BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25647_g1_i1 len=1730 path=[6387:0-44 188:45-46 190:47-76 6638:77-89
233:90-124 268:125-143 6656:144-161 305:162-165 309:166-228
372:229-234 378:235-270 414:271-276 420:277-296 6760:297-302
446:303-342 486:343-355 499:356-399 7201:400-482 626:483-487
631:488-557 701:558-585 @729@!:586-808 952:809-822 966:823-893
1037:894-931 1075:932-998 1142:999-1020 1164:1021-1064
1208:1065-1130 7029:1131-1145 7044:1146-1153 1297:1154-1170
1314:1171-1174 7213:1175-1207 5336:1208-1268 5396:1269-1301
1445:1302-1333 1477:1334-1362 1506:1363-1390 1534:1391-1433
1577:1434-1490 1634:1491-1516 7176:1517-1729]

Length=1730
                                                                      Score     E

ref|XP_004247056.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    667   0.0      
ref|XP_009587143.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    667   0.0      
ref|XP_006367560.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    656   0.0      
ref|XP_009761380.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    656   0.0      
emb|CAA81057.1|  UDP rhamnose: anthocyanidin-3-glucoside rhamnosy...    646   0.0      Petunia x hybrida [garden petunia]
sp|Q43716.1|UFOG_PETHY  RecName: Full=Anthocyanidin 3-O-glucosylt...    646   0.0      Petunia x hybrida [garden petunia]
gb|ABO21805.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    643   0.0      Petunia axillaris [large white petunia]
gb|ABO21820.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    643   0.0      Petunia axillaris [large white petunia]
gb|ABO21830.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    642   0.0      Petunia axillaris [large white petunia]
gb|ABO21818.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    642   0.0      Petunia axillaris [large white petunia]
gb|ABO21810.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    641   0.0      Petunia axillaris [large white petunia]
gb|ABO21828.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    641   0.0      Petunia axillaris [large white petunia]
gb|ABO21809.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    640   0.0      Petunia axillaris [large white petunia]
dbj|BAC10994.1|  rhamnosyl transferase                                  637   0.0      Nierembergia sp. NB17
emb|CAA50376.1|  anthocyanin 3 glucoside: rhamnosyltransferase          632   0.0      Petunia x hybrida [garden petunia]
ref|XP_011089649.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    612   0.0      
emb|CDP03925.1|  unnamed protein product                                607   0.0      
ref|XP_002309370.1|  hypothetical protein POPTR_0006s19340g             587   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006421028.1|  hypothetical protein CICLE_v10004868mg             558   0.0      
gb|KDO40622.1|  hypothetical protein CISIN_1g037721mg                   555   0.0      
ref|NP_001275829.1|  1,6-rhamnosyltransferase                           554   0.0      
gb|AFJ52973.1|  UDP-glycosyltransferase 1                               545   0.0      
ref|XP_002509496.1|  UDP-glucosyltransferase, putative                  530   1e-180   Ricinus communis
ref|NP_001275524.1|  anthocyanidin 3-O-glucosyltransferase-like         529   4e-180   
ref|XP_004496085.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    523   7e-178   
ref|XP_003591655.1|  UDP rhamnose anthocyanidin-3-glucoside rhamn...    521   4e-177   
ref|XP_010091273.1|  Anthocyanidin 3-O-glucosyltransferase              521   5e-177   
ref|XP_007144190.1|  hypothetical protein PHAVU_007G135800g             520   2e-176   
gb|KHN30680.1|  Anthocyanidin 3-O-glucosyltransferase                   502   8e-170   
ref|XP_003556320.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    502   2e-169   
ref|XP_003606381.1|  UDP rhamnose anthocyanidin-3-glucoside rhamn...    493   6e-166   
emb|CDP03917.1|  unnamed protein product                                489   9e-166   
ref|XP_010696238.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    492   2e-165   
ref|XP_010909266.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    491   3e-165   
ref|XP_010909163.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    488   6e-164   
gb|KHN00987.1|  Anthocyanidin 3-O-glucosyltransferase                   487   8e-164   
ref|XP_010111557.1|  Anthocyanidin 3-O-glucosyltransferase              487   2e-163   
ref|XP_010696239.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    486   3e-163   
gb|AAN40684.1|  UDP-glucosyltransferase                                 484   6e-163   Stevia rebaudiana
gb|AAR06923.1|  UDP-glycosyltransferase 79A2                            484   1e-162   Stevia rebaudiana
ref|XP_010091274.1|  Anthocyanidin 3-O-glucosyltransferase              484   3e-162   
ref|XP_008778568.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    479   2e-160   
emb|CDP03916.1|  unnamed protein product                                471   6e-159   
ref|XP_009416585.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    473   5e-158   
dbj|BAJ85176.1|  predicted protein                                      428   1e-140   
ref|NP_001067852.2|  Os11g0457300                                       426   2e-139   Oryza sativa Japonica Group [Japonica rice]
gb|EAY80827.1|  hypothetical protein OsI_36007                          424   6e-139   Oryza sativa Indica Group [Indian rice]
gb|ABA93458.1|  Flavonol 3-O-glucosyltransferase, putative, expre...    417   2e-136   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003606382.1|  UDP rhamnose anthocyanidin-3-glucoside rhamn...    410   5e-135   
ref|XP_003560486.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    411   7e-134   
ref|XP_004979714.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    407   2e-132   
ref|XP_004980748.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    406   3e-132   
ref|XP_004979787.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    403   6e-131   
ref|XP_003560487.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    400   7e-130   
ref|XP_002442800.1|  hypothetical protein SORBIDRAFT_08g003060          400   2e-129   Sorghum bicolor [broomcorn]
gb|EEE52059.1|  hypothetical protein OsJ_33813                          392   1e-126   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007025501.1|  UDP-Glycosyltransferase superfamily protein        385   6e-124   
gb|AES88578.2|  UDP-glucosyltransferase family protein                  381   2e-123   
ref|XP_010277785.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    380   3e-122   
ref|XP_002448982.1|  hypothetical protein SORBIDRAFT_05g002840          381   4e-122   Sorghum bicolor [broomcorn]
ref|XP_007025500.1|  UDP-Glycosyltransferase superfamily protein        380   5e-122   
ref|XP_006848503.1|  hypothetical protein AMTR_s00013p00259270          380   5e-122   
gb|AFJ52974.1|  UDP-glycosyltransferase 1                               375   5e-121   
ref|XP_004979244.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    377   6e-121   
ref|XP_002448983.1|  hypothetical protein SORBIDRAFT_05g002850          377   2e-120   Sorghum bicolor [broomcorn]
ref|XP_008371430.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    376   2e-120   
ref|XP_008371703.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    375   3e-120   
ref|XP_003593675.1|  Anthocyanidin 3-O-glucosyltransferase              374   9e-120   
ref|XP_009353146.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    373   2e-119   
ref|XP_010262362.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    374   3e-119   
ref|XP_002522508.1|  UDP-glucosyltransferase, putative                  371   1e-118   Ricinus communis
ref|XP_004485850.1|  PREDICTED: UDP-glycosyltransferase 79B3-like       368   2e-117   
ref|NP_001131009.1|  uncharacterized protein LOC100192114 precursor     368   2e-117   Zea mays [maize]
ref|XP_004304716.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       367   6e-117   
ref|XP_007213494.1|  hypothetical protein PRUPE_ppa022356mg             366   7e-117   
ref|XP_007213460.1|  hypothetical protein PRUPE_ppa024453mg             365   1e-116   
ref|XP_004499897.1|  PREDICTED: UDP-glycosyltransferase 79B3-like       365   2e-116   
ref|XP_006449434.1|  hypothetical protein CICLE_v10017784mg             362   5e-115   
ref|XP_011045872.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    362   5e-115   
ref|XP_007132927.1|  hypothetical protein PHAVU_011G136700g             360   2e-114   
ref|XP_010111152.1|  UDP-glycosyltransferase                            360   2e-114   
gb|KDO77743.1|  hypothetical protein CISIN_1g039043mg                   359   3e-114   
ref|XP_010260356.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    359   8e-114   
ref|XP_006449435.1|  hypothetical protein CICLE_v10015186mg             358   1e-113   
ref|XP_004307624.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       358   1e-113   
ref|XP_010260530.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    358   3e-113   
emb|CDO96715.1|  unnamed protein product                                356   4e-113   
ref|XP_008455479.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    357   6e-113   
ref|XP_008245371.1|  PREDICTED: LOW QUALITY PROTEIN: anthocyanidi...    356   6e-113   
ref|XP_008455481.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    356   1e-112   
ref|XP_007021598.1|  UDP-Glycosyltransferase superfamily protein        354   3e-112   
ref|XP_006467704.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    354   3e-112   
ref|XP_010686377.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    355   4e-112   
gb|KDP21029.1|  hypothetical protein JCGZ_21500                         352   2e-111   
ref|XP_011087015.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    352   3e-111   
ref|XP_004144602.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       352   5e-111   
gb|EYU43362.1|  hypothetical protein MIMGU_mgv1a019428mg                350   7e-111   
ref|XP_010035825.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    350   1e-110   
gb|ACU24192.1|  unknown                                                 350   2e-110   Glycine max [soybeans]
ref|XP_010062847.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    350   3e-110   
ref|XP_010035826.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    349   4e-110   
gb|KHN36711.1|  UDP-glycosyltransferase 79B6                            348   5e-110   
ref|XP_009628388.1|  PREDICTED: LOW QUALITY PROTEIN: anthocyanidi...    347   2e-109   
ref|XP_004248461.2|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    347   2e-109   
gb|AES89730.2|  UDP-glucosyltransferase family protein                  347   2e-109   
ref|XP_003530810.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    347   4e-109   
ref|XP_002316802.1|  glycosyltransferase family protein                 346   8e-109   Populus trichocarpa [western balsam poplar]
gb|KCW69983.1|  hypothetical protein EUGRSUZ_F03293                     345   1e-108   
ref|XP_010041982.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    345   2e-108   
ref|XP_010062848.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    344   3e-108   
gb|EYU41034.1|  hypothetical protein MIMGU_mgv1a006102mg                343   7e-108   
ref|XP_003607533.1|  Glucosyltransferase                                345   2e-107   
ref|XP_010245594.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    342   4e-107   
ref|XP_006377437.1|  hypothetical protein POPTR_0011s05910g             340   5e-107   
gb|ABL74480.1|  glucosyltransferase                                     341   6e-107   Ipomoea batatas [batate]
gb|KCW69984.1|  hypothetical protein EUGRSUZ_F03295                     340   6e-107   
ref|XP_011008292.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    340   9e-107   
ref|XP_003526249.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    340   1e-106   
ref|XP_011082711.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    340   2e-106   
ref|XP_002523261.1|  UDP-glucosyltransferase, putative                  339   3e-106   Ricinus communis
gb|KHN07772.1|  UDP-glycosyltransferase 79B6                            339   3e-106   
ref|XP_003539949.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    339   3e-106   
emb|CDP05961.1|  unnamed protein product                                338   3e-106   
ref|XP_003540019.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    338   4e-106   
ref|XP_002282825.3|  PREDICTED: UDP-glycosyltransferase 79B6-like       338   5e-106   Vitis vinifera
ref|XP_011082713.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    338   6e-106   
ref|XP_008383670.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    338   6e-106   
dbj|BAF75891.1|  glucosyltransferase                                    338   1e-105   Dianthus caryophyllus [carnation]
ref|XP_003607531.1|  Glucosyltransferase                                337   1e-105   
ref|XP_010093489.1|  UDP-glycosyltransferase                            337   2e-105   
ref|XP_007132682.1|  hypothetical protein PHAVU_011G115700g             337   2e-105   
sp|Q53UH4.1|DUSKY_IPONI  RecName: Full=Anthocyanidin 3-O-glucosid...    335   7e-105   Ipomoea nil [qian niu]
ref|XP_008465522.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    336   9e-105   
gb|AHJ60266.1|  anthocyanidin 3-O-glucoside-2''-O-glucosyltransfe...    335   1e-104   
ref|XP_010666234.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    335   1e-104   
ref|XP_007132838.1|  hypothetical protein PHAVU_011G128700g             335   2e-104   
ref|XP_010675464.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       334   3e-104   
sp|Q53UH5.1|DUSKY_IPOPU  RecName: Full=Anthocyanidin 3-O-glucosid...    333   4e-104   Ipomoea purpurea
gb|KDP36254.1|  hypothetical protein JCGZ_09819                         333   5e-104   
ref|XP_004164964.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       333   8e-104   
gb|KHN41619.1|  UDP-glycosyltransferase 79B6                            333   9e-104   
ref|XP_004505528.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       333   1e-103   
ref|XP_009610402.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    330   9e-103   
gb|KGN43487.1|  hypothetical protein Csa_7G041320                       330   1e-102   
ref|NP_200212.1|  UDP-glycosyltransferase 79B6                          330   1e-102   Arabidopsis thaliana [mouse-ear cress]
gb|EPS67374.1|  hypothetical protein M569_07398                         330   1e-102   
ref|XP_004144601.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       330   1e-102   
ref|XP_009767952.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    329   2e-102   
ref|XP_010098447.1|  UDP-glycosyltransferase                            329   3e-102   
ref|XP_009352834.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    329   3e-102   
ref|XP_006401633.1|  hypothetical protein EUTSA_v10013535mg             328   4e-102   
ref|XP_010674067.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       328   4e-102   
ref|XP_010537036.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       328   5e-102   
ref|XP_010442976.1|  PREDICTED: UDP-glycosyltransferase 79B6 isof...    327   6e-102   
dbj|BAN91400.1|  flavonol 3-O-glucoside (1->6) rhamnosyltransferase     322   1e-101   
dbj|BAD95885.1|  glucosyltransferase                                    327   1e-101   Ipomoea nil [qian niu]
ref|XP_007132923.1|  hypothetical protein PHAVU_011G136400g             327   1e-101   
ref|XP_004236775.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    327   1e-101   
dbj|BAD95884.1|  glucosyltransferase                                    327   1e-101   Ipomoea nil [qian niu]
gb|AES66918.2|  UDP-glucosyltransferase family protein                  327   2e-101   
ref|XP_003596667.1|  Anthocyanidin 3-O-glucosyltransferase              326   3e-101   
ref|XP_004144610.1|  PREDICTED: UDP-glycosyltransferase 79B1-like       327   3e-101   
ref|XP_009352835.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    326   6e-101   
gb|KFK27016.1|  hypothetical protein AALP_AA8G323600                    323   2e-100   
ref|XP_004301656.1|  PREDICTED: UDP-glycosyltransferase 79B3-like       324   2e-100   
ref|XP_006281795.1|  hypothetical protein CARUB_v10027966mg             323   3e-100   
ref|XP_007149722.1|  hypothetical protein PHAVU_005G093600g             323   5e-100   
ref|XP_002866013.1|  glycosyltransferase family protein                 322   6e-100   
gb|AFJ52978.1|  UDP-glycosyltransferase 1                               322   8e-100   
ref|XP_004146274.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       322   1e-99    
ref|XP_003527222.1|  PREDICTED: UDP-glycosyltransferase 79B3-like       322   1e-99    
ref|XP_004166346.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    322   1e-99    
ref|XP_004487585.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       321   2e-99    
ref|XP_006361401.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    322   2e-99    
gb|EYU44977.1|  hypothetical protein MIMGU_mgv1a006277mg                321   2e-99    
ref|XP_003596670.1|  Anthocyanidin 3-O-glucosyltransferase              321   2e-99    
ref|XP_004169305.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    321   4e-99    
gb|KGN57635.1|  hypothetical protein Csa_3G236030                       322   5e-99    
ref|XP_008226432.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       321   5e-99    
ref|XP_008455478.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    320   6e-99    
ref|XP_004487586.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       320   8e-99    
ref|XP_008226430.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       320   1e-98    
ref|XP_004238162.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       319   2e-98    
ref|XP_004293911.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       318   2e-98    
ref|XP_004487588.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       318   2e-98    
ref|XP_008456016.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    319   3e-98    
ref|XP_004487587.1|  PREDICTED: UDP-glycosyltransferase 79B1-like       318   3e-98    
ref|XP_006361070.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    318   3e-98    
ref|XP_004487584.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       318   4e-98    
gb|AES66927.2|  UDP-glucosyltransferase family protein                  318   4e-98    
ref|XP_003543299.2|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    317   9e-98    
ref|XP_010520927.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    317   2e-97    
ref|XP_003596668.1|  Anthocyanidin 3-O-glucosyltransferase              316   3e-97    
ref|XP_008226434.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       315   5e-97    
emb|CAN63557.1|  hypothetical protein VITISV_034121                     315   6e-97    Vitis vinifera
ref|XP_008349217.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    315   6e-97    
gb|EYU28028.1|  hypothetical protein MIMGU_mgv1a006231mg                315   7e-97    
gb|KHN27959.1|  UDP-glycosyltransferase 79B3                            314   1e-96    
ref|XP_003540412.2|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    313   5e-96    
ref|XP_007132948.1|  hypothetical protein PHAVU_011G138500g             312   6e-96    
ref|XP_010319271.1|  PREDICTED: UDP-glycosyltransferase 79B8 isof...    313   8e-96    
ref|XP_009132454.1|  PREDICTED: UDP-glycosyltransferase 79B6            311   8e-96    
gb|KHN27960.1|  UDP-glycosyltransferase 79B3                            314   9e-96    
emb|CDP05960.1|  unnamed protein product                                311   9e-96    
ref|XP_004487589.1|  PREDICTED: UDP-glycosyltransferase 79B1-like       311   2e-95    
ref|XP_003596675.1|  Anthocyanidin 3-O-glucosyltransferase              311   2e-95    
gb|AFK34819.1|  unknown                                                 311   2e-95    
ref|XP_004236774.1|  PREDICTED: UDP-glycosyltransferase 79B6 isof...    313   2e-95    
ref|XP_009339314.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       310   4e-95    
ref|XP_009132456.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       309   5e-95    
ref|XP_006397072.1|  hypothetical protein EUTSA_v10028656mg             309   6e-95    
gb|AEM37037.1|  UDP-glucose:flavonoid 3-O-glucosyltransferase 2         310   9e-95    
ref|XP_004144600.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       309   1e-94    
ref|XP_008355387.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       309   1e-94    
gb|KHN36713.1|  UDP-glycosyltransferase 79B6                            309   1e-94    
gb|KHN13063.1|  UDP-glycosyltransferase 79B3                            309   2e-94    
gb|AEM37036.1|  UDP-glucose:flavonoid 3-O-glucosyltransferase 1         308   2e-94    
ref|XP_007149716.1|  hypothetical protein PHAVU_005G093300g             308   3e-94    
ref|XP_003596671.1|  Anthocyanidin 3-O-glucosyltransferase              308   3e-94    
ref|XP_002282717.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       308   3e-94    Vitis vinifera
ref|XP_010695817.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    307   4e-94    
gb|AES66921.2|  UDP-glucosyltransferase family protein                  306   8e-94    
ref|XP_006281777.1|  hypothetical protein CARUB_v10027945mg             307   9e-94    
gb|EPS58858.1|  glucosyltransferase                                     306   1e-93    
ref|XP_007021621.1|  UDP-Glycosyltransferase superfamily protein        310   2e-93    
ref|XP_010446338.1|  PREDICTED: UDP-glycosyltransferase 79B6-like...    305   2e-93    
ref|XP_008226433.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       305   3e-93    
ref|XP_007213912.1|  hypothetical protein PRUPE_ppa005654mg             305   3e-93    
gb|KDO77744.1|  hypothetical protein CISIN_1g017557mg                   301   5e-93    
ref|XP_009127123.1|  PREDICTED: UDP-glycosyltransferase 79B10-like      304   8e-93    
gb|AFK39154.1|  unknown                                                 303   1e-92    
gb|AFJ52975.1|  UDP-glycosyltransferase 1                               304   1e-92    
ref|XP_006354934.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       303   2e-92    
emb|CDY28802.1|  BnaA02g09940D                                          302   3e-92    
ref|XP_003634640.2|  PREDICTED: UDP-glycosyltransferase 79B9-like       302   5e-92    
gb|AFJ52977.1|  UDP-glycosyltransferase 1                               302   9e-92    
ref|XP_003543300.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    301   1e-91    
gb|ADV71366.1|  glycosyltransferase GT10J15                             301   1e-91    
ref|XP_002867497.1|  glycosyltransferase family protein                 301   1e-91    
ref|XP_007021619.1|  UDP-Glycosyltransferase superfamily protein        302   1e-91    
ref|XP_007132949.1|  hypothetical protein PHAVU_011G138600g             301   2e-91    
gb|EYU19000.1|  hypothetical protein MIMGU_mgv1a021196mg                301   2e-91    
gb|AES66919.2|  UDP-glucosyltransferase family protein                  300   3e-91    
ref|NP_194487.1|  UDP-glycosyltransferase 79B3                          299   5e-91    Arabidopsis thaliana [mouse-ear cress]
ref|NP_189604.1|  UDP-glycosyltransferase 79B4                          298   8e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866011.1|  glycosyltransferase family protein                 298   9e-91    
ref|XP_011096374.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    298   1e-90    
emb|CDY65923.1|  BnaCnng49110D                                          298   1e-90    
ref|XP_010448113.1|  PREDICTED: UDP-glycosyltransferase 79B3-like...    298   2e-90    
ref|XP_010446317.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       298   2e-90    
ref|XP_004238163.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    298   2e-90    
dbj|BAE99810.1|  putative flavonol 3-O-glucosyltransferase              297   3e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866015.1|  UDP-glucose:flavonoid 3-O-glucosyltransferase      297   6e-90    
ref|XP_010446327.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       296   6e-90    
ref|XP_010442979.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    296   7e-90    
gb|AFJ52976.1|  UDP-glycosyltransferase 1                               296   1e-89    
gb|KDO58530.1|  hypothetical protein CISIN_1g012080mg                   296   1e-89    
ref|XP_006451768.1|  hypothetical protein CICLE_v10008184mg             296   1e-89    
ref|NP_194486.1|  UDP-glycosyltransferase 79B2                          295   2e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010482811.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    295   5e-89    
ref|XP_006401632.1|  hypothetical protein EUTSA_v10013471mg             294   7e-89    
ref|XP_010433351.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    293   9e-89    
ref|XP_010482808.1|  PREDICTED: UDP-glycosyltransferase 79B9            293   1e-88    
ref|XP_010474328.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    293   2e-88    
ref|XP_010437944.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       292   2e-88    
ref|XP_010442978.1|  PREDICTED: UDP-glycosyltransferase 79B6 isof...    290   9e-88    
emb|CAN63797.1|  hypothetical protein VITISV_026414                     290   1e-87    Vitis vinifera
ref|XP_010442973.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       290   1e-87    
ref|XP_002285222.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       290   2e-87    Vitis vinifera
ref|NP_200210.1|  UDP-glycosyltransferase 79B9                          290   2e-87    Arabidopsis thaliana [mouse-ear cress]
ref|NP_200217.1|  anthocyanidin 3-O-glucoside 2'''-O-xylosyltrans...    290   2e-87    Arabidopsis thaliana [mouse-ear cress]
gb|EEC68120.1|  hypothetical protein OsI_36026                          283   2e-87    Oryza sativa Indica Group [Indian rice]
ref|XP_006401636.1|  hypothetical protein EUTSA_v10013536mg             289   4e-87    
ref|XP_010437932.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       288   6e-87    
ref|NP_001176529.1|  Os11g0461300                                       282   7e-87    
ref|XP_010479520.1|  PREDICTED: UDP-glycosyltransferase 79B5            288   7e-87    
gb|AAM65481.1|  UDP rhamnose-anthocyanidin-3-glucoside rhamnosylt...    288   8e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010421894.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       287   2e-86    
gb|ABR18123.1|  unknown                                                 288   2e-86    Picea sitchensis
gb|AAL09791.1|  AT4g27560/T29A15_50                                     287   2e-86    
ref|XP_008386210.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       287   4e-86    
ref|XP_010496151.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       286   5e-86    
gb|EPS58859.1|  hypothetical protein M569_15954                         285   5e-86    
emb|CDY59372.1|  BnaA08g29640D                                          286   6e-86    
ref|XP_009107252.1|  PREDICTED: UDP-glycosyltransferase 79B5-like       286   6e-86    
ref|XP_006289841.1|  hypothetical protein CARUB_v10003451mg             285   1e-85    
emb|CDY03578.1|  BnaC03g68370D                                          285   1e-85    
ref|XP_010421892.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       285   2e-85    
ref|XP_010455377.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       284   3e-85    
emb|CDY43058.1|  BnaA03g12050D                                          282   5e-85    
gb|KFK35925.1|  hypothetical protein AALP_AA4G054400                    283   6e-85    
gb|KFK30258.1|  hypothetical protein AALP_AA7G237800                    283   7e-85    
ref|XP_010438412.1|  PREDICTED: UDP-glycosyltransferase 79B8            282   1e-84    
ref|XP_002872446.1|  glycosyltransferase family protein                 282   1e-84    
ref|NP_176671.1|  UDP-glycosyltransferase 79B10                         281   2e-84    
ref|XP_006393137.1|  hypothetical protein EUTSA_v10012257mg             281   3e-84    
ref|NP_176672.1|  UDP-glycosyltransferase 79B11                         281   3e-84    
emb|CDY68468.1|  BnaC03g71890D                                          280   4e-84    
ref|XP_009340549.1|  PREDICTED: UDP-glycosyltransferase 79B3-like       281   5e-84    
ref|XP_010496152.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       280   9e-84    
ref|XP_010644165.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       280   1e-83    
ref|XP_009340538.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       280   2e-83    
ref|NP_175473.1|  UDP-glycosyltransferase 79B5                          279   2e-83    
ref|XP_010455375.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       278   4e-83    
ref|XP_010455340.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       278   4e-83    
ref|NP_179877.1|  UDP-glycosyltransferase 79B8                          278   4e-83    
ref|XP_006287748.1|  hypothetical protein CARUB_v10000959mg             278   7e-83    
ref|XP_008386212.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    278   9e-83    
ref|XP_006282036.1|  hypothetical protein CARUB_v10028277mg             277   1e-82    
ref|XP_006286772.1|  hypothetical protein CARUB_v10003323mg             276   2e-82    
emb|CDY43844.1|  BnaC03g14770D                                          275   2e-82    
ref|XP_010442975.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       276   2e-82    
ref|XP_002285228.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       276   3e-82    
ref|XP_003596676.1|  Anthocyanidin 3-O-glucosyltransferase              274   3e-82    
emb|CAN63555.1|  hypothetical protein VITISV_034119                     276   4e-82    
ref|XP_006593292.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    274   6e-82    
ref|XP_006289802.1|  hypothetical protein CARUB_v10003406mg             275   7e-82    
ref|XP_006393134.1|  hypothetical protein EUTSA_v10011473mg             275   7e-82    
ref|NP_974524.1|  UDP-glycosyltransferase 79B7                          275   8e-82    
ref|XP_009147894.1|  PREDICTED: UDP-glycosyltransferase 79B5-like...    275   8e-82    
emb|CDY70505.1|  BnaAnng33940D                                          275   1e-81    
ref|XP_010093983.1|  UDP-glycosyltransferase                            275   1e-81    
ref|XP_006286630.1|  hypothetical protein CARUB_v10002468mg             274   2e-81    
ref|XP_008350006.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    275   2e-81    
dbj|BAE98680.1|  UDP rhamnose-anthocyanidin-3-glucoside rhamnosyl...    273   3e-81    
ref|XP_002888294.1|  glycosyltransferase family protein                 271   3e-80    
gb|ABR16160.1|  unknown                                                 272   3e-80    
ref|XP_002888295.1|  predicted protein                                  270   4e-80    
ref|XP_006393133.1|  hypothetical protein EUTSA_v10012012mg             270   1e-79    
ref|XP_006354953.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    268   3e-79    
ref|XP_010446347.1|  PREDICTED: UDP-glycosyltransferase 79B6-like...    267   3e-79    
gb|ABR16053.1|  unknown                                                 269   4e-79    
ref|XP_002891582.1|  glycosyltransferase family protein                 267   4e-79    
gb|ABR18376.1|  unknown                                                 268   5e-79    
ref|XP_003591656.1|  UDP rhamnose anthocyanidin-3-glucoside rhamn...    262   2e-78    
ref|XP_006373006.1|  hypothetical protein POPTR_0017s06940g             263   8e-78    
ref|XP_007021622.1|  UDP-Glycosyltransferase superfamily protein,...    262   5e-77    
emb|CDY43057.1|  BnaA03g12040D                                          259   2e-76    
emb|CBI20245.3|  unnamed protein product                                259   5e-76    
gb|KHN00988.1|  Anthocyanidin 3-O-glucosyltransferase                   249   4e-75    
gb|EYU28029.1|  hypothetical protein MIMGU_mgv1a006905mg                254   2e-74    
emb|CBI20246.3|  unnamed protein product                                254   4e-74    
ref|XP_006360080.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       251   5e-74    
ref|XP_004289519.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    253   5e-73    
ref|XP_010934404.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    253   7e-73    
gb|AEQ33588.2|  putative UDP-glucose:flavonoid glucosyltransferase      253   7e-73    
ref|XP_009800982.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    250   6e-72    
ref|XP_009132457.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       248   8e-72    
ref|XP_003596801.1|  Pentatricopeptide repeat-containing protein        257   9e-72    
ref|XP_004287868.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    249   1e-71    
ref|XP_004288503.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    248   2e-71    
sp|Q66PF2.1|URT1_FRAAN  RecName: Full=Putative UDP-rhamnose:rhamn...    248   2e-71    
gb|KDP29780.1|  hypothetical protein JCGZ_18715                         247   5e-71    
ref|XP_002315125.2|  hypothetical protein POPTR_0010s18980g             246   1e-70    
ref|XP_008788945.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    246   1e-70    
ref|XP_010683330.1|  PREDICTED: UDP-glycosyltransferase 79B6-like...    245   3e-70    
ref|XP_010683329.1|  PREDICTED: UDP-glycosyltransferase 79B6-like...    245   3e-70    
ref|XP_010938322.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    244   4e-70    
ref|XP_010683409.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       244   7e-70    
ref|XP_010646446.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    243   9e-70    
gb|AAO42032.1|  unknown protein                                         242   1e-69    
ref|XP_010547586.1|  PREDICTED: UDP-glycosyltransferase 91B1            243   1e-69    
ref|NP_192688.2|  UDP-glycosyltransferase 79B7                          241   2e-69    
gb|KFK27014.1|  hypothetical protein AALP_AA8G323200                    239   2e-69    
ref|XP_010938324.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    243   2e-69    
ref|XP_010934416.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    243   2e-69    
gb|KCW69986.1|  hypothetical protein EUGRSUZ_F03297                     241   2e-69    
ref|XP_009415710.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    241   6e-69    
ref|XP_004250157.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    241   7e-69    
ref|XP_010445097.1|  PREDICTED: UDP-glycosyltransferase 79B3-like       236   8e-69    
ref|XP_008246180.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       235   1e-68    
emb|CAN71740.1|  hypothetical protein VITISV_005149                     248   4e-68    
ref|XP_004240255.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    239   4e-68    
ref|XP_008338469.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    239   5e-68    
ref|XP_002270369.2|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    238   8e-68    
gb|KCW59683.1|  hypothetical protein EUGRSUZ_H02441                     239   9e-68    
ref|XP_010023429.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       239   1e-67    
emb|CDY65922.1|  BnaCnng49100D                                          238   1e-67    
gb|KDP29791.1|  hypothetical protein JCGZ_18726                         238   1e-67    
ref|XP_006353159.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    238   2e-67    
ref|XP_010254573.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       238   2e-67    
ref|XP_007208586.1|  hypothetical protein PRUPE_ppa023071mg             238   2e-67    
ref|XP_011015214.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    238   2e-67    
dbj|BAO45905.1|  UDP-glycosyltransferase                                237   3e-67    
ref|XP_009364807.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    237   4e-67    
ref|XP_011015202.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    236   5e-67    
gb|EYU30925.1|  hypothetical protein MIMGU_mgv1a005472mg                237   5e-67    
gb|ACE87855.1|  UDP-glucosyltransferase                                 236   9e-67    
ref|XP_006354893.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       229   2e-66    
ref|XP_008807755.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    234   3e-66    
ref|XP_006360400.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    234   5e-66    
emb|CBI20248.3|  unnamed protein product                                238   1e-65    
gb|KDP29789.1|  hypothetical protein JCGZ_18724                         233   1e-65    
ref|XP_010023433.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       233   2e-65    
ref|XP_008788932.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    232   5e-65    
ref|XP_008236334.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    231   5e-65    
gb|KHG23094.1|  hypothetical protein F383_29773                         230   5e-65    
ref|XP_010051440.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       231   6e-65    
ref|XP_008779257.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    229   7e-65    
gb|KDP29785.1|  hypothetical protein JCGZ_18720                         230   9e-65    
ref|XP_010023432.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       230   1e-64    
gb|KHN19033.1|  UDP-glycosyltransferase 79B6                            225   1e-64    
gb|AAM53963.1|AF515727_1  UDP-glucosyltransferase                       230   1e-64    
gb|KDP29783.1|  hypothetical protein JCGZ_18718                         230   1e-64    
ref|XP_009767381.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    230   2e-64    
ref|XP_006852904.1|  hypothetical protein AMTR_s00033p00224400          229   2e-64    
emb|CDP01583.1|  unnamed protein product                                229   2e-64    
ref|XP_004250156.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    229   4e-64    
ref|XP_006401634.1|  hypothetical protein EUTSA_v10016070mg             226   4e-64    
ref|XP_009801322.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    228   5e-64    
gb|KCW82042.1|  hypothetical protein EUGRSUZ_C03411                     228   5e-64    
gb|AFJ53032.1|  UDP-glycosyltransferase 1                               228   6e-64    
ref|XP_009623232.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    228   7e-64    
ref|XP_008789644.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    228   7e-64    
gb|KDP29779.1|  hypothetical protein JCGZ_18714                         228   7e-64    
gb|KCW59684.1|  hypothetical protein EUGRSUZ_H02443                     228   8e-64    
ref|XP_010023430.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       228   8e-64    
ref|XP_004288529.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       228   9e-64    
ref|XP_009606311.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    227   2e-63    
ref|XP_009788298.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    227   2e-63    
ref|XP_010680364.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    226   2e-63    
dbj|BAK03755.1|  predicted protein                                      227   2e-63    
ref|XP_010277530.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       227   2e-63    
emb|CDP04856.1|  unnamed protein product                                226   2e-63    
ref|XP_009587012.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    226   4e-63    
gb|AAR06918.1|  UDP-glycosyltransferase 91D1                            226   4e-63    
gb|AFJ53031.1|  UDP-glycosyltransferase 1                               226   5e-63    
gb|EPS58464.1|  hypothetical protein M569_16352                         220   6e-63    
gb|AFW64796.1|  hypothetical protein ZEAMMB73_921632                    223   8e-63    
gb|ACU17706.1|  unknown                                                 219   9e-63    
ref|NP_199780.1|  UDP-glycosyltransferase 91C1                          225   9e-63    
ref|XP_006836292.1|  hypothetical protein AMTR_s00092p00015830          225   1e-62    
ref|XP_010910495.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    225   1e-62    
ref|XP_010049449.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       224   1e-62    
ref|XP_011099970.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    225   2e-62    
emb|CAN63798.1|  hypothetical protein VITISV_026415                     223   2e-62    
ref|XP_010060107.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    224   2e-62    
ref|XP_011017699.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       224   2e-62    
ref|XP_009803298.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       224   2e-62    
ref|XP_009623239.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    223   2e-62    
gb|KEH20103.1|  UDP-glucosyltransferase family protein                  224   3e-62    
ref|XP_009774870.1|  PREDICTED: UDP-glycosyltransferase 91C1            223   4e-62    
ref|XP_011084238.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    223   4e-62    
ref|XP_004161742.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       223   5e-62    
ref|XP_010419269.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       223   5e-62    
ref|XP_004288528.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       223   5e-62    
ref|XP_002270331.2|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    223   6e-62    
ref|XP_011084237.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       222   9e-62    
ref|XP_009623233.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       223   1e-61    
ref|XP_011073572.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    222   1e-61    
ref|XP_009408288.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       222   1e-61    
gb|AFJ53033.1|  UDP-glycosyltransferase 1                               222   1e-61    
ref|XP_011092703.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    221   2e-61    
ref|XP_002275824.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    221   2e-61    
ref|XP_010277529.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    221   3e-61    
emb|CDP01582.1|  unnamed protein product                                221   3e-61    
ref|XP_004233155.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       221   4e-61    
ref|XP_002865752.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    222   4e-61    
ref|XP_002533518.1|  UDP-glucosyltransferase, putative                  221   5e-61    
ref|XP_002318358.2|  hypothetical protein POPTR_0012s01130g             221   5e-61    
gb|EYU37211.1|  hypothetical protein MIMGU_mgv1a018729mg                220   5e-61    
emb|CDO97382.1|  unnamed protein product                                219   8e-61    
gb|AIE12480.1|  UGT3                                                    220   8e-61    
ref|XP_010905696.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    220   9e-61    
ref|XP_006852901.1|  hypothetical protein AMTR_s00033p00222830          219   1e-60    
ref|XP_010431575.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       219   1e-60    
gb|KFK32801.1|  hypothetical protein AALP_AA6G289900                    219   1e-60    
ref|XP_004955982.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    219   1e-60    
gb|AAD15567.1|  putative anthocyanidin-3-glucoside rhamnosyltrans...    219   1e-60    
ref|XP_010661830.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    219   1e-60    
ref|NP_565540.4|  UDP-glycosyltransferase 91A1                          219   2e-60    
emb|CAN80742.1|  hypothetical protein VITISV_015059                     219   2e-60    
ref|XP_002302598.1|  hypothetical protein POPTR_0002s16380g             218   2e-60    
ref|XP_011043118.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    218   3e-60    
ref|XP_009623131.1|  PREDICTED: UDP-glycosyltransferase 91C1            218   4e-60    
ref|XP_002323718.1|  hypothetical protein POPTR_0017s07030g             218   4e-60    
ref|XP_006657538.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    219   4e-60    
gb|AHL38585.1|  glycosyltransferase                                     224   5e-60    
ref|XP_010683331.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       217   6e-60    
ref|XP_006294142.1|  hypothetical protein CARUB_v10023135mg             217   7e-60    
ref|XP_008466142.1|  PREDICTED: UDP-glycosyltransferase 91C1            217   7e-60    
ref|XP_007156464.1|  hypothetical protein PHAVU_003G288200g             217   8e-60    
ref|XP_007018258.1|  UDP-Glycosyltransferase superfamily protein        217   9e-60    
ref|XP_004489092.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    216   1e-59    
ref|NP_001051624.1|  Os03g0804900                                       217   1e-59    
dbj|BAJ84800.1|  predicted protein                                      216   2e-59    
ref|XP_009112190.1|  PREDICTED: UDP-glycosyltransferase 91B1            216   2e-59    
ref|XP_010061561.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       217   2e-59    
dbj|BAK04512.1|  predicted protein                                      216   2e-59    
dbj|BAJ99561.1|  predicted protein                                      216   3e-59    
ref|XP_007134315.1|  hypothetical protein PHAVU_010G036900g             215   3e-59    
ref|XP_006451091.1|  hypothetical protein CICLE_v10010307mg             215   3e-59    
ref|XP_010472246.1|  PREDICTED: UDP-glycosyltransferase 91A1            215   4e-59    
ref|XP_010271397.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       215   5e-59    
ref|XP_010049450.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       214   5e-59    
ref|XP_004136252.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    214   5e-59    
ref|XP_002459516.1|  hypothetical protein SORBIDRAFT_02g005940          215   6e-59    
ref|XP_003552084.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       214   7e-59    
dbj|BAJ89368.1|  predicted protein                                      214   8e-59    
ref|XP_003593144.1|  Glucosyltransferase                                214   1e-58    



>ref|XP_004247056.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase-like [Solanum 
lycopersicum]
Length=469

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/468 (72%), Positives = 401/468 (86%), Gaps = 3/468 (1%)
 Frame = -3

Query  1539  EITNNHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSN  1360
             EI  N   D+LH+V+FPFFAFGHISPFVQLSNKLS+HGVK+SFF+A+GN +R+KSMLNS 
Sbjct  2     EIDGN-SNDVLHIVLFPFFAFGHISPFVQLSNKLSIHGVKVSFFTASGNANRVKSMLNSA  60

Query  1359  PCTQIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFD  1180
             P T IVPL LP VEGLPPG +STA+  P  AELL VAL+ MQPQIK+LL  L+PHFV+FD
Sbjct  61    PTTSIVPLTLPQVEGLPPGAESTAELTPVTAELLKVALDQMQPQIKSLLSNLRPHFVLFD  120

Query  1179  FAQNWLPPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTS  1000
             FAQ+WLP +A ELGIK++++SVFVAL+TAF T PAR+P P+  P++E+MKKPPP FP TS
Sbjct  121   FAQDWLPKMADELGIKSVYYSVFVALSTAFLTCPARVPQPKNCPSLEDMKKPPPAFPHTS  180

Query  999   VASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQF  820
             V S++TFEA+DF+ IFK  H GG +VYDRVL+GL GCSAILAKTC +ME PYI+YVKSQF
Sbjct  181   VTSVKTFEAQDFLYIFKSFH-GGPTVYDRVLSGLKGCSAILAKTCSQMEGPYIEYVKSQF  239

Query  819   KKPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLEL  640
             KKP+ L GPVVP+P +G L+++W +WL++FE  +VIY SFGSETFL DDQIKELALGLE 
Sbjct  240   KKPVFLVGPVVPDPPTGELEERWGNWLNKFELGSVIYSSFGSETFLTDDQIKELALGLEE  299

Query  639   TGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVC  460
             TGLPFFLVLNFPAN+DV++ELNR LP GF ERVK RGIIHSGWVQQQQIL HSSVGCYVC
Sbjct  300   TGLPFFLVLNFPANIDVSTELNRVLPKGFMERVKERGIIHSGWVQQQQILAHSSVGCYVC  359

Query  459   HAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKA  280
             HAGFSSVIE +VNDCQ+VMLPQKGDQFLNAKL++ DMKAGVEVNRRDEDGYF K+DI++A
Sbjct  360   HAGFSSVIEALVNDCQVVMLPQKGDQFLNAKLVSGDMKAGVEVNRRDEDGYFGKQDIKEA  419

Query  279   VQTIMGEE-GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
             V+ +M EE G   R NQ+KWKEFLL+K+IQ KFI+DLV  M+DMA ++
Sbjct  420   VEMVMMEEPGKLFRENQKKWKEFLLNKDIQCKFIEDLVYEMKDMAKIS  467



>ref|XP_009587143.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase [Nicotiana tomentosiformis]
Length=494

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/481 (70%), Positives = 398/481 (83%), Gaps = 5/481 (1%)
 Frame = -3

Query  1569  ATGKSRIMEREITNNHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNV  1390
             A   +   E  + N+   D+LHVV+FPFFAFGHISPFVQL+NKLS HGVK+SFF+A+GN 
Sbjct  13    AHSHNYTTESIMKNDKSNDVLHVVMFPFFAFGHISPFVQLANKLSSHGVKVSFFTASGNA  72

Query  1389  DRIKSMLNSNPCTQIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLV  1210
              R+KSMLNS P T IVPL LP VEGLPPG +STA+  P  AELL V L+LMQPQIK LL 
Sbjct  73    SRVKSMLNSAPTTHIVPLTLPQVEGLPPGAESTAELTPVTAELLKVGLDLMQPQIKTLLS  132

Query  1209  ELKPHFVIFDFAQNWLPPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMK  1030
              LKPHFV+FDFAQ WLP +A ELGIKT+F+SVFVAL+TAF T PAR+P  ++ P++E+MK
Sbjct  133   HLKPHFVLFDFAQEWLPKMAVELGIKTVFYSVFVALSTAFLTCPARVPEAKKYPSLEDMK  192

Query  1029  KPPPGFPPTSVASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEA  850
             KPPPGFP TSV S+RTFEARDF+ IFK  H GG +VYDRVL+GL GCSAILAKTC +ME 
Sbjct  193   KPPPGFPHTSVTSVRTFEARDFLYIFKSFH-GGPTVYDRVLSGLKGCSAILAKTCSQMEG  251

Query  849   PYIDYVKSQFKKPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQ  670
             PYI+YVK+QF KP+ L GPVVP+P SG L+++W+ WL++FE  TVIYCSFGSETFLKD+Q
Sbjct  252   PYIEYVKAQFNKPVFLVGPVVPDPPSGKLEERWSSWLNKFEAGTVIYCSFGSETFLKDEQ  311

Query  669   IKELALGLELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQIL  490
             IKELALGLE TGLPFFLVLNFPANVD ++ELNRALP GF ERVK +GIIHSGWVQQQ IL
Sbjct  312   IKELALGLEQTGLPFFLVLNFPANVDFSAELNRALPKGFMERVKEKGIIHSGWVQQQHIL  371

Query  489   VHSSVGCYVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDG  310
              H+SVGCYVCHAGFSSVIE +VNDCQ+VMLPQKGDQFLNAKL++ DMKAGVEVNRRDEDG
Sbjct  372   AHTSVGCYVCHAGFSSVIEALVNDCQVVMLPQKGDQFLNAKLVSGDMKAGVEVNRRDEDG  431

Query  309   YFWKEDIQKAVQTIMGE----EGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATM  142
             YF KEDI++AV+ +M E     G   R NQ+KWKEFLL+K+IQ KFI+DL+  M  MA +
Sbjct  432   YFGKEDIKEAVEMVMVEIDKQPGKLIRENQKKWKEFLLNKDIQCKFIEDLLHEMMAMAKV  491

Query  141   N  139
             +
Sbjct  492   S  492



>ref|XP_006367560.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase-like [Solanum 
tuberosum]
Length=472

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/466 (71%), Positives = 393/466 (84%), Gaps = 5/466 (1%)
 Frame = -3

Query  1524  HGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQI  1345
             +  D+LH+V+FPFFAFGHISPFVQLSNKLS HGVK+SFF+A+GN  R+KSMLNS P T I
Sbjct  6     NSNDVLHIVMFPFFAFGHISPFVQLSNKLSFHGVKVSFFTASGNASRVKSMLNSAPTTCI  65

Query  1344  VPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNW  1165
             VPL LP VEGLPPG +STA+  P  AELL VAL+ MQPQIK+LL  LKPHFV+FDFAQ+W
Sbjct  66    VPLTLPQVEGLPPGAESTAELTPITAELLKVALDQMQPQIKSLLSNLKPHFVLFDFAQDW  125

Query  1164  LPPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLR  985
             LP +A ELGIK++++SVFVAL+TAF T PAR+P P+  P++E+MKKPPPGFP TSV S++
Sbjct  126   LPKMADELGIKSVYYSVFVALSTAFLTCPARVPQPKNYPSLEDMKKPPPGFPHTSVTSVK  185

Query  984   TFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLL  805
             TFEA+DF+ IFK  H GG +VYDRVL+GL GCSAILAKTC +ME PYI+YVKSQFKKP+ 
Sbjct  186   TFEAQDFLYIFKSFH-GGPTVYDRVLSGLKGCSAILAKTCSQMEGPYIEYVKSQFKKPVF  244

Query  804   LAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPF  625
             L GPVVP+P SG L+++W +WL++FE  TVIY SFGSETFL DDQIKELALGLE TGLPF
Sbjct  245   LVGPVVPDPPSGELEERWGNWLNKFESGTVIYSSFGSETFLTDDQIKELALGLEETGLPF  304

Query  624   FLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFS  445
             FLVLNFPAN+DV++ELNR LP GF ERVK RGI+HSGWVQQQ IL HSSVGCYVCHAGFS
Sbjct  305   FLVLNFPANIDVSAELNRVLPKGFMERVKERGIVHSGWVQQQHILAHSSVGCYVCHAGFS  364

Query  444   SVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM  265
             SVIE +VNDCQ+VMLPQKGDQFLNAKL++ DMKAGVEVNRRDEDGYF K+DI++AV+ +M
Sbjct  365   SVIEALVNDCQVVMLPQKGDQFLNAKLVSGDMKAGVEVNRRDEDGYFGKQDIKEAVEMVM  424

Query  264   ----GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
                  E G   R NQ+KWKEFLL+ +IQ KFI+DLV  M+ M  ++
Sbjct  425   MEVDKEPGKFFRENQKKWKEFLLNTDIQCKFIEDLVYEMKAMVKIS  470



>ref|XP_009761380.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase [Nicotiana sylvestris]
Length=494

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/475 (71%), Positives = 393/475 (83%), Gaps = 9/475 (2%)
 Frame = -3

Query  1551  IMEREITNNHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSM  1372
             IME E +N    D+LHVV+FPFFAFGHISPFVQL+NKLS H VK+SFF+A+GN  R+KSM
Sbjct  23    IMENEKSN----DVLHVVMFPFFAFGHISPFVQLANKLSSHDVKVSFFTASGNATRVKSM  78

Query  1371  LNSNPCTQIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHF  1192
             LNS P T IVPL LP VEGLPPG +STA+  P  AELL VAL+LMQPQI+ LL  LKPHF
Sbjct  79    LNSAPTTHIVPLTLPQVEGLPPGAESTAELTPVTAELLKVALDLMQPQIRTLLTHLKPHF  138

Query  1191  VIFDFAQNWLPPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGF  1012
             V+FDFAQ WLP +  ELGIKT+F+SVFVAL+TAF T PAR+P P++ P +E+M KPPPGF
Sbjct  139   VLFDFAQEWLPKMVDELGIKTVFYSVFVALSTAFLTCPARVPEPKKYPRLEDMTKPPPGF  198

Query  1011  PPTSVASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYV  832
             P TSV S++TFEARDF+ IFK  H GG +VYDRVL+GL GCSAIL KTC +ME PYI+YV
Sbjct  199   PHTSVTSVKTFEARDFLYIFKSFH-GGPTVYDRVLSGLKGCSAILVKTCSQMEGPYIEYV  257

Query  831   KSQFKKPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELAL  652
             K+QF KP+ L GPVVP+P SG L+++W+ WL++FE  TVIYCSFGSETFLKD+QIKELAL
Sbjct  258   KAQFNKPVFLVGPVVPDPPSGKLEERWSSWLNKFEAGTVIYCSFGSETFLKDEQIKELAL  317

Query  651   GLELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVG  472
             GLE TGLPFFLVLNFPANVD + ELNRALP GF ERVK +GIIHSGWVQQQ IL HSSVG
Sbjct  318   GLEQTGLPFFLVLNFPANVDFSVELNRALPQGFLERVKDKGIIHSGWVQQQHILAHSSVG  377

Query  471   CYVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKED  292
             CYVCHAGFSSVIE +VNDCQ+VMLPQKGDQFLNAKL++ DMKAGVEVNRRDEDGYF KED
Sbjct  378   CYVCHAGFSSVIEALVNDCQVVMLPQKGDQFLNAKLVSGDMKAGVEVNRRDEDGYFGKED  437

Query  291   IQKAVQTIMGE----EGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
             I++A + +M E     G   R NQ+KWKEFLL+K+IQ KFI+DLV  M  MA ++
Sbjct  438   IKEAAEMVMVEIDKQPGKLIRENQKKWKEFLLNKDIQCKFIEDLVHEMMAMAKVS  492



>emb|CAA81057.1| UDP rhamnose: anthocyanidin-3-glucoside rhamnosyltransferase 
[Petunia x hybrida]
Length=471

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/466 (71%), Positives = 389/466 (83%), Gaps = 5/466 (1%)
 Frame = -3

Query  1524  HGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQI  1345
             H  D LHVV+FPFFAFGHISPFVQL+NKLS +GVK+SFF+A+GN  R+KSMLNS P T I
Sbjct  5     HSNDALHVVMFPFFAFGHISPFVQLANKLSSYGVKVSFFTASGNASRVKSMLNSAPTTHI  64

Query  1344  VPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNW  1165
             VPL LP VEGLPPG +STA+  PA+AELL VAL+LMQPQIK LL  LKPHFV+FDFAQ W
Sbjct  65    VPLTLPHVEGLPPGAESTAELTPASAELLKVALDLMQPQIKTLLSHLKPHFVLFDFAQEW  124

Query  1164  LPPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLR  985
             LP +A  LGIKT+++SV VAL+TAF T PAR+  P++ P++E+MKKPP GFP TSV S+R
Sbjct  125   LPKMANGLGIKTVYYSVVVALSTAFLTCPARVLEPKKYPSLEDMKKPPLGFPQTSVTSVR  184

Query  984   TFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLL  805
             TFEARDF+ +FK  HNG  ++YDR+ +GL GCSAILAKTC +ME PYI YV++QF KP+ 
Sbjct  185   TFEARDFLYVFKSFHNG-PTLYDRIQSGLRGCSAILAKTCSQMEGPYIKYVEAQFNKPVF  243

Query  804   LAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPF  625
             L GPVVP+P SG L++KWA WL++FE  TVIYCSFGSETFL DDQ+KELALGLE TGLPF
Sbjct  244   LIGPVVPDPPSGKLEEKWATWLNKFEGGTVIYCSFGSETFLTDDQVKELALGLEQTGLPF  303

Query  624   FLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFS  445
             FLVLNFPANVDV++ELNRALP GF ERVK +GIIHSGWVQQQ IL HSSVGCYVCHAGFS
Sbjct  304   FLVLNFPANVDVSAELNRALPEGFLERVKDKGIIHSGWVQQQHILAHSSVGCYVCHAGFS  363

Query  444   SVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM  265
             SVIE +VNDCQ+VMLPQKGDQ LNAKL++ DM+AGVE+NRRDEDGYF KEDI++AV+ +M
Sbjct  364   SVIEALVNDCQVVMLPQKGDQILNAKLVSGDMEAGVEINRRDEDGYFGKEDIKEAVEKVM  423

Query  264   ----GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
                  E G   R NQ+KWKEFLL+K+IQSK+I +LV  M  MA ++
Sbjct  424   VDVEKEPGKLIRENQKKWKEFLLNKDIQSKYIGNLVNEMTAMAKVS  469



>sp|Q43716.1|UFOG_PETHY RecName: Full=Anthocyanidin 3-O-glucosyltransferase; AltName: 
Full=Anthocyanin rhamnosyl transferase; AltName: Full=Flavonol 
3-O-glucosyltransferase; AltName: Full=UDP-glucose flavonoid 
3-O-glucosyltransferase [Petunia x hybrida]
Length=473

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/474 (70%), Positives = 393/474 (83%), Gaps = 7/474 (1%)
 Frame = -3

Query  1548  MEREITNNHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSML  1369
             ME E+   H  D LHVV+FPFFAFGHISPFVQL+NKLS +GVK+SFF+A+GN  R+KSML
Sbjct  1     MENEM--KHSNDALHVVMFPFFAFGHISPFVQLANKLSSYGVKVSFFTASGNASRVKSML  58

Query  1368  NSNPCTQIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFV  1189
             NS P T IVPL LP VEGLPPG +STA+  PA+AELL VAL+LMQPQIK LL  LKPHFV
Sbjct  59    NSAPTTHIVPLTLPHVEGLPPGAESTAELTPASAELLKVALDLMQPQIKTLLSHLKPHFV  118

Query  1188  IFDFAQNWLPPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFP  1009
             +FDFAQ WLP +A  LGIKT+++SV VAL+TAF T PAR+  P++ P++E+MKKPP GFP
Sbjct  119   LFDFAQEWLPKMANGLGIKTVYYSVVVALSTAFLTCPARVLEPKKYPSLEDMKKPPLGFP  178

Query  1008  PTSVASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVK  829
              TSV S+RTFEARDF+ +FK  HNG  ++YDR+ +GL GCSAILAKTC +ME PYI YV+
Sbjct  179   QTSVTSVRTFEARDFLYVFKSFHNG-PTLYDRIQSGLRGCSAILAKTCSQMEGPYIKYVE  237

Query  828   SQFKKPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALG  649
             +QF KP+ L GPVVP+P SG L++KWA WL++FE  TVIYCSFGSETFL DDQ+KELALG
Sbjct  238   AQFNKPVFLIGPVVPDPPSGKLEEKWATWLNKFEGGTVIYCSFGSETFLTDDQVKELALG  297

Query  648   LELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGC  469
             LE TGLPFFLVLNFPANVDV++ELNRALP GF ERVK +GIIHSGWVQQQ IL HSSVGC
Sbjct  298   LEQTGLPFFLVLNFPANVDVSAELNRALPEGFLERVKDKGIIHSGWVQQQNILAHSSVGC  357

Query  468   YVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDI  289
             YVCHAGFSSVIE +VNDCQ+VMLPQKGDQ LNAKL++ DM+AGVE+NRRDEDGYF KEDI
Sbjct  358   YVCHAGFSSVIEALVNDCQVVMLPQKGDQILNAKLVSGDMEAGVEINRRDEDGYFGKEDI  417

Query  288   QKAVQTIM----GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
             ++AV+ +M     + G   R NQ+KWKEFLL+K+IQSK+I +LV  M  MA ++
Sbjct  418   KEAVEKVMVDVEKDPGKLIRENQKKWKEFLLNKDIQSKYIGNLVNEMTAMAKVS  471



