+
Sbjct  402  IFVNKLVELWSVEGFLNEEEGKSIEEVATTCINELIDRSLIFIHNFSFRGTIESCGMHDV  461

Query  888  VHEFCVREAIKEKLLNV--DNKQHPSCGELQQ  977
              E C+REA     +NV        SC +  Q
Sbjct  462  TRELCLREARNMNFVNVIRGKSDQNSCAQSMQ  493



>ref|XP_011072173.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=869

 Score =   152 bits (384),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 115/179 (64%), Gaps = 3/179 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLAR  ++ P V + FDI +W  +SQ ++VR++L+  LN+   +    +   L 
Sbjct  182  GGIGKTTLARNAFDHPYVVNRFDICIWFTISQVYNVREILLHYLNDGKDEESNESLARLG  241

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             KL K L G+RYLIV+DD+WST++W+   L FP++   SR+L+TTR  +V  S  +    
Sbjct  242  EKLHKKLFGRRYLIVMDDVWSTKAWDDFSLFFPNNGNGSRVLMTTRLSKVGGSLGTHNPY  301

Query  362  LHTLGFLNQEESWDLFCKSFPGIQSLPF-ELETIGRKVVDKCHGLPLAIVVVAGVFFKT  535
            L  + FLN+E+SW+L C+   G    P+ ELE +G+ +   C GLP+AIVV++G+  +T
Sbjct  302  L--MDFLNEEKSWNLLCEKVFGQNDCPYSELEKVGKDIAKGCKGLPIAIVVISGLLART  358


 Score =   124 bits (311),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 88/143 (62%), Gaps = 1/143 (1%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              ++ +   E W++  +   S   + D +  C  IL+LSYN LP+HLK C LY+S  P+D
Sbjct  354  LLARTDMKQERWEHIARNVASFASSKD-NRHCLEILSLSYNNLPIHLKPCFLYMSAFPED  412

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
              I V RL++LW+A G+ +    +NLEE+A  YL+DL DR+LI I +R   GKI++C +H
Sbjct  413  SKIKVSRLIKLWVANGYSKPERGKNLEEIAMEYLEDLIDRNLILISERTDGGKIRSCSIH  472

Query  882  DIVHEFCVREAIKEKLLNVDNKQ  950
            D++   C+RE+ KE L  V   Q
Sbjct  473  DLLRNLCLRESKKEHLFRVSKTQ  495



>gb|EYU24428.1| hypothetical protein MIMGU_mgv1a001134mg [Erythranthe guttata]
Length=880

 Score =   145 bits (365),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 114/183 (62%), Gaps = 5/183 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEV-TDGEL  178
            GGIGKTTLAR  YE  L+ +HFDI  W  +SQ++ V  +   LL+ ++    E   + +L
Sbjct  179  GGIGKTTLARNAYESRLILNHFDICAWAAISQEYSVNGIFSKLLSCQSKSTGETGREDQL  238

Query  179  AGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGN  358
              ++ K L G+RYLIVLDD+WS  +W+ I+  FPD+N  SR+++TTR   +A    S  +
Sbjct  239  GERMYKSLVGRRYLIVLDDMWSIEAWDKIKRFFPDNNNGSRVVVTTRLSNMATHLGS--D  296

Query  359  RLHTLGFLNQEESWDLFC-KSFPGI-QSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
               ++ FL+++ SW LFC K+FP      P ELE I +++V KC GLPL IVV+  V  K
Sbjct  297  SYLSMKFLDKDTSWKLFCEKAFPQEGGGCPSELEDIAKRIVGKCKGLPLLIVVIGAVVRK  356

Query  533  TQQ  541
            + +
Sbjct  357  SSK  359


 Score =   130 bits (327),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 92/145 (63%), Gaps = 3/145 (2%)
 Frame = +3

Query  531  KLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAI  710
            K +KT E  +N  +  NS++   D  EQ   IL+LSY +LP+HLK C LY+ I P+D  I
Sbjct  356  KSSKTQEYLENLSRNMNSIL---DSEEQSLDILSLSYRHLPVHLKPCFLYMGIFPEDHVI  412

Query  711  IVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIV  890
             V RL++LW+ EGF++   ++ LEEVA GYL+DL DR+LI +      GKIKTC VHD++
Sbjct  413  RVSRLIKLWVVEGFIKPNETQTLEEVAEGYLKDLVDRNLIIVGTFGSTGKIKTCHVHDLL  472

Query  891  HEFCVREAIKEKLLNVDNKQHPSCG  965
             + C++ A KEK L V      S G
Sbjct  473  RDLCLKTAHKEKFLYVVGVSDSSQG  497



>ref|XP_011072192.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=881

 Score =   142 bits (357),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 110/181 (61%), Gaps = 6/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKID---EVTDG  172
            GG+GKTTLAR LY+D LV  HFD+  W  +SQ + V  ++  LL N    I+   E +  
Sbjct  184  GGVGKTTLARNLYDDSLVKDHFDLCAWVTISQTYLVDDVIRGLLANFGVVINRPKEKSVQ  243

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            +L   L K L+G+RY+IVLDD+WST+ W+ ++  FPDD   SRI+LTTR + VA  A  S
Sbjct  244  DLTQTLWKFLKGRRYIIVLDDMWSTQVWDDMKRMFPDDGNGSRIMLTTRLQGVAVYATDS  303

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLP---FELETIGRKVVDKCHGLPLAIVVVAGV  523
             +  H +  L++++SW L C+   G +  P    ELE IG+ +   C GLPLA  VV G+
Sbjct  304  FSPPHRIRLLDKDKSWHLLCQEVFGQEGCPPEFQELEDIGKMIAHNCKGLPLAARVVGGL  363

Query  524  F  526
             
Sbjct  364  L  364


 Score =   133 bits (335),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 97/164 (59%), Gaps = 19/164 (12%)
 Frame = +3

Query  543   TVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKR  722
             T E W       NS+ +  D  EQCS IL+LSYN+LP HLK C LYL   P+D  I V +
Sbjct  370   TREFWGYVADNVNSITIEND--EQCSEILSLSYNHLPHHLKPCFLYLGAFPEDYEIPVTK  427

Query  723   LVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFC  902
             L+RLWIAEGF+    S++LE  A GYL DL DR+L+ +++R  NGK +TC +HD++ + C
Sbjct  428   LIRLWIAEGFLRPSRSKSLEVAAEGYLNDLIDRNLVIVRQRGSNGKTRTCTMHDLLRDLC  487

Query  903   VREAIKEKLLNVDNKQHPSCGELQQEGCRWLNFWPKKIPDLDNI  1034
             ++EA  E  L++ N              R   F P   PD+DNI
Sbjct  488   LKEAQNENFLHIIN--------------RSAQFSP---PDMDNI  514



>ref|XP_011073039.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=868

 Score =   151 bits (381),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 118/185 (64%), Gaps = 6/185 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN----EAAKIDEVTD  169
            GGIGKTTLA+ +++ P + + FDI +W  +SQ++ VR+ L+  L N    +A+  DE+  
Sbjct  185  GGIGKTTLAQNVFDHPYIINRFDIRIWFTISQQYSVREDLLKYLINDKKIQASAADELDL  244

Query  170  GELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADS  349
             +L     K L GKRYLIVLDD+WS ++WE  ++ FPD++ RSRIL+TTR  +VA     
Sbjct  245  TKLGECFHKLLFGKRYLIVLDDLWSIKAWEDFKMSFPDNSNRSRILVTTRLLDVARPL-G  303

Query  350  SGNRLHTLGFLNQEESWDLFCKSFPGIQSLPF-ELETIGRKVVDKCHGLPLAIVVVAGVF  526
              N   T+  L+ ++SW+L C+     +S P+ ELE IGR +   C+GLPLAIVV+ G+ 
Sbjct  304  FDNHYFTMTILDNDQSWNLLCQKTFARKSCPYPELEEIGRNIARCCYGLPLAIVVIGGLL  363

Query  527  FKTQQ  541
             K+  
Sbjct  364  AKSNH  368


 Score =   124 bits (311),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 92/139 (66%), Gaps = 1/139 (1%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              +K N T E W+   K   S V + D  + C +IL+LSYN LP++LK C LY+ + P+D
Sbjct  362  LLAKSNHTREYWEFVAKNVTSFVNSGD-DDHCLKILSLSYNSLPIYLKPCFLYMRVFPED  420

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
            + I   +L+ LWI+EGF++L+  ++++E A   L+DLADR+LI I+K   +GKIK C +H
Sbjct  421  DWIEASKLIELWISEGFLKLLGGKSMKEAAKECLKDLADRNLIFIRKWTRSGKIKECGIH  480

Query  882  DIVHEFCVREAIKEKLLNV  938
            DI+ E C RE+ +E L+ V
Sbjct  481  DILRELCFRESKRENLIRV  499



>ref|XP_009766921.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=479

 Score =   164 bits (416),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 121/173 (70%), Gaps = 4/173 (2%)
 Frame = +2

Query  14   KTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTD-GELAGKL  190
            KTTLA+ +Y D  V  HFD+  W  VS +++++++L+ LL++       + D  ELA  L
Sbjct  188  KTTLAKEVYNDASVRRHFDVCSWATVSSQYNLKEILLSLLHSTKGDTFYMEDEAELADML  247

Query  191  QKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNRLHT  370
            QK L+ +RYLIVLDD+WS+++W+ ++ CFP  N  SRILLTTR+ EVA SA +    L  
Sbjct  248  QKNLKSRRYLIVLDDVWSSKAWDDVRQCFPVQNNGSRILLTTRNNEVACSAGTKDLSL-P  306

Query  371  LGFLNQEESWDLF-CKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
            +G ++  ESW+LF   +FP  +SLP + ETIG+++VDKCHGLPL IVVVAG+F
Sbjct  307  MGLMDPVESWNLFKSAAFPN-ESLPSDFETIGKQIVDKCHGLPLTIVVVAGLF  358


 Score =   110 bits (276),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 83/123 (67%), Gaps = 5/123 (4%)
 Frame = +3

Query  531  KLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAI  710
            K  +T+E+W+N  K   S  +T D  +QC  +L LSYN+L   LKAC+LY  I P+D AI
Sbjct  359  KFKRTIEDWENVAKDVKS--ITNDPDKQCLHVLGLSYNHLTSDLKACLLYFGIFPEDSAI  416

Query  711  IVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFN-GKIKTCRVHDI  887
             VK+LVRLW+AEGF++L   ++L+E A   LQDL DR L+ + K+  +   IK C+VHD+
Sbjct  417  PVKKLVRLWMAEGFLKL--EKDLQEEAEKCLQDLIDRCLVLVCKKSLDETNIKFCKVHDL  474

Query  888  VHE  896
            +++
Sbjct  475  IYD  477



>gb|AEW48208.1| disease resistance protein RGH4 [Solanum huancabambense]
Length=877

 Score =   158 bits (399),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 118/181 (65%), Gaps = 6/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA  LY DP + S FDI     VSQ++ VR +L  LL++    I +  D +LA
Sbjct  172  GGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLQGLLSS----ISDEPDYQLA  227

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +LQK L+G+RYL+V+DDIW+T +W+ I+LCFPD    SRILLTTR+ EVA+ A SSG  
Sbjct  228  DRLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCINGSRILLTTRNVEVAEYA-SSGKP  286

Query  362  LHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             H +  +  +ESW+L  K  F    S   E E IG+++  KC GLPLAI V+AG+  K  
Sbjct  287  PHHMRLMKFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKMG  346

Query  539  Q  541
            Q
Sbjct  347  Q  347


 Score =   117 bits (292),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 88/154 (57%), Gaps = 3/154 (2%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK+ + ++EWQ   +  +S VV+ D   QC R+L LSY++LP HLK C LY +I  +D
Sbjct  341  LLSKMGQRLDEWQRIAENVSS-VVSRDPEAQCMRVLALSYHHLPSHLKPCFLYFAIFAED  399

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
            E I V +LV LW  E F+     +++EEVA   + +L DRSLI I    F G I++C +H
Sbjct  400  EEIYVNKLVELWAVERFLNEEEGKSIEEVATTCINELIDRSLIFIHNFSFRGTIESCGMH  459

Query  882  DIVHEFCVREAIKEKLLNV--DNKQHPSCGELQQ  977
            D+  E C+REA     +NV        SC +  Q
Sbjct  460  DVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQ  493



>emb|CDP00691.1| unnamed protein product [Coffea canephora]
Length=693

 Score =   151 bits (381),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 111/178 (62%), Gaps = 4/178 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKID---EVTDG  172
            GGIGKTTLAR  + DP    HF    W  VSQ +  R +L+ L ++ A   D   E ++ 
Sbjct  2    GGIGKTTLARKAFNDPYTVYHFYCRAWITVSQVYQARDLLLALWSSIAQSTDKMVEKSNA  61

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            +LA  + + L+GKRY+IV+DD+WS+ +W  ++ CFPDD   SRI++T+R KE+A +  S 
Sbjct  62   QLAEIVYRRLKGKRYVIVMDDLWSSDAWNDVKRCFPDDENGSRIVVTSRFKELATNV-SP  120

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
                H +  LN E+SW+L  K   G  S P EL  +G+++  +C GLPLAIVV+AGV 
Sbjct  121  KKPPHCMNLLNIEQSWELLEKLIFGTASCPHELVGVGKQIAKRCRGLPLAIVVIAGVL  178


 Score =   122 bits (306),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 94/149 (63%), Gaps = 2/149 (1%)
 Frame = +3

Query  555   WQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRL  734
             W    ++ +S VV+TD  E C  IL LSYN LP HLKAC LY+ I P+D  I V +L+ L
Sbjct  188   WNEIAEEVSS-VVSTD-PENCLDILALSYNCLPHHLKACFLYMGIFPEDCEIEVSKLINL  245

Query  735   WIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREA  914
             W AEGF+ L + + LE++   Y++DL  R+L+ ++K+ F G++KTCR+HD + E C++EA
Sbjct  246   WAAEGFLYLNSEKQLEQIGEDYVEDLIGRNLVLVEKKRFGGEVKTCRLHDFLRELCLKEA  305

Query  915   IKEKLLNVDNKQHPSCGELQQEGCRWLNF  1001
              KE  ++V  ++     +      R L+F
Sbjct  306   QKENFMHVIQRRSAKGVQAGTRNQRRLSF  334



>ref|XP_006367920.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X5 [Solanum tuberosum]
Length=476

 Score =   163 bits (412),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 120/184 (65%), Gaps = 5/184 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEV----TD  169
            GGIGKTTLAR +Y+D L++ HF +  WT VSQ+ D R++ + +L +  A  DEV    T+
Sbjct  177  GGIGKTTLARRVYDDSLIAYHFYVRAWTNVSQEFDTREIFLGILRSIGAVNDEVERNSTN  236

Query  170  GELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADS  349
             +LA ++ + L+G++YLIVLDD+WS  +W+ ++  FPDD+  SRI+LTTR  +VA  A  
Sbjct  237  EQLAERVYRSLKGRKYLIVLDDMWSIEAWQHVRRSFPDDHNGSRIVLTTRLADVASCA-C  295

Query  350  SGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFF  529
            S N LH + FL+ EESW L      G  S   ELE IGR +V +C GLPLA+V + G+  
Sbjct  296  SVNSLHQMRFLSMEESWTLLRDKVFGNGSYSPELEKIGRYIVHQCQGLPLAVVAIGGLLS  355

Query  530  KTQQ  541
            K  +
Sbjct  356  KMSK  359


 Score =   110 bits (275),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 86/126 (68%), Gaps = 2/126 (2%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
              SK++K    W+N  ++  SL+ T+D ++ C  IL+LSYN+LP +LKAC LY+ +  + 
Sbjct  353  LLSKMSKETSSWENVAEKVGSLM-TSDTTD-CLNILSLSYNHLPQYLKACFLYMGVFAEI  410

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
              I V +L++LWIAEGFV+ +N +NLE+VA   L++L DRSL+ + K     KIKTC++H
Sbjct  411  REIPVWKLIKLWIAEGFVKKVNHKNLEDVAEENLRELVDRSLVLVGKHTSLRKIKTCKMH  470

Query  882  DIVHEF  899
            D+V + 
Sbjct  471  DLVRDM  476



>ref|XP_011072136.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=877

 Score =   156 bits (395),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 120/181 (66%), Gaps = 4/181 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKID-EVTDGEL  178
            GGIGKTTLAR ++E P + +HFD+  W  +SQ+++VRK+++DLLN+   + D + T  EL
Sbjct  187  GGIGKTTLARNIFEHPYIVNHFDMCKWLTISQENNVRKIVLDLLNDVKTEDDNKKTLAEL  246

Query  179  AGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGN  358
               L K L G+RYLIV+DD+W+T  W+ ++L  P +   SRIL+TTR   V  S   S N
Sbjct  247  GNLLHKKLFGRRYLIVMDDVWNTNVWDDLKLFLPKNKTGSRILVTTRLSNVVVSL--SSN  304

Query  359  RLHTLGFLNQEESWDLFCKSFPGIQSLPF-ELETIGRKVVDKCHGLPLAIVVVAGVFFKT  535
            + + + FL++++SW+L C+     +S P+ ELE IG+ +   C GLPLAIVV+ G+  K+
Sbjct  305  KSYMMDFLDEDKSWNLLCQETFSQESCPYPELENIGKDIAKGCKGLPLAIVVIGGLLGKS  364

Query  536  Q  538
             
Sbjct  365  N  365


 Score =   116 bits (291),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 87/148 (59%), Gaps = 1/148 (1%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
               K N T E W+   K   S+  + D  + C RIL+LSY+ LP+HLK C LY+ +  +D
Sbjct  360  LLGKSNMTRESWELVAKNLTSVANSED-DDYCLRILSLSYHNLPIHLKPCFLYMGVFRED  418

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
              I V +L +LW+AEGF++ I  ++LE+VA  YL+DL DR+LI ++       I+TC +H
Sbjct  419  YKITVSKLAKLWVAEGFLKPIRGKSLEQVAEAYLRDLIDRNLILVRTYGHGRNIETCGIH  478

Query  882  DIVHEFCVREAIKEKLLNVDNKQHPSCG  965
            D++ + C+RE  KE  +     Q    G
Sbjct  479  DLLRDVCLRENEKENFMRSPKVQRAYIG  506



>ref|XP_006348816.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
[Solanum tuberosum]
Length=1437

 Score =   161 bits (408),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 123/187 (66%), Gaps = 6/187 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN---EAAKIDEVTDG  172
             G+GKTTLA  LY D  V S+FDI     VSQ++  + +L+ +L++   E AK+   T+ 
Sbjct  747  AGLGKTTLANKLYSDKSVVSYFDIHAHCCVSQEYTRKDLLLAILHDITDERAKLRRETEN  806

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA KL+K L  KRYL+++DD+W TR+W+ ++LCFP+DN RSRI+LTTRH EVA  A   
Sbjct  807  ELADKLRKLLMRKRYLLLIDDVWETRAWDDLKLCFPEDNNRSRIILTTRHYEVASHAKHD  866

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF--  526
             +  H L FLN +ESW L  K     +S P  L  + +++V KC GLP++I++VAG+   
Sbjct  867  SDP-HKLRFLNSDESWMLLNKKVFNNESGPLILRDVSQEIVRKCGGLPISIILVAGILTR  925

Query  527  FKTQQNC  547
             K +++C
Sbjct  926  MKKEKHC  932


 Score =   110 bits (275),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 78/124 (63%), Gaps = 3/124 (2%)
 Frame = +3

Query  597   TDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSEN  776
             T++ +Q    L LSY  LP +LK C LYL + P+D  I V +L  LWIAEGF++    + 
Sbjct  942   TNIQDQMEGTLDLSYQNLPPYLKPCFLYLGVFPEDGEIQVSKLTWLWIAEGFIKPHTGKT  1001

Query  777   LEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLL---NVDNK  947
             LEE+A  YL++L  R+L+ I KR  +G+IKTC +HD+VHE C ++A  E +L   N D  
Sbjct  1002  LEEIAENYLENLVGRNLVMIDKRSSDGRIKTCHIHDLVHEVCRKKAKLENILQRINGDAG  1061

Query  948   QHPS  959
               P+
Sbjct  1062  SDPT  1065



>ref|XP_009762701.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=983

 Score =   151 bits (381),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 117/181 (65%), Gaps = 7/181 (4%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN------EAAKIDEV  163
            GGIGK+T A+ ++ DP + S FD   W  VS+ + +RKML+ LL +      +  K+D+ 
Sbjct  176  GGIGKSTFAKKMFYDPSILSFFDFRGWITVSKDYSLRKMLLSLLQDTIVEKEKKEKLDKK  235

Query  164  TDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSA  343
            ++G+LA  LQK L+G+RYLIV+DDIWS  +W+ I+L FP+++  SRILLTTR  +VA+ A
Sbjct  236  SNGDLADLLQKSLKGRRYLIVVDDIWSREAWDDIRLWFPENSNASRILLTTRDMKVAEYA  295

Query  344  DSSGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGV  523
             S  +    +  L  EESW+LFC+   G +  P E E + + VV+ C GLPL I VVAG 
Sbjct  296  SSPEDPF-PMRPLELEESWNLFCQKAFGKKDCPTEFENVAKLVVENCKGLPLMISVVAGA  354

Query  524  F  526
             
Sbjct  355  L  355


 Score =   120 bits (301),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 99/155 (64%), Gaps = 3/155 (2%)
 Frame = +3

Query  540  KTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVK  719
            + +EEW+   +  +SLV   D  ++CS +L LSY +LP HLKAC LY  + PK   I VK
Sbjct  359  RRLEEWREVAQSVSSLVNLDDY-QRCSGVLALSYKHLPSHLKACYLYFGVFPKAREISVK  417

Query  720  RLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEF  899
            +L+RLW AEG +EL   E LE++A   L DL D++L+ +  R   G+IK CR+HD++H+ 
Sbjct  418  KLIRLWAAEGLLELKGLEGLEKLASNLLHDLIDKNLVVVSTRSLCGRIKACRIHDLLHDL  477

Query  900  CVREAIKEKLL--NVDNKQHPSCGELQQEGCRWLN  998
            C+REA +E LL   V +      G++  EGCRW++
Sbjct  478  CLREAKREMLLYSYVVDPISYGAGKILPEGCRWVS  512



>ref|XP_010320901.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X2 [Solanum lycopersicum]
Length=1493

 Score =   155 bits (392),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 119/185 (64%), Gaps = 5/185 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLV----DLLNNEAAKIDEVTD  169
             G+GKTTLA  LY D  V S+FDI     VSQ++  + +L+    D++ +E AK+   T+
Sbjct  802  AGLGKTTLANKLYSDESVVSYFDIHAHCCVSQQYTRKDLLLAILHDIITDERAKLGRETE  861

Query  170  GELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADS  349
             ELA KL+K L  KRYL+++DD+W T +W+ ++LCFP+DN  SRI+LTTRH EVA  A  
Sbjct  862  NELADKLRKLLMRKRYLLLIDDVWETSAWDDLKLCFPEDNNGSRIILTTRHYEVASHAKH  921

Query  350  SGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFF  529
              +  H L  LN +ESW L  K     +S P     IG+++V KC GLPL+I++VAG+  
Sbjct  922  DSDP-HKLRSLNNDESWMLLNKKVFNNESCPLIPRDIGQEIVRKCGGLPLSIILVAGILT  980

Query  530  KTQQN  544
            + +++
Sbjct  981  RMKKD  985


 Score =   113 bits (283),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 81/123 (66%), Gaps = 3/123 (2%)
 Frame = +3

Query  600   DLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENL  779
             ++ +Q    L LSY +LP +LK C LYL + P+D  I V +L  LWIAEGF++    + L
Sbjct  999   NIQDQMEGTLDLSYQHLPPYLKPCFLYLGLFPEDREIQVSKLTWLWIAEGFIKPHAGKTL  1058

Query  780   EEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKL---LNVDNKQ  950
             EE+A  +L++L  R+L+ ++KR F+G+IK CR+HD+VHEFC ++A  E +   +N D   
Sbjct  1059  EEIAENHLENLVGRNLVMVKKRSFDGRIKACRIHDLVHEFCRKKAKLENIIQRINGDAGS  1118

Query  951   HPS  959
              P+
Sbjct  1119  DPT  1121



>ref|XP_010320900.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Solanum lycopersicum]
Length=1495

 Score =   155 bits (392),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 119/185 (64%), Gaps = 5/185 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLV----DLLNNEAAKIDEVTD  169
             G+GKTTLA  LY D  V S+FDI     VSQ++  + +L+    D++ +E AK+   T+
Sbjct  802  AGLGKTTLANKLYSDESVVSYFDIHAHCCVSQQYTRKDLLLAILHDIITDERAKLGRETE  861

Query  170  GELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADS  349
             ELA KL+K L  KRYL+++DD+W T +W+ ++LCFP+DN  SRI+LTTRH EVA  A  
Sbjct  862  NELADKLRKLLMRKRYLLLIDDVWETSAWDDLKLCFPEDNNGSRIILTTRHYEVASHAKH  921

Query  350  SGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFF  529
              +  H L  LN +ESW L  K     +S P     IG+++V KC GLPL+I++VAG+  
Sbjct  922  DSDP-HKLRSLNNDESWMLLNKKVFNNESCPLIPRDIGQEIVRKCGGLPLSIILVAGILT  980

Query  530  KTQQN  544
            + +++
Sbjct  981  RMKKD  985


 Score =   113 bits (283),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 81/123 (66%), Gaps = 3/123 (2%)
 Frame = +3

Query  600   DLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENL  779
             ++ +Q    L LSY +LP +LK C LYL + P+D  I V +L  LWIAEGF++    + L
Sbjct  999   NIQDQMEGTLDLSYQHLPPYLKPCFLYLGLFPEDREIQVSKLTWLWIAEGFIKPHAGKTL  1058

Query  780   EEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKL---LNVDNKQ  950
             EE+A  +L++L  R+L+ ++KR F+G+IK CR+HD+VHEFC ++A  E +   +N D   
Sbjct  1059  EEIAENHLENLVGRNLVMVKKRSFDGRIKACRIHDLVHEFCRKKAKLENIIQRINGDAGS  1118

Query  951   HPS  959
              P+
Sbjct  1119  DPT  1121



>ref|XP_006361239.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X1 [Solanum tuberosum]
Length=992

 Score =   145 bits (367),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 113/176 (64%), Gaps = 4/176 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAA---KIDEVTDG  172
            GGIGK+T A+ ++ DP +   F++  W  VS+ + ++KML+ LL +      ++DE  D 
Sbjct  283  GGIGKSTFAKKMFSDPSIVGFFNVCGWITVSKDYSLKKMLLSLLQDAIGVNEQLDEKPDD  342

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA  LQK L+ +RYLIV+DDIWS  +WE I+  FP+ N RSRILLTTR  EVA  A SS
Sbjct  343  ELADCLQKSLKKRRYLIVVDDIWSIEAWEDIRQWFPEHNNRSRILLTTRITEVARDA-SS  401

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAG  520
              +   + FL+ +ESW+LFC+   G    P E E +G+ +   C+GLPL I VVAG
Sbjct  402  PKKPFQMRFLDPDESWNLFCQKAFGKNDCPAEFENVGKVIAGNCNGLPLMISVVAG  457


 Score =   123 bits (308),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 93/161 (58%), Gaps = 6/161 (4%)
 Frame = +3

Query  540   KTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVK  719
             K + +W    +  +SLV   D  ++CS +L LSYN+LP HLKAC LY  +  K   I V+
Sbjct  463   KMLRKWHEVAQSVSSLV-NLDEYQRCSGVLALSYNHLPSHLKACFLYFGVFKKASEISVE  521

Query  720   RLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEF  899
              L+RLW+AEG  +L     LE+ A   L DL D+SLI   K   +GKIKTCR+HD++H+ 
Sbjct  522   NLIRLWMAEGLFKLRGIGELEKEASSLLHDLIDKSLIVACKHSLDGKIKTCRIHDLLHDL  581

Query  900   CVREAIKEKLLNVDNKQHPSCGELQQEGCRWLNFWPKKIPD  1022
             C+ E+  E LL V N   P     Q    RW++F  K + D
Sbjct  582   CLSESESENLLYVSN---PPTNVRQHR--RWVSFHQKPMQD  617



>ref|XP_009612031.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
 ref|XP_009612039.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=872

 Score =   147 bits (371),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 112/180 (62%), Gaps = 8/180 (4%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEV---TDG  172
             GIGK+TLA+ +++D  +  +F I  W  VS+  + RKML+DLL +  AK +E+   TDG
Sbjct  175  AGIGKSTLAKDIFQDTFIKQYFHIRKWITVSENCNFRKMLLDLLQDATAKKEELNKKTDG  234

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            +LAG  Q  L+ +RYLI++DDIWS  +W  +   FPD    SR++LT+R + VAD A S 
Sbjct  235  DLAGIFQNSLKVERYLIIVDDIWSKEAWNRMIHWFPDCENNSRLVLTSRDQPVADHATSP  294

Query  353  GN--RLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
             +  R+H    L  ++SWDLF +     +  P E + IGR+VV +C GLPL I  VAG+ 
Sbjct  295  EDVIRMH---LLEPDKSWDLFHQKVFAKRDYPVEFKEIGREVVKECKGLPLMITAVAGIL  351


 Score =   120 bits (302),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 97/155 (63%), Gaps = 4/155 (3%)
 Frame = +3

Query  543  TVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKR  722
            T++EW+   K  +SLV   D  ++C  ++ LSYN+LP H+KAC L   + PK   I VK+
Sbjct  356  TLDEWKKVAKNMSSLVNNDDY-QRCLEVVDLSYNHLPSHMKACFLNFGVFPKAIEISVKK  414

Query  723  LVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFC  902
            L+RLW+A+G ++L   +  E+VA   L DL  ++L+ I K+  +G IKTCR+HD+ H+ C
Sbjct  415  LIRLWVAKGLLKLKGVKEWEKVAAKVLLDLIGKNLVIIDKQSLDGNIKTCRIHDLFHDLC  474

Query  903  VREAIKEKLLNVDNKQHPSCGELQQ---EGCRWLN  998
            +REA +E LL V +    S   +Q+   +  RW++
Sbjct  475  LREAERENLLYVTSDATISASGIQRNLPKDRRWVS  509



>ref|XP_006361240.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X2 [Solanum tuberosum]
Length=859

 Score =   145 bits (366),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 113/176 (64%), Gaps = 4/176 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAA---KIDEVTDG  172
            GGIGK+T A+ ++ DP +   F++  W  VS+ + ++KML+ LL +      ++DE  D 
Sbjct  150  GGIGKSTFAKKMFSDPSIVGFFNVCGWITVSKDYSLKKMLLSLLQDAIGVNEQLDEKPDD  209

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA  LQK L+ +RYLIV+DDIWS  +WE I+  FP+ N RSRILLTTR  EVA  A SS
Sbjct  210  ELADCLQKSLKKRRYLIVVDDIWSIEAWEDIRQWFPEHNNRSRILLTTRITEVARDA-SS  268

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAG  520
              +   + FL+ +ESW+LFC+   G    P E E +G+ +   C+GLPL I VVAG
Sbjct  269  PKKPFQMRFLDPDESWNLFCQKAFGKNDCPAEFENVGKVIAGNCNGLPLMISVVAG  324


 Score =   122 bits (307),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 93/161 (58%), Gaps = 6/161 (4%)
 Frame = +3

Query  540   KTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVK  719
             K + +W    +  +SLV   D  ++CS +L LSYN+LP HLKAC LY  +  K   I V+
Sbjct  330   KMLRKWHEVAQSVSSLV-NLDEYQRCSGVLALSYNHLPSHLKACFLYFGVFKKASEISVE  388

Query  720   RLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEF  899
              L+RLW+AEG  +L     LE+ A   L DL D+SLI   K   +GKIKTCR+HD++H+ 
Sbjct  389   NLIRLWMAEGLFKLRGIGELEKEASSLLHDLIDKSLIVACKHSLDGKIKTCRIHDLLHDL  448

Query  900   CVREAIKEKLLNVDNKQHPSCGELQQEGCRWLNFWPKKIPD  1022
             C+ E+  E LL V N   P     Q    RW++F  K + D
Sbjct  449   CLSESESENLLYVSN---PPTNVRQHR--RWVSFHQKPMQD  484



>ref|XP_006348578.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=915

 Score =   150 bits (380),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 108/182 (59%), Gaps = 11/182 (6%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLN--------NEAAKID  157
            GGIGKTTLAR  ++   +  HFDI VW  VSQK+  R +L++ L+        +     D
Sbjct  149  GGIGKTTLARKAHDHLTIRYHFDIRVWITVSQKYGSRNVLLEALHCISKQKNIDIGKDYD  208

Query  158  EVTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVAD  337
            E  D ELA  +QK L+G RYL+V+DDIWST  W+ I+  FPD N RSRILLTTR   VA 
Sbjct  209  EKDDNELADLVQKKLKGPRYLLVVDDIWSTDVWDNIRGIFPDCNNRSRILLTTRETNVAM  268

Query  338  SADSSGNRLHTLGFLNQEESWDLFC-KSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVV  514
             A+      H +  LN E SW L C K F      P EL  IG+K+ +KC GLPL I V+
Sbjct  269  YANPVSP--HKMNLLNLENSWKLICDKVFGPKHDCPPELVEIGKKIAEKCQGLPLTISVI  326

Query  515  AG  520
            AG
Sbjct  327  AG  328


 Score =   117 bits (292),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 90/141 (64%), Gaps = 3/141 (2%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             SK+ +T+  W +  +    ++ +    ++C  +L LSY++LP HLK C L +   P+D 
Sbjct  330  LSKVARTLGSWMDVARTLGEIIASH--PDKCLGVLGLSYHHLPNHLKPCFLSIGGFPEDY  387

Query  705  AIIVKRLVRLWIAEGFVELINSE-NLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
             +   RL+RLWIAEGF++   SE +LEE A  YL+DL  R+LI ++K+ FNG+IK C +H
Sbjct  388  QVETWRLIRLWIAEGFIKRPGSEKSLEEAAEDYLEDLISRNLIMVRKKRFNGEIKACGMH  447

Query  882  DIVHEFCVREAIKEKLLNVDN  944
            D++ EFC+ E  + K ++V+ 
Sbjct  448  DLLREFCLTEVERTKFMHVET  468



>ref|XP_009617727.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=478

 Score =   154 bits (389),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 113/181 (62%), Gaps = 10/181 (6%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLN-----NEAAKID--E  160
            GGIGKTTLAR  Y+   +  HFDI VW  +SQ+   R +L+D L+     N   +ID  +
Sbjct  17   GGIGKTTLARKAYDHLPIRYHFDIRVWVTISQEFRCRNVLLDALHCISGPNVFNRIDYDK  76

Query  161  VTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADS  340
              D ELA  +QK L+G+RYL+V+DDIWST  W  I+  FPD N RSRILLT+R  +VA  
Sbjct  77   KDDNELADLVQKNLKGRRYLVVVDDIWSTDVWNRIRRIFPDYNNRSRILLTSRETDVAMY  136

Query  341  ADSSGNRLHTLGFLNQEESWDLFC-KSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVA  517
            A+SS    H +  LN + SW L   K F      P ELE IG+K+V+KC GLPL I V+A
Sbjct  137  ANSSSP--HEMNLLNLDNSWKLLGDKVFGPKHDHPPELEEIGKKIVEKCQGLPLTISVIA  194

Query  518  G  520
            G
Sbjct  195  G  195


 Score =   113 bits (283),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 89/143 (62%), Gaps = 3/143 (2%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             SK+ +T++ W++  +    +V +     +C  +L LSY++LP HLK C L +    +D 
Sbjct  197  LSKIARTLKSWKDVARTLGEIVASH--PNKCLEVLGLSYHHLPNHLKHCFLSMGSFQEDF  254

Query  705  AIIVKRLVRLWIAEGFVELINS-ENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
             I   RL++LWIAEGFV    S +NLEEVA  YL+DL  R+LI  +KR FNG+IK C  H
Sbjct  255  QIETGRLIQLWIAEGFVRTSESGKNLEEVAVDYLEDLISRNLILARKRRFNGEIKVCGTH  314

Query  882  DIVHEFCVREAIKEKLLNVDNKQ  950
            D++ EFC+ EA   K ++V+  +
Sbjct  315  DLLREFCLIEAEMTKFMHVERTE  337



>gb|EYU23534.1| hypothetical protein MIMGU_mgv1a023257mg, partial [Erythranthe 
guttata]
Length=913

 Score =   150 bits (378),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 117/179 (65%), Gaps = 6/179 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA+  YE  L+  HFDI  W  VSQK++V+++L+ LL+ ++ + DE   G+  
Sbjct  211  GGIGKTTLAQNAYEHSLILHHFDIRTWVTVSQKYNVKQLLLQLLSRQSCETDEHLLGQ--  268

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +L K L G+RYLIV+DDIWS  +W+ +   FPD+N  SRI++TTR   VA   DSS   
Sbjct  269  -ELHKMLWGRRYLIVIDDIWSIEAWDKVSGFFPDNNNGSRIVVTTRISNVATHFDSS---  324

Query  362  LHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
            L  L FL++++SW L CK   G    P +L  IG+++V KC GLPLAI V+ G+  ++ 
Sbjct  325  LFELSFLDEDQSWKLLCKKAFGHADCPSKLVDIGKEIVQKCKGLPLAICVIGGLLGRSH  383


 Score =   117 bits (292),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 91/132 (69%), Gaps = 2/132 (2%)
 Frame = +3

Query  543  TVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKR  722
            T + W+N  K   S++ + +    CS IL+LSY YLP HLK C LY+ I P+D+ I V +
Sbjct  385  TQKYWKNISKDLISILNSRE-DGNCSSILSLSYTYLPAHLKPCFLYMGIFPEDDEIRVSQ  443

Query  723  LVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFC  902
            L++LW+AEGF++   S++LEE+A GYL +L DR+LI +++   NG+IK CR+HD++ +  
Sbjct  444  LIKLWVAEGFIKSNESQSLEEIARGYLNNLIDRNLI-LKQLGSNGRIKFCRIHDLLRDLS  502

Query  903  VREAIKEKLLNV  938
            ++ A K++ + V
Sbjct  503  LKVAQKDEFICV  514



>ref|XP_011072191.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=884

 Score =   133 bits (335),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 97/164 (59%), Gaps = 19/164 (12%)
 Frame = +3

Query  543   TVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKR  722
             T E W       NS+ +  D  EQCS IL+LSYN+LP HLK C LYL   P+D  I V +
Sbjct  370   TREFWGYVADNVNSITIEND--EQCSEILSLSYNHLPHHLKPCFLYLGAFPEDYEIPVTK  427

Query  723   LVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFC  902
             L+RLWIAEGF+    S++LE  A GYL DL DR+L+ +++R  NGK +TC +HD++ + C
Sbjct  428   LIRLWIAEGFLRPSRSKSLEVAAEGYLNDLIDRNLVIVRQRGSNGKTRTCTMHDLLRDLC  487

Query  903   VREAIKEKLLNVDNKQHPSCGELQQEGCRWLNFWPKKIPDLDNI  1034
             ++EA  E  L++ N+                 F P   PD+DNI
Sbjct  488   LKEAQNENFLHIINRSA--------------QFSP---PDMDNI  514


 Score =   132 bits (331),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 107/181 (59%), Gaps = 6/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKID---EVTDG  172
            GG+GKTTLAR LY+D LV  HFD+  W  +SQ + V  ++  LL N    I+   E +  
Sbjct  184  GGVGKTTLARNLYDDSLVKDHFDLCAWVTISQTYLVDDVIRGLLANFGVVINRPKEKSVQ  243

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            +L   L K L+G+RY+IVLDD+WST+ W+ ++  FP     SRI+LTTR + VA  A  S
Sbjct  244  DLTQTLWKFLKGRRYIIVLDDMWSTQVWDDMKRMFPFRMIGSRIMLTTRLQGVAVYATDS  303

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLP---FELETIGRKVVDKCHGLPLAIVVVAGV  523
             +    +  L++++SW L C+   G +  P    ELE IG+ +   C GLPLA  VV G+
Sbjct  304  FSPALRIRLLDKDKSWHLLCQEVFGQEGCPPEFQELEDIGKMIAHNCKGLPLAARVVGGL  363

Query  524  F  526
             
Sbjct  364  L  364



>ref|XP_010244072.1| PREDICTED: probable disease resistance RPP8-like protein 4 [Nelumbo 
nucifera]
Length=925

 Score =   142 bits (358),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 117/183 (64%), Gaps = 10/183 (5%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN--EAAKIDE-VTDG  172
            GG+GKTTLA+ +Y   LV+ HFD      VSQ++ VR +L  +LN   E +K D+ ++D 
Sbjct  213  GGLGKTTLAKKVYNHNLVTKHFDCRALIYVSQEYRVRDILEXILNQITEFSKEDKKLSDE  272

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            EL  KL   L+ +RYL+V+DDIWS  +W+ ++  FP +   SRILLTTR K+VA  AD  
Sbjct  273  ELEKKLILYLKQRRYLVVVDDIWSVEAWDRLEHIFPKEMMGSRILLTTRKKDVARHADVE  332

Query  353  GNRL-HTLGFLNQEESWDLFC-KSFPGIQS---LPFELETIGRKVVDKCHGLPLAIVVVA  517
              R+ H L  L + ESW+LFC K+    Q+   +P +LE IGR +V KC GLPLAIVV+ 
Sbjct  333  --RIPHELQPLTENESWELFCKKTLLRSQTTCVVPSDLEKIGRDMVGKCKGLPLAIVVLG  390

Query  518  GVF  526
            G  
Sbjct  391  GYL  393


 Score =   123 bits (308),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 94/141 (67%), Gaps = 5/141 (4%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCS--RILTLSYNYLPLHLKACILYLSIVP  695
            + S  +++ +EWQ   K +N +      +E+    +IL+LSYN LP +LK+C LY  + P
Sbjct  392  YLSTRDRSWDEWQ---KVSNRMAWQLSGNEESPIPKILSLSYNDLPYYLKSCFLYFGVFP  448

Query  696  KDEAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCR  875
            +D  I V +L+RLW+AEGF++    + LE+VA  YLQ+L +RS++Q  KR +NG+ KTCR
Sbjct  449  EDSEIPVGKLIRLWVAEGFIQQRGDQTLEDVARDYLQELINRSMVQASKRRYNGEAKTCR  508

Query  876  VHDIVHEFCVREAIKEKLLNV  938
            +HD++ +  + EA +++ L+V
Sbjct  509  IHDLLRDLSISEAKEDRFLDV  529



>ref|XP_011072133.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=874

 Score =   150 bits (378),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 118/181 (65%), Gaps = 4/181 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKID-EVTDGEL  178
            GGIGKTTLAR ++E P + +HFD+  W  +SQ++ VRK+++DLLN+   + D + T  EL
Sbjct  187  GGIGKTTLARSIFEHPYIVNHFDMRRWLTISQENRVRKIVLDLLNDVKIEDDNKKTLAEL  246

Query  179  AGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGN  358
               L K L G+RYLIV+DD+W+T  W+ ++L  P +   SRIL+TTR   V  S   S  
Sbjct  247  GSLLYKKLFGRRYLIVMDDVWNTNVWDDLKLFLPKNENGSRILVTTRLSNVVVSL--SSK  304

Query  359  RLHTLGFLNQEESWDLFCKSFPGIQSLPF-ELETIGRKVVDKCHGLPLAIVVVAGVFFKT  535
            + + + FL++++SW+L C+     +S P+ ELE IG+ +   C GLPLAIVV+ G+  K+
Sbjct  305  KPYMMDFLDEDKSWNLLCQETFSQESCPYPELENIGKDIAKGCKGLPLAIVVLGGLLGKS  364

Query  536  Q  538
             
Sbjct  365  N  365


 Score =   114 bits (286),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 85/148 (57%), Gaps = 1/148 (1%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
               K N T E W+   K   S+    D  + C RIL+LSY+ LP+HLK C LY+ +  +D
Sbjct  360  LLGKSNMTRESWELVAKNLTSVANLED-DDYCLRILSLSYHNLPIHLKPCFLYMGVFRED  418