>gb|ABO21805.1| UDP rhamnose:anthocyanidin-3-glucoside rhamnosyltransferase [Petunia 
axillaris]
 gb|ABO21806.1| UDP rhamnose:anthocyanidin-3-glucoside rhamnosyltransferase [Petunia 
axillaris]
 gb|ABO21807.1| UDP rhamnose:anthocyanidin-3-glucoside rhamnosyltransferase [Petunia 
axillaris]
 gb|ABO21808.1| UDP rhamnose:anthocyanidin-3-glucoside rhamnosyltransferase [Petunia 
axillaris]
 gb|ABO21812.1| UDP rhamnose:anthocyanidin-3-glucoside rhamnosyltransferase [Petunia 
axillaris]
 gb|ABO21813.1| UDP rhamnose:anthocyanidin-3-glucoside rhamnosyltransferase [Petunia 
axillaris]
 gb|ABO21814.1| UDP rhamnose:anthocyanidin-3-glucoside rhamnosyltransferase [Petunia 
axillaris]
 gb|ABO21815.1| UDP rhamnose:anthocyanidin-3-glucoside rhamnosyltransferase [Petunia 
axillaris]
 gb|ABO21816.1| UDP rhamnose:anthocyanidin-3-glucoside rhamnosyltransferase [Petunia 
axillaris]
 gb|ABO21817.1| UDP rhamnose:anthocyanidin-3-glucoside rhamnosyltransferase [Petunia 
axillaris]
 gb|ABO21824.1| UDP rhamnose:anthocyanidin-3-glucoside rhamnosyltransferase [Petunia 
axillaris]
 gb|ABO21825.1| UDP rhamnose:anthocyanidin-3-glucoside rhamnosyltransferase [Petunia 
axillaris]
 gb|ABO21826.1| UDP rhamnose:anthocyanidin-3-glucoside rhamnosyltransferase [Petunia 
axillaris]
 gb|ABO21827.1| UDP rhamnose:anthocyanidin-3-glucoside rhamnosyltransferase [Petunia 
axillaris]
Length=465

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/463 (71%), Positives = 388/463 (84%), Gaps = 5/463 (1%)
 Frame = -3

Query  1515  DLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPL  1336
             D LHVV+FPFFAFGHISPFVQL+NKLS +GVK+SFF+A+GN  R+KSMLNS P T IVPL
Sbjct  2     DALHVVMFPFFAFGHISPFVQLANKLSSYGVKVSFFTASGNASRVKSMLNSAPTTHIVPL  61

Query  1335  ALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPP  1156
              LP VEGLPPG +STA+  PA+AELL VAL+LMQPQIK LL  LKPHFV+FDFAQ WLP 
Sbjct  62    TLPHVEGLPPGAESTAELTPASAELLKVALDLMQPQIKTLLSHLKPHFVLFDFAQEWLPK  121

Query  1155  LAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFE  976
             +A  LGIKT+++SV VAL+TAF T PAR+  P++ P++E+MKKPP GFP TSV S+RTFE
Sbjct  122   MANGLGIKTVYYSVVVALSTAFLTCPARVLEPKKYPSLEDMKKPPLGFPQTSVTSVRTFE  181

Query  975   ARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
             ARDF+ +FK  HNG  ++YDR+ +GL GCSAILAKTC +ME PYI YV++QF KP+ L G
Sbjct  182   ARDFLYVFKSFHNG-PTLYDRIQSGLRGCSAILAKTCSQMEGPYIKYVEAQFNKPVFLIG  240

Query  795   PVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
             PVVP+P SG L++KWA WL++FE  TVIYCSFGSETFL DDQ+KELALGLE TGLPFFLV
Sbjct  241   PVVPDPPSGKLEEKWATWLNKFEGGTVIYCSFGSETFLTDDQVKELALGLEQTGLPFFLV  300

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             LNFPANVDV++ELNRALP GF ERVK +GIIHSGWVQQQ IL HSSVGCYVCHAGFSSVI
Sbjct  301   LNFPANVDVSAELNRALPEGFLERVKDKGIIHSGWVQQQHILAHSSVGCYVCHAGFSSVI  360

Query  435   EGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM---  265
             E +VNDCQ+VMLPQKGDQ LNAKL++ DM+AGVE+NRRDEDGYF KEDI++AV+ +M   
Sbjct  361   EALVNDCQVVMLPQKGDQILNAKLVSGDMEAGVEINRRDEDGYFGKEDIKEAVEKVMVDV  420

Query  264   -GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
               E G   R NQ+KWKEFLL+K+IQSK+I +LV  M  MA ++
Sbjct  421   EKEPGKLIRENQKKWKEFLLNKDIQSKYIGNLVNEMTAMAKVS  463



>gb|ABO21820.1| UDP rhamnose:anthocyanidin-3-glucoside rhamnosyltransferase [Petunia 
axillaris]
Length=465

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/463 (71%), Positives = 388/463 (84%), Gaps = 5/463 (1%)
 Frame = -3

Query  1515  DLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPL  1336
             D LHVV+FPFFAFGHISPFVQL+NKLS +GVK+SFF+A+GN  R+KSMLNS P T IVPL
Sbjct  2     DALHVVMFPFFAFGHISPFVQLANKLSSYGVKVSFFTASGNASRVKSMLNSAPTTHIVPL  61

Query  1335  ALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPP  1156
              LP VEGLPPG +STA+  PA+AELL VAL+LMQPQIK LL  LKPHFV+FDFAQ WLP 
Sbjct  62    TLPHVEGLPPGAESTAELTPASAELLKVALDLMQPQIKTLLSHLKPHFVLFDFAQEWLPK  121

Query  1155  LAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFE  976
             +A  LGIKT+++SV VAL+TAF T PAR+  P++ P++E+MKKPP GFP TSV S+RTFE
Sbjct  122   MANGLGIKTVYYSVVVALSTAFLTCPARVLEPKKYPSLEDMKKPPLGFPQTSVTSVRTFE  181

Query  975   ARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
             ARDF+ +FK  HNG  ++YDR+ +GL GCSAILAKTC +ME PYI YV++QF KP+ L G
Sbjct  182   ARDFLYVFKSFHNG-PTLYDRIQSGLRGCSAILAKTCSQMEGPYIKYVEAQFNKPVFLIG  240

Query  795   PVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
             PVVP+P SG L++KWA WL++FE  TVIYCSFGSETFL DDQ+KELALGLE TGLPFFLV
Sbjct  241   PVVPDPPSGKLEEKWATWLNKFEGGTVIYCSFGSETFLTDDQVKELALGLEQTGLPFFLV  300

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             LNFPANVDV++ELNRALP GF ERVK +GIIHSGWVQQQ IL HSSVGCYVCHAGFSSVI
Sbjct  301   LNFPANVDVSAELNRALPEGFLERVKDKGIIHSGWVQQQNILAHSSVGCYVCHAGFSSVI  360

Query  435   EGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM---  265
             E +VNDCQ+VMLPQKGDQ LNAKL++ DM+AGVE+NRRDEDGYF KEDI++AV+ +M   
Sbjct  361   EALVNDCQVVMLPQKGDQILNAKLVSGDMEAGVEINRRDEDGYFGKEDIKEAVEKVMVDV  420

Query  264   -GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
               E G   R NQ+KWKEFLL+K+IQSK+I +LV  M  MA ++
Sbjct  421   EKEPGKLIRENQKKWKEFLLNKDIQSKYIGNLVNEMTAMAKVS  463



>gb|ABO21830.1| UDP rhamnose:anthocyanidin-3-glucoside rhamnosyltransferase [Petunia 
axillaris]
Length=465

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/463 (71%), Positives = 388/463 (84%), Gaps = 5/463 (1%)
 Frame = -3

Query  1515  DLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPL  1336
             D LHVV+FPFFAFGHISPFVQL+NKLS +GVK+SFF+A+GN  R+KSMLNS P T IVPL
Sbjct  2     DALHVVMFPFFAFGHISPFVQLANKLSSYGVKVSFFTASGNASRVKSMLNSAPTTHIVPL  61

Query  1335  ALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPP  1156
              LP VEGLPPG +STA+  PA+AELL VAL+LMQPQIK LL  LKPHFV+FDFAQ WLP 
Sbjct  62    TLPHVEGLPPGAESTAELTPASAELLKVALDLMQPQIKTLLSHLKPHFVLFDFAQEWLPK  121

Query  1155  LAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFE  976
             +A  LGIKT+++SV VAL+TAF T PAR+  P++ P++E+MKKPP GFP TSV S+RTFE
Sbjct  122   MANGLGIKTVYYSVVVALSTAFLTCPARVLEPKKYPSLEDMKKPPLGFPQTSVTSVRTFE  181

Query  975   ARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
             ARDF+ +FK  HNG  ++YDR+ +GL GCSAILAKTC +ME PYI YV++QF KP+ L G
Sbjct  182   ARDFLYVFKSFHNG-PTLYDRIQSGLRGCSAILAKTCSQMEDPYIKYVEAQFNKPVFLIG  240

Query  795   PVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
             PVVP+P SG L++KWA WL++FE  TVIYCSFGSETFL DDQ+KELALGLE TGLPFFLV
Sbjct  241   PVVPDPPSGKLEEKWATWLNKFEGGTVIYCSFGSETFLTDDQVKELALGLEQTGLPFFLV  300

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             LNFPANVDV++ELNRALP GF ERVK +GIIHSGWVQQQ IL HSSVGCYVCHAGFSSVI
Sbjct  301   LNFPANVDVSAELNRALPEGFLERVKDKGIIHSGWVQQQHILAHSSVGCYVCHAGFSSVI  360

Query  435   EGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM---  265
             E +VNDCQ+VMLPQKGDQ LNAKL++ DM+AGVE+NRRDEDGYF KEDI++AV+ +M   
Sbjct  361   EALVNDCQVVMLPQKGDQILNAKLVSGDMEAGVEINRRDEDGYFGKEDIKEAVEKVMVDV  420

Query  264   -GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
               E G   R NQ+KWKEFLL+K+IQSK+I +LV  M  MA ++
Sbjct  421   EKEPGKLIRENQKKWKEFLLNKDIQSKYIGNLVNEMTAMAKVS  463



>gb|ABO21818.1| UDP rhamnose:anthocyanidin-3-glucoside rhamnosyltransferase [Petunia 
axillaris]
Length=465

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/463 (71%), Positives = 388/463 (84%), Gaps = 5/463 (1%)
 Frame = -3

Query  1515  DLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPL  1336
             D LHVV+FPFFAFGHISPFVQL+NKLS +GVK+SFF+A+GN  R+KSMLNS P T IVPL
Sbjct  2     DALHVVMFPFFAFGHISPFVQLANKLSSYGVKVSFFTASGNASRVKSMLNSAPTTHIVPL  61

Query  1335  ALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPP  1156
              LP VEGLPPG +STA+  PA+AELL VAL+LMQPQIK LL  LKPHFV+FDFAQ WLP 
Sbjct  62    TLPHVEGLPPGAESTAELTPASAELLKVALDLMQPQIKTLLSHLKPHFVLFDFAQEWLPK  121

Query  1155  LAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFE  976
             +A  LGIKT+++SV VAL+TAF T PAR+  P++ P++E+MKKPP GFP TSV S+RTFE
Sbjct  122   MANGLGIKTVYYSVVVALSTAFLTCPARVLEPKKYPSLEDMKKPPLGFPQTSVTSVRTFE  181

Query  975   ARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
             ARDF+ +FK  HNG  ++YDR+ +GL GCSAILAKTC +ME PYI YV++QF KP+ L G
Sbjct  182   ARDFLYVFKSFHNG-PTLYDRIQSGLRGCSAILAKTCSQMEGPYIKYVEAQFNKPVFLIG  240

Query  795   PVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
             PVVP+P SG L++KWA WL++FE  TVIYCSFGSETFL DDQ+KELALGLE TGLPFFLV
Sbjct  241   PVVPDPPSGKLEEKWATWLNKFEGGTVIYCSFGSETFLTDDQVKELALGLEQTGLPFFLV  300

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             LNFPANVDV++ELNRALP GF ERVK +GIIHSGWVQQQ IL HSSVGCYVCHAGFSSVI
Sbjct  301   LNFPANVDVSAELNRALPEGFLERVKDKGIIHSGWVQQQHILAHSSVGCYVCHAGFSSVI  360

Query  435   EGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM---  265
             E +VNDCQ+VMLPQKGDQ LNAKL++ DM+AGVE+NRRDEDGYF KEDI++AV+ +M   
Sbjct  361   EALVNDCQVVMLPQKGDQILNAKLVSGDMEAGVEINRRDEDGYFGKEDIKEAVEKVMVDV  420

Query  264   -GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
               + G   R NQ+KWKEFLL+K+IQSK+I +LV  M  MA ++
Sbjct  421   EKQPGKLIRENQKKWKEFLLNKDIQSKYIGNLVNEMTAMAKVS  463



>gb|ABO21810.1| UDP rhamnose:anthocyanidin-3-glucoside rhamnosyltransferase [Petunia 
axillaris]
 gb|ABO21811.1| UDP rhamnose:anthocyanidin-3-glucoside rhamnosyltransferase [Petunia 
axillaris]
 gb|ABO21819.1| UDP rhamnose:anthocyanidin-3-glucoside rhamnosyltransferase [Petunia 
axillaris]
 gb|ABO21822.1| UDP rhamnose:anthocyanidin-3-glucoside rhamnosyltransferase [Petunia 
axillaris]
 gb|ABO21823.1| UDP rhamnose:anthocyanidin-3-glucoside rhamnosyltransferase [Petunia 
axillaris]
Length=465

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/463 (71%), Positives = 388/463 (84%), Gaps = 5/463 (1%)
 Frame = -3

Query  1515  DLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPL  1336
             D LHVV+FPFFAFGHISPFVQL+NKLS +GVK+SFF+A+GN  R+KSMLNS P T IVPL
Sbjct  2     DALHVVMFPFFAFGHISPFVQLANKLSSYGVKVSFFTASGNASRVKSMLNSAPTTHIVPL  61

Query  1335  ALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPP  1156
              LP VEGLPPG ++TA+  PA+AELL VAL+LMQPQIK LL  LKPHFV+FDFAQ WLP 
Sbjct  62    TLPHVEGLPPGAENTAELTPASAELLKVALDLMQPQIKTLLSHLKPHFVLFDFAQEWLPK  121

Query  1155  LAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFE  976
             +A  LGIKT+++SV VAL+TAF T PAR+  P++ P++E+MKKPP GFP TSV S+RTFE
Sbjct  122   MANGLGIKTVYYSVVVALSTAFLTCPARVLEPKKYPSLEDMKKPPLGFPQTSVTSVRTFE  181

Query  975   ARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
             ARDF+ +FK  HNG  ++YDR+ +GL GCSAILAKTC +ME PYI YV++QF KP+ L G
Sbjct  182   ARDFLYVFKSFHNG-PTLYDRIQSGLRGCSAILAKTCSQMEGPYIKYVEAQFNKPVFLIG  240

Query  795   PVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
             PVVP+P SG L++KWA WL++FE  TVIYCSFGSETFL DDQ+KELALGLE TGLPFFLV
Sbjct  241   PVVPDPPSGKLEEKWATWLNKFEGGTVIYCSFGSETFLTDDQVKELALGLEQTGLPFFLV  300

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             LNFPANVDV++ELNRALP GF ERVK +GIIHSGWVQQQ IL HSSVGCYVCHAGFSSVI
Sbjct  301   LNFPANVDVSAELNRALPEGFLERVKDKGIIHSGWVQQQHILAHSSVGCYVCHAGFSSVI  360

Query  435   EGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM---  265
             E +VNDCQ+VMLPQKGDQ LNAKL++ DM+AGVE+NRRDEDGYF KEDI++AV+ +M   
Sbjct  361   EALVNDCQVVMLPQKGDQILNAKLVSGDMEAGVEINRRDEDGYFGKEDIKEAVEKVMVDV  420

Query  264   -GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
               E G   R NQ+KWKEFLL+K+IQSK+I +LV  M  MA ++
Sbjct  421   EKEPGKLIRENQKKWKEFLLNKDIQSKYIGNLVNEMTAMAKVS  463



>gb|ABO21828.1| UDP rhamnose:anthocyanidin-3-glucoside rhamnosyltransferase [Petunia 
axillaris]
Length=465

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/463 (71%), Positives = 387/463 (84%), Gaps = 5/463 (1%)
 Frame = -3

Query  1515  DLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPL  1336
             D LHVV+FPFFAFGHISPFVQL+NKLS +GVK+SFF+A+GN  R+KSMLNS P T IVPL
Sbjct  2     DALHVVMFPFFAFGHISPFVQLANKLSSYGVKVSFFTASGNASRVKSMLNSAPTTHIVPL  61

Query  1335  ALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPP  1156
              LP VEGLPPG +STA+  PA+AELL VAL+LMQPQIK LL  LKPHFV+FDFAQ WLP 
Sbjct  62    TLPHVEGLPPGAESTAELTPASAELLKVALDLMQPQIKTLLSHLKPHFVLFDFAQEWLPK  121

Query  1155  LAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFE  976
             +A  LGIKT+++SV VAL+TAF T PAR+  P++ P+ E+MKKPP GFP TSV S+RTFE
Sbjct  122   MANGLGIKTVYYSVVVALSTAFLTCPARVLEPKKYPSPEDMKKPPLGFPQTSVTSVRTFE  181

Query  975   ARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
             ARDF+ +FK  HNG  ++YDR+ +GL GCSAILAKTC +ME PYI YV++QF KP+ L G
Sbjct  182   ARDFLYVFKSFHNG-PTLYDRIQSGLRGCSAILAKTCSQMEGPYIKYVEAQFNKPVFLIG  240

Query  795   PVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
             PVVP+P SG L++KWA WL++FE  TVIYCSFGSETFL DDQ+KELALGLE TGLPFFLV
Sbjct  241   PVVPDPPSGKLEEKWATWLNKFEGGTVIYCSFGSETFLTDDQVKELALGLEQTGLPFFLV  300

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             LNFPANVDV++ELNRALP GF ERVK +GIIHSGWVQQQ IL HSSVGCYVCHAGFSSVI
Sbjct  301   LNFPANVDVSAELNRALPEGFLERVKDKGIIHSGWVQQQHILAHSSVGCYVCHAGFSSVI  360

Query  435   EGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM---  265
             E +VNDCQ+VMLPQKGDQ LNAKL++ DM+AGVE+NRRDEDGYF KEDI++AV+ +M   
Sbjct  361   EALVNDCQVVMLPQKGDQILNAKLVSGDMEAGVEINRRDEDGYFGKEDIKEAVEKVMVDV  420

Query  264   -GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
               E G   R NQ+KWKEFLL+K+IQSK+I +LV  M  MA ++
Sbjct  421   EKEPGKLIRENQKKWKEFLLNKDIQSKYIGNLVNEMTAMAKVS  463



>gb|ABO21809.1| UDP rhamnose:anthocyanidin-3-glucoside rhamnosyltransferase [Petunia 
axillaris]
 gb|ABO21821.1| UDP rhamnose:anthocyanidin-3-glucoside rhamnosyltransferase [Petunia 
axillaris]
 gb|ABO21829.1| UDP rhamnose:anthocyanidin-3-glucoside rhamnosyltransferase [Petunia 
axillaris]
Length=465

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/463 (71%), Positives = 388/463 (84%), Gaps = 5/463 (1%)
 Frame = -3

Query  1515  DLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPL  1336
             D LHVV+FPFFAFGHISPFVQL+NKLS +GVK+SFF+A+GN  R+KSMLNS P T IVPL
Sbjct  2     DALHVVMFPFFAFGHISPFVQLANKLSSYGVKVSFFTASGNASRVKSMLNSAPTTHIVPL  61

Query  1335  ALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPP  1156
              LP VEGLPPG ++TA+  PA+AELL VAL+LMQPQIK LL  LKPHFV+FDFAQ WLP 
Sbjct  62    TLPHVEGLPPGAENTAELTPASAELLKVALDLMQPQIKTLLSHLKPHFVLFDFAQEWLPK  121

Query  1155  LAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFE  976
             +A  LGIKT+++SV VAL+TAF T PAR+  P++ P++E+MKKPP GFP TSV S+RTFE
Sbjct  122   MANGLGIKTVYYSVVVALSTAFLTCPARVLEPKKYPSLEDMKKPPLGFPQTSVTSVRTFE  181

Query  975   ARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
             ARDF+ +FK  HNG  ++YDR+ +GL GCSAILAKTC +ME PYI YV++QF KP+ L G
Sbjct  182   ARDFLYVFKSFHNG-PTLYDRIQSGLRGCSAILAKTCSQMEDPYIKYVEAQFNKPVFLIG  240

Query  795   PVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
             PVVP+P SG L++KWA WL++FE  TVIYCSFGSETFL DDQ+KELALGLE TGLPFFLV
Sbjct  241   PVVPDPPSGKLEEKWATWLNKFEGGTVIYCSFGSETFLTDDQVKELALGLEQTGLPFFLV  300

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             LNFPANVDV++ELNRALP GF ERVK +GIIHSGWVQQQ IL HSSVGCYVCHAGFSSVI
Sbjct  301   LNFPANVDVSAELNRALPEGFLERVKDKGIIHSGWVQQQHILAHSSVGCYVCHAGFSSVI  360

Query  435   EGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM---  265
             E +VNDCQ+VMLPQKGDQ LNAKL++ DM+AGVE+NRRDEDGYF KEDI++AV+ +M   
Sbjct  361   EALVNDCQVVMLPQKGDQILNAKLVSGDMEAGVEINRRDEDGYFGKEDIKEAVEKVMVDV  420

Query  264   -GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
               E G   R NQ+KWKEFLL+K+IQSK+I +LV  M  MA ++
Sbjct  421   EKEPGKLIRENQKKWKEFLLNKDIQSKYIGNLVNEMTAMAKVS  463



>dbj|BAC10994.1| rhamnosyl transferase [Nierembergia sp. NB17]
Length=465

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/461 (71%), Positives = 386/461 (84%), Gaps = 6/461 (1%)
 Frame = -3

Query  1512  LLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCT---QIV  1342
             +LHVV+FPFFAFGHISPF QL+NKLS HGVK+SFF+A+GN  R++SMLNS P T    IV
Sbjct  6     VLHVVMFPFFAFGHISPFAQLANKLSSHGVKVSFFTASGNASRLRSMLNSAPTTTHIDIV  65

Query  1341  PLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWL  1162
             PL LP VEGLPPG++STA+  P  AELL VAL+LMQPQIK LL  LKPHFV+FDFAQ WL
Sbjct  66    PLTLPHVEGLPPGSESTAELTPVTAELLKVALDLMQPQIKTLLSHLKPHFVLFDFAQEWL  125

Query  1161  PPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRT  982
             P +A ELGIKT+F+SVFVAL+TAF T PAR+  P++ PT+E+MKKPP GFP TS+ S++T
Sbjct  126   PKMADELGIKTVFYSVFVALSTAFLTCPARVTEPKKYPTLEDMKKPPLGFPHTSITSVKT  185

Query  981   FEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLL  802
             FEA+DF+ IFK   N   +VYDRVL+GL GCSAILAKTC +ME PYI+YVKSQFKKP+LL
Sbjct  186   FEAQDFLYIFKS-FNNRPTVYDRVLSGLKGCSAILAKTCSQMEGPYIEYVKSQFKKPVLL  244

Query  801   AGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFF  622
              GPVVP+P SG L++KW  WL++FE  TVIYCSFGSETFLKDDQIKELALGLE TGLPFF
Sbjct  245   VGPVVPDPPSGKLEEKWDAWLNKFEAGTVIYCSFGSETFLKDDQIKELALGLEQTGLPFF  304

Query  621   LVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSS  442
             LVLNFPANVD ++ELNR LP GF ERVK +G+IHSGWVQQQ IL H+SVGCYVCHAGFSS
Sbjct  305   LVLNFPANVDASAELNRGLPEGFRERVKEKGVIHSGWVQQQHILAHTSVGCYVCHAGFSS  364

Query  441   VIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMG  262
             VIE  +NDCQ+VMLPQKGDQ LNAKL++ DMKAGVEVNRRDEDGYF K+DI++AV+ +M 
Sbjct  365   VIEAFMNDCQVVMLPQKGDQLLNAKLVSGDMKAGVEVNRRDEDGYFSKDDIEEAVEKVMV  424

Query  261   EEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
             E+    R NQ+KWKEFLL+K+  SKF++DLV  M  MA ++
Sbjct  425   EK--VIRENQKKWKEFLLNKDTHSKFVEDLVHDMMAMAKLS  463



>emb|CAA50376.1| anthocyanin 3 glucoside: rhamnosyltransferase [Petunia x hybrida]
 emb|CAA50377.1| anthocyanin: rhamnosyltransferase [Petunia x hybrida]
Length=473

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/474 (69%), Positives = 387/474 (82%), Gaps = 7/474 (1%)
 Frame = -3

Query  1548  MEREITNNHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSML  1369
             ME E+   H  D LHVV+FPFFAFGHISPFVQL+NKLS +GVK+SFF+A+GN  R+KSML
Sbjct  1     MENEM--KHSNDALHVVMFPFFAFGHISPFVQLANKLSSYGVKVSFFTASGNASRVKSML  58

Query  1368  NSNPCTQIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFV  1189
             NS P T IVPL LP VEGLPPG +STA+  PA+AELL VAL+LMQPQIK LL  LKPHFV
Sbjct  59    NSAPTTHIVPLTLPHVEGLPPGAESTAELTPASAELLKVALDLMQPQIKTLLSHLKPHFV  118

Query  1188  IFDFAQNWLPPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFP  1009
             +FDFAQ WLP +A  LGIKT+++SV VAL+TAF T PAR+  P++ P++E+MKKPP GFP
Sbjct  119   LFDFAQEWLPKMANGLGIKTVYYSVVVALSTAFLTCPARVLEPKKYPSLEDMKKPPLGFP  178

Query  1008  PTSVASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVK  829
              TSV S+RTFEARDF+ +FK  HNG  ++YDR+ +GL GCSAILAKTC +ME PYI YV+
Sbjct  179   QTSVTSVRTFEARDFLYVFKSFHNG-PTLYDRIQSGLRGCSAILAKTCSQMEGPYIKYVE  237

Query  828   SQFKKPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALG  649
             +QF KP+         PASG L++KWA WL++FE  TVIYCSFGSETFL DDQ+KELALG
Sbjct  238   AQFNKPVFSNRTRSSGPASGKLEEKWATWLNKFEGGTVIYCSFGSETFLTDDQVKELALG  297

Query  648   LELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGC  469
             LE TGLPFFLVLNFPANVDV++ELNRALP GF ERVK +GIIHSGWVQQQ IL HSSVGC
Sbjct  298   LEQTGLPFFLVLNFPANVDVSAELNRALPEGFLERVKDKGIIHSGWVQQQNILAHSSVGC  357

Query  468   YVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDI  289
             YVCHAGFSSVIE +VNDCQ+VMLPQKGDQ LNAKL++ DM+AGVE+NRRDEDGYF KEDI
Sbjct  358   YVCHAGFSSVIEALVNDCQVVMLPQKGDQILNAKLVSGDMEAGVEINRRDEDGYFGKEDI  417

Query  288   QKAVQTIM----GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
             ++AV+ +M     + G   R NQ+KWKEFLL+K+IQSK+I +LV  M  MA ++
Sbjct  418   KEAVEKVMVDVEKDPGKLIRENQKKWKEFLLNKDIQSKYIGNLVNEMTAMAKVS  471



>ref|XP_011089649.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase-like [Sesamum 
indicum]
Length=471

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/461 (68%), Positives = 377/461 (82%), Gaps = 5/461 (1%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             L VV+FPFFAFGHISPFVQLSNKLS  GV+ISFFS   NV RI+SML+ +P + IVPL L
Sbjct  10    LRVVMFPFFAFGHISPFVQLSNKLSSRGVRISFFSPPANVSRIRSMLHPSPTSHIVPLTL  69

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P V+GLP G  ST+D  P  +ELL VAL+LMQPQI+ LL +LKPHF++FDFAQ WLP +A
Sbjct  70    PPVQGLPSGLASTSDLTPTQSELLKVALDLMQPQIRQLLSQLKPHFILFDFAQEWLPKMA  129

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
             ++LGIKT+F+SVF+AL+TAF TVP+RLP P   P +E++K PPPGFP TSVA+++TFEAR
Sbjct  130   SDLGIKTVFYSVFIALSTAFLTVPSRLPDPGTYPALEQVKNPPPGFPATSVAAVKTFEAR  189

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
             DF+ +FK  H+    VYDRV++GL G S ILAKTC EMEAPYI YVKSQF KP+LLAGPV
Sbjct  190   DFLYMFKSFHDS-PCVYDRVISGLKGSSIILAKTCNEMEAPYIQYVKSQFNKPVLLAGPV  248

Query  789   VPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLN  610
             VPE     L+ KWADWL QFE  +VIYCSFGSETFL DDQI+ELALGLELTGLPF LVLN
Sbjct  249   VPEGRGDQLEGKWADWLGQFEAKSVIYCSFGSETFLNDDQIRELALGLELTGLPFLLVLN  308

Query  609   FPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEG  430
             FPAN D ++EL RALP G  ERVKG+G+I SGWV+QQ+IL HSSVGCY+ HAGFSSVIEG
Sbjct  309   FPANADASAELRRALPEGLMERVKGKGVISSGWVEQQKILAHSSVGCYLFHAGFSSVIEG  368

Query  429   IVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM----G  262
             ++NDCQLV+LPQKGDQFLN+KL++ D++AGVEVNRRDEDGYF KEDI++AV+++M     
Sbjct  369   LLNDCQLVLLPQKGDQFLNSKLVSGDLRAGVEVNRRDEDGYFGKEDIERAVESVMVRVDE  428

Query  261   EEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
             E G S R NQ+KW+EF+LDK +Q  FI DLVK M  +A ++
Sbjct  429   EPGKSVRGNQKKWREFVLDKGVQDSFIVDLVKEMEALAAIS  469



>emb|CDP03925.1| unnamed protein product [Coffea canephora]
Length=475

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/471 (68%), Positives = 384/471 (82%), Gaps = 10/471 (2%)
 Frame = -3

Query  1524  HGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNS---NPC  1354
             +GG  LHVV+FPFFAFGHISPFVQLS KLS+HGVKISFFSA GNV+RI+SML+S      
Sbjct  4     NGGHRLHVVMFPFFAFGHISPFVQLSKKLSLHGVKISFFSALGNVNRIQSMLHSVSAPTT  63

Query  1353  TQIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFA  1174
             TQ++PL LP VEGLPPG +STAD  PA +ELL +AL+LMQPQI +LL +LKPHFV+FDFA
Sbjct  64    TQVIPLTLPPVEGLPPGLESTADLSPAQSELLKLALDLMQPQISSLLSQLKPHFVLFDFA  123

Query  1173  QNWLPPLAAELGIKTIffsvfvalatafatVPARLPG--PERSPTVEEMKKPPPGFPPTS  1000
             Q WLPPLA++LGIKT+F+SVFVAL+T++ T+PARLP   P R P +E+++KPPPGFP TS
Sbjct  124   QEWLPPLASQLGIKTVFYSVFVALSTSYLTIPARLPEAEPTRPPAIEDLRKPPPGFPETS  183

Query  999   VASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQF  820
             + S++TFEARDF+ +FK  H GGASVYDRVL GLNGC  ILAKTC EME PY+D+V  QF
Sbjct  184   IKSMKTFEARDFLYMFKSFH-GGASVYDRVLRGLNGCDIILAKTCREMEDPYVDHVTQQF  242

Query  819   KKPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLEL  640
             KKP+LL GPVVPEP S  L+ +WA WL QFEP +VIYCSFGSETFL D+Q+KEL LGL+L
Sbjct  243   KKPVLLVGPVVPEPRSEPLEGRWASWLGQFEPKSVIYCSFGSETFLSDEQVKELLLGLDL  302

Query  639   TGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVC  460
             TGLPFF+VLNFPAN D+++EL RALP GF E+VK + +IH+GWVQQQQIL H SVGCYV 
Sbjct  303   TGLPFFVVLNFPANTDISAELKRALPEGFLEKVKHKAVIHAGWVQQQQILAHQSVGCYVF  362

Query  459   HAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKA  280
             HAGFSSV+E IVNDCQLVMLP +GDQ LNAKL++ D+KAGVEVNRRDEDGYF K+DI+ A
Sbjct  363   HAGFSSVVEAIVNDCQLVMLPVRGDQLLNAKLVSGDLKAGVEVNRRDEDGYFGKDDIKDA  422

Query  279   VQTIMG----EEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
             V  +M     E   S   N +KWKEFL + EIQ+KF+ DLVK M  +A + 
Sbjct  423   VGRVMADIDKEPAKSISGNHKKWKEFLQNSEIQTKFVSDLVKEMEAVAGLR  473



>ref|XP_002309370.1| hypothetical protein POPTR_0006s19340g [Populus trichocarpa]
 gb|EEE92893.1| hypothetical protein POPTR_0006s19340g [Populus trichocarpa]
Length=465

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/458 (63%), Positives = 367/458 (80%), Gaps = 5/458 (1%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LHVV+FPFFAFGHI PFVQLSNKLS+HGV+ISF SA GN+ RIKS L + P TQI+ L +
Sbjct  9     LHVVMFPFFAFGHICPFVQLSNKLSLHGVRISFLSAPGNIARIKSSLLATPTTQIISLPI  68

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P VEGLPPG  STA+  PA A LL  AL+LMQPQIK +L ELKPHFV FD  Q+WLP LA
Sbjct  69    PVVEGLPPGHNSTAETTPAVAGLLKKALDLMQPQIKTILAELKPHFVFFDLLQHWLPKLA  128

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
             +++GIKTI ++VF A +T++ TVPAR+     SP++ ++ KPP G+P +S+ S++ F+AR
Sbjct  129   SQIGIKTISYTVFSATSTSYLTVPARIGEEGESPSIGDLMKPPNGYPSSSITSVKAFQAR  188

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
             DF I++K   +GG ++ DR +    GC+A+L KTC EME PY+D++K+QFKKP+LL GP+
Sbjct  189   DFSIVYKS-FDGGPTICDRAVGSRLGCTAMLLKTCQEMEGPYVDFIKTQFKKPVLLTGPL  247

Query  789   VPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLN  610
             VP+P SGVLD+KWA+WL QF   +VI+CSFGSETFL  DQIKEL LGLELTGLPFFLVLN
Sbjct  248   VPDPPSGVLDEKWANWLGQFPAKSVIFCSFGSETFLNHDQIKELVLGLELTGLPFFLVLN  307

Query  609   FPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEG  430
             FPA +D  +ELN+ALP+ F ERVKGRG++H+GWVQQQ IL HSSVGCYVCH+GFSS+IE 
Sbjct  308   FPAELDSQTELNQALPSSFLERVKGRGVLHTGWVQQQLILAHSSVGCYVCHSGFSSLIEA  367

Query  429   IVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM----G  262
             +VNDCQL MLP KGDQFLN KL+A D+KAGVE+NRRDEDGYF K+DI +AV+T+M     
Sbjct  368   LVNDCQLAMLPLKGDQFLNTKLIAGDLKAGVEINRRDEDGYFGKDDICEAVKTVMLDVDK  427

Query  261   EEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
             E G S R N +KW+EFLL+ +IQ+++I +L++ ++ MA
Sbjct  428   EPGKSMRENHKKWREFLLNAQIQNQYIVELIEELKAMA  465



>ref|XP_006421028.1| hypothetical protein CICLE_v10004868mg [Citrus clementina]
 gb|ESR34268.1| hypothetical protein CICLE_v10004868mg [Citrus clementina]
Length=481

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/468 (62%), Positives = 361/468 (77%), Gaps = 11/468 (2%)
 Frame = -3

Query  1533  TNNHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPC  1354
             T +   D LHVV+FP+FAFGHISPFVQLSNKLS+HGVK+SFFSA GN+ RIKS LN  P 
Sbjct  19    TESAEADQLHVVMFPWFAFGHISPFVQLSNKLSLHGVKVSFFSAPGNIPRIKSSLNLTPM  78

Query  1353  TQIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFA  1174
               I+PL +P V+GLPPG  ST++  P  AELL  AL+LMQPQIK LL +LKPHFV FDF 
Sbjct  79    ADIIPLQIPHVDGLPPGLDSTSEMTPHMAELLKQALDLMQPQIKTLLSQLKPHFVFFDFT  138

Query  1173  QNWLPPL-AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSV  997
               WLP L  ++LGIKT+ FSVF A++ A+  VPAR    + + ++ ++ K P GFP TS+
Sbjct  139   HYWLPGLVGSQLGIKTVNFSVFSAISQAYLVVPAR----KLNNSLADLMKSPDGFPATSI  194

Query  996   ASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFK  817
              SL  F ARD++ ++ +  NGG SVY+R + G++GC  +  KTC EME PY+D+V++QFK
Sbjct  195   TSLDEFVARDYLYVYTK-FNGGPSVYERGIQGVDGCDVLAIKTCNEMEGPYLDFVRTQFK  253

Query  816   KPLLLAGPVV-PEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLEL  640
             KP+LL GP+V PEP SG L+++WA WL ++ P +VIYCSFGSETFL  DQIKELA+GLE+
Sbjct  254   KPVLLTGPLVNPEPPSGELEERWAKWLCKYPPKSVIYCSFGSETFLTVDQIKELAIGLEI  313

Query  639   TGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVC  460
             TGLPFFLVLNFP NVD  SEL R LP GF +RVK RG++H+GWVQQQ IL H SVGCYVC
Sbjct  314   TGLPFFLVLNFPPNVDAQSELVRTLPPGFMDRVKDRGVVHTGWVQQQLILRHESVGCYVC  373

Query  459   HAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKA  280
             H+GFSSV E +++DCQLV+LP KGDQFLN+KL+A D+KAGVEVNRRD DG+F KEDI KA
Sbjct  374   HSGFSSVTEAVISDCQLVLLPLKGDQFLNSKLVAGDLKAGVEVNRRDHDGHFGKEDIFKA  433

Query  279   VQTIM----GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
             V+T+M     E GAS RANQ+ W+EFLL+ +IQ KFI D VK ++ +A
Sbjct  434   VKTVMVDVNKEPGASIRANQKWWREFLLNGQIQDKFIADFVKDLKTLA  481



>gb|KDO40622.1| hypothetical protein CISIN_1g037721mg [Citrus sinensis]
Length=465

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/468 (62%), Positives = 361/468 (77%), Gaps = 11/468 (2%)
 Frame = -3

Query  1533  TNNHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPC  1354
             T +   D LHVV+FP+FAFGHISPFVQLSNKLS+HGVK+SFFSA GN+ RIKS LN  P 
Sbjct  3     TESAEADQLHVVMFPWFAFGHISPFVQLSNKLSLHGVKVSFFSAPGNIPRIKSSLNLTPM  62

Query  1353  TQIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFA  1174
               I+PL +P V+GLPPG  ST++  P  AELL  AL+LMQPQIK LL +LKPHFV FDF 
Sbjct  63    ADIIPLQIPHVDGLPPGLDSTSEMTPHMAELLKQALDLMQPQIKTLLSQLKPHFVFFDFT  122

Query  1173  QNWLPPL-AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSV  997
               WLP L  ++LGIKT+ FSVF A++ A+  VPAR    + + ++ ++ K P GFP TS+
Sbjct  123   HYWLPGLVGSQLGIKTVNFSVFSAISQAYLVVPAR----KLNNSLADLMKSPDGFPATSI  178

Query  996   ASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFK  817
              SL  F ARD++ ++ +  NGG SVY+R + G++GC  +  KTC EME PY+D+V++QFK
Sbjct  179   TSLDEFVARDYLYVYTK-FNGGPSVYERGIQGVDGCDVLAIKTCNEMEGPYLDFVRTQFK  237

Query  816   KPLLLAGPVV-PEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLEL  640
             KP+LL GP+V PEP SG L+++WA WL ++ P +VIYCSFGSETFL  DQIKELA+GLE+
Sbjct  238   KPVLLTGPLVNPEPPSGELEERWAKWLCKYPPKSVIYCSFGSETFLTVDQIKELAIGLEI  297

Query  639   TGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVC  460
             TGLPFFLVLNFP NVD  SEL R LP GF +RVK RG++H+GWVQQQ IL H SVGCYVC
Sbjct  298   TGLPFFLVLNFPPNVDGQSELVRTLPPGFMDRVKDRGVVHTGWVQQQLILRHESVGCYVC  357

Query  459   HAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKA  280
             H+GFSSV E +++DCQLV+LP KGDQFLN+KL+A D+KAGVEVNRRD DG+F KEDI KA
Sbjct  358   HSGFSSVTEAVISDCQLVLLPLKGDQFLNSKLVAGDLKAGVEVNRRDHDGHFGKEDIFKA  417

Query  279   VQTIM----GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
             V+T+M     E GAS RANQ+ W+EFLL+ +IQ KFI D VK ++ +A
Sbjct  418   VKTVMVDVNKEPGASIRANQKWWREFLLNGQIQDKFIADFVKDLKALA  465



>ref|NP_001275829.1| 1,6-rhamnosyltransferase [Citrus sinensis]
 gb|ABA18631.1| 1,6-rhamnosyltransferase [Citrus sinensis]
Length=475

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/468 (62%), Positives = 361/468 (77%), Gaps = 11/468 (2%)
 Frame = -3

Query  1533  TNNHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPC  1354
             T +   D LHVV+FP+FA GHISPFVQLSNKLS+HGVK+SFFSA GN+ RIKS LN  P 
Sbjct  13    TESAEADQLHVVMFPWFASGHISPFVQLSNKLSLHGVKVSFFSAPGNIPRIKSSLNLTPM  72

Query  1353  TQIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFA  1174
               I+PL +P V+GLPPG  ST++  P  AELL  AL+LMQPQIK LL +LKPHFV FDF 
Sbjct  73    ADIIPLQIPHVDGLPPGLDSTSEMTPHMAELLKQALDLMQPQIKTLLSQLKPHFVFFDFT  132

Query  1173  QNWLPPL-AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSV  997
               WLP L  ++LGIKT+ FSVF A++ A+  VPAR    + + ++ ++ K P GFP TS+
Sbjct  133   HYWLPGLVGSQLGIKTVNFSVFSAISQAYLVVPAR----KLNNSLADLMKSPDGFPATSI  188

Query  996   ASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFK  817
              SL  F ARD++ ++ +  NGG SVY+R + G++GC  +  KTC EME PY+D+V++QFK
Sbjct  189   TSLDEFVARDYLYVYTK-FNGGPSVYERGIQGVDGCDVLAIKTCNEMEGPYLDFVRTQFK  247

Query  816   KPLLLAGPVV-PEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLEL  640
             KP+LL GP+V PEP SG L+++WA+WL +F P +VIYCSFGSETFL  DQIKELA+GLE+
Sbjct  248   KPVLLTGPLVNPEPPSGELEERWANWLGKFPPKSVIYCSFGSETFLTVDQIKELAIGLEI  307

Query  639   TGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVC  460
             TGLPFFLVLNFP NVD  SEL R LP GF +RVK RG++H+GWVQQQ IL H SVGCYVC
Sbjct  308   TGLPFFLVLNFPPNVDGQSELVRTLPPGFMDRVKDRGVVHTGWVQQQLILRHESVGCYVC  367

Query  459   HAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKA  280
             H+GFSSV E +++DCQLV+LP KGDQFLN+KL+A D+KAGVEVNRRD DG+F KEDI KA
Sbjct  368   HSGFSSVTEAVISDCQLVLLPLKGDQFLNSKLVAGDLKAGVEVNRRDHDGHFGKEDIFKA  427

Query  279   VQTIM----GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
             V+T+M     E GAS RANQ+ W+EFLL+ +IQ KFI D VK ++ +A
Sbjct  428   VKTVMVDVNKEPGASIRANQKWWREFLLNGQIQDKFIADFVKDLKALA  475



>gb|AFJ52973.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=474

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/472 (59%), Positives = 367/472 (78%), Gaps = 8/472 (2%)
 Frame = -3

Query  1548  MEREITNNHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHG-VKISFFSAAGNVDRIKSM  1372
             M R   ++   + LHVV+FP+FAFGHISPF+QL+NKLS+HG V+ISFFSA GN+ RI + 
Sbjct  1     MVRTAESSPADEELHVVMFPWFAFGHISPFIQLANKLSLHGRVRISFFSAPGNIPRIANS  60

Query  1371  LNSNPCTQIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHF  1192
             L  +P TQI+PL +P VEGLPPG  STA+ PP  AELL +AL+LMQPQ++ LL++LKP F
Sbjct  61    LLPSPTTQIIPLPIPPVEGLPPGLDSTAELPPHLAELLKIALDLMQPQVRELLIQLKPDF  120

Query  1191  VIFDFAQNWLPPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGF  1012
             V FD  Q+WLP + ++LGIKT+ F+VF A++T + TVPAR+ G  + PTVE+MK+PP G+
Sbjct  121   VFFDHYQHWLPGMGSKLGIKTLSFTVFSAVSTGYLTVPARIEG-GKIPTVEDMKRPPKGY  179

Query  1011  PPTSVASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYV  832
             P T V  ++TF ARDF  ++K+  NGG SV DRVL   N  +A++ K+C E+E PY+DY+
Sbjct  180   PETPVDQMKTFTARDFTYVYKK-FNGGLSVIDRVLDCRNAATALVFKSCNEIEGPYLDYL  238

Query  831   KSQFKKPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELAL  652
             ++QF KP+L  GP+VPEP +G L+ +WADWL +F  S++++C+FGSETFL D+QI+ELA 
Sbjct  239   RTQFAKPVLSCGPLVPEPPTGRLEDRWADWLGRFPTSSIVFCNFGSETFLTDEQIRELAF  298

Query  651   GLELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVG  472
             GLE TGLPFFLVLNFPA +D  +EL+RALP GF ERVK RG++H+GWVQQ  IL H SVG
Sbjct  299   GLENTGLPFFLVLNFPAQLDSRTELDRALPEGFLERVKDRGVVHTGWVQQPLILAHGSVG  358

Query  471   CYVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKED  292
             CY+ HAGFSS+IEG+++DC+LV+LP KGDQ+LNAKL+  DMKAG+EV+RRDEDGYF ++D
Sbjct  359   CYLNHAGFSSLIEGLIHDCKLVLLPLKGDQYLNAKLITGDMKAGIEVDRRDEDGYFGRDD  418

Query  291   IQKAVQTIMG-----EEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             + +AV TIM      E   S R NQEKWK+FLLD E Q+K+ K+LV  ++ M
Sbjct  419   VTRAVNTIMAGDADKEPLKSIRENQEKWKKFLLDDEAQNKYAKELVAQLKAM  470



>ref|XP_002509496.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF50883.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=463

 Score =   530 bits (1366),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 266/458 (58%), Positives = 351/458 (77%), Gaps = 9/458 (2%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             +H+V+FP+ AFGHI+PFVQL NKLS+HG+++SF SA+GN+ RIKS L   P ++I+P+++
Sbjct  11    IHIVMFPWLAFGHINPFVQLCNKLSLHGIEVSFLSASGNIPRIKSSLLPTPNSRIIPISI  70

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P V GLP G  +T++  PA A+L   A++LMQPQIK LL +LKPHF++FDF   W+P +A
Sbjct  71    PPVAGLPQGLDNTSEMTPAMADLFKKAIDLMQPQIKTLLSQLKPHFILFDFLIQWIPEIA  130

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
             +ELGIKTI FSVF A++ A+  VPAR      +  V+++ KPP GFP + + S++ F+A+
Sbjct  131   SELGIKTIGFSVFSAISGAYIMVPAR----STATNVDDLMKPPTGFPSSPLISMKEFQAQ  186

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
             +   +FK   NG  SV+DRV  G + C AI+ KTC EME PYI+++ +QF+K +LLAGP+
Sbjct  187   NISYVFKHFDNG-PSVFDRVTEGHHKCDAIVFKTCNEMEGPYINFLLNQFQKRVLLAGPL  245

Query  789   VPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLN  610
             VPEP SG+L++KW  WL QF P +VI CSFGSETFL+DDQIKELALGLELTGLPF L++N
Sbjct  246   VPEPTSGLLEEKWDKWLGQFPPKSVILCSFGSETFLQDDQIKELALGLELTGLPFILIMN  305

Query  609   FPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEG  430
             F   VD   E+NR LP GF ER K RGI+H+GWVQQQ +L H SVGCY+CH+GFSS+IE 
Sbjct  306   FSVGVDAYDEINRTLPEGFLERTKDRGIVHTGWVQQQLLLAHKSVGCYLCHSGFSSLIEA  365

Query  429   IVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM----G  262
             ++NDCQLV+LP KGDQ LN+KL ++ MKAGVEVNRR+EDGYF KEDI KAV+ +M     
Sbjct  366   VINDCQLVLLPLKGDQCLNSKLFSECMKAGVEVNRRNEDGYFGKEDIDKAVRRVMVEVEK  425

Query  261   EEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
             E   S RAN +KW+EFLL++EIQ KFI +LVK ++ +A
Sbjct  426   EPSKSIRANHKKWREFLLNEEIQDKFIAELVKEIKALA  463



>ref|NP_001275524.1| anthocyanidin 3-O-glucosyltransferase-like [Glycine max]
 dbj|BAN91401.1| flavonol 3-O-glucoside (1->6) rhamnosyltransferase [Glycine max]
Length=464

 Score =   529 bits (1362),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 273/472 (58%), Positives = 350/472 (74%), Gaps = 13/472 (3%)
 Frame = -3

Query  1548  MEREITNNHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSML  1369
             M  E+  N+  D LHVV+FPF AFGHISPFVQLSNKL  HGV ++F SAA N+ RI+S L
Sbjct  1     MPSELAMNN--DELHVVMFPFLAFGHISPFVQLSNKLFSHGVHVTFLSAASNIPRIRSTL  58

Query  1368  NSNPCTQIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFV  1189
             N NP   ++ L  P       G  +TA+ PP  A  L  AL+L Q Q+K+LL+ELKPH+V
Sbjct  59    NLNPAINVISLKFPN------GITNTAELPPHLAGNLIHALDLTQDQVKSLLLELKPHYV  112

Query  1188  IFDFAQNWLPPLAAELGIKTIffsvfvalatafatVPARLPGPE-RSPTVEEMKKPPPGF  1012
              FDFAQ+WLP LA+E+GIK++ FSV+ A++ A+ TVP+R    E R+ T E++KKPPPG+
Sbjct  113   FFDFAQHWLPKLASEVGIKSVHFSVYSAISDAYITVPSRFADVEGRNITFEDLKKPPPGY  172

Query  1011  PPTSVASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYV  832
             P  S  SL+ FEA DF+ +F R      + Y+RVL  L  CS I+ KTC E+E PY+DY+
Sbjct  173   PQNSNISLKAFEAMDFMFLFTRFGEKNLTGYERVLQSLGECSFIVFKTCKEIEGPYLDYI  232

Query  831   KSQFKKPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELAL  652
             ++QF+KP+LL+GP+VPEP++ VL++KW+ WL  F   +VI CSFGSETFL D QIKELA 
Sbjct  233   ETQFRKPVLLSGPLVPEPSTDVLEEKWSKWLDGFPAKSVILCSFGSETFLSDYQIKELAS  292

Query  651   GLELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVG  472
             GLELTGLPF LVLNFP+N+   +EL RALP G+ ERVK RG++HSGW QQQ +L HSSVG
Sbjct  293   GLELTGLPFILVLNFPSNLSAKAELERALPKGYLERVKNRGVVHSGWFQQQLVLKHSSVG  352

Query  471   CYVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKED  292
             CYVCH GFSSVIE +VN+CQLV+LP KGDQF N+KL+A+D+KAGVEVNR DEDG+F KED
Sbjct  353   CYVCHGGFSSVIEAMVNECQLVLLPFKGDQFFNSKLIANDLKAGVEVNRSDEDGFFHKED  412

Query  291   IQKAVQTIM----GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
             I +A++T+M     E+G   R N  +W +FL +KEIQ+KFI DLV  ++ MA
Sbjct  413   ILEALKTVMLEDNKEQGKQIRENHMQWSKFLSNKEIQNKFITDLVAQLKSMA  464



>ref|XP_004496085.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase-like [Cicer 
arietinum]
 gb|AGU14091.1| UDP-glycosyltransferase [Cicer arietinum]
Length=462

 Score =   523 bits (1347),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 272/472 (58%), Positives = 346/472 (73%), Gaps = 15/472 (3%)
 Frame = -3

Query  1548  MEREITNNHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSML  1369
             M  E  +N+  D LHV +FPF AFGHISPFVQLSNKL  HGV+I+F SA+ N+ RIKS L
Sbjct  1     MSSEAMSNN--DKLHVFMFPFLAFGHISPFVQLSNKLFSHGVQITFLSASSNIPRIKSTL  58

Query  1368  NSNPCTQIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFV  1189
             N NP  +I+PL  P       G  STAD PP  A  L  A++  QPQ+K+L +ELKP+FV
Sbjct  59    NLNPSIKIIPLQFPN------GISSTADLPPHLAGNLIHAIDSTQPQLKSLFLELKPNFV  112

Query  1188  IFDFAQNWLPPLAAELGIKTIffsvfvalatafatVPARLPGPE-RSPTVEEMKKPPPGF  1012
              FDFAQNWLP LA+E+G+K+I FSVF A++ A+  VP+RL   E RS T E++KKPP G+
Sbjct  113   FFDFAQNWLPKLASEVGVKSIHFSVFSAISDAYIIVPSRLDDIEGRSITFEDLKKPPQGY  172

Query  1011  PPTSVASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYV  832
             P  ++  L+TFEA DF+ +F++      + Y+R L  L+ CS ++ K+C EME PYIDY+
Sbjct  173   PKNNIF-LKTFEAMDFMFLFQK-FTEDITGYERALQSLSECSYVVFKSCKEMEGPYIDYI  230

Query  831   KSQFKKPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELAL  652
             + QF K +L  GP+VPEP   VL++KW  WL  F   TVI+CSFGSET+L DDQI ELA 
Sbjct  231   EKQFGKQVLSVGPLVPEPPMDVLEEKWLKWLDNFPAKTVIFCSFGSETYLNDDQISELAT  290

Query  651   GLELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVG  472
             GLELTGLPF LVLNFP+N+   +EL R LP GF ERVK RG++HSGW+QQQ IL H+SVG
Sbjct  291   GLELTGLPFILVLNFPSNLCAKTELERTLPKGFLERVKDRGVVHSGWLQQQHILKHTSVG  350

Query  471   CYVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKED  292
             CYVCH GFSSVIE ++NDCQLV+LP KGDQF N+KL+A D++AG+EVNR +EDG+F KED
Sbjct  351   CYVCHGGFSSVIEAMINDCQLVLLPFKGDQFFNSKLIAKDLEAGIEVNRNEEDGFFHKED  410

Query  291   IQKAVQTIMGEE----GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
             I KAV+ IM E+    G S R N  KW++F+L+KE+Q KFIKDLV  ++ +A
Sbjct  411   ILKAVKIIMVEDEKEPGKSIRENHMKWRKFILNKEVQDKFIKDLVAQLKSLA  462



>ref|XP_003591655.1| UDP rhamnose anthocyanidin-3-glucoside rhamnosyltransferase [Medicago 
truncatula]
 ref|XP_003637102.1| UDP rhamnose anthocyanidin-3-glucoside rhamnosyltransferase [Medicago 
truncatula]
 gb|AES61906.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=465

 Score =   521 bits (1342),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 270/465 (58%), Positives = 345/465 (74%), Gaps = 12/465 (3%)
 Frame = -3

Query  1527  NHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQ  1348
             N+    LHV +FPF AFGHISPFVQLSNKL   GV I+F SA+ N+ +IKS LN NP  Q
Sbjct  8     NNNDHQLHVFMFPFLAFGHISPFVQLSNKLFSQGVHITFLSASSNIHKIKSTLNLNPSIQ  67

Query  1347  IVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQN  1168
             I+PL  P       G  +TA+ PP  A  L  AL+L QPQIK+LL+ELKPH+V FDFAQN
Sbjct  68    IIPLQFPN------GITNTAELPPHLAGNLIHALDLTQPQIKSLLLELKPHYVFFDFAQN  121

Query  1167  WLPPLAAELGIKTIffsvfvalatafatVPARLPGPE-RSPTVEEMKKPPPGFPPTSVAS  991
             WLP LA+ELG+K++ FSV+ A++ ++ TVP+RL   E RS T E++K+PP G+P  +  S
Sbjct  122   WLPKLASELGVKSVHFSVYSAISDSYITVPSRLDDIEGRSITFEDLKEPPKGYPQKNNIS  181

Query  990   LRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKP  811
             L+TFEA DF+ +F +    G + Y+RV+  L  CS I+ K+C E+E PYIDY++ QF K 
Sbjct  182   LKTFEAMDFMFMFTK-FGEGLTGYERVMQSLGECSYIVFKSCKEIEGPYIDYIEKQFGKQ  240

Query  810   LLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGL  631
             +LLAGP+VPEP+  VL++K   WL  F   +VI+CSFGSETFL D+QI ELA GLELTGL
Sbjct  241   VLLAGPLVPEPSMEVLEEKLCKWLDNFSVKSVIFCSFGSETFLNDEQINELATGLELTGL  300

Query  630   PFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAG  451
             PF LVLNFP+N+   +EL RALP GF ERVK RG++H+GW+QQQ IL H+SVGCYVCH G
Sbjct  301   PFILVLNFPSNLCAKTELERALPKGFLERVKDRGMVHTGWLQQQLILKHNSVGCYVCHGG  360

Query  450   FSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQT  271
             FSSV E +VNDCQLV+LP KGDQF N+KL+A+D++AG+EVNR++EDGYF +E I KAV+ 
Sbjct  361   FSSVTEAMVNDCQLVLLPFKGDQFFNSKLIANDLEAGIEVNRKEEDGYFHQESILKAVKI  420

Query  270   IM----GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
             IM     E G S R N  KW++F+LDKEIQ+KFI DLV  ++ +A
Sbjct  421   IMMDGEKEPGKSIRENHMKWRKFMLDKEIQNKFIIDLVAQLKSLA  465



>ref|XP_010091273.1| Anthocyanidin 3-O-glucosyltransferase [Morus notabilis]
 gb|EXB44194.1| Anthocyanidin 3-O-glucosyltransferase [Morus notabilis]
Length=483

 Score =   521 bits (1343),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 264/476 (55%), Positives = 346/476 (73%), Gaps = 17/476 (4%)
 Frame = -3