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
              I V +L +LW+AEGF++ I  ++LE+ A  YL+DL DR+LI I+       I+TC +H
Sbjct  419  YRITVSKLAKLWVAEGFLKSIKGKSLEQAAEAYLRDLIDRNLILIRTYGHGRNIETCGIH  478

Query  882  DIVHEFCVREAIKEKLLNVDNKQHPSCG  965
            D++ + C+RE  KE  +     Q    G
Sbjct  479  DLLRDICLRENEKENFMRSPKVQRAYIG  506



>ref|XP_010319247.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
Length=895

 Score =   147 bits (371),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 111/193 (58%), Gaps = 11/193 (6%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLN--------NEAAKID  157
            GGIGKTTLAR  Y    +  HFDIL W  +SQ+   R +L++ L+          A   D
Sbjct  177  GGIGKTTLARKAYHHLTIRYHFDILAWVTISQEFQCRNVLLEALHCISKKTAIVNAKDYD  236

Query  158  EVTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVAD  337
            ++ D ELA  +QK L+G RYL+V+DDIW+   W+ ++  FP+ N  SRILLTTR  EVA 
Sbjct  237  KMDDNELADLVQKNLKGPRYLVVVDDIWTENVWDSVRGIFPNYNNGSRILLTTRENEVAM  296

Query  338  SADSSGNRLHTLGFLNQEESWDLFC-KSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVV  514
             A++     H +  L+ E  W L C K F      P ELE IG+++V+KC GLPL I V+
Sbjct  297  YANTCSP--HEMSLLSGENGWKLVCDKVFGPKHDHPPELEEIGKEIVEKCQGLPLTISVI  354

Query  515  AGVFFKTQQNC*G  553
            AG   K  +   G
Sbjct  355  AGHLCKVARTLEG  367


 Score =   117 bits (292),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 100/158 (63%), Gaps = 5/158 (3%)
 Frame = +3

Query  531   KLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAI  710
             K+ +T+E W++  +  + ++ +    ++C  +L LSY++LP HLK C L +S  P+D  +
Sbjct  360   KVARTLEGWKDVARTLSEIIASH--PDECLAVLGLSYHHLPNHLKPCFLSMSSFPEDFQV  417

Query  711   IVKRLVRLWIAEGFVELI-NSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDI  887
               + L++LWIAEGF+    N ++LEEVA  YL+DL  R+LIQ ++R FNG IK C +HD+
Sbjct  418   ETRILIQLWIAEGFIRTSENGKSLEEVAIDYLEDLISRNLIQARERRFNGDIKACGIHDL  477

Query  888   VHEFCVREAIKEKLLNVDNKQHPSCGELQQEGCRWLNF  1001
             + EFC+ EA   K ++V+ + +P+    Q    R  +F
Sbjct  478   LREFCLTEAEMTKHMHVE-RTYPTL-PTQMHNVRRFSF  513



>ref|XP_006346790.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
[Solanum tuberosum]
Length=890

 Score =   148 bits (374),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 111/182 (61%), Gaps = 11/182 (6%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN--------EAAKID  157
            GGIGKTTLA+  Y+   +  HFDIL W  +SQ+   R +L++ L+          A   +
Sbjct  177  GGIGKTTLAKKAYDQVTIRYHFDILAWVTISQEFRARNVLLEALHCIPKKSVSVNAKDYN  236

Query  158  EVTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVAD  337
            ++ D +LA  +QK L+G+RYL V+DDIWST  W+ ++  FPD N RSR+LLTTR  EVA 
Sbjct  237  KMDDNQLAELVQKSLKGQRYLFVVDDIWSTDVWDSLRRIFPDCNNRSRVLLTTRETEVAM  296

Query  338  SADSSGNRLHTLGFLNQEESWDLFC-KSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVV  514
             A++     H +  L+ E  W L C K F   +  P ELE IG+ +V+KC GLPL I V+
Sbjct  297  YANTCSP--HKMRLLSLENGWRLLCDKVFGPKRDHPPELEEIGKVIVEKCQGLPLTISVI  354

Query  515  AG  520
            AG
Sbjct  355  AG  356


 Score =   115 bits (288),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 103/170 (61%), Gaps = 6/170 (4%)
 Frame = +3

Query  525   FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
              SK+ +T+E W++  +  + ++ +    ++C  +L LSY++LP  LK C L +   P+D 
Sbjct  358   LSKIARTLECWKDVARNLSEIIASH--PDKCLGVLGLSYHHLPNRLKPCFLSMGDFPEDF  415

Query  705   AIIVKRLVRLWIAEGFV--ELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRV  878
              +   RL+++WIAEGF+     N + LEEVA  YL+DL  R+LIQ +KR FN +IKTC +
Sbjct  416   QVETWRLIQIWIAEGFIIRTFENGKTLEEVAIDYLEDLISRNLIQARKRRFNCEIKTCGI  475

Query  879   HDIVHEFCVREAIKEKLLNVDNKQHPSCGELQQEGCRWLNFWPKKIPDLD  1028
             HD++ EFC+ EA   K ++V+ +  P+    Q+   R  +F P+  P  D
Sbjct  476   HDLLREFCLIEAEMTKHMHVE-RTRPTL-PTQRHNARHFSFQPRFYPFAD  523



>ref|XP_004246080.2| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
Length=871

 Score =   154 bits (388),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 113/189 (60%), Gaps = 11/189 (6%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVT-----  166
            GGIGKTTLAR  Y+   +  HFD+ VW  +SQ++  R +L++ L+  + + D        
Sbjct  185  GGIGKTTLARKAYDHLKLRYHFDVRVWITISQEYGRRSVLLEALHCISKQTDNAIKKDYD  244

Query  167  ---DGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVAD  337
               D ELA  +QK L+G+RYL+V+DDIWST  W+ I+  FPD N RSRILLTTR  +VA 
Sbjct  245  VKDDNELADLVQKSLKGRRYLVVVDDIWSTDVWDSIRGIFPDYNRRSRILLTTRETKVAM  304

Query  338  SADSSGNRLHTLGFLNQEESWDLFC-KSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVV  514
             A+      H +  LN E SW L C K F      P ELE IG+K+ +KC GLPL I V+
Sbjct  305  YANPISP--HEMNLLNLENSWKLLCDKVFGPNNCHPPELEEIGKKIAEKCQGLPLTISVI  362

Query  515  AGVFFKTQQ  541
            AG   K  +
Sbjct  363  AGHLSKVSR  371


 Score =   107 bits (268),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 88/143 (62%), Gaps = 3/143 (2%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             SK+++T+  W +  +    ++  +   ++C  +L LSY++LP HLK C L +   P+D 
Sbjct  366  LSKVSRTLGSWMDVSRTLGEII--SSHPDKCLGVLGLSYHHLPNHLKPCFLSMGSFPEDY  423

Query  705  AIIVKRLVRLWIAEGFVELINS-ENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
             +   RL++LWI +GF+    S E+L EVA  YL+DL  R+LI ++K+ FNG+IK C +H
Sbjct  424  HVETWRLIQLWITQGFIRRSGSDESLTEVAKDYLEDLISRNLIMVRKKRFNGEIKACGMH  483

Query  882  DIVHEFCVREAIKEKLLNVDNKQ  950
            D++ EFC+ E    + + V+  +
Sbjct  484  DLLREFCLTEVELTQFMYVETTK  506



>gb|AGX27500.1| NBS-LRR class resistance protein Fy2-Ry2 [Sesamum indicum]
Length=892

 Score =   140 bits (352),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 109/179 (61%), Gaps = 4/179 (2%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKID---EVTDGE  175
            G+GKTTLA+M+Y DP +   F    W  +SQ +  +++ +++L+N     D   ++ D  
Sbjct  187  GLGKTTLAKMIYRDPKIEYEFYSRAWIYISQDYSRKEVFLNILSNFTQLTDSMYKMNDEN  246

Query  176  LAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSG  355
            LA +L + L   +YLIV+DD+WS  +W  +++ FP +N RSRIL+T+R K VA  A+ S 
Sbjct  247  LAKELCRILEKGKYLIVMDDVWSEEAWNDLKVAFPKNNKRSRILITSRIKRVARHANPS-  305

Query  356  NRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
               H L FL  +ESW L  +   G ++ P EL   G+ + ++C GLPLAIVV+ G+  +
Sbjct  306  REPHNLRFLTPDESWRLLQRRALGAENCPEELVKDGKHIANECRGLPLAIVVIGGILLQ  364


 Score =   121 bits (304),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 84/133 (63%), Gaps = 1/133 (1%)
 Frame = +3

Query  534  LNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAII  713
            L K  + W+   K  ++  +  D  ++    + LSYN+LP HLKAC +Y  + P+D  I 
Sbjct  363  LQKGTDWWEQVAKSVDA-YIAMDQEKRMDNFIALSYNHLPYHLKACFIYFGMFPEDCEIP  421

Query  714  VKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVH  893
            V +LVRLWIAEGF++     +LE++   YL+DL +R+L+ +     NGKIKTCR+HD++H
Sbjct  422  VWKLVRLWIAEGFIQQKEEMSLEDIGEEYLEDLVNRNLVMVGLYRSNGKIKTCRIHDMLH  481

Query  894  EFCVREAIKEKLL  932
            EFC +EA +E   
Sbjct  482  EFCTKEAKEENFF  494



>ref|XP_004231569.2| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=929

 Score =   158 bits (399),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 117/174 (67%), Gaps = 4/174 (2%)
 Frame = +2

Query  14   KTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLL-NNEAAKIDEVTDGELAGKL  190
            KTTLA  +Y D  V SHFD+  W  +SQ+H+V+++L++LL + +    D + + ELA  L
Sbjct  190  KTTLAIEVYNDAHVRSHFDVCAWATLSQQHNVKEILLNLLRSTKGGAFDMLDEAELADML  249

Query  191  QKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNRLHT  370
            +K L GKRYLIV+DDIWS ++W+ ++  FP  N  SRILLTTR+ EVA  A++    L  
Sbjct  250  RKSLYGKRYLIVMDDIWSIKAWDDVRRFFPSQNKGSRILLTTRNNEVACYANTENLSLQ-  308

Query  371  LGFLNQEESWDLFCKSFPGIQSLPF--ELETIGRKVVDKCHGLPLAIVVVAGVF  526
            + F++Q+ESW+LF       ++LP   E E IG+K+ +K HGLPL IVVVAG+ 
Sbjct  309  MSFMDQDESWNLFKSVAFANEALPLPSEFENIGKKIAEKSHGLPLTIVVVAGLL  362


 Score =   103 bits (256),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 79/135 (59%), Gaps = 4/135 (3%)
 Frame = +3

Query  531  KLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAI  710
            K  KT+E+W+   K   S V   D  EQCS +L LSYN+L   LK C+LY  I P+D  I
Sbjct  363  KSKKTIEDWETVAKDVKSFV-NNDPDEQCSHVLGLSYNHLTSDLKTCLLYFGIFPEDSEI  421

Query  711  IVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQ-KRHFNGKIKTCRVHDI  887
             V  L RLW+AEGF+   N  +LE  A   LQDL +R L+ +  K     KI +C+VHD+
Sbjct  422  PVNHLKRLWMAEGFLNFEN--DLEGEADKCLQDLINRCLVHVSNKSRDETKIISCKVHDL  479

Query  888  VHEFCVREAIKEKLL  932
            +++ C+R+  +  L 
Sbjct  480  IYDLCLRQIQRGNLF  494



>ref|XP_011070823.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
Length=892

 Score =   139 bits (351),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 109/179 (61%), Gaps = 4/179 (2%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKID---EVTDGE  175
            G+GKTTLA+M+Y DP +   F    W  +SQ +  +++ +++L+N     D   ++ D  
Sbjct  187  GLGKTTLAKMIYRDPKIEYEFYSRAWIYISQDYSRKEVFLNILSNFTQLTDSMYKMNDEN  246

Query  176  LAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSG  355
            LA +L + L   +YLIV+DD+WS  +W  +++ FP +N RSRIL+T+R K VA  A+ S 
Sbjct  247  LAKELCRILEKGKYLIVMDDVWSEEAWNDLKVAFPKNNKRSRILITSRIKRVARHANPS-  305

Query  356  NRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
               H L FL  +ESW L  +   G ++ P EL   G+ + ++C GLPLAIVV+ G+  +
Sbjct  306  REPHNLRFLTPDESWRLLQRRALGAENCPEELVKDGKHIANECRGLPLAIVVIGGILLQ  364


 Score =   121 bits (304),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 84/133 (63%), Gaps = 1/133 (1%)
 Frame = +3

Query  534  LNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAII  713
            L K  + W+   K  ++  +  D  ++    + LSYN+LP HLKAC +Y  + P+D  I 
Sbjct  363  LQKGTDWWEQVAKSVDA-YIAMDQEKRMDNFIALSYNHLPYHLKACFIYFGMFPEDCEIP  421

Query  714  VKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVH  893
            V +LVRLWIAEGF++     +LE++   YL+DL +R+L+ +     NGKIKTCR+HD++H
Sbjct  422  VWKLVRLWIAEGFIQQKEEMSLEDIGEEYLEDLVNRNLVMVGLYRSNGKIKTCRIHDMLH  481

Query  894  EFCVREAIKEKLL  932
            EFC +EA +E   
Sbjct  482  EFCTKEAKEENFF  494



>gb|AAV88068.1| NBS-LRR protein [Ipomoea batatas]
Length=849

 Score =   134 bits (336),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 113/182 (62%), Gaps = 12/182 (7%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLL------NNEAAK----  151
             GIGKTTLA  +YED  V+SHFD+  W  +S ++ +R+ L DLL      N+E  K    
Sbjct  174  NGIGKTTLAASVYEDSSVASHFDVRAWITMSGEYTMRQTLHDLLLTLAEPNHETRKRTTL  233

Query  152  IDEVTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEV  331
              +  D  LA ++ KCL+GK YLIVLD++W+ R W+ IQ  FP+D+  SRI+LTT H + 
Sbjct  234  DLDDDDDLLAKQVSKCLKGKIYLIVLDNLWNNRVWDDIQGYFPNDSNGSRIVLTTTHFD-  292

Query  332  ADSADSSGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVV  511
               + +S + +H +  L+ +ESWDLFC +    + +  + E I   V++KC GLPL+IV 
Sbjct  293  -QGSYTSLDCIHNMALLDAKESWDLFCSNPFLEKHMEPKFEKIRSHVLEKCEGLPLSIVT  351

Query  512  VA  517
            VA
Sbjct  352  VA  353


 Score =   125 bits (315),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 94/162 (58%), Gaps = 8/162 (5%)
 Frame = +3

Query  525   FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
              SK N   +EW+  EK+   L          S  LTL YN LP +LK C LY  +  K  
Sbjct  356   LSKCNNIRKEWEKVEKELELLGFLD------SSALTLMYNQLPQYLKVCFLYFGVFSKRN  409

Query  705   AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHD  884
              I VK+L +LWIAEG + L+ +E LE  A+ YLQ+L DRSL+ I K+  +GKIKTC++H 
Sbjct  410   VIRVKQLFKLWIAEGILNLLGNEELESQAYEYLQELIDRSLVLIDKQSSDGKIKTCKMHS  469

Query  885   IVHEFCVREAIKEKLL-NVDNKQHPSCG-ELQQEGCRWLNFW  1004
              +H FCVREA K  +   V+ +Q+P     +    CRWL+ +
Sbjct  470   ALHSFCVREAQKNSIFCAVNTQQYPQGSFNMFANSCRWLSLY  511



>gb|EYU24163.1| hypothetical protein MIMGU_mgv1a019941mg, partial [Erythranthe 
guttata]
Length=843

 Score =   151 bits (381),  Expect(2) = 9e-60, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 115/186 (62%), Gaps = 11/186 (6%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLN-------NEAAKIDE  160
            GGIGKTTLA  +Y +P +  HF +  W  VSQ++  +++L+ LL+       N+A  +++
Sbjct  187  GGIGKTTLATHVYTNPFIVQHFHVRAWFTVSQEYTKKEILLGLLHKINNKNSNDAHDMND  246

Query  161  VTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADS  340
              + EL  KL K L G++YLIV+DD+W   +WE I +  PD+N  SRIL+TTR   +A  
Sbjct  247  --EDELGDKLHKTLFGRKYLIVMDDMWDINAWEMINMFLPDNNNGSRILVTTRLLRLA--  302

Query  341  ADSSGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAG  520
             D    R + L FL++E+SWDL  +     +  P ELE IGR +  KC GLPLA+VV+ G
Sbjct  303  MDIGSCRPYQLNFLDEEQSWDLLSQKIYADKCCPVELEVIGRSIAKKCRGLPLALVVIGG  362

Query  521  VFFKTQ  538
            V  K++
Sbjct  363  VLAKSK  368


 Score =   107 bits (268),  Expect(2) = 9e-60, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 80/129 (62%), Gaps = 1/129 (1%)
 Frame = +3

Query  546  VEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRL  725
             E W+  E+   S V   D  E   +IL LSYN +P++LK C LY ++ P+D  I V +L
Sbjct  369  TENWKYIEEDVTSAVRNQD-DEFYMKILLLSYNNMPIYLKPCFLYFAVFPEDYTIKVSKL  427

Query  726  VRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCV  905
            V LW+AEGF+     ++LEE  + YL+DL DR+L+ +  R  +G++++CR+HD++   C 
Sbjct  428  VSLWVAEGFIRQCGHKSLEENGNEYLEDLIDRNLVLVDWRSISGEVRSCRIHDLLSNLCR  487

Query  906  REAIKEKLL  932
             EA K+  +
Sbjct  488  TEAQKDNFI  496



>gb|EYU31457.1| hypothetical protein MIMGU_mgv1a017859mg, partial [Erythranthe 
guttata]
Length=810

 Score =   146 bits (369),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 107/181 (59%), Gaps = 17/181 (9%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA   Y DPL++ HF I  W  +SQ +  + +   LL + + +          
Sbjct  172  GGIGKTTLAAHAYNDPLITEHFHIRAWVTISQDYVAQDVFSRLLASISPERP--------  223

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
                    GKRYLIVLDD+WST+ W+G++  FP+DN  SRI+ TTR  EVA   DSS + 
Sbjct  224  --------GKRYLIVLDDMWSTKVWDGVRRLFPNDNNGSRIIQTTRLGEVASYPDSSSH-  274

Query  362  LHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQQ  541
            +H +  L+ E+SW+L  +     +  P EL+ IG+++   C GLPLAIVV+AGV FK   
Sbjct  275  VHKMHLLDDEQSWNLLRQKVFKEEYYPLELKIIGKEIAKSCGGLPLAIVVIAGVLFKGGN  334

Query  542  N  544
            N
Sbjct  335  N  335


 Score =   112 bits (279),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 85/140 (61%), Gaps = 10/140 (7%)
 Frame = +3

Query  555  WQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRL  734
            W+ F +   S+V T D   +   ILTLSYN LP HL+ C LY+   P+D  I V +LV+L
Sbjct  339  WKKFARNVKSVVATKD--GRFEAILTLSYNNLPHHLRPCFLYMGAFPEDYEIHVSKLVKL  396

Query  735  WIAEGFVELINSEN-----LEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEF  899
            W+AEGF   INS +      E     YL+DL  RSL+ + KR  NGKIKTCRVHD++ + 
Sbjct  397  WVAEGF---INSSSECRSLEEAAEEEYLEDLVKRSLVMLSKRKSNGKIKTCRVHDLMRKL  453

Query  900  CVREAIKEKLLNVDNKQHPS  959
            C+R A  EK L+V   Q P+
Sbjct  454  CIRIAQHEKFLHVMYGQAPT  473



>gb|EYU24168.1| hypothetical protein MIMGU_mgv1a022184mg, partial [Erythranthe 
guttata]
Length=802

 Score =   133 bits (335),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 110/184 (60%), Gaps = 7/184 (4%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLL---NNEAAKIDEVTDG  172
            GGIGKTTLA  ++ +P +  HF +  W  VSQ++  +K+L+ LL   NN      E+ D 
Sbjct  189  GGIGKTTLATNVFNNPFIVEHFQLRAWFTVSQEYTDKKILLGLLHQINNTYRNAHEIVDD  248

Query  173  E--LAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSAD  346
            +  +  +L K L G++YLIV+DD+W  ++ + ++   PD+N  SRIL+TTR  ++A   D
Sbjct  249  DDAIGDRLHKTLFGRKYLIVMDDMWDIKACDMVKRFLPDNNNGSRILVTTRLMKLA--VD  306

Query  347  SSGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
                  + L  L + +SWDL  +     +  P ELE IG+ +  KC GLPLA+VV+AGV 
Sbjct  307  IGSCSPYQLNLLEKSQSWDLLREKIFAEERCPDELEGIGKSIATKCRGLPLALVVIAGVL  366

Query  527  FKTQ  538
             K++
Sbjct  367  AKSK  370


 Score =   124 bits (312),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 83/132 (63%), Gaps = 1/132 (1%)
 Frame = +3

Query  537  NKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIV  716
            +KT E W + EK   S V   D  E C +IL LSYN LP+HLK C LY ++ P+D  I V
Sbjct  369  SKTEEHWVSIEKDVTSAVNNQD-DESCMKILLLSYNNLPIHLKPCFLYFAVFPEDHIIKV  427

Query  717  KRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHE  896
            +RLVRLW+AEGF+     ++LE++   YL+DL DR+LI +  R   G++  C +HD++  
Sbjct  428  ERLVRLWVAEGFIRQYGHKSLEDIGKEYLKDLIDRNLISVNWRSVTGEVTGCNIHDVLSN  487

Query  897  FCVREAIKEKLL  932
             C REA K+  +
Sbjct  488  LCKREAQKDNFI  499



>emb|CDP10671.1| unnamed protein product [Coffea canephora]
Length=776

 Score =   137 bits (345),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 104/177 (59%), Gaps = 26/177 (15%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GG+GKTTLAR LYEDP +  HF + +W  VSQ   +R +L DL   +    +E+ + +LA
Sbjct  181  GGVGKTTLARRLYEDPSIVLHFHVRLWVTVSQDFQIRILLQDLC--QLGNDNEMNNADLA  238

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
              L K L+G+RYLIVLDDIW T +W+ ++  FPDDN  SRI+LT+R KEVA  A+     
Sbjct  239  EHLYKSLKGRRYLIVLDDIWCTEAWDAVKSIFPDDNNGSRIILTSRLKEVAVHANRK-KP  297

Query  362  LHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
            LH +  L+ E                      +G+++  KC GLPLAIVVVAG   K
Sbjct  298  LH-IKLLDPE----------------------VGKEIAAKCQGLPLAIVVVAGYLLK  331


 Score =   121 bits (303),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 90/141 (64%), Gaps = 3/141 (2%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
            +  K+++T + W NF     S V  T   +QC  I+ LSYN LP  LKAC LY    P+D
Sbjct  328  YLLKIDRTRDCWDNFADSVASYV--TGDPQQCLDIIALSYNQLPPPLKACFLYFGAFPED  385

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
              I V RL+ LW+AEGF++ +  ++LEE+A   L DL DR+LI +++  + G+IKTC +H
Sbjct  386  REIPVSRLIYLWVAEGFLKQVTGKSLEEIAEECLMDLIDRNLILVRRVSY-GRIKTCIIH  444

Query  882  DIVHEFCVREAIKEKLLNVDN  944
            DI+ + C+REA KE  ++V N
Sbjct  445  DILRDLCLREAEKENFMHVVN  465



>ref|XP_009596957.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Nicotiana tomentosiformis]
 ref|XP_009596958.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Nicotiana tomentosiformis]
 ref|XP_009596959.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Nicotiana tomentosiformis]
Length=772

 Score =   144 bits (362),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 111/180 (62%), Gaps = 2/180 (1%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVT-DGELA  181
            G+GKTTLAR +Y +  + +HFD+  W  VSQ ++  K+LV++         E+  D ++A
Sbjct  61   GLGKTTLARKVYNNSSIVNHFDVKAWISVSQAYNRMKLLVEIFKQVTGDKREMKEDVDIA  120

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             KLQK L+G+RYLIVLDDIW   +WE + LCFP     SR+++TTR +EVA       + 
Sbjct  121  DKLQKTLKGRRYLIVLDDIWEVDAWEDLGLCFPKGEDGSRVIVTTRIEEVAKHLQHRSDP  180

Query  362  LHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQQ  541
             ++L FL  EESW+L  K     +S P +L+  G +V   C GLPL +V++AG+  K ++
Sbjct  181  -YSLRFLTPEESWELLQKKVFQGESCPPDLQEAGLQVAKHCKGLPLVVVLIAGIIVKMER  239


 Score =   114 bits (284),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 80/119 (67%), Gaps = 0/119 (0%)
 Frame = +3

Query  603  LSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENLE  782
            L EQ  +++  SY++L  HLK+C+LY++  P+D  I+V  L++LW+AE FVE I++EN+E
Sbjct  256  LGEQSMKVMQSSYDHLEDHLKSCLLYMAFFPEDHEILVSDLLKLWMAEEFVENIDTENIE  315

Query  783  EVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLLNVDNKQHPS  959
            E +   L DL  RSL+ + KR FNG  + C VHD+V EFC+ + I+EK + +     P+
Sbjct  316  ETSRICLNDLLKRSLVMVSKRSFNGDTEYCTVHDVVREFCLAKLIEEKYMQLTMPYSPN  374



>gb|EYU31460.1| hypothetical protein MIMGU_mgv1a020657mg [Erythranthe guttata]
Length=720

 Score =   149 bits (375),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 114/182 (63%), Gaps = 2/182 (1%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA   Y DP ++ +F++  W  +SQ     K+   L+      +   ++    
Sbjct  31   GGIGKTTLATKAYHDPSINENFNVRAWVTLSQDSSKEKVSSSLVCAMENFVVGRSNESNE  90

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             K+ + L+G++YL+VLDDIWST++W+ I + FPDDN +SRI+LTTR  +VA   DS  + 
Sbjct  91   VKVFQALKGRKYLLVLDDIWSTKAWDDIMMMFPDDNNKSRIILTTRLSDVAAYPDSCSH-  149

Query  362  LHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
            LH +  L+ ++SW+L  ++ F G +  P ELE IG+++   C GLPLAIVV+AGV  K  
Sbjct  150  LHEMDLLDDDQSWNLLRQNIFNGKEDYPLELEIIGKEIARSCGGLPLAIVVIAGVLSKVD  209

Query  539  QN  544
             N
Sbjct  210  NN  211


 Score =   108 bits (269),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 91/150 (61%), Gaps = 7/150 (5%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             SK++     W+   +   S +   + + +   IL+LSYN+LP HL+ C LY+   P+D 
Sbjct  205  LSKVDNNRASWEKIARNVKSTIAKEE-NGKFEEILSLSYNHLPRHLRPCFLYMGGFPEDY  263

Query  705  AIIVKRLVRLWIAEGFVELIN----SENLEEVA-HGYLQDLADRSLIQIQKRHFNGKIKT  869
             I + RLV+LW+AE F+  I     S +LEEVA   YL DL  R+L+ + +R  +G+IKT
Sbjct  264  DINIPRLVKLWVAEEFIHDIRPSSVSRSLEEVAEEEYLADLVKRNLVMVTERKSDGRIKT  323

Query  870  CRVHDIVHEFCVREAIKEK-LLNVDNKQHP  956
            CRVHD++ E C+R + KE  L++V +K  P
Sbjct  324  CRVHDLMRELCIRISRKENFLVHVTDKGIP  353



>gb|EYU24355.1| hypothetical protein MIMGU_mgv1a024375mg, partial [Erythranthe 
guttata]
Length=941

 Score =   146 bits (368),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 114/180 (63%), Gaps = 9/180 (5%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA+  YE  L++ HFD+  W  +SQ ++V+K+L  LL+ +       T+ E+ 
Sbjct  281  GGIGKTTLAKHTYERSLITQHFDVCAWATISQTYNVKKILTQLLSWQK------TEDEIG  334

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
              L + L G+RYLIV+DDIWS  +W+ IQ   PD+N  SRI++TTR   +    DS    
Sbjct  335  RGLYQQLWGRRYLIVVDDIWSIEAWDNIQRFLPDNNNGSRIIITTRISNLCVHFDSPHLE  394

Query  362  LHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQQ  541
               L FL++++SW LFC++  G +    ELE IG+++  KC GLPL+IVV+ G+  ++ +
Sbjct  395  ---LTFLDEDQSWKLFCEAAFGQEGGVPELEDIGKEIAKKCKGLPLSIVVIGGLLRRSNR  451


 Score =   110 bits (276),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 86/132 (65%), Gaps = 1/132 (1%)
 Frame = +3

Query  537  NKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIV  716
            N+T E W+   K   S++ + +  + C  IL+LSY +LP+HLK C+LY+    +D    V
Sbjct  450  NRTREYWKGIAKDLISILNSGE-DDDCLNILSLSYTHLPVHLKPCLLYMGFFVEDTETHV  508

Query  717  KRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHE  896
              +++LW+AEGF++L   ++LEE A GYL DL DR+LI   +   NGKI++ ++HD++ +
Sbjct  509  NEVIKLWVAEGFIKLNAIQSLEETARGYLNDLVDRNLILRLRLGSNGKIRSFKIHDLMRD  568

Query  897  FCVREAIKEKLL  932
             C++ A KEK +
Sbjct  569  LCLKLAQKEKFV  580



>gb|EYU31287.1| hypothetical protein MIMGU_mgv1a022746mg, partial [Erythranthe 
guttata]
Length=472

 Score =   140 bits (352),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 108/183 (59%), Gaps = 6/183 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLL----NNEAAKIDEVTD  169
            GGIGKTTL   +Y  P +  HF +  W  VSQ++  +++L+ LL    N       E++D
Sbjct  70   GGIGKTTLTTHVYNKPFIVQHFHVRAWFTVSQEYTEKEILLGLLHQIDNTNQDDAHEISD  129

Query  170  GELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADS  349
            G+L  KL K L G++YLIV+DD+W  ++W+  +   PD+N  SRIL+TTR   +A   D 
Sbjct  130  GKLGDKLYKTLLGRKYLIVMDDVWDIKAWDMFKRFLPDNNNGSRILVTTRLLRLA--VDI  187

Query  350  SGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFF  529
                 + L  L++++SWDL  +        P ELE  G+ +  KC GLPLA+VV+AGV  
Sbjct  188  GSCIPYQLNLLDEKQSWDLLRRKIFADGRSPVELEGTGKSIATKCRGLPLALVVIAGVLA  247

Query  530  KTQ  538
            K++
Sbjct  248  KSK  250


 Score =   115 bits (288),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 83/133 (62%), Gaps = 1/133 (1%)
 Frame = +3

Query  546  VEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRL  725
             E W+  E+   S  V  +  + C +IL LSYN+LP++LK C LY ++ P+D  I + RL
Sbjct  251  TENWKYVEEDVTS-AVNNEHDDFCMKILLLSYNHLPIYLKPCFLYFAVFPEDFDIKLSRL  309

Query  726  VRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCV  905
            VRLWIAEGF+     ++LE++   YL+DL DR+LI +  R   G++  C +HD++ E C 
Sbjct  310  VRLWIAEGFIRKRGHKSLEKIGEEYLEDLIDRNLILVSWRSITGQVTDCHIHDVLSELCR  369

Query  906  REAIKEKLLNVDN  944
            REA K+  +  +N
Sbjct  370  REAHKDNFILTEN  382



>ref|XP_006364074.1| PREDICTED: putative late blight resistance protein homolog R1A-4-like 
[Solanum tuberosum]
Length=761

 Score =   164 bits (415),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 86/184 (47%), Positives = 120/184 (65%), Gaps = 5/184 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEV----TD  169
            GGIGKTTLAR +Y+D L++ HF +  WT VSQ+ D R++ + +L +     DEV    T+
Sbjct  149  GGIGKTTLARRVYDDSLIAYHFYVRAWTNVSQEFDTREIFLGILRSIGVVNDEVERNSTN  208

Query  170  GELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADS  349
             +LA ++ + L+G +YLIVLDD+WS ++W+ ++  FPDD   SRI+LTTR  +VA S   
Sbjct  209  EQLAERVYRSLKGMKYLIVLDDMWSIKAWQHVRRSFPDDRNGSRIVLTTRLVDVA-SCVC  267

Query  350  SGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFF  529
            SGN LH + FL+ EESWDL      G  S P ELE IGR +  +C GLPLA+V + G+  
Sbjct  268  SGNSLHQMRFLSMEESWDLLSGKVFGNGSYPPELEKIGRYIGHQCQGLPLAVVAIGGLLS  327

Query  530  KTQQ  541
            K  +
Sbjct  328  KMSK  331


 Score = 90.9 bits (224),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 86/168 (51%), Gaps = 10/168 (6%)
 Frame = +3

Query  522   FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
               SK++K    W+N  ++  SL+ +  +   C  IL+LSYN+LP +LK C LY+ +  + 
Sbjct  325   LLSKMSKETSSWENVAEKVGSLMTSDTMD--CLNILSLSYNHLPQYLKTCFLYMGVFAET  382

Query  702   EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
               I V +L++LWIAEGFV+ +N +NLE+VA   L++L DRSL   +       +  C   
Sbjct  383   REIPVWKLIKLWIAEGFVKKVNHKNLEDVAEENLRELVDRSLSSFRLLRI---LDVCFTS  439

Query  882   DIVHEFCVREAIKEKLLNVDNKQHPSCGELQQEGCRWLNFWPKKIPDL  1025
              +     + E +  + L       PS   L Q  C+  N     I DL
Sbjct  440   RLYRSMSITELVHLRYLAC-----PSFNGLVQSLCKLRNIQNLVIQDL  482



>ref|XP_010271768.1| PREDICTED: disease resistance protein RPM1-like isoform X2 [Nelumbo 
nucifera]
Length=931

 Score =   145 bits (366),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 110/187 (59%), Gaps = 12/187 (6%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEA---------AKI  154
            GG+GKTTL + +Y+D  V  HF    W   S+   + ++L++++               +
Sbjct  200  GGLGKTTLVKKVYDDQRVKRHFQTQAWVTFSESPGIHELLIEMIKQLVYAEQKQPIPQDV  259

Query  155  DEVTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVA  334
             E+ D +L   LQ+ L+ KRY++VLDDIWS  +W+ ++  FP++N  SRI++TTR  +VA
Sbjct  260  AEMKDAQLKQLLQEFLKQKRYVVVLDDIWSIPAWDSVKNVFPNNNFGSRIIITTRSNDVA  319

Query  335  DSADSSGNRLHTLGFLNQEESWDLFCK---SFPGIQSLPFELETIGRKVVDKCHGLPLAI  505
             S   S  R++ L  L+QEESW LFCK   SF   Q  P ELE   + +V KC GLPLAI
Sbjct  320  SSCIKSCFRVYNLQPLSQEESWTLFCKKTFSFSPEQICPPELEVPSQSIVKKCGGLPLAI  379

Query  506  VVVAGVF  526
            V V GV 
Sbjct  380  VTVGGVL  386


 Score =   109 bits (273),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 82/136 (60%), Gaps = 1/136 (1%)
 Frame = +3

Query  540  KTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVK  719
            K   EW+ F +   + +   D  +   +IL+LSYN LP HLK+C L LS+ P+DE I   
Sbjct  391  KITTEWEMFNRSLGAELNLDDRLKGMMKILSLSYNDLPYHLKSCFLCLSMFPEDELIDRM  450

Query  720  RLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQI-QKRHFNGKIKTCRVHDIVHE  896
            RL+R+W+AEGF++ I  + LEE    Y  +L +RSLIQ+  K   +G++  CR+HD++ E
Sbjct  451  RLIRIWMAEGFIQRIQGKTLEEAGESYFSELVNRSLIQVANKADDDGRVIDCRIHDLIRE  510

Query  897  FCVREAIKEKLLNVDN  944
            F + +A  +    + N
Sbjct  511  FILSKARDQSFGAISN  526



>gb|EYU26873.1| hypothetical protein MIMGU_mgv1a025130mg [Erythranthe guttata]
Length=811

 Score =   139 bits (351),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 108/183 (59%), Gaps = 6/183 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLL----NNEAAKIDEVTD  169
            GGIGKTTL   +Y  P +  HF +  W  VSQ++  +++L+ LL    N       E++D
Sbjct  185  GGIGKTTLTTHVYNKPFIVQHFHVRAWFTVSQEYTEKEILLGLLHQIDNTNQDDAHEISD  244

Query  170  GELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADS  349
            G+L  KL K L G++YLIV+DD+W  ++W+  +   PD+N  SRIL+TTR   +A   D 
Sbjct  245  GKLGDKLYKTLLGRKYLIVMDDVWDIKAWDMFKRFLPDNNNGSRILVTTRLLRLA--VDI  302

Query  350  SGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFF  529
                 + L  L++++SWDL  +        P ELE  G+ +  KC GLPLA+VV+AGV  
Sbjct  303  GSCIPYQLNLLDEKQSWDLLRRKIFADGRSPVELEGTGKSIATKCRGLPLALVVIAGVLA  362

Query  530  KTQ  538
            K++
Sbjct  363  KSK  365


 Score =   114 bits (286),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 83/133 (62%), Gaps = 1/133 (1%)
 Frame = +3

Query  546  VEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRL  725
             E W+  E+   S  V  +  + C +IL LSYN+LP++LK C LY ++ P+D  I + RL
Sbjct  366  TENWKYVEEDVTS-AVNNEHDDFCMKILLLSYNHLPIYLKPCFLYFAVFPEDFDIKLSRL  424

Query  726  VRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCV  905
            VRLWIAEGF+     ++LE++   YL+DL DR+LI +  R   G++  C +HD++ E C 
Sbjct  425  VRLWIAEGFIRKRGHKSLEKIGEEYLEDLIDRNLILVSWRSITGQVTDCHIHDVLSELCR  484

Query  906  REAIKEKLLNVDN  944
            REA K+  +  +N
Sbjct  485  REAHKDNFILTEN  497



>emb|CDP11186.1| unnamed protein product [Coffea canephora]
Length=1466

 Score =   136 bits (343),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 110/184 (60%), Gaps = 5/184 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEV---TDG  172
             GIGKTTLA+ LY DP +  HF    W  VSQ +  R +L+++L +     DE+   +D 
Sbjct  765  AGIGKTTLAKKLYNDPNIVYHFHCRAWCSVSQVYLKRNLLLNILRDIEGLTDEIHEMSDA  824

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            +L  +L++ L   +YLIVLDD+W    W  ++   PDD   SRI++T+R ++VA  A+  
Sbjct  825  DLEQRLRQRLLKNKYLIVLDDVWDVEVWNVLERSLPDDGNGSRIMITSRLRKVALEAEPD  884

Query  353  GNRLHTLGFLNQEESWDLF-CKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFF  529
             +  H+L  LN +ESW L   K F G    P EL  IG ++ ++C GLPLA+V VAG+  
Sbjct  885  RDP-HSLRLLNHDESWKLLQMKIFHGEGCCPKELVDIGEQIAERCGGLPLAVVAVAGILE  943

Query  530  KTQQ  541
            KT++
Sbjct  944  KTEK  947


 Score =   117 bits (294),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 92/158 (58%), Gaps = 4/158 (3%)
 Frame = +3

Query  531   KLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAI  710
             K  K +E+W+   K+ NS V+  D   +C  IL LSY++LP HLKAC LY      D+ +
Sbjct  944   KTEKELEQWELIAKELNSQVIG-DAETRCKDILQLSYSHLPAHLKACFLYFGAFQGDKDV  1002

Query  711   IVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIV  890
              V +L++LWIAEGFV+     +LEE A  YL DL DRSL+ I K+   G +K CR+HD++
Sbjct  1003  RVNKLIQLWIAEGFVQKKVPRSLEETAEEYLLDLIDRSLVIISKKRSKGGVKACRIHDLL  1062

Query  891   HEFCVREAIKEKLLN-VDNKQHPSCGELQQEGCRWLNF  1001
              + C  ++ ++K L  V     P    L  +   W++F
Sbjct  1063  RDLCQSQSSEDKFLQLVTRYDEPYASLLDSD--HWVDF  1098



>ref|XP_006363500.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=742

 Score =   134 bits (337),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 106/183 (58%), Gaps = 12/183 (7%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVS-SHFDILVWTVVSQKHDVRKMLVDLL--------NNEAAKI  154
            GGIGKTTLAR  Y    +   HFDIL W  +SQ+   R +L++ L        ++ A   
Sbjct  182  GGIGKTTLARKAYNHLAIRYHHFDILAWVTISQEFRGRNVLLEALRCISKQTVSSNAKDY  241

Query  155  DEVTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVA  334
            D   D +LAG ++K L G+RY +V+DDIWS   W+ I+  FPD N RSR+LLTTR  EVA
Sbjct  242  DNKDDSDLAGLVKKELNGRRYFVVVDDIWSKDVWDSIRGIFPDCNNRSRVLLTTRETEVA  301

Query  335  DSADSSGNRLHTLGFLNQEESWDLFCKSFPGIQ-SLPFELETIGRKVVDKCHGLPLAIVV  511
              A +S    H +  L+ + SW L      G++   P EL  IG+++ +KC GLP  I V
Sbjct  302  IYATTSSP--HKMNLLDLDNSWKLLRDQVFGLEHDHPPELGEIGKEIAEKCQGLPFTISV  359

Query  512  VAG  520
            ++G
Sbjct  360  ISG  362


 Score =   119 bits (299),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 95/140 (68%), Gaps = 4/140 (3%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             SK+++T+E W++  +  + ++ +    ++C  +L LSY++LP+HLK C L ++  P+D 
Sbjct  364  LSKVDRTLESWKDVARTLSEVLASH--PDKCLGVLGLSYHHLPIHLKPCFLSMACFPEDF  421

Query  705  AIIVKRLVRLWIAEGFVELI--NSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRV  878
             +  +RL++LWIAEGF+ +   + ++LEEVA  YL+DL  R+LI  +KR FNG+IK C +
Sbjct  422  QVDTRRLIQLWIAEGFIRMSGRSRKSLEEVAEYYLEDLISRNLIMARKRRFNGEIKECAM  481

Query  879  HDIVHEFCVREAIKEKLLNV  938
            HD++ EFC+ EA   K + V
Sbjct  482  HDLLREFCLIEAKMTKFIYV  501



>gb|EYU31572.1| hypothetical protein MIMGU_mgv1a024734mg [Erythranthe guttata]
Length=826

 Score =   145 bits (367),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 121/184 (66%), Gaps = 8/184 (4%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEA----AKIDEVTD  169
            GGIGKTTLA+  YE  L++ +FDI  WT VSQ ++V+++L+ L+  ++     + +  T+
Sbjct  182  GGIGKTTLAKHTYEHSLITKYFDIRAWTTVSQTYNVKEILLQLVYGQSKSRNTESNRETE  241

Query  170  GELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADS  349
             E+  +L + L G+RYLIV+DDIWS  +W+ I    PD+N  SRI++TTR   ++     
Sbjct  242  EEVGKQLYQELWGRRYLIVVDDIWSIEAWDKIHRFLPDNNNGSRIVITTRISNLS----I  297

Query  350  SGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFF  529
             G++   L FL++++SW LFC+   G++    EL+ IG+++ +KC GLPL+IVV+ G+  
Sbjct  298  RGSQCLELTFLDEDKSWKLFCEMAFGLEGYLPELKDIGKEIANKCKGLPLSIVVIGGLLR  357

Query  530  KTQQ  541
            K+ +
Sbjct  358  KSNR  361


 Score =   108 bits (270),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 88/137 (64%), Gaps = 1/137 (1%)
 Frame = +3

Query  522  FFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKD  701
               K N+T E W++  K   S++ + +  + C  IL+LSY +LP HLK C+L++ I  +D
Sbjct  355  LLRKSNRTQEYWKDIAKDLISILNSGE-HDDCLNILSLSYTHLPTHLKPCLLHMGIFLED  413

Query  702  EAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVH  881
            +   V  L++LW+AEGF++    ++LEE+A GY+ DL +R+LI   K   NGKI+T ++H
Sbjct  414  KENYVNELIKLWVAEGFIKPNAIQSLEEIARGYINDLVERNLILKHKMGSNGKIRTFKIH  473

Query  882  DIVHEFCVREAIKEKLL  932
            D++ + C++ A  EK +
Sbjct  474  DLMRDLCLKLAQTEKFI  490



>emb|CDP18682.1| unnamed protein product [Coffea canephora]
Length=1077

 Score =   130 bits (328),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 106/189 (56%), Gaps = 14/189 (7%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLL-------NNEAAKIDE  160
             G+GKTTLA  +Y DPL+ +HF IL    VSQ + +  +LV LL        +E  K+DE
Sbjct  384  AGLGKTTLANRVYNDPLILNHFHILARCTVSQAYSMHSLLVQLLCSISSRSPDEYLKMDE  443

Query  161  VTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADS  340
                +LA KL K L+  RYLI LDD+W  ++W  ++   PDD   SRIL T+R  ++   
Sbjct  444  ---SDLAHKLYKLLKRNRYLIFLDDVWEIKAWNLVERSLPDDANGSRILFTSR-IQLQFK  499

Query  341  ADSSGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAG  520
             DS   ++H L  L  EESW L  K   G +  P  L  +G ++   C GLPL +V+VAG
Sbjct  500  PDS---KVHHLRHLTDEESWKLLQKKVFGKEGFPPTLGKVGSQIAKLCWGLPLTVVLVAG  556

Query  521  VFFKTQQNC  547
            +   T ++C
Sbjct  557  ILANTVEDC  565


 Score =   122 bits (307),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 91/136 (67%), Gaps = 3/136 (2%)
 Frame = +3

Query  534  LNKTVEE-WQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAI  710
            L  TVE+ W+   K   S +V  D  E C + L LSY++L   LK C+LY     + E +
Sbjct  558  LANTVEDCWEEVAKSLTSSIVLDD--EDCMKTLELSYSHLSDDLKVCLLYFGAFKEGENV  615

Query  711  IVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIV  890
            +V+RL+ LWI+EGFV  I  ++LE+VA+ YL+DL DRSL+ + ++   G +KTCR+HD+V
Sbjct  616  LVRRLLWLWISEGFVRKIEGKSLEDVANNYLKDLVDRSLVMVSEQRAMGGVKTCRLHDLV  675

Query  891  HEFCVREAIKEKLLNV  938
            HEFCV++A +E  L+V
Sbjct  676  HEFCVKKAKEENFLHV  691



>gb|EYU29956.1| hypothetical protein MIMGU_mgv1a001088mg [Erythranthe guttata]
Length=893

 Score =   132 bits (332),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 106/179 (59%), Gaps = 4/179 (2%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKID---EVTDGE  175
            G+GKTTLA+M+Y +  +   F    W  VSQ +  +++ +++L+N     D   ++ D  
Sbjct  187  GLGKTTLAKMIYRNSKIEYEFYSRAWVYVSQDYSRKELFLNILSNFTQLTDSMYKMNDEN  246

Query  176  LAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSG  355
            L+ +L K L   +YLIVLDD+W+  +W  +++ FP +N RSRIL+T+R K VA  A+ + 
Sbjct  247  LSKELYKFLEKGKYLIVLDDVWTEEAWNDLKIAFPKNNKRSRILITSRIKRVAIHANPNL  306

Query  356  NRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
               H L FL  EESW L  +   G ++ P E    G  + ++C GLPLAIVV+ G+  +
Sbjct  307  EP-HNLRFLTPEESWKLLQRKALGAENCPEEFMRDGMHISNECQGLPLAIVVIGGILLE  364


 Score =   121 bits (303),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 84/133 (63%), Gaps = 1/133 (1%)
 Frame = +3

Query  534  LNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAII  713
            L K  + W+   +  ++  +  D  ++    + LSYN+LP HLKAC +Y  + P+D  I 
Sbjct  363  LEKGTDWWERVARSVDA-YIAMDQDKRVDNFIALSYNHLPYHLKACFIYFGMFPEDFEIP  421

Query  714  VKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVH  893
            V +LVRLWIAEGF++     + E++A  YL+DL  R+L+ + +   NGKIKTCR+HD++H
Sbjct  422  VWKLVRLWIAEGFIQQNQEMSWEDIAEEYLEDLVSRNLVMVGRLRSNGKIKTCRIHDMLH  481

Query  894  EFCVREAIKEKLL  932
            EFC +EA +E   
Sbjct  482  EFCKKEAAEENFF  494



>ref|XP_004237148.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
Length=881

 Score =   140 bits (354),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 108/182 (59%), Gaps = 11/182 (6%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLN--------NEAAKID  157
            GGIGKTTLAR  Y+   +  HFDIL W  +SQ+   R +L++ L+          A   D
Sbjct  177  GGIGKTTLARKAYDHLTIRYHFDILAWVTISQEFQCRNVLLEALHCISKKTDIVNAKDYD  236

Query  158  EVTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVAD  337
            ++ + ELA  +QK L+G+RYL+V+DDIWS   W+ I+  F + N  SRIL+TTR  EVA 
Sbjct  237  KMDENELADLVQKNLKGRRYLVVVDDIWSRDVWDSIRGIFSNYNNGSRILMTTRENEVAM  296

Query  338  SADSSGNRLHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVV  514
             A++     H +  L+    W L C + F      P ELE IG+++V+KC GLPL I V+
Sbjct  297  YANTCSP--HEMSLLSAGNGWKLVCDTVFGPKHDHPPELEEIGKEIVEKCQGLPLTISVI  354

Query  515  AG  520
            AG
Sbjct  355  AG  356


 Score =   112 bits (281),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 100/158 (63%), Gaps = 5/158 (3%)
 Frame = +3

Query  531   KLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAI  710
             K+ +T+E W++  +  + ++ +    ++C  +L LSY++LP HLK C L +S   +D   
Sbjct  360   KVARTLEGWKDVARTLSEIIASH--PDECLAVLGLSYHHLPNHLKPCFLSMSSFQEDFHF  417

Query  711   IVKRLVRLWIAEGFVELI-NSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDI  887
               + L++LWIAEGF+    N ++LEEVA  YL+DL  R+L+Q ++R FNG+IKTC +HD+
Sbjct  418   ETQILIQLWIAEGFIRTCENGKSLEEVAIDYLEDLISRNLLQARERRFNGEIKTCGIHDL  477

Query  888   VHEFCVREAIKEKLLNVDNKQHPSCGELQQEGCRWLNF  1001
             + EFC+ EA   K ++V+ + +P+    Q    R  +F
Sbjct  478   LREFCLTEAEMTKHMHVE-RTYPTL-PTQMHNVRRFSF  513



>gb|EYU24181.1| hypothetical protein MIMGU_mgv1a025424mg, partial [Erythranthe 
guttata]
Length=702

 Score =   127 bits (320),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 111/185 (60%), Gaps = 9/185 (5%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKID----EVTD  169
            GGIGKT LA  ++ +P +   FDI  W VVSQ+   +++L+ LL+      +    E+ D
Sbjct  80   GGIGKTNLATNVFNNPFIIEKFDIRAWFVVSQECTGKEILLGLLHQIINPTNRNELEMND  139

Query  170  GELAG-KLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSAD  346
             ++ G KL K L G++Y IV+DD+W   +WE ++   PD+N  SRIL+TTR  ++A   D
Sbjct  140  DDVLGEKLHKTLFGRKYFIVMDDMWDITAWEIVKRFLPDNNNGSRILVTTRLLKLA--VD  197

Query  347  SSGNRLHTLGFLNQEESWDLFC-KSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGV  523
                  + L  L++ +SWDL   K FP  +  P ELE IGR +  KC GLPLA+VV+ G+
Sbjct  198  LGSCTPYELNLLDEAQSWDLLREKVFPEGRC-PAELEEIGRNIAKKCRGLPLALVVIGGL  256

Query  524  FFKTQ  538
              K++
Sbjct  257  LAKSK  261


 Score =   125 bits (314),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 85/123 (69%), Gaps = 1/123 (1%)
 Frame = +3

Query  546  VEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRL  725
             E+W+  E+   S V   D  E C ++++LSYN+LP++LK C LYL++ P+D  I + RL
Sbjct  262  TEDWKYVEEDVTSAVNNED-DELCMKVISLSYNHLPIYLKPCFLYLAVFPQDFDIKMSRL  320

Query  726  VRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCV  905
            VRLW+AEGFV     ++LEE+   YL+DL DR+LI + KR  +G++KTC +HD++ + C 
Sbjct  321  VRLWVAEGFVRQCGPKSLEEIGEEYLKDLIDRNLILVSKRGISGEVKTCHIHDLLSDLCR  380

Query  906  REA  914
            REA
Sbjct  381  REA  383



>ref|XP_004238948.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
 ref|XP_010320774.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=891

 Score =   134 bits (338),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 110/178 (62%), Gaps = 7/178 (4%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN---EAAKIDEVTDGE  175
            G+GKTTLA  +Y+DP V   F   VW  VSQ    R++ +++++       + D+  + +
Sbjct  186  GLGKTTLAYKIYKDPKVEYEFFTRVWVYVSQTFKRREIFLNIISKFTRNTKQYDDTPEDD  245

Query  176  LAGKLQKCL-RGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            LA ++++ L +G +YLIVLDD+W+  +W+ I++ FP++  R+R+L+TTR   VA   +  
Sbjct  246  LANEVKELLGKGGKYLIVLDDVWTMEAWDRIKIAFPNNGKRNRVLMTTRQSNVAKRCN--  303

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
             ++ H L FL ++ESW+L  K     +  P ELE  G  + +KC GLPLAIVV+AG  
Sbjct  304  -DKPHDLKFLTKDESWELLEKKVFHKEKCPPELELPGISIAEKCMGLPLAIVVIAGAL  360


 Score =   118 bits (295),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 84/138 (61%), Gaps = 1/138 (1%)
 Frame = +3

Query  537  NKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIV  716
             KT  EW+         ++  D  E C +++ +SY+ LP  LKAC LY    P    I  
Sbjct  364  GKTTREWELVAASVGEHLINRD-PENCKKLVQMSYDRLPYDLKACFLYCGAFPGGSQIPA  422

Query  717  KRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHE  896
            K+L+RLWIAEGF++      LE+VA  +L DL +R+L+ + +R  +G+IKTCRVHD++HE
Sbjct  423  KKLIRLWIAEGFIQYQGPLALEDVAEDHLNDLVNRNLVMVTQRSCSGQIKTCRVHDMLHE  482

Query  897  FCVREAIKEKLLNVDNKQ  950
            FC  EA+ E+ L  + KQ
Sbjct  483  FCRHEAMMEENLFQEIKQ  500



>emb|CAN74463.1| hypothetical protein VITISV_032893 [Vitis vinifera]
Length=931

 Score =   140 bits (352),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 113/186 (61%), Gaps = 13/186 (7%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN--------EAAKID  157
            GG+GKTTL + +Y+D  V  HF+  +W  VSQ     ++L D++              +D
Sbjct  208  GGLGKTTLVKKVYDDIEVRKHFESHMWITVSQSFKTEELLKDMIRQLYDGIRQPVPNSVD  267

Query  158  EVTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVAD  337
              +   L   ++  L+ +RYL++LDD+W   +WE ++   P+ NC SR+LLTTR+ + A 
Sbjct  268  MGSSQMLKASIKDFLQQRRYLLILDDVWDLHAWEALKYTLPNSNCDSRVLLTTRNVDTAS  327

Query  338  SA--DSSGNRLHTLGFLNQEESWDLFC-KSFPGIQSLPFELETIGRKVVDKCHGLPLAIV  508
            +A  +S GN ++TL  L+QEESW LFC K+FP  +S P  LE I + ++ +C GLPLAIV
Sbjct  328  TACKESHGN-VYTLKPLSQEESWTLFCKKTFPA-ESCPSYLEGISKCILQRCEGLPLAIV  385

Query  509  VVAGVF  526
             V+GV 
Sbjct  386  AVSGVL  391


 Score =   113 bits (282),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 77/120 (64%), Gaps = 0/120 (0%)
 Frame = +3

Query  546  VEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRL  725
            ++EW++  +   + +   +  +    IL LSYN LP +LK+C LY+SI P+D  I   RL
Sbjct  397  IDEWESVYRSLGAELEGNNKFDSLKEILLLSYNDLPYYLKSCFLYMSIFPEDYLIRRMRL  456

Query  726  VRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCV  905
            +RLW+AEGFVE    +  EEV  GYL +L +RSL+Q+  R  NG++ TCRVHD++ E  V
Sbjct  457  IRLWMAEGFVEAKGRKTQEEVGEGYLNELVNRSLVQVATRTRNGRVSTCRVHDLLREIXV  516



>emb|CDP04885.1| unnamed protein product [Coffea canephora]
Length=989

 Score =   144 bits (362),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 121/183 (66%), Gaps = 6/183 (3%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKID---EVTDGE  175
            GIGKTTLA+ LY D  V+ HF I  W  +SQ +  R++L+D+L+N +   D   ++TD +
Sbjct  305  GIGKTTLAKKLYNDSRVTYHFHIRAWCCISQVYSKRQVLLDILSNISGLTDYIHKMTDED  364

Query  176  LAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSG  355
            L  +L + L+G+RYLIV+DD+WST +W+ ++  FPDD   SR+L+T+R + VA +A  + 
Sbjct  365  LDLELYQQLKGRRYLIVMDDMWSTEAWDDLERSFPDDKNGSRLLITSRIQNVALNAKPNS  424

Query  356  NRLHTLGFLNQEESWDLF-CKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
            +  + L  L  +ESW L   KSF G +  P EL  +G+++  +C GLPL++V VAG+  +
Sbjct  425  DP-YLLRLLTDDESWSLLQLKSFHG-KGCPTELLGVGKEIAQQCKGLPLSVVAVAGLLER  482

Query  533  TQQ  541
            T++
Sbjct  483  TEK  485


 Score =   109 bits (272),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 73/111 (66%), Gaps = 0/111 (0%)
 Frame = +3

Query  600  DLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENL  779
            D   QC  IL LSY +LP +LKAC LY     +D+ I V++L+ LWIAEGF++    ++L
Sbjct  504  DPQTQCKEILELSYEHLPYNLKACFLYFGAFLEDKDISVRKLIWLWIAEGFIKKSEEKSL  563

Query  780  EEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLL  932
            E++   YL DL  RSL+ + KR   G++KTCRVHD++H+ C+  + +E  L
Sbjct  564  EDIGEDYLMDLISRSLVLVSKRRSMGRVKTCRVHDMLHDLCLSRSKEEMFL  614



>gb|KDP33396.1| hypothetical protein JCGZ_12852 [Jatropha curcas]
Length=950

 Score =   134 bits (337),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 112/185 (61%), Gaps = 11/185 (6%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLL-------NNEAAK-ID  157
            GG+GKTT+ + +Y+D  V  HFD   W  VSQ   + +ML D++       N +A + ++
Sbjct  210  GGLGKTTIIKRVYDDGEVKKHFDSRAWINVSQSFKIDEMLKDMIYQLFDGVNKQAPQGME  269

Query  158  EVTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVAD  337
             +    L   +++ L+  RYL+VLDDIW   +W+ I+  FP++N  SR+LLTTR+ EVA 
Sbjct  270  TMNSHRLKITIKEFLQQSRYLLVLDDIWGRDAWDAIKHAFPNNNQGSRVLLTTRNAEVAS  329

Query  338  SA--DSSGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVV  511
            +   +S GN ++ L  L+ +ESW LFCK        P  LE + R++V +C GLPLAIV 
Sbjct  330  ATCIESKGN-IYVLEPLSDKESWTLFCKKTFRQNLSPPHLEVLSRQIVQRCSGLPLAIVA  388

Query  512  VAGVF  526
            ++G+ 
Sbjct  389  MSGIL  393


 Score =   118 bits (295),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 94/157 (60%), Gaps = 14/157 (9%)
 Frame = +3

Query  546   VEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRL  725
             ++EW+       + +  TD+ +  ++IL L YN LP +LK+C LYLSI P+D +I   RL
Sbjct  401   IDEWEKLASNLWAEIGGTDIQQSMAKILLLGYNDLPYYLKSCFLYLSIFPEDHSIECMRL  460

Query  726   VRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCV  905
             + LWIAEGFV+ +  + LEEVA  YL +L  RSLIQ+ +   +G+I +CR+H +V E  +
Sbjct  461   IHLWIAEGFVKKVAGKTLEEVAEAYLNELLTRSLIQVAQTTSDGRIHSCRIHGLVREIIL  520

Query  906   REAIKEKLLNVDNKQHPSCGELQQEGCRWLNFWPKKI  1016
              ++  + L+ V ++Q+              + WP++I
Sbjct  521   LKSRDQNLMTVTSEQN--------------DMWPERI  543



>ref|XP_010319246.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=879

 Score =   138 bits (347),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 107/179 (60%), Gaps = 8/179 (4%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLL-----NNEAAKIDEVT  166
            GGIGKTTLAR  Y+   +  HFDIL W  ++Q+   R +L++ L     + ++    +  
Sbjct  177  GGIGKTTLARKAYDHLQIRYHFDILAWVTITQEFRNRNVLLEALRCILKSTDSFNAKDYD  236

Query  167  DGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSAD  346
            D ELA  +QK L+G+RYL+V+DDIW+   W+ I+  FP+    SRILLTTR  EVA  A 
Sbjct  237  DNELADLVQKKLKGRRYLVVVDDIWTKNVWDSIRGIFPNYKNGSRILLTTRETEVAMYAS  296

Query  347  SSGNRLHTLGFLNQEESWDLFC-KSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAG  520
            +     H +  L+ E  W L C K F      P EL+ IG+++V+KC GLPL I V+AG
Sbjct  297  TCSP--HEMIHLSLENGWRLLCDKVFGQKYEHPPELDEIGKEIVEKCQGLPLTISVIAG  353


 Score =   114 bits (285),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 97/158 (61%), Gaps = 5/158 (3%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             SK+  T+E W++  +  + ++ +     QC  +L LSY +LP  LK C L +S  P+D 
Sbjct  355  LSKVANTLEGWKDVARNLSEIIASH--PNQCLGVLGLSYYHLPNRLKPCFLSMSSFPEDF  412

Query  705  AIIVKRLVRLWIAEGFVELI--NSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRV  878
             +  +RL++LWIAEGF+     + ++LEEVA  YL+DL  R+LIQ +KR F+G+IK C +
Sbjct  413  QVDTRRLIQLWIAEGFIRTSAGSRKSLEEVAEHYLEDLISRNLIQARKRRFSGEIKACGI  472

Query  879  HDIVHEFCVREAIKEKLLNVDNKQHPSCGELQQEGCRW  992
            HDI+ EFC+ EA     ++V+ + H +    +   CR+
Sbjct  473  HDILREFCLIEAEMTNHMHVE-RTHLTLPTQKNNVCRF  509



>emb|CDP15598.1| unnamed protein product [Coffea canephora]
Length=817

 Score =   135 bits (340),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 109/182 (60%), Gaps = 10/182 (5%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLN--NEAAKIDEVTDGEL  178
            G+GKT LA+ +Y  P V+SHF IL W  +SQ +  + +L+ +L+  +  A+  E+ + +L
Sbjct  120  GLGKTFLAQKVYHHPSVTSHFHILAWCCISQTYCKKDLLLGMLSCIDPKAQYSEMNEDDL  179

Query  179  AGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGN  358
            A KL   LR ++YLIVLDDIW   +W  +++ FPDD   SRILLT+RH  +         
Sbjct  180  AHKLCNHLRKQKYLIVLDDIWDIEAWNALKISFPDDTNGSRILLTSRHHGII-------G  232

Query  359  RLHTLGFLNQEESWDLFCKS-FPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKT  535
            + H L  L++EESW+L  K      +  P EL  + R++   C+GLPL+IV+++G+    
Sbjct  233  KPHYLRPLDEEESWELLQKRLLTREEGYPPELNVLARQIAKHCNGLPLSIVIISGILLTL  292

Query  536  QQ  541
             Q
Sbjct  293  DQ  294


 Score =   117 bits (292),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = +3

Query  606  SEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENLEE  785
            +EQC  IL LSY +LP HLK C++Y +   +D+ I V+RL+ LWIAEGFV+   SENLE+
Sbjct  313  TEQCKSILELSYIHLPEHLKPCLIYFAAFSEDQEISVQRLIFLWIAEGFVKKSESENLEK  372

Query  786  VAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLL  932
            +A GY+  L +RSL+ + ++   G +KTCR+HD++H FC+R+A  +  L
Sbjct  373  IAEGYIMALINRSLVMVGQQRSIGGVKTCRIHDLLHVFCLRKAKDQNFL  421



>ref|XP_010271767.1| PREDICTED: disease resistance protein RPM1-like isoform X1 [Nelumbo 
nucifera]
Length=936

 Score =   146 bits (368),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 114/193 (59%), Gaps = 12/193 (6%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEA---------AKI  154
            GG+GKTTL + +Y+D  V  HF    W   S+  ++ ++L++++               +
Sbjct  200  GGLGKTTLVKKVYDDQRVKRHFQTQAWVTFSESPEIHELLIEMIKQLVYAEQKQPIPQDV  259

Query  155  DEVTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVA  334
             E+ D +L  +LQ+ L+ KRY++VLDDIW+  +W+ ++  FP++N  SRI+++TR  +VA
Sbjct  260  AEMKDVQLKQRLQEFLKKKRYVVVLDDIWTIPAWDSVKNVFPNNNFGSRIIISTRSNDVA  319

Query  335  DSADSSGNRLHTLGFLNQEESWDLFCK---SFPGIQSLPFELETIGRKVVDKCHGLPLAI  505
             S   S  R++ L  L+QEESW LFCK   SF   Q  P ELE   + +V KC GLPLAI
Sbjct  320  SSCIKSYFRVYNLKPLSQEESWTLFCKKTFSFSPEQICPPELEVPSQSIVKKCGGLPLAI  379

Query  506  VVVAGVFFKTQQN  544
            V V GV    Q+ 
Sbjct  380  VTVGGVLSTKQKT  392


 Score =   105 bits (263),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 77/131 (59%), Gaps = 1/131 (1%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             S   KT  EW+ F     + +   D  +   +ILTLSYN LP HLK C L L + P+DE
Sbjct  386  LSTKQKTTTEWEMFNHSLGTDLFDDDRLKGMMKILTLSYNDLPYHLKFCFLSLFMFPEDE  445

Query  705  AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKR-HFNGKIKTCRVH  881
             I   RL+R+W+AEGF+     + LEEV   Y  +L +RSL+QI K    +G+++ CRVH
Sbjct  446  LIEKMRLIRIWMAEGFIRRKEGKTLEEVGESYFHELINRSLLQIAKTDDDDGRVEACRVH  505

Query  882  DIVHEFCVREA  914
            D++ E  + +A
Sbjct  506  DLIREIILSKA  516



>ref|XP_011072005.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=886

 Score =   127 bits (319),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 103/181 (57%), Gaps = 8/181 (4%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDE----VTDG  172
            G+GKTTLA  ++ DP +   F   +W  VSQ    + + + +L  E  +IDE     +D 
Sbjct  182  GLGKTTLAGKIFRDPAILYEFPTRIWVYVSQDFTRKNIFLAILR-EFTRIDEEMYHKSDQ  240

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA  +   L   ++L+V+DD+W+   WE +Q+  P  N   ++L+T+RH EV   A+  
Sbjct  241  ELARLVASHLERGKFLLVMDDVWTAEDWEKLQIALPKSNKMGKVLITSRHVEVGQYANK-  299

Query  353  GNRL-HTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFF  529
             NRL H L FL Q+ESW L      G    P ELE +G+ +VD+C  LPLAIVV+ G+  
Sbjct  300  -NRLPHMLRFLTQDESWLLLQLEVFGKPECPPELEVLGKLIVDQCDRLPLAIVVIGGILV  358

Query  530  K  532
            K
Sbjct  359  K  359


 Score =   123 bits (309),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 102/161 (63%), Gaps = 12/161 (7%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSR----ILTLSYNYLPLHLKACILYLSIV  692
            FS  +    +   + K +NS  V+T LSE   R    I+ LSY+ LP HL+AC LYL + 
Sbjct  361  FSASDDISAKRNAWTKVSNS--VSTYLSEDPGRRMEKIIALSYDKLPYHLRACFLYLGMF  418

Query  693  PKDEAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTC  872
            P+D  I V +L+R+WIAEGF++  +  +LEE A  YL+DL +R+L++++KR  +G++KTC
Sbjct  419  PEDFEIPVWKLIRMWIAEGFIQEKSGISLEETAENYLEDLINRNLLRVEKRRSDGRVKTC  478

Query  873  RVHDIVHEFCVREAIKEK------LLNVDNKQHPSCGELQQ  977
            R+HD++ +FC++EA  E+      +    +   PS  E+Q+
Sbjct  479  RIHDMLRDFCIKEAGNERENFLQEMKRSSDGFEPSVAEVQK  519



>emb|CDP10265.1| unnamed protein product [Coffea canephora]
Length=693

 Score =   134 bits (337),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 112/177 (63%), Gaps = 3/177 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLL--NNEAAKIDEVTDGE  175
             G+GKTTLA+ +Y D  +  +F I +W  +SQ+++ + +L  +L  + + +++D++ + +
Sbjct  44   AGLGKTTLAKKVYNDNSIIYNFHIRLWCTISQEYNKKSLLTQILCSDGKHSRMDDLNEDD  103

Query  176  LAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSG  355
            L  KL + L+  RYL+VLDDIW  R+W  ++  FPD+  RSRI+ T+R   VA   +  G
Sbjct  104  LLQKLYQKLKRNRYLVVLDDIWDFRAWNELRYSFPDEMNRSRIIFTSRSSNVASQVEYGG  163

Query  356  NRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
             + H L  L+++ES++L  K   G +  P  L  +G ++ +KC GLPLA+VVVAGV 
Sbjct  164  -KPHYLRQLSEKESFELLQKKVFGKEDCPQALHGLGMEIAEKCRGLPLALVVVAGVL  219


 Score =   116 bits (290),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 79/129 (61%), Gaps = 4/129 (3%)
 Frame = +3

Query  555  WQNFEKQ-TNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVR  731
            W+ F K  T ++V  TD   QC + L LSY +LP HLKAC LY +   +DE I  K L+R
Sbjct  229  WEEFAKSLTLTMVSGTD---QCKKSLELSYEHLPYHLKACFLYFAAFREDEKIGAKNLMR  285

Query  732  LWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVRE  911
            LWIAEGFVE I  E  E++A  YL DL  R+L+ + K    G ++TC +HD++ EFC  E
Sbjct  286  LWIAEGFVEKIGGERSEDIAEEYLMDLIGRNLVMVSKSKSIGGVRTCYIHDLILEFCKTE  345

Query  912  AIKEKLLNV  938
            A  +  L V
Sbjct  346  AKAKNFLQV  354



>gb|EPS70521.1| hypothetical protein M569_04260 [Genlisea aurea]
Length=925

 Score =   135 bits (340),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 107/180 (59%), Gaps = 5/180 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLAR +Y+   + S FD  +W  +SQK DV ++L  LL  ++ K    T  EL 
Sbjct  180  GGIGKTTLARSVYDHENMESRFDRRMWCTMSQKCDVHQILQSLLEIKSNK----TVRELG  235

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +L   L  +RYLIV+DD+WS  +WE +++  PD+   SR+++TTR+KEVADS+ + G+ 
Sbjct  236  CELHHKLYRRRYLIVVDDVWSFEAWESLKIHLPDNMNGSRVIVTTRNKEVADSSCTCGDS  295

Query  362  LHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQQ  541
               L  L   + WDL      G    P   E IG+K+   C GLPL++V +AG+  K + 
Sbjct  296  C-ALALLESNKCWDLLKNKIFGESDCPGSFERIGKKIAKSCRGLPLSLVTIAGLLSKPEN  354


 Score =   115 bits (287),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 83/132 (63%), Gaps = 1/132 (1%)
 Frame = +3

Query  537  NKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIV  716
            N  +  W +  +  + +  +TD  + C ++L+LSY++LP+HLK C LYLS   +DE I  
Sbjct  354  NMNIRYWGSVARNVSGVASSTD-EQNCLKVLSLSYHFLPIHLKPCFLYLSNFDEDEKINA  412

Query  717  KRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHE  896
            K L+R WIAEGF++ +    +E+V   YL+DL DR+L+ I K++   +IK C VHD+V E
Sbjct  413  KELIRRWIAEGFLKSVAGRTMEDVGEEYLKDLIDRNLVLILKKNLADEIKECGVHDLVRE  472

Query  897  FCVREAIKEKLL  932
             C++E+  E   
Sbjct  473  LCIKESGMENFF  484



>ref|XP_003631469.1| PREDICTED: disease resistance protein RPM1-like [Vitis vinifera]
Length=931

 Score =   136 bits (343),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 112/186 (60%), Gaps = 13/186 (7%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN--------EAAKID  157
            GG+GKTTL + +Y+D  V  HF+  +W  VSQ     ++L D++              +D
Sbjct  208  GGLGKTTLVKKVYDDIEVRKHFESHMWITVSQSFKTEELLKDMIRQLYDGIRQPVPNSVD  267

Query  158  EVTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVAD  337
              +   L   ++  L+ +RYL++LDD+W   +WE ++   P+ NC  R+LLTTR+ + A 
Sbjct  268  MGSSQMLKASIKDFLQQRRYLLILDDVWDLHAWEALKYTLPNCNCDGRVLLTTRNVDTAS  327

Query  338  SA--DSSGNRLHTLGFLNQEESWDLFC-KSFPGIQSLPFELETIGRKVVDKCHGLPLAIV  508
            +A  +S GN ++TL  L+QEESW LFC K+FP  +S P  LE I + ++ +C GLPLAIV
Sbjct  328  TACKESHGN-VYTLKPLSQEESWTLFCKKTFPA-ESCPSYLEGISKCILQRCEGLPLAIV  385

Query  509  VVAGVF  526
             V+GV 
Sbjct  386  AVSGVL  391


 Score =   114 bits (284),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 79/123 (64%), Gaps = 0/123 (0%)
 Frame = +3

Query  546  VEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRL  725
            ++EW++  +   + +   +  +    IL LSYN LP +LK+C LY+SI P+D  I   RL
Sbjct  397  IDEWESVYRSLGAELEGNNKFDSLKEILLLSYNDLPYYLKSCFLYMSIFPEDYLIRRMRL  456

Query  726  VRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCV  905
            +RLW+AEGFVE    +  EEV  GYL +L +RSL+Q+  R  NG++ TCRVHD++ E  V
Sbjct  457  IRLWMAEGFVEAKGRKTQEEVGEGYLNELVNRSLVQVATRTRNGRVSTCRVHDLLREIIV  516

Query  906  REA  914
             ++
Sbjct  517  SKS  519



>emb|CDP11163.1| unnamed protein product [Coffea canephora]
Length=2495

 Score =   136 bits (342),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 115/184 (63%), Gaps = 6/184 (3%)
 Frame = +2

Query  5     GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEV---TDGE  175
             G+GKTTLAR +Y +  V+  F    W  VSQ ++ +++L+ +L++     DE+   T  +
Sbjct  1810  GLGKTTLARKVYNNQNVTRRFHCRAWCYVSQVYEKKELLLKILHDMHGLSDEICQMTTED  1869

Query  176   LAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSG  355
             L  KL++CL   +YLIV+DD+W  R+W  +Q  FPDDN  SRIL+T+RH  VA   + +G
Sbjct  1870  LESKLRQCLLKNKYLIVMDDVWDARAWNDLQNSFPDDNIGSRILMTSRHCHVALEIEPNG  1929

Query  356   NRLHTLGFLNQEESWDLF-CKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
             +  H L  L ++ESW L   K F G +  P EL  IG+K+  +C GLPLA V ++G+  +
Sbjct  1930  DP-HLLRSLFEDESWILLEGKVFQG-EGCPQELLPIGKKIAQRCGGLPLATVTISGLLQR  1987

Query  533   TQQN  544
             T+++
Sbjct  1988  TEKS  1991


 Score =   114 bits (285),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 86/136 (63%), Gaps = 1/136 (1%)
 Frame = +3

Query  531   KLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAI  710
             +  K+ E W+N  +  +S +++ D   +C+ I  LSY +LP HL+AC LYL +  ++  I
Sbjct  1987  RTEKSKEFWENILESLSSEIMS-DPEARCNEIFELSYKHLPGHLRACFLYLGVFLEERDI  2045

Query  711   IVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIV  890
              V +L+R W+AEGF+    S  LE++A  YL DL +RSL+ + KR  NG++K+CR+HD++
Sbjct  2046  PVSKLIRFWLAEGFIPNTESRRLEDIAEAYLVDLINRSLVIVSKRRSNGQVKSCRLHDLI  2105

Query  891   HEFCVREAIKEKLLNV  938
               FC  +A  E  L +
Sbjct  2106  LVFCRSKAKSENFLQL  2121


 Score =   120 bits (301),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 110/184 (60%), Gaps = 6/184 (3%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDE---VTDGE  175
            GIGKTT+AR +Y +  V  HF    W  VSQ ++ R +L+ +L +    I E   +++ +
Sbjct  713  GIGKTTMARKVYNNQKVMYHFHRRAWCTVSQLYEKRDLLLQILRDIHGFIKEFHYMSNED  772

Query  176  LAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSG  355
            L  KL++CL   RYLIV+DD+W   +W+  +   P+D   SRIL+T+R  +VA   + + 
Sbjct  773  LESKLRQCLLKNRYLIVMDDVWDAAAWDNFRNSCPNDANGSRILITSRLHDVALEIEPNC  832

Query  356  NRLHTLGFLNQEESWDLF-CKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
            N  H+L   +  ESW+L   K F G +  P EL  +G+++  KC GLPLA+V ++G+  +
Sbjct  833  NP-HSLRPFSDNESWNLLQGKVFQG-EDCPEELLLVGKEIAHKCGGLPLAVVAISGLLQR  890

Query  533  TQQN  544
             +++
Sbjct  891  MEKS  894


 Score =   114 bits (285),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 82/124 (66%), Gaps = 1/124 (1%)
 Frame = +3

Query  531   KLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAI  710
             ++ K+ E W+   +  +S V+  D   +C  I+ LSY +LP +LKAC+LYL +  +D  I
Sbjct  890   RMEKSKELWEKIAEGLSSEVMK-DPEARCVEIIELSYKHLPDYLKACLLYLGVFLEDRDI  948

Query  711   IVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIV  890
              V +L+R W+AEGF+E+   +NLE+VA  YL DL +RSL+ I KR  NGK K CR+H ++
Sbjct  949   PVSKLLRFWLAEGFIEMTEWKNLEDVAEAYLVDLINRSLVMITKRRSNGKAKACRLHYLI  1008

Query  891   HEFC  902
              +FC
Sbjct  1009  RDFC  1012



>ref|XP_009777378.1| PREDICTED: late blight resistance protein R1-A-like isoform X3 
[Nicotiana sylvestris]
Length=1156

 Score =   140 bits (354),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 110/180 (61%), Gaps = 2/180 (1%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTD-GEL  178
            GG GKTT  R LY + ++  HFD+  W V+SQ +  R++L ++ N      D+V D GEL
Sbjct  554  GGQGKTTCVRKLYNNDIIIYHFDVRAWCVISQTYSRRELLQEIYNQVTRCKDKVDDIGEL  613

Query  179  AGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGN  358
            A  L+K L GKRYLIVLDD+W   +W+ ++LCFPD   RSRI++TTR ++V +      +
Sbjct  614  ADMLRKSLIGKRYLIVLDDMWDFMAWDDLRLCFPDVVNRSRIVVTTRLEKVGEHVKCHTD  673

Query  359  RLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             L+ L FL  EES  L  K     ++ P EL+ +   V  +C GLPL +V+VAG+  K +
Sbjct  674  -LYFLPFLTPEESRKLLQKKVFQNEACPHELQDVSLDVARRCKGLPLVVVLVAGIIKKKK  732


 Score =   109 bits (272),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 80/127 (63%), Gaps = 2/127 (2%)
 Frame = +3

Query  555  WQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRL  734
            W   +K   S  +  +  + C   + LSY+ LP +L+ C+LY+ + P+DE I V +L+ L
Sbjct  738  WHEVKKALFS-YLDREFEDYCRATMQLSYDNLPDYLRPCLLYMGMFPEDERIPVSKLISL  796

Query  735  WIAEGFVELINSENL-EEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVRE  911
            WIAEGFV+ I S  L EE A GYL DL   +++ + +R +NGK+K C+VHD+V  FC+  
Sbjct  797  WIAEGFVQNIESGRLTEETAEGYLMDLISSNMVMVARRRYNGKVKYCQVHDVVLYFCLER  856

Query  912  AIKEKLL  932
            + +EK +
Sbjct  857  SRQEKFM  863



>ref|XP_009777374.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009777375.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=1246

 Score =   140 bits (354),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 110/180 (61%), Gaps = 2/180 (1%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTD-GEL  178
            GG GKTT  R LY + ++  HFD+  W V+SQ +  R++L ++ N      D+V D GEL
Sbjct  554  GGQGKTTCVRKLYNNDIIIYHFDVRAWCVISQTYSRRELLQEIYNQVTRCKDKVDDIGEL  613

Query  179  AGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGN  358
            A  L+K L GKRYLIVLDD+W   +W+ ++LCFPD   RSRI++TTR ++V +      +
Sbjct  614  ADMLRKSLIGKRYLIVLDDMWDFMAWDDLRLCFPDVVNRSRIVVTTRLEKVGEHVKCHTD  673

Query  359  RLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             L+ L FL  EES  L  K     ++ P EL+ +   V  +C GLPL +V+VAG+  K +
Sbjct  674  -LYFLPFLTPEESRKLLQKKVFQNEACPHELQDVSLDVARRCKGLPLVVVLVAGIIKKKK  732


 Score =   108 bits (271),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 80/127 (63%), Gaps = 2/127 (2%)
 Frame = +3

Query  555  WQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRL  734
            W   +K   S  +  +  + C   + LSY+ LP +L+ C+LY+ + P+DE I V +L+ L
Sbjct  738  WHEVKKALFS-YLDREFEDYCRATMQLSYDNLPDYLRPCLLYMGMFPEDERIPVSKLISL  796

Query  735  WIAEGFVELINSENL-EEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVRE  911
            WIAEGFV+ I S  L EE A GYL DL   +++ + +R +NGK+K C+VHD+V  FC+  
Sbjct  797  WIAEGFVQNIESGRLTEETAEGYLMDLISSNMVMVARRRYNGKVKYCQVHDVVLYFCLER  856

Query  912  AIKEKLL  932
            + +EK +
Sbjct  857  SRQEKFM  863



>ref|XP_010271935.1| PREDICTED: disease resistance protein RPM1-like [Nelumbo nucifera]
Length=748

 Score =   135 bits (341),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 113/195 (58%), Gaps = 15/195 (8%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAK--------ID  157
            GG+GKTTL R +Y+D  V  HF   VW   S+   + ++L+ +      +        ++
Sbjct  2    GGLGKTTLVRKVYDDQRVKGHFQSHVWVTFSESPRIHELLIHMTKQIYEEHHQPIPHGVE  61

Query  158  EVTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFP--DDNCRSRILLTTRHKEV  331
             + D +L   LQ+ L+ KRY+IV+DDIWS ++W+ I+  FP  D N  SRI++TTR K V
Sbjct  62   TMEDAKLKQLLQEFLKQKRYVIVVDDIWSIQAWKSIEHVFPDTDSNRGSRIMITTRSKVV  121

Query  332  ADSADSSGNRLHTLGFLNQEESWDLFC----KSFPGIQSLPFELETIGRKVVDKCHGLPL  499
            A+S   S   ++TL  L+Q++SW LFC    +S P   S P  LE + + +V KC GLPL
Sbjct  122  AESCMKSHLHVYTLKTLSQKKSWTLFCNKTFRSSPD-HSCPTHLEELSQSIVRKCGGLPL  180

Query  500  AIVVVAGVFFKTQQN  544
            AIV V GV    Q+ 
Sbjct  181  AIVTVGGVLSTKQKT  195


 Score =   114 bits (284),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 83/131 (63%), Gaps = 1/131 (1%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             S   KT  +W+ F++   + +   D      +ILTLSYN LP HLK+C L LS+ P+DE
Sbjct  189  LSTKQKTEMDWEMFDRSLATELYEDDSLRSMVKILTLSYNDLPYHLKSCFLCLSMFPEDE  248

Query  705  AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQI-QKRHFNGKIKTCRVH  881
             I   RL+R+W+AEGF++    + LEE+   YL +L +RSLIQI +   F+G++K CRVH
Sbjct  249  LIDKTRLIRIWMAEGFIQRKEGKTLEEIGESYLYELVNRSLIQIAETSDFDGRVKKCRVH  308

Query  882  DIVHEFCVREA  914
            D++ E  + +A
Sbjct  309  DLIREIILSKA  319



>ref|XP_009777376.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana sylvestris]
Length=1235

 Score =   140 bits (354),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 110/180 (61%), Gaps = 2/180 (1%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTD-GEL  178
            GG GKTT  R LY + ++  HFD+  W V+SQ +  R++L ++ N      D+V D GEL
Sbjct  554  GGQGKTTCVRKLYNNDIIIYHFDVRAWCVISQTYSRRELLQEIYNQVTRCKDKVDDIGEL  613

Query  179  AGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGN  358
            A  L+K L GKRYLIVLDD+W   +W+ ++LCFPD   RSRI++TTR ++V +      +
Sbjct  614  ADMLRKSLIGKRYLIVLDDMWDFMAWDDLRLCFPDVVNRSRIVVTTRLEKVGEHVKCHTD  673

Query  359  RLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             L+ L FL  EES  L  K     ++ P EL+ +   V  +C GLPL +V+VAG+  K +
Sbjct  674  -LYFLPFLTPEESRKLLQKKVFQNEACPHELQDVSLDVARRCKGLPLVVVLVAGIIKKKK  732


 Score =   109 bits (272),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 75/112 (67%), Gaps = 1/112 (1%)
 Frame = +3

Query  600  DLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENL  779
            +  + C   + LSY+ LP +L+ C+LY+ + P+DE I V +L+ LWIAEGFV+ I S  L
Sbjct  752  EFEDYCRATMQLSYDNLPDYLRPCLLYMGMFPEDERIPVSKLISLWIAEGFVQNIESGRL  811

Query  780  -EEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLL  932
             EE A GYL DL   +++ + +R +NGK+K C+VHD+V  FC+  + +EK +
Sbjct  812  TEETAEGYLMDLISSNMVMVARRRYNGKVKYCQVHDVVLYFCLERSRQEKFM  863



>ref|XP_006362574.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
[Solanum tuberosum]
Length=891

 Score =   134 bits (336),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 110/178 (62%), Gaps = 7/178 (4%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN---EAAKIDEVTDGE  175
            G+GKTTLA  +Y+DP V   F   VW  VSQ    R++ +++++       +  +  + +
Sbjct  186  GLGKTTLAYKIYKDPKVEYEFFTRVWVYVSQTFKRREIFLNIISKFTRNTKQYHDTPEDD  245

Query  176  LAGKLQKCL-RGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            LA ++++ L +G +YLIVLDD+W+  +W+ I++ FP++  R+R+L+TTR   VA   +  
Sbjct  246  LANEVKELLGKGGKYLIVLDDVWTMEAWDRIKIAFPNNGKRNRVLMTTRESNVAKCCN--  303

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
             ++ H L FL ++ESW+L  K     +  P ELE  G+ + +KC GLPLAIVV+AG  
Sbjct  304  -DKPHDLKFLTEDESWELLEKKVFHKEKCPPELELPGKSIAEKCMGLPLAIVVIAGAL  360


 Score =   116 bits (290),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 83/138 (60%), Gaps = 1/138 (1%)
 Frame = +3

Query  537  NKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIV  716
             KT  EW+         ++  D  E C +++ +SY+ LP  LKAC LY    P    I  
Sbjct  364  GKTTREWELVAASVREHLINRD-PENCKKLVQMSYDRLPYDLKACFLYCGAFPGGSQIPA  422

Query  717  KRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHE  896
            K+L+RLWIAEGF++      LE+VA  +L DL +R+L+ + +R  +G+IK CRVHD++HE
Sbjct  423  KKLIRLWIAEGFIQYQGPLALEDVAEDHLNDLVNRNLVMVMQRSCSGQIKICRVHDMLHE  482