Query  1515  DLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPL  1336
             D LHVV+FPFFAFGH+SPF+QLSNKLS HGV+ISFF+  G + RI+++L  +P TQIVPL
Sbjct  4     DQLHVVMFPFFAFGHVSPFIQLSNKLSSHGVRISFFTIPGFIPRIQNLLIPSPTTQIVPL  63

Query  1335  ALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPP  1156
              LP   G PP    T DFP + +    VA++L+QPQ+KALL ELKP FV+ DFAQNWLP 
Sbjct  64    QLPPSLGFPPNIAGTFDFPSSVSPKFVVAIDLIQPQVKALLSELKPDFVLLDFAQNWLPS  123

Query  1155  LAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPP----------  1006
             LA+ELGIKT+ FSVF  +A A+   P RL G E  P+V+++++PP GFP           
Sbjct  124   LASELGIKTMLFSVFSGIANAYLLAPGRLTGIEGPPSVDDLRRPPQGFPKRFGRNNVNVA  183

Query  1005  -TSVASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVK  829
              +S   ++TFEA++ + ++K   +  AS+YDR   GL+G +A++ K+C+EME PY+D++K
Sbjct  184   DSSSDLIKTFEAQNILFVYKSKISENASIYDRFQGGLSGSTAVVIKSCFEMEGPYLDFMK  243

Query  828   SQFKKPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALG  649
             SQ  KP ++ GP+VP+P S  LD KW  WL+QF   +VI+CSFGSE  L  +QI+E+ALG
Sbjct  244   SQLNKPFIVTGPLVPQPPSEKLDAKWDKWLAQFPSKSVIFCSFGSEAVLNQEQIREVALG  303

Query  648   LELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGC  469
             LELTGLPF LVL+FPA V+  +EL  ALP GF ER K  GI+H GWV QQ IL H+SVGC
Sbjct  304   LELTGLPFLLVLHFPAKVNAKTELEHALPIGFFERTKDMGIVHVGWVPQQLILRHNSVGC  363

Query  468   YVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADD--MKAGVEVNRRDEDGYFWKE  295
             Y+CHAGFSS+IEG+VNDCQLV+LP +GDQF N+ L+ ++  MKAG+EVNRRD DGYF KE
Sbjct  364   YLCHAGFSSLIEGLVNDCQLVLLPLQGDQFFNSMLMCENGIMKAGIEVNRRDRDGYFGKE  423

Query  294   DIQKAVQTIMG----EEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
             DI  AVQTIM     E G S R+NQ+KW +FL +K++Q K+I D++  M+ +   N
Sbjct  424   DIFAAVQTIMTEIEKEPGKSIRSNQKKWHKFLQEKDVQEKYISDMISEMKKILVDN  479



>ref|XP_007144190.1| hypothetical protein PHAVU_007G135800g [Phaseolus vulgaris]
 gb|ESW16184.1| hypothetical protein PHAVU_007G135800g [Phaseolus vulgaris]
Length=462

 Score =   520 bits (1338),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 268/474 (57%), Positives = 346/474 (73%), Gaps = 19/474 (4%)
 Frame = -3

Query  1548  MEREITNNHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSML  1369
             M  E+ N    + LHVV+FPF AFGHISPFVQLSNKL  HGV+I+F SA  N+ RI+S L
Sbjct  1     MSTELMNE---EQLHVVMFPFLAFGHISPFVQLSNKLFSHGVRITFLSAESNISRIRSSL  57

Query  1368  NSNPCTQIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFV  1189
             N NP   ++PL  P       G  +TAD PP  A  L  AL+L QPQ+K+LL+ELKPH+V
Sbjct  58    NLNPAVNVIPLQFPN------GISNTADLPPHLAANLVHALDLTQPQVKSLLLELKPHYV  111

Query  1188  IFDFAQNWLPPLAAELGIKTIffsvfvalatafatVPARLPGPERSP-TVEEMKKPPPGF  1012
              FDFAQ+WLP +A++LGIK++ FSV+ A++ ++ TVP+R    E +  T E++K PPPG+
Sbjct  112   FFDFAQHWLPKIASQLGIKSVHFSVYSAISDSYITVPSRFSHLEGTNITFEDLKSPPPGY  171

Query  1011  PPTSVASLRTFEARDFVIIFKRP--HNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYID  838
             P  S  SL+ FEA DF+ +FKR   H  G   Y+RVL  L  CS I+ KTC E+E PY++
Sbjct  172   PQNSHVSLKAFEAMDFMFLFKRSGEHLTG---YERVLQSLGECSFIVFKTCREIEGPYLE  228

Query  837   YVKSQFKKPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKEL  658
             Y++ QF KP+LL+GP+VPEP+  VL++KW+ WL  F   +VI CSFGSETFL DDQI+EL
Sbjct  229   YIEKQFGKPVLLSGPLVPEPSRDVLEEKWSKWLDTFPAKSVILCSFGSETFLNDDQIREL  288

Query  657   ALGLELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSS  478
             A GLEL+GLPF LVLNFP+++   SEL R LP GF ERVK R ++H+GW QQQ +L H S
Sbjct  289   ASGLELSGLPFILVLNFPSDLSAQSELERTLPKGFLERVKDRAVVHTGWFQQQLVLKHPS  348

Query  477   VGCYVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWK  298
             VGCYVCHAGFSSVIE +VN+CQLV+LP KGDQF N+KL+A+D++AGVEVNRR+EDGYF K
Sbjct  349   VGCYVCHAGFSSVIEAMVNECQLVLLPFKGDQFFNSKLVANDLEAGVEVNRREEDGYFHK  408

Query  297   EDIQKAVQTIMGEE----GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
             E + KA++T+M E+    G   R N  KW +FL DKEIQ+ FI +L+  ++ MA
Sbjct  409   EGVLKALKTLMVEDDREPGKQIRENHMKWSKFLSDKEIQNNFITNLIAQLKSMA  462



>gb|KHN30680.1| Anthocyanidin 3-O-glucosyltransferase [Glycine soja]
Length=442

 Score =   502 bits (1292),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 261/455 (57%), Positives = 334/455 (73%), Gaps = 18/455 (4%)
 Frame = -3

Query  1497  IFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLALPAVE  1318
             +FPF AFGHISPFVQLSNKL  HGV ++F SAA N+ RI+S LN NP   ++ L  P   
Sbjct  1     MFPFLAFGHISPFVQLSNKLFSHGVHVTFLSAASNIPRIRSTLNLNPAINVISLKFPN--  58

Query  1317  GLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLAAELG  1138
                 G  +TA+ PP  A  L  AL+L Q Q+K+LL+ELKPH+V FDFAQ+WLP LA+E+G
Sbjct  59    ----GITNTAELPPHLAGNLIHALDLTQDQVKSLLLELKPHYVFFDFAQHWLPKLASEVG  114

Query  1137  IKTIffsvfvalatafatVPARLPGPE-RSPTVEEMKKPPPGFPPTSVASLRTFEARDFV  961
             IK++ FSV+ A++ A+ TVP+R    E R+ T E++KKPPPG+P  S  SL+ FEA DF+
Sbjct  115   IKSVHFSVYSAISDAYITVPSRFADVEGRNITFEDLKKPPPGYPQNSNISLKAFEAMDFM  174

Query  960   IIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPVVPE  781
              +F R      + Y+RVL  L  CS I+ KTC E+E PY+DY+++QF+KP+LL+GP+VPE
Sbjct  175   FLFTRFGEKNLTGYERVLQSLGECSFIVFKTCKEIEGPYLDYIETQFRKPVLLSGPLVPE  234

Query  780   PASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLNFPA  601
             P++ VL++KW+ WL  F   +VI CSFGSETFL D QIKELA GLELTGLPF LVL    
Sbjct  235   PSTDVLEEKWSKWLDGFPAKSVILCSFGSETFLSDYQIKELASGLELTGLPFILVL----  290

Query  600   NVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEGIVN  421
                  +EL RALP G+ ERVK RG++HSGW QQQ +L HSSVGCYVCH GFSSVIE +VN
Sbjct  291   ---AKAELERALPKGYLERVKNRGVVHSGWFQQQLVLKHSSVGCYVCHGGFSSVIEAMVN  347

Query  420   DCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM----GEEG  253
             +CQLV+LP KGDQF N+KL+A+D+KAGVEVNR DEDG+F KEDI +A++T+M     E+G
Sbjct  348   ECQLVLLPFKGDQFFNSKLIANDLKAGVEVNRSDEDGFFHKEDILEALKTVMLEDNKEQG  407

Query  252   ASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
                R N  +W +FL +KEIQ+KFI DLV  ++ MA
Sbjct  408   KQIRENHMQWSKFLSNKEIQNKFITDLVAQLKSMA  442



>ref|XP_003556320.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase-like [Glycine 
max]
Length=462

 Score =   502 bits (1292),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 265/472 (56%), Positives = 339/472 (72%), Gaps = 15/472 (3%)
 Frame = -3

Query  1548  MEREITNNHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSML  1369
             M  E+ NN   D LHVV+FPF AFGHI+ FVQLSNKL  HGV+I+F SAA N+ RIKS L
Sbjct  1     MSCEVVNN---DELHVVMFPFLAFGHINAFVQLSNKLFSHGVRITFLSAASNIPRIKSTL  57

Query  1368  NSNPCTQIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFV  1189
             N NP   ++PL  P       G  STA+ PP  A  L  AL+L QP +K+LL+ELKPH+V
Sbjct  58    NLNPAINVIPLYFPN------GITSTAELPPNLAANLIHALDLTQPHVKSLLLELKPHYV  111

Query  1188  IFDFAQNWLPPLAAELGIKTIffsvfvalatafatVPARLPGPE-RSPTVEEMKKPPPGF  1012
              FDFAQNWLP LA+ELGIK++ F+ F A++ ++ TVP+RL   E R+ T E++KKPPPG+
Sbjct  112   FFDFAQNWLPKLASELGIKSVRFASFSAISDSYITVPSRLADIEGRNITFEDLKKPPPGY  171

Query  1011  PPTSVASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYV  832
             P  S  SL+ FEA D + +FKR      + Y+RVL G + CS I+ ++C E+E  Y+DY+
Sbjct  172   PQNSNISLKAFEAMDLMFLFKRFGEKNFTGYERVLQGFSDCSLIVFRSCKEIEESYLDYI  231

Query  831   KSQFKKPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELAL  652
             + QF K +LL G +VPEP+  VL++KW+ WL  F   +VI CSFGSE FL DDQIKE+A 
Sbjct  232   EKQFGKLVLLTGFLVPEPSMDVLEEKWSKWLDSFPAKSVILCSFGSEQFLNDDQIKEVAS  291

Query  651   GLELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVG  472
             GLEL+GLPF LVLNFP+N+   +EL RALP GF ERVK RG++H+GW QQQ +L HSSVG
Sbjct  292   GLELSGLPFILVLNFPSNLSAKAELERALPKGFLERVKNRGVVHTGWFQQQLVLKHSSVG  351

Query  471   CYVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKED  292
             C++ H GF+SVIE + +DC+LV+LP K DQF NAKL+A  ++AG+EVN R EDG F KED
Sbjct  352   CHLGHGGFNSVIEALASDCELVLLPFKADQFFNAKLIAKALEAGIEVN-RSEDGDFKKED  410

Query  291   IQKAVQTIMGEE----GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
             I KAV+TIM E+    G   + N  KWKEFLL+K IQ+KFI DLV  ++ MA
Sbjct  411   ILKAVKTIMVEDDKEPGKQIKENHMKWKEFLLNKGIQNKFITDLVAQLKSMA  462



>ref|XP_003606381.1| UDP rhamnose anthocyanidin-3-glucoside rhamnosyltransferase [Medicago 
truncatula]
Length=459

 Score =   493 bits (1268),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 249/460 (54%), Positives = 333/460 (72%), Gaps = 17/460 (4%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             +HV +FPF AFGHISPFVQLSNKL  HG+ ISF S + N+ +IKS  N NP   I+PL +
Sbjct  11    IHVAMFPFLAFGHISPFVQLSNKLFSHGIHISFLSPSANIPKIKSTFNLNPSIHIIPLHV  70

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
                + LP    +T++        L  A++ MQ  +K +L ELKP+F+ FD A +W+P +A
Sbjct  71    S--DNLP---SNTSNLHSGMFGTLIQAIDSMQDHVKTILFELKPNFIFFDIATSWIPEIA  125

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPE-RSPTVEEMKKPPPGFPPTSVASLRTFEA  973
             +ELGIK+++FSV+ A++ ++    +RL   + R  T E+ K PP G+ P S  SL+TF+A
Sbjct  126   SELGIKSVYFSVYSAISASYLCPSSRLDDTKGRDITYEDFKNPPLGYFPNSKLSLQTFQA  185

Query  972   RD-FVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
             ++ F+ +F+R +      + +V+   +  S I+ K+C EME PY+DY+++QF+KP+L +G
Sbjct  186   KNIFIALFQRFN------FHKVMQNFSESSLIVFKSCKEMEGPYLDYLQNQFEKPILFSG  239

Query  795   PVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
              +VPEP+  VL++KW  WL  F   +VI CSFGSETFL DDQI ELA+GLELT LPF LV
Sbjct  240   VLVPEPSMDVLEEKWTKWLDNFPTKSVILCSFGSETFLSDDQINELAIGLELTNLPFILV  299

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             LNFP+N++  SEL RALP GF ERVK RGI+HSGW+QQQ +L HSSVGCYVCHAGFSSVI
Sbjct  300   LNFPSNLNAESELERALPKGFLERVKNRGIVHSGWLQQQLVLKHSSVGCYVCHAGFSSVI  359

Query  435   EGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM---  265
             E IVNDCQLV+LP KGDQFLN+KL+ADD+KAGVEVNR+DEDG+F KE + +AV+T+M   
Sbjct  360   EAIVNDCQLVLLPFKGDQFLNSKLIADDLKAGVEVNRKDEDGFFEKEGLFEAVKTVMVEV  419

Query  264   -GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
               E G   R N  KW+EFLLDK+IQ+KFI DL+  ++ +A
Sbjct  420   DKEPGKQIRENHMKWREFLLDKKIQNKFITDLIARLKSLA  459



>emb|CDP03917.1| unnamed protein product [Coffea canephora]
Length=374

 Score =   489 bits (1258),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 251/373 (67%), Positives = 303/373 (81%), Gaps = 7/373 (2%)
 Frame = -3

Query  1239  MQPQIKALLVELKPHFVIFDFAQNWLPPLAAELGIKTIffsvfvalatafatVPARLPG-  1063
             MQPQI +LL +LKPHFV+FDFAQ WLPPLA++LGIKT+F+SVFVAL+T++ T+PARLP  
Sbjct  1     MQPQISSLLSQLKPHFVLFDFAQEWLPPLASQLGIKTVFYSVFVALSTSYLTIPARLPEA  60

Query  1062  -PERSPTVEEMKKPPPGFPPTSVASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCS  886
              P R P +E+++KPPPGFP TS+ S++TFEARDF+ +FK  H GGASVYDRVL GLNGC 
Sbjct  61    EPTRPPAIEDLRKPPPGFPETSIKSMKTFEARDFLYMFKSFH-GGASVYDRVLRGLNGCD  119

Query  885   AILAKTCYEMEAPYIDYVKSQFKKPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYC  706
              ILAKTC EME PY+D+V  QFKKP+LL GPVVPEP S  L+ +WA WL QFEP +VIYC
Sbjct  120   IILAKTCREMEDPYVDHVTQQFKKPVLLVGPVVPEPRSEPLEGRWASWLGQFEPKSVIYC  179

Query  705   SFGSETFLKDDQIKELALGLELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGI  526
             SFGS+TFL D+Q+KEL LGL+LTGLPFF+VLNFPAN D+++EL RALP GF E+VK + +
Sbjct  180   SFGSKTFLSDEQVKELLLGLDLTGLPFFVVLNFPANTDISAELKRALPEGFLEKVKHKAV  239

Query  525   IHSGWVQQQQILVHSSVGCYVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMK  346
             IH+GWVQQQQIL H SVGCYV HAGFSSV+E IVNDCQLVMLP +GDQ LNAKL++ D+K
Sbjct  240   IHAGWVQQQQILAHQSVGCYVFHAGFSSVVEAIVNDCQLVMLPVRGDQLLNAKLVSGDLK  299

Query  345   AGVEVNRRDEDGYFWKEDIQKAVQTIMG----EEGASTRANQEKWKEFLLDKEIQSKFIK  178
             AGVEVNRRDEDGYF K+DI+ AV  +M     E   S   N +KWKEFL + EIQ+KF+ 
Sbjct  300   AGVEVNRRDEDGYFGKDDIKDAVGRVMADIDKEPAKSISGNHKKWKEFLQNSEIQTKFVS  359

Query  177   DLVKVMRDMATMN  139
             DLVK M  +A + 
Sbjct  360   DLVKEMEAVAGLR  372



>ref|XP_010696238.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=472

 Score =   492 bits (1266),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 241/460 (52%), Positives = 336/460 (73%), Gaps = 7/460 (2%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ +FP+FA+GHI+PF+QLS KLS HG++ISFFS  GN+ RI+S LN +   +++PL +
Sbjct  11    LHIAMFPWFAYGHINPFIQLSKKLSSHGIQISFFSIPGNILRIESALNLSAPNRVIPLII  70

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P  EGL P   S++D     AELL VAL+ MQPQ+K LL  LKPH ++FDFA  WLP LA
Sbjct  71    PPSEGLSPNFDSSSDLTSQTAELLKVALDQMQPQLKTLLSHLKPHIILFDFAHYWLPALA  130

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
             +ELGIKT+ FS F A A ++ T+P+R+  P + PT+E++KKPP G+P TS+ S++TF+A 
Sbjct  131   SELGIKTVNFSTFPASANSYLTIPSRMTDPSKPPTLEDLKKPPQGYPKTSITSMKTFQAL  190

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
             DF  +++   NGG   ++R++  +  C A + K+  E+E PYIDY+KSQ +KPL LAGPV
Sbjct  191   DFQYLYQS-FNGGPPAFERIMRFIKTCDATIYKSSTEVEGPYIDYIKSQIEKPLFLAGPV  249

Query  789   VPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLN  610
              P P SG LD+KW  WL +F   +VI+C+FGSE++L D QI++L LGLELTG+PFFLVL 
Sbjct  250   APLPPSGELDEKWESWLGKFPEKSVIFCNFGSESYLDDAQIEQLTLGLELTGMPFFLVLK  309

Query  609   FPA-NVDVASE-LNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             F + ++DVA + L  +LP  F ERVK RG++H+GWVQQQ IL H SVGC++ H+G SS++
Sbjct  310   FESESIDVAKQKLEASLPENFRERVKDRGVVHTGWVQQQHILAHKSVGCFLTHSGMSSIV  369

Query  435   EGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM---  265
             EG+VNDC L  LP K DQF+NAK+   D+K GVEV+RRDEDGYF KEDI +A++ +M   
Sbjct  370   EGVVNDCLLACLPLKADQFMNAKVFCGDLKLGVEVSRRDEDGYFGKEDILEAIKILMLDT  429

Query  264   -GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
               E G   R N  KW++F L++EI+++++ +LV  ++ +A
Sbjct  430   ENEAGILMRENHNKWRKFFLNQEIEARYVANLVGELQALA  469



>ref|XP_010909266.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase-like [Elaeis 
guineensis]
Length=475

 Score =   491 bits (1265),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 266/467 (57%), Positives = 348/467 (75%), Gaps = 16/467 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHG---VKISFFSAAGNVDRIKSMLNSNPCTQIVP  1339
             LHV++FP+ AFGHI PF+QL+ KLS  G   ++ISF S AGN+ RI ++L S+    I+P
Sbjct  10    LHVLLFPWPAFGHIGPFLQLACKLSTTGGAAIRISFLSIAGNIPRIATLLPSDHSISIIP  69

Query  1338  LALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLP  1159
             L LP V GL     STAD  PAAAELL +A++L +PQ+++LL  L+PHFV FDFA  WLP
Sbjct  70    LDLPRVPGLTDDATSTADMTPAAAELLKLAVDLTKPQVESLLRHLRPHFVFFDFAMQWLP  129

Query  1158  PLAAELGIKTIffsvfvalatafatVPAR-LPGPERSPTVEEMKKPPPGFPPTS-VASLR  985
              LA  LGIK++ FS+F  + TA+  VP+R L GP  +P+V+++K PP GFP TS V+++ 
Sbjct  130   SLAHSLGIKSLHFSIFATICTAYNIVPSRRLHGP--NPSVDDLKNPPDGFPSTSSVSTIP  187

Query  984   TFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLL  805
             +++A D + +FKR HNG   VYDRV+A L GC+A++AKTC E+E  YIDYV SQF+KP L
Sbjct  188   SYQATDLLYLFKRFHNG-PCVYDRVVACLEGCTAVVAKTCMELEGQYIDYVDSQFQKPFL  246

Query  804   LAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPF  625
             LAGP+VPEP SG L+++WA WL  F   +V++CSFGSETFL D+ +KEL LGLE+TGLPF
Sbjct  247   LAGPLVPEPPSGKLEERWARWLDGFSEESVVFCSFGSETFLSDEGVKELVLGLEMTGLPF  306

Query  624   FLVLNFPAN----VDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCH  457
             F+VLNFP +     +   EL R LP GF ERVKGRG++H+GWVQQQ IL H SVGC+VCH
Sbjct  307   FVVLNFPKDSEGREEGEEELRRKLPEGFGERVKGRGVLHTGWVQQQHILRHKSVGCFVCH  366

Query  456   AGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAV  277
             AG SSVIEG+V  CQLVMLPQKGDQ+LNA L A D++ GVEV RR+EDG F +E + KAV
Sbjct  367   AGLSSVIEGVVAGCQLVMLPQKGDQYLNAALFARDLEIGVEVERREEDGVFGREGLCKAV  426

Query  276   QTIM---GEE-GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
             + +M   GEE G   RAN  K K+FL+DKE+Q+KF++D +  ++++A
Sbjct  427   RKVMTEAGEESGRRVRANHRKLKDFLMDKEVQAKFMRDFLGNLKELA  473



>ref|XP_010909163.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase-like [Elaeis 
guineensis]
Length=474

 Score =   488 bits (1256),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 262/466 (56%), Positives = 350/466 (75%), Gaps = 15/466 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHG---VKISFFSAAGNVDRIKSMLNSNPCTQIVP  1339
             LHV++FP+ AFGHISPF+QL++KLS +G   ++ISF S AGN+ RI ++L S+    ++P
Sbjct  10    LHVLLFPWPAFGHISPFLQLAHKLSTYGGAALRISFLSIAGNIPRITTLLPSDHSIAVIP  69

Query  1338  LALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLP  1159
             L LP V GLP    STAD  PAAAELL +A++L +PQ+++LL  L+PHFV+FDF   WLP
Sbjct  70    LDLPWVPGLPAEATSTADMTPAAAELLKLAVDLTKPQVESLLRNLRPHFVVFDFGMQWLP  129

Query  1158  PLAAELGIKTIffsvfvalatafatVPAR-LPGPERSPTVEEMKKPPPGFPPTS-VASLR  985
              LA  LGIK++FFS+F A+ TA+ TVP+R L GP+  PTV+++K PP GFP TS V+++ 
Sbjct  130   SLAHSLGIKSLFFSIFAAICTAYNTVPSRRLHGPD--PTVDDLKNPPDGFPSTSSVSTIP  187

Query  984   TFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLL  805
             +++A DF+ +FK+  NG   VYDRV+A L GC+A++AKTC E E  YIDYV+SQF+KP L
Sbjct  188   SYQAADFLYLFKKFDNG-PCVYDRVVACLEGCTAVVAKTCTEFEGRYIDYVESQFQKPFL  246

Query  804   LAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPF  625
             LA P+VPEP SG L+++WA WL  F   +V++CSFGSETFL D+ +KEL LGLE+TGLPF
Sbjct  247   LASPLVPEPPSGELEERWARWLDGFPEESVVFCSFGSETFLSDEGVKELVLGLEMTGLPF  306

Query  624   FLVLNFPANVD---VASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHA  454
             F+VLNFP N +      EL++ LP GF ERVKGRG++H+GWVQQQ IL H SVGC+VCHA
Sbjct  307   FVVLNFPKNNEGREEEEELSKKLPKGFGERVKGRGVLHTGWVQQQHILRHKSVGCFVCHA  366

Query  453   GFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQ  274
             GFSSV+EG+V  CQLVMLPQKGDQ+ NA L A D++ GVEV RR+EDG F +E + KAV+
Sbjct  367   GFSSVLEGVVAGCQLVMLPQKGDQYFNAALFARDLEIGVEVERREEDGVFGREGVCKAVR  426

Query  273   TIMGEEGAST----RANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
              +M E G  +      N  K ++FL+DK +Q KF+ D V+ ++++A
Sbjct  427   KVMAETGEESGRRVSENHRKLEQFLMDKGVQEKFMVDFVENLKELA  472



>gb|KHN00987.1| Anthocyanidin 3-O-glucosyltransferase [Glycine soja]
Length=448

 Score =   487 bits (1253),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 255/455 (56%), Positives = 328/455 (72%), Gaps = 12/455 (3%)
 Frame = -3

Query  1497  IFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLALPAVE  1318
             +FPF AFGHI  FVQLSNKL  HGV+I+F SAA N+ RIKS L+ NP   ++PL  P   
Sbjct  1     MFPFLAFGHIKAFVQLSNKLFSHGVRITFLSAASNIPRIKSTLSLNPAINVIPLYFPN--  58

Query  1317  GLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLAAELG  1138
                 G  STA+ PP  A  L  AL+L QP +K+LL+ELKPH+V FDFAQNWLP LA+ELG
Sbjct  59    ----GITSTAELPPNLAANLIHALDLTQPHVKSLLLELKPHYVFFDFAQNWLPKLASELG  114

Query  1137  IKTIffsvfvalatafatVPARLPGPE-RSPTVEEMKKPPPGFPPTSVASLRTFEARDFV  961
             IK++ F+ F A++ ++ TVP+RL   E R+ T E++KKPPPG+P  S  SL+ FEA D +
Sbjct  115   IKSVRFASFSAISDSYITVPSRLADIEGRNITFEDLKKPPPGYPQNSNISLKAFEAMDLM  174

Query  960   IIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPVVPE  781
              +FKR      + Y+RVL G + CS I+ ++C E+E  Y+DY++ QF K +LL G +VPE
Sbjct  175   FLFKRFGEKNFTGYERVLQGFSDCSLIVFRSCKEIEESYLDYIEKQFGKLVLLTGFLVPE  234

Query  780   PASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLNFPA  601
             P+  VL++KW+ WL  F   +VI CSFGSE FL DDQIKE+A GLEL+GLPF LVLNFP+
Sbjct  235   PSMDVLEEKWSKWLDSFPAKSVILCSFGSEQFLNDDQIKEVASGLELSGLPFILVLNFPS  294

Query  600   NVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEGIVN  421
             N+   +EL RALP GF ERVK RG++H+GW QQQ +L HSSVGC++ H GF+SVIE + +
Sbjct  295   NLSAKAELERALPKGFLERVKNRGVVHTGWFQQQLVLKHSSVGCHLGHGGFNSVIEALAS  354

Query  420   DCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE----G  253
             DC+LV+LP K DQF NAKL+A  ++AG+EVN R EDG F KEDI KAV+TIM E+    G
Sbjct  355   DCELVLLPFKADQFFNAKLIAKALEAGIEVN-RSEDGDFKKEDILKAVKTIMVEDDKEPG  413

Query  252   ASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
                + N  KWKEFLL+K IQ+KFI DLV  ++ MA
Sbjct  414   KQIKENHMKWKEFLLNKGIQNKFITDLVAQLKSMA  448



>ref|XP_010111557.1| Anthocyanidin 3-O-glucosyltransferase [Morus notabilis]
 gb|EXC31240.1| Anthocyanidin 3-O-glucosyltransferase [Morus notabilis]
Length=483

 Score =   487 bits (1254),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 260/479 (54%), Positives = 340/479 (71%), Gaps = 19/479 (4%)
 Frame = -3

Query  1521  GGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIV  1342
             G D LHVV+FPFFAFGH+SPF+QLSNKLS HGV+ISFF+  G + RI+++L  +P TQI+
Sbjct  2     GDDQLHVVMFPFFAFGHVSPFIQLSNKLSSHGVRISFFTIPGFIPRIENLLIPSPTTQII  61

Query  1341  PLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWL  1162
             PL L    GLPP    T D PP+ A  L  A++L QPQ+K+LL +LKP FV+FDFAQ+WL
Sbjct  62    PLQLSPSLGLPPDIAGTFDLPPSEAIKLITAIDLTQPQVKSLLSDLKPDFVLFDFAQHWL  121

Query  1161  PPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPP----TSVA  994
             P LA+ELGIK + F VF A+A A+   P+RL G + +PTV++++KPP GFP       +A
Sbjct  122   PSLASELGIKAMLFIVFSAIACAYVVAPSRLAGVDGNPTVDDLRKPPQGFPMRFGYEHIA  181

Query  993   S-----LRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVK  829
             +     ++TF+AR  +  ++   N   + + RV    N  +AI+ KTC+EME  Y+D++K
Sbjct  182   ADHSNLIKTFQARTNLFHYES-FNESPNNFFRVQEAFNSSTAIVIKTCFEMEGLYLDFLK  240

Query  828   SQFKKPLLLAGPVVP-EPASGVL--DQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKEL  658
             SQ  KP +L GP+VP EP S V+  D+ W  WL+QF   +V++CSFGSETFL  +QI EL
Sbjct  241   SQIHKPFILTGPLVPAEPPSSVVLNDEDWTKWLAQFSAKSVVFCSFGSETFLTKEQISEL  300

Query  657   ALGLELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSS  478
             ALGLELTG+PF  VLNFPA V+  +EL  ALP GF ER K RG +H GWV QQ IL H S
Sbjct  301   ALGLELTGIPFLFVLNFPAKVNAEAELKHALPVGFLERTKERGRVHIGWVPQQLILGHDS  360

Query  477   VGCYVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADD--MKAGVEVNRRDEDGYF  304
             VGCY+CHAGFSS+IEG+VNDCQLV+LP K DQF N+ L+ ++  +KAG+EVNRRD+DGYF
Sbjct  361   VGCYLCHAGFSSLIEGLVNDCQLVLLPIKSDQFFNSMLMCENGILKAGIEVNRRDQDGYF  420

Query  303   WKEDIQKAVQTIM----GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
              KEDI  AV+TIM     E G S R NQ+KW +FL +K++Q KFI ++V  M+ +   N
Sbjct  421   GKEDIFTAVKTIMVEVEKEPGKSIRLNQKKWHKFLREKDVQEKFISNMVAEMKKILVHN  479



>ref|XP_010696239.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=472

 Score =   486 bits (1251),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 246/459 (54%), Positives = 340/459 (74%), Gaps = 6/459 (1%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ IFP+FA+GHI+PF+QLSNKLS H ++ISFFS  GN+ RI+S LN +   Q++ L +
Sbjct  12    LHIAIFPWFAYGHINPFIQLSNKLSSHNIQISFFSIPGNIRRIESSLNLSASNQLISLTI  71

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P + GL P   S++D     AELL VAL+ MQPQ+K LL +LKPH ++FDFA  WLP LA
Sbjct  72    PPIVGLSPNFDSSSDLTSQTAELLKVALDQMQPQVKTLLSQLKPHIILFDFAHYWLPSLA  131

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
             +EL +K + FSVF A+A ++ T+P+R+  P   P +E++ KPP  +P TS+ +++TF+AR
Sbjct  132   SELSVKAVNFSVFSAVANSYLTIPSRMIDPNIPPALEDLMKPPQEYPETSITAMKTFQAR  191

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
             DF+ ++K   NGG   ++R++  +N C A + K+C E+E PY++Y+K++ +KPL  AGP 
Sbjct  192   DFMYLYKS-FNGGPPAFERIMGFINTCDATIYKSCTEVEGPYLNYLKTRLEKPLFSAGPA  250

Query  789   VPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLN  610
             VP P +G LD+KW  WL +F   TVI+C+FGSET+L DDQIKEL LGLELTGLPFFLVLN
Sbjct  251   VPLPPTGALDKKWESWLGKFPEKTVIFCNFGSETYLNDDQIKELTLGLELTGLPFFLVLN  310

Query  609   F-PANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
             F   ++D  ++L  +LP  F ER+K RG++H+GWVQQQ IL H SVGCY+ H+GFSSVIE
Sbjct  311   FGTRSIDATNKLEDSLPENFRERIKDRGVVHTGWVQQQHILAHKSVGCYLNHSGFSSVIE  370

Query  432   GIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM----  265
             GIVNDCQL  +PQKGDQFLN+KL + D+K GVEVNRRDEDG+F K+DI +A++ +M    
Sbjct  371   GIVNDCQLAFVPQKGDQFLNSKLFSGDLKVGVEVNRRDEDGFFGKQDILEAIKIVMLDTE  430

Query  264   GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
              E   S R N  KW+ F L++EI+S+++ +LVK ++ +A
Sbjct  431   NELCKSIRENHIKWRNFFLNEEIESRYVANLVKELQRLA  469



>gb|AAN40684.1| UDP-glucosyltransferase [Stevia rebaudiana]
Length=454

 Score =   484 bits (1247),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 264/459 (58%), Positives = 336/459 (73%), Gaps = 24/459 (5%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLS--VHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPL  1336
             LH+V+FPFFAFGHI+PFVQLSNK+S    GVKI+F +A+ +V RI++MLN +  T+++PL
Sbjct  10    LHLVMFPFFAFGHITPFVQLSNKISSLYPGVKITFLAASASVSRIETMLNPSTNTKVIPL  69

Query  1335  ALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPP  1156
              LP V+GLP G ++TAD  PA   LL VA++LMQPQIK LL  LKP FVIFDF   WLP 
Sbjct  70    TLPRVDGLPEGVENTADASPATIGLLVVAIDLMQPQIKTLLANLKPDFVIFDFVHWWLPE  129

Query  1155  LAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMK--KPPPGFPPTSVASLRT  982
             +A+ELGIKTI+FSV++A     +T  ++L G + S TVE++K  +   G P      ++T
Sbjct  130   IASELGIKTIYFSVYMANIVMPST--SKLTGNKPS-TVEDIKALQQSDGIP------VKT  180

Query  981   FEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLL  802
             FEA   + +FK       S +D +   +NGC+ +L K+C EME   ID V  Q  +P+ L
Sbjct  181   FEAISLMNVFK-------SFHDWMDKCINGCNLMLIKSCREMEGSRIDDVTKQSTRPVFL  233

Query  801   AGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFF  622
              GPVVPEP SG LD+ WA+WL++F   +VIYCSFGSETFL DDQI+ELALGLELTGLPFF
Sbjct  234   IGPVVPEPHSGELDETWANWLNRFPAKSVIYCSFGSETFLTDDQIRELALGLELTGLPFF  293

Query  621   LVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSS  442
             LVLNFPANVD ++EL R LP GF ERVK +GI+HSGWVQQ+ IL H SVGCYV HAG+ S
Sbjct  294   LVLNFPANVDKSAELKRTLPDGFLERVKDKGIVHSGWVQQRHILAHDSVGCYVFHAGYGS  353

Query  441   VIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM-  265
             VIEG+VNDCQLVMLP K DQF N+K++A ++KAGVEVNRRDEDGYF K+D+ +AV+++M 
Sbjct  354   VIEGLVNDCQLVMLPMKVDQFTNSKVIALELKAGVEVNRRDEDGYFGKDDVFEAVESVMM  413

Query  264   ---GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMR  157
                 E   S R N  K KEFL + EIQ K+I D V+ ++
Sbjct  414   DTENEPAKSIRENHRKLKEFLQNDEIQKKYIADFVENLK  452



>gb|AAR06923.1| UDP-glycosyltransferase 79A2 [Stevia rebaudiana]
Length=454

 Score =   484 bits (1245),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 264/459 (58%), Positives = 336/459 (73%), Gaps = 24/459 (5%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLS--VHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPL  1336
             LH+V+FPFFAFGHI+PFVQLSNK+S    GVKI+F +A+ +V RI++MLN +  T+++PL
Sbjct  10    LHLVMFPFFAFGHITPFVQLSNKISSLYPGVKITFLAASASVSRIETMLNPSTNTKVIPL  69

Query  1335  ALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPP  1156
              LP V+GLP G ++TAD  PA   LL VA++LMQPQIK LL  LKP FVIFDF   WLP 
Sbjct  70    TLPRVDGLPEGVENTADASPATIGLLVVAIDLMQPQIKTLLANLKPDFVIFDFVHWWLPE  129

Query  1155  LAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMK--KPPPGFPPTSVASLRT  982
             +A+ELGIKTI+FSV++A     +T  ++L G + S TVE++K  +   G P      ++T
Sbjct  130   IASELGIKTIYFSVYMANIVMPST--SKLTGNKPS-TVEDIKALQQSYGIP------VKT  180

Query  981   FEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLL  802
             FEA   + +FK       S +D +   +NGC+ +L K+C EME   ID V  Q  +P+ L
Sbjct  181   FEAISLMNVFK-------SFHDWMDKCINGCNLMLIKSCREMEGSRIDDVTKQSTRPVFL  233

Query  801   AGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFF  622
              GPVVPEP SG LD+ WA+WL++F   +VIYCSFGSETFL DDQI+ELALGLELTGLPFF
Sbjct  234   IGPVVPEPHSGELDETWANWLNRFPAKSVIYCSFGSETFLTDDQIRELALGLELTGLPFF  293

Query  621   LVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSS  442
             LVLNFPANVD ++EL R LP GF ERVK +GI+HSGWVQQ+ IL H SVGCYV HAG+ S
Sbjct  294   LVLNFPANVDKSAELKRTLPDGFLERVKDKGIVHSGWVQQRHILAHDSVGCYVFHAGYGS  353

Query  441   VIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM-  265
             VIEG+VNDCQLVMLP K DQF N+K++A ++KAGVEVNRRDEDGYF K+D+ +AV+++M 
Sbjct  354   VIEGLVNDCQLVMLPMKVDQFTNSKVIALELKAGVEVNRRDEDGYFGKDDVFEAVESVMM  413

Query  264   ---GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMR  157
                 E   S R N  K KEFL + EIQ K+I D V+ ++
Sbjct  414   DTENEPAKSIRENHRKLKEFLQNDEIQKKYIADFVENLK  452



>ref|XP_010091274.1| Anthocyanidin 3-O-glucosyltransferase [Morus notabilis]
 gb|EXB44195.1| Anthocyanidin 3-O-glucosyltransferase [Morus notabilis]
Length=483

 Score =   484 bits (1245),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 256/477 (54%), Positives = 338/477 (71%), Gaps = 19/477 (4%)
 Frame = -3

Query  1515  DLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPL  1336
             D LHVV+FPFFAFGH+SPF+QLSNKLS HGV+ISFF+  G + RI+++L  +P TQI+PL
Sbjct  4     DQLHVVMFPFFAFGHVSPFIQLSNKLSSHGVRISFFTIPGFIPRIENLLIPSPTTQIIPL  63

Query  1335  ALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPP  1156
              L    GLPP    T D PP+ A  L  A++L QPQ+K+LL +LKP FV+FDFAQ+WLP 
Sbjct  64    QLSPSLGLPPDIAGTFDLPPSEAIKLITAIDLTQPQVKSLLSDLKPDFVLFDFAQHWLPS  123

Query  1155  LAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFP---------PT  1003
             LA+ELGIK + F VF A+A A+   P+RL G + +PTV++++KPP GFP           
Sbjct  124   LASELGIKAMLFLVFSAIACAYVVAPSRLAGVDGNPTVDDLRKPPQGFPMRFGHERIAAD  183

Query  1002  SVASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQ  823
                 ++TF+AR  + +++   +   + + RV    N  SAI+ KTC+EME  Y+D++KSQ
Sbjct  184   HSGLIKTFQARSNLFLYES-FDESPNNFFRVQEAFNSSSAIVIKTCFEMEGLYLDFLKSQ  242

Query  822   FKKPLLLAGPVVPE--PASGVL-DQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELAL  652
               KP +L GP+VP   P+S VL D+ W  WL+QF   +V++CSFGSETFL  +QI ELAL
Sbjct  243   IHKPFILTGPLVPAEPPSSEVLNDEDWTKWLAQFSAKSVVFCSFGSETFLTKEQISELAL  302

Query  651   GLELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVG  472
             GLELTGLPF LVLNFPA V+  +EL  ALP G  ER K RG++H GWV QQ IL H SVG
Sbjct  303   GLELTGLPFLLVLNFPATVNAEAELKHALPVGLLERTKERGLVHIGWVPQQLILGHDSVG  362

Query  471   CYVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADD--MKAGVEVNRRDEDGYFWK  298
             CY+CHAGFSS+IEG+VNDCQLV+LP + DQF N+ L+ ++  ++AG+EVNRRD+DGYF K
Sbjct  363   CYLCHAGFSSLIEGLVNDCQLVLLPIQNDQFFNSMLMCENGILEAGIEVNRRDQDGYFGK  422

Query  297   EDIQKAVQTIM----GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
             EDI  AV+TI+     E G S R NQ+KW +FL +K++Q KFI ++V  M+ +   N
Sbjct  423   EDIFTAVKTIVVEVEKEPGKSIRLNQKKWHKFLREKDVQEKFISNMVAEMKKILVHN  479



>ref|XP_008778568.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase-like [Phoenix 
dactylifera]
Length=474

 Score =   479 bits (1233),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 261/466 (56%), Positives = 345/466 (74%), Gaps = 15/466 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHG---VKISFFSAAGNVDRIKSMLNSNPCTQIVP  1339
             LHV++FP+ AFGHISPF+QL+ KLS  G   ++ISF S AGN+ RI ++L S+    I+P
Sbjct  10    LHVLLFPWPAFGHISPFIQLARKLSTTGGAAIRISFLSIAGNIPRIATLLPSDHSIAIIP  69

Query  1338  LALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLP  1159
             L LP V GLP    STAD  PAAAELL +A++L +PQ+++LL  L+PHFV FDFA  WLP
Sbjct  70    LDLPQVPGLPADATSTADMTPAAAELLKLAVDLTKPQVESLLRHLRPHFVFFDFAMQWLP  129

Query  1158  PLAAELGIKTIffsvfvalatafatVPAR-LPGPERSPTVEEMKKPPPGFPPTS-VASLR  985
              LA  +GIK++ FS+F  +  A+  VP+R L GP  +P+V+++K PP GFP TS V+++ 
Sbjct  130   SLAHSMGIKSLHFSIFATICAAYNIVPSRRLHGP--NPSVDDLKNPPDGFPCTSSVSTIP  187

Query  984   TFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLL  805
             +++A DF+ +FKR  NG   VYDRV+A L+GC+A++AKTC E+E  YI YV+SQF+KP L
Sbjct  188   SYQAADFLYLFKRFDNG-PCVYDRVVACLDGCTAVVAKTCMELEGQYIAYVESQFQKPFL  246

Query  804   LAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPF  625
             LAGP+VPEP SG L+++ A WL  F   +V++ SFGSETFL D+ +KEL LGLE+TGLPF
Sbjct  247   LAGPLVPEPPSGELEERRARWLDGFPEESVVFSSFGSETFLSDEGVKELVLGLEMTGLPF  306

Query  624   FLVLNFPAN---VDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHA  454
             F+VLNFP N    +   EL R LP GF ERVKGRG++H GWVQQQ IL H SVGC+VCHA
Sbjct  307   FVVLNFPKNSEGREEEEELRRKLPEGFGERVKGRGVLHRGWVQQQHILRHKSVGCFVCHA  366

Query  453   GFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQ  274
             G SSV+EG++  CQLVMLPQKGDQ+LNA L A D++ GVEV RR EDG F +E + KAV+
Sbjct  367   GMSSVMEGVMAGCQLVMLPQKGDQYLNAALFARDLEIGVEVERRGEDGVFGREGVCKAVR  426

Query  273   TIM---GEE-GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
              +M   GEE G   R N  K KEFL+D+E+Q KF+ D+++ ++++A
Sbjct  427   KVMTETGEESGRRVRENHRKLKEFLMDEEVQEKFMVDMLEKLKELA  472



>emb|CDP03916.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   471 bits (1213),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 243/375 (65%), Positives = 300/375 (80%), Gaps = 9/375 (2%)
 Frame = -3

Query  1239  MQPQIKALLVELKPHFVIFDFAQNWLPPLAAELGIKTIffsvfvalatafatVPARLPGP  1060
             MQPQI +LL +LKPHFV+FDFAQ+WLPPLA++LGIKT+F+S+FVAL+T++ TVPARLP  
Sbjct  1     MQPQISSLLSQLKPHFVLFDFAQDWLPPLASQLGIKTVFYSIFVALSTSYLTVPARLPRS  60

Query  1059  E----RSPTVEEMKKPPPGFPPTSVASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNG  892
                  R   + ++KKPPPGFP TS+ S++TFEAR F+ +FK  ++G ASVYDRVL GLNG
Sbjct  61    TAYLARPSAIGDLKKPPPGFPETSIKSVKTFEARGFLYMFKSFYSG-ASVYDRVLRGLNG  119

Query  891   CSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVI  712
             C  ILAKTC EME PY+DYV  QFKKP+LL GPVVPEP+S  L+ +WA WL QFEP +VI
Sbjct  120   CDVILAKTCREMEGPYVDYVTQQFKKPVLLVGPVVPEPSSEPLEGRWASWLGQFEPKSVI  179

Query  711   YCSFGSETFLKDDQIKELALGLELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGR  532
             YCSFGS+TFL D+Q+KEL LGL+LTGLPFF+VLNFPA+ D++++L RALP GF E+VK +
Sbjct  180   YCSFGSKTFLSDEQVKELLLGLDLTGLPFFVVLNFPADADISADLKRALPEGFLEKVKHK  239

Query  531   GIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADD  352
              +IH+GW QQ+QIL H SVGCYV HAGFSSV+E IVNDCQLVMLP +GDQ LNAKL++ D
Sbjct  240   AVIHAGWAQQEQILAHQSVGCYVFHAGFSSVVEAIVNDCQLVMLPVRGDQLLNAKLVSGD  299

Query  351   MKAGVEVNRRDEDGYFWKEDIQKAVQTIMG----EEGASTRANQEKWKEFLLDKEIQSKF  184
             +KAGVEVNRRD DG+F K+DI+ AV  +M     E   S R N +KWKEFL + EIQ+KF
Sbjct  300   LKAGVEVNRRDVDGHFGKDDIKDAVGRVMADIDKEPAKSIRGNHKKWKEFLQNSEIQTKF  359

Query  183   IKDLVKVMRDMATMN  139
             + DLVK M  MA + 
Sbjct  360   VSDLVKEMEAMAGLR  374



>ref|XP_009416585.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase-like [Musa acuminata 
subsp. malaccensis]
Length=467

 Score =   473 bits (1216),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 254/465 (55%), Positives = 330/465 (71%), Gaps = 15/465 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSV----HGVKISFFSAAGNVDRIKSMLNSNPCTQIV  1342
             LHVV+FP+ AFGHISPF+QL+ K+S      GV+++F SAA NV RIKS+L ++    +V
Sbjct  5     LHVVMFPYLAFGHISPFLQLARKISSCAASGGVRVTFLSAAANVPRIKSLLPASTSISVV  64

Query  1341  PLALPAVEGLPPGTQSTADF--ppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQN  1168
             PL LPAV GLPPG +STAD      AAELL +A++  +PQ+++LL EL+PH  +FDF   
Sbjct  65    PLYLPAVPGLPPGVESTADLPPTSPAAELLKLAVDGTRPQVESLLRELRPHLAVFDFGMQ  124

Query  1167  WLPPLAAELGIKTIffsvfvalatafatVPAR-LPGPERSPTVEEMKKPPPGFP--PTSV  997
             WLP +A  LG++T+FFSVF A++TA+ TVPAR L GP  +PT+ ++  PPPGFP   +S+
Sbjct  125   WLPEVAEPLGVRTLFFSVFAAVSTAYLTVPARRLHGP--APTLGDIMSPPPGFPSAASSI  182

Query  996   ASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFK  817
              S+  ++A DF+ IFK    GGA VY+RV+  +  CSAI+AKTC EME  YIDYV+ QF 
Sbjct  183   RSVPAYQAADFLYIFKS-FGGGACVYERVVKCIESCSAIVAKTCTEMEGSYIDYVEGQFG  241

Query  816   KPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELT  637
             KP+LLAGPVVP P  G L+ +WA WL  F   TV++ SFGSETFL D+  +EL LGLE+T
Sbjct  242   KPMLLAGPVVPVPPEGELEARWAKWLGGFAEGTVVFSSFGSETFLTDEGERELLLGLEMT  301

Query  636   GLPFFLVLNFPANVDVAS--ELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYV  463
             G+PF +VLN P +       E+ + LP GF ERVKGRG++HSGWVQQQ IL H SVGC+V
Sbjct  302   GMPFLVVLNRPKSCTNGEQEEVRKRLPEGFEERVKGRGMVHSGWVQQQHILRHKSVGCFV  361

Query  462   CHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQK  283
             CHAG SSV+EG+   CQL M+PQKGDQ+LNA L A D+  GVEV R+ EDG F +E +  
Sbjct  362   CHAGLSSVMEGVAAGCQLAMMPQKGDQYLNAALFARDLGIGVEVERKGEDGSFTRESVCA  421

Query  282   AVQTIMGEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
             AV+ +M  E A  R    KW+EFLL KE+Q  F   LV+ +R++A
Sbjct  422   AVRKVMAAE-AEARKKHAKWREFLLKKELQDGFTARLVERLRELA  465



>dbj|BAJ85176.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=462

 Score =   428 bits (1100),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 232/455 (51%), Positives = 305/455 (67%), Gaps = 11/455 (2%)
 Frame = -3

Query  1515  DLLHVVIFPFFAFGHISPFVQLSNKL-SVHGVKISFFSAAGNVDRIKSMLN-SNPCTQIV  1342
             D +H+V+FPF AFGHISPFVQL+ KL +  GV+++  SAA NV R+++ML  +     + 
Sbjct  4     DGMHIVMFPFLAFGHISPFVQLARKLVAGGGVRVTLLSAAANVPRVEAMLGPAAAAVAVA  63

Query  1341  PLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWL  1162
             PL L  V GLP G +STA+     AELL VA++  +PQ+ ALL EL+P  ++FDFA  W+
Sbjct  64    PLRLQRVPGLPEGAESTAEVSADGAELLKVAVDGTRPQVAALLAELRPDALLFDFATPWV  123

Query  1161  PPLAAELGIKTIffsvfvalatafatVPARLPGPE-RSPTVEEMKKPPPGFPPTS-VASL  988
               LAA LGIK + FSVF A++ A+  VP+R  G     PT +++K  P GFPP+S +A++
Sbjct  124   TELAAPLGIKALHFSVFSAVSGAYLMVPSRRLGDGGHGPTADDLKSAPAGFPPSSSLATV  183

Query  987   RTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPL  808
               ++A +F  +F   H G   VYDRVLAG+    AI+ KTC+EME PYIDY+ +Q  KP+
Sbjct  184   PAYQAANFSYVFTSFH-GEPCVYDRVLAGIQASDAIVIKTCFEMEGPYIDYLAAQHGKPV  242

Query  807   LLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLP  628
             L+ GPVVPEP  G L+++WA WLS F    V++ SFGSETFL  D   EL LGLE T  P
Sbjct  243   LVTGPVVPEPPQGELEERWAKWLSSFPDKAVVFASFGSETFLPADAATELLLGLEATNRP  302

Query  627   FFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGF  448
             F +VLNFP   D  +EL    P GF ER KGRG++H+GWVQQQ IL H SVGC+V HAG 
Sbjct  303   FLVVLNFPKGTDTTAELAERTPPGFEERTKGRGVVHTGWVQQQHILRHRSVGCFVNHAGL  362

Query  447   SSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTI  268
             SSV+EG+V  C+LV+LP KGDQ+LNA L A D++ G EV RRD DG+F + D+  AV+T 
Sbjct  363   SSVVEGLVAGCRLVLLPMKGDQYLNAALFARDLRVGTEVARRDGDGWFGRRDVSDAVETA  422

Query  267   M--GEEGASTRANQEKWKEFLLDKEIQSKFIKDLV  169
             M  G EG  T     KW++FL+D  +Q +   D V
Sbjct  423   MADGWEGQGT----NKWRDFLVDDAVQKRLADDFV  453



>ref|NP_001067852.2| Os11g0457300 [Oryza sativa Japonica Group]
 gb|ABA93512.1| Flavonol 3-O-glucosyltransferase, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF28215.2| Os11g0457300 [Oryza sativa Japonica Group]
Length=479

 Score =   426 bits (1094),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 227/459 (49%), Positives = 308/459 (67%), Gaps = 9/459 (2%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSV--HGVKISFFSAAGNVDRIKSMLNSNPCTQIVP-  1339
             LHVV+FPF AFGHISPF QL+ K++    GV+++F SAA NV R+++ML     T  V  
Sbjct  22    LHVVMFPFLAFGHISPFAQLARKMAGVGAGVRVTFLSAAANVPRVEAMLGGTGGTSTVAA  81

Query  1338  LALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLP  1159
             L LP V GLP G +STA+     AELL +A++  +PQ++ALL  L P  V+FDFA  W+ 
Sbjct  82    LELPRVPGLPEGAESTAEVSADGAELLKLAVDGTRPQVEALLARLHPDVVLFDFATPWVV  141

Query  1158  PLAAELGIKTIffsvfvalatafatVPAR--LPGPERSPTVEEMKKPPPGFPPTS-VASL  988
              +A  LG+K   FSVF A++ A+   PAR  LPGP R PTV+++   P GFPP+S +A++
Sbjct  142   DVARPLGVKAALFSVFAAVSGAYVMAPARRRLPGPGR-PTVDDLASAPEGFPPSSPLATV  200

Query  987   RTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPL  808
               ++A DF  +F+  H G   VYDRV A  N C A++ KTC EME PYIDY+ ++  KP+
Sbjct  201   PAYQAADFSYVFESFH-GMPCVYDRVAACHNACDALVIKTCAEMEGPYIDYIAAEHGKPV  259

Query  807   LLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLP  628
             L+ GP+VPEP  G L+++WA WLS F  ++V++ SFGSETFL      EL LGLE T LP
Sbjct  260   LVTGPIVPEPPRGELEERWATWLSSFPDNSVVFASFGSETFLLHAAATELLLGLEATALP  319

Query  627   FFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGF  448
             F  VLNFP   D  +EL +  P G  ERVKGRGI+H+GWVQQQ IL H SVGC+V H+G 
Sbjct  320   FLAVLNFPKGTDAEAELRKLTPPGLEERVKGRGILHTGWVQQQHILRHRSVGCFVNHSGL  379

Query  447   SSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTI  268
             SSV+EG+V  C+LV+LP KGDQ+LNA L A +++ G EV RR  DG+F +ED++ A+   
Sbjct  380   SSVVEGLVAGCRLVLLPMKGDQYLNAALFARELRVGTEVARRARDGWFGREDVRDALAAA  439

Query  267   MGEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                 G      ++KW+EFL+D  +Q +F+++ V  +R +
Sbjct  440   F-AGGEDGGGEEKKWREFLMDDAVQRRFVREFVAELRRL  477



>gb|EAY80827.1| hypothetical protein OsI_36007 [Oryza sativa Indica Group]
Length=479

 Score =   424 bits (1090),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 226/459 (49%), Positives = 308/459 (67%), Gaps = 9/459 (2%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSV--HGVKISFFSAAGNVDRIKSMLNSNPCTQIVP-  1339
             LHVV+FPF AFGHISPF QL+ K++    GV+++F SAA NV R+++ML     T  V  
Sbjct  22    LHVVMFPFLAFGHISPFAQLARKMAGVGAGVRVTFLSAAANVPRVEAMLGGTGGTSTVAA  81

Query  1338  LALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLP  1159
             L LP V GLP G +STA+     AELL +A++  +PQ++ALL  L P  V+FDFA  W+ 
Sbjct  82    LELPRVPGLPEGAESTAEVSADGAELLKLAVDGTRPQVEALLARLHPDVVLFDFATPWVV  141

Query  1158  PLAAELGIKTIffsvfvalatafatVPAR--LPGPERSPTVEEMKKPPPGFPPTS-VASL  988
              +A  LG+K   FSVF A++ A+   PAR  LPGP R PTV+++   P GFPP+S +A++
Sbjct  142   DVARPLGVKAALFSVFAAVSGAYVMAPARRRLPGPWR-PTVDDLASAPEGFPPSSPLATV  200

Query  987   RTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPL  808
               ++A DF  +F+  H G   VYDRV A  N C A++ KTC EME PYIDY+ ++  KP+
Sbjct  201   PAYQAADFSYVFESFH-GMPCVYDRVAACHNACDALVIKTCAEMEGPYIDYIAAEHGKPV  259

Query  807   LLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLP  628
             L+ GP+VPEP  G L+++WA WLS F  ++V++ SFGSETFL      EL LGLE T LP
Sbjct  260   LVTGPIVPEPPRGELEERWATWLSSFPDNSVVFASFGSETFLLHAAATELLLGLEATALP  319

Query  627   FFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGF  448
             F  VLNFP   D  +EL +  P G  ERVKGRGI+H+GWVQQQ IL H SVGC+V H+G 
Sbjct  320   FLAVLNFPKGTDAEAELRKLTPPGLEERVKGRGILHTGWVQQQHILRHRSVGCFVNHSGL  379

Query  447   SSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTI  268
             SSV+EG++  C+LV+LP KGDQ+LNA L A +++ G EV RR  DG+F +ED++ A+   
Sbjct  380   SSVVEGLIAGCRLVLLPMKGDQYLNAALFARELRVGTEVARRARDGWFGREDVRDALAAA  439

Query  267   MGEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                 G      ++KW+EFL+D  +Q +F+++ V  +R +
Sbjct  440   F-AGGEDGGGEEKKWREFLMDDAVQRRFVREFVAGLRRL  477



>gb|ABA93458.1| Flavonol 3-O-glucosyltransferase, putative, expressed [Oryza 
sativa Japonica Group]
Length=470

 Score =   417 bits (1072),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 223/460 (48%), Positives = 308/460 (67%), Gaps = 7/460 (2%)
 Frame = -3

Query  1515  DLLHVVIFPFFAFGHISPFVQLSNKL-SVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVP  1339
             + +HV +FPF AFGHISPF QL+  L +V GV+++F SAA NV R+++ML ++    +  
Sbjct  11    EAMHVALFPFLAFGHISPFAQLARSLGAVGGVRVTFLSAAANVARVEAMLPADGTAVVAA  70

Query  1338  LALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLP  1159
             L LP V GLP G +STA+     AELL +AL+  +PQ++ALL  L+P  V+FDFA  W+ 
Sbjct  71    LHLPRVPGLPVGAESTAEVDADGAELLKLALDGTRPQVEALLARLRPDVVLFDFATPWVA  130

Query  1158  PLAAELGIKTIffsvfvalatafatVPARL---PGPERSPTVEEMKKPPPGFPPTS-VAS  991
              +A +LG +   FSVF A+ +A+ TVPAR     G    PTV+++   P GFPP+S +A+
Sbjct  131   DVARQLGARAAHFSVFTAVTSAYLTVPARRRLHHGAASCPTVDDLATAPVGFPPSSSLAT  190

Query  990   LRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKP  811
             + T++A DF  +F   H G  S YDRV A       ++ KTC EME PYI+YV +Q+ KP
Sbjct  191   VPTYQAADFTYVFTSFH-GMPSAYDRVAACDKASDVLVFKTCAEMEGPYIEYVATQYDKP  249

Query  810   LLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGL  631
             +L+ GP+VPEP  G L+++W  WLS F  + V++ SFGSETFL      EL LGLE TG 
Sbjct  250   ILVTGPLVPEPPHGELEERWETWLSSFPDNAVVFASFGSETFLPTAAATELLLGLEATGQ  309

Query  630   PFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAG  451
             PF  VLNFP +VD  +E+ + +  GF ERVKGRG++HSGWVQQQ IL H SVGCYV HAG
Sbjct  310   PFVAVLNFPRSVDAEAEVKKCMAPGFEERVKGRGVVHSGWVQQQHILRHRSVGCYVNHAG  369

Query  450   FSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQT  271
             FSSV+EG+V  C+LV+LP K DQF NA LLA +++ G EV RRD DG+F  + ++ AV  
Sbjct  370   FSSVVEGLVAGCRLVLLPMKSDQFFNAALLARELRVGTEVARRDGDGWFGHDAVRDAVNA  429

Query  270   IMGEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
              + + G     ++ KW+EFL D  +Q +F+++ V+ +R +
Sbjct  430   AVADAGGGDD-DERKWREFLTDDAVQRRFVEEFVRELRKL  468



>ref|XP_003606382.1| UDP rhamnose anthocyanidin-3-glucoside rhamnosyltransferase [Medicago 
truncatula]
Length=375

 Score =   410 bits (1054),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 204/369 (55%), Positives = 267/369 (72%), Gaps = 10/369 (3%)
 Frame = -3

Query  1239  MQPQIKALLVELKPHFVIFDFAQNWLPPLAAELGIKTIffsvfvalatafatVPARLPGP  1060
             MQ Q+K +L++LKPHFV FDFAQNWLP +A+ELGIK++ FSV+ A+  ++ +  ++    
Sbjct  12    MQDQVKTILLKLKPHFVFFDFAQNWLPKIASELGIKSVHFSVYSAICHSYISRISK----  67

Query  1059  ERSPTVEEMKKPPPGFPPTSVASLRTFEAR-DFVIIFKRPHNGGASVYDRVLAGLNGCSA  883
              R  T E+ K PP G    S  +L+TF+AR +F++++ +  +   +V DR +  L+ CS 
Sbjct  68    GRDVTYEDFKNPPVGIIHNSKRTLQTFQARINFMMLYTKSGDS-PTVSDRFIQSLSECSL  126

Query  882   ILAKTCYEMEAPYIDYVKSQFKKPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCS  703
             IL K+C E+E  Y+DY+++QF+K ++ +G +VPEP+  VL+ KW  WL  F   +VI CS
Sbjct  127   ILFKSCKEIEGSYLDYLQNQFEKAIVFSGVLVPEPSMDVLEDKWTKWLDNFPTKSVILCS  186

Query  702   FGSETFLKDDQIKELALGLELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGII  523
             FGSETFL DDQI ELA+GLELT LPF  VLNFP+N++  SEL RALP GF ERVK  GI+
Sbjct  187   FGSETFLSDDQINELAIGLELTNLPFIFVLNFPSNLNAESELERALPKGFLERVKNTGIV  246

Query  522   HSGWVQQQQILVHSSVGCYVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKA  343
             HSGW QQQ +L HSSVGCYVCHAG SSVIE IVNDCQLV+LP KGDQF N+ L+ADD+KA
Sbjct  247   HSGWFQQQLVLKHSSVGCYVCHAGLSSVIEAIVNDCQLVLLPLKGDQFYNSMLIADDLKA  306

Query  342   GVEVNRRDEDGYFWKEDIQKAVQTIM----GEEGASTRANQEKWKEFLLDKEIQSKFIKD  175
             G+EV R DEDG+F KE I +AV+ +M     E G   R N  KW+EFLLDKEIQ+KFI D
Sbjct  307   GIEVKRNDEDGFFEKEGILEAVKGVMVEVDKEPGKQIRENHMKWREFLLDKEIQNKFITD  366

Query  174   LVKVMRDMA  148
             LV  ++ + 
Sbjct  367   LVAQLKSLV  375



>ref|XP_003560486.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase-like [Brachypodium 
distachyon]
Length=471

 Score =   411 bits (1056),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 224/460 (49%), Positives = 303/460 (66%), Gaps = 9/460 (2%)
 Frame = -3

Query  1518  GDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSML--NSNPCTQI  1345
             GD+ HV++FPF AFGHISPFVQL+ KL  +GV+++  SAA NV R+++ML  +S     +
Sbjct  14    GDI-HVLMFPFLAFGHISPFVQLARKLVANGVRVTLLSAAANVPRVEAMLGFSSAAAVAV  72

Query  1344  VPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNW  1165
             VPL LP V GLP G +STA+     AELL +AL+  +PQ+ ALL EL+P  V+FDFA  W
Sbjct  73    VPLQLPRVAGLPEGAESTAEVSADGAELLKIALDGTRPQVAALLAELRPDAVLFDFATPW  132

Query  1164  LPPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTS--VAS  991
             +  + A LG+K + FSVF A+  A+  VPAR        T +E+   P GFPP+S  + +
Sbjct  133   ITDITAPLGVKALHFSVFAAVVRAYLMVPARRVNGSLPSTADELASGPAGFPPSSALLGT  192

Query  990   LRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKP  811
             +  ++A  F  ++   H G   VYDRV+AG+  C A++ KTC EME  YIDY+ +QF KP
Sbjct  193   VPPYQAAGFKYVYTAFH-GMPCVYDRVVAGIEACDALVVKTCAEMEGAYIDYLAAQFGKP  251

Query  810   LLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGL  631
             +L+ G VVP+P  G L++ WA WLS F  +  ++ SFGSETFL      EL LGLE +  
Sbjct  252   VLVTGLVVPDPPQGELEEPWATWLSTFPDNAAVFASFGSETFLPAAAATELLLGLEASKR  311

Query  630   PFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAG  451
             PF  VLNFP   DV +EL + +P GF ERVKGRG +H+GWVQQQ IL H+SVGC+V HAG
Sbjct  312   PFLAVLNFPRGADVEAELRKCVPPGFEERVKGRGAVHTGWVQQQHILRHASVGCFVNHAG  371

Query  450   FSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQT  271
              SSV+EG+V  C+LV+LP KGDQ+LNA L A +++ GVEV RR  DG+F  ED+  AV  
Sbjct  372   LSSVVEGLVAGCRLVLLPMKGDQYLNAALAARELRVGVEVARRGLDGWFGAEDVAAAVAE  431

Query  270   IMGEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                + G       +KW EFL+D  +Q +F+ D +  ++D+
Sbjct  432   AETDVGCG---EGKKWVEFLMDAAVQKRFVDDFIAGLKDL  468



>ref|XP_004979714.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase-like [Setaria 
italica]
Length=469

 Score =   407 bits (1046),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 225/465 (48%), Positives = 305/465 (66%), Gaps = 12/465 (3%)
 Frame = -3

Query  1530  NNHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHG---VKISFFSAAGNVDRIKSML-NS  1363
             +   G   HVV+FP+ AFGHISPF QL+ KL + G   ++++F +AAGNV R+++ML  +
Sbjct  8     SGRAGVATHVVMFPWLAFGHISPFAQLTRKL-ISGDETLRVTFLTAAGNVPRVEAMLAEA  66

Query  1362  NPCTQIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIF  1183
                  ++PL LP+V GLPP   STA+     AELL VAL+  +PQ+  LL EL+P  V+F
Sbjct  67    AGAVAVLPLDLPSVPGLPPVAASTAELSADGAELLKVALDGTRPQVATLLAELRPDAVLF  126

Query  1182  DFAQNWLPPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPT  1003
             DFA  W+  +AA LG++ ++F+V+ A   A    PAR PG +R P+  E+   P GFP  
Sbjct  127   DFAVPWVCDVAAPLGVRALYFNVYSAATLALTV-PARCPGGQR-PSAHELTAAPAGFPSD  184

Query  1002  S-VASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKS  826
             S + +L  ++A +   +F+  + G  S YDR +    GC  I+ KTC EME PYIDY+ +
Sbjct  185   SPLVTLPAYQAANMTYVFESFY-GMPSAYDRFIECFKGCFGIVMKTCAEMEGPYIDYILA  243

Query  825   QFKKPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGL  646
             Q  KP+LLAGPVVPEP  G L+++WA WLS F  ++V++ SFGSETFL      EL LGL
Sbjct  244   QIGKPVLLAGPVVPEPPEGELEERWASWLSSFPENSVVFASFGSETFLPAAAATELLLGL  303

Query  645   ELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCY  466
             E T  PF  VLNFP   D  +EL   +P GF ERVKGRG +H+GWVQQQ IL H SVGCY
Sbjct  304   EATNRPFLAVLNFPKGADTEAELRARIPPGFEERVKGRGAVHTGWVQQQHILQHQSVGCY  363

Query  465   VCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQ  286
             + HAGFSS +EG+V  C+LV+LP KGDQ++NA LLA +++ GVEV RRDEDG+F  +D+ 
Sbjct  364   LNHAGFSSAVEGLVAGCRLVLLPMKGDQYVNAALLARELRVGVEVARRDEDGWFGGQDVS  423

Query  285   KAVQTIMGEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
              AV   M E G     +  KW+EFL D  +Q +F  D V+ ++++
Sbjct  424   DAVALAMAEGG---DGDGRKWREFLTDDAVQKRFAGDFVRQLKEL  465



>ref|XP_004980748.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase-like [Setaria 
italica]
Length=463

 Score =   406 bits (1044),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 226/463 (49%), Positives = 300/463 (65%), Gaps = 13/463 (3%)
 Frame = -3

Query  1518  GDLLHVVIFPFFAFGHISPFVQLSNKL----SVHGVKISFFSAAGNVDRIKSMLNSNPCT  1351
             G+ +HVV+ P+ AFGHISPF QL+ KL      H ++++F +A GN+ R+++ML      
Sbjct  3     GEAIHVVMLPWLAFGHISPFAQLARKLFSVEGGHNIRVTFLTADGNLPRVQAMLAPAAGA  62

Query  1350  QIVPLA-LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFA  1174
               V    LP V GLP G  STA+     AELL VA +  + Q+ ALL EL+P   + DFA
Sbjct  63    AAVVPLHLPHVPGLPEGAASTAELTADGAELLKVAFDGTRDQVSALLSELRPDAALIDFA  122

Query  1173  QNWLPPLAAELGIKTIffsvfvalatafatVPAR-LPGPERSPTVEEMKKPPPGFPPTS-  1000
               W+  +AA LGIK ++FSVF A+A+ +  VPAR L G   +P+  +    P GFP  S 
Sbjct  123   TPWVTDIAAPLGIKVLYFSVFSAVASTYTVVPARRLHGA--APSAGDFTAAPSGFPKGSA  180

Query  999   VASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQF  820
             +A++  ++A D   +F   + G   VYDRV AG+  C AI+ KTC EME PYI Y+ +QF
Sbjct  181   LATIPPYQAADLTYLFTSFY-GQPCVYDRVTAGIKACDAIVIKTCVEMEGPYISYLSAQF  239

Query  819   KKPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLEL  640
              +P+LLAGPVVPEP  G LD++WA WLS F  ++V++ SFGSETFL      EL LGLE 
Sbjct  240   GRPVLLAGPVVPEPPQGHLDERWASWLSSFPENSVVFASFGSETFLPTAAATELLLGLEA  299

Query  639   TGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVC  460
             T  PF  VLNFP   D  +EL   +P GF ERVKGRG +H+GWVQQQ IL H SVGCY+ 
Sbjct  300   TNRPFLAVLNFPKGADTEAELRARIPPGFEERVKGRGAVHTGWVQQQHILQHQSVGCYLN  359

Query  459   HAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKA  280
             HAGFSS +EG+V  C+LV+LP KGDQ+LNA LLA +++ GVEV RRDEDG+F  +D+  A
Sbjct  360   HAGFSSAVEGLVAGCRLVLLPMKGDQYLNAALLARELRVGVEVARRDEDGWFGGQDVSDA  419

Query  279   VQTIMGEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             V   M E G     +  KW+EFL D  +Q +F  D V+ ++++
Sbjct  420   VALAMAEGGDR---DGRKWREFLTDDAVQKRFAGDFVRQLKEL  459



>ref|XP_004979787.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase-like [Setaria 
italica]
Length=464

 Score =   403 bits (1036),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 224/462 (48%), Positives = 297/462 (64%), Gaps = 19/462 (4%)
 Frame = -3

Query  1518  GDLLHVVIFPFFAFGHISPFVQLSNKL-SVHG--VKISFFSAAGNVDRIKSMLNSNPCTQ  1348
             G+ +HVV+ P+ AFGHISPF QL+ KL SV G  ++++F +A GN+ R+++ML       
Sbjct  12    GEAIHVVMLPWLAFGHISPFAQLARKLFSVEGGHIRVTFLTADGNLPRVQAMLAPAVGAA  71

Query  1347  IVP-LALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQ  1171
              V  L LP V GLP G  STA+    A +         + Q+ ALL EL+P   + DFA 
Sbjct  72    AVVPLHLPHVPGLPEGAASTAELLKVAFDGT-------RDQVSALLSELRPDAALIDFAT  124

Query  1170  NWLPPLAAELGIKTIffsvfvalatafatVPAR-LPGPERSPTVEEMKKPPPGFPPTS-V  997
              W+  +AA LGIK + FSVF A+A A+  V AR L G    P+  +    P GFP  S +
Sbjct  125   PWVTDIAAPLGIKVLHFSVFSAVARAYNVVLARRLHGA--VPSAGDPMAAPSGFPKGSAL  182

Query  996   ASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFK  817
             A++  ++A  F  +F   + G   VYDRV+AG+  C AI+ KTC EME PYI Y+ +QF 
Sbjct  183   ATIPPYQAAGFTYLFTSFY-GQPCVYDRVIAGIKACDAIVVKTCVEMEGPYISYLSAQFG  241

Query  816   KPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELT  637
             +P+LLAGPVVPEP  G LD++WA WLS F  ++V++ SFGSE FL      EL LGLE T
Sbjct  242   RPVLLAGPVVPEPLQGHLDERWASWLSSFPENSVVFASFGSEMFLPAAAATELLLGLEAT  301

Query  636   GLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCH  457
               PF  VLNFP   D  +EL   +P GF ERVKGRG +H+GWVQQQ IL H SVGCYV H
Sbjct  302   NRPFLAVLNFPKGADTEAELRARIPPGFEERVKGRGAVHTGWVQQQHILQHQSVGCYVNH  361

Query  456   AGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAV  277
             AGFSSV+EG+V  C+LV+LP KGDQ+LNA LL  +++ GVEV RRDEDG+F ++D+  AV
Sbjct  362   AGFSSVVEGLVAGCRLVLLPMKGDQYLNAALLVRELQVGVEVARRDEDGWFGRQDVSDAV  421

Query  276   QTIMGEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                M E G     +  KW+EFL D  +Q +F +D V+ ++++
Sbjct  422   ALAMAEGG---DGDGRKWREFLTDDAVQKRFARDFVRQLKEL  460



>ref|XP_003560487.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase-like [Brachypodium 
distachyon]
Length=473

 Score =   400 bits (1029),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 226/468 (48%), Positives = 309/468 (66%), Gaps = 13/468 (3%)
 Frame = -3

Query  1527  NHGGDL---LHVVIFPFFAFGHISPFVQLSNKLSV--HGVKISFFSAAGNVDRIKSMLNS  1363
             + GGD    +HV++FPF AFGHISPFVQL+ KL    + V+++  SAA NV R+++ML +
Sbjct  7     SAGGDGDGDIHVLMFPFLAFGHISPFVQLARKLVAGNNRVRVTLLSAAANVPRVEAMLGA  66

Query  1362  NPCTQIV--PLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFV  1189
             +    +   PL LP V GLP G +STA+     AELL +A++  +PQ+ ALL EL+P  V
Sbjct  67    SAAAAVAVAPLQLPRVAGLPEGAESTAEVSADGAELLKIAVDGTRPQVAALLAELRPDAV  126

Query  1188  IFDFAQNWLPPLAAELGIKTIffsvfvalatafatVPARLPGPERSP-TVEEMKKPPPGF  1012
             +FDFA  W+  +AA LGIK + FSVF A+A A+  V AR       P T +E+   P GF
Sbjct  127   LFDFATPWVTDIAAPLGIKALQFSVFAAVAGAYLMVQARRANNGSLPSTADELVSAPAGF  186

Query  1011  PPTS-VASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDY  835
             PP+S +A++  ++A DF  ++   H G   VYDRV+AG+  C A++ KTC EME  YIDY
Sbjct  187   PPSSALATVPAYQAADFKYVYTAFH-GMPCVYDRVVAGIEACDALVVKTCAEMEGAYIDY  245

Query  834   VKSQFKKPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELA  655
             + +QF KP+L+ G VVP+P  G L++ WA WLS F  +  ++ SFGSETFL      EL 
Sbjct  246   LAAQFGKPVLVTGLVVPDPPQGELEEPWATWLSTFPDNAAVFASFGSETFLPAAAATELL  305

Query  654   LGLELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSV  475
             LGLE +  PF  VLNFP   DV +EL + +P GF ERVKGRG +H+GWVQQQ IL H+SV
Sbjct  306   LGLEASKRPFLAVLNFPRGADVEAELRKCVPPGFEERVKGRGAVHTGWVQQQHILRHASV  365

Query  474   GCYVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKE  295
             GC+V HAG SSV+EG+V  C+LV+LP KGDQ+LNA L A +++ GVEV RR EDG+F ++
Sbjct  366   GCFVNHAGLSSVVEGLVAGCRLVLLPMKGDQYLNAALAARELRVGVEVARRAEDGWFGRD  425

Query  294   DIQKAVQTIMGEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             D+  AV     + G       +KW EFL+D  +Q +F+ D +  +R++
Sbjct  426   DVAAAVAEAEADGGCR---EGKKWVEFLMDGAVQRRFVDDFIVGLRNL  470



>ref|XP_002442800.1| hypothetical protein SORBIDRAFT_08g003060 [Sorghum bicolor]
 gb|EES16638.1| hypothetical protein SORBIDRAFT_08g003060 [Sorghum bicolor]
Length=483

 Score =   400 bits (1027),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 224/475 (47%), Positives = 302/475 (64%), Gaps = 16/475 (3%)
 Frame = -3

Query  1530  NNHGGDLLHVVIFPFFAFGHISPFVQLSNKL--SVHGVKISFFSAAGNVDRIKSMLNSNP  1357
             N      +HV++ P+ AFGHI PF QL+ +L  S   V+++F +AAGNV R+++ML+S  
Sbjct  8     NRDAAPAMHVLMLPWLAFGHIVPFAQLARRLLASSSSVRVTFVTAAGNVPRVEAMLSSAS  67

Query  1356  C-----TQIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHF  1192
                     IVPL LP V GLP G  STA+     AELL VAL+  +PQ+ ALL EL+P  
Sbjct  68    SSAGGRVSIVPLRLPHVPGLPEGAASTAELSLDGAELLKVALDGARPQVAALLAELRPDA  127

Query  1191  VIFDFAQNWLPPLAAELGIKTIffsvfvalatafatVPARLP-GPERSPTVEEMKKPPPG  1015
             V+ DFA  W    AA LG+K++ FSVF A+A A+  VPAR P G    P+  ++   P G
Sbjct  128   VLLDFATPWAADDAAALGVKSLQFSVFSAIAGAYLVVPARRPEGASPPPSARDLMSGPAG  187

Query  1014  FP---PTSVASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPY  844
             FP   P +   +  ++A DF  +F     G   VY+RV+AG+  C  ++ KTC +MEA Y
Sbjct  188   FPASSPLAATGVPAYQAADFTYVFTS-FGGQPCVYERVVAGIRACDGVVLKTCADMEAAY  246

Query  843   IDYVKSQFKKPLLLAGPVVPEPASG--VLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQ  670
             +DY+ +QF+KP+L AGP+VP+P  G  +LD++WA WLS F    V++ SFGSETFL    
Sbjct  247   VDYLAAQFRKPVLTAGPLVPDPPRGDELLDERWATWLSAFPDGAVVFASFGSETFLPPAA  306

Query  669   IKELALGLELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQIL  490
               EL LGLE TG PF  VLN P +   A+ +    P GF ERV GRGI+HSGWVQQQ IL
Sbjct  307   ATELLLGLEATGRPFLAVLNSPDDGGGAAVV--VTPPGFKERVSGRGIVHSGWVQQQHIL  364

Query  489   VHSSVGCYVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDG  310
              H SVGCYV HAGFSSV+EG+V  C+LV+LP KGDQ+LNA L A +++ GVEV RRDEDG
Sbjct  365   RHRSVGCYVTHAGFSSVVEGLVAGCRLVLLPMKGDQYLNAALFARELRVGVEVARRDEDG  424

Query  309   YFWKEDIQKAVQTIMGEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMAT  145
             +F + D+  AV   +  +G      ++KW +F  D  +Q KF  + V+ +R++ +
Sbjct  425   WFGRHDVCDAVAAAVANDGGGGDDARKKWTDFFTDDAVQGKFADEFVRQLREIVS  479



>gb|EEE52059.1| hypothetical protein OsJ_33813 [Oryza sativa Japonica Group]
Length=464

 Score =   392 bits (1006),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 217/459 (47%), Positives = 295/459 (64%), Gaps = 24/459 (5%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSV--HGVKISFFSAAGNVDRIKSMLNSNPCTQIVP-  1339
             LHVV+FPF AFGHISPF QL+ K++    GV+++F SAA NV R+++ML     T  V  
Sbjct  22    LHVVMFPFLAFGHISPFAQLARKMAGVGAGVRVTFLSAAANVPRVEAMLGGTGGTSTVAA  81

Query  1338  LALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLP  1159
             L LP V GLP G +STA+     AELL +A++  +PQ++ALL  L P  V+FDFA  W+ 
Sbjct  82    LELPRVPGLPEGAESTAEVSADGAELLKLAVDGTRPQVEALLARLHPDVVLFDFATPWVV  141

Query  1158  PLAAELGIKTIffsvfvalatafatVPAR--LPGPERSPTVEEMKKPPPGFPPTS-VASL  988
              +A  LG+K   FSVF A++ A+   PAR  LPGP R PTV+++   P GFPP+S +A++
Sbjct  142   DVARPLGVKAALFSVFAAVSGAYVMAPARRRLPGPGR-PTVDDLASAPEGFPPSSPLATV  200

Query  987   RTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPL  808
               ++A DF  +F+  H G   VYDRV A  N C A++ KTC EME PYIDY+ ++  KP+
Sbjct  201   PAYQAADFSYVFESFH-GMPCVYDRVAACHNACDALVIKTCAEMEGPYIDYIAAEHGKPV  259

Query  807   LLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLP  628
             L+ GP+VPEP  G L+++WA WLS F  ++V++ SFGSETFL      EL LGLE T LP
Sbjct  260   LVTGPIVPEPPRGELEERWATWLSSFPDNSVVFASFGSETFLLHAAATELLLGLEATALP  319

Query  627   FFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGF  448
             F  VLNFP   D  +EL +  P G  ERVKGRGI+H+GWVQQQ IL H S          
Sbjct  320   FLAVLNFPKGTDAEAELRKLTPPGLEERVKGRGILHTGWVQQQHILRHRS----------  369

Query  447   SSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTI  268
                  G+V  C+LV+LP KGDQ+LNA L A +++ G EV RR  DG+F +ED++ A+   
Sbjct  370   -----GLVAGCRLVLLPMKGDQYLNAALFARELRVGTEVARRARDGWFGREDVRDALAAA  424

Query  267   MGEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                 G      ++KW+EFL+D  +Q +F+++ V  +R +
Sbjct  425   F-AGGEDGGGEEKKWREFLMDDAVQRRFVREFVAELRRL  462



>ref|XP_007025501.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY28123.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=456

 Score =   385 bits (988),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 206/460 (45%), Positives = 280/460 (61%), Gaps = 9/460 (2%)
 Frame = -3

Query  1521  GGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIV  1342
             G   LH+ ++P+FA GHI+ F+ +SNKL+  G KISFF       + +           +
Sbjct  2     GEKFLHMAMYPWFAVGHITSFLHISNKLAERGHKISFFLPTKTQSKFEPFNLHPDVITFI  61

Query  1341  PLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWL  1162
             P+ +P ++GLP GT++T D P +   LL  A++L +P I+A L ELKPHF+ FDF   W+
Sbjct  62    PIKVPHIDGLPLGTETTTDIPFSLQPLLMAAMDLTEPAIEASLRELKPHFLFFDFT-FWM  120

Query  1161  PPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRT  982
             P L   LGIK++++         +   P R    E+  T  ++ +PP GFP +S+  LR 
Sbjct  121   PALCHRLGIKSMYYCTISPATVGYLISPTR-KILEKGLTGSDLMEPPLGFPSSSI-KLRD  178

Query  981   FEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLL  802
              EAR       R +  G S   R L  LN C AI  KTC E+E PY DYV+ QF+KP++L
Sbjct  179   HEARGLAAATTREYGSGISFVVRQLTALNECDAIGFKTCREIEGPYCDYVEKQFEKPVIL  238

Query  801   AGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFF  622
             AGPV PEP +  L+++W   LS F+  TVI+C+FGSE  L  DQ +EL LGLELTGLPF 
Sbjct  239   AGPVAPEPPNKTLEERWEKLLSSFQAQTVIFCAFGSECVLNKDQFQELVLGLELTGLPFL  298

Query  621   LVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSS  442
             + L  P   + A     ALP GF ERVKGRG +H  WV QQ IL H SVGC+V H G  S
Sbjct  299   VALKAPMGAETA---ESALPEGFQERVKGRGFVHGSWVPQQLILSHPSVGCFVTHCGSGS  355

Query  441   VIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMG  262
             + E +VNDCQLV+LP  GDQ +NA+L+A D+K GVEV + +EDG F K+D+ KAV  +M 
Sbjct  356   LSEAMVNDCQLVLLPHVGDQIINARLMAGDLKVGVEVEKGEEDGLFRKDDVCKAVMAMMD  415

Query  261   EE---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             ++   G   RAN  KWK+FLL K ++  +I   V+ +  +
Sbjct  416   DDSEVGKEARANHAKWKDFLLGKGLEISYIDSFVEKLHAL  455



>gb|AES88578.2| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=392

 Score =   381 bits (979),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 182/308 (59%), Positives = 234/308 (76%), Gaps = 11/308 (4%)
 Frame = -3

Query  1056  RSPTVEEMKKPPPGFPPTSVASLRTFEARD-FVIIFKRPHNGGASVYDRVLAGLNGCSAI  880
             R  T E+ K PP G+ P S  SL+TF+A++ F+ +F+R +      + +V+   +  S I
Sbjct  91    RDITYEDFKNPPLGYFPNSKLSLQTFQAKNIFIALFQRFN------FHKVMQNFSESSLI  144

Query  879   LAKTCYEMEAPYIDYVKSQFKKPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSF  700
             + K+C EME PY+DY+++QF+KP+L +G +VPEP+  VL++KW  WL  F   +VI CSF
Sbjct  145   VFKSCKEMEGPYLDYLQNQFEKPILFSGVLVPEPSMDVLEEKWTKWLDNFPTKSVILCSF  204

Query  699   GSETFLKDDQIKELALGLELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIH  520
             GSETFL DDQI ELA+GLELT LPF LVLNFP+N++  SEL RALP GF ERVK RGI+H
Sbjct  205   GSETFLSDDQINELAIGLELTNLPFILVLNFPSNLNAESELERALPKGFLERVKNRGIVH  264

Query  519   SGWVQQQQILVHSSVGCYVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAG  340
             SGW+QQQ +L HSSVGCYVCHAGFSSVIE IVNDCQLV+LP KGDQFLN+KL+ADD+KAG
Sbjct  265   SGWLQQQLVLKHSSVGCYVCHAGFSSVIEAIVNDCQLVLLPFKGDQFLNSKLIADDLKAG  324

Query  339   VEVNRRDEDGYFWKEDIQKAVQTIM----GEEGASTRANQEKWKEFLLDKEIQSKFIKDL  172
             VEVNR+DEDG+F KE + +AV+T+M     E G   R N  KW+EFLLDK+IQ+KFI DL
Sbjct  325   VEVNRKDEDGFFEKEGLFEAVKTVMVEVDKEPGKQIRENHMKWREFLLDKKIQNKFITDL  384

Query  171   VKVMRDMA  148
             +  ++ +A
Sbjct  385   IARLKSLA  392



>ref|XP_010277785.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Nelumbo nucifera]
Length=462

 Score =   380 bits (977),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 193/457 (42%), Positives = 291/457 (64%), Gaps = 8/457 (2%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
              HVV++P+FAFGH++PF+ LSNKL+  G +ISF        ++++        + VPL +
Sbjct  7     FHVVMYPWFAFGHLTPFLHLSNKLAERGHRISFLLPTKARAKLEAFNLHPDLIRFVPLVV  66

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P V+GLP G ++T D P     L+  A++  QP ++A L +LKP F+ FDF  + +PPLA
Sbjct  67    PHVDGLPAGAETTNDVPLHLQPLIMSAMDRTQPDVEAALKDLKPDFIFFDFT-HCIPPLA  125

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEE-MKKPPPGFPPTSVASLRTFEA  973
               LGIK+I + +  A   A+   PA +   E +   E+ +   PPGFPP+S   L   EA
Sbjct  126   RRLGIKSIQYCITSAATIAYLLAPASIKLEEGAQLSEDDLMHQPPGFPPSSSIKLHRHEA  185

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             R    I  R +  G S ++R+   L    A+  ++C E+E P+ +Y++ Q+ K +LL+GP
Sbjct  186   RKMTFITYREYGSGVSFHERITWALRDSDAVCFRSCSEIEGPFCEYLEKQYGKIVLLSGP  245

Query  792   VVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
             ++PEP +  L+ +WA WL  F+  +V+YC+FGSE FL+ DQ +EL LG ELTGLPFF+ L
Sbjct  246   ILPEPPTSSLEDRWAKWLDGFKAGSVVYCAFGSECFLEKDQFQELVLGFELTGLPFFVAL  305

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
               P   +   E   ALP GFTERV+GRG++  GWVQQQ IL H S+GC+V H+G++S+IE
Sbjct  306   KPPIGTETMEE---ALPEGFTERVRGRGVVEGGWVQQQLILGHPSIGCFVSHSGWASLIE  362

Query  432   GIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE-  256
              +VN  QLV+LP  GDQF++A+L++ D+K GVEV RR+EDG+F +E++ KAV+ +M E+ 
Sbjct  363   SLVNQPQLVLLPYSGDQFVHARLMSGDLKVGVEVERREEDGWFTRENVCKAVKMVMDEDN  422

Query  255   --GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
               G   RAN+ + ++  L +   S +I   ++ +R +
Sbjct  423   EVGREVRANRLRLRDVFLKQGFDSSYIDGFIEKLRTL  459



>ref|XP_002448982.1| hypothetical protein SORBIDRAFT_05g002840 [Sorghum bicolor]
 gb|EES07970.1| hypothetical protein SORBIDRAFT_05g002840 [Sorghum bicolor]
Length=479

 Score =   381 bits (978),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 215/477 (45%), Positives = 297/477 (62%), Gaps = 21/477 (4%)
 Frame = -3

Query  1542  REITNNHGGDLLHVVIFPFFAFGHISPFVQLSNKL--SVHGVKISFFSAAGNVDRIKSML  1369
             R+         +HVV+ P+ AFGHI PF QL+ +L  S   V+++F +AAGNV R+++ML
Sbjct  9     RDAGGGSNATPMHVVMLPWLAFGHIVPFAQLARRLLASSSAVRVTFLTAAGNVPRVEAML  68

Query  1368  NSNPCT---QIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKP  1198
             +S        +VPL LP V GLP G  STA+  P  AELL V+L+  +PQ+ ALL EL+P
Sbjct  69    SSAASAGGVAVVPLNLPRVPGLPEGAASTANLSPEGAELLKVSLDAARPQVAALLAELRP  128

Query  1197  HFVIFDFAQNWLPPLAAELGIKTIffsvfvalatafatVPARLP---GPERSPTVEEMKK  1027
               V+ DFA  W    AA LG+K+  FSVF A+A A+  VPAR P   G    P+  ++  
Sbjct  129   DAVLLDFATPWASHDAAALGVKSFHFSVFSAVACAYLAVPARRPDGAGAGALPSAHDLLS  188

Query  1026  PPPGFP---PTSVASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEM  856
              P GFP   P +   +  ++A DF  +F     G   V++R++AG+  C  ++ KTC EM
Sbjct  189   VPTGFPASSPLAATGVPAYQATDFTYMFSS-FGGKPCVHERLVAGIQACDGVVYKTCAEM  247

Query  855   EAPYIDYVKSQFKKPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKD  676
             E  Y++Y+ +Q++KP+L+AGP+VP+   G LD++W+ WLS F    V++ SFGSETFL  
Sbjct  248   EGAYVEYLAAQYRKPVLMAGPLVPDRPQGELDERWSTWLSAFPDGAVVFASFGSETFLPP  307

Query  675   DQIKELALGLELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQ  496
                 EL LGLE TG PF  VLN P    V +      P GF ERV GRG++ SGWVQQQ 
Sbjct  308   AAAMELLLGLEATGRPFLAVLNCPDGEAVVA------PPGFAERVAGRGVVCSGWVQQQH  361

Query  495   ILVHSSVGCYVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDE  316
             IL H SVGCYV H GFSSV+EG+V  C+LV+LP KGDQ+LNA L A +++ GVEV RRDE
Sbjct  362   ILHHRSVGCYVTHVGFSSVVEGLVAGCRLVLLPMKGDQYLNAALFARELRVGVEVARRDE  421

Query  315   DGYFWKEDIQKAVQTIMGEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMAT  145
             DG+F ++D+  AV   + + G        KW +FL D  +Q +F  + V+ +R++ +
Sbjct  422   DGWFGRQDVCDAVAAAVADGG---EGEARKWADFLTDDGVQGRFADEFVRQLRELVS  475



>ref|XP_007025500.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY28122.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=456

 Score =   380 bits (975),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 202/456 (44%), Positives = 281/456 (62%), Gaps = 9/456 (2%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
              H+ ++P+FA GHI+ FV ++NKL+  G KISFF  A    ++++          +P+ +
Sbjct  6     FHIALYPWFALGHITAFVHIANKLAERGHKISFFLPAKTQRKVEAFNLHPDLITFIPITV  65

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P VEGLP G ++T D P     L+  A++L +P I+A L+ELKPHFV FDF   WLP L+
Sbjct  66    PHVEGLPHGAETTNDVPFPLHPLIMTAMDLTEPDIEASLLELKPHFVFFDFT-CWLPALS  124

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
               LGIK++ + +  +    +   PAR    E+  T  ++ +PP GFP +S+  LRT EAR
Sbjct  125   RRLGIKSVLYCIVSSATIGYLLSPAR-KILEKGLTGHDLLEPPKGFPSSSI-KLRTHEAR  182

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
                 +    +  G S   R L  L+ C AI  KTC E+E P+ DY+  QF+K ++ AGPV
Sbjct  183   GLAAVTTMDYGSGISFVQRQLRSLSDCDAISFKTCREIEGPFCDYIGHQFEKTVIFAGPV  242

Query  789   VPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLN  610
             VPEP    L+++W   LS F+  TVI+C+FGSE  LK DQ +EL LGLE TGLPF + L 
Sbjct  243   VPEPPKLALEERWEKLLSSFQAKTVIFCAFGSECVLKKDQFQELVLGLEQTGLPFLVALK  302

Query  609   FPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEG  430
              P     A  +  ALP GF ERV+GRG++H GWV QQ IL H SVGC+V H G  S+ E 
Sbjct  303   PPMG---AETIESALPEGFQERVQGRGLVHGGWVPQQLILRHPSVGCFVTHCGSGSLAEA  359

Query  429   IVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM---GE  259
             +VNDCQLV+LP  GDQ +NA+L+A D++ GVEV + DEDG F K+ + KAV+ +M    E
Sbjct  360   MVNDCQLVLLPNVGDQIINARLMAGDLRIGVEVEKGDEDGLFKKDGVCKAVKAVMDDDSE  419

Query  258   EGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
              G   R N  KWKEFLL   +++ ++   V+ +  +
Sbjct  420   VGKEARVNHAKWKEFLLGPGLENSYMDAFVEKLHAL  455



>ref|XP_006848503.1| hypothetical protein AMTR_s00013p00259270 [Amborella trichopoda]
 gb|ERN10084.1| hypothetical protein AMTR_s00013p00259270 [Amborella trichopoda]
Length=475

 Score =   380 bits (977),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 213/462 (46%), Positives = 302/462 (65%), Gaps = 17/462 (4%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHG-VKISFFSAAGNVDRIKSMLNSNPCTQIVPLA  1333
             LHV +FP+ AFGHI+P+V L+NKL+     +++  SA GN+ +I   +       ++PL 
Sbjct  16    LHVAMFPWLAFGHINPYVYLANKLAGDAATRVTIVSAPGNLPQISPSILLPSLITLLPLP  75

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             LP ++GLPPG + T D     AELL  AL+  QPQ+ ++L +L P  V++DF+  WLP +
Sbjct  76    LPHIDGLPPGLECTTDATFLQAELLKDALDATQPQVVSILRDLAPDLVVYDFSYCWLPTV  135

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
             A +LGI+ ++FSVF A +  +  V  R       PT EE+++ P GFP      LR FEA
Sbjct  136   AHKLGIRAVYFSVFSAASDGYTMVCERRAN-GTFPTSEELERSPLGFPSGCNFVLRPFEA  194

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             R F+ ++     G  SVYDRV   +    A+L KTC EME P+ DY+ +Q KKP+LLAGP
Sbjct  195   RQFMYLYTS-FAGKPSVYDRVTRSIREADALLFKTCSEMEGPFCDYIAAQHKKPILLAGP  253

Query  792   VVPEPAS-----GVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLP  628
              +P P         LD +W+ WLS     +V++C+FGSETFL + +I+EL LG+E+TGLP
Sbjct  254   AIPGPNQQRIGIAALDNEWSTWLSSHPAGSVVFCAFGSETFLTEKEIQELLLGIEMTGLP  313

Query  627   FFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGF  448
             F +VLNFP+   + S     +P GF ERV+GRG++ +GWVQQ+ IL H SVG ++CH+GF
Sbjct  314   FAVVLNFPSPHPIQS----PMPEGFEERVRGRGVVKTGWVQQRLILGHESVGGFLCHSGF  369

Query  447   SSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTI  268
              S+IEG+V+ CQLV+LP KGDQFLNA+L+  +++ GVEV RR EDG+F +ED+ KAV+ +
Sbjct  370   GSLIEGVVSGCQLVLLPLKGDQFLNARLMGRELRVGVEVERRAEDGFFRREDVCKAVRCV  429

Query  267   M----GEEGASTRANQEKWKEFLLDKEIQSK-FIKDLVKVMR  157
             M     E G   R N E+ K+FLLD ++Q + F +D VK +R
Sbjct  430   MVEADKEPGKRVRENHERLKQFLLDDKVQCRTFEEDFVKKLR  471



>gb|AFJ52974.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=405

 Score =   375 bits (964),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 220/477 (46%), Positives = 290/477 (61%), Gaps = 87/477 (18%)
 Frame = -3

Query  1548  MEREITNNHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHG-VKISFFSAAGNVDRIKSM  1372
             M R   ++   + LHVV+FP+FAFGHISPF+QL+NKLS+HG V+ISFFSA GN+ RI + 
Sbjct  1     MGRTAESSLADEELHVVMFPWFAFGHISPFIQLANKLSLHGRVQISFFSAPGNIPRISNS  60

Query  1371  LNSNPCTQIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHF  1192
             L  +P TQI PL +  VEGLPPG  STA+  P  AELL ++L LMQPQ+K LL++LKP F
Sbjct  61    LLPSPTTQITPLPIHPVEGLPPGLDSTAELLPHLAELLKISLGLMQPQVKELLIQLKPDF  120

Query  1191  VIFDFAQNWL-----PPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKK  1027
             V     + W+      PLA++  ++                 P    G  + PT E+MK+
Sbjct  121   VF----RGWVLSSGSRPLASQFFLQ----------------FPPGTCG--KIPTAEDMKR  158

Query  1026  PPPGFPPTSVASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAP  847
             PP G+P TSV  ++TF ARDF             VY +   GL+   ++    C      
Sbjct  159   PPKGYPETSVNQMKTFTARDFTY-----------VYKKFKGGLSVIDSLGLSQCRH----  203

Query  846   YIDYVKSQFKKPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQI  667
                                     +GV                 +     SETFL D+Q+
Sbjct  204   -----------------------RTGV----------------QVMQRDRSETFLTDEQV  224

Query  666   KELALGLELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILV  487
             +ELA GLE TGLPFFLVLNFPA +D  +EL+RAL  GF ERVK RG++++GWVQQ  IL 
Sbjct  225   QELAFGLENTGLPFFLVLNFPAQLDSQTELDRALREGFLERVKDRGVVNTGWVQQPLILA  284

Query  486   HSSVGCYVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGY  307
             HSSVGCY+ H+GFSS+IEG+++DCQLV+LP KGDQ+LNAKL+  DMKAG+EV+RRDEDGY
Sbjct  285   HSSVGCYLNHSGFSSLIEGLIHDCQLVLLPLKGDQYLNAKLITGDMKAGIEVDRRDEDGY  344

Query  306   FWKEDIQKAVQTIMGEEG-----ASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             F ++D+ +AV T+M  +       S R NQEKWK+FLLD E Q+K+ K+LV  ++ M
Sbjct  345   FGRDDVTRAVNTMMAGDADKEPLKSIRENQEKWKKFLLDNEAQNKYAKELVAQLKAM  401



>ref|XP_004979244.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase-like [Setaria 
italica]
Length=474

 Score =   377 bits (969),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 212/459 (46%), Positives = 293/459 (64%), Gaps = 11/459 (2%)
 Frame = -3

Query  1506  HVVIFPFFAFGHISPFVQLSNKLSVHG---VKISFFSAAGNVDRIKSML-NSNPCTQIVP  1339
             HVV+FP+ AFGHISPF QL+ +L + G   ++++F +AAGNV R+++ML  +     ++P
Sbjct  16    HVVMFPWLAFGHISPFAQLTRRL-ISGDETLRVTFLTAAGNVPRVEAMLAEAAGAVAVLP  74

Query  1338  LALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLP  1159
             L LP+V+GLPP   STA+     AELL VAL+  +PQ+  LL EL+P  V+FDFA  W+ 
Sbjct  75    LDLPSVKGLPPAAASTAELSADGAELLKVALDGTRPQVATLLAELRPDAVLFDFAVPWVC  134

Query  1158  PLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTS-VASLRT  982
              +AA LG++ ++F+V+ A   A  TVPAR PG +R P+  E+   P GFP  S + +L  
Sbjct  135   DVAAPLGVRALYFNVYSAATLALLTVPARCPGGQR-PSAHELTAAPAGFPSDSPLVTLPA  193

Query  981   FEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLL  802
             ++A +    F+  + G  S YDR +    GC   + KTC EME PYIDY+ +Q  KP+LL
Sbjct  194   YQAANLTYAFQSFY-GMPSAYDRFIECFKGCFGTVMKTCAEMEGPYIDYISAQIGKPVLL  252

Query  801   AGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFF  622
             AGPVVPEP  G L+++W+ WLS F  + V++ SFGSETFL      EL LGLE T  PF 
Sbjct  253   AGPVVPEPPEGELEERWSSWLSSFPENAVVFASFGSETFLPAAAATELLLGLEATNRPFL  312

Query  621   LVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSS  442
             +VLNFP   D   EL   +P GF +RVKGRG++H+GWVQQQ IL+H SVGCYV H+GFSS
Sbjct  313   VVLNFPKGADAEEELRARVPPGFEDRVKGRGVLHTGWVQQQHILLHPSVGCYVNHSGFSS  372

Query  441   VIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMG  262
             V EG+   C+LV+LP K DQ++NA + A ++  GVEV RR EDG+F           +  
Sbjct  373   VAEGLAAGCRLVLLPMKTDQYINAAVFARELHVGVEVARRSEDGWF---GCDAVSDAVAA  429

Query  261   EEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMAT  145
                A       KW+EFLLD  +Q  F  + ++ ++ + +
Sbjct  430   AMAAGGDGEGRKWREFLLDDAVQKGFAAEFLRNLKGLVS  468



>ref|XP_002448983.1| hypothetical protein SORBIDRAFT_05g002850 [Sorghum bicolor]
 gb|EES07971.1| hypothetical protein SORBIDRAFT_05g002850 [Sorghum bicolor]
Length=474

 Score =   377 bits (967),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 223/466 (48%), Positives = 298/466 (64%), Gaps = 22/466 (5%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKL--SVHGVKISFFSAAGNVDRIKSMLNSNPCTQI---  1345
             +HVV+ P+ AFGHI PF QL+ +L  S   V+++F +AAGNV R+++ML+S+  +     
Sbjct  15    MHVVMLPWLAFGHIVPFAQLARRLLASSSSVRVTFLTAAGNVPRVEAMLSSSASSAGGVA  74

Query  1344  -VPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQN  1168
              +PL LP V GLP    STAD  P  AELL VAL+  +PQ+ ALL EL+P  V+ DFA  
Sbjct  75    VLPLRLPRVPGLPEDAASTADLSPDGAELLKVALDAARPQVAALLAELRPDAVLLDFATP  134

Query  1167  WLPPLAAELGIKTIffsvfvalatafatVPAR-LPGPERSPTVEEMKKPPPGFPPTS---  1000
             W    AA LG+K+ +FS F A+A A+  VPAR L GP  S    ++   P GFP +S   
Sbjct  135   WASHDAAALGVKSFYFSAFSAVALAYLAVPARRLDGPGAS--ARDLMSAPAGFPGSSHLA  192

Query  999   VASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQF  820
              A +  ++A DF  +F     G    YDR +A    C  ++ KTC EME  YIDY  +QF
Sbjct  193   TAGVPAYQAADFTYVFTS-FGGQPCAYDRSVASTRACDGVVLKTCAEMEGVYIDYYAAQF  251

Query  819   KKPLLLAGPVVPEPASGVLDQKWADWLSQF-EPSTVIYCSFGSETFLKDDQIKELALGLE  643
             +KP+L+AGP+VPEP  G LD++WA WLS F +   V++ SFGSETFL      EL LGLE
Sbjct  252   RKPVLVAGPLVPEPPRGDLDERWATWLSAFPDDGAVVFASFGSETFLPPAAATELLLGLE  311

Query  642   LTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYV  463
              TG PF  VLN P   D A+ +    P GFTERV GRG++H+GWVQQQ IL H SVGCYV
Sbjct  312   ATGRPFLAVLNSP---DGAAAV--VPPPGFTERVSGRGLVHTGWVQQQHILRHRSVGCYV  366

Query  462   CHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQK  283
              HAGFSSV+EG+V  C+LV+LP KGDQ+LNA L A +++ GVEV RRDEDG+F ++D+  
Sbjct  367   THAGFSSVVEGLVAGCRLVLLPMKGDQYLNAALFARELRVGVEVARRDEDGWFGRQDVCD  426

Query  282   AVQTIMGEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMAT  145
             AV   + + G     +  KW +FL D  +Q +F  + V+ + ++ +
Sbjct  427   AVAAAVADGG---EGDARKWADFLTDDGVQGRFADEFVRQLSELVS  469



>ref|XP_008371430.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Malus domestica]
Length=459

 Score =   376 bits (965),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 199/462 (43%), Positives = 280/462 (61%), Gaps = 11/462 (2%)
 Frame = -3

Query  1521  GGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIV  1342
             G   LHV ++P+FA GH+  F+   NKL+  G +ISFF     + ++++          +
Sbjct  2     GDKKLHVAMYPWFAMGHLIAFLHTCNKLAERGHRISFFVPVQTLQKLQAFNLYPDRIAFI  61

Query  1341  PLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWL  1162
             P+ +P V+GLPPGT++T D P     LL  A++L +P +   L ELKP FV FDF  +W+
Sbjct  62    PINVPHVDGLPPGTETTTDVPFPLHSLLMTAMDLTRPAVGQALRELKPDFVFFDFT-HWM  120

Query  1161  PPLAAEL--GIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASL  988
             P L  EL  GIK+I + +       + + P R P  E+ PT  ++  PPP FP +S+ +L
Sbjct  121   PELLHELDMGIKSIHYCIISPATIGYLSTPERNP-TEKLPTAADLMLPPPSFPASSI-TL  178

Query  987   RTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPL  808
             RT EAR  V +  +    G +   R     +GC AI  KTC EME PY DY+++Q+KKP+
Sbjct  179   RTHEARGLVAVLLKEFGRGMTFMQRQFLSFSGCDAIAFKTCREMEGPYSDYIETQYKKPV  238

Query  807   LLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLP  628
             +LAG VVPE ++  LD+KWA WL  FE  ++IYC+FGSE  LK DQ +EL LG ELTGLP
Sbjct  239   ILAGSVVPETSTTELDEKWAKWLEGFEAKSMIYCAFGSECILKIDQFQELLLGFELTGLP  298

Query  627   FFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGF  448
             FF  L  P     A  +  ALP GF ER +GRG+++ GWVQQ   L H SVGC+V H G 
Sbjct  299   FFAALKPPMG---AESIESALPEGFEERTRGRGVVYGGWVQQPLFLRHPSVGCFVTHCGS  355

Query  447   SSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTI  268
              S+ E +VN+CQLV+LP  GDQ +NA+++  D+K GVEV +RD DG F KE + KAV+ +
Sbjct  356   GSLSEALVNECQLVLLPNVGDQIINARMMGCDLKVGVEVEKRDLDGLFTKEGVAKAVEAV  415

Query  267   M---GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             M   GE     R+N  KW+EF   + + + ++    + +  +
Sbjct  416   MEDGGELAEEVRSNHAKWREFFSGQGLGNSYLDSFEQKLHKL  457



>ref|XP_008371703.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Malus domestica]
Length=459

 Score =   375 bits (963),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 197/462 (43%), Positives = 280/462 (61%), Gaps = 11/462 (2%)
 Frame = -3

Query  1521  GGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIV  1342
             G   LH  ++P+FA GH++ F+ +SNKL+  G +ISFF     + ++++          +
Sbjct  2     GAKKLHXAMYPWFAMGHLTSFLHISNKLAERGHRISFFIPVKTLQKLEAFNLYPDRIAFI  61

Query  1341  PLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWL  1162
             P+ +P V GLPPGT++TAD P     LL  A++L +P+I   L ELKP FV FDF Q W+
Sbjct  62    PINVPHVPGLPPGTETTADVPFPLHSLLMTAMDLTRPEIGQALRELKPDFVFFDFTQ-WM  120

Query  1161  PPLAAEL--GIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASL  988
             P L  EL  G K+I +         + + P R    E+ PTV ++  PPP FP +S+ +L
Sbjct  121   PELLHELDMGTKSIHYCTISPATVLYLSTPER-NLMEKQPTVADLMLPPPSFPASSI-TL  178

Query  987   RTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPL  808
             RT EAR  V +  +    G +   R     +GC AI  KTC E+E PY DY+ +Q +KP+
Sbjct  179   RTHEARGLVDVMLKEFGRGVTFMQRQFRSFSGCDAIAFKTCREIEGPYCDYIGTQLRKPV  238

Query  807   LLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLP  628
              LAGPVVPE  +  LD+KW+ WL +FE  ++IYC+FGSE  LK DQ +EL  G E+TGLP
Sbjct  239   FLAGPVVPETPTKELDEKWSKWLERFEAKSMIYCAFGSECILKIDQFQELLXGFEITGLP  298

Query  627   FFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGF  448
             FF  L  P     A  +  ALP GF ER + RG+++ GWVQQ   L H SVGC+V H G 
Sbjct  299   FFAALKPPMG---AESIESALPEGFAERTRERGVVYGGWVQQPLFLRHPSVGCFVTHCGS  355

Query  447   SSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTI  268
              S+ E +VN+CQLV+LP  GDQ +NA++++ D+K GVEV + D DG F KE + KAV+ +
Sbjct  356   GSLSEALVNECQLVLLPNVGDQIINARVMSRDLKVGVEVEKGDLDGLFTKEGVSKAVEAV  415

Query  267   M---GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             M   GE     R+N  KW++FL  KE+++ ++    + +  +
Sbjct  416   MEDGGEVAEEVRSNHAKWRDFLCRKELENSYLNSFEQKLHQL  457



>ref|XP_003593675.1| Anthocyanidin 3-O-glucosyltransferase [Medicago truncatula]
 gb|AES63926.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=458

 Score =   374 bits (960),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 194/459 (42%), Positives = 277/459 (60%), Gaps = 9/459 (2%)
 Frame = -3

Query  1518  GDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVP  1339
              ++ HV ++P+FA GH++ ++ +SNKL+  G KISF      + +++           VP
Sbjct  3     ANIFHVAMYPWFALGHLTSYLHISNKLAERGHKISFLMPRNTISKLEHFNLHPDLISFVP  62

Query  1338  LALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLP  1159
             + +P V+GLP G+++TAD P +   LL  A++L +P I+  L EL+PH V FDF   WLP
Sbjct  63    ITIPHVDGLPLGSETTADIPFSLHSLLMTAMDLTEPIIEDTLRELRPHMVFFDFTY-WLP  121

Query  1158  PLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTF  979
              LA  LGIK + +         +   P R    E+S T E++  PPP FPP+++  L+  
Sbjct  122   ALACRLGIKALHYCTISPATVGYLISPER-KLHEKSLTEEDLIDPPPSFPPSAI-KLQPH  179

Query  978   EARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLA  799
             EAR       + +    S   R L     C AI+ KTC EME PY DY++   +K ++LA
Sbjct  180   EARGLATATVKGYGKDISFTKRQLISFTSCDAIVFKTCREMEGPYCDYLEKTMRKQVILA  239

Query  798   GPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFL  619
             GPV+P+P +  L++KW  WL  F+  TVI+C+FGSE  LK +Q KEL LG ELTG+PF  
Sbjct  240   GPVLPDPPTTTLEEKWVTWLGGFKSKTVIFCAFGSECILKSNQFKELLLGFELTGMPFLA  299

Query  618   VLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSV  439
              L  P     A  +  ALP GF ER KGR I+   WVQQQ IL H SVGC+V H G  S+
Sbjct  300   ALKPPIG---AKTMKLALPEGFIERTKGRAIVVGDWVQQQLILSHQSVGCFVTHCGSGSL  356

Query  438   IEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM--  265
              E +V DCQLV+LP  GDQF+NA++++ D+K GVEV + ++DG F KE + KAV+T+M  
Sbjct  357   TEAMVTDCQLVLLPHAGDQFINARIMSGDLKVGVEVEKSEDDGLFTKEAVCKAVKTVMDS  416

Query  264   -GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
              GE G   R N  KW +FLL + +++ ++ DLV+ +  +
Sbjct  417   EGELGHMVRTNHAKWGKFLLSQGLENSYVDDLVQKLDSL  455



>ref|XP_009353146.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Pyrus x bretschneideri]
Length=459

 Score =   373 bits (958),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 197/462 (43%), Positives = 278/462 (60%), Gaps = 11/462 (2%)
 Frame = -3

Query  1521  GGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIV  1342
             G   LHV ++P+FA GH++ F+ +SNKL+  G +ISFF     + ++++          +
Sbjct  2     GDKKLHVAMYPWFAMGHLTSFLHISNKLAERGHRISFFIPVKTLQKLEAFNLYPDRIAFI  61

Query  1341  PLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWL  1162
             P+ +P V GLPPGT++TAD P     LL   ++L +P+I   L ELKP FV FDF Q W+
Sbjct  62    PINVPHVPGLPPGTETTADVPFPLHSLLMTTMDLTRPEIGQALRELKPDFVFFDFTQ-WM  120