Query  897  FCVREAIKEKLLNVDNKQ  950
            FC  EA+ E+ L  + KQ
Sbjct  483  FCRHEAMTEEDLFQEIKQ  500



>ref|XP_009763714.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Nicotiana sylvestris]
Length=1376

 Score =   152 bits (385),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 115/182 (63%), Gaps = 4/182 (2%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLL---NNEAAKIDEVTDGE  175
            G+GKTTLA  LY D LV S+FDI     VSQ++  + +L+ LL    ++  K+D   + E
Sbjct  698  GLGKTTLANELYFDELVVSYFDIRAHCCVSQEYKRKDLLLALLRDVTDDTTKLDREAENE  757

Query  176  LAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSG  355
            LA KLQK L+ KRYL+++DD+W   +W+ ++ CFP++N  SRI+LTTRH EVA  A    
Sbjct  758  LADKLQKLLKHKRYLVLIDDVWKMSAWDDLRSCFPENNIGSRIILTTRHYEVASCAKHVS  817

Query  356  NRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKT  535
            +  H L F + +ESW L        +  P  LE +G+ +  KC GLPL++V+VAG+  +T
Sbjct  818  DP-HKLRFFSIDESWTLLQNKVFNKERCPLVLEAVGKSIAQKCGGLPLSMVLVAGILTRT  876

Query  536  QQ  541
            ++
Sbjct  877  KK  878


 Score = 97.1 bits (240),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 84/144 (58%), Gaps = 4/144 (3%)
 Frame = +3

Query  534   LNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAII  713
             L +T +E   +E+ + +L  + ++  Q    L LSY  LP +LK C LY+ + P+D  I 
Sbjct  873   LTRTKKEKHCWEQVSKNL--SPNIQAQSEGTLDLSYQNLPHYLKPCFLYMGVFPEDREIQ  930

Query  714   VKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVH  893
             V +L  LWIAEG +     +  E++A  YL++L  R+L+ + K+  +G+IKTCR+HD+V 
Sbjct  931   VSKLTWLWIAEGLINTHMEKLSEDIAKFYLENLIGRNLVMVSKKSSDGRIKTCRIHDLVL  990

Query  894   EFCVREAIKEKLL--NVDNKQHPS  959
             EFC ++A  E  L    D    PS
Sbjct  991   EFCRKKAKLENFLERTRDRGSDPS  1014



>emb|CDP12774.1| unnamed protein product [Coffea canephora]
Length=1253

 Score =   129 bits (324),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 109/185 (59%), Gaps = 5/185 (3%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN-EAAKIDE---VTDG  172
            G+GKTTLA ++Y  P V  HF+I  W  VSQ + +  MLV +L + E+ K ++   + + 
Sbjct  565  GLGKTTLASIVYNSPSVMLHFNIRAWCTVSQSYSMHNMLVQILGSIESGKFEQYQKMDEH  624

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            +LA KL++ L   +YL+VLDD+W  ++W  ++   PDD   SRIL+T+R + ++      
Sbjct  625  DLAVKLKQVLLRNKYLLVLDDLWDAKAWNLLERSLPDDANGSRILITSRLQNLSLQF-KP  683

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
             +++H L  L  EESW+L  K   G +  P  L  +  ++   C GLPL +V+VAG+   
Sbjct  684  DSKVHHLRRLTDEESWNLLQKKLFGKEGCPPRLSGVASQIAKSCRGLPLTVVLVAGILAN  743

Query  533  TQQNC  547
            T ++C
Sbjct  744  TAEDC  748


 Score =   119 bits (299),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 87/141 (62%), Gaps = 3/141 (2%)
 Frame = +3

Query  534  LNKTVEE-WQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAI  710
            L  T E+ W+   K   S +V  D  E C + L LSY +LP  LK CILY     +D+ +
Sbjct  741  LANTAEDCWKEVTKSLTSSIVLDD--EYCMKTLELSYTHLPDDLKPCILYFGAFQEDKNV  798

Query  711  IVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIV  890
             V+RL  LWI+EGFV+      LE+VA  YL+DL DRSL+ + ++   G  K CRVHD+V
Sbjct  799  PVRRLFWLWISEGFVQKTEGMRLEDVADDYLKDLVDRSLVMVSEQRIKGGAKACRVHDLV  858

Query  891  HEFCVREAIKEKLLNVDNKQH  953
            HEFCV++A +E  L++ + Q+
Sbjct  859  HEFCVKKAQEENFLHILHSQN  879



>ref|XP_002273976.1| PREDICTED: disease resistance protein RPP13 [Vitis vinifera]
Length=920

 Score =   136 bits (343),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 110/179 (61%), Gaps = 7/179 (4%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEV---TDG  172
            GG+GKTTLA+ +Y    V  HF    W  VSQ++++R++L+ + N      DE     + 
Sbjct  210  GGLGKTTLAKKVYNHSDVQHHFSCRAWVYVSQEYNIRELLLGIANCVTTLEDEQKRKNEN  269

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            EL   ++KCL+GKRYLIVLDD+W+T  W G+   FP ++ +SR+L+TTR +++A  A S 
Sbjct  270  ELGEVVKKCLQGKRYLIVLDDVWNTDVWRGLSSYFPAESNKSRVLITTRREDIAVDAHSE  329

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFE-LETIGRKVVDKCHGLPLAIVVVAGVF  526
              +L  LG   ++ESW+LF         L +  LE   +++V KC GLPLAIVV+ G+ 
Sbjct  330  CYKLQLLG---EKESWELFLNKVGSEAVLTWPGLEEFKKEIVAKCKGLPLAIVVLGGLL  385


 Score =   112 bits (281),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 73/111 (66%), Gaps = 0/111 (0%)
 Frame = +3

Query  609  EQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENLEEV  788
            + C  IL LSYN LP +LK C LY  + P+D  I   +L+RLW+AEGFV+    E LE++
Sbjct  411  DSCLGILALSYNDLPTYLKPCFLYCGVFPEDSEIKASKLIRLWVAEGFVQKRGKETLEDI  470

Query  789  AHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLLNVD  941
            A  YL +L  RS+IQ+     +G++K+CR+HD++ +  + EA +EKL  VD
Sbjct  471  AEDYLYELIQRSMIQVADTRDDGRVKSCRIHDLLRDLAISEAKEEKLFEVD  521



>ref|XP_009802397.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
 ref|XP_009802398.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=898

 Score =   133 bits (335),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 99/155 (64%), Gaps = 6/155 (4%)
 Frame = +3

Query  543  TVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKR  722
            T+ EW    +  +SLV   D  +QC ++L LSYN+LP H+KAC L+  + PK   I VK+
Sbjct  359  TLGEWNTVAQSVSSLV-NDDAYQQCLKVLALSYNHLPSHVKACFLHFGVFPKAHEISVKK  417

Query  723  LVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFC  902
            L+RLW+AEG + L   E  E+VA   L +L ++SL+ I KR F+GKIKTC +HD+ H+ C
Sbjct  418  LIRLWVAEGLLNLKGVEEFEQVAGHLLYNLIEKSLVIIGKRSFDGKIKTCMIHDLFHDLC  477

Query  903  VREAIKEKLLNVDNKQHPSCGELQQ---EGCRWLN  998
            + EA  E LL V +    +  E+Q+   +GCRW++
Sbjct  478  LEEAKSENLLYVPSDS--TIFEVQRYFPKGCRWVS  510


 Score =   115 bits (289),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 102/178 (57%), Gaps = 5/178 (3%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAK--IDEVTD-GE  175
            GIGK+T A+ ++  P +   F I  W  VS+ +D+RKML+ LL+    K  +D   D G+
Sbjct  178  GIGKSTFAKTIFLHPSIRRVFHIRGWITVSKDYDLRKMLLVLLDAIGKKDPVDAKIDIGK  237

Query  176  LAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSG  355
            LA +L+  L+ +RYLIV+DDIWS  +W  I   FPD   +SRILLT+R KEVA+ A S  
Sbjct  238  LAERLKNGLKRERYLIVVDDIWSKEAWIRIAQWFPDSGNKSRILLTSRDKEVAEYA-SFP  296

Query  356  NRLHTLGFLNQEESWDLFC-KSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
                 +  LN  ES +LF  K+F    +     + +  +V   C GLPL I  VAG+ 
Sbjct  297  RSCFQMRPLNTNESQNLFYRKTFAKNDNPGSAFKEVVEEVAKNCKGLPLMITAVAGIL  354



>ref|XP_010271762.1| PREDICTED: disease resistance protein RPM1-like isoform X2 [Nelumbo 
nucifera]
Length=929

 Score =   131 bits (330),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 117/191 (61%), Gaps = 11/191 (6%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN--EAAK------ID  157
            GG+GKT+L +  ++D  V  +F+I +W  VSQ   + ++L D++    E +K      +D
Sbjct  222  GGVGKTSLVKQAFDDRRVKVYFNIHIWISVSQSFKLDELLKDMMRQLCEESKEPVPQRLD  281

Query  158  EVTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVAD  337
             + + EL   L++ L+ KRY+IVLDD+WS   W+ I+  F D NC+SRI++TTR  ++A 
Sbjct  282  GMKETELKLALKEFLKQKRYVIVLDDMWSKFDWDSIRHIFIDCNCKSRIIVTTRSDDIAA  341

Query  338  SADSSGNRLHTLGFLNQEESWDLFC-KSFPGI--QSLPFELETIGRKVVDKCHGLPLAIV  508
            S ++   + + L  L ++ESW LFC K+F  +   + P +LE + R +V KC GLPLAIV
Sbjct  342  SCNNYFVQTYRLQPLCEKESWTLFCKKTFWSVDENNCPPQLEKLSRSIVRKCGGLPLAIV  401

Query  509  VVAGVFFKTQQ  541
             V GV    Q+
Sbjct  402  TVGGVLSTKQR  412


 Score =   117 bits (293),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 84/130 (65%), Gaps = 0/130 (0%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             S   +T+ EW+ F++     +   D      +IL+LSYN LP HLK+  L LSI P+DE
Sbjct  407  LSTKQRTLTEWEMFDRSLGGELQNDDRLRSVMKILSLSYNDLPYHLKSGFLCLSIFPEDE  466

Query  705  AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHD  884
            +I   RL+R+W+AEGF++    + LEEV   YL +L +RSLIQ+ +  ++G+IKTCRVHD
Sbjct  467  SIETMRLIRIWMAEGFIQRRQGKTLEEVGESYLYELVNRSLIQVTETTYDGRIKTCRVHD  526

Query  885  IVHEFCVREA  914
            ++ +  + +A
Sbjct  527  LIRKIILLKA  536



>ref|XP_010271761.1| PREDICTED: disease resistance protein RPM1-like isoform X1 [Nelumbo 
nucifera]
Length=940

 Score =   131 bits (330),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 117/191 (61%), Gaps = 11/191 (6%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN--EAAK------ID  157
            GG+GKT+L +  ++D  V  +F+I +W  VSQ   + ++L D++    E +K      +D
Sbjct  222  GGVGKTSLVKQAFDDRRVKVYFNIHIWISVSQSFKLDELLKDMMRQLCEESKEPVPQRLD  281

Query  158  EVTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVAD  337
             + + EL   L++ L+ KRY+IVLDD+WS   W+ I+  F D NC+SRI++TTR  ++A 
Sbjct  282  GMKETELKLALKEFLKQKRYVIVLDDMWSKFDWDSIRHIFIDCNCKSRIIVTTRSDDIAA  341

Query  338  SADSSGNRLHTLGFLNQEESWDLFC-KSFPGI--QSLPFELETIGRKVVDKCHGLPLAIV  508
            S ++   + + L  L ++ESW LFC K+F  +   + P +LE + R +V KC GLPLAIV
Sbjct  342  SCNNYFVQTYRLQPLCEKESWTLFCKKTFWSVDENNCPPQLEKLSRSIVRKCGGLPLAIV  401

Query  509  VVAGVFFKTQQ  541
             V GV    Q+
Sbjct  402  TVGGVLSTKQR  412


 Score =   117 bits (293),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 84/130 (65%), Gaps = 0/130 (0%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             S   +T+ EW+ F++     +   D      +IL+LSYN LP HLK+  L LSI P+DE
Sbjct  407  LSTKQRTLTEWEMFDRSLGGELQNDDRLRSVMKILSLSYNDLPYHLKSGFLCLSIFPEDE  466

Query  705  AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHD  884
            +I   RL+R+W+AEGF++    + LEEV   YL +L +RSLIQ+ +  ++G+IKTCRVHD
Sbjct  467  SIETMRLIRIWMAEGFIQRRQGKTLEEVGESYLYELVNRSLIQVTETTYDGRIKTCRVHD  526

Query  885  IVHEFCVREA  914
            ++ +  + +A
Sbjct  527  LIRKIILLKA  536



>emb|CDP15579.1| unnamed protein product [Coffea canephora]
Length=1338

 Score =   141 bits (356),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 112/184 (61%), Gaps = 11/184 (6%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLN--NEAAKIDEVTDGEL  178
            GIGKTTLA+ +Y DP + SHF IL W  +SQ +  + +L+++L   +E  +  E  + +L
Sbjct  648  GIGKTTLAQKVYHDPSIISHFHILAWCCISQVYSKKDLLLEILACIDEKDEYAERNENDL  707

Query  179  AGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGN  358
            A  L+K L+ K+YLIVLDD+W T +W  ++  FPDD   SRILLT+R+ E+         
Sbjct  708  ANTLRKHLKQKKYLIVLDDVWDTEAWNALKESFPDDTNGSRILLTSRNHEIP-------G  760

Query  359  RLHTLGFLNQEESWDLFCKSFPGI--QSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
            + H L  L +EE W+L  +       +  P EL+ +GR++   C+GLPL+IV+++G+   
Sbjct  761  KPHLLRLLTEEEGWELLQRKLEITREEGYPPELDVLGRQIAKNCNGLPLSIVIISGILAT  820

Query  533  TQQN  544
              Q+
Sbjct  821  LDQD  824


 Score =   107 bits (266),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 83/137 (61%), Gaps = 13/137 (9%)
 Frame = +3

Query  576  TNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFV  755
            +NS+V  T    QC  IL LSY +LP HLK C+LY     +D+ I ++RL+ L +AEGFV
Sbjct  835  SNSVVGATG---QCKSILELSYVHLPDHLKPCLLYFGAFREDQEIPIRRLMWLLVAEGFV  891

Query  756  ELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKE----  923
            +    E+ E++A GY+  L +RSL+ + +R   G +KTCR+HD++H FCV +A  +    
Sbjct  892  QKNELESTEKIAEGYIMALINRSLVMVGQRRSTGGVKTCRIHDLLHVFCVGKAKDQNFLH  951

Query  924  ------KLLNVDNKQHP  956
                  + L +D  QHP
Sbjct  952  LVQGYDEFLELDELQHP  968



>ref|XP_009769019.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=884

 Score =   135 bits (339),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 109/178 (61%), Gaps = 7/178 (4%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN---EAAKIDEVTDGE  175
            G+GKTTLA  +++DP V   F   +W  VSQ  + R++ +++++       +  +  + E
Sbjct  184  GLGKTTLAYKIFKDPTVEYEFFNRIWVYVSQSFNRREIFLNIISKFTRNTKQYHDTPEEE  243

Query  176  LAGKLQKCL-RGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            LA ++++ L +G +YL+VLDD+W+  +W  I++ FP++N R+R+L+TTR   VA   +  
Sbjct  244  LANEIKELLGKGGKYLVVLDDVWTREAWNRIKIAFPNNNKRNRVLMTTRQSNVAKCCN--  301

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
             ++ H L FL + ESW+L  K     +  P ELE  G+ +  KC GLPLAIVV+AG  
Sbjct  302  -DKPHDLKFLTENESWELLEKRVFHKEKCPSELELPGKSIAKKCRGLPLAIVVIAGAL  358


 Score =   113 bits (282),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 80/132 (61%), Gaps = 1/132 (1%)
 Frame = +3

Query  537  NKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIV  716
             KT  EW+         ++  D  E C +++ +SY+ LP  LKAC LY    P    I  
Sbjct  362  GKTTREWELVADSVGEHLINRD-PENCKKLVQMSYDRLPYDLKACFLYCGAFPGGSEISA  420

Query  717  KRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHE  896
            ++L+ LWIAEGF++      LE++A  +L DL +R+L+ + +R  +G+IKTCRVHD++HE
Sbjct  421  RKLICLWIAEGFIQYQGPLTLEDIAEDHLNDLVNRNLVMVMQRSSSGQIKTCRVHDMLHE  480

Query  897  FCVREAIKEKLL  932
            FC  EA+ E+ L
Sbjct  481  FCRHEAMMEENL  492



>ref|XP_009587570.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=1088

 Score =   144 bits (362),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 114/178 (64%), Gaps = 5/178 (3%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN----EAAKIDEVTDG  172
            G+GKTTLA+ LY+D    + FD+ VW  +S++++ + +L+D+L          ++E ++G
Sbjct  765  GLGKTTLAKKLYDDCKAVNRFDVCVWCCISERYEKKSLLIDILQQINIGLPENVEEKSEG  824

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            +LA  L++ + G+RYLI +DDIW+  +W+ ++  F DD   SRI+LTTRH EVA  A  +
Sbjct  825  DLADLLRRSIMGRRYLIFMDDIWTIEAWDDVKTPFRDDKQGSRIILTTRHAEVASYAKCT  884

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
             + L  L F ++EESW L  +     Q  P EL  + +++ +KC GLPL++V+VAG+ 
Sbjct  885  TDPLR-LHFFHKEESWMLLVQKLFQDQQCPPELVDVSKRIAEKCQGLPLSVVLVAGLL  941


 Score =   103 bits (257),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 75/120 (63%), Gaps = 1/120 (1%)
 Frame = +3

Query  573   QTNSLVVTTDLSEQCSR-ILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEG  749
             Q    + TT + +  SR I+ LSY +LP +LK C LY     +DE I V +L   WIAEG
Sbjct  953   QVAESLSTTTVGDSSSRGIIELSYKHLPEYLKPCFLYFGGFMEDEEIPVSKLTWKWIAEG  1012

Query  750   FVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKL  929
              V  +  ++LE++A  YL DL  RSL+   K  +NG++K+CR+HD++HEFC  +A +EK 
Sbjct  1013  LVRKLKPKSLEDMAEEYLVDLISRSLVMDAKMRYNGRVKSCRIHDLLHEFCQNKAKEEKF  1072



>ref|XP_009587569.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=1268

 Score =   144 bits (362),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 114/178 (64%), Gaps = 5/178 (3%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN----EAAKIDEVTDG  172
            G+GKTTLA+ LY+D    + FD+ VW  +S++++ + +L+D+L          ++E ++G
Sbjct  765  GLGKTTLAKKLYDDCKAVNRFDVCVWCCISERYEKKSLLIDILQQINIGLPENVEEKSEG  824

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            +LA  L++ + G+RYLI +DDIW+  +W+ ++  F DD   SRI+LTTRH EVA  A  +
Sbjct  825  DLADLLRRSIMGRRYLIFMDDIWTIEAWDDVKTPFRDDKQGSRIILTTRHAEVASYAKCT  884

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
             + L  L F ++EESW L  +     Q  P EL  + +++ +KC GLPL++V+VAG+ 
Sbjct  885  TDPLR-LHFFHKEESWMLLVQKLFQDQQCPPELVDVSKRIAEKCQGLPLSVVLVAGLL  941


 Score =   103 bits (257),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 75/120 (63%), Gaps = 1/120 (1%)
 Frame = +3

Query  573   QTNSLVVTTDLSEQCSR-ILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEG  749
             Q    + TT + +  SR I+ LSY +LP +LK C LY     +DE I V +L   WIAEG
Sbjct  953   QVAESLSTTTVGDSSSRGIIELSYKHLPEYLKPCFLYFGGFMEDEEIPVSKLTWKWIAEG  1012

Query  750   FVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKL  929
              V  +  ++LE++A  YL DL  RSL+   K  +NG++K+CR+HD++HEFC  +A +EK 
Sbjct  1013  LVRKLKPKSLEDMAEEYLVDLISRSLVMDAKMRYNGRVKSCRIHDLLHEFCQNKAKEEKF  1072



>ref|XP_010265610.1| PREDICTED: disease resistance protein RPP8-like [Nelumbo nucifera]
Length=831

 Score =   132 bits (331),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 101/183 (55%), Gaps = 9/183 (5%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDL----LNNEAAKIDEVTD  169
            GG+GKTTLA+ +Y    +  HFD L W  +SQ+H V ++L D+    L     +++++  
Sbjct  133  GGLGKTTLAKKVYNSSDIKKHFDCLAWVYISQEHRVEEILQDMGKRVLGLGKVEMEKMIK  192

Query  170  GELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADS  349
             EL   L   L  +RYL+V+DDIW    W  +Q  FPD    SR++ T+R K VA  AD 
Sbjct  193  KELEEMLSTFLEDRRYLVVIDDIWKIEVWNDLQAIFPDRTNGSRVMFTSRFKGVALLADP  252

Query  350  SGNRLHTLGFLNQEESWDLFCKSF----PGIQSLPFELETIGRKVVDKCHGLPLAIVVVA  517
                 H L FLN EE W L  K        + S P  LE IG+++V KC GLPLAI V+ 
Sbjct  253  RSPP-HELHFLNDEEGWVLLSKKVFVRRNTLTSFPLWLEEIGKQIVRKCGGLPLAISVLG  311

Query  518  GVF  526
            G+ 
Sbjct  312  GLL  314


 Score =   115 bits (288),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 79/113 (70%), Gaps = 0/113 (0%)
 Frame = +3

Query  597  TDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSEN  776
            T+ +EQCS IL LSYN LP +LK C LY+ I P+   I  +RL  LWIAEGFV+    E 
Sbjct  336  TNSAEQCSEILALSYNELPFYLKPCFLYVDIFPEGYEISARRLTLLWIAEGFVQQRGDEP  395

Query  777  LEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLLN  935
            LE+VA  YL++L  R++IQ+ KR +NG++KTC VH+++ +  + ++ ++K L+
Sbjct  396  LEDVAEDYLEELIGRNMIQLAKRKYNGRVKTCCVHNLLRDLAISKSKEDKFLD  448



>gb|EYU21175.1| hypothetical protein MIMGU_mgv1a021134mg [Erythranthe guttata]
Length=766

 Score =   125 bits (313),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 87/134 (65%), Gaps = 2/134 (1%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
            FS  N+T   W+   +  N  V+  D   +  +I+ LSY+ LP HL+AC LYL + P+D 
Sbjct  241  FSASNETT--WKKVSESMNRYVIEKDPERRMEKIIALSYDKLPYHLRACYLYLGMFPEDF  298

Query  705  AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHD  884
             I   +L+R+WIAEGF++     +LEE A GYL+DL  R+L+++ K   +GKIKTCR+HD
Sbjct  299  QIPAWKLIRMWIAEGFIQQNIGVSLEETAEGYLEDLISRNLVRVDKVKSDGKIKTCRIHD  358

Query  885  IVHEFCVREAIKEK  926
            ++ +FC+ EA  EK
Sbjct  359  MLRDFCINEARNEK  372


 Score =   122 bits (306),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 99/180 (55%), Gaps = 5/180 (3%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVT----DG  172
            G+GKTTLA  ++ DP +   F   +W  +SQ+   + + + +L  E  K+ E T    D 
Sbjct  61   GLGKTTLAGKIFRDPAIVYRFHTRIWVYISQEFTRKDVFLAILK-EFTKVTEETKTKSDH  119

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA  +   L   R+LIV+DD+W+   W+ +++  P  N   ++L+T+RH+EVA  A+  
Sbjct  120  ELAMLVAAKLDEGRFLIVMDDVWAVEDWDKLKIALPHTNSMGKVLITSRHEEVAKRANMI  179

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
                H L FL   ESW L      G  + P ELE  G+ +   C+GLPLAIVV+ G+  K
Sbjct  180  NRLPHKLRFLTHAESWLLLRLEVFGKPACPPELEDHGKLIAKDCNGLPLAIVVIGGILVK  239



>ref|XP_009618298.1| PREDICTED: disease resistance protein RPP13-like [Nicotiana tomentosiformis]
Length=619

 Score =   134 bits (336),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 67/177 (38%), Positives = 111/177 (63%), Gaps = 7/177 (4%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN---EAAKIDEVTDGE  175
            G+GKTTLA  +Y+DP V   F   +W  VSQ  + R++ +++++       +  +  + E
Sbjct  184  GLGKTTLAYKIYKDPKVEYEFFNRIWVYVSQSFNRREIFLNIISKFTRNTKQYHDTPEEE  243

Query  176  LAGKLQKCL-RGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            LA ++++ L +G +YLIVLDD+W+  +W+ I++ FP+++ ++R+L+TTR   VA   +  
Sbjct  244  LANEIKELLGKGGKYLIVLDDVWTREAWDRIKIAFPNNDKQNRVLMTTRQSNVAKCCN--  301

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGV  523
             ++ H L FL + ESW+L  K     +  P ELE  G+ + +KC GLPLAIVV+AG 
Sbjct  302  -DKPHDLKFLTENESWELLEKRVFYKEKCPPELELPGKSIAEKCRGLPLAIVVIAGA  357


 Score =   112 bits (281),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 80/132 (61%), Gaps = 1/132 (1%)
 Frame = +3

Query  537  NKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIV  716
             KT  EW+         ++  D  E C +++ +SY+ LP  LKAC LY    P    I  
Sbjct  362  GKTTREWKLVADSVGEHLINRD-PENCKKLVQMSYDRLPYDLKACFLYCGAFPGGSEISA  420

Query  717  KRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHE  896
            ++L+ LWIAEGF++      LE++A  +L DL +R+L+ + +R  +G+IKTCRVHD++HE
Sbjct  421  RKLICLWIAEGFIQYQGPLTLEDIAEDHLNDLVNRNLVMVMQRSSSGQIKTCRVHDMLHE  480

Query  897  FCVREAIKEKLL  932
            FC  EA+ E+ L
Sbjct  481  FCRHEAMMEENL  492



>ref|XP_009788847.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=900

 Score =   144 bits (364),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 116/182 (64%), Gaps = 5/182 (3%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN----EAAKIDEVTDG  172
            G+GKTTLA+ +Y+D    + FD+ VW  +S++++ + +L+D+L          ++E ++G
Sbjct  213  GLGKTTLAKKVYDDCKAVNRFDVCVWCCISERYEKKSLLIDILQQINIALPENVEEKSEG  272

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            +LA  L++ + G+RYLI +DDIW+  +W+ ++  F DD   SRI+LTTRH EVA  A  +
Sbjct  273  DLADLLRRSIMGRRYLIFMDDIWTIEAWDDVKTPFRDDKQGSRIILTTRHAEVASYAKCT  332

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
             + L  L F + EESW L  +     Q  P EL  +G+++ +KC GLPL++V+VAG+  K
Sbjct  333  TDPLR-LRFFHNEESWMLLVQKLFQGQQCPPELVDVGKRIAEKCQGLPLSVVLVAGLLGK  391

Query  533  TQ  538
             +
Sbjct  392  ME  393


 Score =   102 bits (253),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 74/120 (62%), Gaps = 1/120 (1%)
 Frame = +3

Query  573  QTNSLVVTTDLSEQCSR-ILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEG  749
            Q    + TT + +  SR I+ LSY +LP +LK C LY     +DE I V +L   WIAEG
Sbjct  401  QVAESLSTTTVGDSSSRGIIELSYKHLPEYLKPCFLYFGGFMEDEEIPVSKLTWKWIAEG  460

Query  750  FVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKL  929
             V     ++LE++A  YL DL  RSL+   K  +NG++K+CR+HD++HEFC  +A +EK 
Sbjct  461  LVRKHKPKSLEDMAEEYLVDLISRSLVMDAKMRYNGRVKSCRIHDLLHEFCQNKAKEEKF  520



>ref|XP_009373504.1| PREDICTED: disease resistance protein RPM1-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009373505.1| PREDICTED: disease resistance protein RPM1-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009373506.1| PREDICTED: disease resistance protein RPM1-like isoform X2 [Pyrus 
x bretschneideri]
Length=949

 Score =   134 bits (338),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 104/185 (56%), Gaps = 10/185 (5%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKI--------D  157
            GG+GKTTLA+ +Y+DP V  HF +  W  V++      +L D++      I         
Sbjct  196  GGMGKTTLAKQVYDDPEVKKHFKVRAWITVNRSFKFGDLLRDMVQQLFKAIRRKVPQMVT  255

Query  158  EVTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVAD  337
             +++ +L   +++ L+ +RYLIVLDD+W+   W  I+   P+++C SRI+LTTR  +VA 
Sbjct  256  NMSNNQLKTTIKELLQKRRYLIVLDDVWNLSEWNAIKYALPNNDCGSRIMLTTRKSDVAT  315

Query  338  SADS--SGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVV  511
            +A S  S  + + L  L   ESWDLFC+        P  LE I   V+ KC GLPLAIV 
Sbjct  316  TAASVLSEGKAYDLKPLPPSESWDLFCRKAFQHNKCPPHLEEICNYVLRKCEGLPLAIVA  375

Query  512  VAGVF  526
            + GV 
Sbjct  376  IGGVL  380


 Score =   112 bits (279),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 86/141 (61%), Gaps = 0/141 (0%)
 Frame = +3

Query  528  SKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEA  707
            +K  + ++EW    +   + +   D      ++L+LS+N LP  LK+C+LYLSI P+D  
Sbjct  382  TKDTRRLDEWDVVARSLGAEIEGNDKLNDLKKVLSLSFNDLPYFLKSCLLYLSIFPEDHL  441

Query  708  IIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDI  887
            I   RL+RLW+AEGF+E    + LEEV   YLQ+L +RSL+Q+     +G++KTCR+HD+
Sbjct  442  IERMRLIRLWVAEGFIEAKEGKTLEEVGEDYLQELLNRSLMQVATTTPDGRVKTCRIHDL  501

Query  888  VHEFCVREAIKEKLLNVDNKQ  950
            + E  + ++  +    +  +Q
Sbjct  502  LREIIISKSRDQNFTTILKEQ  522



>emb|CDP04724.1| unnamed protein product [Coffea canephora]
Length=613

 Score =   137 bits (345),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 111/182 (61%), Gaps = 4/182 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLN---NEAAKIDEVTDG  172
             GIGKTTLA+ LY +P V  HF +  WT   Q  +V+  L D+L+   ++   + ++T  
Sbjct  2    AGIGKTTLAKRLYNNPRVVYHFHVHGWTSGLQNLEVKNALHDILSLITDDKKSLHKMTRD  61

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            E+  KL K L+GKRYL+V+DDIW   SW  ++  FPDD   S+IL+T++ K+      S 
Sbjct  62   EIGEKLYKRLKGKRYLVVIDDIWDFGSWSTMKWYFPDDMIGSKILITSQIKDAVLEI-SP  120

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
             N +H L FL  +ESW+LF       ++ P EL  +G ++V KC GLPLAIVV+AG+  K
Sbjct  121  RNSVHFLRFLTHDESWNLFESKVFTNETCPEELMELGSEIVAKCEGLPLAIVVLAGLAKK  180

Query  533  TQ  538
             +
Sbjct  181  NK  182


 Score =   108 bits (271),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 82/129 (64%), Gaps = 2/129 (2%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             +K NKT +EW N+  Q  +  +  +  E+   IL LSY +LP  LK+C LYL   P + 
Sbjct  177  LAKKNKT-QEWWNYINQNTTACLGGE-QEKFMGILGLSYQHLPSSLKSCFLYLGSFPWNH  234

Query  705  AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHD  884
             I VK+L++ WIAEGFVE    + +E+VA  YL+DL DRSL+ + KR  NG IKT  VHD
Sbjct  235  EIPVKKLIQSWIAEGFVESNGEKKVEDVAEDYLKDLVDRSLVMVSKRRSNGGIKTFHVHD  294

Query  885  IVHEFCVRE  911
            ++ + CV++
Sbjct  295  LLRDLCVQK  303



>ref|XP_006487403.1| PREDICTED: disease resistance protein RPP13-like [Citrus sinensis]
Length=859

 Score =   139 bits (349),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 116/192 (60%), Gaps = 14/192 (7%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN-EAAKIDE------  160
            GG+GKTTLAR L     V   FD   W  V+Q++  R +L   + + +  KI++      
Sbjct  193  GGLGKTTLARKLVNSTDVKGGFDCRAWVCVTQEYTTRDLLQKTIKSFQKPKIEDLELMER  252

Query  161  VTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADS  340
            +T+ +L   L + L G+RYL+V+DDIW   +WE ++  FPD+   SRI++TTR++ VA  
Sbjct  253  MTEEDLELHLYEFLEGRRYLVVVDDIWHKSAWESLRRAFPDNGNGSRIVITTRNEPVAMI  312

Query  341  ADSSGNRLHTLGFLNQEESWDLFC-KSFPGIQS-----LPFELETIGRKVVDKCHGLPLA  502
             D   N ++ L FLNQEESW LFC K+FP          P  LE +GR++V+KC GLPLA
Sbjct  313  TDEK-NFVYKLRFLNQEESWKLFCKKAFPDTADGQATVCPPGLEKLGREMVEKCRGLPLA  371

Query  503  IVVVAGVFFKTQ  538
            I+V+ G+  + +
Sbjct  372  IIVLGGLLSRRE  383


 Score =   106 bits (265),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 80/114 (70%), Gaps = 2/114 (2%)
 Frame = +3

Query  597  TDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSEN  776
            T  S+  S IL LSY+ LP  LK+C LYLS+ P+D  I  ++L+RLWIAEGF+     ++
Sbjct  399  TQDSDHVSPILALSYDELPYQLKSCFLYLSLFPEDSLIDTEKLIRLWIAEGFIP-EEEQD  457

Query  777  LEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLLNV  938
            +E VA  YL++L DRS+IQI +R+ + K+KTCR+HD++ E  +++A   + L+V
Sbjct  458  MENVAEEYLKELIDRSMIQIVERYLD-KVKTCRIHDLIRELAIKKARALEFLDV  510



>ref|XP_009775077.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
Length=725

 Score =   153 bits (386),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 119/186 (64%), Gaps = 6/186 (3%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN---EAAKIDEVTDGE  175
            G+GKTTLA  LY D LV S+FDI V   VSQ++  + +L+ LL++   + AK+D   + E
Sbjct  416  GLGKTTLANELYFDELVVSYFDIRVHCCVSQEYKRKDLLLALLHDVIDDTAKLDREVENE  475

Query  176  LAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSG  355
            LA +LQK L+ KRYL+++DD+W   +W+ +Q CFP++N  SRI+LTTRH EVA S D   
Sbjct  476  LADRLQKLLKRKRYLVLIDDVWKRSAWDDLQSCFPENNKGSRIILTTRHYEVA-SYDKHV  534

Query  356  NRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF--F  529
            +  H L F + +ESW L        +  P  LE +G+ +  KC GLPL++V+V G+    
Sbjct  535  SDPHKLRFFSIDESWTLLQNKVFNKERCPLVLEAVGKSIAQKCGGLPLSMVLVVGILTRM  594

Query  530  KTQQNC  547
            K +++C
Sbjct  595  KKEKHC  600


 Score = 92.4 bits (228),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 68/111 (61%), Gaps = 0/111 (0%)
 Frame = +3

Query  600  DLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENL  779
            ++  Q    L  SY  LP +LK C LY+ + P+D  I V +L  LWIAEG +        
Sbjct  611  NIQAQSEGTLDQSYQNLPHYLKPCFLYMGVFPEDREIQVSKLTWLWIAEGLINTHTERLY  670

Query  780  EEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLL  932
            +++A  YL+++  R+L+ + K+  +G+IKTCR+HD+V EFC ++A  E LL
Sbjct  671  KDIAKFYLENIIGRNLVMVAKKSSDGRIKTCRIHDLVVEFCRKKAKLENLL  721



>ref|XP_011072177.1| PREDICTED: disease resistance RPP8-like protein 3 [Sesamum indicum]
Length=861

 Score =   122 bits (307),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 83/116 (72%), Gaps = 4/116 (3%)
 Frame = +3

Query  591  VTTDLSEQCSR----ILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVE  758
            V+T LSE   R    ++ LSY+ LP HL+AC LYL I P+D  I V+ L+R+WIAEGF++
Sbjct  359  VSTYLSEDPGRRMEKLIALSYDELPYHLRACFLYLGIFPEDFEIPVRELIRMWIAEGFIQ  418

Query  759  LINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEK  926
              +   LEE+A  YL+DL +R+L++  KR  +G++KTCR+HD++ +FC+REA  E+
Sbjct  419  QKSGFTLEEIAENYLEDLVNRNLVRADKRTVDGRVKTCRIHDMLRDFCIREAGIER  474


 Score =   122 bits (306),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 103/180 (57%), Gaps = 6/180 (3%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDE----VTDG  172
            G+GKTTLA  ++ + ++   F   +W  VSQ+   + + + +L  E  ++DE     +D 
Sbjct  160  GLGKTTLAEKIFTNSVIQYEFPRRIWVSVSQEFTRKDIFLTILR-EFTRLDEDMYHKSDQ  218

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA  +   L   ++ +V+DD+W+ + WE +Q+  P  N   ++L+T+RH+EV  SA+  
Sbjct  219  ELAELVSSYLEKDKFFLVMDDVWTGKDWEKLQIALPKRNKMGKVLITSRHEEVGWSANRD  278

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
              R H L FL +EESW L      G    P ELE +G++   +C GLPLAIVVV G+  K
Sbjct  279  -RRPHRLRFLTEEESWLLLQMEVFGELECPSELEGLGKRTAHQCAGLPLAIVVVGGILSK  337



>emb|CDP10261.1| unnamed protein product [Coffea canephora]
Length=706

 Score =   133 bits (334),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 107/177 (60%), Gaps = 3/177 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN--EAAKIDEVTDGE  175
             G+GKTTLA+ +Y D  +  +F I  W  VSQ+ +V+K+L+ +L++  E  K++ + + E
Sbjct  44   AGLGKTTLAKKVYNDNSIIYNFHIRFWCTVSQEFNVKKLLLQILHSDGENEKLEFLDEDE  103

Query  176  LAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSG  355
            L  KL + L+G RYL+V  DIW  R+W  ++  FPD+N R+RIL T+R   VA   +  G
Sbjct  104  LLQKLYQKLKGNRYLVVFYDIWDIRAWNELRYSFPDNNKRNRILFTSRFSNVASQVEYGG  163

Query  356  NRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
             + H L  L ++ES +L  +   G +  P  L   G ++  KC GLPL +VVVAG+ 
Sbjct  164  -QPHNLRPLTEKESCELLQRKVFGEEDCPQPLCGFGMEIAQKCKGLPLTVVVVAGIL  219


 Score =   112 bits (280),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 84/129 (65%), Gaps = 4/129 (3%)
 Frame = +3

Query  555  WQNF-EKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVR  731
            W+ F E+ T ++V +T+L   C + L LSY YLP  LK C+LY +   +DE I  K L+R
Sbjct  229  WEEFSERLTLTMVSSTEL---CKKSLELSYEYLPYRLKVCLLYFAAFQEDEIIGTKNLMR  285

Query  732  LWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVRE  911
            LWIAEGFVE +  + LE++A  Y+ DL  R+L+ I +R  +G +K+C +HD++ EFC  +
Sbjct  286  LWIAEGFVENVEGKRLEDIAEEYMMDLIGRNLVMISERRSSGGVKSCCIHDLLFEFCKIQ  345

Query  912  AIKEKLLNV  938
            A ++  L V
Sbjct  346  AKEKNFLQV  354



>gb|EYU24151.1| hypothetical protein MIMGU_mgv1a019744mg, partial [Erythranthe 
guttata]
Length=868

 Score =   123 bits (308),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 109/186 (59%), Gaps = 10/186 (5%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLL---NNEAAKIDEVTDG  172
            GGIGKTTLA  ++ +P V  HF +  W  VSQ++  +K+L+ LL   NN      E+ D 
Sbjct  189  GGIGKTTLASNVFNNPFVE-HFQLRAWFTVSQEYTDKKILLGLLHQINNTYINAHEIDDD  247

Query  173  ----ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADS  340
                 +  +L K L G++YLIV+DD+W  ++ + ++   PD+N  SRIL+TTR  ++A  
Sbjct  248  DDDYAIGDRLHKTLFGRKYLIVMDDMWDIKACDMVKRFLPDNNNGSRILVTTRLMKLA--  305

Query  341  ADSSGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAG  520
             D      + L  L+  +SWDL  +     +  P ELE  G+ +  KC+GLPLA+VV+AG
Sbjct  306  VDIGSCSPYQLNLLDISQSWDLLREKIFAEECCPDELEGTGKSIAKKCNGLPLALVVIAG  365

Query  521  VFFKTQ  538
            V  K++
Sbjct  366  VLAKSK  371


 Score =   122 bits (305),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 82/132 (62%), Gaps = 1/132 (1%)
 Frame = +3

Query  537  NKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIV  716
            +KT E W + EK   S V   D  E C +IL LSYN LP+HLK C LY ++ P+D  I  
Sbjct  370  SKTEEHWVSIEKDVTSAVNNQD-DESCMKILLLSYNNLPIHLKPCFLYFAVFPEDHIINA  428

Query  717  KRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHE  896
            +RLVRLW+AEGFV     ++LEE+   YL+DL DR+LI +  R   G++  C +HD++  
Sbjct  429  ERLVRLWVAEGFVRQCGHKSLEEIGEEYLEDLIDRNLILVDLRSIMGEVIDCNIHDVLSN  488

Query  897  FCVREAIKEKLL  932
             C +EA KE  +
Sbjct  489  LCRKEAQKENFI  500



>ref|XP_010661781.1| PREDICTED: putative disease resistance protein At1g50180 [Vitis 
vinifera]
Length=808

 Score =   137 bits (344),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 77/194 (40%), Positives = 117/194 (60%), Gaps = 21/194 (11%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDL------LNNEAAKIDEV  163
            GG+GKTTLA+ +Y    V  HFD + W  VSQ+   R++L+ +      L+NE  K  E+
Sbjct  198  GGLGKTTLAKKVYNHSGVKRHFDCIAWVCVSQEFKPRELLLSIISSVMSLSNEEKK--EM  255

Query  164  TDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSA  343
             + EL GKL++CL  K+YL+V+DD+WS  +W  +    P+    S++L+TTR+KE+A  A
Sbjct  256  REVELGGKLRECLNDKKYLVVMDDVWSIEAWSSLCSYLPESRNGSKVLMTTRNKEIAAQA  315

Query  344  DS--------SGNRLHTLGFLNQEESWDLFCKSFPGIQS---LPFE--LETIGRKVVDKC  484
            +         S   ++ L  ++ +ESW+LF K   G +    +P    LE +GRK+V KC
Sbjct  316  NGHEVVGHTDSQALVYELPIMDDDESWELFLKKTFGARDNTHVPSSKTLEELGRKIVAKC  375

Query  485  HGLPLAIVVVAGVF  526
            +GLPLAIVV+ G+ 
Sbjct  376  NGLPLAIVVLGGLL  389


 Score =   108 bits (269),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 79/126 (63%), Gaps = 4/126 (3%)
 Frame = +3

Query  609  EQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENLEEV  788
            E C  IL LSYN LP +LK+C LY  I P+D  I   +L+ LWIAEGFV+    E LE++
Sbjct  415  ESCFGILALSYNDLPYYLKSCFLYCGIFPEDSEIKASKLIHLWIAEGFVQRRGIEKLEDI  474

Query  789  AHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLLNVDNKQHPSC--  962
            A  YL +L  RS++Q+ ++  NG++ +CR+HD++ +  + EA   KL   +  +H +C  
Sbjct  475  AEDYLYELIHRSMVQVARKKANGRVMSCRIHDLLRDLAISEARDAKLF--EELRHLNCCY  532

Query  963  GELQQE  980
            GE+  +
Sbjct  533  GEMSSQ  538



>ref|XP_006355881.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=1255

 Score =   139 bits (349),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 113/183 (62%), Gaps = 6/183 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEA---AKIDEVTDG  172
            GG GKTT AR+LY + ++ S+FD+  W ++SQ ++ +++L D+ +       K+DEV  G
Sbjct  569  GGQGKTTCARLLYNNEIIVSNFDVRAWCIISQTYNRKELLQDIFSQVTGFKVKVDEV--G  626