Query  1161  PPLAAEL--GIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASL  988
             P L  EL  G K+I +         + +   R    E+ PT  ++  PPP FP +S+ +L
Sbjct  121   PELLHELDMGTKSIHYCTISPATVLYLSTLER-NLMEKQPTAADLMLPPPSFPASSI-TL  178

Query  987   RTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPL  808
             RT EAR  V +  +    G +   R     +GC AI  KTC E+E PY DY+ +Q +KP+
Sbjct  179   RTHEARGLVAVMLKEFGRGVTFMQRQFRSFSGCDAIAFKTCREIEGPYCDYIGTQLRKPV  238

Query  807   LLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLP  628
             LLAGP VPE  +  LD+KW+ WL  FE  ++IYC+FGSE  LK DQ +EL LG E+TGLP
Sbjct  239   LLAGPGVPETPTKELDEKWSKWLEGFEAKSMIYCAFGSECILKIDQFQELLLGFEITGLP  298

Query  627   FFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGF  448
             FF  L  P     A  +  ALP GF ER + RG+++ GWVQQ   L H SVGC+V H G 
Sbjct  299   FFAALKPPMG---AESIESALPEGFEERTRERGVVYGGWVQQPLFLRHPSVGCFVTHCGS  355

Query  447   SSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTI  268
              S+ E +VN+CQLV+LP  GDQ +NA++++ D+K GVEV + D DG F KE + KAV+ +
Sbjct  356   GSLSEALVNECQLVLLPNVGDQIINARVMSRDLKVGVEVEKGDLDGLFTKEGVSKAVEAV  415

Query  267   M---GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             M   GE     R+N  KW+EFL  KE+++ ++    + +  +
Sbjct  416   MEDGGEVAEEVRSNHAKWREFLCGKELENSYLNSFERKLHQL  457



>ref|XP_010262362.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Nelumbo nucifera]
Length=475

 Score =   374 bits (959),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 192/462 (42%), Positives = 287/462 (62%), Gaps = 17/462 (4%)
 Frame = -3

Query  1515  DLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPC----TQ  1348
             D LH+ ++P++A GH++PF+ +SNKL+  G ++SFF       + +S LNSN        
Sbjct  9     DTLHIAMYPWYAMGHLTPFLHISNKLAERGHRVSFFLPT----KTQSKLNSNNLHPNLIT  64

Query  1347  IVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQN  1168
              +P+ +P V+GLPPG ++TAD P +   L+  A++L QP+I+A L +LKPH V FDFA  
Sbjct  65    FIPVVVPHVDGLPPGAETTADVPHSLHSLIMTAMDLTQPEIEASLRQLKPHIVFFDFAY-  123

Query  1167  WLPPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASL  988
             W+P LA  LGIK+I + +   +   +   P+R    +       +  PPPGFP  ++  L
Sbjct  124   WVPALARSLGIKSIHYCIISPVTIGYLLSPSRNNISDVDLYESSLMHPPPGFPAAAI-KL  182

Query  987   RTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPL  808
              + EAR   ++    +  G + Y+R    L+ C A+  + C E+E  Y DY+++QF+KP+
Sbjct  183   HSNEARRLALVANIEYGKGITFYERQNIALSDCDALAFRACREIEGSYCDYLETQFRKPV  242

Query  807   LLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLP  628
             L++G VVP      L+++W  WL  FE ++V+YC+FGSE  L  DQ +EL +GLELTGLP
Sbjct  243   LVSGSVVPVAPRDGLEERWVKWLGGFEANSVVYCAFGSECILSLDQFRELVMGLELTGLP  302

Query  627   FFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGF  448
             F   L  P   D    +  ALP GF ERV GRG++H  WVQQQ IL H SVGC+V H G 
Sbjct  303   FLAALKLPIGTDT---IEAALPEGFEERVGGRGVVHGQWVQQQLILEHPSVGCFVTHCGS  359

Query  447   SSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTI  268
              S++E +VN CQ+V+LP  GDQ LNA+++  D+K GVEV  +  DG F +E + KAV+ +
Sbjct  360   GSLMESLVNKCQVVLLPHIGDQILNARMMGGDLKVGVEV-EKGGDGLFTRESVCKAVKMV  418

Query  267   MGEE---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             M E+   G   +AN +KW++F L + I+S +I++ V  ++D+
Sbjct  419   MDEDSEIGREVKANHKKWRDFFLTEGIESSYIQNFVHGLQDL  460



>ref|XP_002522508.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF39808.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=457

 Score =   371 bits (953),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 200/461 (43%), Positives = 284/461 (62%), Gaps = 11/461 (2%)
 Frame = -3

Query  1521  GGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQI-  1345
             G +  H+V++P+FA GH++ F+ LSNKL+  G KISF   +  + + +   N +P   I 
Sbjct  2     GEETFHIVMYPWFALGHLTSFLHLSNKLAERGHKISFLLPSKTIKKFQP-FNLHPDLIIF  60

Query  1344  VPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNW  1165
             +P+ +P V+GLPPG+++T D P +   LL  A++L +  I+  L  LKP+FV FDF  +W
Sbjct  61    IPVTVPHVDGLPPGSETTTDVPFSLHSLLMTAMDLTESVIEFHLTNLKPNFVFFDFT-HW  119

Query  1164  LPPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLR  985
             LP L  +LG+K++ +         +   P R    E+S T  ++ KPP  FPP+S+  LR
Sbjct  120   LPALCRKLGVKSVHYCTISPATVGYLISPER-KLLEKSLTAADLMKPPLNFPPSSI-KLR  177

Query  984   TFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLL  805
               EA+    +  +P+    S  +R L   N C AI  KTC EME PY  YV+ QF KP++
Sbjct  178   AHEAQGLAAVTTKPYGSSISFLERQLHSFNECDAISFKTCMEMEGPYCHYVERQFGKPVI  237

Query  804   LAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPF  625
             LAGPVVP+  S VLD+K ++ L   E   V++C+FGSE  LK +Q++EL LGLELTGLPF
Sbjct  238   LAGPVVPKSPSSVLDEKISNMLDNSEAGKVVFCAFGSECILKKNQLQELVLGLELTGLPF  297

Query  624   FLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFS  445
                L  P     A  +  ALP GF ERVKG+G ++ GWVQQQ IL H SVGC++ H G  
Sbjct  298   LAALKPPMG---AETIESALPEGFEERVKGKGYVYGGWVQQQLILKHPSVGCFITHCGSG  354

Query  444   SVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM  265
             S+ E +VN CQLV+LP  GDQ +NA+L+  D+K GVEV + +EDG F K+ ++KAV+ +M
Sbjct  355   SLSEAMVNKCQLVLLPNVGDQIINARLMDGDLKIGVEVEKGEEDGLFTKDGVRKAVKAVM  414

Query  264   ---GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                 E G   R N  KW+EFLL K +++ +I   V  +  +
Sbjct  415   DDDSEVGKEVRTNHMKWREFLLSKGLENSYIDAFVNKLHAL  455



>ref|XP_004485850.1| PREDICTED: UDP-glycosyltransferase 79B3-like [Cicer arietinum]
 gb|AGU14087.1| UDP-glycosyltransferase [Cicer arietinum]
Length=458

 Score =   368 bits (944),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 191/460 (42%), Positives = 275/460 (60%), Gaps = 11/460 (2%)
 Frame = -3

Query  1518  GDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIV  1342
              ++ HV ++P+FA GH++ ++ +SNKL+  G KISF      + +++   N +P     +
Sbjct  3     ANIFHVAMYPWFALGHLTSYLHISNKLAERGHKISFLMPKNTISKLEH-FNLHPNLISFI  61

Query  1341  PLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWL  1162
             P+ +P V GLP G+++TAD P +   LL  A++L +P I+  L EL+PH V FDF   WL
Sbjct  62    PITIPHVHGLPLGSETTADLPFSLHSLLMTAMDLTEPIIEDSLRELRPHMVFFDFTY-WL  120

Query  1161  PPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRT  982
             P LA +LGIK + +         +   P R    E+S T  ++  PPP FPP+++  L+ 
Sbjct  121   PALACQLGIKALHYCTISPATVGYLISPER-KLHEKSLTEADLINPPPSFPPSAI-KLQP  178

Query  981   FEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLL  802
              EAR         +    S  +R L     C AI+ KTC EME  Y DY++ Q +K + L
Sbjct  179   HEARGLATSTVNGYGKDISFMERQLIAFTSCDAIVFKTCREMEGLYCDYLERQMRKQVFL  238

Query  801   AGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFF  622
             AGPV P P +  L +KW  WL +F+P TVI+C+FGSE  LK +Q KEL LG ELT +PF 
Sbjct  239   AGPVFPNPPTSTLKEKWVTWLGRFKPKTVIFCAFGSECILKSNQFKELLLGFELTKIPFI  298

Query  621   LVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSS  442
               L  P     A  +  A P GF+ER KGRG++   WVQQQ IL H SVGC+V H G  S
Sbjct  299   AALKLPIG---AETIKSAFPEGFSERTKGRGVVEGDWVQQQLILSHPSVGCFVTHCGSGS  355

Query  441   VIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMG  262
             + E +VN+CQLV+LP  GDQF+NA++++ D+K GVEV +  E+G F +E + KAV  +M 
Sbjct  356   LTEAMVNECQLVLLPHAGDQFINARIMSGDLKVGVEVEKCKENGLFTREAVCKAVMDVMD  415

Query  261   EE---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
              E   G   R N  KW+EFLL K +++ ++ +LV+ +  +
Sbjct  416   NESELGHMVRTNHAKWREFLLSKGLENSYVDNLVQKLDSL  455



>ref|NP_001131009.1| uncharacterized protein LOC100192114 precursor [Zea mays]
 gb|ACF79433.1| unknown [Zea mays]
Length=458

 Score =   368 bits (944),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 215/464 (46%), Positives = 290/464 (63%), Gaps = 23/464 (5%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKIS---FFSAAGNVDRIKSMLNSNPCTQ---  1348
             +H+++ P+ AFGHI PFVQL+ +L           F +AAGNV R+++ML+S   T    
Sbjct  1     MHLLMLPWLAFGHIVPFVQLARRLLSSTSSSVRVTFLTAAGNVPRVEAMLSSPSSTGEAA  60

Query  1347  -IVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQ  1171
              +VPL LP V GLP    STAD  P  AELL  AL+  +PQ+ ALL EL+P  V+ DFA 
Sbjct  61    VVVPLRLPHVPGLPEDAASTADLSPEGAELLKAALDAARPQVAALLAELRPDAVLLDFAT  120

Query  1170  NWLPPLAAELGIKTIffsvfvalatafatVPARLP-GPERSPTVEEMKKPPPGFP---PT  1003
              W    AA LG K++ FSVF A+A A+ +VPAR P    + P+  ++   P GFP   P 
Sbjct  121   PWAAEDAAALGAKSLRFSVFSAVAGAYLSVPARRPDAAGQLPSARDLMSAPAGFPGSSPL  180

Query  1002  SVASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQ  823
             + A +  ++A DF  +F     G   V++RV+AG+  C  ++ KTC EME  YIDY+ +Q
Sbjct  181   AAAGVPAYQAADFTYMFTS-FGGQPCVHERVVAGIRACDGLVLKTCAEMEGAYIDYLAAQ  239

Query  822   FKKPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLE  643
             F+KP+L+AGP+VP P +G LD  WA WLS F    V++ SFGSETFL      EL LGLE
Sbjct  240   FRKPVLVAGPLVPGPPAGDLDDHWATWLSAFPDGAVVFASFGSETFLPPAAATELLLGLE  299

Query  642   LTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYV  463
              TG PF  VLN P             P GF ERV GRG++H+GWV QQ IL H SVGCY+
Sbjct  300   ATGRPFLAVLNSPDGA--------VPPPGFAERVSGRGLVHAGWVPQQHILRHRSVGCYL  351

Query  462   CHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQK  283
              HAGFSSV+EG+V  C+LV+LP KGDQFLNA L A +++ GVEV RRD+DG+F ++D+  
Sbjct  352   THAGFSSVVEGLVAGCRLVLLPMKGDQFLNAALFARELRVGVEVARRDDDGWFGRQDVCD  411

Query  282   AVQTIMGEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             A+   + + G     +  KW +FL D  +Q +F  + V+ +R++
Sbjct  412   AIAAAVADVG---ERDARKWADFLTDDGVQGRFADEFVRQLREL  452



>ref|XP_004304716.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Fragaria vesca 
subsp. vesca]
Length=463

 Score =   367 bits (941),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 194/448 (43%), Positives = 275/448 (61%), Gaps = 11/448 (2%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ ++P+FA GH+SPF+ +SNKL+  G +ISFF       +++            PL +
Sbjct  9     LHIAMYPWFAMGHLSPFLHISNKLAERGHRISFFLPQKTQAKLQYYNLHPDLITFYPLTI  68

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P VEGLP G ++TAD P     L+  A++L +PQI+  L ELKP  V +DF+ +WLP L 
Sbjct  69    PHVEGLPQGAETTADVPFPLHTLVVTAMDLTRPQIEKFLRELKPDLVFYDFS-HWLPQLL  127

Query  1149  AEL--GIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFE  976
              EL   IK++ + +   +   +   P R    E+     ++ + P  FP +S+  LRT E
Sbjct  128   RELDGNIKSVLYCIISPVTIGYLLSPER-KLTEKPLVATDLLEAPTSFP-SSIIKLRTHE  185

Query  975   ARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
             AR    +  + +  G +  +R L  L  C AI  KTC E E  + DY++ Q KKP++LAG
Sbjct  186   ARGLTYVTNQEYGRGVTFLERQLTSLGECDAIGFKTCREFEGKFCDYIEEQMKKPVILAG  245

Query  795   PVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
             PVVP P S  L+++WA+WL  FEP +VIYC+FGSE  LK  Q++EL LG ELTGLPFF  
Sbjct  246   PVVPAPPSSALEERWAEWLGGFEPGSVIYCAFGSECVLKKKQLQELVLGFELTGLPFFAA  305

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             L  P  ++    +  ALP GF ERVKGRG++HSGWVQQ  IL H SVG +V H G  S+ 
Sbjct  306   LKTPVGLE---SIEAALPEGFEERVKGRGVVHSGWVQQPLILNHPSVGYFVTHCGSGSLA  362

Query  435   EGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE  256
             E ++N C+LV+LP  GDQ +NA+++  D++ GVEV + DEDG F KE + KAV+ +M +E
Sbjct  363   EAMMNHCRLVLLPHVGDQIINARMMGGDLRVGVEVEKGDEDGLFSKEGVCKAVEAVMDDE  422

Query  255   ---GASTRANQEKWKEFLLDKEIQSKFI  181
                G   +AN  KW+EF  +K ++  +I
Sbjct  423   SEVGKEVKANHAKWREFFSNKGLEKTYI  450



>ref|XP_007213494.1| hypothetical protein PRUPE_ppa022356mg [Prunus persica]
 gb|EMJ14693.1| hypothetical protein PRUPE_ppa022356mg [Prunus persica]
Length=450

 Score =   366 bits (940),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 197/454 (43%), Positives = 279/454 (61%), Gaps = 11/454 (2%)
 Frame = -3

Query  1497  IFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLALPAVE  1318
             ++P+F  GH++ F+ +SNKL+  G +ISFFS +    ++++    +     +P+ +P V+
Sbjct  1     MYPWFGMGHLTSFLHISNKLAERGHRISFFSPSKVQQKLEAFNLHSHRISFIPIDVPHVD  60

Query  1317  GLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLAAEL-  1141
             GLPPGT++TAD P     LL  A++L +P I+  L EL+P+FV FDF  +WLP L  +L 
Sbjct  61    GLPPGTETTADVPFPLHSLLVTAMDLTRPAIEQALCELRPNFVFFDFT-HWLPELLHKLD  119

Query  1140  -GIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEARDF  964
              GIK++ +         F   P R    E+S T  ++ +PPP FP +S+  L+T EAR  
Sbjct  120   IGIKSVHYCTISPATVGFLISPERKLF-EKSLTEADLMEPPPSFPASSI-KLQTHEARAL  177

Query  963   VIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPVVP  784
             V      +  G +  +R +   + C AI  KTC EME PY DYV++QF KP++LAGPVVP
Sbjct  178   VGATLMEYGRGVTFLERQMGSFSNCDAIAFKTCREMEGPYCDYVETQFGKPVILAGPVVP  237

Query  783   EPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLNFP  604
             E  +  LD+KWA W   FE  TVIYC+FGSE  L   Q +EL LG ELTGLPFF  L  P
Sbjct  238   ESPTTELDEKWAKWFDGFEAKTVIYCAFGSECILNKAQFQELLLGFELTGLPFFAALKPP  297

Query  603   ANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEGIV  424
               V+    +  ALP GF ERV+GRGI+H GWVQQ  IL H SVGC+V H G  S+ E ++
Sbjct  298   MGVE---SIEAALPEGFEERVQGRGIVHGGWVQQPLILKHPSVGCFVTHCGSGSLSEALM  354

Query  423   NDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE---G  253
             N+C+LV+LP  GDQ +NA++++ D+K GVEV + DEDG F  E + KAV+T+M +E    
Sbjct  355   NECRLVLLPNVGDQIINARMMSRDLKVGVEVEKGDEDGVFTTEGVCKAVKTVMDDESEVA  414

Query  252   ASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                R N  KW+EF   K +++  +    + +  +
Sbjct  415   KEVRTNHAKWREFFTGKGLENSCLDSFEQKLHQL  448



>ref|XP_007213460.1| hypothetical protein PRUPE_ppa024453mg [Prunus persica]
 gb|EMJ14659.1| hypothetical protein PRUPE_ppa024453mg [Prunus persica]
Length=450

 Score =   365 bits (938),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 198/454 (44%), Positives = 281/454 (62%), Gaps = 11/454 (2%)
 Frame = -3

Query  1497  IFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLALPAVE  1318
             ++P+FA GH++ F+ +SNKL+  G +ISFFS +    ++++    +     +P+ +P V+
Sbjct  1     MYPWFAMGHLTSFLHISNKLAQRGHRISFFSPSKVQQKLEAFNLHSHRISFIPIDVPHVD  60

Query  1317  GLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLAAEL-  1141
             GLPPGT++TAD P     LL  A++L +P I+  L EL+P+FV FDF  +WLP L  +L 
Sbjct  61    GLPPGTETTADVPSLLQPLLVTAMDLTRPAIEQALCELRPNFVFFDFT-HWLPELLHKLD  119

Query  1140  -GIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEARDF  964
              GIK++++         F   P R    E S T  ++ +PPP FP +S+  L+T EAR  
Sbjct  120   IGIKSVYYCTISPATVGFLMCPER-KLLEISLTEADLMEPPPSFPASSI-KLQTHEARAL  177

Query  963   VIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPVVP  784
             V         G +  +R +   + C AI  KTC EME PY DYV++QF KP++LAGPVVP
Sbjct  178   VGASLMEFGRGVTFLERQMGSFSNCDAIAFKTCREMEGPYCDYVETQFGKPVILAGPVVP  237

Query  783   EPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLNFP  604
             E  +  LD+KWA W   F+  TVIYC+FGSE  L   Q +EL LG ELTGLPFF  L  P
Sbjct  238   ESPTTELDEKWAKWFDGFKAKTVIYCAFGSECILNKAQFQELLLGFELTGLPFFAALKPP  297

Query  603   ANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEGIV  424
               V+    +  ALP GF ERV+G+GI+H GWVQQ  IL H SVGC+V H G  S+ E +V
Sbjct  298   MGVE---SIEAALPEGFEERVQGKGIVHGGWVQQPLILKHPSVGCFVTHCGSGSLSEALV  354

Query  423   NDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEEGAST  244
             N+C+LV+LP  GDQ +NA++++ D+K GVEV + DEDG F  E + KAV+T+M +E    
Sbjct  355   NECRLVLLPNMGDQIINARMMSRDLKVGVEVEKEDEDGVFTTEGVCKAVKTVMDDESEVA  414

Query  243   R---ANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             +    N  KW+EFL  KE+++  +    + +  +
Sbjct  415   KEVWTNHAKWREFLSGKELENSCLDSFEQKLHQL  448



>ref|XP_004499897.1| PREDICTED: UDP-glycosyltransferase 79B3-like [Cicer arietinum]
 gb|AGU14119.1| UDP-glycosyltransferase [Cicer arietinum]
Length=458

 Score =   365 bits (938),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 191/460 (42%), Positives = 279/460 (61%), Gaps = 11/460 (2%)
 Frame = -3

Query  1518  GDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIV  1342
              ++ HV ++P+FA GH++ ++ +SNKL+  G KISFF     + +++   N +P     +
Sbjct  3     ANIFHVAMYPWFALGHLTSYLHISNKLAERGHKISFFIPKNTISKLEH-FNLHPNLISFI  61

Query  1341  PLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWL  1162
             P+ +P V+GLP G+++TAD P +   LL  A++L +P I+  L EL+PH V FDF   WL
Sbjct  62    PITIPHVDGLPLGSETTADLPFSLHSLLMTAMDLTEPIIEDSLRELRPHMVFFDFTY-WL  120

Query  1161  PPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRT  982
             P LA +LGIK + +         +   P R    E+S T  ++  PPP FPP+++  L+ 
Sbjct  121   PALACQLGIKALHYCTISPATVGYLISPER-KLHEKSLTEADLINPPPSFPPSAI-KLQP  178

Query  981   FEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLL  802
              EAR       + +    S   R L     C AI+ KTC EME  Y DY++ Q +K + L
Sbjct  179   HEARGLATSTVKGYGKDISFMQRQLIAFTSCDAIVFKTCREMEGLYCDYLERQMRKQVFL  238

Query  801   AGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFF  622
             AGPV P+P +  L++KW  WL  F+P TVI+C+FGSE  LK +Q KEL LG ELT +PF 
Sbjct  239   AGPVFPKPPTFTLEEKWVTWLGGFKPKTVIFCAFGSECILKSNQFKELLLGFELTKIPFL  298

Query  621   LVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSS  442
               L  P     A  +  ALP GF+ER KGRG++   WVQQQ IL H SVGC+V H G  S
Sbjct  299   AALKPPIG---AETIKSALPEGFSERTKGRGVVEGDWVQQQLILSHPSVGCFVTHCGSGS  355

Query  441   VIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMG  262
             + E ++N+CQLV+LP  GDQF+NA++++ D+K GVEV +  E+G F ++ + KAV  +M 
Sbjct  356   LTEAMINECQLVLLPHAGDQFINARIMSGDLKVGVEVEKCKENGLFTRKAVCKAVMDVMD  415

Query  261   EEGAST---RANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
              E   +   R N  KW+EFLL K +++ ++ DLV+ +  +
Sbjct  416   NESELSHMVRTNHAKWREFLLSKGLENSYVDDLVQKLDSL  455



>ref|XP_006449434.1| hypothetical protein CICLE_v10017784mg [Citrus clementina]
 gb|ESR62674.1| hypothetical protein CICLE_v10017784mg [Citrus clementina]
Length=458

 Score =   362 bits (928),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 190/461 (41%), Positives = 278/461 (60%), Gaps = 10/461 (2%)
 Frame = -3

Query  1521  GGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIV  1342
             G +  H+ ++P+FA GH++PF+ ++NKL+  G +ISF   A  + + +           +
Sbjct  2     GSETFHIAMYPWFAMGHLTPFLHIANKLAERGHRISFLLPAKAITKFEPSNLHRDLITFI  61

Query  1341  PLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWL  1162
             P+++P V+GLPPG ++T D P     LL  A++L +P I+++L  LKP FV FDF  +WL
Sbjct  62    PVSVPRVDGLPPGAETTNDVPFPLHPLLMTAMDLTEPAIESVLRRLKPDFVFFDFT-HWL  120

Query  1161  PPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRT  982
             PPLA + GIK++ + +       +   P R    ER+ T  ++ +PP GFP TS   LR 
Sbjct  121   PPLARKFGIKSVLYCIISPATIGYLLSPER-KLRERTLTDNDLLRPPQGFP-TSKIRLRA  178

Query  981   FEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLL  802
              EAR       +   GG S   R L  L+ C AI  KTC E+E PY DY+ SQF KP++L
Sbjct  179   HEARGLAAATVKEFGGGLSFAKRNLLSLSECDAIGFKTCREIEGPYCDYIGSQFGKPVIL  238

Query  801   AGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFF  622
             +GP +PE     L+++W   L  F+  ++I+C+FGSE  L  +Q +EL LG EL+GLPF 
Sbjct  239   SGPALPESPRLALEERWETLLGSFKSKSLIFCAFGSECVLNKEQFQELVLGFELSGLPFL  298

Query  621   LVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSS  442
             + L  P   D    +  ALP GF ERVKGRG IH GWVQQQ IL H SVGC+V H G  S
Sbjct  299   VALKPPVGHDT---IESALPEGFEERVKGRGFIHGGWVQQQLILKHPSVGCFVTHCGSGS  355

Query  441   VIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM-  265
             + E +VN+CQLV+LP  GDQ +NA+L+ +++K GVEV + DEDG F ++ + KAV+ ++ 
Sbjct  356   LSEAMVNECQLVLLPNVGDQIINARLMGEELKVGVEVEKGDEDGLFTRDGVCKAVKAVID  415

Query  264   ---GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                 E G   + N  KW+EFL  + +++  +   V+ +  +
Sbjct  416   DDHSEVGKEIKENHAKWREFLRSERLENSHLDGFVQKLHGL  456



>ref|XP_011045872.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Populus euphratica]
Length=462

 Score =   362 bits (929),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 194/456 (43%), Positives = 276/456 (61%), Gaps = 11/456 (2%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ ++P+FA GH++ FV  SNKL+  G ++SFF       + +           +P+ +
Sbjct  13    LHIAMYPWFALGHLTAFVHFSNKLAERGHRVSFFLPKKTQSKFEPFNLHPDLITFIPITV  72

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P V+GLP GT++T + P     LL  A++L +  I+  L  L PHFV FDF  +WLP L+
Sbjct  73    PHVDGLPTGTETTTNVPFPLHPLLMTAMDLTEHVIEDHLRILNPHFVFFDFT-HWLPVLS  131

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
              + GIK++ F +       +   P R      S T  ++ +PPP FPP S+  LR  EAR
Sbjct  132   RKHGIKSVHFCIISPATIGYLLSPER---KLESLTAADLMQPPPSFPP-SLIKLRAHEAR  187

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
                 +  + +    S  +R L  L+ C A+  KTC EME PY DY++ QF KP++LAGP+
Sbjct  188   GMCAVTVQQYGSNISFQERNLYALSQCDAMAFKTCREMEGPYSDYIEDQFGKPVILAGPI  247

Query  789   VPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLN  610
             VPEP + VL++K A  L  F+  T+++C+FGSE  LK DQ +EL LGLELT LPFF VL 
Sbjct  248   VPEPPNSVLEEKIAKMLDNFKAETLVFCAFGSECILKKDQFQELVLGLELTSLPFFAVLK  307

Query  609   FPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEG  430
              P     A  +  ALP GF ERVKGRG +++GWVQQQ IL H SVGC+V H G  S+ EG
Sbjct  308   PPIG---AETIESALPEGFEERVKGRGFVYTGWVQQQLILRHPSVGCFVTHCGSGSLSEG  364

Query  429   IVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM---GE  259
             +VN CQLV+LP  GDQ +NA+++  D+  GVEV + +EDG F +  + +AV+ +M    E
Sbjct  365   MVNKCQLVLLPNAGDQIINARVVGGDLNVGVEVKKGEEDGLFTRHGVCEAVKAVMDDDSE  424

Query  258   EGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
              G   RAN  KW+EFLL K +++ ++   V  + ++
Sbjct  425   VGKLVRANHAKWREFLLGKGLENSYVDGFVHKLHEL  460



>ref|XP_007132927.1| hypothetical protein PHAVU_011G136700g [Phaseolus vulgaris]
 gb|ESW04921.1| hypothetical protein PHAVU_011G136700g [Phaseolus vulgaris]
Length=452

 Score =   360 bits (924),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 189/457 (41%), Positives = 279/457 (61%), Gaps = 15/457 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ ++P+FA GH++PF+ L+NKL+  G KISFF       +++++         VP+++
Sbjct  6     LHIAMYPWFAMGHLTPFLHLANKLAKRGHKISFFIPKRTQAKLENLNLRPSLITFVPISV  65

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P V+GLP G ++T+D P +   L+  A++L +  I+ LL+ELKPH V+FDFA  WLP LA
Sbjct  66    PHVDGLPCGAETTSDVPSSLFPLIASAMDLTEKDIELLLLELKPHIVLFDFATYWLPNLA  125

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
               +GIK++ + +       +   PAR          ++M+KPP GFP  SV  L   E R
Sbjct  126   RRIGIKSLQYWIISPATIGYMASPAR-------KREDDMRKPPSGFPDCSV-KLHEHEVR  177

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
              F    K     G  +YDR+  G +    I  K C E+E PY+DY+++QF KP+LL+GP+
Sbjct  178   FFAASRKLEFGNGILLYDRISIGADLSDHIGFKGCREIEGPYVDYLETQFGKPVLLSGPL  237

Query  789   VPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLN  610
             VPE ++  L+ KW +WL +F+  +VIYC+ GSE  L+ +Q+KEL LGLELTG+PF   L 
Sbjct  238   VPESSNSTLEAKWGEWLGRFKAGSVIYCALGSENSLQQNQLKELVLGLELTGMPFLAALK  297

Query  609   FPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEG  430
              P   +    L  ALP GF ERV+ RG+++ GWVQQQ IL H SVGC++ H G +S+ E 
Sbjct  298   PPNEFE---SLEDALPKGFKERVQERGVVYGGWVQQQLILAHPSVGCFITHCGAASLTEA  354

Query  429   IVNDCQLVMLPQKGDQF-LNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE-  256
             +VN CQLV+LP+ G  F +NA+ + + ++  VEV + +EDG F KE + KAV+ +M +E 
Sbjct  355   LVNQCQLVLLPRLGSDFIINARTMGEKLRVAVEVEKGEEDGLFTKESVGKAVKIVMDDEN  414

Query  255   --GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
               G   RAN  K +  LL    +S  +      +RD+
Sbjct  415   ELGREVRANHNKVRNLLLSDSFESTCVDAFCHKLRDI  451



>ref|XP_010111152.1| UDP-glycosyltransferase [Morus notabilis]
 gb|EXC30543.1| UDP-glycosyltransferase [Morus notabilis]
Length=460

 Score =   360 bits (925),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 201/460 (44%), Positives = 283/460 (62%), Gaps = 11/460 (2%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             LH+ ++P+FA GH++ F+ +SNKL+  G +ISFF       ++ S  N +P     +P+ 
Sbjct  5     LHIAMYPWFAMGHLTSFLHISNKLAERGHRISFFIPTETQPKLSS-FNLHPHLISFLPID  63

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P V GLPP  ++T D P A   LL  A++L +P I+A LV+LKPHFV FDF  +WLP  
Sbjct  64    VPHVPGLPPTAETTNDIPYALFSLLMTAMDLTRPAIEASLVQLKPHFVFFDFT-HWLPQS  122

Query  1152  AAELG-IKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFE  976
             A  +G IKT+ +      A  +   P R    E+S    ++  PP  FP  S   L   E
Sbjct  123   ARRIGNIKTLLYCTISPAAVGYLISPERELN-EKSLKESDLLVPPKSFPSLSCIRLSAHE  181

Query  975   ARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
             AR  V    +    G S  +R L  LN   AI  KT  EME  Y DY++ QF K ++LAG
Sbjct  182   ARGLVKETVKELGAGISFLERQLIALNDSDAIGFKTSREMEGVYCDYIERQFGKKVILAG  241

Query  795   PVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
             PVVPEP +  L++KWA++L  F    VI+C+FGSE  L++DQ +EL +GLELTGLPF + 
Sbjct  242   PVVPEPPNSALEEKWANFLGNFGCKKVIFCAFGSECVLENDQFQELIIGLELTGLPFLVA  301

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             L  P   +   ++  ALP GF ERVK RGI+H GWVQQQ IL HSSVGC+V H G  S++
Sbjct  302   LKPPKGYE---KIECALPEGFEERVKERGIVHGGWVQQQLILRHSSVGCFVTHCGSGSLL  358

Query  435   EGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE  256
             EG++N+CQLV++P  GDQ +NA++++ D++ GVEV R +E G F +E + KAV+ +M +E
Sbjct  359   EGLMNECQLVLVPNVGDQIINARMMSGDLRVGVEVKRGNESGAFTREGVCKAVKDVMDDE  418

Query  255   ---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMAT  145
                G   R N +KW+EFLL K ++  +I   V+ +  M +
Sbjct  419   SEVGKEVRTNHDKWREFLLSKGLEDSYIDCFVEELLAMIS  458



>gb|KDO77743.1| hypothetical protein CISIN_1g039043mg, partial [Citrus sinensis]
Length=449

 Score =   359 bits (922),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 193/454 (43%), Positives = 280/454 (62%), Gaps = 12/454 (3%)
 Frame = -3

Query  1497  IFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIK-SMLNSNPCTQIVPLALPAV  1321
             I+P+FA GH++PF+ ++NKL+  G +ISF   A  + + + S L+ N  T  +P+++P V
Sbjct  1     IYPWFAMGHLTPFLHIANKLAERGHRISFLLPAKAITKFEPSNLHRNLIT-FIPVSVPRV  59

Query  1320  EGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLAAEL  1141
             +GLPPG ++T D P     LL  A++L +P I+++L  LKP FV FDF  +WLPPLA + 
Sbjct  60    DGLPPGAETTNDVPFPLHPLLMTAMDLTEPAIESVLRHLKPDFVFFDFT-HWLPPLARKF  118

Query  1140  GIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEARDFV  961
             GIK++ + +       +   P R    ER+ T  ++ +PP GFP TS   LR  EAR   
Sbjct  119   GIKSVLYCIISPATIGYLLSPER-KLRERTLTDNDLLRPPQGFP-TSKIRLRAHEARGLA  176

Query  960   IIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPVVPE  781
                 +   GG S   R L  L+ C AI  KTC E+E PY DY+ SQF KP++L+GP +PE
Sbjct  177   AATVKEFGGGLSFAKRNLLSLSECDAIGFKTCREIEGPYCDYIGSQFGKPVILSGPALPE  236

Query  780   PASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLNFPA  601
                  L+++W   L  F+  ++I+C+FGSE  L  +Q +EL LG EL+GLPF + L  P 
Sbjct  237   SPRFALEERWETLLGSFKSKSLIFCAFGSECVLNKEQFQELVLGFELSGLPFLVALKPPV  296

Query  600   NVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEGIVN  421
               D    +  ALP GF ERVKGRG IH GWVQQQ IL H SVGC+V H G  S+ E +VN
Sbjct  297   GHDT---IESALPEGFEERVKGRGFIHGGWVQQQLILKHPSVGCFVTHCGSGSLSEAMVN  353

Query  420   DCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM----GEEG  253
             +CQLV+LP  GDQ +NA+L+ +++K GVEV + DEDG F ++ + KAV+ ++     E G
Sbjct  354   ECQLVLLPNVGDQIINARLMGEELKVGVEVEKGDEDGLFTRDGVCKAVKAVIDDDHSEVG  413

Query  252   ASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                + N  KW+EFL  + +++ ++   V+ +  +
Sbjct  414   KEIKENHAKWREFLRSERLENSYLDGFVQKLHGL  447



>ref|XP_010260356.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Nelumbo nucifera]
Length=472

 Score =   359 bits (922),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 187/462 (40%), Positives = 285/462 (62%), Gaps = 15/462 (3%)
 Frame = -3

Query  1512  LLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLA  1333
             + HV ++P+FA GHI+P++ LSNKL+  G ++SFF       +++ +       + + + 
Sbjct  9     IFHVAMYPWFAIGHITPYLHLSNKLAEKGHRVSFFLPLKTKSKLEHLNRYPHLIRFITIP  68

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +  V+GLPP  ++TAD       LL   L+L +  ++A L++LKP  V +D A  WLP L
Sbjct  69    IARVDGLPPTAETTADVSSPMVPLLMTTLDLTKDHVEAFLLDLKPDLVFYDLAY-WLPAL  127

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPE--RSPTVEEMKKPPPGFPPTSVASLRTF  979
             A  LGIK+I +SV  + A+++   PAR+P     +  T EE+ +PP G+P +S   +R +
Sbjct  128   ARHLGIKSIHYSVVSSAASSYLASPARMPPSAGVKQLTQEELMQPPMGYPSSSPFQIRRY  187

Query  978   EARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLA  799
             E RD ++ F+     G + YD +        AI  +TC E+E PY DY+ +Q+ KP+LL 
Sbjct  188   ETRDALLAFQD-RGDGLTFYDMLTTSFGDSDAICFRTCREIEGPYCDYMATQYGKPVLLT  246

Query  798   GPVV-----PEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTG  634
             GP++      +P + +LD+ W+ WL  F+  +V+YC+FGSE  L+ DQ +EL LG ELTG
Sbjct  247   GPLILPAHHQQPNTRLLDEPWSKWLGNFKEGSVVYCAFGSECILQKDQFQELVLGFELTG  306

Query  633   LPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHA  454
             LPF + L  P     AS +  ALP GF ERV+GRG++H GWV Q QIL H SVGC+V H 
Sbjct  307   LPFLVALKPPHG---ASTIEEALPDGFKERVQGRGVVHGGWVPQTQILSHPSVGCFVSHC  363

Query  453   GFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQ  274
             G+ S+ E +V+ CQ+V++P  GDQF++ +LL   +K  VEV RR+EDG+F +E + KA++
Sbjct  364   GYGSMWESLVSSCQIVLIPNYGDQFMHTQLLTRSLKVAVEVERREEDGWFSRESVCKAIR  423

Query  273   TIMGEEG---ASTRANQEKWKEFLLDKEIQSKFIKDLVKVMR  157
              +M  E       +AN  KW++FLLD+ +QS +I   +  +R
Sbjct  424   LVMDGENQIRKEVKANHVKWRDFLLDENMQSSYIDAFIHDLR  465



>ref|XP_006449435.1| hypothetical protein CICLE_v10015186mg [Citrus clementina]
 gb|ESR62675.1| hypothetical protein CICLE_v10015186mg [Citrus clementina]
Length=458

 Score =   358 bits (920),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 191/459 (42%), Positives = 280/459 (61%), Gaps = 10/459 (2%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ ++P+FA GH++ ++ +SNKL+  G KISF        + +           +P+ +
Sbjct  6     LHIAMYPWFAMGHLTSYLHISNKLAERGHKISFILPTNTQTKFEPFNLHKHLITFIPITV  65

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P V+GLP GT++T D P     LL  A++L +P I+A++ ++KP+ V FDF   WLP LA
Sbjct  66    PCVDGLPSGTETTTDVPFPLHPLLMTAMDLTEPAIEAIVRDIKPNIVFFDFTY-WLPSLA  124

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
              +LGIK+I F         +   P R   P++  T  ++ +PP GFPP+ +  LR  EAR
Sbjct  125   RKLGIKSIAFVTISPATVGYLLSPER-KFPDKVLTEADLLQPPQGFPPSKI-KLRAHEAR  182

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
                    +   GG S  +R+L  L  C AI  KTC E+E  Y DYV+SQF+K ++LAGPV
Sbjct  183   GLAAATVKDF-GGLSFMERLLLCLTECDAIGFKTCREIEGAYCDYVESQFEKRVILAGPV  241

Query  789   VPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLN  610
             +PEP + VL++++    S F+  ++I+C+ GSE  LK DQ +EL  G ELTGLPFF  L 
Sbjct  242   LPEPTTSVLEEEFETLFSSFKAKSLIFCALGSECVLKKDQFQELISGFELTGLPFFAALK  301

Query  609   FPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEG  430
              P   D    +  ALP GF +RVKGRG +H GWVQQQ IL H SVGC+V H G  S+ E 
Sbjct  302   PPTGHDT---IESALPEGFEDRVKGRGFVHGGWVQQQLILKHPSVGCFVTHCGSGSLSEA  358

Query  429   IVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE--  256
             +VN+CQLV+LP  GDQ +N++L+ +D+K GVEV R DEDG F ++ + KAV+ +M ++  
Sbjct  359   MVNECQLVLLPNVGDQIINSRLMGEDLKVGVEVERGDEDGLFTRDGVCKAVKAVMDDDSE  418

Query  255   -GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATM  142
              G   R N  K +EFL+   +++ ++   V+ +  +A +
Sbjct  419   VGKDARQNHAKLREFLISPGLENSYVDGFVQELHSLADL  457



>ref|XP_004307624.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Fragaria vesca 
subsp. vesca]
Length=459

 Score =   358 bits (919),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 190/459 (41%), Positives = 282/459 (61%), Gaps = 13/459 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             +H+ ++P+FA GH++ ++ +SNKL+  G KISFF       ++    N +P     +P+ 
Sbjct  6     MHIAMYPWFAMGHLTSYLHISNKLAERGHKISFFIPIKTQPKM-VQFNLHPHLISFIPIN  64

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P ++GLP GT++TAD P      L  A++L +PQI+  L E+ P+FV +DF+  WLP  
Sbjct  65    VPHIDGLPLGTETTADIPLHLHPHLATAMDLTRPQIEQSLREINPNFVFYDFSY-WLPAF  123

Query  1152  AAELG--IKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTF  979
               +LG  IK++ +         +   P R    E++ T  E ++ P  FP +S+  LR  
Sbjct  124   LRQLGKTIKSVHYCTISPATVGYLISPERKLS-EKTLTEFEYREAPTSFPSSSI-KLRPH  181

Query  978   EARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLA  799
             EAR       + +  G +   R       C AI  KTC E+E P+ DY+++Q +KP++LA
Sbjct  182   EARGLAYGANKEYGRGITFLKRQQINFGDCDAIAFKTCRELEGPFCDYLETQLRKPVILA  241

Query  798   GPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFL  619
             GPVVP+P S  L++KWA+WL  F+  TVI+C+FGSE  L+ +Q++EL LG ELTGLPFF 
Sbjct  242   GPVVPDPPSSHLEEKWANWLGGFDSKTVIFCAFGSECILRKEQLQELLLGFELTGLPFFA  301

Query  618   VLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSV  439
              L  P  V+    +  ALP GF ERV+G+GI++ GWVQQ  IL H SVGC+V H G  S+
Sbjct  302   ALKPPTGVE---SIESALPQGFLERVEGKGIVYGGWVQQPLILKHPSVGCFVTHCGSGSL  358

Query  438   IEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGE  259
              E +VN+CQLV+LP  GDQ +NA++++ D+K GVEV + DEDG F KE + KAV+ ++ E
Sbjct  359   SEALVNECQLVLLPNVGDQIINARMMSGDLKVGVEVEKGDEDGLFSKEGVCKAVKAVIDE  418

Query  258   EG---ASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             +       RAN  KW+EF   K ++S +I+D V  +  +
Sbjct  419   DSEVEKEVRANHAKWREFFSSKGLESSYIEDFVHKLHKL  457



>ref|XP_010260530.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Nelumbo nucifera]
Length=471

 Score =   358 bits (918),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 186/462 (40%), Positives = 285/462 (62%), Gaps = 15/462 (3%)
 Frame = -3

Query  1512  LLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLA  1333
             + HV ++P+FA GHI+P++ LSN+L+  G ++SFF       +++ +       + + + 
Sbjct  8     IFHVTMYPWFAIGHITPYLHLSNQLAEKGHRVSFFLPPKTKSKLEHLNRYPHLIRFITIP  67

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +  V+GLPP  ++TAD       LL   L+L +  ++A L++LKP  V +D A  WLP L
Sbjct  68    IARVDGLPPTAETTADVSSPMVPLLMTTLDLTKDHVEAFLLDLKPDLVFYDLAY-WLPAL  126

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPE--RSPTVEEMKKPPPGFPPTSVASLRTF  979
             A  LGIK+I +SV  + A+++   PAR+P     +  T EE+ +PP G+P +S   +R +
Sbjct  127   ARHLGIKSIHYSVVSSAASSYLASPARMPPSAGVKQLTQEELMQPPMGYPSSSPFQIRRY  186

Query  978   EARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLA  799
             E RD ++ F+     G + YD +        AI  +TC E+E PY DY+ +Q+ KP+LL 
Sbjct  187   ETRDALLAFQD-RGDGLTFYDMLTTSFGDSDAICFRTCREIEGPYCDYMATQYGKPVLLT  245

Query  798   GPVV-----PEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTG  634
             GP++      +P + +LD+ W+ WL  F+  +V+YC+FGSE  L+ DQ +EL LG ELTG
Sbjct  246   GPLILPAHHQQPNTRLLDEPWSKWLGNFKEGSVVYCAFGSECILQKDQFQELVLGFELTG  305

Query  633   LPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHA  454
             LPF + L  P     AS +  ALP GF ERV+GRG++H GWV Q QIL H SVGC+V H 
Sbjct  306   LPFLVALKPPHG---ASTIEEALPDGFKERVQGRGVVHGGWVPQTQILSHPSVGCFVSHC  362

Query  453   GFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQ  274
             G+ S+ E +V+ CQ+V++P  GDQF++ +LL   +K  VEV RR+EDG+F +E + KA++
Sbjct  363   GYGSMWESLVSSCQIVLIPNYGDQFMHTQLLTRSLKVAVEVERREEDGWFSRESVCKAIR  422

Query  273   TIMGEEG---ASTRANQEKWKEFLLDKEIQSKFIKDLVKVMR  157
              +M  E       +AN  KW++FLLD+ +QS +I   +  +R
Sbjct  423   LVMDGENQIRKEVKANHVKWRDFLLDENMQSSYIDAFIHDLR  464



>emb|CDO96715.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   356 bits (913),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 194/448 (43%), Positives = 274/448 (61%), Gaps = 16/448 (4%)
 Frame = -3

Query  1476  GHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLALPAVEGLPPGTQ  1297
             GH++ F+ +SNKL+  G KI F        ++K           +PL +P VEGLPPG +
Sbjct  2     GHLTAFLHMSNKLADGGHKIFFLLPRKTQAQLKQFNLYPDLIDFIPLCVPQVEGLPPGAE  61

Query  1296  STADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLAAELGIKTIffs  1117
             +TAD P      L +A++  QPQI+++L E+KP  V FDF  +WLP LA  LGIK+IFF 
Sbjct  62    TTADIPFHLQPNLRLAMDSTQPQIESILQEIKPQVVFFDFT-HWLPKLARRLGIKSIFFI  120

Query  1116  vfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEARDFVIIFKRPHN  937
                +  + +     +        T  ++ K PPGFP +S   L + EAR      K    
Sbjct  121   TMSSATSGYTFRGEQ-------TTDADLMKAPPGFP-SSCIKLLSHEARGLNFAGKVKEI  172

Query  936   G-GASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPVVPEPASGVLD  760
             G G S  +R+L     C AI  KTC EME PY ++++ +FKKP++LAGPV+PE  +  L+
Sbjct  173   GSGLSFLERLLISAEDCDAIGFKTCREMEGPYCEFIERKFKKPVILAGPVLPEQPTTTLE  232

Query  759   QKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLNFPANVDVASE  580
             +KW  WLS F+  +VI+C+FGSE  L+ DQ +EL  GLELTGLPF   L  P   +    
Sbjct  233   EKWEKWLSGFKAKSVIFCAFGSECRLQKDQFQELLKGLELTGLPFLAALKPPIGSET---  289

Query  579   LNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEGIVNDCQLVML  400
             +  ALP GF ER++GR +++ GWVQQQ IL HSSVGC+V H G  S+ EG+VN+CQ+V+L
Sbjct  290   IEMALPEGFNERIQGRSVVYGGWVQQQLILAHSSVGCFVTHCGSGSLSEGLVNECQMVLL  349

Query  399   PQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM---GEEGASTRANQE  229
             PQ GDQF+NA+L+  D++ GVEV + DEDG F KE + KA++ +M    E G   RAN  
Sbjct  350   PQFGDQFINARLMGGDLRVGVEVEKGDEDGLFTKEGVCKAIRMVMDDGSEIGKEVRANHA  409

Query  228   KWKEFLLDKEIQSKFIKDLVKVMRDMAT  145
             KW++FLL +  +S +I + +  M+ + +
Sbjct  410   KWRDFLLREGTESSYIDEFINKMKRLLS  437



>ref|XP_008455479.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Cucumis melo]
Length=469

 Score =   357 bits (915),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 194/464 (42%), Positives = 284/464 (61%), Gaps = 15/464 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ ++P+FAFGH+ P++Q++NKL+  G +ISF   +    +++   +       +P+ +
Sbjct  7     LHIAMYPWFAFGHLIPYLQIANKLAKKGHRISFLIPSNTQPKLQPFNHFPNLITFLPIIV  66

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLM-QPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             P V GLP G ++TAD        L +    + QPQI++ L  +KPHF  FDF   W+P L
Sbjct  67    PHVNGLPQGAETTADVSNLQQFSLIMTAMDLTQPQIESFLQHVKPHFFFFDFTY-WMPKL  125

Query  1152  AAELGIKTIffsvfvalatafatVPAR-LPGPERSPTVEEMKKPPPGFPPTSVASLRTFE  976
             A++ GIK+I+ SV  A   A+   P+R L G +   TV++  KPP GFP +SV  L + E
Sbjct  126   ASQFGIKSIYHSVISATTFAYVYPPSRQLCGHDF--TVDDFMKPPLGFP-SSVIKLHSHE  182

Query  975   ARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
             A+ +  +           + R   GL    AI  K+  E+E P+IDY++++FKKP+LL+G
Sbjct  183   AKFYASMSHMKFGSDVLFFHRHFTGLCESDAIAFKSSREIEGPFIDYLETEFKKPVLLSG  242

Query  795   P--VVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFF  622
             P   + EP +  L+Q+WA+ LS+F+  +VIYC+FGSE  L  DQ++EL LG ELT LPFF
Sbjct  243   PDGNIQEPTT-TLEQRWAECLSEFKAGSVIYCAFGSECTLTKDQLQELVLGFELTNLPFF  301

Query  621   LVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSS  442
              VL  P  +D    +N ALP GF +R++GRG+++ GWVQQQ IL H S+GC+V H G  S
Sbjct  302   AVLKPPHGMDT---INAALPEGFEQRIQGRGVVYGGWVQQQHILEHPSIGCFVTHCGAGS  358

Query  441   VIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMG  262
             + E +V  CQLV LP  GD F  A+ L+  +K GVEV RR EDG F KE + KAV+T+M 
Sbjct  359   LSEALVKKCQLVFLPHIGDHFFRARTLSSCLKVGVEVERRQEDGVFNKESVCKAVKTVMD  418

Query  261   EE---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
             EE   G   RAN  K +E L+DK+++  +I + +  +  +   N
Sbjct  419   EENESGKEIRANLAKLRELLVDKDLEESYINNFIHKLHCLIVSN  462



>ref|XP_008245371.1| PREDICTED: LOW QUALITY PROTEIN: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Prunus mume]
Length=456

 Score =   356 bits (914),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 193/458 (42%), Positives = 277/458 (60%), Gaps = 14/458 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ ++P+F  GH++ F+ +SNKL+  G +ISFFS +    ++++    +     +P+ +
Sbjct  6     LHIAMYPWFGMGHLTSFLHISNKLAERGHRISFFSPSKVQQKLEAFNLHSHRISFIPIDV  65

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P V+GLPPGT++TAD P     LL  A++L +P I+  L EL+P+FV FDF  +WLP L 
Sbjct  66    PHVDGLPPGTETTADVPFPLHSLLVTAMDLTRPAIEQALCELRPNFVFFDFT-HWLPALL  124

Query  1149  AEL--GIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFE  976
              +L  GIK++ +         F   P R    E+S T  ++ +PPP FP +S+  L+T E
Sbjct  125   HKLDIGIKSVHYCTISPATVGFLISPER-KLLEKSLTEADLMEPPPSFPASSI-KLQTHE  182

Query  975   ARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
             AR  V      +  G +  +R +   + C AI  KTC EME PY DYV++QF KP++LAG
Sbjct  183   ARALVGATLMEYGRGVTFLERQMGSFSNCDAIAFKTCREMEGPYCDYVETQFGKPVILAG  242

Query  795   PVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
             PVVPE  +  LD+KWA W   FE  TVIYC+FGSE  L   Q +EL LG ELTGLPFF  
Sbjct  243   PVVPESPTTELDEKWAKWFDGFEAKTVIYCAFGSECILNKAQFQELLLGFELTGLPFFAA  302

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             L  P  V+    +  ALP GF ER +GRGI+H GWV         SVGC+V H G  S+ 
Sbjct  303   LKPPMGVE---SIEAALPEGFEERGQGRGIVHGGWVXXXXX---PSVGCFVTHCGSGSLS  356

Query  435   EGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE  256
             E ++N+C+LV+LP  GDQ +NA++++ D+K GVEV + DEDG F  E + KAV+T+M +E
Sbjct  357   EALMNECRLVLLPNVGDQIINARMMSRDLKVGVEVEKGDEDGVFTTEGVCKAVKTVMDDE  416

Query  255   ---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                    R N  KW+EF   K +++ ++    + +  +
Sbjct  417   SEVAKEVRTNHAKWREFFTGKGLENSWLDSFEQKLHQL  454



>ref|XP_008455481.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Cucumis melo]
 ref|XP_008455483.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Cucumis melo]
Length=463

 Score =   356 bits (913),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 192/460 (42%), Positives = 282/460 (61%), Gaps = 15/460 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ +FP+FAFGH+SP++Q++NKL+  G KISF   +    +++   +       VP+ +
Sbjct  10    LHIAMFPWFAFGHLSPYLQIANKLAKKGHKISFLIPSKIRAKLQPFNHFPNLITFVPIIV  69

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLM-QPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             P V+GLP G ++TAD        L +    + QPQIK+LL  +KPH + FDF   W+P L
Sbjct  70    PHVDGLPEGAETTADVSNLHQFNLIMTAMDLTQPQIKSLLQHIKPHVIFFDFT-FWIPKL  128

Query  1152  AAELGIKTIffsvfvalatafatVPAR-LPGPERSPTVEEMKKPPPGFPPTSVASLRTFE  976
             A++LGIK+I++SV  A   ++   P R L GP+   TV+E  KPP G   TS   L + E
Sbjct  129   ASQLGIKSIYYSVISATTFSYVFTPTRQLCGPDF--TVDEFIKPPLGLA-TSAIKLHSHE  185

Query  975   ARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
             A++   +           + R   GL    AI  K C E+E P++D++ S+FKKP+LL+G
Sbjct  186   AKNVTFMSNMIFGSDVRFFHRHFTGLCESDAIAFKACREIEGPFVDHLISEFKKPILLSG  245

Query  795   PV--VPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFF  622
             P   + EP +  L+ +W +WLS+F+  +VIYC+FGSE  L  DQ++EL LG ELT  PFF
Sbjct  246   PDGDIQEPKT-TLEHRWQEWLSRFKYGSVIYCAFGSECTLTKDQLQELVLGFELTNQPFF  304

Query  621   LVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSS  442
              V   P  VD  +    ALP GF ERV+GRG+++ GWVQQQ IL H S+GC+V H G  S
Sbjct  305   AVFKPPVGVDTVTA---ALPDGFEERVEGRGVVYGGWVQQQHILEHPSIGCFVTHCGAGS  361

Query  441   VIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM-  265
             + E +V  CQLV+LP  GD    A+ L+  +K GVEV +R++DG+F KE + +AV+T+M 
Sbjct  362   LSEALVKKCQLVLLPHVGDHIFRARTLSSYLKVGVEVEKREDDGFFTKESVCEAVKTVMD  421

Query  264   --GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                E G   RA + K +E LLDK+++  +I + +  ++ +
Sbjct  422   EGNERGKEIRATRAKLRELLLDKDLEESYISNFIHNLQSL  461



>ref|XP_007021598.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY13123.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=458

 Score =   354 bits (909),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 182/456 (40%), Positives = 290/456 (64%), Gaps = 11/456 (2%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
              HV++F +FA GH++PF+ L+NKL+  G +I+F      V++++ +          P+ +
Sbjct  9     FHVLMFSWFAIGHMTPFLHLANKLAEKGHRITFVLPRKAVNQLEHLNLYPDFISFHPVTV  68

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P+V GLPPG ++ +D P   +  L +A++  + Q+++++  +KP+ V++D A +W+P +A
Sbjct  69    PSVTGLPPGAETASDIPIFLSHFLSIAMDRTRDQVESVISSVKPNLVLYDTA-HWIPEIA  127

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
               LGIKTI ++V  A A A   VPAR    ER  T  E+  PP G+P +SV  LR+ E +
Sbjct  128   KPLGIKTICYNVVCAAAIAIVLVPARNAARERPITEAELAVPPLGYPSSSVV-LRSHEGQ  186

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
               + +   P   G + Y+R+   +  C AI  +TC+E+E    DY+ SQ++KP+LL GPV
Sbjct  187   SLLFV-TNPFGEGLTFYERITTAMKNCDAISIRTCHEIEGKLCDYIGSQYEKPVLLTGPV  245

Query  789   VPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLN  610
             +PE +  VLD++W  WL+ FEP +V+YC+FGS+   +  Q +EL LG ELTGLPFF+ L 
Sbjct  246   LPEESKSVLDERWGSWLAGFEPGSVVYCAFGSQFIFEKPQFQELLLGFELTGLPFFVALK  305

Query  609   FPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEG  430
              P     A+ +  ALP GF ERVKGRG++  GWVQQ  +L H SVGC+V H GF S+ E 
Sbjct  306   PPLE---AATIEEALPEGFEERVKGRGVVWGGWVQQPLVLAHPSVGCFVSHCGFGSMWES  362

Query  429   IVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM---GE  259
             +++DCQ+V+ PQ GDQ LN +L+AD++K  VEV +R+E G+  KE++ +A++++M    E
Sbjct  363   LMSDCQIVLFPQLGDQILNTRLMADELKVAVEV-KREESGWLSKENLSEAIKSVMHKDSE  421

Query  258   EGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
              G   + N +KW++  +  E+ + +I   ++ M ++
Sbjct  422   VGKLAKENHKKWRD-TISPELTNDYIDKFIQSMHEL  456



>ref|XP_006467704.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Citrus sinensis]
Length=458

 Score =   354 bits (909),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 190/459 (41%), Positives = 280/459 (61%), Gaps = 10/459 (2%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ ++P+FA GH++ ++ +SNKL+  G KISF        + +           +P+ +
Sbjct  6     LHIAMYPWFAMGHLTSYLHISNKLAERGHKISFILPTNTHTKFEPFNLHKHLVTFIPITV  65

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P V+GLP GT++T D P     LL  A++L +P I+A++ ++KP+ V FDF   WLP LA
Sbjct  66    PCVDGLPSGTETTTDVPFPLHPLLMTAMDLTEPAIEAIVRDIKPNIVFFDFTY-WLPSLA  124

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
              +LGIK+I F         +   P R    ++  T  ++ +PP GFPP+ +  LR  EAR
Sbjct  125   RKLGIKSIAFVTISPATVGYLLSPER-KLRDKVLTEADLLQPPQGFPPSKI-KLRAHEAR  182

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
                    +   GG S  +R+L  L  C AI  KTC E+E  Y DYV+SQF+K ++LAGPV
Sbjct  183   GLAAATVKDF-GGLSFMERLLLCLTECDAIGFKTCREIEGAYCDYVESQFEKRVILAGPV  241

Query  789   VPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLN  610
             +PEP + VL++++    S F+  ++I+C+ GSE  LK DQ +EL LG ELTGLPFF  L 
Sbjct  242   LPEPPASVLEEEFEMLFSSFKAKSLIFCALGSECVLKKDQFQELILGFELTGLPFFAALK  301

Query  609   FPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEG  430
              P   D    +  ALP GF +RVKGRG +H GWVQQQ IL H SVGC+V H G  S+ E 
Sbjct  302   PPTGHDT---IESALPEGFEDRVKGRGFVHGGWVQQQLILKHPSVGCFVTHCGSGSLSEA  358

Query  429   IVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE--  256
             +VN+CQLV+LP  GDQ +N++L+ +D+K GVEV R DEDG F ++ + KAV+ +M ++  
Sbjct  359   MVNECQLVLLPNVGDQIINSRLMGEDLKVGVEVERGDEDGLFTRDGVCKAVKAVMDDDSE  418

Query  255   -GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATM  142
              G   R N  + +EFL+   +++ ++   V+ +  +A +
Sbjct  419   VGKDARQNHAELREFLISPGLENSYVDGFVQELHSLADL  457



>ref|XP_010686377.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Beta vulgaris subsp. vulgaris]
Length=466

 Score =   355 bits (910),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 195/468 (42%), Positives = 280/468 (60%), Gaps = 18/468 (4%)
 Frame = -3

Query  1530  NNHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCT  1351
              N   + LH+ + P+FAFGHI+ F+ L+NKL+  G  ISFF       +  S  +     
Sbjct  4     ENGNSEHLHIAMCPWFAFGHITSFLHLANKLAEKGHTISFFIPTKTKLKFVSHNHHPHLI  63

Query  1350  QIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQ  1171
              ++P+ LP+V GL  G ++TAD P ++  L+  A++  Q  I++ L  +KP F+ FDF +
Sbjct  64    TLIPITLPSVHGLHVGAETTADVPASSRSLIMAAMDQTQDTIESHLAHIKPDFIFFDFTE  123

Query  1170  NWLPPLAAELGIKTIffsvfvalatafatVPARLPGPERSP----TVEEMKKPPPGFPPT  1003
              W+P +A +  IK++F+S    +  A+      LP P +      + E+MK+PPPGFP  
Sbjct  124   -WIPKVARKHQIKSVFYSTVYLVTVAYL-----LPQPRKLAINCFSEEDMKQPPPGFPLP  177

Query  1002  SVASLRTFEARDFVIIFKRPHNGGA-SVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKS  826
             S+  LR  EAR      K    GG  S+ +RV      C A+  KTC EME  Y D+++ 
Sbjct  178   SI-RLRAHEARSLSSASKAEFGGGGMSLLERVSEAFQQCDAVCIKTCREMEGSYCDFMQK  236

Query  825   QFKKPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGL  646
              + KP+LLAGPVVPE  +  LD+ +  WL      +V+YC+ GSE  L+ DQ +EL LGL
Sbjct  237   NYGKPVLLAGPVVPELPATQLDEYFDRWLKGCGNGSVVYCALGSECTLQKDQFQELILGL  296

Query  645   ELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCY  466
             ELTG+PF   L  P      S L  ALP GF ER KGRGI+H GWVQQQ +L HSSVGC+
Sbjct  297   ELTGMPFLAALKLPTE---CSTLESALPEGFKERTKGRGIVHIGWVQQQLVLQHSSVGCF  353

Query  465   VCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQ  286
             + H G  S+ E +V+ CQ++MLPQ  DQ +NA+L++ D++ GVEV  RD DG+F +E + 
Sbjct  354   LTHCGAGSLSEAMVSQCQIIMLPQAVDQSVNARLMSLDLRLGVEVEMRDRDGFFTREAVC  413

Query  285   KAVQTIMGEE---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             KAV T+M  E   G   RAN  KW+EFLL + ++  +I   ++ ++D+
Sbjct  414   KAVVTVMDAENEVGREVRANHAKWREFLLKEGLEDAYINGFIQSLQDL  461



>gb|KDP21029.1| hypothetical protein JCGZ_21500 [Jatropha curcas]
Length=458

 Score =   352 bits (904),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 192/458 (42%), Positives = 267/458 (58%), Gaps = 8/458 (2%)
 Frame = -3

Query  1515  DLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPL  1336
             +  H+ ++P+FA GH++ F+ LSNKL+  G KISF          +          ++P+
Sbjct  4     NTFHIAMYPWFALGHLTSFLHLSNKLAERGHKISFLLPPKTKSNFEPFNLYPNLITLIPI  63

Query  1335  ALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPP  1156
              +P V+GLPPG+++TAD P     L+  A++L QP I+  L  LKPHFV FDF  +WLP 
Sbjct  64    DIPHVDGLPPGSETTADVPFPLHPLIMTAMDLTQPTIEFHLRNLKPHFVFFDFT-HWLPA  122

Query  1155  LAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFE  976
             L+ +L IK++ +         +   P       +  T  ++  PPP FP +S+  LR  E
Sbjct  123   LSRKLNIKSVHYYTISPATVGYLLRPEIKIADNKIRTEVDLMNPPPSFPRSSI-KLRAHE  181

Query  975   ARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
             AR      KR    G S   R     + C A+  KTC EME PY +Y++ QF K ++LAG
Sbjct  182   ARHLAAGAKREFGSGISFSQRQWICFSECDAVSFKTCTEMEGPYCNYIEKQFCKKVILAG  241

Query  795   PVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
             PVVPEP S VLDQ+    L  FE  +VI+C+FG+E  L  DQ +EL LGLE TGLPFF  
Sbjct  242   PVVPEPPSLVLDQEIERILDNFEEGSVIFCAFGTECLLNKDQFQELLLGLESTGLPFFAA  301

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             L  P  V+   ++  ALP GF ERVKGRG ++  WVQQQ IL H SVGC+V H G  S+ 
Sbjct  302   LKPPIGVE---KIESALPEGFQERVKGRGFVYGDWVQQQLILQHPSVGCFVTHCGSGSLS  358

Query  435   EGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE  256
             E +V  CQLV+LP  GDQ +NA+L+  D+K GVEV + +EDG F K  + KAV+ +M  +
Sbjct  359   EAMVTKCQLVLLPNVGDQIINARLMGGDLKVGVEVEKGEEDGLFSKNGVCKAVKAVMNND  418

Query  255   G---ASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                    + N  KW+EFLL + ++  +I   V+ + +M
Sbjct  419   SEVKEEVKQNHTKWREFLLSQGLEDSYIDGFVQKLHEM  456



>ref|XP_011087015.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Sesamum indicum]
Length=452

 Score =   352 bits (903),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 193/463 (42%), Positives = 277/463 (60%), Gaps = 21/463 (5%)
 Frame = -3

Query  1521  GGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIV  1342
             G + L +V++P+FA GH++ F+ +S+K +  G KI F        ++          + +
Sbjct  2     GENSLKIVMYPWFAMGHLTAFLHISDKFAEKGHKIFFILPTKTQSKLDQFNLHPNLIKFI  61

Query  1341  PLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWL  1162
             P+ +P V+GLP G+++TAD P     LL  A++L +P I+  L ELKPHFV FDF  +WL
Sbjct  62    PITVPQVDGLPDGSETTADVPFPMYSLLRHAMDLTEPVIEGFLRELKPHFVFFDFT-HWL  120

Query  1161  PPLAAELGIKTIffsvfvalatafatVPARLPGPERS-PTVEEMKKPPPGFPPTSVASLR  985
             P LA  LGIK++ +             PA +    R  P  +   +PPPGFPP+++ SL 
Sbjct  121   PALARRLGIKSVHYCTIS---------PASVAYLFRDEPAADAFLEPPPGFPPSAI-SLH  170

Query  984   TFEAR--DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKP  811
               EAR  D++   K   NG   V  RVL     C A+  K+C EME  + ++++ +FKKP
Sbjct  171   KHEARGVDWINNIKEFGNGMKFV-QRVLMAAEECDAMCFKSCNEMEGRFCEFLEKKFKKP  229

Query  810   LLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGL  631
             ++LAGPV+PEP + +LD+KWA WL QF+  +VI+CSFGSE  L+ DQ +EL LG ELTG 
Sbjct  230   MILAGPVLPEPPTSMLDEKWAKWLDQFKAKSVIFCSFGSEARLERDQFQELILGFELTGF  289

Query  630   PFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAG  451
             PF   L  P   +   E   ALP GF +R   RG +H GWVQQQ IL H SVGC+V H G
Sbjct  290   PFLAALKPPIGAETVEE---ALPEGFKKRSAERGAVHGGWVQQQLILSHPSVGCFVTHCG  346

Query  450   FSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQT  271
             + S+ E +VN+CQLV+LP  GDQ +NA+L+  D+K GVEV + DEDG F +E +   ++ 
Sbjct  347   WGSLSEAMVNECQLVLLPHVGDQPINARLMGGDLKVGVEVEKGDEDGLFTREGVMNVIRL  406

Query  270   IM---GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             +M    E G   R    +W+EFLL + ++S +  D V  ++ +
Sbjct  407   VMEDGSEIGKEIRTKHAEWREFLLREGLESSYFDDFVHRLQRL  449



>ref|XP_004144602.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cucumis sativus]
 ref|XP_004164963.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cucumis sativus]
 gb|KGN43484.1| hypothetical protein Csa_7G041300 [Cucumis sativus]
Length=460

 Score =   352 bits (902),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 190/460 (41%), Positives = 282/460 (61%), Gaps = 15/460 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ +FP+FAFGH++P++Q++NKL+  G KISF   +    +++   +       VP+ +
Sbjct  7     LHIAMFPWFAFGHLAPYLQIANKLAKKGHKISFLIPSKTQVKLQPFNHFPNLITFVPIIV  66

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLM-QPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             P V+GLP G + TAD        L +    + QPQIK LL  +KPH + FDF   W+P L
Sbjct  67    PHVDGLPEGAEITADVSNLHEFNLIMTAMDLTQPQIKTLLQLIKPHVIFFDFT-FWIPKL  125

Query  1152  AAELGIKTIffsvfvalatafatVPAR-LPGPERSPTVEEMKKPPPGFPPTSVASLRTFE  976
             A++LGIK+I++SV  A   ++   P R L GP+   TV+E  +PP G   +++  L + E
Sbjct  126   ASQLGIKSIYYSVISATTFSYVFTPTRQLCGPDF--TVDEFMQPPLGLAISAI-KLHSHE  182

Query  975   ARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
             A++   +           + R   GL    AI  K C E+E P++D++ S+FKKP+LL+G
Sbjct  183   AKNVTFMSNMIFGSDVRFFHRHFTGLCEADAIAFKACGEIEGPFVDFLISEFKKPVLLSG  242

Query  795   PV--VPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFF  622
             P   + EP +  L+ +W +WLS+F+  +VIYC+FGSE  L  DQ +EL LG ELT LPF 
Sbjct  243   PDGDIQEPKT-TLEHRWQEWLSKFKSGSVIYCAFGSECTLTKDQFQELVLGFELTNLPFL  301

Query  621   LVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSS  442
              VL  P  VD  +    ALP GF ERV+GRG+++ GWVQQQ IL H S+GC+V H G  S
Sbjct  302   AVLKPPVGVDTVTA---ALPDGFEERVEGRGVVYGGWVQQQHILEHPSIGCFVTHCGAGS  358

Query  441   VIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM-  265
             + E +V  CQLV+LP  GD F  A+ L+  +K GVEV +R++DG+F KE + +AV+T+M 
Sbjct  359   LSEALVKKCQLVLLPHVGDHFFRARTLSSCLKVGVEVEKREDDGFFTKESVCEAVKTLMD  418

Query  264   --GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                E G   RA + K +E LLDK+++  +I + +  ++ +
Sbjct  419   EGNERGKEIRATRAKLRELLLDKDLEESYIINFIHNLQSL  458



>gb|EYU43362.1| hypothetical protein MIMGU_mgv1a019428mg [Erythranthe guttata]
Length=443

 Score =   350 bits (899),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 191/454 (42%), Positives = 281/454 (62%), Gaps = 19/454 (4%)
 Frame = -3

Query  1497  IFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPC-TQIVPLALPAV  1321
             ++P+FA GH++ F+ +SNK +  G KI FF     V    +  N +P   + +P+ +P V
Sbjct  1     MYPWFAMGHLTTFLHVSNKFAEKGHKI-FFILPTKVQSKLNQFNHHPTLIEFIPITVPEV  59

Query  1320  EGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLAAEL  1141
             EGLP GT++T+D P     LL  A++L +  ++ LL E+KPHFV FDF   WLP LA  L
Sbjct  60    EGLPNGTETTSDVPFTMYSLLRHAMDLTKSTVENLLKEIKPHFVFFDFTP-WLPSLARSL  118

Query  1140  GIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEARDFV  961
             GIK+I + +    + AF             PTV++  +PP  FPP+ +  L   EAR   
Sbjct  119   GIKSIHYFIITTASAAFLF--------RDEPTVDDYIEPPSDFPPSKI-KLYKHEARVIY  169

Query  960   IIFKRPHNGGASVY-DRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPVVP  784
              I  +   G    Y +R++   N C A+  K+C EME PY+++++ +FKK ++LAGPV+P
Sbjct  170   RINNQKEFGSEMKYVERMIMSANECDAMGFKSCREMEGPYLEFLERKFKKRVILAGPVLP  229

Query  783   EPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLNFP  604
             +P +  LD+KWA+WL QF+P +VIYC+FGSE  L+ +Q +EL LG E TGLPFF  L  P
Sbjct  230   DPPTCTLDEKWANWLDQFKPKSVIYCAFGSEARLQREQFQELVLGFEQTGLPFFAALKPP  289

Query  603   ANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEGIV  424
                  A+ +  ALP GF ER   RG++  GWVQQQ IL H SVGC+V H G+ S+ E +V
Sbjct  290   IG---AATVEEALPEGFRERTMERGVVEGGWVQQQVILSHPSVGCFVTHCGWGSLSEALV  346

Query  423   NDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE---G  253
             N+C+LV++P  GDQ +NA+L+  D++ GVEV + DEDG F ++ +  AV+++M ++   G
Sbjct  347   NECRLVLMPHVGDQLVNARLMGGDLRVGVEVEKGDEDGLFTRDGVVTAVRSVMDDDCEIG  406

Query  252   ASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                 AN+ KW+ FLL K ++S +I   V  ++ M
Sbjct  407   REIEANRVKWRSFLLTKGLESSYIDGFVHNLQCM  440



>ref|XP_010035825.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Eucalyptus grandis]
 gb|KCW47287.1| hypothetical protein EUGRSUZ_K01079 [Eucalyptus grandis]
Length=457

 Score =   350 bits (898),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 192/450 (43%), Positives = 277/450 (62%), Gaps = 9/450 (2%)
 Frame = -3

Query  1521  GGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIV  1342
             G   LH+ ++P+ A GH++PF+ L+NKL+  G KISF        +++           V
Sbjct  2     GESRLHIAMYPWLAMGHLTPFLHLANKLAKKGHKISFLIPPRTRAKLEHFNRHPDLITFV  61

Query  1341  PLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWL  1162
             P+A+P VEGLPP  ++T+D P     L+  A++  +P ++ LL  LKPH V  DF  +WL
Sbjct  62    PIAIPHVEGLPPDAETTSDVPYPLHPLIMTAMDHTEPTVRQLLQTLKPHCVFHDFT-HWL  120

Query  1161  PPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRT  982
             P +A +LGIK++ + +   +  ++   PAR     +    + M  PP G+P +S+  L  
Sbjct  121   PAIAHDLGIKSVHYCIISPVTVSYTLSPARHLSAHKLTEADYMV-PPAGYPNSSI-KLHL  178

Query  981   FEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLL  802
              EAR  + I  + +       DR+ AG      +  ++C E+E PYI+Y+KSQF KP+LL
Sbjct  179   HEARALIAIRYKTYGSNIGFSDRMFAGYVESDILSFRSCREIEQPYIEYLKSQFGKPVLL  238

Query  801   AGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFF  622
             +GPV+PEP++  LD+KW +WL  F+  +VIYC+FGSE  ++ DQ +EL LGLELTGLPF 
Sbjct  239   SGPVIPEPSTSGLDEKWVEWLGDFKDGSVIYCAFGSECTMQKDQFQELLLGLELTGLPFL  298

Query  621   LVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSS  442
               L  P      S +  ALP GF ERV+GRG +H GWVQQQ IL H ++GC++ H G SS
Sbjct  299   AALKPPFG---TSSIEEALPVGFEERVQGRGTVHGGWVQQQLILQHPAIGCFITHCGTSS  355

Query  441   VIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMG  262
              IE +VN CQLV+LPQ GDQ  NA+++ +++K GVEV + +EDG   KE + KAV T+M 
Sbjct  356   TIEALVNKCQLVLLPQVGDQIFNARMMGNNLKVGVEVEKGEEDGRLTKESVCKAVNTVMD  415

Query  261   E---EGASTRANQEKWKEFLLDKEIQSKFI  181
             E    G   R N  K +E LLDK+++S +I
Sbjct  416   EGDAYGNEVRENHAKIREILLDKKLESTYI  445



>gb|ACU24192.1| unknown [Glycine max]
Length=458

 Score =   350 bits (898),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 185/457 (40%), Positives = 271/457 (59%), Gaps = 10/457 (2%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             +H+ +FP+FA GH++P++ LSNKL+  G +ISFF       +++            P+ +
Sbjct  6     MHIAMFPWFAMGHLTPYLHLSNKLAKRGHRISFFIPKRTQHKLEQFNLFPHLITFYPINV  65

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P VEGLP G ++T+D   +   L+  A++  +  I+ LL+ELKP  V FDF   WLP L 
Sbjct  66    PHVEGLPHGAETTSDVSFSLGPLIMTAMDRTEKDIELLLIELKPQIVFFDFTY-WLPNLT  124

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
               LGIK+  + +      A+   P R+        V+ M+ PP G+P +S+  L   EA+
Sbjct  125   RRLGIKSFQYMIVSPATVAYNASPPRMQNSVNLTEVDLMQ-PPLGYPVSSI-KLHAHEAK  182

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
                         G   YDR+  GL+   AI  K C E+E PY+DY++ QF K +LL+GP+
Sbjct  183   FLASKRNWEFGSGVLFYDRLYGGLSPSDAIGFKGCREIEGPYVDYLEEQFGKSVLLSGPI  242

Query  789   VPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLN  610
             +PEP + VL+ KW  WL +F+P +VI+C+ GSE  L  DQ +E  LGLELTGLPF  VL 
Sbjct  243   IPEPPNTVLEGKWGSWLERFKPDSVIFCALGSEWKLPHDQFQEFLLGLELTGLPFLAVLK  302

Query  609   FPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEG  430
              P   +    L  ALP GF ERV+ RGI+H GW+QQQ IL H SVGC++ H G  S+ E 
Sbjct  303   TPIGFET---LEAALPEGFKERVEERGIVHGGWIQQQLILEHPSVGCFITHCGAGSLTEA  359

Query  429   IVNDCQLVMLPQ-KGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE-  256
             +VN CQ+V+LPQ  GD  +NA+++ +++K GVEV + +EDG+F KE + KAV+ +M +E 
Sbjct  360   LVNKCQIVLLPQVDGDHIVNARMMGENLKIGVEVEKGEEDGWFTKESVSKAVKIVMDDEN  419

Query  255   --GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
               G   R N  K + FL+   ++S  +    + +RD+
Sbjct  420   EVGREVRTNHAKLRNFLVSHNLESACVDGFCQKLRDL  456



>ref|XP_010062847.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Eucalyptus grandis]
Length=461

 Score =   350 bits (897),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 190/461 (41%), Positives = 285/461 (62%), Gaps = 12/461 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
              H+ +FP+FA GH++PF+ LSN+L+  G KISFF     +  +++ LN +P      PL 
Sbjct  9     FHIAMFPWFAVGHVTPFLHLSNELAKRGHKISFFLPRKALILLEN-LNLHPNLITFHPLT  67

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P+V  LPPGT++ +D P + A  L VA++L + Q++  L  ++P F+ +D A +W+P +
Sbjct  68    VPSVATLPPGTETASDIPISDAPSLAVAMDLTRRQLEVSLQAMRPDFIFYDTA-HWIPQV  126

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
             A  LGI+T+ ++V  A A A   VPAR   P +  T EE+ KPP G+P  +V  LR  EA
Sbjct  127   ARPLGIRTVCYNVVSAAAIAIVLVPAREVTPGKPLTEEELGKPPVGYPSNTVV-LRGNEA  185

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             R  + I   P     + + R    +  C AI  +TC E+E     Y+ +Q+ KP+ L GP
Sbjct  186   RSLIFI-SLPFGDNITFHGRTTTAMRECDAIAMRTCREIEGDLCAYISNQYGKPVFLTGP  244

Query  792   VVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
             V+PEPA   LD+KWA+WLS+FEP +V++C+FGS+  L+  Q +EL  G E TGLPF + L
Sbjct  245   VLPEPAMETLDEKWAEWLSRFEPGSVVFCAFGSQHVLEKGQFQELLRGFESTGLPFLIAL  304

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
               P   +   E   A P GF ERV+GRG++H GWVQQ  IL H SVGC+V H GF S+ E
Sbjct  305   RPPIGTNSVEE---AFPEGFEERVRGRGVVHGGWVQQPLILSHPSVGCFVNHCGFGSMWE  361

Query  432   GIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE-  256
              ++ DCQ+VM+P   DQ LN +LLA+++K GVEV  R+E G+F KE + +A++++M E+ 
Sbjct  362   SLLGDCQIVMVPHLADQILNTRLLANELKVGVEV-EREESGWFSKESLCRAIESVMYEKS  420

Query  255   --GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
               G   + N  KW+E L+     + +I   ++ ++++   N
Sbjct  421   EVGLLVKKNHAKWREVLVSPNFMTGYINRFIQNLQELQMKN  461



>ref|XP_010035826.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Eucalyptus grandis]
 gb|KCW47284.1| hypothetical protein EUGRSUZ_K01076 [Eucalyptus grandis]
Length=457

 Score =   349 bits (895),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 191/450 (42%), Positives = 277/450 (62%), Gaps = 9/450 (2%)
 Frame = -3

Query  1521  GGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIV  1342
             G   LH+ ++P+ A GH++PF+ L+NKL+  G KISF        +++           V
Sbjct  2     GESRLHIAMYPWLAMGHLTPFLHLANKLAKKGHKISFLVPPRTQAKLEHFNRHPDLITFV  61

Query  1341  PLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWL  1162
             P+A+P VEGLPP  ++T+D P     L+  A++  +P +  LL  LKPH V+ DF  +WL
Sbjct  62    PIAIPHVEGLPPDAETTSDVPYPLHPLIMTAMDHTEPTVHQLLQTLKPHCVLHDFT-HWL  120

Query  1161  PPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRT  982
             P +A +LGIK++ + +   +  ++   P R     +    + M  PP G+P +S+  L  
Sbjct  121   PAIARDLGIKSVHYCIISPVTVSYTLSPVRHLSAHKLTEADYMV-PPAGYPNSSI-KLHL  178

Query  981   FEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLL  802
              EAR  + I  + +       DR+ AG      +  ++C E+E PYI+Y+KSQF KP+LL
Sbjct  179   HEARALIAIRYKTYGSNIGFSDRMFAGYVESDILSFRSCREIEQPYIEYLKSQFGKPVLL  238

Query  801   AGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFF  622
             +GPV+PEP++  LD+KW +WL  F+  +VIYC+FGSE  ++ DQ +EL LGLELTGLPF 
Sbjct  239   SGPVIPEPSTSGLDEKWVEWLGDFKDGSVIYCAFGSECTMQKDQFQELLLGLELTGLPFL  298

Query  621   LVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSS  442
               L  P      S +  ALP GF ERV+GRGI+H GWVQQQ IL H ++GC++ H G SS
Sbjct  299   AALKPPFGT---SSIEEALPEGFEERVQGRGIVHGGWVQQQLILQHPAIGCFITHCGTSS  355

Query  441   VIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMG  262
              IE +VN CQLV+LPQ GDQ  NA+++ +++K GVEV + +EDG   KE + KAV T+M 
Sbjct  356   TIEALVNKCQLVLLPQVGDQIFNARMMGNNLKVGVEVEKGEEDGRLTKESVCKAVNTVMD  415

Query  261   E---EGASTRANQEKWKEFLLDKEIQSKFI  181
             E    G   R N  K +E LLDK+++S ++
Sbjct  416   EGDAYGNEVRENHAKIREILLDKKLESTYM  445



>gb|KHN36711.1| UDP-glycosyltransferase 79B6 [Glycine soja]
Length=458

 Score =   348 bits (894),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 184/457 (40%), Positives = 271/457 (59%), Gaps = 10/457 (2%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             +H+ +FP+FA GH++P++ LSNKL+  G +ISFF       +++            P+ +
Sbjct  6     MHIAMFPWFAMGHLTPYLHLSNKLAKRGHRISFFIPKRTQHKLEQFNLFPHLITFYPINV  65

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P VEGLP G ++T+D   +   L+  A++  +  I+ LL+ELKP  V FDF   WLP L 
Sbjct  66    PHVEGLPHGAETTSDVSFSLGPLIMTAMDRTEKDIELLLIELKPQIVFFDFTY-WLPNLT  124

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
               LGIK+  + +      A+   P R+        V+ M+ PP G+P +S+  L   EA+
Sbjct  125   RRLGIKSFQYMIVSPATVAYNASPPRMQNSVNLTEVDLMQ-PPLGYPVSSI-KLHAHEAK  182

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
                         G   YDR+  GL+   AI  K C E+E PY+DY++ QF K +LL+GP+
Sbjct  183   FLASKRNWEFGSGVLFYDRLYGGLSLSDAIGFKGCREIEGPYVDYLEEQFGKSVLLSGPI  242

Query  789   VPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLN  610
             +PEP + VL+ +W  WL +F+P +VI+C+ GSE  L  DQ +E  LGLELTGLPF  VL 
Sbjct  243   IPEPPNTVLEGRWGSWLERFKPDSVIFCALGSEWKLPHDQFQEFLLGLELTGLPFLAVLK  302

Query  609   FPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEG  430
              P   +    L  ALP GF ERV+ RGI+H GW+QQQ IL H SVGC++ H G  S+ E 
Sbjct  303   TPIGFET---LEAALPEGFKERVEERGIVHGGWIQQQLILEHPSVGCFITHCGAGSLTEA  359

Query  429   IVNDCQLVMLPQ-KGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE-  256
             +VN CQ+V+LPQ  GD  +NA+++ +++K GVEV + +EDG+F KE + KAV+ +M +E 
Sbjct  360   LVNKCQIVLLPQVDGDHIVNARMMGENLKIGVEVEKGEEDGWFTKESVSKAVKIVMDDEN  419

Query  255   --GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
               G   R N  K + FL+   ++S  +    + +RD+
Sbjct  420   EVGREVRTNHAKLRNFLVSHNLESACVDGFCQKLRDL  456



>ref|XP_009628388.1| PREDICTED: LOW QUALITY PROTEIN: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Nicotiana tomentosiformis]
Length=458

 Score =   347 bits (891),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 194/460 (42%), Positives = 283/460 (62%), Gaps = 15/460 (3%)
 Frame = -3

Query  1530  NNHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSM-LNSNPC  1354
             +++   +LH+ +FP+FAFGH +PF+ L+N+L+  G +ISF        +++++ L+ N  
Sbjct  2     SDYNSKILHIAMFPWFAFGHFTPFLHLANELAKRGHQISFLLPKKAQFQLQNINLHPNLI  61

Query  1353  TQIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFA  1174
             T    L +P VEGLP GT + +D P      L + L+ M+ QIK+LL +LKPH V +DFA
Sbjct  62    T-FHSLTIPQVEGLPLGTXTASDVPIFLTCHLAMXLDQMRDQIKSLLAKLKPHIVFYDFA  120

Query  1173  QNWLPPLAAELGIKTIffsvfvalatafatVPARLPGPERSP-TVEEMKKPPPGFPPTSV  997
               W+P  A E+  KTI ++V  A + A   VP R   P  +P TVEEM KPP G+P ++V
Sbjct  121   Y-WIPDYAPEISYKTICYNVVCAASIAIMLVPVRKSCPSGAPPTVEEMMKPPKGYPSSAV  179

Query  996   ASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFK  817
               LR  E+R    +F   +  G + YDRV   L  C AI  +TC E   P  DY+ SQ+ 
Sbjct  180   V-LREHESRALSFMFHE-YGRGVTFYDRVTTALKKCDAISIRTC-ENXGPLCDYLSSQYN  236

Query  816   KPLLLAGPVVPEPASG-VLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLEL  640
             KP+ L GP++PEP S  +L+ KWA WL QF+P ++++C+FGS+  L+  Q +EL LG+EL
Sbjct  237   KPVFLTGPILPEPTSKELLEGKWATWLKQFKPGSILFCAFGSQMVLEKSQFQELVLGIEL  296

Query  639   TGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVC  460
             T  PF + L  P  V    E   ALP GF ER KGRGI++   V +  IL HSS+GC+V 
Sbjct  297   TDFPFLIALKPPLGVKTIEE---ALPEGFEERTKGRGIVYGDLVPKLXILSHSSIGCFVS  353

Query  459   HAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKA  280
             H GF S+ E ++++CQ+V++P  GDQ LN +LLAD++   VEV  RDE+G+F KE++ K 
Sbjct  354   HCGFGSMWESLMSECQIVLIPHLGDQILNTRLLADELNVAVEV-ERDENGWFTKENLCKV  412

Query  279   VQTIMGEE---GASTRANQEKWKEFLLDKEIQSKFIKDLV  169
             ++++M E    G   + N  KWKE L      S +I++ +
Sbjct  413   IRSVMNEGSELGYLVKKNHAKWKETLTRPGFMSGYIEEFM  452



>ref|XP_004248461.2| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Solanum lycopersicum]
Length=456

 Score =   347 bits (891),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 187/458 (41%), Positives = 276/458 (60%), Gaps = 17/458 (4%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             L  +++P++A GH++ F+ LSNKL+  G K+ F      + +++             + +
Sbjct  6     LTFIMYPWYAMGHLTSFLHLSNKLAHRGHKVFFVHPTNTLSKLEKFNRYPELINFKSVTV  65

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P V+GLP G ++T+D P     LL  AL+L  P+I++L+ E+KPHF+ +DFA  W+P +A
Sbjct  66    PHVDGLPLGAETTSDVPIFNQNLLCQALDLTLPKIESLIQEIKPHFIFYDFAY-WVPSVA  124

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
              + G+K++ +      +         L   E   +  EM +PPPGFP  S   L   EAR
Sbjct  125   RKYGVKSVHYCSITPSSV------GYLMRGENPTSEAEMMQPPPGFPVDSSIMLHKHEAR  178

Query  969   DFVIIFKRPHNGGA---SVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLA  799
               + +     N G+   S   R+L       AI  KT  E+E  Y ++V+ +FKKP++LA
Sbjct  179   LIIALHSMGKNSGSGSVSFTQRMLLAFQDGDAIAFKTTREIEGRYCEFVEHKFKKPVVLA  238

Query  798   GPVVPEPA-SGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFF  622
             GPV+PEP  +   ++ W+ WL +F+  TVI C+FGSE  LK DQ +EL LGLELTG PFF
Sbjct  239   GPVLPEPMETSNTEENWSKWLEKFQEKTVILCAFGSECKLKRDQFQELVLGLELTGYPFF  298

Query  621   LVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSS  442
               L  P   D   E   ALP GF ER +G+GI+HSGW +QQ +L H SVGC+V H G +S
Sbjct  299   AALKPPIEADTIEE---ALPEGFKERTQGKGIVHSGWAEQQLMLSHPSVGCFVTHCGGNS  355

Query  441   VIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMG  262
             + E ++N+CQLV++P  GDQF+N++L   D+KAGVEV R +E+G F K+ + KA++ +M 
Sbjct  356   LSEALINECQLVLVPNFGDQFINSRLFGGDLKAGVEVERNEENGSFTKDGVCKAIKMVMN  415

Query  261   ---EEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMR  157
                EEG   RAN+ KWKEFLL K ++  +I  LV+ ++
Sbjct  416   DESEEGRKIRANRAKWKEFLLSKGLEDSYIDGLVQKLQ  453



>gb|AES89730.2| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=462

 Score =   347 bits (891),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 181/458 (40%), Positives = 278/458 (61%), Gaps = 12/458 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ ++P+FA GH +PF+ L+NKL+  G KI+FF+      +++           + + +
Sbjct  7     LHIAMYPWFAMGHQTPFLHLANKLAKKGHKITFFTPKSAQSKLEPFNLYPQLITFITIKV  66

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P VEGLP   ++TAD P      +  A++L QP I+  L  LKP  V +DF   W+P L 
Sbjct  67    PHVEGLPLNAETTADVPYPLHPHIMTAMDLTQPDIETHLTNLKPQIVFYDFTH-WIPSLT  125

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
               L IK   + +  ++   +   P+R     +  T  ++ +PP G+P +S+  L + EA+
Sbjct  126   KRLDIKAFHYCIISSIMIGYTLAPSRY-SKGKDLTEFDLMQPPSGYPGSSI-KLHSHEAK  183

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
              F  + K  +      YDR    LN   A+  KTC E+E PY+DY++ QF KP+L +GPV
Sbjct  184   AFAAMRKNTYGSNVLFYDRQAIALNEADALGYKTCREIEGPYLDYIQKQFNKPVLTSGPV  243

Query  789   VP--EPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
             +P  E ++ VLD+ WA WL +F+  +V+YC FGSE  LK +  +EL LGLELTG+PFF  
Sbjct  244   LPILENSNYVLDENWATWLGRFKTDSVVYCCFGSECVLKPNTFQELMLGLELTGMPFFAA  303

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             L  P   +   E   ALP GF+ERV+GRG+++ GWVQQQ IL H SVGC++ H G  S+ 
Sbjct  304   LKPPFGFETIEE---ALPEGFSERVEGRGVVYGGWVQQQLILEHPSVGCFITHCGSGSLS  360

Query  435   EGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE  256
             E +VN CQLV+LP  GDQ LNA+++ +++K GVEV  + EDG++ K+++ KAV  +M +E
Sbjct  361   EALVNKCQLVLLPNVGDQILNARMMGNNLKVGVEV-EKGEDGFYTKDNVCKAVSIVMNDE  419

Query  255   ---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                  + R+N  K +E LL+K+++S +I +    ++++
Sbjct  420   DEISKTVRSNHTKIREMLLNKDLESSYIDNFCMKLQEI  457



>ref|XP_003530810.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
Length=466

 Score =   347 bits (889),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 196/453 (43%), Positives = 271/453 (60%), Gaps = 14/453 (3%)
 Frame = -3

Query  1515  DLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVP  1339
              L HV ++P+FA GH++ F+ +SNKL+  G KISF      + R+ S  N +P     VP
Sbjct  7     SLFHVAMYPWFALGHLTSFLHISNKLAERGHKISFLMPKNTIPRL-SHFNLHPHLIFFVP  65

Query  1338  LALPAVEGLPPGTQSTADFppaaaellpvalnLM-QPQIKALLVELKPHFVIFDFAQNWL  1162
             + +P V+GLP G+++T+D P  +   L +    + +P I+  L  LKPH V FDF  +WL
Sbjct  66    ITVPHVDGLPLGSETTSDLPNYSKHSLLMTAMDLTEPVIETCLKHLKPHMVFFDFT-HWL  124

Query  1161  PPLAAELGIKTIffsvfvalatafatVPAR-LPGPERSPTVEEMKKPPPGFPPTSVASLR  985
             P LA +LGIK + +         +   P R L   + S T  ++  PPP FPP+S   L 
Sbjct  125   PALACKLGIKALHYCTISPATVGYLISPERKLLLEKNSLTEADLINPPPSFPPSSTIRLH  184

Query  984   TFEARDFVII-FKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPL  808
               EAR+      K   NGG S  +R L     C A++ KTC EME PY DY++ Q +K +
Sbjct  185   PHEARELATAAVKNYGNGGISFVERQLISFASCHAVVFKTCREMEGPYCDYLERQMRKQV  244

Query  807   LLAGPVVPE-PASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGL  631
              LAGPV+P+ P    L++KW  WL  F+P TVI+C+FGSE FLK DQ KEL LG ELTG+
Sbjct  245   FLAGPVLPDTPLRSKLEEKWVTWLGSFKPKTVIFCAFGSECFLKSDQFKELLLGFELTGM  304

Query  630   PFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAG  451
             PF   L  P     A  +  ALP GF ER KGRG++H  WVQQ  IL H SVGC+V H G
Sbjct  305   PFLAALKPPIG---AEAIESALPEGFNERTKGRGVVHGDWVQQLLILSHPSVGCFVTHCG  361

Query  450   FSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQT  271
               S+ E +VN+CQLV+LP  GDQF+NA++++ D+K GVEV  + EDG F +E + K ++ 
Sbjct  362   SGSLTEAMVNECQLVLLPHAGDQFINARIMSGDLKVGVEV-EKSEDGLFTREAVCKVLRA  420

Query  270   IM---GEEGASTRANQEKWKEFLLDKEIQSKFI  181
             +M    E G   R N  KW++FL  K +++ ++
Sbjct  421   VMDSDSEVGQMVRTNHAKWRKFLFSKGLENSYV  453



>ref|XP_002316802.1| glycosyltransferase family protein [Populus trichocarpa]
 gb|EEE97414.1| glycosyltransferase family protein [Populus trichocarpa]
Length=463

 Score =   346 bits (887),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 184/457 (40%), Positives = 279/457 (61%), Gaps = 10/457 (2%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
               +++FP+FA GH++PF+ LSNKL+  G  ISF      +  ++            P+ +
Sbjct  11    FRILMFPWFAVGHLTPFLHLSNKLAEKGCTISFLLPNKAIKLLQHFNLYPDHITFHPVKV  70

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P VEGLP GT++ +D P      L VA++  + Q++ ++ + KP FV++D A  W+P +A
Sbjct  71    PHVEGLPLGTETASDIPIHLTHFLCVAMDRTRDQVEKIIRDQKPDFVMYDMAY-WIPEVA  129

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
               LGIKTI +SV  A A A   VPAR     ++ T  E+  PP G+P TSV  LR  E R
Sbjct  130   RPLGIKTIKYSVVSAAAIAIVLVPARNVVEGKAITAAELSVPPTGYPSTSVV-LRGHEVR  188

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
               + +  +P+  G + Y+R   G+ GC AI  ++CYEME    DY+  Q+ KP+ L GPV
Sbjct  189   SLLFV-SQPYGEGTTFYERACTGMKGCDAIAIRSCYEMEEKLCDYIGRQYGKPVFLTGPV  247

Query  789   VPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLN  610
             +PE A   L+ +WA WL++FE  +V++CSFGS+  L+ +Q++EL LG E TGLPF +VL 
Sbjct  248   LPESARTPLEDRWAQWLNRFEAGSVVFCSFGSQLILEKEQLQELVLGFESTGLPFLVVLK  307

Query  609   FPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEG  430
              P     +S +  ALP GF ERVKGRG++  GWVQQ +IL H S+GC+V   GF S+ E 
Sbjct  308   PPVG---SSTIEEALPEGFEERVKGRGVVWGGWVQQLEILDHPSIGCFVNTCGFGSMWES  364

Query  429   IVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM---GE  259
             +++DCQ+V++P  GDQ LN +L+A+++K  VEV  RDE G+F KE++  A++ +M    E
Sbjct  365   LMSDCQIVLVPHLGDQILNTRLMAEELKVAVEVE-RDEKGWFTKENLSNAIKCVMDKDSE  423

Query  258   EGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
              G+  + N  +W++ L  +   S +     + M+++ 
Sbjct  424   VGSMIKKNHTEWRKLLRSEGFMSSYFDKFFQNMQELV  460



>gb|KCW69983.1| hypothetical protein EUGRSUZ_F03293, partial [Eucalyptus grandis]
Length=448

 Score =   345 bits (884),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 189/448 (42%), Positives = 278/448 (62%), Gaps = 12/448 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
              H+ +FP+FA GH++PF+ LSN+L+  G KISFF     +  +++ LN +P      PL 
Sbjct  9     FHIAMFPWFAVGHVTPFLHLSNELAKRGHKISFFLPRKALILLEN-LNLHPNLITFHPLT  67

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P+V  LPPGT++ +D P + A  L VA++L + Q++  L  ++P F+ +D A +W+P +
Sbjct  68    VPSVATLPPGTETASDIPISDAPSLAVAMDLTRRQLEVSLQAMRPDFIFYDTA-HWIPQV  126

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
             A  LGI+T+ ++V  A A A   VPAR   P +  T EE+ KPP G+P  +V  LR  EA
Sbjct  127   ARPLGIRTVCYNVVSAAAIAIVLVPAREVTPGKPLTEEELGKPPVGYPSNTVV-LRGNEA  185

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             R  + I   P     + + R    +  C AI  +TC E+E     Y+ +Q+ KP+ L GP
Sbjct  186   RSLIFI-SLPFGDNITFHGRTTTAMRECDAIAMRTCREIEGDLCAYISNQYGKPVFLTGP  244

Query  792   VVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
             V+PEPA   LD+KWA+WLS+FEP +V++C+FGS+  L+  Q +EL  G E TGLPF + L
Sbjct  245   VLPEPAMETLDEKWAEWLSRFEPGSVVFCAFGSQHVLEKGQFQELLRGFESTGLPFLIAL  304

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
               P   +   E   A P GF ERV+GRG++H GWVQQ  IL H SVGC+V H GF S+ E
Sbjct  305   RPPIGTNSVEE---AFPEGFEERVRGRGVVHGGWVQQPLILSHPSVGCFVNHCGFGSMWE  361

Query  432   GIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE-  256
              ++ DCQ+VM+P   DQ LN +LLA+++K GVEV  R+E G+F KE + +A++++M E+ 
Sbjct  362   SLLGDCQIVMVPHLADQILNTRLLANELKVGVEV-EREESGWFSKESLCRAIESVMYEKS  420

Query  255   --GASTRANQEKWKEFLLDKEIQSKFIK  178
               G   + N  KW+E L+     + +I 
Sbjct  421   EVGLLVKKNHAKWREVLVSPNFMTGYIN  448



>ref|XP_010041982.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Eucalyptus grandis]
Length=461

 Score =   345 bits (884),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 187/461 (41%), Positives = 284/461 (62%), Gaps = 12/461 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
              H+ +FP+FA GHI+P++ LSN+L+  G KISFF     +  +++ LN +P      PL 
Sbjct  9     FHMAMFPWFAVGHITPYLHLSNELAKRGHKISFFLPRKALILLEN-LNLHPNLITFHPLT  67

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P+V  LPPGT++ +D P + +  L  A++L +PQ++  L  ++P F+ +D A +W+P +
Sbjct  68    VPSVATLPPGTETASDIPFSDSPFLAAAMDLTRPQLEVSLQAMRPDFIFYDLA-HWIPQV  126

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
             A  LGI+T+ ++V  A A A   VPAR     +  T EE++KPP G+P  +V  LR  EA
Sbjct  127   ARPLGIRTVCYNVVSAAAIAIVLVPAREVTQGKPCTEEELEKPPRGYPSKTVV-LRGSEA  185

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             R  + I   P     + + R    +  C AI  +TC E+E  +  Y+ SQ+ K + L GP
Sbjct  186   RSLIFI-SLPSGDNITFHGRGTTAMRECDAIALRTCQEIERDFCAYISSQYGKAVFLTGP  244

Query  792   VVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
             V+PEP   +LD+KWA+WL QF+P +V++C+FGS+  L+  Q +EL LG E TGLPF + L
Sbjct  245   VLPEPDMKMLDEKWAEWLGQFKPGSVVFCAFGSQHVLEKGQFQELLLGFETTGLPFLVAL  304

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
               P   +   E   A P GF ERV+GRG++H GWVQQ  IL H SVGC+V H GF S+ E
Sbjct  305   RPPIGTNSVEE---AFPKGFEERVRGRGVVHGGWVQQPLILSHPSVGCFVNHCGFGSMWE  361

Query  432   GIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE-  256
              ++ DCQ+VM+P   DQ L+ +LLAD++K GVEV  R+E G+F KE   +A++++M EE 
Sbjct  362   SLLGDCQIVMVPHLPDQILHTRLLADELKVGVEVE-REESGWFSKESFCRAIESVMDEES  420

Query  255   --GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
               G   + N  KW++ L+     + +I   ++ ++++   N
Sbjct  421   EVGLLVKKNHAKWRKVLVSPNFMTDYIDRFIQNLQELQMKN  461



>ref|XP_010062848.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Eucalyptus grandis]
Length=461

 Score =   344 bits (883),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 184/461 (40%), Positives = 284/461 (62%), Gaps = 12/461 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
              H+ +FP+FA GHI+P++ LSN+L+  G KISFF     +  +++ LN +P      PL 
Sbjct  9     FHMAMFPWFAVGHITPYLHLSNELAKRGHKISFFLPRKALILLEN-LNLHPNLITFHPLT  67

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P+V  LPPGT++ +D   + +  L  A++L +PQ++  L  ++P F+ +D+A +W+P +
Sbjct  68    VPSVATLPPGTETASDITFSDSPFLAAAMDLTRPQLEVSLQAMQPDFIFYDYA-HWIPQV  126

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
             A  LGI+T+ ++V  A A A   VP R     +  T EE++KPP G+P  +V  LR  EA
Sbjct  127   ARPLGIRTVCYNVISAAAIAMVLVPVREVTQGKPCTEEELEKPPNGYPSKTVV-LRGSEA  185

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             R  + I         + Y R    +  C AI  +TC E+E  +  Y+ SQ+ KP+ L GP
Sbjct  186   RPLIFI-SLLSGDNITFYGRGTTAMRECDAIALRTCQEIERDFCAYISSQYGKPVFLTGP  244

Query  792   VVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
             V+P+P   +LD+KWA+WL QF+P +V++C+FGS+  L+  Q +EL  G E TGLPFF+ L
Sbjct  245   VLPKPDMKLLDEKWAEWLGQFKPGSVVFCAFGSQHVLEKGQFQELLRGFESTGLPFFIAL  304

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
               P   +   E   A P GF ERV+GRG++H GWVQQ  IL H SVGC+V H GF S+ E
Sbjct  305   RPPIGTNSVEE---AFPEGFEERVRGRGVVHGGWVQQPLILSHPSVGCFVNHCGFGSMWE  361

Query  432   GIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE-  256
              ++ DCQ+VM+P   DQ LN +LLA+++K G+EV  R+E G+F KE + +A++++M E+ 
Sbjct  362   SLLGDCQIVMVPHLADQILNTRLLANELKVGIEVE-REESGWFSKESLCRAIESVMDEKS  420

Query  255   --GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
               G   + N  KW+E L+     + +I   ++ ++++   N
Sbjct  421   EVGLLVKKNHAKWREVLVSPNFMTGYIDRFIQNLQELHMKN  461



>gb|EYU41034.1| hypothetical protein MIMGU_mgv1a006102mg [Erythranthe guttata]
Length=457

 Score =   343 bits (880),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 186/453 (41%), Positives = 271/453 (60%), Gaps = 13/453 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPC-TQIVPLA  1333
             LH+ +FP+ A GH++PF+ + N+L+  G  +S       + ++    +          + 
Sbjct  8     LHIAMFPWIAMGHVTPFLHVGNELAKRGHTVSLLLPKKALLKLGHAADPGGSPVNFHTVK  67

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVE-LKPHFVIFDFAQNWLPP  1156
             +P V GLP G ++ +D        L +A + M P+++ALL + +KP  V +DFA +W+P 
Sbjct  68    VPHVAGLPAGAETCSDIDITENNFLAMAFDAMSPEVEALLRDTIKPDVVFYDFA-HWIPD  126

Query  1155  LAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFE  976
             LA+ +G KT+ + +  A   A+  VPAR    +R  T EE+  PPPG+P ++V  LR  E
Sbjct  127   LASRVGFKTVCYQIVSASCMAYGVVPARTIPKDRQLTAEELAAPPPGYPSSTVV-LRRHE  185

Query  975   ARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
                 ++ F     G     +R+ A L+GC AI  +TC EME P  DY+  Q+KKP+ L+G
Sbjct  186   G--MIMSFIGRDYGDIRFDERMAAALSGCDAIGIRTCAEMEGPMCDYLSEQYKKPVFLSG  243

Query  795   PVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
             PV+PE   G L++KW  WL++F P +V+YC+FGS+  LK +Q  E+ LG E+TGLPFF+ 
Sbjct  244   PVLPEVPEGPLEEKWDTWLNKFPPKSVVYCAFGSQVILKKEQFTEMVLGFEMTGLPFFIA  303

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
                P  V+   E   ALP GF ERV GRG++H GWVQQ QIL H SVGC+V H GF S+ 
Sbjct  304   AAKPHGVEKVEE---ALPEGFMERVAGRGVVHCGWVQQTQILSHDSVGCFVSHCGFGSMC  360

Query  435   EGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM---  265
             E +++DCQ+V++P+ GDQ LNA+LL  +MK  VEV  R E G+F KED+  AV+T+M   
Sbjct  361   ESLMSDCQIVLVPRFGDQVLNARLLTAEMKVAVEV-ERGEMGWFSKEDLCNAVKTVMDVG  419

Query  264   GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVK  166
              E G   R N   WKE L+       +I + V+
Sbjct  420   SEVGDLVRRNHATWKETLVKPGFMDNYIDNFVQ  452



>ref|XP_003607533.1| Glucosyltransferase [Medicago truncatula]
Length=552

 Score =   345 bits (886),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 181/451 (40%), Positives = 274/451 (61%), Gaps = 12/451 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ ++P+FA GH +PF+ L+NKL+  G KI+FF+      +++           + + +
Sbjct  7     LHIAMYPWFAMGHQTPFLHLANKLAKKGHKITFFTPKSAQSKLEPFNLYPQLITFITIKV  66

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P VEGLP   ++TAD P      +  A++L QP I+  L  LKP  V +DF   W+P L 
Sbjct  67    PHVEGLPLNAETTADVPYPLHPHIMTAMDLTQPDIETHLTNLKPQIVFYDFTH-WIPSLT  125

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
               L IK   + +  ++   +   P+R     +  T  ++ +PP G+P +S+  L + EA+
Sbjct  126   KRLDIKAFHYCIISSIMIGYTLAPSRY-SKGKDLTEFDLMQPPSGYPGSSI-KLHSHEAK  183

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
              F  + K  +      YDR    LN   A+  KTC E+E PY+DY++ QF KP+L +GPV
Sbjct  184   AFAAMRKNTYGSNVLFYDRQAIALNEADALGYKTCREIEGPYLDYIQKQFNKPVLTSGPV  243

Query  789   VP--EPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
             +P  E ++ VLD+ WA WL +F+  +V+YC FGSE  LK +  +EL LGLELTG+PFF  
Sbjct  244   LPILENSNYVLDENWATWLGRFKTDSVVYCCFGSECVLKPNTFQELMLGLELTGMPFFAA  303

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             L  P   +   E   ALP GF+ERV+GRG+++ GWVQQQ IL H SVGC++ H G  S+ 
Sbjct  304   LKPPFGFETIEE---ALPEGFSERVEGRGVVYGGWVQQQLILEHPSVGCFITHCGSGSLS  360

Query  435   EGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE  256
             E +VN CQLV+LP  GDQ LNA+++ +++K GVEV  + EDG++ K+++ KAV  +M +E
Sbjct  361   EALVNKCQLVLLPNVGDQILNARMMGNNLKVGVEV-EKGEDGFYTKDNVCKAVSIVMNDE  419

Query  255   ---GASTRANQEKWKEFLLDKEIQSKFIKDL  172
                  + R+N  K +E LL+K+++S +I + 
Sbjct  420   DEISKTVRSNHTKIREMLLNKDLESSYIDNF  450



>ref|XP_010245594.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Nelumbo nucifera]
Length=461

 Score =   342 bits (876),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 198/460 (43%), Positives = 286/460 (62%), Gaps = 22/460 (5%)
 Frame = -3

Query  1497  IFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLALPAVE  1318
             ++P+FA GHI PF+ LSNKL+ +G ++SF        +++ +       + +P+A+P V+
Sbjct  1     MYPWFAIGHIVPFLHLSNKLAENGHRVSFLLPPKTQSKLQHLNRYPDLIRFIPIAIPPVD  60

Query  1317  GLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLAAELG  1138
             GLPP  ++TAD       LL  A+NL + Q++A L  +KP FV FDF+  WLPPLA +LG
Sbjct  61    GLPPTAETTADVSRPIMPLLVDAMNLTKDQVEAALRNIKPDFVFFDFSY-WLPPLARQLG  119

Query  1137  IKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEARDFVI  958
             IK+I + V    +T++  VPAR P      T EE+ +PPPG+PP S   L   E+R  + 
Sbjct  120   IKSILYCVISPASTSYLLVPARKPDGIEQLTEEELMQPPPGYPPDSPIRLCRHESRSLLF  179

Query  957   IFKRPHNG--GASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPVVP  784
              F++      G + YDR    +  C A+  +T  EME PY DY+ SQ+ KP+LL GP++P
Sbjct  180   AFQKFSRTATGLTFYDRQTTSMRECDALCFRTYREMEGPYCDYMGSQYGKPVLLTGPILP  239

Query  783   EP--ASGVLD--QKWADW-----LSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGL  631
             E   ++ VLD  + W  W     L  F+  +V+YC+FGSE     ++++EL LGLELTGL
Sbjct  240   EKEKSTTVLDDDEHWCTWSSKWRLGNFKAGSVVYCAFGSECVFTKEKVQELVLGLELTGL  299

Query  630   PFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAG  451
             PF + L  P     A  +  ALP GF ERV+GRG+++ GWV QQQIL H SVGC+V H G
Sbjct  300   PFLVALKPPHG---AWTVEEALPDGFRERVEGRGVVYGGWVPQQQILSHLSVGCFVSHCG  356

Query  450   FSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQT  271
             + S+ E +V++CQ+V+LP  GDQ  NAKLLA  MK  VEV RR++DG+F +E + +AV+ 
Sbjct  357   YGSMWESLVSNCQMVLLPNYGDQIKNAKLLARGMKVAVEVERREDDGWFTRESVCRAVKL  416

Query  270   IMGEE---GASTRANQEKWKEFLLDKEIQSK----FIKDL  172
             +M ++   G   +AN  KW+ FLL++ +Q      FI+DL
Sbjct  417   VMDDDSHIGRQVKANHAKWRSFLLEESLQRSYTDAFIRDL  456



>ref|XP_006377437.1| hypothetical protein POPTR_0011s05910g [Populus trichocarpa]
 gb|ERP55234.1| hypothetical protein POPTR_0011s05910g [Populus trichocarpa]
Length=446

 Score =   340 bits (873),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 194/452 (43%), Positives = 275/452 (61%), Gaps = 11/452 (2%)
 Frame = -3

Query  1497  IFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLALPAVE  1318
             ++P+FA GH++ FV  SNKL+  G ++SFF       + +           +P+ +P V+
Sbjct  1     MYPWFALGHLTAFVHFSNKLAERGHRVSFFLPKKTQSKFEPFNLHPDLITFIPITVPHVD  60

Query  1317  GLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLAAELG  1138
             GLP GT++T D P     LL  A++L +  IK  L  L PHF+ FDF  +WLP L+ + G
Sbjct  61    GLPTGTETTTDVPFPLHPLLMTAMDLTEHVIKDHLRILNPHFIFFDFT-HWLPELSRKHG  119

Query  1137  IKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEARDFVI  958
             IK++ F +       +   P R      S T  ++ +PPP FPP+S+  LR  EAR    
Sbjct  120   IKSVHFCIISPATIGYMLSPER---KLESLTAADLMQPPPSFPPSSI-KLRAHEARGICA  175

Query  957   IFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPVVPEP  778
             +  +      S  +R +  L+ C AI  K C EME PY DY++ QF KP++LAGP+VPEP
Sbjct  176   VTVKQFGSNISFQERNIYSLSQCDAIAFKACREMEGPYSDYIEDQFGKPVILAGPIVPEP  235

Query  777   ASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLNFPAN  598
              + VL++K A  L  F+  T+++C+FGSE  LK DQ +EL LGLELT LPFF VL  P  
Sbjct  236   PNSVLEEKIAKMLDSFKAETLVFCAFGSECILKKDQFQELVLGLELTSLPFFAVLKPPIG  295