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA  L+K L GKRY IVLDD+W   +W+ ++L  PD   RSRI++TTR ++V +     
Sbjct  627  ELADMLRKRLLGKRYFIVLDDMWDGMAWDDLRLSLPDGENRSRIVVTTRLEKVGEYVKHH  686

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
             N  + L FL  +ESW+L  K     +S P EL  +  +V  +C GLPL +++VAG+  K
Sbjct  687  TNP-YFLPFLTLKESWELLQKKVFQKKSCPSELYDVSLEVARRCKGLPLVVILVAGIIKK  745

Query  533  TQQ  541
              +
Sbjct  746  KME  748


 Score =   105 bits (263),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 82/133 (62%), Gaps = 4/133 (3%)
 Frame = +3

Query  540  KTVEEWQNFEKQTNSLVVTTDLSEQCSR-ILTLSYNYLPLHLKACILYLSIVPKDEAIIV  716
            K  E W N  K  ++L      SE+ SR  + LSY+ LP +LK C+LY+ + P+D  I  
Sbjct  746  KMEESWWNEVK--DALFSYLGESEEYSRETMHLSYDNLPDYLKPCLLYMGMFPEDHNISA  803

Query  717  KRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKR-HFNGKIKTCRVHDIVH  893
             +L  LWIAEGFV+ + S  LEE A GYL DL   +++ + KR  +NGK+K C+VHDIV 
Sbjct  804  SKLTNLWIAEGFVQNVESGRLEEAAEGYLMDLISSNVVMVSKRGRYNGKVKYCQVHDIVL  863

Query  894  EFCVREAIKEKLL  932
             FC+  + +EK +
Sbjct  864  HFCLERSKEEKFM  876



>emb|CDP20463.1| unnamed protein product [Coffea canephora]
Length=1160

 Score =   130 bits (327),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 113/185 (61%), Gaps = 5/185 (3%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN-EAAKIDE---VTDG  172
            G+GKTTLA ++Y  P V SHF++  W  VSQ + +  MLV +L + E+ K+++   + + 
Sbjct  521  GLGKTTLANIVYNSPSVMSHFNLRAWCTVSQAYSMHNMLVQILGSIESGKLEQYRKMDEH  580

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            +LA KL++ L   +YL+VLDD+W  ++W  ++   PDD   SRIL+T+R + ++   +  
Sbjct  581  DLAVKLKQVLLRNKYLLVLDDLWDAKAWNLLERSLPDDANGSRILITSRLQNLSLQFNPY  640

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
             +++H L  L  +ESW+L  K   G +  P  L  +  ++ + C GLPL +V+V+G+   
Sbjct  641  -SKVHHLRRLTDKESWNLLQKKLFGKKGCPSRLSGVASQIANSCRGLPLTVVLVSGILAN  699

Query  533  TQQNC  547
            T ++C
Sbjct  700  TAEDC  704


 Score =   114 bits (285),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 89/141 (63%), Gaps = 3/141 (2%)
 Frame = +3

Query  534  LNKTVEE-WQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAI  710
            L  T E+ W+   +   S +V  D  E C + L LSY++LP  LKAC+LY     +DE +
Sbjct  697  LANTAEDCWKEVTQSLTSSIVLDD--EYCMKTLELSYSHLPDDLKACLLYFGAFKEDEDV  754

Query  711  IVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIV  890
             V+RL+ LWI+EGF+     ++LE++A   L+DL DRSL+ + ++   G  K CR+HD+V
Sbjct  755  SVRRLLWLWISEGFMRKTEEKSLEDMADDCLKDLVDRSLVMVSEQRTMGSAKACRLHDLV  814

Query  891  HEFCVREAIKEKLLNVDNKQH  953
            HEFCV++A +E  L+V   Q+
Sbjct  815  HEFCVKKAKEENFLHVLRSQN  835



>ref|XP_010319324.1| PREDICTED: disease resistance protein RPP13-like [Solanum lycopersicum]
Length=844

 Score =   147 bits (371),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 120/182 (66%), Gaps = 8/182 (4%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAK-------IDE  160
            GG+GKTTLAR LY++P +SS F    W  VSQ+++   +L  ++ +   +       +++
Sbjct  191  GGLGKTTLARNLYKNPNISSRFPTHAWICVSQEYNTMDLLKTIIKSIQGRTMGTLGLLEK  250

Query  161  VTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADS  340
            + + +L   L+  L+ ++YL+V+DD+W   +WE ++  FPDD   SR+++TTR +++A+ 
Sbjct  251  MDERDLENHLRDLLKERKYLVVVDDVWQREAWESLKRAFPDDKNGSRVIITTRKEDIAER  310

Query  341  ADSSGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAG  520
            A   G  +H L FL+QEESWDLF +    ++++  E+E++ + +V+KC GLPLAIVV++G
Sbjct  311  AADRGF-VHKLRFLSQEESWDLFLRKLLDVRAMVAEMESLAKDMVEKCRGLPLAIVVLSG  369

Query  521  VF  526
            + 
Sbjct  370  LL  371


 Score = 97.4 bits (241),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 84/139 (60%), Gaps = 4/139 (3%)
 Frame = +3

Query  540  KTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVK  719
            K ++EWQ  +       +  D S + S IL+LSYN L + LK C LY  + P+D  +  +
Sbjct  375  KDLDEWQKVKDHLWK-SIKEDKSVEISNILSLSYNDLSIELKQCFLYFGMFPEDRVVKAE  433

Query  720  RLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEF  899
              + LW+AEGF+     E +E+VA G+L +L  RSL+Q+ K  F GK+  CRVHD++H+ 
Sbjct  434  NTIWLWMAEGFIPR-GEERMEDVAEGFLNELIRRSLVQVAKT-FWGKVTECRVHDLLHDL  491

Query  900  CVREAIKEKLLNV-DNKQH  953
             +++A++    ++ D K+H
Sbjct  492  VIQKALEVNFFDIYDPKRH  510



>ref|XP_006423591.1| hypothetical protein CICLE_v10027800mg [Citrus clementina]
 gb|ESR36831.1| hypothetical protein CICLE_v10027800mg [Citrus clementina]
Length=859

 Score =   137 bits (345),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 114/188 (61%), Gaps = 14/188 (7%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN-EAAKIDE------  160
            GG+GKTTLAR L+    V   FD   W  V+Q++  R +L   + + +  KI++      
Sbjct  193  GGLGKTTLARKLFNSTDVKGGFDCRAWVCVTQEYTTRDLLQKTIKSFQKPKIEDLELMER  252

Query  161  VTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADS  340
            +T+ +L   L + L G+RYL+V+DDIW   +WE ++  FPD+   SRI++TTR++ VA  
Sbjct  253  MTEEDLELHLYEFLEGRRYLVVVDDIWHKSAWESLRRAFPDNGNGSRIVITTRNEPVAMI  312

Query  341  ADSSGNRLHTLGFLNQEESWDLFC-KSFPGIQSLPFE-----LETIGRKVVDKCHGLPLA  502
             D   N ++ L FLNQEESW LFC K+FP             LE +GR++V+KC GLPLA
Sbjct  313  TDEK-NFVYKLRFLNQEESWKLFCKKAFPDTADGQATVCSPGLEKLGREMVEKCRGLPLA  371

Query  503  IVVVAGVF  526
            I+V+ G+ 
Sbjct  372  IIVLGGLL  379


 Score =   107 bits (267),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 80/114 (70%), Gaps = 2/114 (2%)
 Frame = +3

Query  597  TDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSEN  776
            T  S+  S IL LSY+ LP  LK+C LYLS+ P+D  I  ++L+RLWIAEGF+     ++
Sbjct  399  TQDSDHVSPILALSYDELPYQLKSCFLYLSLFPEDSLIDTEKLIRLWIAEGFIP-EEEQD  457

Query  777  LEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLLNV  938
            +E VA  YL++L DRS+IQI +R+ + K+KTCR+HD++ E  +++A   + L+V
Sbjct  458  MENVAEEYLKELIDRSMIQIAERYLD-KVKTCRIHDLIRELAIKKARALEFLDV  510



>emb|CDP15268.1| unnamed protein product [Coffea canephora]
Length=1484

 Score =   144 bits (364),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 110/182 (60%), Gaps = 8/182 (4%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKID---EVTDGE  175
            G+GKTTLA   Y DP V+  F    W  VS  +  R++L+ +L       D   E++D +
Sbjct  793  GLGKTTLALKAYNDPSVTYQFHARAWCYVSHTYRRRELLLQILGEIVELKDDILEMSDED  852

Query  176  LAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVAD--SADS  349
            L  KL +CL+GKRYLIV+DDIWST +W   Q  FP+DN  SRIL+T+RH +VA    ADS
Sbjct  853  LEMKLYQCLKGKRYLIVMDDIWSTEAWYDFQRSFPNDNNGSRILITSRHFDVAVKLKADS  912

Query  350  SGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFF  529
            +    H L  L+ +ESW L  K     +  P EL  +G+K+ + C GLPLA+V ++G+  
Sbjct  913  TP---HPLRLLSDDESWTLLQKKLFYTKKCPNELVIVGKKIAESCRGLPLAVVAISGLLE  969

Query  530  KT  535
            +T
Sbjct  970  RT  971


 Score =   100 bits (248),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 70/118 (59%), Gaps = 0/118 (0%)
 Frame = +3

Query  591   VTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINS  770
             +  D    C  IL LSY YLP HLK C LY  +  +D+ I V++L  LWIAEGF+     
Sbjct  989   IVDDPVTGCMDILELSYRYLPNHLKPCFLYTGVFLEDKNIPVRKLTWLWIAEGFIPNNGL  1048

Query  771   ENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLLNVDN  944
             ++ E+VA GYL+DL  RSL+   KR   G +KTC VHD++   C+++  +E  L   N
Sbjct  1049  DSKEDVAEGYLRDLIGRSLVTASKRRSLGGVKTCHVHDMLRTLCLQKCEEENFLQWKN  1106



>ref|XP_010661778.1| PREDICTED: putative disease resistance protein At1g50180 [Vitis 
vinifera]
Length=816

 Score =   137 bits (345),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 74/195 (38%), Positives = 113/195 (58%), Gaps = 20/195 (10%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLL-------NNEAAKIDE  160
            GG+GKTTLA+ +Y    V  HF    W  VSQ+   R++L+ ++       N E  ++ E
Sbjct  201  GGLGKTTLAKKVYNHNDVKQHFHCQAWVYVSQEFKPRELLLSIISSVMSLSNEEKKEMRE  260

Query  161  VTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADS  340
            + + EL GKL++CL  K+YL+ +DD+WS  +W  ++   P+    S++L+TTR+KE+A  
Sbjct  261  MGEDELGGKLRECLNDKKYLVAMDDVWSIEAWSSLRSYLPESRNGSKVLMTTRNKEIAAQ  320

Query  341  ADS--------SGNRLHTLGFLNQEESWDLFCKSFPGIQ-----SLPFELETIGRKVVDK  481
            A+         S   ++ L  ++  ESW+LF K   G +     SL   LE +GRK+V K
Sbjct  321  ANPHEVVGHTDSQALVYELRIMDGNESWELFLKKTFGARDSTPVSLSKALEELGRKIVAK  380

Query  482  CHGLPLAIVVVAGVF  526
            C GLPLAIVV+ G+ 
Sbjct  381  CKGLPLAIVVLGGLL  395


 Score =   107 bits (267),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 79/126 (63%), Gaps = 4/126 (3%)
 Frame = +3

Query  609  EQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENLEEV  788
            E C  IL LSYN LP +LK+C LY  I P+D  I   +L+ LWIAEGFV+    E LE++
Sbjct  421  ESCFGILALSYNDLPYYLKSCFLYCGIFPEDSEIKASKLIHLWIAEGFVQRRGKEKLEDI  480

Query  789  AHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLLNVDNKQHPSC--  962
            A  +L +L  RS++Q+ ++  NG++ +CR+HD++ +  + EA   KL   +  +H +C  
Sbjct  481  AEDFLYELIHRSMVQVARKKANGRVMSCRIHDLLRDLAISEARDAKLF--EELRHLNCRY  538

Query  963  GELQQE  980
            GE+  +
Sbjct  539  GEISSQ  544



>emb|CDP17703.1| unnamed protein product [Coffea canephora]
Length=1247

 Score =   129 bits (324),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 106/184 (58%), Gaps = 5/184 (3%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLN----NEAAKIDEVTDG  172
            G+GKTTLA+ +Y DP +   F I  W  VSQ + ++ +L++LL     + + K  ++ + 
Sbjct  560  GLGKTTLAQRVYRDPSIIRDFHIRAWCNVSQVYCMKDLLLELLRGINPDVSKKYCDMDEQ  619

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            +LA KL   L+  RY IVLDDIW   +W  ++  FPDD   SR+L+T+R  EVA   +  
Sbjct  620  DLAHKLLNSLQRYRYFIVLDDIWDIDAWNILKRSFPDDKKGSRVLITSRQYEVASQVEPD  679

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
                H L     +ESWDL  K     +  P EL TIG+++ + C GLPL +V+VAG+   
Sbjct  680  -REPHRLRQFTDDESWDLLQKMLFPTEPYPPELCTIGKQIAENCGGLPLTVVIVAGILAT  738

Query  533  TQQN  544
             +Q+
Sbjct  739  IEQD  742


 Score =   115 bits (287),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 88/134 (66%), Gaps = 4/134 (3%)
 Frame = +3

Query  543  TVEE--WQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIV  716
            T+E+  W+ F ++ ++  V+  L+EQ   +L LSY ++P +LK C+LY    P+ + I +
Sbjct  738  TIEQDGWKQFAERMSARNVS--LTEQSMNMLELSYRHVPDYLKPCLLYAGAFPQGQEIPI  795

Query  717  KRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHE  896
            +RL+RLWIAEGFV+ +  + +EEVA  Y+ DL  RSLI + K+   G +KTCRVHD+V E
Sbjct  796  QRLLRLWIAEGFVKEVEQKKVEEVAEDYMMDLIGRSLIIVSKQRSFGGVKTCRVHDLVRE  855

Query  897  FCVREAIKEKLLNV  938
            FC  +A +E    +
Sbjct  856  FCATKAKEENFFQL  869



>ref|XP_006360836.1| PREDICTED: disease resistance protein RPP13-like [Solanum tuberosum]
Length=840

 Score =   147 bits (371),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 116/182 (64%), Gaps = 8/182 (4%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLL-------NNEAAKIDE  160
            GG+GKT LAR LY  P+++S F    W  VSQ ++   +L  ++       N     ++ 
Sbjct  191  GGLGKTNLARKLYTSPIIASSFPTRAWICVSQDYNTMDLLKTIIKSIQGCTNETLNLLER  250

Query  161  VTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADS  340
            +T+G+L   L+  L+ ++YL+V+DD+W   +WE ++  FPD    SR+++TTR ++VA+ 
Sbjct  251  MTEGDLEIYLRDLLKERKYLVVVDDVWQNEAWESLKRAFPDSKNGSRVIITTRKEDVAER  310

Query  341  ADSSGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAG  520
            AD  G  +H L FL+QEESWDLF +    ++++  E+E + +++V+ C GLPLAIVV++G
Sbjct  311  ADDRG-FVHKLRFLSQEESWDLFRRKLLDVRAMVPEMENLAKEMVENCRGLPLAIVVLSG  369

Query  521  VF  526
            + 
Sbjct  370  LL  371


 Score = 97.1 bits (240),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 92/160 (58%), Gaps = 8/160 (5%)
 Frame = +3

Query  540   KTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVK  719
             K ++EWQ   K      +  D   + S IL+LSYN L   LK C LY  I P+D+ +   
Sbjct  375   KGLKEWQKV-KDCLWKDIEEDSFHEISSILSLSYNDLSTALKKCFLYFGIFPEDQVVEAD  433

Query  720   RLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEF  899
              ++RLW+AEGF+     E +E+VA G+L +L  RSL+Q+ +  F  ++  CRVHD++ + 
Sbjct  434   NIIRLWMAEGFIVPRGEERMEDVAEGFLNELIRRSLVQVAQ-TFWERVTECRVHDLLRDL  492

Query  900   CVREAIKEKLLNV-DNKQH---PSC--GELQQEGCRWLNF  1001
              ++ A++ K  ++ D ++H    SC    +  +G R+L+F
Sbjct  493   AIQNALEVKFFDIYDPRKHSISSSCIRHAIHSQGERYLSF  532



>gb|EYU28611.1| hypothetical protein MIMGU_mgv1a025283mg, partial [Erythranthe 
guttata]
Length=872

 Score =   135 bits (340),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 111/183 (61%), Gaps = 7/183 (4%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLL----NNEAAKIDEVTD  169
            GGIGKTTLA  +Y +P +   F I  W  VSQ++   ++L+ LL    N +    D + D
Sbjct  197  GGIGKTTLATNVYNNPFIVEMFGIRAWFTVSQEY-TEEILLGLLHQINNTDRNAHDMIDD  255

Query  170  GELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADS  349
             EL  KL K L G++YL+V+DD+W  ++W+ ++   PD+N  SRIL+TTR  ++A  AD 
Sbjct  256  DELGDKLYKTLFGRKYLLVMDDMWDIKAWDMVKRFLPDNNNGSRILVTTRLLKLA--ADL  313

Query  350  SGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFF  529
                 + L FL++ +SWDL  ++       P ELE IG+ +  KC GLPLA+VV+ G+  
Sbjct  314  GSCCPYQLSFLDEAQSWDLLRQNIFAEGRCPIELEGIGKSIAKKCRGLPLALVVIGGLLA  373

Query  530  KTQ  538
            K++
Sbjct  374  KSK  376


 Score =   108 bits (270),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 80/129 (62%), Gaps = 1/129 (1%)
 Frame = +3

Query  546  VEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRL  725
             E W+  E+   S V   D  E C +IL+LSYN LP++LK C LY ++ P+D  I V RL
Sbjct  377  AEHWKYVEEDVTSAVYNQD-EEFCMKILSLSYNRLPIYLKPCFLYFAVFPEDYTIEVPRL  435

Query  726  VRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCV  905
            ++LW+AEGF+     ++LE++   YL+DL DR+LI +  R   G++  C +HD++ +   
Sbjct  436  LKLWVAEGFIRQCGHKSLEDIGREYLEDLIDRNLILVNSRLIIGELIYCCIHDLLSDLSR  495

Query  906  REAIKEKLL  932
            REA KE  +
Sbjct  496  REAQKENFV  504



>emb|CDP08423.1| unnamed protein product [Coffea canephora]
Length=1114

 Score =   124 bits (311),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 102/186 (55%), Gaps = 5/186 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLL----NNEAAKIDEVTD  169
             G+GKTTLA+ +Y DP +  HF I  W  VSQ +    +L+ +L    +  + +  ++ +
Sbjct  458  AGLGKTTLAKNVYSDPSIKFHFHICAWCTVSQVYSKHNLLLQILCVIDSRSSDQYHKMNE  517

Query  170  GELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADS  349
             +LA KL + L+GKRY+IVLDD+W    W  ++   PDD   SR+LLT+R   ++     
Sbjct  518  DDLAAKLYQQLKGKRYVIVLDDVWDIEGWNLLKHSLPDDCNGSRVLLTSRFHNLSLEIRP  577

Query  350  SGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFF  529
                LH L  L  +ES +L  K     +  P  L  +   V   C GLPLA+V+VAG+  
Sbjct  578  DSKPLH-LRPLTNKESLELLQKKLFAKEDCPPTLSEVVLHVAKCCKGLPLAVVLVAGILA  636

Query  530  KTQQNC  547
             TQQ+C
Sbjct  637  TTQQDC  642


 Score =   120 bits (300),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 87/133 (65%), Gaps = 5/133 (4%)
 Frame = +3

Query  555  WQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRL  734
            W+   ++ +S +   +  E C + L  SYNYLP +LK C+LYL    +D+ I +++L RL
Sbjct  643  WEEVTRRLSSTIFVEN--EHCMKTLEYSYNYLPDYLKPCLLYLGAFQEDQDIPIRKLSRL  700

Query  735  WIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREA  914
            WI+EGFV+ I  ++LE+VA  YL DL  RSL+    R   G IK CR+HD+VHEFCV +A
Sbjct  701  WISEGFVQKIEGKSLEDVADNYLMDLIGRSLVMPAHRRSLGGIKVCRIHDLVHEFCVAKA  760

Query  915  IKE---KLLNVDN  944
             +E   ++LNVD+
Sbjct  761  KEENFLRILNVDD  773



>gb|EYU24353.1| hypothetical protein MIMGU_mgv1a022376mg, partial [Erythranthe 
guttata]
Length=765

 Score =   144 bits (364),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 121/181 (67%), Gaps = 5/181 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GGIGKTTLA+  YE+ L++  F I  W  VSQK+DVR +L+ L + +++++   TD +L 
Sbjct  193  GGIGKTTLAKYAYENSLITRPFYIRRWVTVSQKYDVRGLLLQL-SEQSSEMISKTDEQLG  251

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
             +L   L G++YL+V+DD+WS  +WE ++  FP+D   SRI++TTR  +VA++  SS  R
Sbjct  252  DELYTRLCGRKYLVVIDDLWSEEAWEKLKRFFPNDKNGSRIVVTTRIWDVANNFGSSCLR  311

Query  362  LHTLGFLNQEESWDLFC-KSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
            ++   FL++ +SW+LFC K+F      P +LE IG+ +V KC GLPL+I V+ G+  ++ 
Sbjct  312  VN---FLDKVKSWELFCEKAFGNQVGCPSKLENIGKDIVKKCKGLPLSISVIGGLLGRSS  368

Query  539  Q  541
             
Sbjct  369  H  369


 Score = 99.8 bits (247),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 73/115 (63%), Gaps = 0/115 (0%)
 Frame = +3

Query  591  VTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINS  770
            V  D +E C  IL+LSY YLP HLK C L++    +D+ I V  L++LW+AEGF++   +
Sbjct  386  VNLDQNENCLSILSLSYTYLPPHLKPCFLFMGFFSEDDEIHVSTLMKLWVAEGFIKPNKA  445

Query  771  ENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLLN  935
            ++LE++A G+  DL D +L+       NG++  C++HD++ + C+R    EK ++
Sbjct  446  QSLEDIAIGHFNDLIDMNLVLRYSSGANGRVVYCKIHDLLRDLCIRVRHSEKFIS  500



>ref|XP_009588716.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana tomentosiformis]
Length=1008

 Score =   137 bits (346),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 107/175 (61%), Gaps = 2/175 (1%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN-EAAKIDEVTDGEL  178
            GG GKTT AR LY + +++S+FD+  W ++SQ +  R++L D+ +    +K     D  L
Sbjct  563  GGQGKTTFARRLYNNDIIASYFDVRAWCIISQTYKRRELLQDIFSQVTGSKYKGDKDDIL  622

Query  179  AGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGN  358
            A  L+K L GKRYLIVLDD+W   +W+ + LCFPD   RSR ++TTR +EV        +
Sbjct  623  ADMLRKSLMGKRYLIVLDDMWDGMAWDDLSLCFPDFVNRSRTVVTTRLEEVGKQVKHHTD  682

Query  359  RLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGV  523
              ++L FL  +ES+ L  K     +  P EL+ + + + ++C GLPLA+++ AG+
Sbjct  683  P-YSLPFLTPDESYKLLQKKVFQQEDFPTELQDVSQAIAERCKGLPLAVILAAGI  736


 Score =   106 bits (264),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 72/103 (70%), Gaps = 1/103 (1%)
 Frame = +3

Query  627  LTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENL-EEVAHGYL  803
            + LSY+ L  +LK C+LY+ + P+DE I V +L+ LWIAEGFV+ I S  L EE A GYL
Sbjct  770  MQLSYDKLADYLKPCLLYMGMFPEDERIPVSKLISLWIAEGFVQNIESRRLMEEAAEGYL  829

Query  804  QDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLL  932
             DL   +++ + KR +NGK+K C+VHD++  FC++ + +EK +
Sbjct  830  MDLISSNVVMVAKRRYNGKVKYCQVHDVILHFCLKRSREEKFM  872



>emb|CDP18675.1| unnamed protein product [Coffea canephora]
Length=1241

 Score =   127 bits (320),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 101/186 (54%), Gaps = 8/186 (4%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLL----NNEAAKIDEVTD  169
             G+GKTTLA  +  DPL+ SHF IL    VSQ + +  +LV LL    +    +  E+ +
Sbjct  569  AGLGKTTLANRVCNDPLILSHFHILARCTVSQVYSMHSLLVQLLCSISSRSPGEYLEMDE  628

Query  170  GELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADS  349
             +LA KL K L+  RYLI LDD+W  ++W  ++   PDD   SRIL T+R  ++    DS
Sbjct  629  SDLAHKLYKLLKRNRYLIFLDDVWEIKAWNLVKSSLPDDANGSRILFTSR-IQLQLKPDS  687

Query  350  SGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFF  529
                 H L  L  EESW L  K   G +  P  L  +G ++   C GLPL +V+V G+  
Sbjct  688  KA---HNLRHLTNEESWKLLQKKLIGKEGFPPTLGKVGSQIAKLCRGLPLTVVLVVGILA  744

Query  530  KTQQNC  547
             T ++C
Sbjct  745  NTAEDC  750


 Score =   116 bits (290),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 89/145 (61%), Gaps = 3/145 (2%)
 Frame = +3

Query  534  LNKTVEE-WQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAI  710
            L  T E+ W+   K   S +V  D  E C   L LSY++L   LK+C+LY     +DE +
Sbjct  743  LANTAEDCWEEVTKSLTSSIVLDD--EYCMMTLELSYSHLSDDLKSCLLYFGAFKEDENV  800

Query  711  IVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIV  890
             V+RL+ LWI+EGFV     ++LE+ A  YL+DL DRSL+ + K+   G  K CR+HD+V
Sbjct  801  PVRRLLWLWISEGFVRKTEGKSLEDTADDYLKDLVDRSLVMVSKQRTMGGAKACRLHDLV  860

Query  891  HEFCVREAIKEKLLNVDNKQHPSCG  965
            HEFCV++A +E  L+V + ++   G
Sbjct  861  HEFCVKKAKEENFLHVLHSRNDHTG  885



>ref|XP_009776048.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=886

 Score =   131 bits (330),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 107/178 (60%), Gaps = 4/178 (2%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN---EAAKIDEVTDGE  175
            G+GKTTLA  +Y+ P +   F   +W  VSQ +  R++ +++++       +  ++ + +
Sbjct  185  GLGKTTLANKIYKHPDIGYQFFTRIWVYVSQSYRRRELFLNIISKFTRNTKQYHDMCEED  244

Query  176  LAGKLQKCL-RGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            LA +++  L +G +YLIVLDD+WS  +WE I++ FP++N  +RILLTTR+ +VA      
Sbjct  245  LADEIEDFLGKGGKYLIVLDDVWSPDAWERIRIAFPNNNKSNRILLTTRNSKVAKQCKQC  304

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
                H L FL ++ESW L  K        P ELE  G+ +  KC+GLPLAIVV+AG  
Sbjct  305  IGIPHDLKFLTEDESWILLEKKVFHKDKCPPELELSGKSIAKKCNGLPLAIVVIAGAL  362


 Score =   112 bits (279),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 82/132 (62%), Gaps = 0/132 (0%)
 Frame = +3

Query  537  NKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIV  716
             KT  EW+  ++     ++  D  E C++++ LSY+ L   LKAC LY    P    I  
Sbjct  366  GKTSREWKQVDESVGEHLINKDQPENCNKLVQLSYDRLSYDLKACFLYCGAFPGGFEIPA  425

Query  717  KRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHE  896
             +L+RLWIAEGF++     +LE  A   L DL +R+L+ I +R  +G+IKTCR+HD++HE
Sbjct  426  WKLIRLWIAEGFIQYKGHLSLECKAEDNLNDLINRNLVMIMQRTSDGQIKTCRLHDMLHE  485

Query  897  FCVREAIKEKLL  932
            FC +EA+KE+ L
Sbjct  486  FCRQEAMKEENL  497



>emb|CDP18959.1| unnamed protein product [Coffea canephora]
Length=890

 Score =   129 bits (325),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 67/177 (38%), Positives = 111/177 (63%), Gaps = 4/177 (2%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAA---KIDEVTDGE  175
            G+GKTTLA+ +  DP +   F    +  VSQ+++ ++M + +L        ++++++D +
Sbjct  195  GLGKTTLAKKVLNDPKIEYEFYTRAFVNVSQEYERKEMFLKILGQFTQITDQMNKMSDEQ  254

Query  176  LAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSG  355
            L  +L   L+ ++YLIV+DD+W+  +W+ ++  FP++N RSR+L+T+RHK VA  A+ S 
Sbjct  255  LCKELHDQLKTRKYLIVMDDVWTNEAWDQLKGAFPNNNKRSRVLITSRHKPVAVHANQSI  314

Query  356  NRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
            +  + L FL  EES +L  +   G    P ELE    +++ KC GLPLAIVVVAG+ 
Sbjct  315  DP-YFLRFLYPEESRELLRRKVFGNNCCPSELEAYELRILQKCDGLPLAIVVVAGIL  370


 Score =   114 bits (284),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 87/150 (58%), Gaps = 5/150 (3%)
 Frame = +3

Query  555  WQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRL  734
            W+   +  N  V      EQ   ++ LSYN++P +LK C LYL +  +D  I V +LVRL
Sbjct  380  WKKVAEDVNDYVARK--QEQSYDVIKLSYNHMPYYLKPCFLYLGVFREDFEIPVWKLVRL  437

Query  735  WIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREA  914
            WIAEGF+      +LE++A  YL++L DR+L+ +  R   G+IKTCR+HD + +FC +EA
Sbjct  438  WIAEGFIPRDGCMSLEDIAEDYLEELVDRNLVMVGHRRLTGQIKTCRIHDTLRDFCKKEA  497

Query  915  IKEKLLNVDNK--QHPS-CGELQQEGCRWL  995
             KE L     +  Q PS   +   +G R L
Sbjct  498  TKENLFQEIKRFDQAPSFSADRSSDGFRRL  527



>emb|CAN81725.1| hypothetical protein VITISV_034604 [Vitis vinifera]
Length=506

 Score =   130 bits (326),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 111/181 (61%), Gaps = 9/181 (5%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFD-ILVWTVVSQKHDVRKMLVDLLNNEAAKIDE----VT  166
            GG+GKTTLA+ +Y D  V +HF     W  VSQ++ +R++L+ + +     IDE    + 
Sbjct  45   GGLGKTTLAQKVYNDGAVQNHFGRYCAWVYVSQEYSIRELLLGIASCIMTLIDEQKRKIQ  104

Query  167  DGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSAD  346
            + EL  +++KCL+ K YLIVLDD+W+T  W G+   FP ++ ++R+L+TTR++++   A 
Sbjct  105  NHELGKEIEKCLKEKSYLIVLDDVWNTDVWRGLSSFFPAESNKTRVLITTRNEQIVVDAH  164

Query  347  SSGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFE-LETIGRKVVDKCHGLPLAIVVVAGV  523
            S   +L  LG    +ESW+LF         L +  LE   +++V KC GLPLAIVV+ G+
Sbjct  165  SDCYKLQHLG---DDESWELFLSRVGSAAVLTWSGLEEFKKEIVAKCKGLPLAIVVLGGL  221

Query  524  F  526
             
Sbjct  222  L  222


 Score =   113 bits (283),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 73/111 (66%), Gaps = 0/111 (0%)
 Frame = +3

Query  609  EQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENLEEV  788
            + C  IL LSYN LP +LK+  LY  + PKD  I   +L+RLW+AEGFV+    E LE++
Sbjct  248  DSCLGILALSYNDLPSYLKSYFLYCGVFPKDSEIKATKLIRLWVAEGFVQKRGKETLEDI  307

Query  789  AHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLLNVD  941
            A  YL +L  RS+IQ+     +G++K+CR+HD+V +  + EA KEKL  VD
Sbjct  308  AEDYLYELIQRSMIQVADTRDDGRVKSCRIHDLVRDLAISEAKKEKLFEVD  358



>ref|XP_008373506.1| PREDICTED: disease resistance protein RPM1-like [Malus domestica]
 ref|XP_008346479.1| PREDICTED: disease resistance protein RPM1-like [Malus domestica]
Length=949

 Score =   132 bits (331),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 103/185 (56%), Gaps = 10/185 (5%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDE-------  160
            GG+GKTTLA+ +Y+DP V  HF +  W  V++      +L D++      I         
Sbjct  196  GGMGKTTLAKQVYDDPEVKKHFKVRAWITVNRSFKFGDLLRDMVQQLFKAIRRQVPQMVA  255

Query  161  -VTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVAD  337
             + + +L   +++ L+ +RYLIVLDD+W+   W  I+   P+++C SRI+LTTR  +VA 
Sbjct  256  NMNNNQLKTTIKELLQKRRYLIVLDDVWNLSEWNAIKYALPNNDCGSRIMLTTRKSDVAT  315

Query  338  SADS--SGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVV  511
            +A    S  + + L  L   ESWDLFC+        P  LE I   ++ KC GLPLAIV 
Sbjct  316  TAAGVLSEGKAYDLKPLPXSESWDLFCRRAFQHNKCPPHLEEICNYILRKCEGLPLAIVA  375

Query  512  VAGVF  526
            ++GV 
Sbjct  376  ISGVL  380


 Score =   111 bits (278),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 85/141 (60%), Gaps = 0/141 (0%)
 Frame = +3

Query  528  SKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEA  707
            +K  + ++EW    +   + +   D      ++L+LS+N LP  LK+C LYLSI P+D  
Sbjct  382  TKDTRRLDEWDVVARSLGAEIEGNDKLNDLKKVLSLSFNDLPYFLKSCFLYLSIFPEDHL  441

Query  708  IIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDI  887
            I   RL+RLW+AEGF+E    + LEEV   YLQ+L +RSL+Q+     +G++KTCR+HD+
Sbjct  442  IERMRLIRLWVAEGFIEAKEGKTLEEVGEDYLQELLNRSLMQVATTTPDGRVKTCRIHDL  501

Query  888  VHEFCVREAIKEKLLNVDNKQ  950
            + E  + ++  +    +  +Q
Sbjct  502  LREIIISKSRDQNFTTILKEQ  522



>ref|XP_006387370.1| hypothetical protein POPTR_1142s00200g, partial [Populus trichocarpa]
 gb|ERP46284.1| hypothetical protein POPTR_1142s00200g, partial [Populus trichocarpa]
Length=593

 Score =   135 bits (340),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 103/184 (56%), Gaps = 9/184 (5%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN--------EAAKID  157
            GG+GK+TL + +Y+D  V  HF    W  VSQ      +L D++          +   +D
Sbjct  78   GGLGKSTLVKKVYDDSDVKKHFKFCAWITVSQSFKREDLLKDMIQQLFRVHSKPDPKGVD  137

Query  158  EVTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVAD  337
             +   +L   + + LR K+YLIVLDD+W T +W   Q   P++ C SRIL+TTR+ EVA 
Sbjct  138  NMNYNKLRSVIHEFLRQKKYLIVLDDVWHTSAWRAFQHALPNNICGSRILVTTRNTEVAS  197

Query  338  -SADSSGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVV  514
             S   S ++++ L  L+QEESW LFCK        P  L+ +   ++ +C GLPLAIV +
Sbjct  198  TSCMDSPDKVYPLNPLSQEESWTLFCKKIFQDNPRPPHLKNVSETILGRCEGLPLAIVAI  257

Query  515  AGVF  526
            +GV 
Sbjct  258  SGVL  261


 Score =   107 bits (268),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 89/163 (55%), Gaps = 14/163 (9%)
 Frame = +3

Query  528   SKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEA  707
             +K     +EW+         +   D+     +IL+LSYN LP +LK+C+LY SI P    
Sbjct  263   TKDKSKTDEWEMVHLSLGVGLEENDMLMSARKILSLSYNDLPYYLKSCLLYFSIFPVGNR  322

Query  708   IIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDI  887
             I   RL+RLWIAEGFV+      +EEVA  YL +L  RSL+Q+ +   +G++KTCRVHD+
Sbjct  323   IKRMRLIRLWIAEGFVKGKEGMTVEEVAQDYLNELMKRSLVQVVRATSDGRVKTCRVHDL  382

Query  888   VHEFCVREAIKEKLLNVDNKQHPSCGELQQEGCRWLNFWPKKI  1016
             + E  + +A  +  + +           ++EG      WP+K+
Sbjct  383   LREIMITKAKDQDFVAI----------AKEEG----TIWPEKV  411



>ref|XP_007210391.1| hypothetical protein PRUPE_ppa000953mg [Prunus persica]
 gb|EMJ11590.1| hypothetical protein PRUPE_ppa000953mg [Prunus persica]
Length=952

 Score =   130 bits (328),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 104/187 (56%), Gaps = 15/187 (8%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDE-------  160
            GG+GKTTLA+ +Y+DP V  HF++  W  V++      +L D++      I         
Sbjct  200  GGMGKTTLAKQVYDDPEVKKHFEVRAWITVNRSFKFGDLLKDMVQQLFKAIRRRIPQIVA  259

Query  161  -VTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVAD  337
             + D +L   +++ L+ +RYL+VLDD+W    W+ I+   P + C SRI+LTTR+   AD
Sbjct  260  NMNDYQLKTTIKELLQNRRYLVVLDDVWHLYEWDAIKYALPSNGCGSRIMLTTRN---AD  316

Query  338  SADSSG----NRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAI  505
             A ++G     + + L  L   ESWDLFC+        P  LE I + ++ KC GLPLAI
Sbjct  317  VASTTGVLCEGKAYNLKPLPPPESWDLFCRKAFQWNKCPSHLEEICKYILRKCEGLPLAI  376

Query  506  VVVAGVF  526
            V ++GV 
Sbjct  377  VAISGVL  383


 Score =   112 bits (281),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 81/126 (64%), Gaps = 0/126 (0%)
 Frame = +3

Query  528  SKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEA  707
            +K  + ++EW    +   + +   D  +   ++L+LS+N LP +LK+C LYLSI P+D  
Sbjct  385  TKDKRRIDEWDMVRRSLGAEIEGNDKLKDLKKVLSLSFNDLPYYLKSCFLYLSIFPEDHL  444

Query  708  IIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDI  887
            I   RL+RLW+AEGF+E    + LEEVA  YL +L +RSL+Q+     +G++KTCR+HD+
Sbjct  445  IERMRLIRLWVAEGFIEAKEGKTLEEVADDYLHELLNRSLMQVATTTPDGRVKTCRIHDL  504

Query  888  VHEFCV  905
            + E  +
Sbjct  505  LREIII  510



>ref|XP_010661463.1| PREDICTED: probable disease resistance RPP8-like protein 2 [Vitis 
vinifera]
Length=741

 Score =   132 bits (333),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 109/179 (61%), Gaps = 7/179 (4%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEV---TDG  172
            GG+GKTTLA+ +Y D  + +HF    W  VSQ++++R++L+ + N      DE     + 
Sbjct  72   GGLGKTTLAKKVYNDRDIQNHFCYRAWVYVSQEYNIRELLLGIANCVTTLTDEQKRKNEN  131

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            EL  ++ KCL+GKR LIVLDDIW+T  W G+   FP ++ +SR+L+TTR +++   A S 
Sbjct  132  ELGEEVYKCLQGKRNLIVLDDIWNTDVWRGLSSYFPAESNKSRVLITTRREDIVVDAHSD  191

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFE-LETIGRKVVDKCHGLPLAIVVVAGVF  526
              +L  LG   ++ESW+LF         L +  LE   +++V KC GLPL IVV+ G+ 
Sbjct  192  CYKLQLLG---EKESWELFLNKVGTRAVLTWPGLEEFKKEIVAKCKGLPLTIVVLGGLL  247


 Score =   110 bits (276),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 72/110 (65%), Gaps = 0/110 (0%)
 Frame = +3

Query  609  EQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENLEEV  788
            + C  IL LSYN LP +LK C LY  + P+D  I   +L+RLW+AEGFV+    E LE+V
Sbjct  273  DSCLGILALSYNDLPSYLKPCFLYCGVFPEDSEIKATKLIRLWVAEGFVQKRGKETLEDV  332

Query  789  AHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLLNV  938
            A  YL +L  RS+IQ+     +G++K+CR+HD++ +  + EA +EKL  V
Sbjct  333  AEDYLYELIQRSMIQVADTRDDGRVKSCRIHDLLRDLAISEAKEEKLFEV  382



>ref|XP_008238139.1| PREDICTED: disease resistance protein RPM1-like [Prunus mume]
Length=952

 Score =   130 bits (328),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 104/187 (56%), Gaps = 15/187 (8%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDE-------  160
            GG+GKTTLA+ +Y+DP V  HF++  W  V+Q      +L D++      I         
Sbjct  200  GGMGKTTLAKQVYDDPEVKKHFEVRAWITVNQSFKFGDLLKDMVQQLFKAIRRRIPQIVA  259

Query  161  -VTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVAD  337
             + + +L   +++ L+ +RYL+VLDD+W    W+ I+   P + C SRI+LTTR+   AD
Sbjct  260  NMNNCQLKTTIKELLQNRRYLVVLDDVWHLYEWDAIKYALPSNGCGSRIMLTTRN---AD  316

Query  338  SADSSG----NRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAI  505
             A ++G     + + L  L   ESWDLFC+        P  LE I + ++ KC GLPLAI
Sbjct  317  VASTTGVLCEGKAYNLKPLPPPESWDLFCRKAFQWNKCPPHLEEICKYILRKCEGLPLAI  376

Query  506  VVVAGVF  526
            V ++GV 
Sbjct  377  VAISGVL  383


 Score =   112 bits (280),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 83/129 (64%), Gaps = 0/129 (0%)
 Frame = +3

Query  528  SKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEA  707
            +K  + ++EW    +   + +   D  +   ++L+LS+N LP +LK+C LYLSI P+D  
Sbjct  385  TKDKRRIDEWDMVGRSLGAEIEGNDKLKDLKKVLSLSFNDLPYYLKSCFLYLSIFPEDHL  444

Query  708  IIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDI  887
            I   RL+RLW+AEGF+E    + LEEVA  YL +L +RSL+Q+     +G++KTCR+HD+
Sbjct  445  IERMRLIRLWVAEGFIEAKEGKTLEEVADDYLHELLNRSLMQVATTTPDGRVKTCRIHDL  504

Query  888  VHEFCVREA  914
            + E  + ++
Sbjct  505  LREIIISKS  513



>ref|XP_009783244.1| PREDICTED: late blight resistance protein R1-A-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009783245.1| PREDICTED: late blight resistance protein R1-A-like isoform X1 
[Nicotiana sylvestris]
Length=1272

 Score =   138 bits (348),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 108/182 (59%), Gaps = 4/182 (2%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN---EAAKIDEVTDGE  175
            G+GKTTLA  LY D LV SHFDI     VSQ +  + +L+ +L +   E ++  E    E
Sbjct  574  GLGKTTLAYRLYSDRLVVSHFDIRADCCVSQVYSRKNLLLAILRDVISENSEFREKKADE  633

Query  176  LAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSG  355
            LA  L+K L  KRYLI++DD+W    W+ +  CF D N  SRI+LTTR+ E+A+ A    
Sbjct  634  LADLLRKALFSKRYLILVDDVWEASVWDDLICCFQDANNGSRIILTTRNHEIAEYAKFQS  693

Query  356  NRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKT  535
            N   +L   N EESW L  K   G +S P  L  IGR++ +KC  LPL+I +VAGV  + 
Sbjct  694  NPF-SLRMFNNEESWKLLRKKVFGEESCPSLLMNIGRQIAEKCGQLPLSIALVAGVLAEV  752

Query  536  QQ  541
            ++
Sbjct  753  EK  754


 Score =   104 bits (260),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 69/103 (67%), Gaps = 0/103 (0%)
 Frame = +3

Query  624  ILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENLEEVAHGYL  803
            I+  SY  LP HL++C LY     +D  I V +L+RLWI+EGFV+    ++LE++A GYL
Sbjct  777  IIENSYQILPYHLRSCFLYFGAFLEDNVINVSKLIRLWISEGFVKGCEGKSLEDIAEGYL  836