Query  597   VDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEGIVND  418
                A  +  ALP GF ERVKGRG++++GWVQQQ IL H SVGC+V H G  S+ EG+VN 
Sbjct  296   ---AETIESALPEGFEERVKGRGLVYTGWVQQQLILRHPSVGCFVTHCGSGSLSEGMVNK  352

Query  417   CQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM---GEEGAS  247
             CQLV+LP  GDQ +NA+++  D+K GVEV + +EDG F +  + +AV+ +M    E G  
Sbjct  353   CQLVLLPNVGDQIINARVVGGDLKVGVEVKKGEEDGLFTRHGVCEAVKAVMDDDSEVGKL  412

Query  246   TRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
              RAN  KW+EFLL KE+++ ++   V  + ++
Sbjct  413   VRANHAKWREFLLGKELENSYVDGFVHKLHEL  444



>gb|ABL74480.1| glucosyltransferase [Ipomoea batatas]
Length=459

 Score =   341 bits (874),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 181/456 (40%), Positives = 280/456 (61%), Gaps = 11/456 (2%)
 Frame = -3

Query  1506  HVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLAL  1330
             H+ ++P+F  GH++ F +L+NKL+  G +ISF        ++ S  N +P     VP+ +
Sbjct  9     HMAMYPWFGVGHLTAFFRLANKLASKGHRISFLIPKNTQSKLAS-FNLHPHLVSFVPITV  67

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P++ GLPPG ++T+D P ++  LL  A++  Q  I+ +L  L+   V FDF  +WLP LA
Sbjct  68    PSIPGLPPGAETTSDVPFSSTHLLMEAMDKTQTDIEIILKNLEVDVVFFDFT-HWLPGLA  126

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
              ++GIK++F+S    L   FA  P R    ++  T  +M K P  FP  S+  L   EAR
Sbjct  127   RKIGIKSVFYSTISPLMHGFALSPERRVAGKQL-TEADMMKAPASFPDPSI-KLHAHEAR  184

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
              F         G  + +DR+   ++    +   TC E+E  + DY+++QFKKP+LLAGP 
Sbjct  185   GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFKKPVLLAGPA  244

Query  789   VPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLN  610
             +P P+   ++QKW+DWL +F+  +VIYC+FGSE  L+ +Q +EL  GLELTG+PFF  L 
Sbjct  245   LPVPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKEQFQELLWGLELTGMPFFAALK  304

Query  609   FPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEG  430
              P   D    +  A+P    E++ G+GI+H GWVQQQ  L H SVGC+V H G++S+ E 
Sbjct  305   APFGTD---SIEAAIPEELREKIHGKGIVHGGWVQQQLFLQHPSVGCFVSHCGWASLSEA  361

Query  429   IVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE--  256
             +VNDCQ+V+LPQ GDQ +NA++++  +K GVEV + +EDG F +E + KAV+ +M E+  
Sbjct  362   LVNDCQIVLLPQVGDQIINARIMSVSLKVGVEVEKGEEDGVFSRESVCKAVKAVMDEKSE  421

Query  255   -GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
              G   R N +K + FLL+ ++ SK++    + ++D+
Sbjct  422   IGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQDL  457



>gb|KCW69984.1| hypothetical protein EUGRSUZ_F03295 [Eucalyptus grandis]
Length=449

 Score =   340 bits (873),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 183/457 (40%), Positives = 282/457 (62%), Gaps = 12/457 (3%)
 Frame = -3

Query  1497  IFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLALPAV  1321
             +FP+FA GHI+P++ LSN+L+  G KISFF     +  +++ LN +P      PL +P+V
Sbjct  1     MFPWFAVGHITPYLHLSNELAKRGHKISFFLPRKALILLEN-LNLHPNLITFHPLTVPSV  59

Query  1320  EGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLAAEL  1141
               LPPGT++ +D   + +  L  A++L +PQ++  L  ++P F+ +D+A +W+P +A  L
Sbjct  60    ATLPPGTETASDITFSDSPFLAAAMDLTRPQLEVSLQAMQPDFIFYDYA-HWIPQVARPL  118

Query  1140  GIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEARDFV  961
             GI+T+ ++V  A A A   VP R     +  T EE++KPP G+P  +V  LR  EAR  +
Sbjct  119   GIRTVCYNVISAAAIAMVLVPVREVTQGKPCTEEELEKPPNGYPSKTVV-LRGSEARPLI  177

Query  960   IIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPVVPE  781
              I         + Y R    +  C AI  +TC E+E  +  Y+ SQ+ KP+ L GPV+P+
Sbjct  178   FI-SLLSGDNITFYGRGTTAMRECDAIALRTCQEIERDFCAYISSQYGKPVFLTGPVLPK  236

Query  780   PASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLNFPA  601
             P   +LD+KWA+WL QF+P +V++C+FGS+  L+  Q +EL  G E TGLPFF+ L  P 
Sbjct  237   PDMKLLDEKWAEWLGQFKPGSVVFCAFGSQHVLEKGQFQELLRGFESTGLPFFIALRPPI  296

Query  600   NVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEGIVN  421
               +   E   A P GF ERV+GRG++H GWVQQ  IL H SVGC+V H GF S+ E ++ 
Sbjct  297   GTNSVEE---AFPEGFEERVRGRGVVHGGWVQQPLILSHPSVGCFVNHCGFGSMWESLLG  353

Query  420   DCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE---GA  250
             DCQ+VM+P   DQ LN +LLA+++K G+EV  R+E G+F KE + +A++++M E+   G 
Sbjct  354   DCQIVMVPHLADQILNTRLLANELKVGIEVE-REESGWFSKESLCRAIESVMDEKSEVGL  412

Query  249   STRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
               + N  KW+E L+     + +I   ++ ++++   N
Sbjct  413   LVKKNHAKWREVLVSPNFMTGYIDRFIQNLQELHMKN  449



>ref|XP_011008292.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Populus euphratica]
Length=463

 Score =   340 bits (873),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 183/457 (40%), Positives = 279/457 (61%), Gaps = 10/457 (2%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
               +++FP+FA GH++PF+ LSNKL+  G  ISF      +  ++            P+ +
Sbjct  11    FRILMFPWFAVGHLTPFLHLSNKLAEKGCTISFLLPNKAIKLLQHFNLYPDHITFHPVQV  70

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P VEGLP GT++ +D P      L VA++  + Q++ ++ + KP FV++D A  W+P +A
Sbjct  71    PHVEGLPLGTETASDIPIYLTHFLCVAMDRTRDQVEKIIRDQKPDFVMYDMAY-WIPEVA  129

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
               LGIKTI +SV  A A A   VPAR     +  T  E+  PP G+P TSV  LR  E R
Sbjct  130   RPLGIKTIKYSVVSAAAIAIVLVPARNVVEGKPITAAELSVPPTGYPSTSVV-LRGHEVR  188

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
               + +  +P+    + Y+R   G+ GC AI  +TC+EME    DY+  Q++KP+ L GPV
Sbjct  189   SLLFV-SQPYGERITFYERACTGMKGCDAIAIRTCHEMEEKLCDYIGRQYEKPVFLTGPV  247

Query  789   VPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLN  610
             +PE A   L+ +WA WL+ FE  +V++CSFGS+  L+ +Q++EL LG E TGLPF +VL 
Sbjct  248   LPESARTPLEDRWAQWLNGFEAGSVVFCSFGSQFILEKEQLQELVLGFESTGLPFIVVLK  307

Query  609   FPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEG  430
              P     +S +  ALP GF ERVKGRG++  GWVQQ +IL H S+GC+V   GF S+ E 
Sbjct  308   PPVG---SSTIEEALPEGFEERVKGRGVVWGGWVQQLEILDHPSIGCFVNTCGFGSMWES  364

Query  429   IVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE--  256
             +++DCQ+V++P  GDQ LN +L+A+++K  VEV  RDE G+F KE++  A++ +M ++  
Sbjct  365   LMSDCQIVLVPHLGDQILNTRLMAEELKVAVEVE-RDEKGWFTKENLSNAIKCVMDKDSK  423

Query  255   -GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
              G+  + N  +W++ L  +   S +I    + M+++ 
Sbjct  424   VGSMIKKNHTEWRKLLRSEGFMSSYIDKFFQNMQELV  460



>ref|XP_003526249.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
Length=459

 Score =   340 bits (872),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 182/460 (40%), Positives = 278/460 (60%), Gaps = 17/460 (4%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSM-LNSNPCTQIVPLA  1333
             LH+ ++P+ A GH + F+ L NKL++ G KISF +      +++   L+ N  T  V + 
Sbjct  6     LHIAMYPWLAMGHQTAFLHLCNKLAIRGHKISFITPPKAQAKLEPFNLHPNSIT-FVTIN  64

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P VEGLPP  Q+TAD        +  A++L +  I+ LL  LKP  V +DF  +W+P L
Sbjct  65    VPHVEGLPPDAQTTADVTYPLQPQIMTAMDLTKDDIETLLTGLKPDLVFYDFT-HWMPAL  123

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVE-EMKKPPPGFPPTSVASLRTFE  976
             A  LGIK + +    ++   +   P+R    + +  +E ++ +PP G+P +S+  L+T E
Sbjct  124   AKRLGIKAVHYCTASSVMVGYTLTPSRFH--QGTDLMESDLMEPPEGYPDSSI-KLQTHE  180

Query  975   ARDFVIIFKRPHNGGASV--YDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLL  802
             AR F    KR    G++V  YDR    LN    +  +TC E+E PY+DY+  QF KP++ 
Sbjct  181   ARTFAA--KRKDTFGSNVLFYDRQFIALNEADLLAYRTCREIEGPYMDYIGKQFNKPVVA  238

Query  801   AGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFF  622
              GPV+ +P +  L++K++ WL  FEP +V+YC FGSE  L+ +Q  EL LGLELTG+PF 
Sbjct  239   TGPVILDPPTLDLEEKFSTWLGGFEPGSVVYCCFGSECTLRPNQFLELVLGLELTGMPFL  298

Query  621   LVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSS  442
               +  P   +    +  A+P GF ERVKGRG ++ GWVQQQ IL H SVGC++ H G  S
Sbjct  299   AAVKAPLGFET---VESAMPEGFQERVKGRGFVYGGWVQQQLILAHPSVGCFITHCGSGS  355

Query  441   VIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMG  262
             + E +VN CQLV+LP  GDQ LNA+++  +++ GVEV + DEDG + KE + KAV  +M 
Sbjct  356   LSEALVNKCQLVLLPNVGDQILNARMMGTNLEVGVEVEKGDEDGMYTKESVCKAVSIVMD  415

Query  261   EEGAST---RANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
              E  ++   RAN  + +E LL+K+++S ++      ++++
Sbjct  416   CENETSKRVRANHARIRELLLNKDLESSYVDSFCMRLQEI  455



>ref|XP_011082711.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
isoform X1 [Sesamum indicum]
 ref|XP_011082712.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
isoform X2 [Sesamum indicum]
Length=457

 Score =   340 bits (871),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 182/457 (40%), Positives = 277/457 (61%), Gaps = 13/457 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ +FP+ A GHI+PF+ L+N+L+  G  IS       + ++          +   + +
Sbjct  9     LHIAMFPWVAIGHITPFIHLANELAKRGHSISILIPNKPLLQLGHHSLYPDLIKFHVVTI  68

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P VEGLPPG ++ +D    A   L +A +    Q++ +L  LKP  V +DFA +W+P +A
Sbjct  69    PQVEGLPPGAETASDIDITAKNPLAIAFDATAEQVETILSGLKPDIVFYDFA-DWIPKMA  127

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
             A +G KT+ ++V  A   A   VPAR    +R  T EE+ +PP G+P ++V  LR  EA 
Sbjct  128   ARVGFKTVCYNVICASCMAIGIVPARHIPKDRRLTEEELGQPPKGYPSSTVV-LRGQEAL  186

Query  969   DFVIIFKRPHNGGASVYD-RVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
                 I     + GA+ +D R+ A + GC AI  +TC E+E P  DY+  Q+ KP+ L+GP
Sbjct  187   TLSFI---AMDYGATKFDVRITAAMQGCDAIGIRTCRELEGPMCDYLSEQYNKPVFLSGP  243

Query  792   VVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
             V+PE   G L++KW  WLS+F+P +V+YC+FGS+  L+  Q +E+ LG E+TGLPFF+ +
Sbjct  244   VLPENPKGALEEKWDKWLSKFKPKSVVYCAFGSQLMLQKKQFQEMVLGFEMTGLPFFVAV  303

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
             + P   D   E   ALP GF ERV  RG++H GWVQQ Q L H SVGC+V H GF S+ E
Sbjct  304   SKPHGADSIEE---ALPEGFLERVGDRGVVHGGWVQQTQGLNHPSVGCFVSHCGFGSMWE  360

Query  432   GIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE-  256
              ++++ Q+V++P+  DQ LN +LLA+++K  VEV  R E G+F KED+ KA++++M EE 
Sbjct  361   SLLSESQIVLVPRLADQILNTRLLAEELKVAVEV-ERGEMGWFSKEDLSKAIKSVMDEES  419

Query  255   --GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
               G   + N  KW+E L+  E    ++ + ++ +  +
Sbjct  420   EVGKLVKENHGKWRETLMSPEFMDNYVDNFIRQLYQL  456



>ref|XP_002523261.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF39100.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=460

 Score =   339 bits (870),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 184/458 (40%), Positives = 283/458 (62%), Gaps = 14/458 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIK-SMLNSNP-CTQIVPL  1336
              H+V+FP+FA GH++PF+ L+N+++  G   +F     N  +++    N++P       +
Sbjct  9     FHIVMFPWFAVGHMTPFLHLANRVAERGCSTTFLLP--NKAKLQLEHFNTHPDLITFHSI  66

Query  1335  ALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPP  1156
              +P VEGLP GT++ +D P      L +AL+  + Q++ ++V+ +P  VIFD A +W+P 
Sbjct  67    TVPHVEGLPLGTETASDIPIHLTHFLAIALDRTRRQVEKVIVDTRPKLVIFDVA-HWIPK  125

Query  1155  LAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFE  976
             +  +LGIK I ++V  A + A A VPAR    +R  T  E+ +PP G+P ++V  LR  E
Sbjct  126   ITKDLGIKAINYNVVCAASIAIALVPARNVTKDRPVTEAELLQPPAGYPSSNVV-LRGHE  184

Query  975   ARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
              R  + +   P   G + Y+R+   + G  AI  +TC+E+E    DY+ SQ++KP+ L G
Sbjct  185   VRSLLFV-SLPFGEGITFYERIYTAIKGSDAIAIRTCHEIEGKLCDYIASQYEKPVFLTG  243

Query  795   PVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
             PV+PEP+   L+ +W  WL  FE  +VI+C+FGS+  L+ +Q +EL LGLE TGLPF   
Sbjct  244   PVLPEPSKAPLEDQWTKWLGGFEKDSVIFCAFGSQIKLEKNQFQELVLGLESTGLPFLAA  303

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             L  P   + AS +  ALP GF ERV GRG+I  GWVQQ  IL H SVGC++ H GF S+ 
Sbjct  304   LKPP---NGASTVEEALPEGFEERVNGRGVIWGGWVQQLLILDHPSVGCFLNHCGFGSMW  360

Query  435   EGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM---  265
             E +++DCQ+V++P  GDQ LN +++A+++K GVEV  RDE G+F KE ++KA+ ++M   
Sbjct  361   ESLMSDCQIVLVPHLGDQILNTRIMAEELKVGVEV-VRDESGWFSKESLRKAITSVMDKN  419

Query  264   GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
              E G+  + N  KW E L  +   + +I   V+ M+D+
Sbjct  420   SEVGSMVKENHRKWTEILGGEGFMTSYIDKFVQNMQDL  457



>gb|KHN07772.1| UDP-glycosyltransferase 79B6 [Glycine soja]
Length=459

 Score =   339 bits (869),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 182/460 (40%), Positives = 277/460 (60%), Gaps = 17/460 (4%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSM-LNSNPCTQIVPLA  1333
             LH+ ++P+ A GH + F+ L NKL++ G KISF +      +++   L+ N  T  V + 
Sbjct  6     LHIAMYPWLAMGHQTAFLHLCNKLAIRGHKISFITPPKAQAKLEPFNLHPNSIT-FVTIN  64

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P VEGLPP  Q+TAD        +  A++L +  I+ LL  LKP  V +DF  +W+P L
Sbjct  65    VPHVEGLPPDAQTTADVTYPLQPQIMTAMDLTKDDIETLLTGLKPDLVFYDFT-HWMPAL  123

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVE-EMKKPPPGFPPTSVASLRTFE  976
             A  LGIK + +    ++   +   P R    + +  +E ++ +PP G+P +S+  L+T E
Sbjct  124   AKRLGIKAVHYCTASSVMVGYTLSPVRFH--QGTDLMESDLMEPPEGYPDSSI-KLQTHE  180

Query  975   ARDFVIIFKRPHNGGASV--YDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLL  802
             AR F    KR    G++V  YDR    LN    +  +TC E+E PY+DY+  QF KP++ 
Sbjct  181   ARAFAA--KRKDTFGSNVLFYDRQFIALNEADLLAYRTCREIEGPYMDYIGKQFNKPVVA  238

Query  801   AGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFF  622
              GPV+ +P +  L++K++ WL  FEP +V+YC FGSE  L+ +Q  EL LGLELTG+PF 
Sbjct  239   TGPVILDPPTLDLEEKFSTWLGGFEPGSVVYCCFGSECTLRPNQFLELVLGLELTGMPFL  298

Query  621   LVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSS  442
               +  P   +    +  A+P GF ERVKGRG ++ GWVQQQ IL H SVGC++ H G  S
Sbjct  299   AAVKAPLGFET---VESAMPEGFQERVKGRGFVYGGWVQQQLILAHPSVGCFITHCGSGS  355

Query  441   VIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMG  262
             + E +VN CQLV+LP  GDQ LNA+++  +++ GVEV + DEDG + KE + KAV  +M 
Sbjct  356   LSEALVNKCQLVLLPNVGDQILNARMMGTNLEVGVEVEKGDEDGMYTKESVCKAVSIVMD  415

Query  261   EEGAST---RANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
              E  ++   RAN  + +E LL+K+++S ++      ++++
Sbjct  416   CENETSKRVRANHARIRELLLNKDLESSYVDSFCMRLQEI  455



>ref|XP_003539949.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
Length=461

 Score =   339 bits (869),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 180/460 (39%), Positives = 277/460 (60%), Gaps = 17/460 (4%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSM-LNSNPCTQIVPLA  1333
             LH+ ++P+ A GH + F+ L NKL++ G KISF +      ++++  L+ N  T  V + 
Sbjct  6     LHIAMYPWLAMGHQTAFLHLCNKLAIRGHKISFITPPKAQAKLEAFNLHPNSIT-FVTIT  64

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P VEGLPP  Q+TAD        +  A++L +  I+ LL  LKP  V +DF  +W+P L
Sbjct  65    VPHVEGLPPDAQTTADVTYPLQPQIMTAMDLTKDDIETLLSGLKPDLVFYDFT-HWMPAL  123

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVE-EMKKPPPGFPPTSVASLRTFE  976
             A  LGIK + +    ++   +   PAR    + +  +E ++ +PP G+P +S+  L   E
Sbjct  124   AKSLGIKAVHYCTASSVMVGYTLPPARYH--QGTNLIESDLMEPPEGYPDSSI-KLHAHE  180

Query  975   ARDFVIIFKRPHNGGASV--YDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLL  802
             AR F    KR    G++V  YDR    LN    +  +TC E+E PY+DY++ QF KP+L 
Sbjct  181   ARAFAA--KRKDTFGSNVLFYDRQFIALNEADVLAYRTCREIEGPYLDYIEKQFNKPVLA  238

Query  801   AGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFF  622
              GPV+ +P +  L++K++ WL  FEP +V+YC FGSE  L  +Q +EL LGLELTG+PF 
Sbjct  239   TGPVILDPPTSDLEEKFSTWLGGFEPGSVVYCCFGSECTLGPNQFQELVLGLELTGMPFL  298

Query  621   LVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSS  442
               +  P   +    +  A+P GF ERVKGRG ++ GWV QQ IL H SVGC++ H G  S
Sbjct  299   AAVKAPLGFET---VESAMPEGFEERVKGRGFVYGGWVLQQLILAHPSVGCFITHCGSGS  355

Query  441   VIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMG  262
             + E +VN CQLV+LP  GDQ LNA+++ ++++ GVEV + DEDG + +E + KAV  +M 
Sbjct  356   LSEALVNKCQLVLLPNVGDQILNARMMGNNLEVGVEVEKGDEDGMYTRESVCKAVSIVMD  415

Query  261   EEGAST---RANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
              E  ++   R N  + +E LL+K+++S ++      ++++
Sbjct  416   GENETSKRVRGNHARIRELLLNKDLESSYVDSFCMRLQEI  455



>emb|CDP05961.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   338 bits (868),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 188/450 (42%), Positives = 273/450 (61%), Gaps = 15/450 (3%)
 Frame = -3

Query  1497  IFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPC-TQIVPLALPAV  1321
             +FP+FA GH++PF+ LSNKL+  G +ISF        +++  LN +P       L +P V
Sbjct  1     MFPWFATGHMTPFLHLSNKLAEKGHRISFLLPNKAKHQLEH-LNLHPSLITFYTLTVPHV  59

Query  1320  EGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLAAEL  1141
             EGLPPGT++ +D P     LL  A++ M+ +++ LL +LKP  V +D A +W+P LA+E+
Sbjct  60    EGLPPGTETASDVPIFLTSLLATAMDNMRDRVRDLLQKLKPSIVFYDMA-HWIPELASEI  118

Query  1140  GIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEARDFV  961
             G KT+ ++V  A + A A VP+R P  +R+ T  E+ +PPPG+P ++V  LR  EA+   
Sbjct  119   GFKTVNYNVVSAASIAIALVPSRKPVEDRTITGAELMEPPPGYPSSTVL-LRRHEAQGLS  177

Query  960   IIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPVVPE  781
              IF        + YDR+   +    AI  +TC E+E    DY+  ++ KP+ L GPV+PE
Sbjct  178   FIFLE-FGKDITFYDRITIAMKRSHAISIRTCRELEGSLCDYIAREYHKPVFLTGPVLPE  236

Query  780   PASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLNFPA  601
                  L +KWA+WL  FEP TV++C+FGS+  L+  Q +EL LG ELTGLPF + L  P 
Sbjct  237   SEKEDLQEKWANWLKGFEPGTVVFCAFGSQVVLEKQQFQELVLGFELTGLPFLIALKPPF  296

Query  600   NVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEGIVN  421
                   E   ALP GF  R++GRGI++ GWVQQ  IL H SVGC+V H GF S+ E +++
Sbjct  297   GTTSVEE---ALPEGFEGRIRGRGIVYGGWVQQPAILSHPSVGCFVNHCGFGSMWESLMS  353

Query  420   DCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM---GEEGA  250
             DCQ+V++P   DQ LN +LLA+++K  VEV R ++  +F +E + +A+++ M    E G 
Sbjct  354   DCQIVLVPHLADQILNTRLLAEELKVAVEVERDNKSTWFSRESLCRAIKSAMDRDSEVGG  413

Query  249   STRANQEKWKEFLLDKEIQ----SKFIKDL  172
               R N  KWKE L           KFI+DL
Sbjct  414   LIRENHAKWKEVLASPTFMGDCIEKFIQDL  443



>ref|XP_003540019.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
 gb|KHN27788.1| UDP-glycosyltransferase 79B6 [Glycine soja]
Length=455

 Score =   338 bits (868),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 190/459 (41%), Positives = 282/459 (61%), Gaps = 18/459 (4%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             LH+ ++P+FA GH++PF+ L+NKL+  G KISFF       +++  LN +P     VP+ 
Sbjct  8     LHIAMYPWFAMGHLTPFLHLANKLAKRGHKISFFIPRRTQAKLED-LNLHPNLITFVPIN  66

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P V+GLP   ++T+D P +   L+  A++L +  I+ LL++LKPH V+FDF+  WLP L
Sbjct  67    VPHVDGLPYDAETTSDVPSSLFPLIATAMDLTEKNIELLLLDLKPHIVLFDFSTYWLPNL  126

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
             A  +GIK++ + +       +   PAR    +R    ++M+KPP GFP  S+  L   E 
Sbjct  127   ARRIGIKSLQYWIISPATVGYMASPAR----QRE---DDMRKPPSGFPDCSI-KLHAHEV  178

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             R      K     G   YDR+  G +   AI  K C E+E PY+DY+++QF KP+LL GP
Sbjct  179   RFLAAARKLEFGNGVLFYDRISVGADLSDAIGFKGCREIEGPYVDYLETQFGKPVLLTGP  238

Query  792   VVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
             +VPEP++  LD KW +WL +F+  +VIY +FGSE  L+ +Q+ EL LGLELTG+PFF  L
Sbjct  239   LVPEPSNSTLDAKWGEWLGRFKAGSVIYIAFGSEHSLQQNQLNELLLGLELTGMPFFAAL  298

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
               P   +    + +ALP GF ERV+ RG+++ GWVQQQ IL H SVGC++ H G +S+ E
Sbjct  299   KPPIEFE---SIEKALPKGFKERVQERGVVYGGWVQQQLILAHPSVGCFITHCGGASLTE  355

Query  432   GIVNDCQLVMLPQKGDQF-LNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE  256
              +VN CQLV+LP+ G  F +NA+ +   ++ GVEV + +EDG F KE + KAV+T+M +E
Sbjct  356   ALVNRCQLVLLPRLGSDFIINARTMGGKLRVGVEVEKGEEDGLFTKESVCKAVKTVMDDE  415

Query  255   ----GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                 G   RAN  K +  LL    ++  +      ++D+
Sbjct  416   IDQLGREVRANHNKVRSLLLSNNFETSCVDAFSHRLQDL  454



>ref|XP_002282825.3| PREDICTED: UDP-glycosyltransferase 79B6-like [Vitis vinifera]
Length=463

 Score =   338 bits (868),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 190/461 (41%), Positives = 272/461 (59%), Gaps = 12/461 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPC-TQIVPLA  1333
              HV +FP+FAFGH++ F+ LSNKL+  G KI+F        ++++ LN +P      PL+
Sbjct  11    FHVAMFPWFAFGHMTAFLHLSNKLAERGHKITFMLPKKAQSQLQT-LNFHPTLISFHPLS  69

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P V+GLPPG ++ +D P     LL  A++    Q++A L    P F+ +D   +  P L
Sbjct  70    IPHVDGLPPGAETASDIPIFLTHLLATAMDRATDQLEAALRASNPDFLFYD-CSHLAPVL  128

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
             A+ LGIK I ++V  A + A A VPAR    +R  T  E+  PP G+P +S A  R  E 
Sbjct  129   ASRLGIKAICYNVVCAASIAIALVPARGVSKDRPVTEAELAVPPSGYP-SSTAVFRRHEG  187

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             R    I   P   G S Y+R    +    AI  +TC E+E    DY+ +Q+ KP+ L GP
Sbjct  188   RALQFI-SAPFGDGISFYERTTTAMKESDAISIRTCREIEGNLCDYIGTQYGKPIFLTGP  246

Query  792   VVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
             V+PEP+   L+ +WA WL  F+P ++I+C+FGS+  L+ DQ +EL LGLELTGLPF + L
Sbjct  247   VLPEPSPTPLEDRWAQWLGGFKPGSIIFCAFGSQYILEKDQFQELVLGLELTGLPFLVAL  306

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
               P     A+ +  ALP GF ERV GR  +H GWVQQ  IL H SVGC+V H GF S+ E
Sbjct  307   KPPTG---AATIEEALPEGFKERVGGRAAVHGGWVQQPSILSHPSVGCFVSHCGFGSMWE  363

Query  432   GIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE-  256
              ++NDCQ+V++P  GDQ LN ++LA +++  VEV  R+E+G+F KE + KA++++M EE 
Sbjct  364   SLMNDCQIVLVPHLGDQILNTRVLAGELQVAVEVE-REENGWFSKESLCKAIKSVMDEES  422

Query  255   --GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
               G   R N  KWKE        S ++   V  ++ +   N
Sbjct  423   EVGGLVRKNHAKWKETFARPGFMSNYVDKFVGQLQGLLDHN  463



>ref|XP_011082713.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
isoform X3 [Sesamum indicum]
Length=458

 Score =   338 bits (867),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 181/457 (40%), Positives = 278/457 (61%), Gaps = 12/457 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ +FP+ A GHI+PF+ L+N+L+  G  IS       + ++          +   + +
Sbjct  9     LHIAMFPWVAIGHITPFIHLANELAKRGHSISILIPNKPLLQLGHHSLYPDLIKFHVVTI  68

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P VEGLPPG ++ +D    A   L +A +    Q++ +L  LKP  V +DFA +W+P +A
Sbjct  69    PQVEGLPPGAETASDIDITAKNPLAIAFDATAEQVETILSGLKPDIVFYDFA-DWIPKMA  127

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
             A +G KT+ ++V  A   A   VPAR    +R  T EE+ +PP G+P ++V  LR  EA 
Sbjct  128   ARVGFKTVCYNVICASCMAIGIVPARHIPKDRRLTEEELGQPPKGYPSSTVV-LRGQEAL  186

Query  969   DFVIIFKRPHNGGASVYD-RVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
                 I     + GA+ +D R+ A + GC AI  +TC E+E P  DY+  Q+ KP+ L+GP
Sbjct  187   TLSFI---AMDYGATKFDVRITAAMQGCDAIGIRTCRELEGPMCDYLSEQYNKPVFLSGP  243

Query  792   VVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
             V+PE   G L++KW  WLS+F+P +V+YC+FGS+  L+  Q +E+ LG E+TGLPFF+ +
Sbjct  244   VLPENPKGALEEKWDKWLSKFKPKSVVYCAFGSQLMLQKKQFQEMVLGFEMTGLPFFVAV  303

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
             + P +   A  +  ALP GF ERV  RG++H GWVQQ Q L H SVGC+V H GF S+ E
Sbjct  304   SKPPH--GADSIEEALPEGFLERVGDRGVVHGGWVQQTQGLNHPSVGCFVSHCGFGSMWE  361

Query  432   GIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE-  256
              ++++ Q+V++P+  DQ LN +LLA+++K  VEV  R E G+F KED+ KA++++M EE 
Sbjct  362   SLLSESQIVLVPRLADQILNTRLLAEELKVAVEV-ERGEMGWFSKEDLSKAIKSVMDEES  420

Query  255   --GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
               G   + N  KW+E L+  E    ++ + ++ +  +
Sbjct  421   EVGKLVKENHGKWRETLMSPEFMDNYVDNFIRQLYQL  457



>ref|XP_008383670.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Malus domestica]
Length=471

 Score =   338 bits (868),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 196/467 (42%), Positives = 275/467 (59%), Gaps = 16/467 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             LH+ ++P+FA GH++P++ LSNKL+  G +ISF        +    LN +P     +P+ 
Sbjct  10    LHIAMYPWFAMGHLTPYLHLSNKLAERGHRISFVPT--KTQQKLQALNLHPHLISFIPIT  67

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P V+GL PG ++T D P  +  LL  A++L QP I   + EL P FV FDF   WLP L
Sbjct  68    VPHVDGLLPGAETTNDVPFPSYSLLMTAMDLTQPAILQAICELNPDFVFFDFTP-WLPKL  126

Query  1152  AAELG--IKTIffsvfvalatafatVPARLPGPERSPTVEEMKKP----PPGFPPTSVAS  991
               +LG  IK+I + +       +   P R    E+S   E+        PP   P S   
Sbjct  127   LRQLGTGIKSINYIIITPALVGYVRSPERKVLMEKSVLTEDDLINDLINPPPSFPPSSIK  186

Query  990   LRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKP  811
             L   EAR       +    G  + DR++  LN C A+  +TC EME  Y DY+++Q +KP
Sbjct  187   LPAHEARMLAPFLLKEFGSGTKLIDRLIISLNDCDAVAFRTCREMEGKYCDYLETQLRKP  246

Query  810   LLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGL  631
             +LLAGPVVPE  +  LD+KWA WL  FE  +VIYC+FG+E  LK DQ++EL LG ELTGL
Sbjct  247   VLLAGPVVPETPTTELDEKWAKWLESFEAKSVIYCAFGTECVLKIDQLQELLLGFELTGL  306

Query  630   PFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAG  451
             PFF  L  P  V+    +  ALP GF  RVKGRG++  GWVQQ  IL H SVGC+V H G
Sbjct  307   PFFAALKPPMGVEA---VESALPEGFEGRVKGRGVVSWGWVQQPLILKHPSVGCFVTHCG  363

Query  450   FSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQT  271
              SS++EG+V++CQLV+LP   DQ   A+++  D++ GV+V + +EDG F KE + KAV+ 
Sbjct  364   PSSLMEGLVSECQLVLLPNVADQLAIARVMGRDLRVGVKVEKGEEDGVFTKEGVCKAVRD  423

Query  270   IMGEE---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
             +M EE   G   R N  KW+EFL  K +++ ++   V+ +  +  +N
Sbjct  424   VMDEESEVGKEVRRNHTKWREFLSSKGLENSYVDSFVEKLHALLGLN  470



>dbj|BAF75891.1| glucosyltransferase [Dianthus caryophyllus]
Length=461

 Score =   338 bits (866),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 186/463 (40%), Positives = 271/463 (59%), Gaps = 8/463 (2%)
 Frame = -3

Query  1530  NNHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCT  1351
             +++ G  LH+ ++P+ A GHI+ F+++ NKL+  G +ISFF       R  S  +     
Sbjct  2     SHNNGTPLHIAMYPWLAMGHITSFLRIGNKLAERGHRISFFLPPKTQLRFTSQNHYPELI  61

Query  1350  QIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQ  1171
               + + LP V+G P   ++T D    A  LL  A++L +  I+A LV+L+P+FV FDF  
Sbjct  62    TFISITLPPVDGFPAEAETTNDISAHARPLLMTAMDLTKDTIEAHLVDLRPNFVFFDFT-  120

Query  1170  NWLPPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVAS  991
              W+P LA + GIK I++   + +  A+    + +  P+  P  E     P    P+   +
Sbjct  121   CWMPELAHKHGIKPIYYMSALLVRAAYILHLSVIT-PKGQPIKEAHLMSPLPLLPSPHMT  179

Query  990   LRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKP  811
              R  EAR  +  F     GG ++ DRV      C AI  KTC EME  Y ++V+ ++ KP
Sbjct  180   HRAHEARSLIEAFHLDFGGGLTLLDRVGKSSRECDAIGIKTCREMEEIYYEFVEKKYGKP  239

Query  810   LLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGL  631
             +L AGPV+P+P S  LD+++  WL+ F    VIYC+FGSE  +     +EL LGLELTG 
Sbjct  240   VLTAGPVLPDPISTKLDERFNKWLASFGFDQVIYCAFGSECTINLVAFQELVLGLELTGS  299

Query  630   PFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAG  451
             PF   L  P   D+   +  ALP GF ER K RGI++ GWVQQQ IL H SVGC+V H G
Sbjct  300   PFLAALKAPTGHDI---IESALPEGFLERTKDRGIVYGGWVQQQLILRHPSVGCFVTHCG  356

Query  450   FSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQT  271
               S+ E +VN CQLVM+P   DQF+NAK+++ +++ GVEV RRDEDG+F +ED++KAV++
Sbjct  357   AGSLSEAMVNKCQLVMIPHAVDQFINAKMMSLELRVGVEVERRDEDGFFSREDVRKAVES  416

Query  270   IMGEE---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             +M E    G    AN  KW+EF+L   I+  +I   +  + D+
Sbjct  417   VMDENSVLGKEVMANHAKWREFILKDGIEESYISGFIDKLYDL  459



>ref|XP_003607531.1| Glucosyltransferase [Medicago truncatula]
 gb|AES89728.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=462

 Score =   337 bits (865),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 182/458 (40%), Positives = 275/458 (60%), Gaps = 12/458 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ ++P+FA GH +PF+ L+NKL+  G KI+FF+      +++           + + +
Sbjct  7     LHIAMYPWFAMGHQTPFLHLANKLAKKGHKITFFTPKSAQSKLEPFNLYPQLITFITIKV  66

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P VEGLP   ++TAD P      +  A++L QP I+  L  LKP  V +DF  +W+P L 
Sbjct  67    PHVEGLPLNAETTADVPYPLHPHIMTAMDLTQPDIETHLTNLKPQIVFYDFT-HWIPSLT  125

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
               LGIK   + +  ++   ++  PAR      + T  ++ +PP G+P +S+  L + EA+
Sbjct  126   KRLGIKAFHYCIISSIMVGYSLTPARY-SQGNNLTEFDLMQPPYGYPDSSI-RLHSHEAK  183

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
                 + K         YDR    LN   A+  +TC E+E PY+DYV+ QF K +L +GPV
Sbjct  184   ALAAMRKNTFGSNVLFYDRQAIALNEADALGYRTCREIEGPYLDYVQKQFNKSVLTSGPV  243

Query  789   --VPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
               + E  + VLD+KWA WL  F+  +V+YC FGSE  L  +Q +EL LGLEL+G+PFF  
Sbjct  244   LQILENPNYVLDEKWATWLGGFKADSVVYCCFGSECTLIPNQFQELILGLELSGMPFFAA  303

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             L  P       E   ALP G  ER+KGRG+++ GWVQQQ IL H SVGC++ H G  S+ 
Sbjct  304   LKPPFGFATIEE---ALPEGLAERIKGRGVVYGGWVQQQLILEHPSVGCFITHCGSGSLS  360

Query  435   EGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE  256
             E +VN CQLV+LP  GD+ LNA+++A+++K GVEV  +DEDG + K+ + KAV  +M +E
Sbjct  361   EALVNKCQLVLLPNFGDRILNARIMANNLKVGVEV-EKDEDGLYTKDSVCKAVSIVMDDE  419

Query  255   GAST---RANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
               ++   RAN  K +E LL+K+++S +I +  K ++++
Sbjct  420   NETSKTVRANHAKIREMLLNKDLESSYIDNFCKKLQEI  457



>ref|XP_010093489.1| UDP-glycosyltransferase [Morus notabilis]
 gb|EXB54128.1| UDP-glycosyltransferase [Morus notabilis]
Length=458

 Score =   337 bits (864),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 197/455 (43%), Positives = 287/455 (63%), Gaps = 14/455 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             LH+ + P+FA GHI+ F+ +SNKL+  G KISFF       ++ S  N  P     VP+ 
Sbjct  7     LHIAMCPWFALGHITSFLHISNKLAKKGHKISFFIPTKTQSKV-SHFNLFPHLISFVPIT  65

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P V+GLPPG+++T D P     L+  A++  +P  + LL +LKP  V FD A +W+P L
Sbjct  66    IPLVDGLPPGSETTNDVPRPLIPLIMTAMDRAEPDFEILLHDLKPDIVFFDSA-HWIPKL  124

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
             A  L IK++F+    A+A  F        G  ++  V E  +PPPGFP +S+  L   EA
Sbjct  125   ARRLSIKSVFYITVSAVAIGFNLSRNMKLGESKATDVAEAMQPPPGFPDSSIKRL-LHEA  183

Query  972   RDFVIIFKRPHN-GGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
             RD++ +  +P       + DR+  G+  C A+  K+C E+E P+++Y++    KPLLLAG
Sbjct  184   RDYIDLRSKPLGPTNMRIQDRIYVGVQDCDALAFKSCREIEGPFVEYLERLILKPLLLAG  243

Query  795   PVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
             PV+P      L++KWA+WL  F+P TV+YC+FGSET L+ DQ++EL LGLEL+GLPF   
Sbjct  244   PVLPVRPLSTLEEKWANWLGGFKPCTVVYCAFGSETALRKDQLQELLLGLELSGLPFLAA  303

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             L  P  V   + L  ALP GF ERV+GRG++H GW+QQQ +L H SVGC+V H G+ S++
Sbjct  304   LRPPLEV---ATLKEALPEGFEERVRGRGVVHEGWIQQQLMLEHKSVGCFVTHCGWGSLV  360

Query  435   EGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE  256
             EG++N C+LVM+PQ GDQ LNA+L+ +++K GVEV + +EDG F +E +  A++T+M E 
Sbjct  361   EGLLNGCELVMIPQVGDQVLNARLMGNNLKVGVEVAKGEEDGLFTRESVCNAIRTVMEEN  420

Query  255   ----GASTRANQEKWKEFLL--DKEIQSKFIKDLV  169
                 G   RAN+ K ++ L   D+E   +F + LV
Sbjct  421   YSEVGREIRANRAKLQDQLFNKDEEYIDEFSRKLV  455



>ref|XP_007132682.1| hypothetical protein PHAVU_011G115700g [Phaseolus vulgaris]
 gb|ESW04676.1| hypothetical protein PHAVU_011G115700g [Phaseolus vulgaris]
Length=457

 Score =   337 bits (864),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 178/459 (39%), Positives = 276/459 (60%), Gaps = 16/459 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ ++P+ A GH + F+ L NKL++ G +ISF +      +++           V + +
Sbjct  6     LHIAMYPWLAMGHQTAFLHLCNKLAIRGHRISFITPPKAQAKLEPFNLHPELITFVTITV  65

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P VEGLPP  Q+TAD        +  A++L +  I+ LL +LKP  V +DF  +W+P L 
Sbjct  66    PHVEGLPPDAQTTADVTYPLQPNIMTAMDLTKDDIETLLTDLKPDLVFYDFT-HWMPTLT  124

Query  1149  AELGIKTIffsvfvalatafatVPARL-PGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
              +LGIK + +    ++   +   PAR   G + S +  ++ +PP G+P +S+  L   EA
Sbjct  125   KKLGIKAVHYCTASSVMVGYTLPPARYYQGIDLSES--DLMEPPKGYPDSSI-KLHAHEA  181

Query  972   RDFVIIFKRPHNGGASV--YDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLA  799
             R F    KR    G+ V  YDR    LN    +  +TC E+E PY+DY+ ++F KP+L +
Sbjct  182   RAFA--GKRKDTFGSDVLFYDRQFTALNEADVLAYRTCREIEGPYLDYIGNEFNKPVLAS  239

Query  798   GPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFL  619
             GPV+ EP +  L++K++ WL  FEP TV+YC FGSE  L+ +Q +EL LGLELTG+PF  
Sbjct  240   GPVILEPPTSELEEKFSTWLGGFEPGTVVYCCFGSECTLRPEQFQELVLGLELTGMPFLA  299

Query  618   VLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSV  439
              +  P        +  A+P GF ERVKGRG ++ GWV QQ IL H SVGC++ H G  S+
Sbjct  300   AVKPPVGFHT---VESAMPEGFEERVKGRGFVYGGWVMQQLILAHPSVGCFITHCGSGSL  356

Query  438   IEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGE  259
              E +VN C+LV+LP  GDQ LNA+++A++++ GVEV+ + EDG + K+ + KAV  +M E
Sbjct  357   SEALVNKCRLVLLPNVGDQILNARMMANNLEVGVEVD-KGEDGMYTKDSVCKAVSIVMDE  415

Query  258   EGASTR---ANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             E  +++    N  + +E LLDK+++S ++ +    +R++
Sbjct  416   ENETSKKVTVNHTRIRETLLDKDLESYYLDNFCTRLREI  454



>sp|Q53UH4.1|DUSKY_IPONI RecName: Full=Anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase; 
AltName: Full=3-O-glucoside-2''-O-glucosyltransferase; 
Short=In3GGT; AltName: Full=Protein dusky; Short=Dy [Ipomoea 
nil]
 dbj|BAD95881.1| glucosyltransferase [Ipomoea nil]
 dbj|BAD95883.1| glucosyltransferase [Ipomoea nil]
Length=459

 Score =   335 bits (860),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 180/457 (39%), Positives = 282/457 (62%), Gaps = 13/457 (3%)
 Frame = -3

Query  1506  HVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLAL  1330
             H+ ++P+F  GH++ F +L+NKL+  G +ISF        +++S  N +P     VP+ +
Sbjct  9     HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLES-FNLHPHLISFVPIVV  67

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P++ GLPPG ++T+D P  +  LL  A++  Q  I+ +L +LK   V +DF  +WLP LA
Sbjct  68    PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFT-HWLPSLA  126

Query  1149  AELGIKTIffsvfvalatafatVPAR-LPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
              ++GIK++F+S    L   +A  P R + G  +  T  +M K P  FP  S+  L   EA
Sbjct  127   RKIGIKSVFYSTISPLMHGYALSPERRVVG--KQLTEADMMKAPASFPDPSI-KLHAHEA  183

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             R F         G  + +DR+   ++    +   TC E+E  + DY+++QF+KP+LLAGP
Sbjct  184   RGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKPVLLAGP  243

Query  792   VVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
              +P P+   ++QKW+DWL +F+  +VIYC+FGSE  L+ D+ +EL  GLELTG+PFF  L
Sbjct  244   ALPVPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAAL  303

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
               P     A  +  A+P    E+++GRGI+H  WVQQQ  L H SVGC+V H G++S+ E
Sbjct  304   KPPFE---AESIEAAIPEELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  360

Query  432   GIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE-  256
              +VNDCQ+V+LPQ GDQ +NA++++  +K GVEV + +EDG F +E + KAV+ +M E+ 
Sbjct  361   ALVNDCQIVLLPQVGDQIINARIMSVSLKVGVEVEKGEEDGVFSRESVCKAVKAVMDEKS  420

Query  255   --GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
               G   R N +K + FLL+ ++ SK++    + ++D+
Sbjct  421   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQDL  457



>ref|XP_008465522.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Cucumis melo]
Length=479

 Score =   336 bits (861),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 189/460 (41%), Positives = 288/460 (63%), Gaps = 14/460 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ ++P+FA GH++PF+ LSNKL+  G KISFF     + + + +         +P+ +
Sbjct  18    LHIAMYPWFALGHLTPFLHLSNKLAKKGHKISFFIPTKTLPKFEPLNLFPNLITFIPIIV  77

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P V+GLP G ++T D P     L+  +++L QPQI  LL  LKPH ++FDF  +WLP LA
Sbjct  78    PHVDGLPRGAETTCDVPYPLHNLIMTSMDLTQPQITLLLQSLKPHLILFDFT-HWLPKLA  136

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
             ++LGIK+I + V  A   A+   P+R    +   T E++ KPP G+P +S  +L   EAR
Sbjct  137   SQLGIKSIHYCVTSAAMIAYTLTPSR-QFSKNELTEEDLMKPPIGYP-SSTINLHPHEAR  194

Query  969   DFVIIFKRPHNGGASV--YDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
              F    KR    G+ V  YDR     + C AI  +TC+E+E  +++Y++++F+KP+LL G
Sbjct  195   VFAS--KRKWKFGSDVLFYDRQFVSFSDCDAIGFRTCHEIEGDFVNYLQTEFRKPILLTG  252

Query  795   PVVPEPAS-GVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFL  619
              V+PEP +   L++KW  WL  F+  +V+YC+FGSE  L+ +Q +EL +G EL  +PF  
Sbjct  253   SVLPEPLNPEALEEKWESWLLGFKEGSVVYCAFGSECTLQMEQFQELLMGFELLDMPFLA  312

Query  618   VLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSV  439
              L  P     A  +  ALP GFT+RV GRG+++ GW+QQ++IL H SVGC+V H G +S+
Sbjct  313   ALKPPFG---AETVEAALPEGFTKRVGGRGVVYGGWIQQERILEHPSVGCFVTHCGSNSL  369

Query  438   IEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGE  259
              E +VN CQLV+LPQ GDQ +NA+++  +++ GVEV +R+EDG+F KE + KAV+ +M E
Sbjct  370   KEALVNKCQLVLLPQVGDQIINARMMGSNLRVGVEVEKREEDGWFTKESVCKAVKIVMDE  429

Query  258   E---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
             +   G   R N  K ++ LL K+++  +I      + D+ 
Sbjct  430   DNEIGKEVRTNHSKIRDLLLKKDLEQSYIDSFSHNLCDLV  469



>gb|AHJ60266.1| anthocyanidin 3-O-glucoside-2''-O-glucosyltransferase [Ipomoea 
purpurea]
Length=459

 Score =   335 bits (859),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 180/457 (39%), Positives = 282/457 (62%), Gaps = 13/457 (3%)
 Frame = -3

Query  1506  HVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLAL  1330
             H+ ++P+F  GH++ F +L+NKL+  G +ISF        +++S  N +P     VP+ +
Sbjct  9     HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLES-FNLHPHLISFVPIVV  67

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P++ GLPPG ++T+D P  +  LL  A++  Q  I+ +L +LK   V +DF  +WLP LA
Sbjct  68    PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFT-HWLPSLA  126

Query  1149  AELGIKTIffsvfvalatafatVPAR-LPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
              ++GIK++F+S    L   +A  P R + G  +  T  +M K P  FP  S+  L   EA
Sbjct  127   RKIGIKSVFYSTISPLMHGYALSPERRVVG--KQLTEADMMKAPASFPDPSI-KLHAHEA  183

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             R F         G  + +DR+   ++    +   TC E+E  + DY+++QF+KP+LLAGP
Sbjct  184   RGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKPVLLAGP  243

Query  792   VVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
              +P P+   ++QKW+DWL +F+  +VIYC+FGSE  L+ D+ +EL  GLELTG+PFF  L
Sbjct  244   ALPVPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAAL  303

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
               P     A  +  A+P    E+++GRGI+H  WVQQQ  L H SVGC+V H G++S+ E
Sbjct  304   KPPFE---AESVEAAIPEELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  360

Query  432   GIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE-  256
              +VNDCQ+V+LPQ GDQ +NA++++  +K GVEV + +EDG F +E + KAV+ +M E+ 
Sbjct  361   ALVNDCQIVLLPQVGDQIINARIMSVSLKVGVEVEKGEEDGVFSRESVCKAVKAVMDEKS  420

Query  255   --GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
               G   R N +K + FLL+ ++ SK++    + ++D+
Sbjct  421   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQDL  457



>ref|XP_010666234.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Beta vulgaris subsp. vulgaris]
Length=459

 Score =   335 bits (858),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 199/459 (43%), Positives = 281/459 (61%), Gaps = 16/459 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ ++ +FAFGH++ F+QL+NKL+  G KISFF       ++    +       +P+A+
Sbjct  9     LHIAMYSWFAFGHLTSFLQLANKLAQRGHKISFFLPTKTQQKLTPHNHHPHLITFIPIAV  68

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             PAVEGLP G ++TAD P  A  L+  A++L Q  I++LL +LKP  V FDF + WLP +A
Sbjct  69    PAVEGLPSGAETTADVPYEARSLIMAAMDLTQDTIESLLSQLKPDLVFFDFTE-WLPNVA  127

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPT-SVASLRTFEA  973
              + G+K+++++  +A++ A+    AR     R     ++ +PPPGFPP+ S+ +LR  EA
Sbjct  128   RKHGVKSVYYATLLAVSGAYFLPRARAQLGGR-----DLTRPPPGFPPSKSMITLRDHEA  182

Query  972   RDFVIIFKRPHNGGAS--VYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLA  799
             R       +   GG    +  R    L  C A  AK+C EME  Y D+V + ++KPLLLA
Sbjct  183   RAVGYAVTQMEFGGPGKMMLQRHAVALEACDAFAAKSCREMEGDYCDFVYNVYRKPLLLA  242

Query  798   GPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFL  619
             GPVVPEP +  LD K   WLS F   +VIYC+ GSE FL  D+ +EL LGLELTG+PF  
Sbjct  243   GPVVPEPPAARLDDKLNAWLSSFAKDSVIYCALGSECFLSKDRFQELLLGLELTGMPFLA  302

Query  618   VLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSV  439
              L  P   +    +  ALP GF ER KGRGI+H  WVQQQ IL H SVGC+V H G  S+
Sbjct  303   ALKLPIGYET---MEHALPEGFEERTKGRGIVHGDWVQQQLILQHPSVGCFVTHCGAGSL  359

Query  438   IEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM--  265
              E +V++CQLV+ PQ  DQF+NA+ L+ D+K GVEV    EDG   K+ I K ++ IM  
Sbjct  360   SEAMVSNCQLVLFPQVTDQFINARFLSLDLKVGVEVE-IGEDGILTKDGICKTIKVIMDP  418

Query  264   -GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
               E G   R N+ KW++FLL K +++ +I   ++ +R +
Sbjct  419   KSEVGREARINRVKWRDFLLAKGLEASYISGFIQNLRGL  457



>ref|XP_007132838.1| hypothetical protein PHAVU_011G128700g [Phaseolus vulgaris]
 gb|ESW04832.1| hypothetical protein PHAVU_011G128700g [Phaseolus vulgaris]
Length=457

 Score =   335 bits (858),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 178/459 (39%), Positives = 274/459 (60%), Gaps = 16/459 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ ++P+ A GH  PF+ L NKL++ G +ISF +      +++           V + +
Sbjct  6     LHIAMYPWLAMGHQIPFLHLCNKLAIGGHRISFITPPKAQAKLEPFNLHPELITFVTITV  65

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P VEGLPP  Q+TAD        +  A++L +  I+ LL  LKP  V +DF  +W+P L 
Sbjct  66    PHVEGLPPDAQTTADVTYPLQPNIMTAMDLTKDDIQTLLTHLKPDLVFYDFT-HWMPTLT  124

Query  1149  AELGIKTIffsvfvalatafatVPARL-PGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
              +LGIK + + +  ++   +   PAR   G + S +  ++ +PP G+P +S+  L   EA
Sbjct  125   KKLGIKAVHYCIVSSVMVGYTLTPARYYQGVDLSES--DLMEPPQGYPNSSI-KLHAHEA  181

Query  972   RDFVIIFKRPHNGGASV--YDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLA  799
               F    KR    G+ V  YDR    +N    +  +TC E+E PY+DY+ +QF KP+L +
Sbjct  182   CAFA--RKRKDTFGSDVLFYDRQFTAMNEADVLAYRTCREIEGPYLDYIGNQFNKPVLAS  239

Query  798   GPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFL  619
             GPV+ EP +  L++K++ WL  FEP T++YC FGSE  L+ +Q +EL LGLELTG+PF  
Sbjct  240   GPVILEPPTTELEEKFSTWLGGFEPGTMVYCCFGSECTLRPEQFQELVLGLELTGMPFLA  299

Query  618   VLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSV  439
              +  P   +    +  A+P GF ERVKGRG ++ GWV QQ IL H SVGC++ H G  S+
Sbjct  300   AVKPPVGFET---VESAMPEGFEERVKGRGFVYGGWVMQQLILAHPSVGCFITHCGSGSL  356

Query  438   IEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGE  259
              E +VN CQLV+LP  GDQ LNA+++A++++ GVEV  + EDG + K+++ K V  +M E
Sbjct  357   SEALVNKCQLVLLPNVGDQILNARMMANNLEVGVEV-EKGEDGMYTKDNVCKVVSIVMDE  415

Query  258   EGAST---RANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             E  ++   R N  + +E LLDK+++S +  +    +R++
Sbjct  416   ENETSKKVRDNHTRIRETLLDKDLESYYFHNFCTRLREI  454



>ref|XP_010675464.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Beta vulgaris subsp. 
vulgaris]
Length=458

 Score =   334 bits (856),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 183/457 (40%), Positives = 282/457 (62%), Gaps = 13/457 (3%)
 Frame = -3

Query  1518  GDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVP  1339
             G  LH+V+FP+FA GH++PF+ LSNKL+ +G KI+F        +++ +L       + P
Sbjct  2     GKQLHIVMFPWFAIGHMTPFLHLSNKLAEYGHKITFLLPKKAKHQLQHLLLYPSLITLHP  61

Query  1338  LALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVEL--KPHFVIFDFAQNW  1165
             + +P V  LPPGT++ ++ P      L  AL+L + +++  ++ L  KPH + +D A  W
Sbjct  62    ITIPHVHPLPPGTETASEIPLHLNNHLATALDLTRLEVEYFIITLQPKPHLLFYDIA-FW  120

Query  1164  LPPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLR  985
             +P +A++L IK+I ++V  A + A A VPA   G ++  T E++ KPPPG+P ++V    
Sbjct  121   VPEIASKLQIKSICYNVVCAASLAIALVPALNVGRDQPVTEEDVAKPPPGYPSSNVV-FH  179

Query  984   TFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLL  805
               EAR  + I       G + YDR++  +  C AI  +TC E+E  + DY+ +Q+ KP+L
Sbjct  180   GPEARSLLFI-GLEFGSGLTFYDRIVTAMKSCDAIAIRTCREIEDNFCDYISAQYNKPVL  238

Query  804   LAGPVVPEPASGV-LDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLP  628
             L GPV+PE  +   L+ +W +WLS+FEP++V++C+FGS+  L+ DQ +EL LG E+T LP
Sbjct  239   LTGPVLPETNNNHPLEAQWVEWLSRFEPNSVVFCAFGSQYILEKDQFQELLLGFEMTMLP  298

Query  627   FFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGF  448
             F + L  P       E   ALP GF ERV  RG++H GWVQQ  IL H SVGC+V H GF
Sbjct  299   FLVALKPPQGCGFVEE---ALPEGFKERVGERGVVHGGWVQQPLILAHPSVGCFVNHCGF  355

Query  447   SSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTI  268
              S+ E ++ + Q+VM+PQ GDQ LN +L++ ++  GVEV  R E G+  KE + KA+Q++
Sbjct  356   GSMWESLMAESQIVMVPQLGDQILNTRLMSGELVVGVEV-ERAESGWVSKESLCKAIQSV  414

Query  267   MGEE---GASTRANQEKWKEFLLDKEIQSKFIKDLVK  166
             MGE+   G   R N  KW++ ++ +     +I + VK
Sbjct  415   MGEDSEVGCLVRNNHAKWRQIMVSQGFMRGYIDNFVK  451