Query  804  QDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLL  932
             +L  R+L+   KR F GKIK CR+HD++H+FC   A +E L+
Sbjct  837  GNLIGRNLVMGTKRSFRGKIKACRIHDLLHDFCKVRAKEENLV  879



>ref|XP_009783246.1| PREDICTED: late blight resistance protein R1-A-like isoform X2 
[Nicotiana sylvestris]
Length=1220

 Score =   138 bits (348),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 108/182 (59%), Gaps = 4/182 (2%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN---EAAKIDEVTDGE  175
            G+GKTTLA  LY D LV SHFDI     VSQ +  + +L+ +L +   E ++  E    E
Sbjct  522  GLGKTTLAYRLYSDRLVVSHFDIRADCCVSQVYSRKNLLLAILRDVISENSEFREKKADE  581

Query  176  LAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSG  355
            LA  L+K L  KRYLI++DD+W    W+ +  CF D N  SRI+LTTR+ E+A+ A    
Sbjct  582  LADLLRKALFSKRYLILVDDVWEASVWDDLICCFQDANNGSRIILTTRNHEIAEYAKFQS  641

Query  356  NRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKT  535
            N   +L   N EESW L  K   G +S P  L  IGR++ +KC  LPL+I +VAGV  + 
Sbjct  642  NPF-SLRMFNNEESWKLLRKKVFGEESCPSLLMNIGRQIAEKCGQLPLSIALVAGVLAEV  700

Query  536  QQ  541
            ++
Sbjct  701  EK  702


 Score =   104 bits (260),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 69/103 (67%), Gaps = 0/103 (0%)
 Frame = +3

Query  624  ILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENLEEVAHGYL  803
            I+  SY  LP HL++C LY     +D  I V +L+RLWI+EGFV+    ++LE++A GYL
Sbjct  725  IIENSYQILPYHLRSCFLYFGAFLEDNVINVSKLIRLWISEGFVKGCEGKSLEDIAEGYL  784

Query  804  QDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLL  932
             +L  R+L+   KR F GKIK CR+HD++H+FC   A +E L+
Sbjct  785  GNLIGRNLVMGTKRSFRGKIKACRIHDLLHDFCKVRAKEENLV  827



>ref|XP_009777373.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana sylvestris]
Length=1308

 Score =   130 bits (326),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 109/179 (61%), Gaps = 2/179 (1%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GG GKTT+AR +Y++ ++ SHFD L W  +SQ +   ++L ++ +++ +K     D ELA
Sbjct  580  GGQGKTTIARKVYDNKVIVSHFDGLAWCCISQTYSWIELLREI-HSQVSKNKVDKDDELA  638

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
              L+K L  +RYLIVLDD+W  ++W+ ++L FP+D   SRI++TTR +EV        + 
Sbjct  639  HMLKKSLMSRRYLIVLDDMWDVKAWDDLRLSFPNDENGSRIIVTTRLEEVGKQVKQHTDP  698

Query  362  LHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             ++L FL QEES  L  K     +  P EL+ +  +V   C GLPL +V+ AG+  K +
Sbjct  699  -YSLPFLTQEESCQLLQKKVFQQEDCPPELQDVSLEVAKTCKGLPLVVVLAAGIIKKKK  756


 Score =   112 bits (281),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +3

Query  627  LTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQ  806
            + LSY+ LP +L+ C+LY+ + P+D  I V +L+ LWIAEGFV+ I S  LEEVA GYL 
Sbjct  784  MQLSYDNLPDYLRPCLLYMGVFPEDARIPVSKLISLWIAEGFVKNIESGRLEEVAEGYLL  843

Query  807  DLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLL  932
            DL   ++I + +R +NGK+K C+VHD+V  FC R++ +EK +
Sbjct  844  DLISSNVIMVSRRRYNGKVKYCKVHDVVLHFCFRKSREEKFM  885



>ref|XP_009624787.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=888

 Score =   129 bits (324),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 106/179 (59%), Gaps = 5/179 (3%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN---EAAKIDEVTDGE  175
            G+GKTTLA  +Y+ P +   F   +W  VSQ +  R++ +++++       +   + + +
Sbjct  185  GLGKTTLANKIYKHPKIGYEFFTRIWVYVSQSYRRRELFLNIISKFTRNTKQYHGMCEED  244

Query  176  LAGKLQKCL-RGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRS-RILLTTRHKEVADSADS  349
            LA ++Q  L +G +YLIVLDD+WS  +WE I++ FP++N +S RILLTTR  +VA     
Sbjct  245  LADEIQDFLGKGGKYLIVLDDVWSPDAWERIRIAFPNNNNKSNRILLTTRDSKVAKQCKQ  304

Query  350  SGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
                 H L FL ++ESW L  K        P ELE  G+ +  KC+GLPLAIVV+AG  
Sbjct  305  CIGIPHDLKFLTEDESWILLEKKVFHKDKCPPELELSGKSIAKKCNGLPLAIVVIAGAL  363


 Score =   113 bits (283),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 83/132 (63%), Gaps = 0/132 (0%)
 Frame = +3

Query  537  NKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIV  716
             KT  EW+  ++     ++  D  E C++++ +SY+ LP  LKAC LY    P    I  
Sbjct  367  GKTSREWKQVDQSVGEHLINKDQLENCNKLVQMSYDRLPYDLKACFLYCGAFPGGFEIPA  426

Query  717  KRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHE  896
             +L+RLWIAEGF++     +LE  A   L DL +R+L+ + +R  +G+IKTCR+HD++HE
Sbjct  427  WKLIRLWIAEGFIQYKGHLSLECKAEDNLNDLINRNLVMVMQRTSDGQIKTCRLHDMLHE  486

Query  897  FCVREAIKEKLL  932
            FC +EA+KE+ L
Sbjct  487  FCRQEAMKEENL  498



>ref|XP_009588710.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana tomentosiformis]
Length=1175

 Score =   131 bits (330),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 111/179 (62%), Gaps = 2/179 (1%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GG GKTT+AR +Y++ ++ SHFD L W  +SQ ++   +L ++ +++ +K     D ELA
Sbjct  439  GGQGKTTIARKVYDNKMIVSHFDGLAWCCISQTYNWIDLLREI-HSQVSKNKVDKDDELA  497

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
              L+K L G+RYLIVLDD+W  ++W+ ++L FP+D   SRI++TTR +EV+       + 
Sbjct  498  HMLKKSLMGRRYLIVLDDMWDVKAWDDLRLSFPNDENGSRIIVTTRLEEVSKQVKQHTDP  557

Query  362  LHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             ++L FL QE+S  L  K     +  P EL+ +  +V   C GLPL +V+ AG+  K +
Sbjct  558  -YSLPFLTQEKSCQLLQKKVFQQEDCPPELQDVSLEVAKTCKGLPLVVVLAAGIIKKKK  615


 Score =   111 bits (277),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +3

Query  627  LTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQ  806
            + LSY+ LP +L+ C+LY+ + P+D  I V +L+ LWIAEGFV+ I S  LEEVA GYL 
Sbjct  643  MQLSYDNLPDYLRPCLLYMGVFPEDARIPVSKLISLWIAEGFVKNIESGRLEEVAEGYLL  702

Query  807  DLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLL  932
            DL   +++ + +R +NGK+K C VHD+V  FC R++ +EK +
Sbjct  703  DLISSNVVMVSRRRYNGKVKYCNVHDVVLHFCFRKSREEKFM  744



>ref|XP_009596953.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana tomentosiformis]
 ref|XP_009596954.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana tomentosiformis]
 ref|XP_009596956.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana tomentosiformis]
Length=787

 Score =   142 bits (359),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 114/183 (62%), Gaps = 6/183 (3%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN---EAAKIDEVTDGE  175
            G+GKTTLAR +Y++P + ++FD+  W  VSQ ++ R +L+++      + ++IDE  D  
Sbjct  61   GLGKTTLARKVYDNPSIVNYFDVKAWCSVSQAYNRRTLLIEIFKQATRDKSEIDEAVD--  118

Query  176  LAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSG  355
            +A KLQK L+G+RYLIVLDDIW   +WE + L FP     SR+++TTR +EVA       
Sbjct  119  IADKLQKTLKGRRYLIVLDDIWEVETWEDLGLYFPKGEDGSRVIVTTRIEEVAKHLQHCS  178

Query  356  NRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKT  535
            +  ++L FL  +ESW+L  K     +S P +L   G  V + C GLPL IV++AG+  K 
Sbjct  179  DP-YSLRFLTSKESWELLQKKVFRGESCPPDLLEAGLHVAEHCKGLPLVIVLIAGIIVKM  237

Query  536  QQN  544
            ++ 
Sbjct  238  ERK  240


 Score =   100 bits (248),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 79/133 (59%), Gaps = 5/133 (4%)
 Frame = +3

Query  531  KLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAI  710
            K+ +    W       +SL     L EQ  +++  SY++L   LK C+LY+++ P+D  I
Sbjct  236  KMERKASLWLEVANDLSSLA----LGEQGMKVIQSSYDHLEDQLKPCLLYMALYPEDYKI  291

Query  711  IVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRH-FNGKIKTCRVHDI  887
             V  L++LW+AE FVE I+SEN+EE +   L DL  RSL+ +  R   NG I+ C +HD+
Sbjct  292  PVSDLLKLWMAEEFVENIDSENMEETSRILLNDLLKRSLVMVSGRQEINGAIEYCSLHDL  351

Query  888  VHEFCVREAIKEK  926
            V EFC+R   +EK
Sbjct  352  VREFCLRRLTEEK  364



>ref|XP_009777372.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=1168

 Score =   130 bits (326),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 109/179 (61%), Gaps = 2/179 (1%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GG GKTT+AR +Y++ ++ SHFD L W  +SQ +   ++L ++ +++ +K     D ELA
Sbjct  440  GGQGKTTIARKVYDNKVIVSHFDGLAWCCISQTYSWIELLREI-HSQVSKNKVDKDDELA  498

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
              L+K L  +RYLIVLDD+W  ++W+ ++L FP+D   SRI++TTR +EV        + 
Sbjct  499  HMLKKSLMSRRYLIVLDDMWDVKAWDDLRLSFPNDENGSRIIVTTRLEEVGKQVKQHTDP  558

Query  362  LHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             ++L FL QEES  L  K     +  P EL+ +  +V   C GLPL +V+ AG+  K +
Sbjct  559  -YSLPFLTQEESCQLLQKKVFQQEDCPPELQDVSLEVAKTCKGLPLVVVLAAGIIKKKK  616


 Score =   112 bits (281),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +3

Query  627  LTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQ  806
            + LSY+ LP +L+ C+LY+ + P+D  I V +L+ LWIAEGFV+ I S  LEEVA GYL 
Sbjct  644  MQLSYDNLPDYLRPCLLYMGVFPEDARIPVSKLISLWIAEGFVKNIESGRLEEVAEGYLL  703

Query  807  DLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLL  932
            DL   ++I + +R +NGK+K C+VHD+V  FC R++ +EK +
Sbjct  704  DLISSNVIMVSRRRYNGKVKYCKVHDVVLHFCFRKSREEKFM  745



>emb|CDP20519.1| unnamed protein product [Coffea canephora]
Length=1251

 Score =   122 bits (306),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 109/185 (59%), Gaps = 5/185 (3%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN-EAAKIDE---VTDG  172
            G+GKTTLA ++Y  P V  HF+I     VSQ + +  MLV +L++ ++ K+++   + + 
Sbjct  574  GLGKTTLANIVYNSPSVMLHFNIRARCTVSQAYSMHNMLVQILDSIDSGKLEQYRKMDEH  633

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            +LA KL++ L   +YL+VLDD+W   +W  ++   PDD   SRIL+T+R + ++      
Sbjct  634  DLAVKLKQVLLRNKYLLVLDDLWDANAWNLLERSLPDDANGSRILITSRLQNLSLQF-KP  692

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
             +++H L  L  EESW+L  K   G +  P  L  +  ++   C GLPL +V+VAG+   
Sbjct  693  HSKVHHLRCLTVEESWNLLQKKLFGKEGCPPRLSGVASQIAKSCRGLPLTVVLVAGILAN  752

Query  533  TQQNC  547
            T ++C
Sbjct  753  TAEDC  757


 Score =   120 bits (301),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 88/145 (61%), Gaps = 3/145 (2%)
 Frame = +3

Query  534  LNKTVEE-WQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAI  710
            L  T E+ W+   K   S +V  D  E C + L LSY +LP  LK C+LY     +DE +
Sbjct  750  LANTAEDCWEEVTKSLTSSIVLDD--EYCMKTLELSYGHLPDDLKLCLLYFGAFQEDEDV  807

Query  711  IVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIV  890
             V+RL  LWI+EGFV     + LE+VA  YL+DL DRSL+ + K+   G  K CR+HD+V
Sbjct  808  PVRRLSWLWISEGFVRKTEGKRLEDVADDYLKDLVDRSLVMVSKQRSTGGAKACRIHDLV  867

Query  891  HEFCVREAIKEKLLNVDNKQHPSCG  965
            HEFCV++A +E  L+V + ++   G
Sbjct  868  HEFCVKKAEEETFLHVLHGRNDHTG  892



>ref|XP_009588708.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=1292

 Score =   131 bits (330),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 111/179 (62%), Gaps = 2/179 (1%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GG GKTT+AR +Y++ ++ SHFD L W  +SQ ++   +L ++ +++ +K     D ELA
Sbjct  556  GGQGKTTIARKVYDNKMIVSHFDGLAWCCISQTYNWIDLLREI-HSQVSKNKVDKDDELA  614

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
              L+K L G+RYLIVLDD+W  ++W+ ++L FP+D   SRI++TTR +EV+       + 
Sbjct  615  HMLKKSLMGRRYLIVLDDMWDVKAWDDLRLSFPNDENGSRIIVTTRLEEVSKQVKQHTDP  674

Query  362  LHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             ++L FL QE+S  L  K     +  P EL+ +  +V   C GLPL +V+ AG+  K +
Sbjct  675  -YSLPFLTQEKSCQLLQKKVFQQEDCPPELQDVSLEVAKTCKGLPLVVVLAAGIIKKKK  732


 Score =   111 bits (277),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +3

Query  627  LTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQ  806
            + LSY+ LP +L+ C+LY+ + P+D  I V +L+ LWIAEGFV+ I S  LEEVA GYL 
Sbjct  760  MQLSYDNLPDYLRPCLLYMGVFPEDARIPVSKLISLWIAEGFVKNIESGRLEEVAEGYLL  819

Query  807  DLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLL  932
            DL   +++ + +R +NGK+K C VHD+V  FC R++ +EK +
Sbjct  820  DLISSNVVMVSRRRYNGKVKYCNVHDVVLHFCFRKSREEKFM  861



>ref|XP_009777371.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
Length=1285

 Score =   130 bits (326),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 109/179 (61%), Gaps = 2/179 (1%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GG GKTT+AR +Y++ ++ SHFD L W  +SQ +   ++L ++ +++ +K     D ELA
Sbjct  557  GGQGKTTIARKVYDNKVIVSHFDGLAWCCISQTYSWIELLREI-HSQVSKNKVDKDDELA  615

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
              L+K L  +RYLIVLDD+W  ++W+ ++L FP+D   SRI++TTR +EV        + 
Sbjct  616  HMLKKSLMSRRYLIVLDDMWDVKAWDDLRLSFPNDENGSRIIVTTRLEEVGKQVKQHTDP  675

Query  362  LHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             ++L FL QEES  L  K     +  P EL+ +  +V   C GLPL +V+ AG+  K +
Sbjct  676  -YSLPFLTQEESCQLLQKKVFQQEDCPPELQDVSLEVAKTCKGLPLVVVLAAGIIKKKK  733


 Score =   112 bits (281),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +3

Query  627  LTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQ  806
            + LSY+ LP +L+ C+LY+ + P+D  I V +L+ LWIAEGFV+ I S  LEEVA GYL 
Sbjct  761  MQLSYDNLPDYLRPCLLYMGVFPEDARIPVSKLISLWIAEGFVKNIESGRLEEVAEGYLL  820

Query  807  DLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLL  932
            DL   ++I + +R +NGK+K C+VHD+V  FC R++ +EK +
Sbjct  821  DLISSNVIMVSRRRYNGKVKYCKVHDVVLHFCFRKSREEKFM  862



>ref|XP_009588709.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=1284

 Score =   131 bits (330),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 111/179 (62%), Gaps = 2/179 (1%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELA  181
            GG GKTT+AR +Y++ ++ SHFD L W  +SQ ++   +L ++ +++ +K     D ELA
Sbjct  556  GGQGKTTIARKVYDNKMIVSHFDGLAWCCISQTYNWIDLLREI-HSQVSKNKVDKDDELA  614

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
              L+K L G+RYLIVLDD+W  ++W+ ++L FP+D   SRI++TTR +EV+       + 
Sbjct  615  HMLKKSLMGRRYLIVLDDMWDVKAWDDLRLSFPNDENGSRIIVTTRLEEVSKQVKQHTDP  674

Query  362  LHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             ++L FL QE+S  L  K     +  P EL+ +  +V   C GLPL +V+ AG+  K +
Sbjct  675  -YSLPFLTQEKSCQLLQKKVFQQEDCPPELQDVSLEVAKTCKGLPLVVVLAAGIIKKKK  732


 Score =   111 bits (277),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +3

Query  627  LTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQ  806
            + LSY+ LP +L+ C+LY+ + P+D  I V +L+ LWIAEGFV+ I S  LEEVA GYL 
Sbjct  760  MQLSYDNLPDYLRPCLLYMGVFPEDARIPVSKLISLWIAEGFVKNIESGRLEEVAEGYLL  819

Query  807  DLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLL  932
            DL   +++ + +R +NGK+K C VHD+V  FC R++ +EK +
Sbjct  820  DLISSNVVMVSRRRYNGKVKYCNVHDVVLHFCFRKSREEKFM  861



>emb|CDP21692.1| unnamed protein product [Coffea canephora]
Length=948

 Score =   121 bits (304),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 88/139 (63%), Gaps = 2/139 (1%)
 Frame = +3

Query  537  NKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIV  716
            N   + W+   K   S +V  D  E C + L LSY+YLP  LK+C+LY     +D+ + +
Sbjct  747  NSAEDSWEEVAKGLTSSIVLDD--EHCMKTLELSYSYLPNDLKSCLLYFGAFQEDKNVHI  804

Query  717  KRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHE  896
            +RL+ LWI+EGF+     ++LE+VA  YL+DL DRSL+   K+  +G  K CR+HD+VHE
Sbjct  805  RRLLWLWISEGFIRKTEGKSLEDVADNYLKDLVDRSLVMASKQRTSGGAKACRLHDLVHE  864

Query  897  FCVREAIKEKLLNVDNKQH  953
            FCV++A +E  L++   Q+
Sbjct  865  FCVKKAKEENFLHILRSQN  883


 Score =   121 bits (303),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 108/184 (59%), Gaps = 5/184 (3%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN-EAAKIDE---VTDG  172
            G+GKTTLA ++Y    V  HF I  W +VSQ + +  +LV +L + E+ K+++   + + 
Sbjct  569  GLGKTTLATIIYSSSSVMLHFHIRAWCIVSQAYSMHNLLVQILGSIESGKLEQYQNMDEH  628

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            +LA KL++ L   RYL+VLDD+W  ++W  ++   PDD   SRI++T+R + V+      
Sbjct  629  DLAIKLKQVLLRNRYLLVLDDLWDAKAWNLLERLLPDDANGSRIVITSRLQNVSLQF-KP  687

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
             +++H L  L  EESW+L  K   G +  P  L  +  ++   C GLPL +V+VAG+   
Sbjct  688  DSKVHHLRHLTNEESWNLLQKKLFGQEGCPPRLSGVVSQIAKSCRGLPLTVVLVAGILAN  747

Query  533  TQQN  544
            + ++
Sbjct  748  SAED  751



>emb|CDP18680.1| unnamed protein product [Coffea canephora]
Length=1268

 Score =   124 bits (310),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 105/188 (56%), Gaps = 11/188 (6%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN-------EAAKIDEV  163
            G+GKTTLA ++Y    V  HF I  W +VSQ +    +LV +L +       +  K+DEV
Sbjct  579  GLGKTTLANIIYSSSSVMLHFHIRAWCIVSQVYSEHNLLVQILGSIGSGSPEQYQKVDEV  638

Query  164  TDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSA  343
               +LA KL++ L   RYL+VLDD+W  + W  ++   PDD   SRIL+T+R + ++   
Sbjct  639  ---DLAIKLKQVLLRNRYLLVLDDLWDAKVWNLLERLLPDDANGSRILITSRLQNLSLQF  695

Query  344  DSSGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGV  523
                +++H L  L  EESW+L  K   G Q  P  L  +  ++   C GLPL +V+VAG+
Sbjct  696  -KPDSKVHHLRRLTDEESWNLLQKKLFGKQGCPPRLSGVTSQIAKSCRGLPLTVVLVAGI  754

Query  524  FFKTQQNC  547
               T ++C
Sbjct  755  LANTTEDC  762


 Score =   118 bits (296),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 84/134 (63%), Gaps = 2/134 (1%)
 Frame = +3

Query  537  NKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIV  716
            N T + W+   K   S +V  D  E C + L LSY++LP  LK C+LY     +DE + V
Sbjct  757  NTTEDCWEEVAKSLPSSIVLDD--EYCIKTLELSYSHLPDDLKPCLLYFGAFKEDENVPV  814

Query  717  KRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHE  896
            +RL  LWI+EGFV     + LE+VA  YL+DL DRSL+ + K+   G  K CR+HD+VHE
Sbjct  815  RRLSWLWISEGFVRKTEGKGLEDVADNYLKDLIDRSLVMVSKQRTIGGAKACRLHDLVHE  874

Query  897  FCVREAIKEKLLNV  938
            FCV++A +E  L+V
Sbjct  875  FCVKKAKEENFLHV  888



>emb|CDP19488.1| unnamed protein product [Coffea canephora]
Length=1135

 Score =   125 bits (315),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 102/186 (55%), Gaps = 8/186 (4%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLL----NNEAAKIDEVTD  169
             G+GKTTLA  +  DPL+ SHF IL   +VSQ + +  +LV LL    +    +  E+ +
Sbjct  483  AGLGKTTLANRVCNDPLILSHFHILARCIVSQVYSMHSLLVQLLCSISSRSPGEYLEMDE  542

Query  170  GELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADS  349
             +L  KL K L+  RYL+ LDD+W   +W  ++   PDD   SRIL T+R  ++    D+
Sbjct  543  NDLVPKLYKLLKRNRYLVFLDDVWEIEAWNLLERSLPDDANGSRILFTSR-IQLQFKPDT  601

Query  350  SGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFF  529
                 H L  L  EESW L  K   G +  P  L  +G ++ + C GLPL +V+VAG+  
Sbjct  602  KA---HHLRHLTDEESWKLLQKKVFGKEGFPPTLGKVGSQIANLCRGLPLTVVLVAGILS  658

Query  530  KTQQNC  547
             T ++C
Sbjct  659  NTMEDC  664


 Score =   116 bits (290),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 88/136 (65%), Gaps = 3/136 (2%)
 Frame = +3

Query  534  LNKTVEE-WQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAI  710
            L+ T+E+ W+   +  NS +V  D  E C + L LSY++L   LK C+LY     +DE I
Sbjct  657  LSNTMEDCWEEVAQSLNSSIVLDD--EYCMKTLDLSYSHLLDDLKPCLLYFGAFKEDEYI  714

Query  711  IVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIV  890
             V+RL  LWI+EGFV     ++LE+VA  YL+DL DRSL+ + ++   G  K CR+HD+V
Sbjct  715  SVRRLSWLWISEGFVRKTEEKSLEDVADDYLKDLVDRSLVMVSEQRTMGGAKACRLHDLV  774

Query  891  HEFCVREAIKEKLLNV  938
            HEFCV++A +E  L+V
Sbjct  775  HEFCVKKAKEENFLHV  790



>gb|ABO92985.1| putative disease resistance protein [Solanum tuberosum]
Length=1264

 Score =   142 bits (357),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 111/183 (61%), Gaps = 4/183 (2%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN---EAAKIDEVTDGE  175
            G+GKTTLA  LY D  V S FD      VSQ +  + +L+ LL +   E ++  E+ D E
Sbjct  543  GLGKTTLANRLYSDRSVVSQFDFCAQCCVSQVYSCKDLLLSLLRDAIGEESERRELPDNE  602

Query  176  LAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSG  355
            LA  L+K L  +RYLI++DD+W   +W+ ++ CFPD N RSRI+LTTRH EVA  A    
Sbjct  603  LADMLRKTLLPRRYLILVDDVWDNSAWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVRS  662

Query  356  NRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKT  535
            + LH L   ++ ESW L  K   G QS P  L+ IG ++   C  LPL+IV+VAG+  + 
Sbjct  663  DPLH-LRMFDEVESWKLLEKKVFGEQSCPPLLKNIGLRIAKMCGQLPLSIVLVAGILSEM  721

Query  536  QQN  544
            +++
Sbjct  722  EKD  724


 Score = 99.8 bits (247),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 86/149 (58%), Gaps = 9/149 (6%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             S++ K VE W   E+  N+L   + +      I+  SY+ LP HLK+C LY     +D 
Sbjct  718  LSEMEKDVECW---EQVANNL--GSHIHNDSRAIVDQSYHVLPCHLKSCFLYFGAFLEDR  772

Query  705  AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHF-NGKIKTCRVH  881
             I + RL+RLWI+E F++     +LE++A GYL++L  R+L+ + +R   +GK+K CR+H
Sbjct  773  VIDISRLIRLWISEAFIKSSEGRSLEDIAEGYLENLIGRNLVMVTQRAISDGKVKACRLH  832

Query  882  DIVHEFCVREAIKEKLL---NVDNKQHPS  959
            D++ +FC   A +E  L   N D    PS
Sbjct  833  DVLLDFCKERAAEENFLLWINRDQITKPS  861



>emb|CDP15593.1| unnamed protein product [Coffea canephora]
Length=1711

 Score =   131 bits (329),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 108/178 (61%), Gaps = 11/178 (6%)
 Frame = +2

Query  5     GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLN--NEAAKIDEVTDGEL  178
             G+GKT LA+ +Y DP ++SHF IL W  +SQ +  + +L+ +L   +  A+  E+ + +L
Sbjct  985   GLGKTFLAQRVYHDPSIASHFHILAWCCISQVYCKKDLLLGILGCIDPKAQYSEMDEDDL  1044

Query  179   AGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGN  358
             A KL   LR ++YLIVLDD+W   +W  +++ FPD    SRI+LT+RH  +         
Sbjct  1045  AHKLCNHLRKQKYLIVLDDVWDIEAWNALKISFPDYANGSRIILTSRHHGIT-------G  1097

Query  359   RLHTLGFLNQEESWDLFCK--SFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
             + H L  L++EESW+L  K  S       P EL  +GR++   C+GLPL+IV+++G+ 
Sbjct  1098  KPHHLRALDEEESWELLKKKLSITIEGGYPVELSVLGRQIAKNCNGLPLSIVIISGIL  1155


 Score =   110 bits (275),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = +3

Query  606   SEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENLEE  785
             +EQC  IL LSY +LP HLK C+LY S   +D+ I VK+L+ LWIAEGF++   SE+LE+
Sbjct  1179  TEQCKSILELSYIHLPDHLKPCLLYFSAFREDQEISVKKLIWLWIAEGFLQKKESESLEK  1238

Query  786   VAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLLNV  938
             +A GYL DL +RSL+   ++   G +KTC +HD++H FC+ +A  +  L++
Sbjct  1239  LAEGYLIDLINRSLVMEGQKRSIGGVKTCHIHDLLHVFCLGKAKDQNFLHL  1289



>sp|Q60CZ8.1|R1A10_SOLDE RecName: Full=Putative late blight resistance protein homolog 
R1A-10 [Solanum demissum]
 sp|Q6L438.2|R1A6_SOLDE RecName: Full=Putative late blight resistance protein homolog 
R1A-6 [Solanum demissum]
 gb|AAU93589.1| Putative late blight resistance protein, identical [Solanum demissum]
 gb|AAT39944.2| Putative late blight resistance protein, identical [Solanum demissum]
Length=1306

 Score =   142 bits (357),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 111/183 (61%), Gaps = 4/183 (2%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN---EAAKIDEVTDGE  175
            G+GKTTLA  LY D  V S FD      VSQ +  + +L+ LL +   E ++  E+ D E
Sbjct  557  GLGKTTLANRLYSDRSVVSQFDFCAQCCVSQVYSCKDLLLSLLRDAIGEESERRELPDNE  616

Query  176  LAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSG  355
            LA  L+K L  +RYLI++DD+W   +W+ ++ CFPD N RSRI+LTTRH EVA  A    
Sbjct  617  LADMLRKTLLPRRYLILVDDVWDNSAWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVRS  676

Query  356  NRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKT  535
            + LH L   ++ ESW L  K   G QS P  L+ IG ++   C  LPL+IV+VAG+  + 
Sbjct  677  DPLH-LRMFDEVESWKLLEKKVFGEQSCPPLLKNIGLRIAKMCGQLPLSIVLVAGILSEM  735

Query  536  QQN  544
            +++
Sbjct  736  EKD  738


 Score = 99.8 bits (247),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 86/149 (58%), Gaps = 9/149 (6%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             S++ K VE W   E+  N+L   + +      I+  SY+ LP HLK+C LY     +D 
Sbjct  732  LSEMEKDVECW---EQVANNL--GSHIHNDSRAIVDQSYHVLPCHLKSCFLYFGAFLEDR  786

Query  705  AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHF-NGKIKTCRVH  881
             I + RL+RLWI+E F++     +LE++A GYL++L  R+L+ + +R   +GK+K CR+H
Sbjct  787  VIDISRLIRLWISEAFIKSSEGRSLEDIAEGYLENLIGRNLVMVTQRAISDGKVKACRLH  846

Query  882  DIVHEFCVREAIKEKLL---NVDNKQHPS  959
            D++ +FC   A +E  L   N D    PS
Sbjct  847  DVLLDFCKERAAEENFLLWINRDQITKPS  875



>gb|ABO93000.1| putative disease resistance protein [Solanum tuberosum]
Length=1305

 Score =   142 bits (357),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 111/183 (61%), Gaps = 4/183 (2%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN---EAAKIDEVTDGE  175
            G+GKTTLA  LY D  V S FD      VSQ +  + +L+ LL +   E ++  E+ D E
Sbjct  557  GLGKTTLANRLYSDRSVVSQFDFCAQCCVSQVYSCKDLLLSLLRDAIGEESERRELPDNE  616

Query  176  LAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSG  355
            LA  L+K L  +RYLI++DD+W   +W+ ++ CFPD N RSRI+LTTRH EVA  A    
Sbjct  617  LADMLRKTLLPRRYLILVDDVWDNSAWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVRS  676

Query  356  NRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKT  535
            + LH L   ++ ESW L  K   G QS P  L+ IG ++   C  LPL+IV+VAG+  + 
Sbjct  677  DPLH-LRMFDEVESWKLLEKKVFGEQSCPPLLKNIGLRIAKMCGQLPLSIVLVAGILSEM  735

Query  536  QQN  544
            +++
Sbjct  736  EKD  738


 Score = 99.8 bits (247),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 86/149 (58%), Gaps = 9/149 (6%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             S++ K VE W   E+  N+L   + +      I+  SY+ LP HLK+C LY     +D 
Sbjct  732  LSEMEKDVECW---EQVANNL--GSHIHNDSRAIVDQSYHVLPCHLKSCFLYFGAFLEDR  786

Query  705  AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHF-NGKIKTCRVH  881
             I + RL+RLWI+E F++     +LE++A GYL++L  R+L+ + +R   +GK+K CR+H
Sbjct  787  VIDISRLIRLWISEAFIKSSEGRSLEDIAEGYLENLIGRNLVMVTQRAISDGKVKACRLH  846

Query  882  DIVHEFCVREAIKEKLL---NVDNKQHPS  959
            D++ +FC   A +E  L   N D    PS
Sbjct  847  DVLLDFCKERAAEENFLLWINRDQITKPS  875



>emb|CDP05499.1| unnamed protein product [Coffea canephora]
Length=866

 Score =   132 bits (331),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 107/178 (60%), Gaps = 5/178 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLN---NEAAKIDEVTDG  172
             GIGKTT A+ LY D  V  HF +  WT   Q ++    L DLL    N+   + ++   
Sbjct  186  AGIGKTTFAKRLYNDSRVLHHFHVRAWTRGPQLNEEMNALHDLLTCVTNDNYSLHKMYPH  245

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQL-CFPDDNCRSRILLTTRHKEVADSADS  349
            E+  KL K L+GKRYLIV+D IW + SW+   +  FPDD+  S++L+T+R K+V     S
Sbjct  246  EMGEKLHKLLKGKRYLIVIDGIWDSLSWKLFFMKYFPDDSNGSKVLITSRTKDVVLKI-S  304

Query  350  SGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGV  523
              +    L FL+Q+ESW+LF       +S P EL  +G+++V KC GLPLAI+V+AGV
Sbjct  305  PNSSPQVLQFLSQDESWELFESKVFTDESCPQELMELGKEMVAKCRGLPLAIIVLAGV  362


 Score =   109 bits (273),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 83/149 (56%), Gaps = 9/149 (6%)
 Frame = +3

Query  528  SKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEA  707
            +K  K+ E W +       +   T   EQ   IL   Y++LP  LK C LYL   P+   
Sbjct  363  AKQEKSPEWWMHI---VTDIASPTRGKEQFMDILAFGYDHLPNWLKPCFLYLGSFPQGYE  419

Query  708  IIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDI  887
            I+VK++V  WIAEGFV+    + LEE+A  YL DL DR+LI + KR  NG IKTC+VHD+
Sbjct  420  ILVKKIVWSWIAEGFVKQNGEKRLEELAEEYLTDLVDRNLIAVSKRKSNGGIKTCQVHDL  479

Query  888  VHEFCVREAIKEKLLNVDNKQHPSCGELQ  974
            + + CV++A     L       PSCG  Q
Sbjct  480  LRDLCVKKAKDNLFL------QPSCGHKQ  502



>ref|XP_002269455.2| PREDICTED: probable disease resistance protein RF45 [Vitis vinifera]
Length=943

 Score =   133 bits (335),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 114/195 (58%), Gaps = 20/195 (10%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLL-------NNEAAKIDE  160
            GG+GKTTLA+ +Y    V  HFD   W  VSQ+   R++L+ ++       N E  ++ E
Sbjct  201  GGLGKTTLAKKVYNHSDVKQHFDCQAWVYVSQEFKPRELLLSIISSVISLSNEEKKEMRE  260

Query  161  VTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADS  340
            + + EL GKL++CL  K+YL+ +DD+WS  +W  ++   P+    S++L+TTR+KE+A  
Sbjct  261  MGEDELGGKLRECLNDKKYLVAMDDVWSIEAWSSLRSYLPESRNGSKVLMTTRNKEIAAQ  320

Query  341  ADS--------SGNRLHTLGFLNQEESWDLFCKSFPGIQ-----SLPFELETIGRKVVDK  481
            A+         S   ++ L  ++  ESW+LF K   G +     SL   LE +GRK+V K
Sbjct  321  ANPHEVVGHTDSQALVYELRIMDGNESWELFLKKTFGARDITPLSLSKALEELGRKIVAK  380

Query  482  CHGLPLAIVVVAGVF  526
            C GLPLAIVV+ G+ 
Sbjct  381  CKGLPLAIVVLGGLL  395


 Score =   107 bits (268),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 70/110 (64%), Gaps = 0/110 (0%)
 Frame = +3

Query  609  EQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENLEEV  788
            E C  IL LSYN LP +LK+C LY  I P+   I   +L+ LWIAEGFVE    E LE++
Sbjct  421  ESCFGILALSYNDLPYYLKSCFLYCGIFPEASEIKASKLIHLWIAEGFVERRGKEKLEDI  480

Query  789  AHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLLNV  938
            A  YL +L  RS++Q+ ++  NG++ +CR+HD++ +  + EA   KL  V
Sbjct  481  AEDYLYELIHRSMVQVARKKANGRVMSCRIHDLLRDLAISEARDAKLFEV  530



>ref|XP_006368520.1| hypothetical protein POPTR_0001s03710g [Populus trichocarpa]
 gb|ERP65089.1| hypothetical protein POPTR_0001s03710g [Populus trichocarpa]
Length=617

 Score =   137 bits (345),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 110/185 (59%), Gaps = 11/185 (6%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAA--------KID  157
            GG+GKTTLA+ +Y+D  V  HF +  W  VS+ + + ++L D+L    A         ++
Sbjct  195  GGLGKTTLAKQVYDDAEVKKHFSVHAWITVSRSYKMEELLKDILQQLFAADRKPVPKNLE  254

Query  158  EVTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVA-  334
                 +L   +++ L+ +RYLIVLDD+W    W+ ++   P +NC SR++LTTR+ ++A 
Sbjct  255  SQNSSQLKSIIKEVLQKRRYLIVLDDVWHVNEWDAVKYALPTNNCGSRVMLTTRNADLAF  314

Query  335  DSADSSGNRLHTLGFLNQEESWDLFC-KSFPGIQSLPFELETIGRKVVDKCHGLPLAIVV  511
             S   S  +++ L  L  EESW LFC K+F G  S P  LE I + ++ KC GLPLAIV 
Sbjct  315  TSRIESEGKVYNLEPLLPEESWTLFCRKTFRG-NSCPHHLEDICKNILRKCEGLPLAIVA  373

Query  512  VAGVF  526
            ++GV 
Sbjct  374  ISGVL  378


 Score =   103 bits (258),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 91/166 (55%), Gaps = 14/166 (8%)
 Frame = +3

Query  528   SKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEA  707
             +K  + ++EW+   +   + +   +      ++L+LS+N LP +LK+C LY+SI P+D  
Sbjct  380   AKDKRRIDEWEMVRRSLGAEIEDNNKLLNLKKVLSLSFNDLPYYLKSCFLYVSIFPEDHL  439

Query  708   IIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDI  887
             I   +L+RLW+AEGFVE    + LE+VA  Y  +L +RSL+Q+ +   +G++KTCR HD+
Sbjct  440   IEHTKLIRLWVAEGFVEAKYGKELEDVAEDYFNELLNRSLLQVAETASDGRVKTCRPHDL  499

Query  888   VHEFCVREAIKEKLLNVDNKQHPSCGELQQEGCRWLNFWPKKIPDL  1025
             + E  + ++  +    +   Q+                WP KI  L
Sbjct  500   LREIIISKSRDQNFAVIAKDQNA--------------MWPDKIRRL  531



>ref|XP_009776290.1| PREDICTED: LOW QUALITY PROTEIN: putative late blight resistance 
protein homolog R1A-3 [Nicotiana sylvestris]
Length=1176

 Score =   154 bits (390),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 117/181 (65%), Gaps = 3/181 (2%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDG--EL  178
            G+GKTTLA  +Y++ LV+ HF++  W  VS+K++  K+L D+ N      D+  +G  ++
Sbjct  510  GLGKTTLANKVYKNTLVARHFNVRAWCTVSKKYNKSKLLHDIFNQVTGSKDKPREGHNDI  569

Query  179  AGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGN  358
            A KL+K LR KRYLIVLDD+W   SWE +   FPD    SRI+LT+R  EVA       +
Sbjct  570  ADKLRKELRKKRYLIVLDDLWDIASWEELTAGFPDVMNGSRIILTSRSAEVASKVKCHTS  629

Query  359  RLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
             L+ L FL  EESW+LF K   G +  P EL  +G+K+V+KC GLPL +V++AGV  +T+
Sbjct  630  PLN-LRFLTPEESWELFEKKVFGEEKCPGELLDVGQKIVEKCQGLPLVVVLIAGVIRRTE  688

Query  539  Q  541
            +
Sbjct  689  E  689


 Score = 86.7 bits (213),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 70/118 (59%), Gaps = 2/118 (2%)
 Frame = +3

Query  609  EQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENLEEV  788
            EQ  +++ +SY++LP ++K C+LY +    ++      L+RL +AEGFV+ I S++LEE 
Sbjct  710  EQMMKVMQMSYDHLPDNVKPCLLYFAGSQNNKLTPESELIRLLMAEGFVDDIPSKSLEEA  769

Query  789  AHGYLQDLADRSLIQIQKRH--FNGKIKTCRVHDIVHEFCVREAIKEKLLNVDNKQHP  956
               YL  L   SL+ + ++   F+  I+ C VHDIVHEFC   A KE+  N  +   P
Sbjct  770  TKTYLDALISSSLVMVFEKEAVFSRIIRVCSVHDIVHEFCSITAKKERFFNFISTGTP  827



>ref|XP_006359360.1| PREDICTED: disease resistance protein RPP13-like [Solanum tuberosum]
Length=860

 Score =   144 bits (364),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 118/182 (65%), Gaps = 8/182 (4%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN--EAAK-----IDE  160
            GG+GKTTLAR LY  P ++S F    W  VSQ+++   +L  ++ +    AK     +++
Sbjct  190  GGLGKTTLARKLYTSPNIASSFLTRAWICVSQEYNTMDLLKTIIKSIQGCAKETLDLLEK  249

Query  161  VTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADS  340
            + + +L   L+K L  ++YL+V+DD+W   +WE ++  FPD    SR+++TTR ++VA+ 
Sbjct  250  MAEIDLENHLRKLLTERKYLVVVDDVWQREAWESLKRAFPDSKNGSRVIITTRKEDVAER  309

Query  341  ADSSGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAG  520
            AD  G  +H L FL Q ESWDLFC+    ++++  E+E++ + +V+KC GLPLAIVV++G
Sbjct  310  ADDRGF-VHKLRFLTQGESWDLFCRKLLDVRAMVPEMESLAKDMVEKCRGLPLAIVVLSG  368

Query  521  VF  526
            + 
Sbjct  369  LL  370


 Score = 96.7 bits (239),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 84/144 (58%), Gaps = 3/144 (2%)
 Frame = +3

Query  540  KTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVK  719
            K ++EWQ  +      ++  D S + S IL+LSYN L   LK C LY  I P+D+ +   
Sbjct  374  KGLDEWQKVKDHLWKNIIE-DKSIEISNILSLSYNDLSTPLKQCFLYFGIFPEDQVLEAD  432

Query  720  RLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEF  899
             ++RLW+AEGF+     E +E+VA G+L  L  RSL+Q+ K  F  K+  CRVHD++H+ 
Sbjct  433  NIIRLWMAEGFIPR-GEERMEDVAEGFLNQLIRRSLVQVTKT-FWEKVTECRVHDLLHDL  490

Query  900  CVREAIKEKLLNVDNKQHPSCGEL  971
             +++A++    +V + +  S   L
Sbjct  491  AIQKALEVNFFDVYDPRSHSISSL  514



>ref|XP_009612837.1| PREDICTED: putative late blight resistance protein homolog R1A-10, 
partial [Nicotiana tomentosiformis]
Length=845

 Score =   144 bits (364),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 113/181 (62%), Gaps = 2/181 (1%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAA-KIDEVTDGELA  181
            G+GKTTLA+ +++D  + SHFDI  W  +SQ +DVR++L ++    A  K +   + ++A
Sbjct  55   GLGKTTLAKKIFKDSSIVSHFDIRAWLTISQSYDVRELLRNIYKQVAGVKYNGDKESDIA  114

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
              L+KCL GKRYLIVLDD+W   +W+ ++LCFP     SRI+LTTR K VA    +  + 
Sbjct  115  DMLRKCLMGKRYLIVLDDVWEVEAWDELRLCFPIGKQGSRIMLTTRLKHVAMEVKNCTDP  174

Query  362  LHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQQ  541
             ++  FL +E SW L  K     ++ P E + +G ++ + C GLPL +V++ G+  K ++
Sbjct  175  -YSPRFLTREASWKLLEKKAFQKETCPPEFQDVGVQIAEYCKGLPLTVVLIGGILAKKER  233

Query  542  N  544
            N
Sbjct  234  N  234


 Score = 96.7 bits (239),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 86/155 (55%), Gaps = 13/155 (8%)
 Frame = +3

Query  525  FSKLNKTVEEW----QNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIV  692
             +K  + V EW     N +    ++   ++L+ Q      LSY YLP HLK C+L + + 
Sbjct  228  LAKKERNVSEWCEVANNLKSHLGAVESESNLAIQ------LSYCYLPDHLKHCLLTMGVF  281

Query  693  PKDEAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTC  872
             +DE     +L+ LW+AEG ++  +   LEEVA GYL D+   SL+ + K  F+GK+K  
Sbjct  282  REDEKFGASKLMLLWMAEGLIQCSDERGLEEVAEGYLIDIISSSLLMVSKTTFDGKVKYL  341

Query  873  RVHDIVHEFCVREAIKEKLLNV---DNKQHPSCGE  968
            ++HD+V +F + +A +EK + V    N+  PS  E
Sbjct  342  QIHDLVRDFVLNKAKEEKFMQVIGTHNQYQPSYDE  376



>ref|XP_009614428.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
 ref|XP_009614429.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
 ref|XP_009614430.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=1164

 Score =   133 bits (335),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 108/180 (60%), Gaps = 2/180 (1%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDGELAG  184
            G+GKTTLA+ +Y D  +  HFD+     +SQ +D RK+L+++LN +     +  + +   
Sbjct  507  GLGKTTLAKKVYHDETIRHHFDVHAMCCLSQTYDRRKLLLEILN-QVRGPSQQNEKDPVV  565

Query  185  KLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNRL  364
             L++ L GKRYL+ +DD+WS  +WE  Q CFP +   SRILLT+R  +VA   + +   L
Sbjct  566  ALRRFLMGKRYLLYIDDVWSINAWEEFQGCFPVNENGSRILLTSRLSDVASDINPARPPL  625

Query  365  HTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQQN  544
              L FL+ EESW+L         + P EL  +G ++  +C GLPL +++VAGV  K ++N
Sbjct  626  Q-LRFLSTEESWELLQIKLFNKPTCPSELCEVGEEIARECQGLPLLVILVAGVLTKKEKN  684


 Score =   107 bits (268),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 84/143 (59%), Gaps = 3/143 (2%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             +K  K  E W+   +  NS    TD+SE+C  I+ LSY +LP HLK C+LY +   +DE
Sbjct  678  LTKKEKNKENWRKIAESINS---DTDISEKCLDIIELSYRHLPDHLKPCLLYFASFREDE  734

Query  705  AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHD  884
             I +  L  LW  EGF+     +++E VA   L DL  RSL+ + K+   G +++C +HD
Sbjct  735  EIPISNLAWLWTIEGFIPNREKKSVELVAESLLNDLIGRSLVMVNKKRSTGGVRSCHIHD  794

Query  885  IVHEFCVREAIKEKLLNVDNKQH  953
            ++H+FC  +A +EK + + + ++
Sbjct  795  MLHDFCATKAKEEKFMQITSTEN  817



>ref|XP_004512078.1| PREDICTED: disease resistance RPP8-like protein 3-like [Cicer 
arietinum]
Length=903

 Score =   143 bits (360),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 112/180 (62%), Gaps = 6/180 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAA----KIDEVTD  169
            GG+GKTTLA+ LY D  +++HF+   W  VS+++  + +L  +L    A    ++D++ +
Sbjct  186  GGLGKTTLAKKLYNDSRIANHFECKAWVYVSEEYRRKDVLQGILRGVDALGRDEMDKLPE  245

Query  170  GELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADS  349
             EL  KL   L  KRYL+VLDD+W+   W+G++  FP     S+ILLTTR  EVA  AD 
Sbjct  246  EELVNKLHNVLAEKRYLVVLDDVWAMEVWDGLKYAFPRRKLGSKILLTTRIWEVALHADG  305

Query  350  SGNRLHTLGFLNQEESWDLF-CKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
              +  H +  LNQ+ES+ L   K+FPG   +P E E + +++V KC GLPLA+VVV G+ 
Sbjct  306  HSHP-HQIRPLNQDESFALLRSKAFPGANVIPSEFENLAKEIVVKCEGLPLAVVVVGGLL  364


 Score = 97.8 bits (242),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = +3

Query  609  EQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENLEEV  788
            E+ +RIL LSYN LP  LK+C LYL + PK   I  K+L+RLW+AEGF+     E  E+V
Sbjct  390  EKITRILALSYNDLPSALKSCFLYLGLFPKGMNIQTKKLIRLWVAEGFLPQEGGETAEDV  449

Query  789  AHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKE  923
            A  YL +L  R +IQ+      G++KT R+HD++ E  V +A +E
Sbjct  450  AQRYLNELIGRCMIQVGMVSSLGRVKTIRIHDLLRELSVYKAKEE  494



>ref|NP_001289831.1| putative late blight resistance protein homolog R1A-3 [Solanum 
lycopersicum]
 gb|AFN86172.1| reistance protein F [Solanum lycopersicum]
Length=1275

 Score =   145 bits (365),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 113/180 (63%), Gaps = 2/180 (1%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDE-VTDGEL  178
            GG GKTT+AR +Y    + SHFD+  W +VSQ ++ RK+L D+L+      D+   D  L
Sbjct  585  GGQGKTTVARKVYNSDNIVSHFDVRAWCIVSQTYNRRKLLQDILSQVTGSKDKGYEDDIL  644

Query  179  AGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGN  358
            A +L+K L GKRYLIVLDD+W   +W+ ++L FPD   RSRI++TTR ++V +      +
Sbjct  645  ADELRKSLMGKRYLIVLDDMWDCMAWDDLRLSFPDSGNRSRIVVTTRLEKVGEQVKCHTD  704

Query  359  RLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
              ++L FL +EES +L  K     +  P EL+ + R V +KC GLPL +V+VAG+  K +
Sbjct  705  P-YSLPFLTKEESCELLQKKVFQKEDFPPELQDVSRAVAEKCKGLPLVVVLVAGIIKKRK  763


 Score = 95.9 bits (237),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 77/136 (57%), Gaps = 2/136 (1%)
 Frame = +3

Query  531  KLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAI  710
            K  K  E W N  K +    +  +  E     + LSY  L   LK C+LY+ +  +D  I
Sbjct  760  KKRKMEESWWNEVKDSLFDHLNRESEEYSLSTMQLSYYNLTDCLKPCLLYMGMFQEDAII  819

Query  711  IVKRLVRLWIAEGFVELINSENL--EEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHD  884
             V  L+ LWIAEGFV+ I S  L  EE A GYL DL   +++ +  R +NGK+K C+VHD
Sbjct  820  RVSELISLWIAEGFVQSIESGRLLMEEAAEGYLMDLIQSNVVMVSNRRYNGKVKYCQVHD  879

Query  885  IVHEFCVREAIKEKLL  932
            +V  FC+ ++++EK +
Sbjct  880  VVLHFCLEKSLEEKFM  895



>ref|XP_004248007.2| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=1278

 Score =   145 bits (365),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 113/180 (63%), Gaps = 2/180 (1%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDE-VTDGEL  178
            GG GKTT+AR +Y    + SHFD+  W +VSQ ++ RK+L D+L+      D+   D  L
Sbjct  588  GGQGKTTVARKVYNSDNIVSHFDVRAWCIVSQTYNRRKLLQDILSQVTGSKDKGYEDDIL  647

Query  179  AGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGN  358
            A +L+K L GKRYLIVLDD+W   +W+ ++L FPD   RSRI++TTR ++V +      +
Sbjct  648  ADELRKSLMGKRYLIVLDDMWDCMAWDDLRLSFPDSGNRSRIVVTTRLEKVGEQVKCHTD  707

Query  359  RLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
              ++L FL +EES +L  K     +  P EL+ + R V +KC GLPL +V+VAG+  K +
Sbjct  708  P-YSLPFLTKEESCELLQKKVFQKEDFPPELQDVSRAVAEKCKGLPLVVVLVAGIIKKRK  766


 Score = 95.9 bits (237),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 77/136 (57%), Gaps = 2/136 (1%)
 Frame = +3

Query  531  KLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAI  710
            K  K  E W N  K +    +  +  E     + LSY  L   LK C+LY+ +  +D  I
Sbjct  763  KKRKMEESWWNEVKDSLFDHLNRESEEYSLSTMQLSYYNLTDCLKPCLLYMGMFQEDAII  822

Query  711  IVKRLVRLWIAEGFVELINSENL--EEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHD  884
             V  L+ LWIAEGFV+ I S  L  EE A GYL DL   +++ +  R +NGK+K C+VHD
Sbjct  823  RVSELISLWIAEGFVQSIESGRLLMEEAAEGYLMDLIQSNVVMVSNRRYNGKVKYCQVHD  882

Query  885  IVHEFCVREAIKEKLL  932
            +V  FC+ ++++EK +
Sbjct  883  VVLHFCLEKSLEEKFM  898



>gb|AHG28977.1| NBS-LRR protein [Cicer arietinum]
Length=959

 Score =   142 bits (359),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 112/180 (62%), Gaps = 6/180 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAA----KIDEVTD  169
            GG+GKTTLA+ LY D  +++HF+   W  VS+++  + +L  +L    A    ++D++ +
Sbjct  186  GGLGKTTLAKKLYNDSRIANHFECKAWVYVSEEYRRKDVLQGILRGVDALGRDEMDKLPE  245

Query  170  GELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADS  349
             EL  KL   L  KRYL+VLDD+W+   W+G++  FP     S+ILLTTR  EVA  AD 
Sbjct  246  EELVNKLHNVLAEKRYLVVLDDVWAMEVWDGLKYAFPRRKLGSKILLTTRIWEVALHADG  305

Query  350  SGNRLHTLGFLNQEESWDLF-CKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
              +  H +  LNQ+ES+ L   K+FPG   +P E E + +++V KC GLPLA+VVV G+ 
Sbjct  306  HSHP-HQIRPLNQDESFALLRSKAFPGANVIPSEFENLAKEIVVKCEGLPLAVVVVGGLL  364


 Score = 97.8 bits (242),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = +3

Query  609  EQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENLEEV  788
            E+ +RIL LSYN LP  LK+C LYL + PK   I  K+L+RLW+AEGF+     E  E+V
Sbjct  390  EKITRILALSYNDLPSALKSCFLYLGLFPKGMNIQTKKLIRLWVAEGFLPQEGGETAEDV  449

Query  789  AHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKE  923
            A  YL +L  R +IQ+      G++KT R+HD++ E  V +A +E
Sbjct  450  AQRYLNELIGRCMIQVGMVSSLGRVKTIRIHDLLRELSVYKAKEE  494



>ref|XP_006347944.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006347945.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006347946.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X3 [Solanum tuberosum]
Length=703

 Score =   127 bits (320),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 107/178 (60%), Gaps = 7/178 (4%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN---EAAKIDEVTDGE  175
            G+GKTTLA  +++ P +   F   +W  VSQ +  R++ +++++          ++++ +
Sbjct  3    GLGKTTLATKIFKHPKIEYEFFTRLWLYVSQSYKTRELYLNIISKFTGNTKNCRDMSETD  62

Query  176  LAGKLQKCL-RGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            LA K+++ L  G +YLIVLDD+WST +W+ I++ FP ++  +R+LLTTR  +VA   + S
Sbjct  63   LAHKVREILDEGGKYLIVLDDVWSTDAWDRIKIAFPKNDKGNRVLLTTRDHKVAKHCNRS  122

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
                H L FL  EESW L  K        P ELET G+ +  KC GLPLAIVV+AG  
Sbjct  123  P---HDLKFLTDEESWILLEKRAFHKAKCPPELETNGKSIARKCKGLPLAIVVIAGAL  177


 Score =   113 bits (282),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 83/132 (63%), Gaps = 0/132 (0%)
 Frame = +3

Query  537  NKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIV  716
             KT++EW+  ++      +  D    C++++ +SY+ LP   KAC LY    P+   I  
Sbjct  181  GKTIKEWEQVDQSVGEYFINRDQPNNCNKLVRMSYDVLPYDWKACFLYFGTFPRGYLIPA  240

Query  717  KRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHE  896
            ++L+RLWIAEGF++   + +LE  A  YL +L +R+L+ + +R  + +IKTCRVHD+++E
Sbjct  241  RKLIRLWIAEGFIQYEGNLSLECKAEEYLNELVNRNLVMVMQRTLDRQIKTCRVHDMLYE  300

Query  897  FCVREAIKEKLL  932
            FC +EA  E+ L
Sbjct  301  FCWQEATTEENL  312



>ref|XP_009613225.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
tomentosiformis]
Length=579

 Score =   139 bits (349),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 111/183 (61%), Gaps = 4/183 (2%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKID-EVTDGEL  178
            GGIGKTTLARMLY +   S+HFD+ VW  VS+ ++VR++L+++L          + D  +
Sbjct  61   GGIGKTTLARMLYNNH--STHFDVQVWCTVSETYNVRELLLEMLKQIMGDTHVTINDYSI  118

Query  179  AGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGN  358
               L K LR K+YLIVLDDIW  + WE ++L FPD    SRI+LTTR  EVA       +
Sbjct  119  VDVLSKILRTKKYLIVLDDIWEVKVWEELRLSFPDGGNGSRIMLTTRSAEVAMELKHHSD  178

Query  359  RLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
              + L  L+ ++SW+L  K     +S P EL+++G ++     GLPLA+ V+AG+  + +
Sbjct  179  P-YFLSCLSDKQSWELLQKKVFQGESCPPELQSVGAEIATLTKGLPLAVTVIAGILSQME  237

Query  539  QNC  547
            +  
Sbjct  238  RQA  240


 Score =   102 bits (253),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 71/112 (63%), Gaps = 0/112 (0%)
 Frame = +3

Query  597  TDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSEN  776
            + L +Q   ++ LSY++L  HLK C+LY+ + PK   I V  L++ WIAE FV+ I++  
Sbjct  253  SSLEQQLMGVMQLSYDHLEDHLKPCLLYMGLFPKRYEIPVSDLLKWWIAEEFVQNIDTLK  312

Query  777  LEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLL  932
            LEE +   L DL  RSL+ + KR  NG+IK C VHD V EFC+ +  KEK +
Sbjct  313  LEETSRSCLYDLVSRSLVMVSKRRTNGEIKYCTVHDQVREFCMEKITKEKFM  364



>ref|XP_009598609.1| PREDICTED: putative late blight resistance protein homolog R1A-10, 
partial [Nicotiana tomentosiformis]
Length=610

 Score =   144 bits (364),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 113/181 (62%), Gaps = 2/181 (1%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAA-KIDEVTDGELA  181
            G+GKTTLA+ +++D  + SHFDI  W  +SQ +DVR++L ++    A  K +   + ++A
Sbjct  55   GLGKTTLAKKIFKDSSIVSHFDIRAWLTISQSYDVRELLRNIYKQVAGVKYNGDKESDIA  114

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
              L+KCL GKRYLIVLDD+W   +W+ ++LCFP     SRI+LTTR K VA    +  + 
Sbjct  115  DMLRKCLMGKRYLIVLDDVWEVEAWDELRLCFPIGKQGSRIMLTTRLKHVAMEVKNCTDP  174

Query  362  LHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQQ  541
             ++  FL +E SW L  K     ++ P E + +G ++ + C GLPL +V++ G+  K ++
Sbjct  175  -YSPRFLTREASWKLLEKKAFQKETCPPEFQDVGVQIAEYCKGLPLTVVLIGGILAKKER  233

Query  542  N  544
            N
Sbjct  234  N  234


 Score = 96.3 bits (238),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 86/155 (55%), Gaps = 13/155 (8%)
 Frame = +3

Query  525  FSKLNKTVEEW----QNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIV  692
             +K  + V EW     N +    ++   ++L+ Q      LSY YLP HL+ C+L + + 
Sbjct  228  LAKKERNVSEWCEVANNLKSHFGAVESESNLAIQ------LSYCYLPDHLRRCLLTMGVF  281

Query  693  PKDEAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTC  872
             +DE     +L+ LW+AEG V+  +   LEEVA GYL D+   SL+ + K  F+GK+K  
Sbjct  282  REDEKFGASKLMLLWMAEGLVQCSDERGLEEVAEGYLIDIISSSLLMVSKTTFDGKVKYL  341

Query  873  RVHDIVHEFCVREAIKEKLLNV---DNKQHPSCGE  968
            ++HD+V +F + +A +EK + V    N+  PS  E
Sbjct  342  QIHDLVRDFVLNKAKEEKFMQVIGTHNQYQPSYDE  376



>emb|CDP20153.1| unnamed protein product [Coffea canephora]
Length=1449

 Score =   137 bits (344),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 113/180 (63%), Gaps = 4/180 (2%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN---EAAKIDEVTDGE  175
            G+GKTTLA+ +Y DP ++ HF I  W  +SQ +  R++L+++L++       + E+++ +
Sbjct  750  GLGKTTLAKKVYNDPSITYHFHIRAWCYISQVYRKRELLLNILSDIMELTNDVLELSEDD  809

Query  176  LAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSG  355
            L  KL +CL+ ++YLIVLDD+WS  +W  ++   PDD   SRIL+T+R  +VA +   S 
Sbjct  810  LEFKLYQCLKNRKYLIVLDDLWSREAWNDLEFSLPDDKNGSRILITSRLTDVALTT-KSD  868

Query  356  NRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKT  535
            +  H+L   + +ESW+L  K     +  P EL  +G+K+   C GLPLA+V ++G+  +T
Sbjct  869  SIAHSLRLFSDDESWNLLQKKLFNRKDCPDELVNLGKKIARGCKGLPLAVVAISGLLQRT  928


 Score =   103 bits (257),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 71/119 (60%), Gaps = 0/119 (0%)
 Frame = +3

Query  549   EEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLV  728
             ++W     +T S  +  D   +C  IL LSY++LP +LK C LYL    KD  I V +L 
Sbjct  932   QDWWETVARTLSSCIADDPETRCMDILELSYSHLPTYLKPCFLYLGAFLKDREIPVSKLT  991

Query  729   RLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCV  905
             RLWIAEGFV+    ++LE +A  YL DL  RSL+   KR  NG +KTC VHD++   C+
Sbjct  992   RLWIAEGFVQNPELDSLEHLAEKYLNDLIGRSLVIASKRKSNGGVKTCCVHDMLRALCL  1050



>gb|AAF76312.1|AF220603_4 Prf [Solanum lycopersicum]
Length=1825

 Score =   139 bits (349),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 112/176 (64%), Gaps = 3/176 (2%)
 Frame = +2

Query  5     GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN--EAAKIDEVTDGEL  178
             G+GKTTLA+ +Y DP V+S FD+    VV+Q +  R++L+ +LN+  E +  +E  DGE+
Sbjct  1126  GLGKTTLAKKIYNDPEVTSRFDVHAQCVVTQLYSWRELLLTILNDVLEPSDRNEKEDGEI  1185

Query  179   AGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGN  358
             A +L++ L  KR+LI++DD+W  + W+ + +CF D + RSRI+LTTR  +VA+      +
Sbjct  1186  ADELRRFLLTKRFLILIDDVWDYKVWDNLCMCFSDVSNRSRIILTTRLNDVAEYVKCESD  1245

Query  359   RLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
               H L     +ESW L  K     +S P ELE +G ++   C GLPL++V+VAGV 
Sbjct  1246  P-HHLRLFRDDESWTLLQKEVFQGESCPPELEDVGFEISKSCRGLPLSVVLVAGVL  1300


 Score =   101 bits (252),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 81/131 (62%), Gaps = 2/131 (2%)
 Frame = +3

Query  540   KTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVK  719
             KT++ W+  E+  +S  + + L E  S I+  SY  LP +LK C LY     + + I V 
Sbjct  1305  KTLDSWKVVEQSLSSQRIGS-LEESIS-IIGFSYKNLPHYLKPCFLYFGGFLQGKDIHVS  1362

Query  720   RLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEF  899
             ++ +LW+AEGFV+  N +  E+ A G+L DL  R+L+   ++  N K+KTCR+HD++H+F
Sbjct  1363  KMTKLWVAEGFVQANNEKGQEDTAQGFLDDLIGRNLVMAMEKRPNAKVKTCRIHDLLHKF  1422

Query  900   CVREAIKEKLL  932
             C+ +A +E  L
Sbjct  1423  CMEKAKQEDFL  1433



>gb|ADL59395.1| EDNR2GH5 protein [Solanum x edinense]
Length=841

 Score =   153 bits (386),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 122/182 (67%), Gaps = 8/182 (4%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAK-------IDE  160
            GG+GKTTLAR LY++P ++S F    W  VSQ+++   +L  ++ +   +       ++ 
Sbjct  191  GGLGKTTLARNLYKNPNIASSFSTRAWICVSQEYNTMDLLKTIIKSIQGRTKGTLGLLET  250

Query  161  VTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADS  340
            +T+G+L   L+  L+ ++YL+V+DD+W   +WE ++  FPD    SR+++TTR ++VA+ 
Sbjct  251  MTEGDLEVHLRDLLKERKYLVVVDDVWQREAWESLKRAFPDSKNGSRVIITTRKEDVAER  310

Query  341  ADSSGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAG  520
            AD+ G  +H L FL+QEESWDLFC+    ++++   +E++ + +V+KC GLPLAIVV++G
Sbjct  311  ADNRG-FVHKLRFLSQEESWDLFCRKLVDVRAMVPAMESLAKDMVEKCRGLPLAIVVLSG  369

Query  521  VF  526
            + 
Sbjct  370  LL  371


 Score = 87.0 bits (214),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (58%), Gaps = 6/137 (4%)
 Frame = +3

Query  546  VEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRL  725
            +++WQ  + Q    ++     E  S IL+LSYN L   LK C LY  I P+D+ +  + +
Sbjct  377  LDKWQEVKDQLWKNIIEDKFIE-ISCILSLSYNDLSTVLKQCFLYFGIFPEDQVLEAENI  435

Query  726  VRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCV  905
            +RLWIAEGFV     E +E+VA G+L +L  RSL+Q+    F  K+  CRVHD++ +  +
Sbjct  436  IRLWIAEGFVP-NGEERMEDVAEGFLNELIRRSLVQVVDT-FWEKVTQCRVHDLLRDLAI  493

Query  906  REAIKEKLLNVDNKQHP  956
            ++A    L ++    HP
Sbjct  494  QKASDTNLFDI---YHP  507



>gb|KEH21734.1| disease resistance protein (CC-NBS-LRR class) family protein 
[Medicago truncatula]
Length=938

 Score =   129 bits (325),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 107/188 (57%), Gaps = 14/188 (7%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLL--------NNEAAKID  157
            GG+GKTTLA+ +Y    +  HF+   W  +SQK + R++   +L          E  +I 
Sbjct  189  GGLGKTTLAKNVYHYSSIRRHFEGFAWAYISQKCNRREVWEGILLQLTASSSKEERDEIR  248

Query  158  EVTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVAD  337
             + D ELA KL K  + K  LIVLDDIWS  +W+ +   FP  N +S+++ T+R+K V+ 
Sbjct  249  NMRDEELAKKLYKVQQEKMCLIVLDDIWSNETWDILSPAFPSKNAKSKMVFTSRNKGVSS  308

Query  338  SADSSGNRLHTLGFLNQEESWDLFC-KSFPGIQSLPF----ELETIGRKVVDKCHGLPLA  502
              DS G  +H  GFLN E+SW LF  K+F       F    E E +GR +V KC GLPLA
Sbjct  309  HVDSKG-LVHEPGFLNAEDSWSLFQKKAFSTSDDPEFKICNEFERLGRDMVAKCAGLPLA  367

Query  503  IVVVAGVF  526
            I+V+ G+ 
Sbjct  368  IIVLGGLL  375


 Score =   110 bits (275),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 86/140 (61%), Gaps = 7/140 (5%)
 Frame = +3

Query  540  KTVEEWQNFEKQTNSLVVTTDLSEQCSR---ILTLSYNYLPLHLKACILYLSIVPKDEAI  710
            +T+ EW+   K   S ++  D+ E+ SR   +L LSY+ +P  LK C LYLS  P+D  I
Sbjct  379  ETINEWEMIHKHITSYLIKGDVPERQSRLAEVLDLSYHNMPYQLKPCFLYLSQFPEDFEI  438

Query  711  IVKRLVRLWIAEGFV----ELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRV  878
               +L++LW+AEGFV    E+   E LE+VA  YL  L  R ++Q+ +    GKIKTCR+
Sbjct  439  PKNKLIQLWMAEGFVSSQYEIERDERLEDVAERYLGSLISRCMVQVGQMGSTGKIKTCRL  498

Query  879  HDIVHEFCVREAIKEKLLNV  938
            HD++ + C+ +A KE  L+V
Sbjct  499  HDLMRDMCLSKARKEHFLSV  518



>ref|XP_008348395.1| PREDICTED: LOW QUALITY PROTEIN: disease resistance protein RPM1-like 
[Malus domestica]
Length=954

 Score =   135 bits (340),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 108/185 (58%), Gaps = 11/185 (6%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKI--------D  157
            GG+GKTTLA+ +Y+   V  HF +  W  V+Q   +R++L D++      I        +
Sbjct  197  GGLGKTTLAKQVYDAAEVKKHFKVSAWVTVTQSLRLRELLKDMIQQLHKAIRRPVPQGTN  256

Query  158  EVTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVAD  337
             + + +L   ++  L+ +RYLIVLDD+W    W  ++   P++ C SR++LTTR  +VA 
Sbjct  257  NMNNNQLKTMIKAFLQKRRYLIVLDDVWDRDGWASLKYALPNNTCGSRVILTTRKADVAS  316

Query  338  S-ADSSGNRLHTLGFLNQEESWDLFCK-SFPGIQSLPFELETIGRKVVDKCHGLPLAIVV  511
            + +  SG R+  L  L Q ESW L CK +F G  S P  LE IG+ ++ KC GLPLAIV 
Sbjct  317  TTSKESGGRVFNLEPLPQLESWXLLCKKTFQG-NSCPPYLEEIGKSILRKCEGLPLAIVA  375

Query  512  VAGVF  526
            V+GV 
Sbjct  376  VSGVL  380


 Score =   104 bits (260),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 85/142 (60%), Gaps = 0/142 (0%)
 Frame = +3

Query  528  SKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEA  707
            +K  + ++EW        + +   D  +   ++L+LS+N LP +LK+C LYLSI P+D  
Sbjct  382  TKDKRRIDEWDMVGHSLGAEMEGNDKLKDLKKVLSLSFNDLPYYLKSCFLYLSIFPEDHL  441

Query  708  IIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDI  887
            I   RLVRLW+AEGF+E    + LE+VA  YL +L +RS+IQ+ +   +G++K+ RVHD+
Sbjct  442  IEHMRLVRLWMAEGFIEEXQGKTLEDVAEDYLNELLNRSMIQVAETTTDGRVKSFRVHDL  501

Query  888  VHEFCVREAIKEKLLNVDNKQH  953
            + E    +   +    +  +Q+
Sbjct  502  LREIITSKIRDQNFATIAKEQN  523



>gb|ADL59397.1| EDNR2GH7 protein [Solanum x edinense]
Length=841

 Score =   153 bits (386),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 122/182 (67%), Gaps = 8/182 (4%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAK-------IDE  160
            GG+GKTTLAR LY++P ++S F    W  VSQ+++   +L  ++ +   +       ++ 
Sbjct  191  GGLGKTTLARNLYKNPNIASSFSTRAWICVSQEYNTMDLLKTIIKSIQGRTKGTLGLLET  250

Query  161  VTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADS  340
            +T+G+L   L+  L+ ++YL+V+DD+W   +WE ++  FPD    SR+++TTR ++VA+ 
Sbjct  251  MTEGDLEVHLRDLLKERKYLVVVDDVWQREAWESLKRAFPDSKNGSRVIITTRKEDVAER  310

Query  341  ADSSGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAG  520
            AD+ G  +H L FL+QEESWDLFC+    ++++   +E++ + +V+KC GLPLAIVV++G
Sbjct  311  ADNRG-FVHKLRFLSQEESWDLFCRKLVDVRAMVPAMESLAKDMVEKCRGLPLAIVVLSG  369

Query  521  VF  526
            + 
Sbjct  370  LL  371


 Score = 87.0 bits (214),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (58%), Gaps = 6/137 (4%)
 Frame = +3

Query  546  VEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRL  725
            +++WQ  + Q    ++     E  S IL+LSYN L   LK C LY  I P+D+ +  + +
Sbjct  377  LDKWQEVKDQLWKNIIEDKFIE-ISCILSLSYNDLSTVLKQCFLYFGIFPEDQVLEAENI  435

Query  726  VRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCV  905
            +RLWIAEGFV     E +E+VA G+L +L  RSL+Q+    F  K+  CRVHD++ +  +
Sbjct  436  IRLWIAEGFVP-NGEERMEDVAEGFLNELIRRSLVQVVDT-FWEKVTQCRVHDLLRDLAI  493

Query  906  REAIKEKLLNVDNKQHP  956
            ++A    L ++    HP
Sbjct  494  QKASDTNLFDI---YHP  507



>ref|XP_009592156.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
tomentosiformis]
Length=888

 Score =   144 bits (362),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 112/181 (62%), Gaps = 2/181 (1%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN-EAAKIDEVTDGELA  181
            G+GKTTLAR +++D  + SHFD+  W  +SQ +DVR++L D+       K +   + ++A
Sbjct  55   GLGKTTLARKIFKDSSIVSHFDVRAWLTISQSYDVRELLRDIYKQVTGVKYNGDKESDIA  114

Query  182  GKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGNR  361
              L+KCL GKRYLIVLDD+W  ++W+ ++LCFP     SRI+LTTR + VA       + 
Sbjct  115  DMLRKCLIGKRYLIVLDDVWEVKAWDELRLCFPIGKQGSRIMLTTRLEHVAMEVKHCTDP  174

Query  362  LHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQQ  541
             ++  FL +E SW L  K     ++ P E + +G ++ + C GLPL +V++ G+  K ++
Sbjct  175  -YSPRFLTREASWKLLEKKAFQKETCPPEFQDVGVQIAEYCKGLPLTVVLIGGILAKKER  233

Query  542  N  544
            N
Sbjct  234  N  234


 Score = 96.3 bits (238),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 86/155 (55%), Gaps = 13/155 (8%)
 Frame = +3

Query  525  FSKLNKTVEEW----QNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIV  692
             +K  + V EW     N +    ++   ++L+ Q      LSY YLP HL+ C+L + + 
Sbjct  228  LAKKERNVSEWCEVANNLKSHLGAVESESNLAIQ------LSYCYLPDHLRHCLLTMGVF  281

Query  693  PKDEAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTC  872
             +DE     +L+ LW+AEG V+  +   LEEVA GYL D+   SL+ + K  F+GK+K  
Sbjct  282  REDEKFGASKLMLLWMAEGLVQCSDDRGLEEVAEGYLIDIISSSLLMVSKTTFDGKVKYL  341

Query  873  RVHDIVHEFCVREAIKEKLL---NVDNKQHPSCGE  968
            ++HD+V +F + +A +EK +    + N+  PS  E
Sbjct  342  QIHDLVRDFVLNKAKEEKFMQAIGIHNQYQPSYDE  376



>ref|XP_004239116.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Solanum lycopersicum]
 ref|XP_010320925.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Solanum lycopersicum]
Length=1825

 Score =   139 bits (349),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 112/176 (64%), Gaps = 3/176 (2%)
 Frame = +2

Query  5     GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN--EAAKIDEVTDGEL  178
             G+GKTTLA+ +Y DP V+S FD+    VV+Q +  R++L+ +LN+  E +  +E  DGE+
Sbjct  1126  GLGKTTLAKKIYNDPEVTSRFDVHAQCVVTQLYSWRELLLTILNDVLEPSDRNEKEDGEI  1185

Query  179   AGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGN  358
             A +L++ L  KR+LI++DD+W  + W+ + +CF D + RSRI+LTTR  +VA+      +
Sbjct  1186  ADELRRFLLTKRFLILIDDVWDYKVWDNLCMCFSDVSNRSRIILTTRLNDVAEYVKCESD  1245

Query  359   RLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
               H L     +ESW L  K     +S P ELE +G ++   C GLPL++V+VAGV 
Sbjct  1246  P-HHLRLFRDDESWTLLQKEVFQGESCPPELEDVGFEISKSCRGLPLSVVLVAGVL  1300


 Score =   100 bits (250),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 80/131 (61%), Gaps = 2/131 (2%)
 Frame = +3

Query  540   KTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVK  719
             KT++ W+  E+  +S  + + L E  S I+  SY  LP +LK C LY     + + I V 
Sbjct  1305  KTLDSWKVVEQSLSSQRIGS-LEESIS-IIGFSYKNLPHYLKPCFLYFGGFLQGKDIHVS  1362

Query  720   RLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEF  899
             ++ +LW+AEGFV+  N    E+ A G+L DL  R+L+   ++  N K+KTCR+HD++H+F
Sbjct  1363  KMTKLWVAEGFVQANNENGQEDTAQGFLDDLIGRNLVMAMEKRPNAKVKTCRIHDLLHKF  1422

Query  900   CVREAIKEKLL  932
             C+ +A +E  L
Sbjct  1423  CMEKAKQEDFL  1433



>ref|XP_007032835.1| CC-NBS-LRR class disease resistance protein, putative isoform 
1 [Theobroma cacao]
 ref|XP_007032836.1| CC-NBS-LRR class disease resistance protein, putative isoform 
1 [Theobroma cacao]
 ref|XP_007032837.1| CC-NBS-LRR class disease resistance protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY03761.1| CC-NBS-LRR class disease resistance protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY03762.1| CC-NBS-LRR class disease resistance protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY03763.1| CC-NBS-LRR class disease resistance protein, putative isoform 
1 [Theobroma cacao]
Length=931

 Score =   133 bits (335),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 111/188 (59%), Gaps = 14/188 (7%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKM-------LVDLLNNEAAKIDE  160
            GG+GKTTLA+ LY    +  HF+   W  VSQ+   R +       L+     E  +I  
Sbjct  187  GGLGKTTLAKTLYHHADIRRHFEAFAWAYVSQQCRRRDVWEGILLKLITPSKEEKEEILR  246

Query  161  VTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNC-RSRILLTTRHKEVAD  337
            + D ELA KL K    KR LIV+DDIW+T +WE +Q  FP +    S++LLTTR+KEVA 
Sbjct  247  MRDDELAKKLYKVQLEKRCLIVIDDIWTTEAWETLQPAFPKETTVGSKVLLTTRNKEVAL  306

Query  338  SADSSGNRLHTLGFLNQEESWDLFC-KSFPGIQSLPF----ELETIGRKVVDKCHGLPLA  502
             AD SG  LH    LN+E+SW+LF  K+FP      F    ++E +GR++V  C GLPLA
Sbjct  307  GADLSGF-LHEPQCLNEEKSWELFQRKAFPWKHESGFTVSKDMENLGREMVGSCAGLPLA  365

Query  503  IVVVAGVF  526
            I+V+ G+ 
Sbjct  366  IIVLGGLL  373


 Score =   106 bits (264),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 91/157 (58%), Gaps = 9/157 (6%)
 Frame = +3

Query  540  KTVEEWQNFEKQTNS-LVVTTDLSEQC--SRILTLSYNYLPLHLKACILYLSIVPKDEAI  710
            +TV EW    +   S L  +    EQ   S +L LSY+ LP  LK C LYLS  P+D  I
Sbjct  377  ETVNEWDMVHRNIKSHLARSKGRGEQARLSEVLALSYHELPYQLKPCFLYLSQFPEDFDI  436

Query  711  IVKRLVRLWIAEGFVELINSE----NLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRV  878
              K+LV+ W+AEG V L + +     +EEVA  YL+DL +RS++Q+  R   G IKTCR+
Sbjct  437  PTKKLVQQWVAEGIVSLQDEKEVDGTMEEVAKSYLRDLINRSMVQLGVRGSTGTIKTCRL  496

Query  879  HDIVHEFCVREAIKEKLLNVDN--KQHPSCGELQQEG  983
            HD++ + C+ +A +E   ++ +    + + G+LQ  G
Sbjct  497  HDLMRDLCLSKAKQENFFHIIDHVDGNKTNGDLQSSG  533



>gb|AES95039.2| NB-ARC domain disease resistance protein [Medicago truncatula]
Length=939

 Score =   142 bits (357),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 109/180 (61%), Gaps = 6/180 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN----EAAKIDEVTD  169
            GG+GKTTLA+ LY D  +++HF+I  W  VS+++  + +L  +L          +D + +
Sbjct  198  GGLGKTTLAKKLYNDSRIANHFEIKAWVYVSEEYRRKDVLQGILRGVDGVAREDMDRMPE  257

Query  170  GELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADS  349
             EL  KL   L  KRYL+VLDDIW    W+G++  FP     S+ILLTTR  EVA  AD 
Sbjct  258  EELVNKLHNALAEKRYLVVLDDIWGMEVWDGLKYAFPRRKLGSKILLTTRILEVALHADG  317

Query  350  SGNRLHTLGFLNQEESWDLF-CKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
            + +  + L  LN +ES+ L   K+FPG   +P E E + +++V KC GLPLA+VVV G+ 
Sbjct  318  NSDP-YQLRPLNHDESYALLRSKAFPGASVIPSEFENLAKEIVVKCEGLPLAVVVVGGLL  376


 Score = 97.8 bits (242),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 66/105 (63%), Gaps = 0/105 (0%)
 Frame = +3

Query  609  EQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENLEEV  788
            E+ +RIL LSYN LP  LK+C LYL + PK   I  K+L+RLW+AEGF+     E  E+V
Sbjct  402  EKITRILALSYNDLPPPLKSCFLYLGLFPKGMNIQTKKLIRLWVAEGFLPQEGGETAEDV  461

Query  789  AHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKE  923
            A  YL +L  R +IQ+      G++KT R+HD++ E  V +  +E
Sbjct  462  AQRYLNELIGRCMIQVGTVSSMGRVKTIRIHDLLRELSVTKGKEE  506



>gb|AFN86170.1| reistance protein F variant 1.1 [Solanum lycopersicum]
Length=1275

 Score =   144 bits (363),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 113/180 (63%), Gaps = 2/180 (1%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDE-VTDGEL  178
            GG GKTT+AR +Y    + SHFD+  W +VSQ ++ RK+L D+L+      D+   D  L
Sbjct  585  GGQGKTTVARKVYNSDNIVSHFDVRAWCIVSQTYNRRKLLQDILSQVTGSKDKGYEDDIL  644

Query  179  AGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGN  358
            A +L+K L GKRYLIVLDD+W   +W+ ++L FPD   RSRI++TTR ++V +      +
Sbjct  645  ADELRKGLMGKRYLIVLDDMWDCMAWDDLRLSFPDSGNRSRIVVTTRLEKVGEQVKCHTD  704

Query  359  RLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
              ++L FL +EES +L  K     +  P EL+ + R V +KC GLPL +V+VAG+  K +
Sbjct  705  P-YSLPFLTKEESCELLQKKVFQKEDFPPELQDVSRAVAEKCKGLPLVVVLVAGIIKKRK  763


 Score = 95.5 bits (236),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 77/136 (57%), Gaps = 2/136 (1%)
 Frame = +3

Query  531  KLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAI  710
            K  K  E W N  K +    +  +  E     + LSY  L   LK C+LY+ +  +D  I
Sbjct  760  KKRKMEESWWNEVKDSLFDHLNRESEEYSLSTMQLSYYNLTDCLKPCLLYMGMFQEDAII  819

Query  711  IVKRLVRLWIAEGFVELINSENL--EEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHD  884
             V  L+ LWIAEGFV+ I S  L  EE A GYL DL   +++ +  R +NGK+K C+VHD
Sbjct  820  RVSELISLWIAEGFVQSIESGRLLMEEAAEGYLMDLIQSNVVMVSNRRYNGKVKYCQVHD  879

Query  885  IVHEFCVREAIKEKLL  932
            +V  FC+ ++++EK +
Sbjct  880  VVLHFCLEKSLEEKFM  895



>ref|XP_003612081.1| Disease resistance RPP8-like protein [Medicago truncatula]
Length=941

 Score =   142 bits (357),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 109/180 (61%), Gaps = 6/180 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN----EAAKIDEVTD  169
            GG+GKTTLA+ LY D  +++HF+I  W  VS+++  + +L  +L          +D + +
Sbjct  198  GGLGKTTLAKKLYNDSRIANHFEIKAWVYVSEEYRRKDVLQGILRGVDGVAREDMDRMPE  257

Query  170  GELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADS  349
             EL  KL   L  KRYL+VLDDIW    W+G++  FP     S+ILLTTR  EVA  AD 
Sbjct  258  EELVNKLHNALAEKRYLVVLDDIWGMEVWDGLKYAFPRRKLGSKILLTTRILEVALHADG  317

Query  350  SGNRLHTLGFLNQEESWDLF-CKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
            + +  + L  LN +ES+ L   K+FPG   +P E E + +++V KC GLPLA+VVV G+ 
Sbjct  318  NSDP-YQLRPLNHDESYALLRSKAFPGASVIPSEFENLAKEIVVKCEGLPLAVVVVGGLL  376


 Score = 97.8 bits (242),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 66/105 (63%), Gaps = 0/105 (0%)
 Frame = +3

Query  609  EQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENLEEV  788
            E+ +RIL LSYN LP  LK+C LYL + PK   I  K+L+RLW+AEGF+     E  E+V
Sbjct  402  EKITRILALSYNDLPPPLKSCFLYLGLFPKGMNIQTKKLIRLWVAEGFLPQEGGETAEDV  461

Query  789  AHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKE  923
            A  YL +L  R +IQ+      G++KT R+HD++ E  V +  +E
Sbjct  462  AQRYLNELIGRCMIQVGTVSSMGRVKTIRIHDLLRELSVTKGKEE  506



>ref|XP_010319291.1| PREDICTED: disease resistance protein RPP13-like [Solanum lycopersicum]
Length=836

 Score =   148 bits (373),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 120/182 (66%), Gaps = 8/182 (4%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDE-------  160
            GG+GKTTLAR LY  P ++S F    W  VSQ+++   +L +++ +   +  E       
Sbjct  183  GGLGKTTLARKLYNCPNITSSFPTRAWICVSQEYNTMDLLRNIIKSIQGRTKETLDLLER  242

Query  161  VTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADS  340
            +T+G+L   ++  L+ ++YL+V+DD+W   +WE ++  FPD    SR+++TTR ++VA+ 
Sbjct  243  MTEGDLEIYIRDLLKERKYLVVVDDVWEREAWESLKRAFPDSKNGSRVIITTRKEDVAER  302

Query  341  ADSSGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAG  520
            AD+ G  +H L FL+QEESWDLF +    ++++  E+E++ + +V+KC GLPLAIVV++G
Sbjct  303  ADNRGF-VHKLRFLSQEESWDLFRRKLLDVRAMVPEMESLAKDMVEKCRGLPLAIVVLSG  361

Query  521  VF  526
            + 
Sbjct  362  LL  363


 Score = 91.7 bits (226),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 81/144 (56%), Gaps = 3/144 (2%)
 Frame = +3

Query  540  KTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVK  719
            K + EWQ  +       +  D S + S IL+LSYN L   LK C LY    P+D  + V 
Sbjct  367  KGLNEWQKVKDHLWK-NIKEDNSIEISNILSLSYNDLSTALKQCFLYFGTFPEDRVVGVD  425

Query  720  RLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEF  899
             ++RLW+AEGF+     E +E+VA G+L +L  RSL+Q+  R F  ++  CR+HD++H+ 
Sbjct  426  NIIRLWMAEGFIPR-GEERMEDVAEGFLNELIRRSLVQV-ARTFWERVTDCRLHDLLHDL  483

Query  900  CVREAIKEKLLNVDNKQHPSCGEL  971
             +++A +    ++ + +  S   L
Sbjct  484  AIQKASEVNFFDIYDPRSHSISSL  507



>gb|ACU65454.1| R2-like protein [Solanum sp. AM-3778-16]
Length=847

 Score =   145 bits (367),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 118/182 (65%), Gaps = 8/182 (4%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDE-------  160
            GG+GKTTLAR LY  P + + F    W  VSQ+++   +L +++ +   +  E       
Sbjct  191  GGLGKTTLARKLYTSPDILNSFRTRAWICVSQEYNTMDLLRNIIKSIQGRTKETLDLLER  250

Query  161  VTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADS  340
            +T+G+L   L+  L+ ++YL+V+DD+W   +WE ++  FPD    SR+++TTR ++VA+ 
Sbjct  251  MTEGDLEIYLRDLLKERKYLVVVDDVWQREAWESLKRSFPDGKNGSRVIITTRKEDVAER  310

Query  341  ADSSGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAG  520
            AD  G  +H L FL+QEESWDLF +    ++++  E+E++ + +V+KC GLPLAIVV++G
Sbjct  311  ADDRGF-VHKLRFLSQEESWDLFRRKLLDVRAMVPEMESLAKDMVEKCRGLPLAIVVLSG  369

Query  521  VF  526
            + 
Sbjct  370  LL  371


 Score = 94.0 bits (232),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 82/142 (58%), Gaps = 8/142 (6%)
 Frame = +3

Query  591  VTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINS  770
            +  D S + S IL+LSYN L   LK C LY  I P+D+ +    ++RLW+AEGF+     
Sbjct  391  IKEDKSIEISNILSLSYNDLSTALKQCFLYFGIFPEDQVVKADDIIRLWMAEGFIPR-GE  449

Query  771  ENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLLNVDNKQ  950
            E +E+VA G+L +L  RSL+Q+ K  F  K+  CRVHD++ +  +++A++    ++ + +
Sbjct  450  ERMEDVADGFLNELIRRSLVQVAK-TFWEKVTDCRVHDLLRDLAIQKALEVNFFDIYDPR  508

Query  951  HPSCGEL------QQEGCRWLN  998
              S   L        EG R+L+
Sbjct  509  SHSISSLCIRHGIHSEGERYLS  530



>gb|ADL59392.1| R2 late blight resistance protein [Solanum x edinense]
Length=847

 Score =   146 bits (368),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 118/182 (65%), Gaps = 8/182 (4%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDE-------  160
            GG+GKTTLAR LY  P + + F    W  VSQ+++   +L +++ +   +  E       
Sbjct  191  GGLGKTTLARKLYTSPDILNSFRTRAWICVSQEYNTMDLLRNIIKSIQGRTKETLDLLER  250

Query  161  VTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADS  340
            +T+G+L   L+  L+ ++YL+V+DD+W   +WE ++  FPD    SR+++TTR ++VA+ 
Sbjct  251  MTEGDLEIYLRDLLKERKYLVVVDDVWQREAWESLKRSFPDGKNGSRVIITTRKEDVAER  310

Query  341  ADSSGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAG  520
            AD  G  +H L FL+QEESWDLF +    ++++  E+E++ + +V+KC GLPLAIVV++G
Sbjct  311  ADDRGF-VHKLRFLSQEESWDLFRRKLLDVRAMVPEMESLAKDMVEKCRGLPLAIVVLSG  369

Query  521  VF  526
            + 
Sbjct  370  LL  371


 Score = 94.0 bits (232),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 82/142 (58%), Gaps = 8/142 (6%)
 Frame = +3

Query  591  VTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINS  770
            +  D S + S IL+LSYN L   LK C LY  I P+D+ +    ++RLW+AEGF+     
Sbjct  391  IKEDKSIEISNILSLSYNDLSTALKQCFLYFGIFPEDQVVKADDIIRLWMAEGFIPR-GE  449

Query  771  ENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLLNVDNKQ  950
            E +E+VA G+L +L  RSL+Q+ K  F  K+  CRVHD++ +  +++A++    ++ + +
Sbjct  450  ERMEDVADGFLNELIRRSLVQVAK-TFWEKVTDCRVHDLLRDLAIQKALEVNFFDIYDPR  508

Query  951  HPSCGEL------QQEGCRWLN  998
              S   L        EG R+L+
Sbjct  509  SHSISSLCIRHGIHSEGERYLS  530



>ref|XP_009791056.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=1101

 Score =   134 bits (338),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 111/183 (61%), Gaps = 5/183 (3%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLV----DLLNNEAAKIDEVTDG  172
            G+GKTTLA  LY D LV SHFDI     VSQ++  + +L+    D++  ++   +   D 
Sbjct  401  GLGKTTLAYRLYSDRLVVSHFDIRAQCCVSQEYSRKNLLLVILRDVIGKDSKSRESCADH  460

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA +L++ L  KRYL++LDD+W   +W+ +  CF D N  SRI++TTR+ EVA+ A   
Sbjct  461  ELADELRRVLLSKRYLVLLDDVWEASAWDDLIGCFQDTNNGSRIIVTTRNNEVANYARFR  520

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
             + L +L   N +ESW+L  K   G +  P  L  IG+++  KC  LPL+I +V G+  +
Sbjct  521  SDPL-SLRMFNDDESWELLRKKVFGEERCPPLLNNIGQQIAKKCGRLPLSIALVGGILAE  579

Query  533  TQQ  541
            T++
Sbjct  580  TEK  582


 Score =   105 bits (261),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 66/103 (64%), Gaps = 0/103 (0%)
 Frame = +3

Query  624  ILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENLEEVAHGYL  803
            I+  SY  LP H+K C LY     +D  I V +L R+WI+EGF++    ++LE++A GYL
Sbjct  605  IIEHSYRILPYHIKLCFLYFGAFLEDSVINVSKLTRMWISEGFIKCFEGKSLEDIAEGYL  664

Query  804  QDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLL  932
             +L  R+L+   KR   GKIK CR+HD++H+FC   A KE LL
Sbjct  665  GNLIGRNLVMGTKRSIGGKIKACRIHDLLHDFCKERAKKENLL  707



>ref|NP_001234202.1| NRC1 [Solanum lycopersicum]
 gb|ABC26878.1| NRC1 [Solanum lycopersicum]
Length=888

 Score =   127 bits (319),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 110/179 (61%), Gaps = 9/179 (5%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKID---EVTDGE  175
            G+GKTTLA  +++ P +   F   +W  VSQ +  R++ +++++          ++++ +
Sbjct  188  GLGKTTLATKIFKHPKIEYEFFTRLWLYVSQSYKTRELYLNIISKFTGNTKHCRDMSEKD  247

Query  176  LAGKLQKCLR-GKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            LA K+Q+ L  G +YLIVLDD+WST +W+ I++ FP ++  +R+LLTTR   VA   + S
Sbjct  248  LALKVQEILEEGGKYLIVLDDVWSTDAWDRIKIAFPKNDKGNRVLLTTRDHRVARYCNRS  307

Query  353  GNRLHTLGFLNQEESWDLFCK-SFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
                H L FL  EESW L  K +F   + LP ELET G+ +  KC GLPLAIVV+AG  
Sbjct  308  P---HDLKFLTDEESWILLEKRAFHKAKCLP-ELETNGKSIARKCKGLPLAIVVIAGAL  362


 Score =   112 bits (280),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 82/132 (62%), Gaps = 0/132 (0%)
 Frame = +3

Query  537  NKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIV  716
            +KT++EW+  ++      +  D    C +++ +SY+ LP   KAC LY    P+   I  
Sbjct  366  SKTIKEWEQVDQSVGEHFINRDQPNSCDKLVRMSYDVLPYDWKACFLYFGTFPRGYLIPA  425

Query  717  KRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHE  896
            ++L+RLWIAEGF++     + E  A  YL +L +R+L+ + +R  +G+IKTCRVHD+++E
Sbjct  426  RKLIRLWIAEGFIQYRGDLSPECKAEEYLNELVNRNLVMVMQRTVDGQIKTCRVHDMLYE  485

Query  897  FCVREAIKEKLL  932
            FC +EA  E+ L
Sbjct  486  FCWQEATTEENL  497



>ref|XP_010320926.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X2 [Solanum lycopersicum]
Length=1785

 Score =   139 bits (349),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 112/176 (64%), Gaps = 3/176 (2%)
 Frame = +2

Query  5     GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN--EAAKIDEVTDGEL  178
             G+GKTTLA+ +Y DP V+S FD+    VV+Q +  R++L+ +LN+  E +  +E  DGE+
Sbjct  1126  GLGKTTLAKKIYNDPEVTSRFDVHAQCVVTQLYSWRELLLTILNDVLEPSDRNEKEDGEI  1185

Query  179   AGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGN  358
             A +L++ L  KR+LI++DD+W  + W+ + +CF D + RSRI+LTTR  +VA+      +
Sbjct  1186  ADELRRFLLTKRFLILIDDVWDYKVWDNLCMCFSDVSNRSRIILTTRLNDVAEYVKCESD  1245

Query  359   RLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
               H L     +ESW L  K     +S P ELE +G ++   C GLPL++V+VAGV 
Sbjct  1246  P-HHLRLFRDDESWTLLQKEVFQGESCPPELEDVGFEISKSCRGLPLSVVLVAGVL  1300


 Score =   100 bits (250),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 80/131 (61%), Gaps = 2/131 (2%)
 Frame = +3

Query  540   KTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVK  719
             KT++ W+  E+  +S  + + L E  S I+  SY  LP +LK C LY     + + I V 
Sbjct  1305  KTLDSWKVVEQSLSSQRIGS-LEESIS-IIGFSYKNLPHYLKPCFLYFGGFLQGKDIHVS  1362

Query  720   RLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEF  899
             ++ +LW+AEGFV+  N    E+ A G+L DL  R+L+   ++  N K+KTCR+HD++H+F
Sbjct  1363  KMTKLWVAEGFVQANNENGQEDTAQGFLDDLIGRNLVMAMEKRPNAKVKTCRIHDLLHKF  1422

Query  900   CVREAIKEKLL  932
             C+ +A +E  L
Sbjct  1423  CMEKAKQEDFL  1433



>ref|XP_009791054.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009791055.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=1135

 Score =   135 bits (339),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 111/183 (61%), Gaps = 5/183 (3%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLV----DLLNNEAAKIDEVTDG  172
            G+GKTTLA  LY D LV SHFDI     VSQ++  + +L+    D++  ++   +   D 
Sbjct  435  GLGKTTLAYRLYSDRLVVSHFDIRAQCCVSQEYSRKNLLLVILRDVIGKDSKSRESCADH  494

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA +L++ L  KRYL++LDD+W   +W+ +  CF D N  SRI++TTR+ EVA+ A   
Sbjct  495  ELADELRRVLLSKRYLVLLDDVWEASAWDDLIGCFQDTNNGSRIIVTTRNNEVANYARFR  554

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
             + L +L   N +ESW+L  K   G +  P  L  IG+++  KC  LPL+I +V G+  +
Sbjct  555  SDPL-SLRMFNDDESWELLRKKVFGEERCPPLLNNIGQQIAKKCGRLPLSIALVGGILAE  613

Query  533  TQQ  541
            T++
Sbjct  614  TEK  616


 Score =   104 bits (260),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 66/103 (64%), Gaps = 0/103 (0%)
 Frame = +3

Query  624  ILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENLEEVAHGYL  803
            I+  SY  LP H+K C LY     +D  I V +L R+WI+EGF++    ++LE++A GYL
Sbjct  639  IIEHSYRILPYHIKLCFLYFGAFLEDSVINVSKLTRMWISEGFIKCFEGKSLEDIAEGYL  698

Query  804  QDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLL  932
             +L  R+L+   KR   GKIK CR+HD++H+FC   A KE LL
Sbjct  699  GNLIGRNLVMGTKRSIGGKIKACRIHDLLHDFCKERAKKENLL  741



>gb|ADL59401.1| R2 late blight resistance protein [Solanum hjertingii]
Length=847

 Score =   145 bits (367),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 118/182 (65%), Gaps = 8/182 (4%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDE-------  160
            GG+GKTTLAR LY  P + + F    W  VSQ+++   +L +++ +   +  E       
Sbjct  191  GGLGKTTLARKLYTSPDILNSFRTRAWICVSQEYNTMDLLRNIIKSIQGRTKETLDLLER  250

Query  161  VTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADS  340
            +T+G+L   L+  L+ ++YL+V+DD+W   +WE ++  FPD    SR+++TTR ++VA+ 
Sbjct  251  MTEGDLEIYLRDLLKERKYLVVVDDVWQREAWESLKRSFPDGKNGSRVIITTRKEDVAER  310

Query  341  ADSSGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAG  520
            AD  G  +H L FL+QEESWDLF +    ++++  E+E++ + +V+KC GLPLAIVV++G
Sbjct  311  ADDRGF-VHKLRFLSQEESWDLFRRKLLDVRAMVPEMESLAKDMVEKCRGLPLAIVVLSG  369

Query  521  VF  526
            + 
Sbjct  370  LL  371


 Score = 93.6 bits (231),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 82/142 (58%), Gaps = 8/142 (6%)
 Frame = +3

Query  591  VTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINS  770
            +  D S + S IL+LSYN L   LK C LY  I P+D+ +    ++RLW+AEGF+     
Sbjct  391  IKEDKSIEISNILSLSYNDLSTALKQCFLYFGIFPEDQVVKADDIIRLWMAEGFIPR-GE  449

Query  771  ENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLLNVDNKQ  950
            E +E+VA G+L +L  RSL+Q+ K  F  K+  CRVHD++ +  +++A++    ++ + +
Sbjct  450  ERMEDVADGFLNELIRRSLVQVAK-TFWEKVTDCRVHDLLRDLAIQKALEVNFFDIYDPR  508

Query  951  HPSCGEL------QQEGCRWLN  998
              S   L        EG R+L+
Sbjct  509  SHSISSLCIRHGIHSEGERYLS  530



>emb|CDP19489.1| unnamed protein product [Coffea canephora]
Length=1247

 Score =   120 bits (300),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 87/136 (64%), Gaps = 3/136 (2%)
 Frame = +3

Query  534  LNKTVEE-WQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAI  710
            L  T E+ W+   K   S +V  D  E C + L LSY +LP  LK C+LY     +D+ +
Sbjct  754  LANTAEDCWEEVTKSLTSSIVLDD--EYCMKTLELSYGHLPDDLKPCLLYFGAFQEDKNV  811

Query  711  IVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIV  890
             V+RL+ LWI+EGFV+    ++LE+VA  YL+DL DRSL+ + K+   G  K CRVHD+V
Sbjct  812  PVRRLLWLWISEGFVQRTEGKSLEDVADDYLKDLVDRSLVMVSKQRTVGGAKACRVHDLV  871

Query  891  HEFCVREAIKEKLLNV  938
            HEFCV++A +E  L+V
Sbjct  872  HEFCVKKAKEENFLHV  887


 Score =   119 bits (298),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 105/185 (57%), Gaps = 5/185 (3%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN-EAAKIDE---VTDG  172
            G+GKTTLA  +Y  P V  HF    W  VSQ + +  MLV +L++ ++ K+++   + + 
Sbjct  578  GLGKTTLANRVYNSPSVMLHFHKCAWCTVSQAYSMHNMLVQILDSIDSGKLEQCRKMDEH  637

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            +LA KL++ L   +YL+VLDD+W  + W  ++   PDD   SRIL+T+R + ++      
Sbjct  638  DLAEKLKQVLLRNKYLLVLDDLWDAKVWNLLERSLPDDANGSRILITSRLQNLSLQF-KP  696

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
             +++H L  L  EESW+L  K        P  L  +  ++   C GLPL +V+VAG+   
Sbjct  697  HSKVHHLRCLTDEESWNLLQKKLFCKAGCPPRLSGVASRIAKSCRGLPLMVVLVAGILAN  756

Query  533  TQQNC  547
            T ++C
Sbjct  757  TAEDC  761



>gb|ACU65455.1| Rpi protein [Solanum sp. ABPT]
Length=845

 Score =   145 bits (367),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 118/182 (65%), Gaps = 8/182 (4%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDE-------  160
            GG+GKTTLAR LY  P + + F    W  VSQ+++   +L +++ +   +  E       
Sbjct  191  GGLGKTTLARKLYTSPDILNSFRTRAWICVSQEYNTMDLLRNIIKSIQGRTKETLDLLER  250

Query  161  VTDGELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADS  340
            +T+G+L   L+  L+ ++YL+V+DD+W   +WE ++  FPD    SR+++TTR ++VA+ 
Sbjct  251  MTEGDLEIYLRDLLKERKYLVVVDDVWQREAWESLKRSFPDGKNGSRVIITTRKEDVAER  310

Query  341  ADSSGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAG  520
            AD  G  +H L FL+QEESWDLF +    ++++  E+E++ + +V+KC GLPLAIVV++G
Sbjct  311  ADDRGF-VHKLRFLSQEESWDLFRRKLLDVRAMVPEMESLAKDMVEKCRGLPLAIVVLSG  369

Query  521  VF  526
            + 
Sbjct  370  LL  371


 Score = 93.6 bits (231),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 82/142 (58%), Gaps = 8/142 (6%)
 Frame = +3

Query  591  VTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINS  770
            +  D S + S IL+LSYN L   LK C LY  I P+D+ +    ++RLW+AEGF+     
Sbjct  391  IKEDKSIEISNILSLSYNDLSTALKQCFLYFGIFPEDQVVKADDIIRLWMAEGFIPR-GE  449

Query  771  ENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLLNVDNKQ  950
            E +E+VA G+L +L  RSL+Q+ K  F  K+  CRVHD++ +  +++A++    ++ + +
Sbjct  450  ERMEDVADGFLNELIRRSLVQVAK-TFWEKVTDCRVHDLLRDLAIQKALEVNFFDIYDPR  508

Query  951  HPSCGEL------QQEGCRWLN  998
              S   L        EG R+L+
Sbjct  509  SHSISSLCIRHGIHSEGERYLS  530



>ref|XP_006367616.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
[Solanum tuberosum]
Length=738

 Score =   139 bits (350),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 113/183 (62%), Gaps = 6/183 (3%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVR----KMLVDLLNNEAAKIDEVTDG  172
            G+GKTTLA  LY D  V+SHFDI     VSQ +  +     +L D + +++A+  E+   
Sbjct  53   GLGKTTLANRLYSDRSVASHFDICAQCCVSQVYSFKDLLLALLCDAIGDDSAR-RELCAS  111

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA  L+K L  +RYLI++DD+W  R+W+ ++ CFPD N RSRI+LTTRH EVA  A   
Sbjct  112  ELADMLRKTLLPRRYLILVDDLWDNRAWDDLRGCFPDANNRSRIILTTRHHEVAKYASVH  171

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
             + LH L   +++ESW L  K   G QS    L  +G+++   C  LPL+IV+VAG+  +
Sbjct  172  SDPLH-LRMFDEDESWKLLEKKVFGEQSCSPLLRDVGQRIAKMCRQLPLSIVLVAGILSE  230

Query  533  TQQ  541
             ++
Sbjct  231  MEK  233


 Score =   100 bits (248),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 82/137 (60%), Gaps = 6/137 (4%)
 Frame = +3

Query  525  FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
             S++ K VE W   E+  N+L   T +      I+  SY+ LP HLK+C LY     +D 
Sbjct  228  LSEMEKEVECW---EQVANNL--GTHIHNDSRAIVDQSYHVLPCHLKSCFLYFGAFIEDR  282

Query  705  AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKR-HFNGKIKTCRVH  881
             I + RL+RLWIAE F++     +LE++A G L++L  R+L+ + KR + NGK+K CR+H
Sbjct  283  VIDISRLIRLWIAESFIKSSEGRSLEDIAEGNLENLIGRNLVMVTKRANSNGKVKACRLH  342

Query  882  DIVHEFCVREAIKEKLL  932
            D++ +FC   A +E  L
Sbjct  343  DVLLDFCKERAAEENFL  359



>ref|XP_003612687.1| Disease resistance protein RPM1 [Medicago truncatula]
 gb|AES95645.1| disease resistance protein (CC-NBS-LRR class) family protein 
[Medicago truncatula]
Length=949

 Score =   129 bits (325),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 109/184 (59%), Gaps = 9/184 (5%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDL---LNNEAAK-----ID  157
            GG+GKTTLA+ +Y+DP V  HF I  W  +SQ   + ++L DL   L+N   K     I 
Sbjct  192  GGLGKTTLAKQVYDDPKVKKHFRIHAWVNLSQSIKMEEILKDLVQKLHNVFGKPAPESIG  251

Query  158  EVTDGELAGKLQKCL-RGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVA  334
             + + +L   +Q  L R ++YLIVLDD+W  + W+G+   FP++N  SR++LTTR +++A
Sbjct  252  TMNNDDLKKFIQNFLQRSQKYLIVLDDVWHVKVWDGLNHAFPNNNRGSRVMLTTRKRDIA  311

Query  335  DSADSSGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVV  514
              + +   +   L FL ++E+W LFC+      S P  LE + R ++  C GLPLAIV +
Sbjct  312  LYSCAGLGKDFHLEFLPEKEAWSLFCRKTFQDNSCPPHLEEVCRNILKLCGGLPLAIVAI  371

Query  515  AGVF  526
            +G  
Sbjct  372  SGAL  375


 Score =   109 bits (273),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 84/128 (66%), Gaps = 0/128 (0%)
 Frame = +3

Query  513  SQEFFSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIV  692
            S    +K    +EEWQ   +   S +   D  E  +++++LS N LP +LK+C++YL+I 
Sbjct  372  SGALATKERSNIEEWQIVCRSFGSEIEGNDKLEDMNKVISLSLNELPSYLKSCLMYLTIF  431

Query  693  PKDEAIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTC  872
            P+  A+   RL+RLWIAEGFV   + + LEEVA  YL++L DRSLIQ+ ++  +G++KTC
Sbjct  432  PEFHAMETWRLIRLWIAEGFVNGEDGKTLEEVADSYLKELLDRSLIQVVEKTSDGRMKTC  491

Query  873  RVHDIVHE  896
            R+H ++ E
Sbjct  492  RMHGLLRE  499



>gb|AFN86171.1| reistance protein F variant 1.2 [Solanum lycopersicum]
Length=1275

 Score =   143 bits (361),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 112/180 (62%), Gaps = 2/180 (1%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDE-VTDGEL  178
            GG GKTT+AR +Y    +  HFD+  W +VSQ ++ RK+L D+L+      D+   D  L
Sbjct  585  GGQGKTTVARKVYNSDNIVPHFDVRAWCIVSQTYNRRKLLQDILSQVTGSKDKGYEDDIL  644

Query  179  AGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGN  358
            A +L+K L GKRYLIVLDD+W   +W+ ++L FPD   RSRI++TTR ++V +      +
Sbjct  645  ADELRKSLMGKRYLIVLDDMWDCMAWDDLRLSFPDSGNRSRIVVTTRLEKVGEQVKCHTD  704

Query  359  RLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKTQ  538
              ++L FL +EES +L  K     +  P EL+ + R V +KC GLPL +V+VAG+  K +
Sbjct  705  P-YSLPFLTKEESCELLQKKVFQKEDFPPELQDVSRAVAEKCKGLPLVVVLVAGIIKKRK  763


 Score = 95.9 bits (237),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 77/136 (57%), Gaps = 2/136 (1%)
 Frame = +3

Query  531  KLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAI  710
            K  K  E W N  K +    +  +  E     + LSY  L   LK C+LY+ +  +D  I
Sbjct  760  KKRKMEESWWNEVKDSLFDHLNRESEEYSLSTMQLSYYNLTDCLKPCLLYMGMFQEDAII  819

Query  711  IVKRLVRLWIAEGFVELINSENL--EEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHD  884
             V  L+ LWIAEGFV+ I S  L  EE A GYL DL   +++ +  R +NGK+K C+VHD
Sbjct  820  RVSELISLWIAEGFVQSIESGRLLMEEAAEGYLMDLIQSNVVMVSNRRYNGKVKYCQVHD  879

Query  885  IVHEFCVREAIKEKLL  932
            +V  FC+ ++++EK +
Sbjct  880  VVLHFCLEKSLEEKFM  895



>emb|CDP08024.1| unnamed protein product [Coffea canephora]
Length=703

 Score =   131 bits (329),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 113/183 (62%), Gaps = 4/183 (2%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAA---KIDEVTDGE  175
            G+GKTT+AR +Y  P V+ HF +  W  VSQ ++ R++L+ +L +      +I E+ D +
Sbjct  3    GLGKTTVARRVYNSPTVTYHFHVRAWCTVSQVYEKRQLLLQILADIRGLTDRISEMNDED  62

Query  176  LAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSG  355
            L  KL++CL   RYLIV+DD+W   ++E ++  FPDD+  SRIL+TTR + +A   +   
Sbjct  63   LQIKLRQCLLRNRYLIVMDDVWGEEAFEDLKNSFPDDHNGSRILVTTRSRGLALEINPH-  121

Query  356  NRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKT  535
               ++L  L+++ES+ L        +  P EL  +G+++  +C GLPLAIVVVAG+   T
Sbjct  122  REPYSLRALSEDESFRLLKMKVFNEEDCPKELVAVGKEIARQCRGLPLAIVVVAGILAMT  181

Query  536  QQN  544
            + +
Sbjct  182  EMS  184


 Score =   107 bits (268),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = +3

Query  552  EWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVR  731
            EW+      +S V+  D   Q   +L LSY YLP +LK C LY+ ++ KD  I+V +LVR
Sbjct  187  EWKKIANSLSSQVLN-DPEAQGQSVLELSYQYLPEYLKPCFLYMGVLDKDRDILVSKLVR  245

Query  732  LWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVRE  911
            LW+AEG +    ++++E++A  +L DL D+SL+ I +R  NGK+K CR+H ++ +FC  +
Sbjct  246  LWLAEGLIPKTQTKSVEDLAEDFLMDLIDKSLVIISQRRSNGKVKACRLHSLMLDFCKSK  305

Query  912  A  914
            A
Sbjct  306  A  306



>emb|CDP08428.1| unnamed protein product [Coffea canephora]
Length=1275

 Score =   124 bits (311),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 102/184 (55%), Gaps = 5/184 (3%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLL----NNEAAKIDEVTDG  172
            G+GKTT+   +Y DP V  HF +  W  VSQ +  R +LV +L       + +  E+ + 
Sbjct  593  GLGKTTIVNKVYSDPSVKFHFHVHAWCCVSQAYSKRSLLVQILCCIDGGSSIQYVEMNED  652

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ++A KL K L+  RYLI+LDD+W    W+ ++   PDD  RSRILLT+R + ++      
Sbjct  653  DMADKLHKFLKRNRYLIILDDVWDIDGWDLLKHSLPDDCNRSRILLTSRFQNLSLQM-KP  711

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
             ++ H L  L  +ES +L  K   G Q  P  L  +   V   C GLPLA+++VAG+   
Sbjct  712  DSKPHHLRPLTSKESLELLQKKLFGKQDCPPTLSEVVLHVAKYCKGLPLAVILVAGILAT  771

Query  533  TQQN  544
            TQQ+
Sbjct  772  TQQD  775


 Score =   114 bits (286),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 83/130 (64%), Gaps = 2/130 (2%)
 Frame = +3

Query  549  EEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLV  728
            + W+   +  +S +   +  E C   L  SYNYLP +LK C+LYLS   +D  I V+ L+
Sbjct  775  DSWEEVARCLSSTIFVDN--EHCMETLEHSYNYLPDYLKPCLLYLSAFQEDRDIPVRELL  832

Query  729  RLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVR  908
             LWI+EGFV+  N ++LE+VA  YL DL  RSL+   ++   G IKTCR+HD+VHEFC+ 
Sbjct  833  WLWISEGFVQQTNGKSLEDVADEYLMDLIGRSLVMATQQRSLGGIKTCRIHDLVHEFCLA  892

Query  909  EAIKEKLLNV  938
            +A +E+ L +
Sbjct  893  KAKEERFLQI  902



>ref|XP_004301649.1| PREDICTED: disease resistance protein RPM1-like [Fragaria vesca 
subsp. vesca]
Length=911

 Score =   131 bits (330),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 104/184 (57%), Gaps = 9/184 (5%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNNEAAKIDEVTDG---  172
            GGIGKTTLA+ +Y+DP V  HF++  W  V++     ++L D++   +  I     G   
Sbjct  201  GGIGKTTLAKQVYDDPEVEKHFEVRAWVTVNRSIKSGELLKDMVQQLSKVIRRRVPGVVA  260

Query  173  -----ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVAD  337
                 +L   +++ L+ +RYLIVLDDIW    W+ IQL  P++ C SRI+LTTR+ EVA 
Sbjct  261  NMDNSQLKATIKELLQERRYLIVLDDIWHLYEWDTIQLALPNNGCGSRIMLTTRNAEVAS  320

Query  338  -SADSSGNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVV  514
             +   S  +   +  +   ESWDLFC+    +   P  L+ I + ++ +C GLPLAIV +
Sbjct  321  ITRILSDGKTFVIKPVTPAESWDLFCRKVFQLNKCPPHLQDICKDILSRCEGLPLAIVTI  380

Query  515  AGVF  526
              V 
Sbjct  381  GRVL  384


 Score =   107 bits (267),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 80/137 (58%), Gaps = 0/137 (0%)
 Frame = +3

Query  528  SKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEA  707
            +K  + ++EW+   +   + +   D  +    +L LS+N LP  LK+C LYLSI P+   
Sbjct  386  TKDERRIDEWEMVARSLGAEIEGNDKLKYLKMVLLLSFNDLPYFLKSCFLYLSIFPEGHL  445

Query  708  IIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDI  887
            I   RL+RLW+AEG VE      LEEVA  YL +L +RSLIQ+ +   +G+IKTCR+H  
Sbjct  446  IERMRLIRLWVAEGLVEAKEGRTLEEVADDYLHELLNRSLIQVAETSSDGRIKTCRIHGF  505

Query  888  VHEFCVREAIKEKLLNV  938
            +HE  + ++  +    V
Sbjct  506  LHEIIISKSRDQNFTTV  522



>ref|XP_004248798.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=885

 Score =   125 bits (315),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 105/178 (59%), Gaps = 7/178 (4%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN---EAAKIDEVTDGE  175
            G+GKTTLA  +Y+ P +   F   +W  VSQ +  R++ +++++       +   + + +
Sbjct  186  GLGKTTLANKIYKHPKIGYEFFTRIWVYVSQSYRRRELFLNIISKFTRNTKQYHGMCEED  245

Query  176  LAGKLQKCL-RGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            LA ++Q+ L +G +YL+VLDD+WS  +WE I++ FP++N  +R+LLTTR  +VA   +  
Sbjct  246  LADEIQEFLGKGGKYLVVLDDVWSDEAWERIKIAFPNNNKPNRVLLTTRDSKVAKQCNPI  305

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
                H L FL ++ESW L  K        P EL   G+ +  KC GLPLAIVV+AG  
Sbjct  306  P---HDLKFLTEDESWILLEKKVFHKDKCPPELVLSGKSIAKKCKGLPLAIVVIAGAL  360


 Score =   113 bits (282),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 83/132 (63%), Gaps = 0/132 (0%)
 Frame = +3

Query  537  NKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIV  716
             KT  EW+  +   +  ++  D  E C++++ +SY+ LP  LKAC LY S  P    I  
Sbjct  364  GKTPREWKQVDDSVSEHLINRDHPENCNKLVQMSYDRLPYDLKACFLYCSAFPGGFQIPA  423

Query  717  KRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHE  896
             +L+RLWIAEGF++     +LE      L DL +R+L+ + +R  +G+IKTCR+HD++HE
Sbjct  424  WKLIRLWIAEGFIQYKGHLSLECKGEDNLNDLINRNLVMVMERTSDGQIKTCRLHDMLHE  483

Query  897  FCVREAIKEKLL  932
            FC +EA+KE+ L
Sbjct  484  FCRQEAMKEENL  495



>ref|XP_009588714.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=882

 Score =   134 bits (338),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 109/177 (62%), Gaps = 6/177 (3%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN---EAAKIDEVTDG  172
             G GKTT AR LY +  +  HFD+  W ++SQ ++ +++L ++ N       K+DEV  G
Sbjct  153  AGQGKTTFARKLYNNDNIVYHFDVRAWCIISQTYNRQELLQEIFNQVTGSKGKVDEV--G  210

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            ELA  L+K L G+RYLIVLDD+W  ++WE ++L FP+ +  SRI++TTR +EV       
Sbjct  211  ELADMLRKRLIGRRYLIVLDDMWDIKAWEDLRLSFPNGDTGSRIIVTTRLEEVGKQVKHD  270

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGV  523
             +  ++L FL ++ES  L  K     ++ P EL+ +   V  +C GLPL I++VAG+
Sbjct  271  TDP-YSLPFLTRDESLKLLQKKVFQKEACPHELQDVSLAVAKRCKGLPLVIILVAGI  326


 Score =   104 bits (259),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 72/103 (70%), Gaps = 1/103 (1%)
 Frame = +3

Query  627  LTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENL-EEVAHGYL  803
            + LSY+ LP  LK C+LY+ + P+D  I V +L+ LWIAEGF++ I SE L EE A GYL
Sbjct  359  MQLSYDNLPDSLKPCLLYMGMFPEDARIPVSKLISLWIAEGFMQNIESERLMEEAAEGYL  418

Query  804  QDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLL  932
             DL   +++ ++ R +NGK+K C+VHD+V  FC+ ++ +EK +
Sbjct  419  MDLISSNVVIVESRKYNGKVKYCQVHDVVLHFCLEKSREEKFM  461



>emb|CDP15591.1| unnamed protein product [Coffea canephora]
Length=792

 Score =   129 bits (323),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 86/128 (67%), Gaps = 1/128 (1%)
 Frame = +3

Query  555  WQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRL  734
            W+   K   SL      +EQC RIL LSY +LP HLK CILY     +D+ I V+RL  L
Sbjct  253  WEEVAKMV-SLTAMVGATEQCRRILKLSYRHLPDHLKRCILYFGAFREDQEICVRRLTWL  311

Query  735  WIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREA  914
            WIAEGFV+   SE LE++A GY++ L +RSL+ + +R + G++KTCR+HD++H FCV++A
Sbjct  312  WIAEGFVQKSESECLEKIAEGYIRALINRSLVMVGQRRYAGEVKTCRIHDLLHVFCVKKA  371

Query  915  IKEKLLNV  938
             K+  L +
Sbjct  372  KKQNFLQL  379


 Score =   110 bits (274),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 59/179 (33%), Positives = 103/179 (58%), Gaps = 11/179 (6%)
 Frame = +2

Query  2    GGIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLN--NEAAKIDEVTDGE  175
             G+GKT LA+ +Y DP ++SHF I  W+ +SQ +  + +L+ +L   ++  +  E  + +
Sbjct  74   AGLGKTFLAQRVYRDPRITSHFHIQAWSYISQTYCKKDLLLQILACIDQKTQFSEKDEYQ  133

Query  176  LAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSG  355
            LA +L +CL  +R+LIVLDD+W   +W  ++  FP+ N  SRILLT+R  ++        
Sbjct  134  LALELWQCLLRQRFLIVLDDVWDIEAWNALKSSFPEKNNGSRILLTSRLTDIV-------  186

Query  356  NRLHTLGFLNQEESWDLFCKSFPGIQSLPFELET--IGRKVVDKCHGLPLAIVVVAGVF  526
             +   L  L++ ES +L  K    I+   +  E   +G K+   C+G+PL+I +++G+ 
Sbjct  187  GKPCNLRTLSESESCELLQKKLAVIREGGYSQEQNLLGWKIAKTCNGMPLSIAIISGIL  245



>gb|AAV88067.1| NBS-LRR protein [Ipomoea batatas]
Length=779

 Score =   122 bits (306),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 90/167 (54%), Gaps = 9/167 (5%)
 Frame = +3

Query  525   FSKLNKTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDE  704
              SK +   +EW   +K+   L V         R LT +YN LP HLK C LY  + PK  
Sbjct  374   LSKCDNIRQEWNKVQKEIELLGVLD------RRALTHTYNQLPQHLKVCFLYFGVFPKRS  427

Query  705   AIIVKRLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQK-RHFNGKIKTCRVH  881
             AI VK L+RLWIAEGF+     + LE  A+ YLQ+  DRSLI I      +GKIK CR+H
Sbjct  428   AIKVKLLMRLWIAEGFINPFEGKELECQAYKYLQEFIDRSLILIDNWSSSSGKIKNCRMH  487

Query  882   DIVHEFCVREAIKEKLLNVDNKQHPSCGELQQ--EGCRWLNFWPKKI  1016
               +H FCVREA KE +    N      G +    + CRWL+F+  K 
Sbjct  488   SALHSFCVREAQKEGIFCALNTLQLPRGSISMFAKSCRWLSFYTHKF  534


 Score =   116 bits (290),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 108/186 (58%), Gaps = 16/186 (9%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQK--HDVRKMLVDLLNNEA-AKIDEVTDGE  175
            GIGKTTLAR +YE+ LV+ HF++  W  +S    ++  +ML  LL   A A  DE+  G 
Sbjct  187  GIGKTTLARSVYENALVAGHFEVRSWVSMSGAGGYNQSRMLHHLLWTLAEADDDEIKKGS  246

Query  176  L-------AGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRH-KEV  331
            +       A ++ KCL+GKRYLIVLD++ +  +   I+ C PDD   SRI++TT H    
Sbjct  247  IPDDDDVAAEQICKCLKGKRYLIVLDNLPNNEACYDIRHCLPDDTNGSRIVITTTHFVRR  306

Query  332  ADSADSSGNRLHTLGFLNQEESWDLFCKSFPGIQ----SLPFELETIGRKVVDKCHGLPL  499
             D  D S + +H +  L+ EESW LFC + P ++      P   + I  +VV+ C GLP 
Sbjct  307  GDYDDDSNSYIHNMTLLDPEESWTLFCNN-PFLKLKEHRAPPIFKEIRSQVVEICEGLPH  365

Query  500  AIVVVA  517
            +I+VVA
Sbjct  366  SILVVA  371



>emb|CDP04754.1| unnamed protein product [Coffea canephora]
Length=875

 Score =   127 bits (320),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 110/184 (60%), Gaps = 8/184 (4%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN----EAAKIDEVTDG  172
            G+GKTTLA  +Y  P V SHF I  W  VSQ++    +LV +L++       +  E+ +G
Sbjct  150  GLGKTTLANAVYTSPSVMSHFHIRGWCTVSQEYSNHNLLVQILSSINSGNPNQYLEMNEG  209

Query  173  ELAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSS  352
            +LA KL++ L   RYL+VLDD+W   +W  ++   PDD   SRIL+T+R + ++  ADS 
Sbjct  210  DLAIKLKQDLLKNRYLLVLDDLWGIEAWNFLEKLLPDDAKGSRILITSRLQNLS-LADSK  268

Query  353  GNRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFK  532
                H+L +L++EESW+L  K   G +    +L  +G ++   C GLPL IV+VAG+   
Sbjct  269  A---HSLRYLSEEESWELMQKKLVGKEGHLAKLSGVGFQIAKSCGGLPLTIVLVAGILAA  325

Query  533  TQQN  544
            T ++
Sbjct  326  TAED  329


 Score =   110 bits (276),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 82/126 (65%), Gaps = 1/126 (1%)
 Frame = +3

Query  564  FEKQTNSLVVTTDLSEQ-CSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWI  740
             EK   SL  ++ L ++ C + L LSY++L   LK C LY S   +DE I V+RL+ LWI
Sbjct  331  LEKVAESLTSSSVLEDKSCMKTLDLSYSHLSGDLKPCFLYFSAFQEDENIPVRRLLWLWI  390

Query  741  AEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIK  920
            +E FV+    ++LE+ A+ +L+DL DRSL+ + K    G  K CR+HD+VHEFCV++A +
Sbjct  391  SERFVQKTEGKSLEDAANDFLKDLVDRSLVMVSKHRTMGGAKACRIHDLVHEFCVKKAKE  450

Query  921  EKLLNV  938
            E  L++
Sbjct  451  ENFLHI  456



>ref|XP_009787864.1| PREDICTED: LOW QUALITY PROTEIN: late blight resistance protein 
R1-A-like [Nicotiana sylvestris]
Length=1261

 Score =   133 bits (335),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 106/182 (58%), Gaps = 4/182 (2%)
 Frame = +2

Query  5    GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN---EAAKIDEVTDGE  175
            G+GKTTLA  LY D LV SHFDI     VSQ +    +L+ LL +   E +   E    E
Sbjct  577  GLGKTTLAYRLYSDRLVVSHFDIRADFCVSQVYSRTDLLLALLRDVISENSDXREKKADE  636

Query  176  LAGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSG  355
            LA  L+K L  KRYLI++DD+W    W+ +  CF D N  SRI+LTTR+ E+A+ A    
Sbjct  637  LADLLRKALFSKRYLILVDDVWEASVWDDLMGCFQDANNGSRIILTTRNLEIAEYARFQS  696

Query  356  NRLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVFFKT  535
            N L +L   N EESW L  K   G +  P  L TIGR++  KC  LPL++ +VAGV  + 
Sbjct  697  NPL-SLRMFNDEESWKLLRKKVFGEEICPPLLMTIGRQIAKKCGQLPLSVALVAGVLAEV  755

Query  536  QQ  541
            ++
Sbjct  756  EK  757


 Score =   105 bits (261),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 76/122 (62%), Gaps = 7/122 (6%)
 Frame = +3

Query  624  ILTLSYNYLPLHLKACILYLSIVPKDEAIIVKRLVRLWIAEGFVELINSENLEEVAHGYL  803
            I+ +SY  LP HL++C LY     +D  I V +L+RLWI+EGFV+    ++LE++A GYL
Sbjct  780  IIEISYQILPYHLRSCFLYFGAFLEDNVINVSKLIRLWISEGFVKSCEGKSLEDIAEGYL  839

Query  804  QDLADRSLIQIQKRHFNGKIKTCRVHDIVHEFCVREAIKEKLL-------NVDNKQHPSC  962
             +L  R+L+   KR   GKIK CRVHD++H+FC   A +E L+       N ++  + SC
Sbjct  840  GNLIGRNLVMGTKRSSRGKIKACRVHDLLHDFCKVRAKEENLVLFIYRDQNANSPSNVSC  899

Query  963  GE  968
             E
Sbjct  900  VE  901



>gb|AAF76308.1| Prf [Solanum pimpinellifolium]
Length=1824

 Score =   139 bits (349),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 112/176 (64%), Gaps = 3/176 (2%)
 Frame = +2

Query  5     GIGKTTLARMLYEDPLVSSHFDILVWTVVSQKHDVRKMLVDLLNN--EAAKIDEVTDGEL  178
             G+GKTTLA+ +Y DP V+S FD+    VV+Q +  R++L+ +LN+  E +  +E  DGE+
Sbjct  1125  GLGKTTLAKKIYNDPEVTSRFDVHAQCVVTQLYSWRELLLTILNDVLEPSDRNEKEDGEI  1184

Query  179   AGKLQKCLRGKRYLIVLDDIWSTRSWEGIQLCFPDDNCRSRILLTTRHKEVADSADSSGN  358
             A +L++ L  KR+LI++DD+W  + W+ + +CF D + RSRI+LTTR  +VA+      +
Sbjct  1185  ADELRRFLLTKRFLILIDDVWDYKVWDNLCMCFSDVSNRSRIILTTRLNDVAEYVKCESD  1244

Query  359   RLHTLGFLNQEESWDLFCKSFPGIQSLPFELETIGRKVVDKCHGLPLAIVVVAGVF  526
               H L     +ESW L  K     +S P ELE +G ++   C GLPL++V+VAGV 
Sbjct  1245  P-HHLRLFRDDESWTLLQKEVFQGESCPPELEDVGFEISKSCRGLPLSVVLVAGVL  1299


 Score = 99.8 bits (247),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 81/131 (62%), Gaps = 2/131 (2%)
 Frame = +3

Query  540   KTVEEWQNFEKQTNSLVVTTDLSEQCSRILTLSYNYLPLHLKACILYLSIVPKDEAIIVK  719
             KT++ W+  E+  +S  + + L E  S I+  SY  LP +LK C LY     + + I V 
Sbjct  1304  KTLDSWKVVEQSLSSQRIGS-LEESIS-IIGFSYKNLPHYLKPCFLYFGGFLQGKDIHVS  1361

Query  720   RLVRLWIAEGFVELINSENLEEVAHGYLQDLADRSLIQIQKRHFNGKIKTCRVHDIVHEF  899
             ++ +LW+AEGFV+  N +  E+ A G+L DL  R+++   ++  N K+KTCR+HD++H+F
Sbjct  1362  KMTKLWVAEGFVQANNEKGQEDTAQGFLDDLIGRNVVMAMEKRPNTKVKTCRIHDLLHKF  1421

Query  900   CVREAIKEKLL  932
             C+ +A +E  L
Sbjct  1422  CMEKAKQEDFL  1432



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2363439201630