>sp|Q53UH5.1|DUSKY_IPOPU RecName: Full=Anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase; 
AltName: Full=3-O-glucoside-2''-O-glucosyltransferase; 
Short=Ip3GGT; AltName: Full=Protein dusky; Short=Dy [Ipomoea 
purpurea]
 dbj|BAD95882.1| glucosyltransferase [Ipomoea purpurea]
Length=459

 Score =   333 bits (855),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 178/457 (39%), Positives = 282/457 (62%), Gaps = 13/457 (3%)
 Frame = -3

Query  1506  HVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLAL  1330
             H+ ++P+F  GH++ F +L+NKL+  G +ISF        +++S  N +P     VP+ +
Sbjct  9     HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLES-FNLHPHLISFVPIVV  67

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P++ GLPPG ++T+D P  +  LL  A++  Q  I+ +L +LK   V +DF  +WLP LA
Sbjct  68    PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFT-HWLPSLA  126

Query  1149  AELGIKTIffsvfvalatafatVPAR-LPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
              ++GIK++F+S    L   +A  P R + G  +  T  +M K P  FP  S+  L   EA
Sbjct  127   RKIGIKSVFYSTISPLMHGYALSPERRVVG--KQLTEADMMKAPASFPDPSI-KLHAHEA  183

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             R F         G  + +DR+   ++    +   TC E+E  + DY+++QF+KP+LLAGP
Sbjct  184   RGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKPVLLAGP  243

Query  792   VVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
              +P P+   ++QKW+DWL +F+  +VIYC+FGSE  L+ D+ +EL  GLELTG+PFF  L
Sbjct  244   ALPVPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAAL  303

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
               P   +    +  A+P    E+++GRGI+H  WVQQQ  L H SVGC+V H G++S+ E
Sbjct  304   KPPFETE---SVEAAIPEELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  360

Query  432   GIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE-  256
              +VNDCQ+V+LPQ GDQ +NA++++  +K GVEV + +EDG F +E + KAV+ +M E+ 
Sbjct  361   ALVNDCQIVLLPQVGDQIINARIMSVSLKVGVEVEKGEEDGVFSRESVCKAVKAVMDEKS  420

Query  255   --GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
               G   R N +K + FL++ ++ SK++    + ++D+
Sbjct  421   EIGREVRGNHDKLRGFLMNADLDSKYMDSFNQKLQDL  457



>gb|KDP36254.1| hypothetical protein JCGZ_09819 [Jatropha curcas]
Length=442

 Score =   333 bits (853),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 171/445 (38%), Positives = 270/445 (61%), Gaps = 10/445 (2%)
 Frame = -3

Query  1536  ITNNHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP  1357
             ++N     + H+V+FP+FA GH++PF+ LSN+L+  G+  +F      + ++K       
Sbjct  1     MSNPKKNSIFHIVMFPWFAVGHMTPFLHLSNRLAEKGLSTTFLLPNKAIQQLKHFNLYPD  60

Query  1356  CTQIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDF  1177
                   L +P V+GLP GT++ +D P      L +A++  + Q++ ++ E KP  VI+D 
Sbjct  61    LIAFHSLIIPPVDGLPAGTETASDIPIHLTHFLTIAMDRTRDQVEKVIHEKKPKLVIYDV  120

Query  1176  AQNWLPPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSV  997
             A +W+P +   +GIK I ++V  A + A    PAR    E+  T  E+  PP G+P ++V
Sbjct  121   A-HWIPEITKSVGIKAINYTVVSAASLAIVLNPARKVTLEKPITEAELAVPPSGYPSSTV  179

Query  996   ASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFK  817
               LR  E R  + +   P   G + Y+R+   +    A+  +TC+E E  + DY+ SQ+K
Sbjct  180   V-LRRHEVRSLLFV-SYPFGEGITFYERITNAMKESDALAIRTCHETEGKFCDYIGSQYK  237

Query  816   KPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELT  637
             KP+ L GPV+PEP    L+++W  WL+ FE  +VI+C+FGS+  L+ +Q +EL LG EL 
Sbjct  238   KPVFLTGPVIPEPGKAPLEERWNKWLNGFEKDSVIFCAFGSQIVLEKEQFQELVLGFELA  297

Query  636   GLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCH  457
             GLPF + +  PA +    E   ALP GF +RVKGRGII   WVQQ +IL H SVGC+V H
Sbjct  298   GLPFLVAIKPPAGISTVEE---ALPEGFEKRVKGRGIICGEWVQQLKILDHPSVGCFVNH  354

Query  456   AGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAV  277
              GF S+ E ++++CQ+V++P  GDQ LN + +A+++K  VEV  RDE+G+F KE++ +A+
Sbjct  355   CGFGSMWEALMSNCQVVLVPHLGDQILNTRFMAEELKVAVEV-ERDENGWFSKENLSQAI  413

Query  276   QTIMGEE---GASTRANQEKWKEFL  211
             +++M +E   G   + N  KW+E +
Sbjct  414   KSVMDKESEVGLMVKKNHNKWRETM  438



>ref|XP_004164964.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cucumis sativus]
Length=462

 Score =   333 bits (853),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 176/457 (39%), Positives = 282/457 (62%), Gaps = 9/457 (2%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ ++P+FAFGH+ PF+Q++NKL+  G +IS F  +  +  ++   +       V + +
Sbjct  9     LHIAMYPWFAFGHMIPFLQIANKLANKGHRISIFIPSKTLPELQHFNHFPNLITFVLITV  68

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLM-QPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             P V+GLPPG Q+TAD    +   L +    + +P+I + L ++KP+ + +DFA  W+  L
Sbjct  69    PHVDGLPPGAQTTADISHPSQLPLLMISMDLTEPEIASCLQDIKPNVIFYDFAY-WVTKL  127

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
             A ++GI +I+++V  A+   +            + T ++  +PPPGFP +S+  L   EA
Sbjct  128   ADQMGITSIYYNVVSAVTIGYVQGKIWELSGHDTLTQDDFMQPPPGFPSSSI-KLHAHEA  186

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             ++F  +     + G +++D+       C+A+  K+C E+E P+I Y++++ KKP+LL+G 
Sbjct  187   QNFASLSHLRFSNGIALFDQFSTSFTNCNALALKSCREIEGPFIGYIENELKKPVLLSGA  246

Query  792   VVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
             V  EP +  L+++W  WL++F   +VIYC+FGSE  L   Q +EL LGLEL+ LPF  VL
Sbjct  247   VDLEPLTTSLEERWEKWLAKFHSGSVIYCAFGSECILTKIQFQELLLGLELSNLPFLAVL  306

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
               P  +D    +  ALP GF +R++GRG+++ GWVQQQQIL H S+GC+V H G  S+ E
Sbjct  307   KPPEGIDT---VEAALPEGFEQRIEGRGVVYGGWVQQQQILEHPSIGCFVTHCGAGSLNE  363

Query  432   GIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE-  256
              +V  CQLV+LP   D F  A+ L+  +K GVEV +R+EDG+F KE + KAV+T+M EE 
Sbjct  364   ALVRKCQLVLLPHVSDHFFRARTLSSHLKVGVEVEKREEDGFFSKESVCKAVKTVMDEEN  423

Query  255   --GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
               G   RAN  K +E L+DK+++  +I + +  +R +
Sbjct  424   ESGKEVRANIAKLRELLVDKDLEESYINNFIHKLRSL  460



>gb|KHN41619.1| UDP-glycosyltransferase 79B6 [Glycine soja]
Length=460

 Score =   333 bits (853),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 179/460 (39%), Positives = 276/460 (60%), Gaps = 18/460 (4%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSM-LNSNPCTQIVPLA  1333
             LH+ ++P+ A GH + F+ L NKL++ G KISF +      ++++  L+ N  T  V + 
Sbjct  6     LHIAMYPWLAMGHQTAFLHLCNKLAIRGHKISFITPPKAQAKLEAFNLHPNSIT-FVTIT  64

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P VEGLPP  Q+TAD        +  A++L +  I+ L   LKP  V +DF  +W+P L
Sbjct  65    VPHVEGLPPDAQTTADVTYPLQPQIMTAMDLTKDDIETLR-GLKPDLVFYDFT-HWMPAL  122

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVE-EMKKPPPGFPPTSVASLRTFE  976
             A  LGIK + +    ++   +   PAR    + +  +E ++ +PP G+P +S+  L   E
Sbjct  123   AKSLGIKAVHYCTASSVMVGYTLPPARYH--QGTNLIESDLMEPPEGYPDSSI-KLHAHE  179

Query  975   ARDFVIIFKRPHNGGASV--YDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLL  802
             AR F    KR    G++V  YDR    LN    +  +TC E+E PY+DY++ QF KP+L 
Sbjct  180   ARAFAA--KRKDTFGSNVLFYDRQFIALNEADVLAYRTCREIEGPYLDYIEKQFNKPVLA  237

Query  801   AGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFF  622
              GPV+ +P +  L++K++ WL  FEP +V+YC FGSE  L  +Q +EL LGLELTG+PF 
Sbjct  238   TGPVILDPPTSDLEEKFSTWLGGFEPGSVVYCCFGSECTLGPNQFQELVLGLELTGMPFL  297

Query  621   LVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSS  442
               +  P   +    +  A+P GF ERVKGRG ++ GWV QQ IL H SVGC++ H G  S
Sbjct  298   AAVKAPLGFET---VESAMPEGFEERVKGRGFVYGGWVLQQLILAHPSVGCFITHCGSGS  354

Query  441   VIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMG  262
             + E +VN CQLV+LP  GDQ LNA+++ ++++ GVEV + DEDG + +E + KAV  +M 
Sbjct  355   LSEALVNKCQLVLLPNVGDQILNARMMGNNLEVGVEVEKGDEDGMYTRESVCKAVSIVMD  414

Query  261   EEGAST---RANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
              E  ++   R N  + +E LL+K+++S ++      ++++
Sbjct  415   GENETSKRVRGNHARIRELLLNKDLESSYVDSFCMRLQEI  454



>ref|XP_004505528.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cicer arietinum]
 gb|AGU14090.1| UDP-glycosyltransferase [Cicer arietinum]
Length=465

 Score =   333 bits (853),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 183/458 (40%), Positives = 275/458 (60%), Gaps = 14/458 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ +FP+FA GH + F+ LSNKL+  G KI+FF+      ++K           + + +
Sbjct  7     LHIAMFPWFAMGHQTAFLHLSNKLAKKGHKITFFTPQKAESKLKPFNLHPESITFITITV  66

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P V+ LPP +Q+TAD P      +  A++L +P I++ L+ LKPH V +DF  +W+P + 
Sbjct  67    PHVDPLPPNSQTTADVPYPLQPHIMTAMDLTRPDIESHLLNLKPHIVFYDFT-HWIPSVT  125

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
               LGIK + +    ++   +   PAR     +  T  ++ +PPPG+P +S+  L   EA+
Sbjct  126   KALGIKCLHYCTASSVMVGYTLSPARY-SKGKDLTEFDLMEPPPGYPDSSI-KLFQHEAK  183

Query  969   DFVIIFKRPHNGGASV--YDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
              F    KR    G++V  YDR    LN   A+  +TC E+E PY+DY++  F KP+L +G
Sbjct  184   SFAA--KRTEYFGSNVLFYDRQSIALNEADALGYRTCREIEGPYLDYIQKVFNKPVLASG  241

Query  795   PVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
             PV+ E  +  L++K     ++FE ++V+YC FGSE  LK DQ  EL LGLELTG PFF  
Sbjct  242   PVILEKPNSCLEEKGTYGFNRFEKNSVVYCCFGSECTLKPDQFTELVLGLELTGKPFFAA  301

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             L  P       E   ALP GF +RV G+G +  GWVQQQ IL HSS+GC++ H G  S+ 
Sbjct  302   LKPPFGFATVEE---ALPEGFKKRVAGKGAVFGGWVQQQLILEHSSIGCFITHCGSGSLS  358

Query  435   EGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE  256
             E +VN CQLV+LP  GDQ LNA+++ +++K GVEV  +DE+G+F KE + +AV+ +M +E
Sbjct  359   EALVNKCQLVLLPNVGDQILNARMMGNNLKVGVEV-VKDENGFFTKESVCEAVKIVMDDE  417

Query  255   G---ASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                    R N  K +E LL+K+++S +I    K ++++
Sbjct  418   NEISKEVRGNHAKIREMLLNKDLESSYIDTFCKKLQEI  455



>ref|XP_009610402.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Nicotiana tomentosiformis]
Length=461

 Score =   330 bits (846),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 181/465 (39%), Positives = 277/465 (60%), Gaps = 22/465 (5%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             L  +++P++A GH++ F+ LSNKL+  G  I F      + +++           + + +
Sbjct  6     LTFIMYPWYAMGHLTSFLHLSNKLADRGHTIFFIHPTNTLSKLEKFNLYPQLINFISIKV  65

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P VEGLP G ++T+D       LL  AL+L Q +I++L+ ELKPHF+++DFA  W+P +A
Sbjct  66    PHVEGLPLGAETTSDISIFKQNLLWQALDLTQQKIESLIQELKPHFILYDFAY-WVPLVA  124

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
              + G+K+I +      +  +     + P PE     +E+ +PP GFPP S   L  +EAR
Sbjct  125   RKYGVKSIHYCSITPSSVGYLMRGEK-PTPE-----DEVMEPPLGFPPNSSIKLHKYEAR  178

Query  969   DFVIIFKRPHNGGASVYD--------RVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKK  814
                 +         S           R+L        I  KT  E+E PY ++V+++FKK
Sbjct  179   LIAALHSIGKESSGSGSGSGSVSFTRRLLLAFQDGDIIAFKTTKEIEGPYCEFVENKFKK  238

Query  813   PLLLAGPVVPEPA-SGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELT  637
             P++LAGP++PEP  +  L++  + WL +F+  TVI+C+FGSE  LK +Q +EL LGLELT
Sbjct  239   PVVLAGPILPEPIDTSNLEENLSKWLEKFQEKTVIFCAFGSECKLKKEQFQELVLGLELT  298

Query  636   GLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCH  457
             GLPFF  L  P     A  +  ALP  F ER++G+GI+HSGW +QQ IL H SVGC+V H
Sbjct  299   GLPFFAALKPPFE---AETIEDALPERFKERIEGKGIVHSGWAEQQLILSHPSVGCFVTH  355

Query  456   AGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAV  277
              G +S+ E ++ +CQLV++P  GDQF+NA+L   D++ GVEV R +E+G F +E + KA+
Sbjct  356   CGGNSLSEAMITECQLVLVPNFGDQFINARLFGGDLRVGVEVERDEENGLFTREGVCKAI  415

Query  276   QTIMG---EEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             + +M    EEG   RAN+ KW+EFLL K ++  +I   V+ ++ +
Sbjct  416   KMVMNGDSEEGREIRANRAKWREFLLSKGLEDSYIDAFVQKLQTL  460



>gb|KGN43487.1| hypothetical protein Csa_7G041320 [Cucumis sativus]
Length=473

 Score =   330 bits (847),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 175/457 (38%), Positives = 281/457 (61%), Gaps = 9/457 (2%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ ++P+FAFGH+ PF+Q++NKL+  G +IS F  +  +  ++   +       V + +
Sbjct  20    LHIAMYPWFAFGHMIPFLQIANKLANKGHRISIFIPSKTLPELQHFNHFPNLITFVLITV  79

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLM-QPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             P V+GLPPG Q+TAD    +   L +    + +P+I + L ++KP+ + +DFA  W+  L
Sbjct  80    PHVDGLPPGAQTTADISHPSQLPLLMISMDLTEPEIASCLQDIKPNVIFYDFAY-WVTKL  138

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
             A ++GI +I+++V  A+   +            + T ++  +PPPGFP +S+  L   EA
Sbjct  139   ADQMGITSIYYNVVSAVTVGYVQGKIWELSGHDTLTQDDFMQPPPGFPSSSI-KLHAHEA  197

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             ++F  +     + G +++D+       C+A+  K+C E+E P+I Y++++ KK +LL+G 
Sbjct  198   QNFASLSHLRFSNGIALFDQFSTSFTNCNALALKSCREIEGPFIGYIENELKKHVLLSGA  257

Query  792   VVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
             V  EP +  L+++W  WL++F   +VIYC+FGSE  L   Q +EL LGLEL+ LPF  VL
Sbjct  258   VDLEPLTTSLEERWEKWLAKFHSGSVIYCAFGSECILTKIQFQELLLGLELSNLPFLAVL  317

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
               P  +D    +  ALP GF +R++GRG+++ GWVQQQQIL H S+GC+V H G  S+ E
Sbjct  318   KPPEGIDT---VEAALPEGFEQRIEGRGVVYGGWVQQQQILEHPSIGCFVTHCGAGSLNE  374

Query  432   GIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE-  256
              +V  CQLV+LP   D F  A+ L+  +K GVEV +R+EDG+F KE + KAV+T+M EE 
Sbjct  375   ALVRKCQLVLLPHVSDHFFRARTLSSHLKVGVEVEKREEDGFFSKESVCKAVKTVMDEEN  434

Query  255   --GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
               G   RAN  K +E L+DK+++  +I + +  +R +
Sbjct  435   ESGKEVRANIAKLRELLVDKDLEESYINNFIHKLRSL  471



>ref|NP_200212.1| UDP-glycosyltransferase 79B6 [Arabidopsis thaliana]
 sp|Q9FN26.1|U79B6_ARATH RecName: Full=UDP-glycosyltransferase 79B6 [Arabidopsis thaliana]
 dbj|BAB10731.1| flavonol 3-O-glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAV84494.1| At5g54010 [Arabidopsis thaliana]
 gb|AAW30019.1| At5g54010 [Arabidopsis thaliana]
 gb|AED96438.1| UDP-glycosyltransferase 79B6 [Arabidopsis thaliana]
 gb|AHL38580.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=453

 Score =   330 bits (845),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 177/460 (38%), Positives = 272/460 (59%), Gaps = 19/460 (4%)
 Frame = -3

Query  1518  GDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVP  1339
             G   H  +FP+F FGH++ F+ L+NKL+    KI+F        +++S+     C     
Sbjct  2     GSKFHAFMFPWFGFGHMTAFLHLANKLAEKDHKITFLLPKKARKQLESLNLFPDCIVFQT  61

Query  1338  LALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLP  1159
             L +P+V+GLP G ++T+D P +    L  A++  + Q+K  +   KP  + FDFA +W+P
Sbjct  62    LTIPSVDGLPDGAETTSDIPISLGSFLASAMDRTRIQVKEAVSVGKPDLIFFDFA-HWIP  120

Query  1158  PLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTF  979
              +A E G+K++ F    A   A + VP R        + +++   PPG+P + V  LR  
Sbjct  121   EIAREYGVKSVNFITISAACVAISFVPGR--------SQDDLGSTPPGYPSSKVL-LRGH  171

Query  978   EARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLA  799
             E      +   P   G S Y+R++ GL  C  I  +TC EME  + D++++QF++ +LL 
Sbjct  172   ETNSLSFL-SYPFGDGTSFYERIMIGLKNCDVISIRTCQEMEGKFCDFIENQFQRKVLLT  230

Query  798   GPVVPEP-ASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFF  622
             GP++PEP  S  L+ +W  WLS+F+P +VIYC+ GS+  L+ DQ +EL LG+ELTGLPF 
Sbjct  231   GPMLPEPDNSKPLEDQWRQWLSKFDPGSVIYCALGSQIILEKDQFQELCLGMELTGLPFL  290

Query  621   LVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSS  442
             + +  P     +S +  ALP GF ERVK RG++  GWVQQ  IL H S+GC+V H GF S
Sbjct  291   VAVKPPKG---SSTIQEALPKGFEERVKARGVVWGGWVQQPLILAHPSIGCFVSHCGFGS  347

Query  441   VIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM-  265
             + E +VNDCQ+V +P  G+Q LN +L+++++K  VEV +R+E G+F KE +  AV+++M 
Sbjct  348   MWEALVNDCQIVFIPHLGEQILNTRLMSEELKVSVEV-KREETGWFSKESLSGAVRSVMD  406

Query  264   --GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                E G   R N  KWKE LL   + S ++   V+ +  +
Sbjct  407   RDSELGNWARRNHVKWKESLLRHGLMSGYLNKFVEALEKL  446



>gb|EPS67374.1| hypothetical protein M569_07398, partial [Genlisea aurea]
Length=459

 Score =   330 bits (845),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 187/459 (41%), Positives = 276/459 (60%), Gaps = 17/459 (4%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHG-VKISFFSAAGNVDRIKSMLNSNPCTQIVPLA  1333
             LH+ +FP+ A GHI+PF+ L+N+L+  G   +S    +  +D ++         +   +A
Sbjct  7     LHIAMFPWIAMGHITPFIHLANELAKRGGHSVSVLLPSKPLDLLRRHNLYPNLVKFHVVA  66

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P  + LP G Q+ +D    A + L  A + M P++ A+L  L+P  V +DFA +W+P L
Sbjct  67    VPPTDSLPAGAQTASDIDSTAKDPLANAFDAMGPEVAAILRTLRPDVVFYDFA-DWIPGL  125

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
             AAE+G KT+ ++V  A   A   VPAR    +R  TVEE+ +PP G+P ++V  LR  EA
Sbjct  126   AAEIGFKTVCYNVICASVMAIGVVPARRIPEDRPLTVEELAQPPKGYPSSTVV-LRGQEA  184

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
                 + F     G    + R+ A +N C AI  +T  E+E P +DY+  Q+ KP+ L+GP
Sbjct  185   --LTLSFIGMDYGSTKFHVRISAAMNNCDAIGIRTIRELEGPMVDYLSQQYGKPVFLSGP  242

Query  792   VVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
             ++P+   G L++KW  WL+QF P +V+YC+FGS+  LK  Q +EL LG ELTGLPFF+ L
Sbjct  243   LLPKEPEGDLEEKWDRWLNQFRPKSVVYCAFGSQMTLKKSQFQELLLGFELTGLPFFVAL  302

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
             + P  VD   E   ALP GF ERV  RG++H GWVQQ QIL H SVGC+V H GF S+ E
Sbjct  303   SKPHGVDSIEE---ALPEGFRERVGDRGVVHGGWVQQTQILNHPSVGCFVSHCGFGSMWE  359

Query  432   GIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEEG  253
              +++D Q+V++P+  DQ LN +LLA+D+K  VEV R D  G+F +ED+  A+++ M E+ 
Sbjct  360   SLLSDPQIVLVPKLADQILNTRLLAEDLKVAVEVPRGDM-GWFSREDLCSAIRSAMIEDE  418

Query  252   A----STRANQEKWKEFLLDKEIQ----SKFIKDLVKVM  160
             A    S + N  +W+E L            FI DL +++
Sbjct  419   AGVAGSLKLNHGRWREKLAGAGFMDGYADGFIDDLHRLL  457



>ref|XP_004144601.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cucumis sativus]
Length=462

 Score =   330 bits (845),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 175/457 (38%), Positives = 281/457 (61%), Gaps = 9/457 (2%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ ++P+FAFGH+ PF+Q++NKL+  G +IS F  +  +  ++   +       V + +
Sbjct  9     LHIAMYPWFAFGHMIPFLQIANKLANKGHRISIFIPSKTLPELQHFNHFPNLITFVLITV  68

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLM-QPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             P V+GLPPG Q+TAD    +   L +    + +P+I + L ++KP+ + +DFA  W+  L
Sbjct  69    PHVDGLPPGAQTTADISHPSQLPLLMISMDLTEPEIASCLQDIKPNVIFYDFAY-WVTKL  127

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
             A ++GI +I+++V  A+   +            + T ++  +PPPGFP +S+  L   EA
Sbjct  128   ADQMGITSIYYNVVSAVTVGYVQGKIWELSGHDTLTQDDFMQPPPGFPSSSI-KLHAHEA  186

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             ++F  +     + G +++D+       C+A+  K+C E+E P+I Y++++ KK +LL+G 
Sbjct  187   QNFASLSHLRFSNGIALFDQFSTSFTNCNALALKSCREIEGPFIGYIENELKKHVLLSGA  246

Query  792   VVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
             V  EP +  L+++W  WL++F   +VIYC+FGSE  L   Q +EL LGLEL+ LPF  VL
Sbjct  247   VDLEPLTTSLEERWEKWLAKFHSGSVIYCAFGSECILTKIQFQELLLGLELSNLPFLAVL  306

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
               P  +D    +  ALP GF +R++GRG+++ GWVQQQQIL H S+GC+V H G  S+ E
Sbjct  307   KPPEGIDT---VEAALPEGFEQRIEGRGVVYGGWVQQQQILEHPSIGCFVTHCGAGSLNE  363

Query  432   GIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE-  256
              +V  CQLV+LP   D F  A+ L+  +K GVEV +R+EDG+F KE + KAV+T+M EE 
Sbjct  364   ALVRKCQLVLLPHVSDHFFRARTLSSHLKVGVEVEKREEDGFFSKESVCKAVKTVMDEEN  423

Query  255   --GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
               G   RAN  K +E L+DK+++  +I + +  +R +
Sbjct  424   ESGKEVRANIAKLRELLVDKDLEESYINNFIHKLRSL  460



>ref|XP_009767952.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Nicotiana sylvestris]
Length=469

 Score =   329 bits (844),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 185/477 (39%), Positives = 280/477 (59%), Gaps = 38/477 (8%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             L  V++P++A GH++ F+ LSNKL+  G  I F      + +++           + + +
Sbjct  6     LTFVMYPWYAMGHLTSFLHLSNKLADRGHTIFFIHPTNTLSKLEKFNLYPQLINFISITV  65

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P VEGLP G ++T+D P     LL  AL+L Q +I++L+ ELKPHF+++DFA  W+P +A
Sbjct  66    PHVEGLPIGAETTSDIPIFKQNLLWQALDLTQQKIESLIQELKPHFILYDFAY-WVPLVA  124

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
              + G+K+I +      +  +     + P PE     +EM +PP GFPP S   L  +EAR
Sbjct  125   RKYGVKSIHYCSITPSSVGYLMRGEK-PTPE-----DEMMEPPLGFPPNSSIKLHKYEAR  178

Query  969   DFVIIFKRPHNGGASVYD--------------------RVLAGLNGCSAILAKTCYEMEA  850
                 +    H+ G                         R+L        I  KT  E+E 
Sbjct  179   LIAAL----HSIGKESSGSGSGLGSGSGSGSGSVSFTRRLLLAFQDGDVIAFKTTKEIEG  234

Query  849   PYIDYVKSQFKKPLLLAGPVVPEPA-SGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDD  673
             PY ++V+++FKKP++LAGP++PEP  +  L++  + WL +F+  TVI+C+FGSE  LK +
Sbjct  235   PYCEFVENKFKKPVILAGPILPEPIDTSNLEENLSKWLEKFQEKTVIFCAFGSECKLKKE  294

Query  672   QIKELALGLELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQI  493
             Q +EL LGLELTGLPFF  L  P     A  +  ALP GF ER++G+GI+HSGW +QQ I
Sbjct  295   QFQELVLGLELTGLPFFAALKPPFE---AETIEDALPEGFKERIEGKGIVHSGWAEQQLI  351

Query  492   LVHSSVGCYVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDED  313
             L H SVGC+V H G +S+ E ++ + QLV++P  GDQF+NA+L   D++ GVEV R +E+
Sbjct  352   LSHPSVGCFVTHCGGNSLSEAMITEGQLVLVPNFGDQFVNARLFGGDLRVGVEVERDEEN  411

Query  312   GYFWKEDIQKAVQTIMG---EEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             G F +E + KA++ +M    EEG   RAN+ KW+EFLL K ++  +I   V+ ++ +
Sbjct  412   GLFTRESVCKAIKMVMNDESEEGREIRANRAKWREFLLSKGLEDSYIDAFVQKLQTL  468



>ref|XP_010098447.1| UDP-glycosyltransferase [Morus notabilis]
 gb|EXB75038.1| UDP-glycosyltransferase [Morus notabilis]
Length=459

 Score =   329 bits (843),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 182/455 (40%), Positives = 272/455 (60%), Gaps = 12/455 (3%)
 Frame = -3

Query  1503  VVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLALP  1327
             V +FP+FA GHI+PF+ ++N+L+V G +IS          +   LN +P       + +P
Sbjct  6     VAMFPWFATGHIAPFIHVANELAVRGHRISIL-LPKKAQILLQHLNLHPNLITFHTITVP  64

Query  1326  AVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLAA  1147
              V+GLPPG ++ +D   +   LL  A++L +PQ+   L   KP  V +DFA +W+P + A
Sbjct  65    HVDGLPPGVETASDIHLSKTHLLAAAMDLTRPQVHDFLSAAKPQIVFYDFA-HWVPDITA  123

Query  1146  ELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEARD  967
              +G  ++ +SV  A + A A VPAR    +R+ TVE++K PPPG+P ++V  LR  E R 
Sbjct  124   HIGAISVCYSVVSASSLAIALVPARNVPCDRTVTVEDIKDPPPGYPSSTVV-LRGPEVRS  182

Query  966   FVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPVV  787
              + I   P   G + Y+R    +     +  +TC E+E    DY+ SQ+KKPLLL GPV+
Sbjct  183   LLFI-SLPFGDGITFYERTTTAMRNADVLSIRTCREVEGELCDYIASQYKKPLLLTGPVL  241

Query  786   PEPASGV-LDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLN  610
              EP     L+ +W +WL++F+P +V++C+FGS+  LK DQ +EL LG E T  PF + L 
Sbjct  242   SEPTDTTPLEVRWTEWLNRFKPGSVVFCAFGSQHILKKDQFQELLLGFESTDFPFLIALK  301

Query  609   FPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEG  430
              P   +   E   A P GF ERVKGRGI++ GWVQQ  IL H SVGC+V H GF S+ E 
Sbjct  302   PPVGCETVEE---AFPVGFAERVKGRGIVYGGWVQQPLILNHPSVGCFVNHCGFGSMWEA  358

Query  429   IVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE--  256
             +++  Q+V++P  GDQ LN KLLA ++K  VEV +  E G+F KE ++KA+++++ E+  
Sbjct  359   LLSKNQIVLVPHLGDQILNTKLLAKEIKVAVEVEKELESGWFSKESLRKAIKSVVDEDSE  418

Query  255   -GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRD  154
              G   R N  KW++ L      S +I + VK + +
Sbjct  419   VGIMVRKNHAKWRDLLGKPGFISGYIDEFVKNLEE  453



>ref|XP_009352834.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Pyrus x bretschneideri]
Length=471

 Score =   329 bits (844),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 189/471 (40%), Positives = 267/471 (57%), Gaps = 32/471 (7%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             LH+ ++P+FA GH++ ++ LSNKL+  G +ISFF       ++++ LN +P     +P+ 
Sbjct  10    LHIAMYPWFAMGHLTSYLHLSNKLAERGHRISFFVPTKTQQKLQA-LNLHPHLISFIPIT  68

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P V+GLPPG ++T D P  +  LL  A++L QP I  L+ EL P+FV FDF   WLP L
Sbjct  69    VPHVDGLPPGAETTNDVPFPSYSLLMDAMDLTQPAILQLICELNPNFVFFDFTP-WLPKL  127

Query  1152  AAELGIKTIffsvfva--latafatVPARLPGPERSPTVEE------------MKKPPPG  1015
               +LG         +       +   P R    E+S   E+                   
Sbjct  128   LRQLGTGIKSIYYIIISPAIVGYVRSPERKVLMEKSVLTEDDLINDLINPPPSFPPSSIK  187

Query  1014  FPPTSVASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDY  835
              P      L  F  ++F         G     +R +  LN C A   +TC EME  Y DY
Sbjct  188   LPAYGTRMLAPFLLKEF---------GSGKFIERQIISLNDCDAAAFRTCREMEGKYCDY  238

Query  834   VKSQFKKPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELA  655
             +++Q +KP+LLAGPVVPE  +  LD+KWA WL +FE  +VIYC+FG+E  LK DQ +EL 
Sbjct  239   LETQLRKPVLLAGPVVPETPTAELDEKWAKWLERFEAKSVIYCAFGTECVLKIDQFQELL  298

Query  654   LGLELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSV  475
             LG ELTGLPFF  L  P  V+    +  ALP GF  RVKGRG++  GWVQQ  +L H SV
Sbjct  299   LGFELTGLPFFAALKLPMGVEA---IESALPEGFEGRVKGRGVVSWGWVQQPLMLKHPSV  355

Query  474   GCYVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKE  295
             GC+V H G SS++EG+V++CQLV+LP   DQ   A+++  D++ GVEV + +EDG F KE
Sbjct  356   GCFVTHCGPSSLMEGLVSECQLVLLPNAVDQISLARVMGRDLRVGVEVEKGEEDGDFTKE  415

Query  294   DIQKAVQTIMGEE---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
              + KAV+ +M EE   G   R N  KW+E L  K +++ +I   V+ +  +
Sbjct  416   GVCKAVRDVMDEESEVGKEVRRNHAKWRELLSSKGLENSYIDSFVEKLHAL  466



>ref|XP_006401633.1| hypothetical protein EUTSA_v10013535mg [Eutrema salsugineum]
 gb|ESQ43086.1| hypothetical protein EUTSA_v10013535mg [Eutrema salsugineum]
Length=447

 Score =   328 bits (841),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 176/462 (38%), Positives = 277/462 (60%), Gaps = 23/462 (5%)
 Frame = -3

Query  1518  GDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIV-  1342
             G   H  +FP+F FGH++ F+ L+NKL+  G KI+F      + +++  LN  P  +IV 
Sbjct  2     GSKFHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKALKQLEP-LNLFP-NRIVF  59

Query  1341  -PLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNW  1165
               + +P+VEGLP G ++T+D P +    L  A++  + Q+K  +   KP  + FDFA +W
Sbjct  60    DTITVPSVEGLPAGAETTSDIPISLGSFLASAMDRTRNQVKERVSMSKPDLIFFDFA-HW  118

Query  1164  LPPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLR  985
             +P +A E G K++ F    A   A +  P R P        +++  PPPG+P + V  LR
Sbjct  119   IPEIAREYGAKSVNFVTISAACVAISFSPGRSP--------DDLAVPPPGYPSSKVL-LR  169

Query  984   TFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLL  805
               E      +   P   G + Y+R++ GL  C  I  +TC EME  + D+++SQF++ +L
Sbjct  170   GQETNSLSFL-SYPFGDGTTFYERIMTGLTHCDVISIRTCQEMEGKFCDFIESQFQRKVL  228

Query  804   LAGPVVPEP-ASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLP  628
             L GP++P+P  S  LD++ + WL QFEP +V+YC+ GS+  L+ DQ +EL LG+ELTGLP
Sbjct  229   LTGPMLPDPDNSKPLDEQRSHWLRQFEPESVVYCALGSQIILEKDQFQELCLGMELTGLP  288

Query  627   FFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGF  448
             F + +  P     AS +  ALP GF ERVKGRG++  GWVQQ  IL H S+GC+V H GF
Sbjct  289   FLVAVKPPKG---ASTIQEALPKGFEERVKGRGVVWGGWVQQPLILAHPSIGCFVSHCGF  345

Query  447   SSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTI  268
              S+ E +VNDCQ+V +P  G+Q  N +L++++++  VEV +R+E G+F KE +  A++++
Sbjct  346   GSMWESLVNDCQIVFIPHLGEQIFNTRLMSEELEVSVEV-KREETGWFSKESLSGAIRSV  404

Query  267   M---GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             M    E G   R N  KWKE ++   + + ++ + ++ +  +
Sbjct  405   MDKDSELGNLVRRNHAKWKESIVSSGLMNGYVNNFIEALEKL  446



>ref|XP_010674067.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Beta vulgaris subsp. 
vulgaris]
Length=458

 Score =   328 bits (841),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 180/457 (39%), Positives = 281/457 (61%), Gaps = 13/457 (3%)
 Frame = -3

Query  1518  GDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVP  1339
             G  LH+V+FP+FA GH++PF+ LSNKL+ +G KI+F        +++ +L       + P
Sbjct  2     GKQLHIVMFPWFAIGHMTPFLHLSNKLAEYGHKITFLIPKKAKHQLEHLLLYPSLITLHP  61

Query  1338  LALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVEL--KPHFVIFDFAQNW  1165
             + +P V  LPPG ++ ++ P      L  AL+L +P++++ ++ L  KPH + +D A  W
Sbjct  62    ITIPHVHPLPPGIETASEIPLHLNNHLATALDLTRPEVESFIITLQPKPHVLFYDMAY-W  120

Query  1164  LPPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLR  985
             +P +A++L IK++ ++V  A + A A VPA   G  +  T E++ KPPPG+P ++V    
Sbjct  121   VPEIASKLQIKSVCYNVVCAASLAIALVPALNVGRYQPFTEEDVAKPPPGYPSSNVV-FH  179

Query  984   TFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLL  805
               EAR  + +       G + YDR+   L  C AI  +TC E+E  + +Y+ SQ+ KP+L
Sbjct  180   GPEARSLLFL-GLEFGSGLTFYDRMSTALKSCDAIAIRTCREIEDNFCNYISSQYNKPVL  238

Query  804   LAGPVVPEPASG-VLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLP  628
             L GPV+PE  +   L+ +WA+WLS+FEP++V++C+FGS+  L+ DQ +EL LG E+T +P
Sbjct  239   LTGPVLPETNNNNPLEARWAEWLSRFEPNSVVFCAFGSQFILEKDQFQELLLGFEMTMVP  298

Query  627   FFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGF  448
             F + L  P       E   ALP GF ERV  RG++H GWVQQ  IL H SVGC+V H GF
Sbjct  299   FLVALKPPQGCGSVEE---ALPEGFKERVGERGVVHGGWVQQPLILAHPSVGCFVNHCGF  355

Query  447   SSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTI  268
              S+ E ++ + Q+VM+PQ GDQ LN +L++ ++  GVEV  R E+G+  KE + KA++++
Sbjct  356   GSMWESLMAESQIVMVPQLGDQILNTRLMSGELVVGVEV-ERTENGWVSKESLCKAIKSV  414

Query  267   MGEE---GASTRANQEKWKEFLLDKEIQSKFIKDLVK  166
             MGE+   G   R N   W++ ++ +     +I   VK
Sbjct  415   MGEDSEVGCLVRNNHANWRQIMVSQGFMRGYIDSFVK  451



>ref|XP_010537036.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Tarenaya hassleriana]
Length=461

 Score =   328 bits (841),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 176/466 (38%), Positives = 291/466 (62%), Gaps = 13/466 (3%)
 Frame = -3

Query  1521  GGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIV  1342
             GG  +HV++FP+FAFGH++PF+ L+NKL+  G K+++       +++++ LN +P +   
Sbjct  2     GGSKIHVLMFPWFAFGHMTPFLHLANKLAEKGHKVTYLLPKKAQEQLEN-LNLHPESISF  60

Query  1341  PL-ALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNW  1165
              L ++P+V  LP G ++ +D P + +  L  A++L + Q++A +  LKP  + +DFA +W
Sbjct  61    NLVSVPSVNDLPAGAETASDIPISLSSSLASAMDLTRDQVEARVHALKPDLIFYDFA-HW  119

Query  1164  LPPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLR  985
             +P +A  +G+KT+ +    A   A + VP  +   +   T +E+  PPPG+P + V   R
Sbjct  120   IPEIAQRIGVKTVCYVTVSAATVAISLVPGLISSRDGPKTEDELVIPPPGYPSSKVVFYR  179

Query  984   TFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLL  805
               EAR  + +   P   G + Y+RV+  L  C AI  +T  E+E  + +Y++SQ++K +L
Sbjct  180   -HEARTLLFL-SLPFGDGTTFYERVIMALTKCDAICLRTYKELERKFCEYIESQYQKKVL  237

Query  804   LAGPVVPEP-ASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLP  628
             L GP++P+P  +  L+ +W++WLS FEP +V++C+ GS+  L+ DQ +EL LGLELTGLP
Sbjct  238   LTGPMLPDPDKTKPLEDRWSNWLSVFEPGSVVFCALGSQIILEKDQFQELCLGLELTGLP  297

Query  627   FFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGF  448
             F  VL  P      S +  A P GF ERVK RG+I+ GW+QQ  IL H SVGC+V H GF
Sbjct  298   FLAVLKPPNG---TSAIQEAFPKGFEERVKDRGVIYGGWIQQPLILSHPSVGCFVSHCGF  354

Query  447   SSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTI  268
              S+ E +++D Q+V++P  GDQ LN +L+A+++K  VEV+ RD+ G+F KE +  A+ ++
Sbjct  355   GSMWESLMSDSQIVLIPHLGDQILNTRLMAEELKVAVEVH-RDKTGWFSKESLSHAIASV  413

Query  267   M---GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
             +    E G   R N++  KE L+   + S ++ + V+ ++++   N
Sbjct  414   VDKDSETGTFLRKNRQMLKETLVSPGLTSCYVDNFVEELQNLVHTN  459



>ref|XP_010442976.1| PREDICTED: UDP-glycosyltransferase 79B6 isoform X1 [Camelina 
sativa]
Length=447

 Score =   327 bits (839),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 172/457 (38%), Positives = 271/457 (59%), Gaps = 19/457 (4%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
              H  +FP+F FGH++ F+ L+NKL+  G KI+F      + ++K +     C     L +
Sbjct  5     FHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKALKQLKPLNIFPDCIVFHTLTI  64

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P+V+GLP G ++T+D P ++   L  A++  + Q++  +   KP  + FDFA +W+P +A
Sbjct  65    PSVDGLPAGAETTSDIPISSGSFLASAMDQTRNQVEEAVSIGKPDLIFFDFA-HWIPEIA  123

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
              E G K++ F    A   A + VP R P        +++  PPPG+P + V  LR  E  
Sbjct  124   RECGAKSVNFITISAACVAISFVPGRSP--------DDLAVPPPGYPSSKVL-LRRQETN  174

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
              F  +   P     + Y+R++ GL  C  I  +TC EME  + D+++SQF++ +LL GP+
Sbjct  175   CFSFL-SHPFGDNTTFYERIMIGLKNCDVISIRTCREMEGKFCDFIQSQFQREVLLTGPM  233

Query  789   VPEP-ASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
             +PEP  S  L+ +W  WLS+FEP +V+YC+ GS+  L+ DQ +EL LG+ELTGLPF + +
Sbjct  234   LPEPYNSKPLEDQWRQWLSRFEPGSVVYCALGSQIILEKDQFQELCLGMELTGLPFLVAV  293

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
               P     +S +  ALP GF ERVKGRG++  GWVQQ  IL H S+GC+V H GF S+ E
Sbjct  294   KPPKG---SSTIQEALPNGFEERVKGRGVVWGGWVQQPLILAHPSIGCFVSHCGFGSMWE  350

Query  432   GIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM---G  262
              +VNDCQ V +P  G+Q  N +L++++++  VEV R D  G+F KE +  +++++M    
Sbjct  351   ALVNDCQTVFIPHLGEQIFNTRLMSEELEVSVEVKRED-SGWFSKESLSGSIRSVMDKDS  409

Query  261   EEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             E G   R N  KWKE L+   + + ++   ++ ++ +
Sbjct  410   ELGYLVRRNHAKWKESLVSTGLMNGYVNKFIEALQKL  446



>dbj|BAN91400.1| flavonol 3-O-glucoside (1->6) rhamnosyltransferase [Glycine max]
Length=314

 Score =   322 bits (826),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 178/319 (56%), Positives = 231/319 (72%), Gaps = 9/319 (3%)
 Frame = -3

Query  1548  MEREITNNHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSML  1369
             M  E+  N+  D LHVV+FPF AFGHISPFVQLSNKL  HGV ++F SAA N+ RI+S L
Sbjct  1     MPSELAMNN--DELHVVMFPFLAFGHISPFVQLSNKLFSHGVHVTFLSAASNIPRIRSTL  58

Query  1368  NSNPCTQIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFV  1189
             N NP   ++ L  P       G  +TA+ PP  A  L  AL+L Q Q+K+LL+ELKPH+V
Sbjct  59    NLNPAINVISLKFPN------GITNTAELPPHLAGNLIHALDLTQDQVKSLLLELKPHYV  112

Query  1188  IFDFAQNWLPPLAAELGIKTIffsvfvalatafatVPARLPGPE-RSPTVEEMKKPPPGF  1012
              FDFAQ+WLP LA+E+GIK++ FSV+ A++ A+ TVP+R    E R+ T E++KKPPPG+
Sbjct  113   FFDFAQHWLPKLASEVGIKSVHFSVYSAISDAYITVPSRFADVEGRNITFEDLKKPPPGY  172

Query  1011  PPTSVASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYV  832
             P  S  SL+ FEA DF+ +F R      + Y+RVL  L  CS I+ KTC E+E PY+DY+
Sbjct  173   PQNSNISLKAFEAMDFMFLFTRFGEKNLTGYERVLQSLGECSFIVFKTCKEIEGPYLDYI  232

Query  831   KSQFKKPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELAL  652
             ++QF+KP+LL+GP+VPEP++ VL++KW+ WL  F   +VI CSFGSETFL D QIKELA 
Sbjct  233   ETQFRKPVLLSGPLVPEPSTDVLEEKWSKWLDGFPAKSVILCSFGSETFLSDYQIKELAS  292

Query  651   GLELTGLPFFLVLNFPANV  595
             GLELTGLPF LVLNFP+N+
Sbjct  293   GLELTGLPFILVLNFPSNL  311



>dbj|BAD95885.1| glucosyltransferase [Ipomoea nil]
Length=464

 Score =   327 bits (839),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 175/441 (40%), Positives = 270/441 (61%), Gaps = 11/441 (2%)
 Frame = -3

Query  1506  HVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLALP  1327
             H+ ++P+F  GH++ F +L+NKL+  G +ISF        +++S          VP+ +P
Sbjct  9     HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  68

Query  1326  AVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLAA  1147
             ++ GLPPG ++T+D P  +  LL  A++  Q  I+ +L +LK   V +DF  +WLP LA 
Sbjct  69    SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFT-HWLPSLAR  127

Query  1146  ELGIKTIffsvfvalatafatVPAR-LPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
             ++GIK++F+S    L   +A  P R + G  +  T  +M K P  FP  S+  L   EAR
Sbjct  128   KIGIKSVFYSTISPLMHGYALSPERRVVG--KQLTEADMMKAPASFPDPSI-KLHAHEAR  184

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
              F         G  + +DR+   ++    +   TC E+E  + DY+++QF+KP+LLAGP 
Sbjct  185   GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKPVLLAGPA  244

Query  789   VPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLN  610
             +P P+   ++QKW+DWL +F+  +VIYC+FGSE  L+ D+ +EL  GLELTG+PFF  L 
Sbjct  245   LPVPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  304

Query  609   FPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEG  430
              P     A  +  A+P    E+++GRGI+H  WVQQQ  L H SVGC+V H G++S+ E 
Sbjct  305   PPFE---AESIEAAIPEELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEA  361

Query  429   IVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE--  256
             +VNDCQ+V+LPQ GDQ +NA++++  +K GVEV + +EDG F +E + KAV+ +M E+  
Sbjct  362   LVNDCQIVLLPQVGDQIINARIMSVSLKVGVEVEKGEEDGVFSRESVCKAVKAVMDEKSE  421

Query  255   -GASTRANQEKWKEFLLDKEI  196
              G   R N +K + FLL+ ++
Sbjct  422   IGREVRGNHDKLRGFLLNADL  442



>ref|XP_007132923.1| hypothetical protein PHAVU_011G136400g [Phaseolus vulgaris]
 gb|ESW04917.1| hypothetical protein PHAVU_011G136400g [Phaseolus vulgaris]
Length=461

 Score =   327 bits (838),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 168/458 (37%), Positives = 270/458 (59%), Gaps = 11/458 (2%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ ++P+FA GHIS ++ L+NKL+  G KISF        +++           +P+ +
Sbjct  8     LHIAMYPWFAIGHISAYLHLANKLAKRGHKISFIVPKLTKSKVEHFNLYPQLVTFIPITM  67

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P V+GLPP  ++T D   +  +L+   ++  +  I+ LL+ELKP+ V FD+   W+P LA
Sbjct  68    PLVDGLPPHAETTFDATISLGKLIMTGMDRTEKDIELLLLELKPNIVFFDYT-CWMPNLA  126

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMK--KPPPGFPPTSVASLRTFE  976
               LGIK++ +     +  ++     +    E++    E+    PP GFP  S+  L+  E
Sbjct  127   RSLGIKSVHYITLSMIFESYMECMEK-QFSEKNIAEHELNLLNPPAGFPDPSI-KLQAHE  184

Query  975   ARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
              R    +       G   YDR+        A+  + C E+E  Y D+++  + KPLLL+G
Sbjct  185   VRQLTSVVNSEFGSGVRYYDRISTSTRLSDAVAFRGCREIEGLYADFLEISYGKPLLLSG  244

Query  795   PVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
             PV+PEP +  L+++WA+WLS F+  +V+YC+FGSE  L  DQ+KEL +GLELTG PF   
Sbjct  245   PVIPEPHTSPLEEEWAEWLSGFKEESVVYCAFGSECRLHQDQLKELLVGLELTGFPFLAA  304

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             L  P   +    +  A+P GF+ERV+GRGI+H  WVQQ  IL H S+GC++ H G +S++
Sbjct  305   LKAPIGFE---SVEAAMPKGFSERVRGRGIVHGSWVQQTLILDHPSIGCFITHCGVASLL  361

Query  435   EGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM---  265
             E +V++CQ+V+LP   DQ LNA++++  +KAGV+V + +EDG F KE +  AV+T+M   
Sbjct  362   EALVSNCQIVVLPNFIDQLLNARMISSSIKAGVQVEKGEEDGLFTKESVCAAVKTVMDLE  421

Query  264   GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
              E G   R N  K +  LL K++++ ++    + ++++
Sbjct  422   SEVGREVRENHLKLRNLLLTKDLENTYLDGFCQKLQEL  459



>ref|XP_004236775.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase 
isoform X3 [Solanum lycopersicum]
Length=463

 Score =   327 bits (838),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 184/463 (40%), Positives = 281/463 (61%), Gaps = 21/463 (5%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             L +V+FP+ A GHI PF+ LSN+L+  G KISF        +++++           L +
Sbjct  9     LQIVMFPWLALGHIIPFLNLSNELAKKGHKISFLLPKNAQIKLQNLNLYPNLITFHTLKI  68

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P + GLP G ++TAD P +   LL  A++ +  +IK+ L  LKPHFV FDFA +W+  +A
Sbjct  69    PHIHGLPYGAETTADVPRSLETLLATAMDELYDEIKSFLQNLKPHFVFFDFA-HWVTEIA  127

Query  1149  AELG-IKTIffsvfvalatafatVPARLPGPERS----PTVEEMKKPPPGFPPTSVASLR  985
              E+G I TI + +     +A     + +  PE+S     T  E  +PPPG+P T+V  L 
Sbjct  128   LEIGDINTICYKLTSPATSAI----SLIRSPEKSVFMASTAAEKVRPPPGYPSTTVV-LH  182

Query  984   TFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLL  805
               EA+    +F+  +  G ++Y+R+  G+  C AI  KTC E+E  + DY+ +QFKKP+L
Sbjct  183   EHEAKLLEFLFQE-YGKGVTIYERLTKGMTLCDAIALKTCREIEGTFGDYIATQFKKPVL  241

Query  804   LAGPVVPEPASGVL-DQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLP  628
               GPV+P+P  G L +   ++WL +FEP +V++C+FGS+  L+  Q +EL LGLELTGLP
Sbjct  242   YTGPVLPDPEKGPLAEHGLSNWLEKFEPGSVVFCAFGSQLILEKKQFQELVLGLELTGLP  301

Query  627   FFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGF  448
             F +VL  P   +   E   ALP GF ERV+ +G++ + WV Q +IL H SVGC+V H G+
Sbjct  302   FLVVLKPPEGTNSVEE---ALPEGFKERVQEKGLVLACWVPQLKILTHKSVGCFVSHCGY  358

Query  447   SSVIEGI-VNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQT  271
              S+ E + + DCQLV+LP   DQ L+A+++  D+K GVEV ++DE+G+F KE + KAV+ 
Sbjct  359   GSMWESLALCDCQLVLLPSANDQTLSARMMEQDLKVGVEV-KKDENGWFSKESLCKAVKC  417

Query  270   IMGEE---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             +M ++   G   + N  KWKE L      S +I   ++++ ++
Sbjct  418   VMDKDSQVGCLVKENHRKWKEVLSSPGFMSNYIDSFIQILYEL  460



>dbj|BAD95884.1| glucosyltransferase [Ipomoea nil]
Length=464

 Score =   327 bits (838),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 175/441 (40%), Positives = 270/441 (61%), Gaps = 11/441 (2%)
 Frame = -3

Query  1506  HVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLALP  1327
             H+ ++P+F  GH++ F +L+NKL+  G +ISF        +++S          VP+ +P
Sbjct  9     HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  68

Query  1326  AVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLAA  1147
             ++ GLPPG ++T+D P  +  LL  A++  Q  I+ +L +LK   V +DF  +WLP LA 
Sbjct  69    SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFT-HWLPSLAR  127

Query  1146  ELGIKTIffsvfvalatafatVPAR-LPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
             ++GIK++F+S    L   +A  P R + G  +  T  +M K P  FP  S+  L   EAR
Sbjct  128   KIGIKSVFYSTISPLMHGYALSPERRVVG--KQLTEADMMKAPASFPDPSI-KLHAHEAR  184

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
              F         G  + +DR+   ++    +   TC E+E  + DY+++QF+KP+LLAGP 
Sbjct  185   GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKPVLLAGPA  244

Query  789   VPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLN  610
             +P P+   ++QKW+DWL +F+  +VIYC+FGSE  L+ D+ +EL  GLELTG+PFF  L 
Sbjct  245   LPVPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  304

Query  609   FPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEG  430
              P     A  +  A+P    E+++GRGI+H  WVQQQ  L H SVGC+V H G++S+ E 
Sbjct  305   PPFE---AESIEAAIPEELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEA  361

Query  429   IVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE--  256
             +VNDCQ+V+LPQ GDQ +NA++++  +K GVEV + +EDG F +E + KAV+ +M E+  
Sbjct  362   LVNDCQIVLLPQVGDQIINARIMSVSLKVGVEVEKGEEDGVFSRESVCKAVKAVMDEKSE  421

Query  255   -GASTRANQEKWKEFLLDKEI  196
              G   R N +K + FLL+ ++
Sbjct  422   IGREVRGNHDKLRGFLLNADL  442



>gb|AES66918.2| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=476

 Score =   327 bits (838),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 186/460 (40%), Positives = 277/460 (60%), Gaps = 16/460 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ +FP+FA GH++P++ LSNKL+  G KISFF       +++            PL +
Sbjct  24    LHIAMFPWFAMGHLTPYLHLSNKLAKRGHKISFFIPKKTQTKLEQFNLYPNLITFYPLNV  83

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P + GLP G ++T+D   +   L+  A++  QPQ++ LL +L P  V FDF   WLP +A
Sbjct  84    PHIHGLPFGAETTSDVSFSLGPLIMTAMDQTQPQVELLLTQLNPEIVFFDFT-FWLPKIA  142

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVE-EMKKPPPGFPPTSVASLRTFEA  973
               LGIK++   +      ++   P+R+   E +   E ++ KPP G+P +S  +L   EA
Sbjct  143   HNLGIKSLQCWIVSPATVSYNASPSRMC--EGTNLTEFDLMKPPKGYPISSF-NLYYHEA  199

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             +   +  K     G   YDR+  GL+   AI  K   E+E PY+DY++ +F KP+LL+GP
Sbjct  200   KHLALKRKLEFGSGIFFYDRIYYGLSLSDAIGFKGIREIEGPYVDYLEQEFGKPVLLSGP  259

Query  792   VVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
             V+PEP   VLD+KW  WL+ F+  +++YC+ GSE+ L   Q  EL LGLELTG PF  +L
Sbjct  260   VLPEPPKTVLDEKWGSWLNGFKDGSLVYCALGSESKLSQKQFHELLLGLELTGYPFLAIL  319

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
               P   +   +   A P GF ERVK +GI+HSGW+QQQ IL HSSVGC+V H G  S+ E
Sbjct  320   KPPIGFETVED---AFPEGFEERVKEKGIVHSGWIQQQLILEHSSVGCFVTHCGAGSLTE  376

Query  432   GIVNDCQLVMLPQ-KGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE  256
             G++N+CQ+V++P   GD   N K++  ++K GVEVN+ DEDG F KE + +AV+ +M +E
Sbjct  377   GLINNCQIVLMPHLDGDHITNTKIMGRELKVGVEVNKGDEDGLFTKESVCEAVKIVMDDE  436

Query  255   ---GASTRANQEKWKEFLLDKEIQSK----FIKDLVKVMR  157
                G   R N +K +  LL+++++S     F + L K++R
Sbjct  437   NEIGREVRNNHDKLRNLLLNQDLESSCVDGFCEKLQKLVR  476



>ref|XP_003596667.1| Anthocyanidin 3-O-glucosyltransferase [Medicago truncatula]
Length=463

 Score =   326 bits (836),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 182/460 (40%), Positives = 276/460 (60%), Gaps = 12/460 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ +FP+FA GH++P++ LSNKL+  G KISFF       +++            PL +
Sbjct  11    LHIAMFPWFAMGHLTPYLHLSNKLAKRGHKISFFIPKKTQTKLEQFNLYPNLITFYPLNV  70

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P + GLP G ++T+D   +   L+  A++  QPQ++ LL +L P  V FDF   WLP +A
Sbjct  71    PHIHGLPFGAETTSDVSFSLGPLIMTAMDQTQPQVELLLTQLNPEIVFFDFT-FWLPKIA  129

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVE-EMKKPPPGFPPTSVASLRTFEA  973
               LGIK++   +      ++   P+R+   E +   E ++ KPP G+P +S  +L   EA
Sbjct  130   HNLGIKSLQCWIVSPATVSYNASPSRMC--EGTNLTEFDLMKPPKGYPISSF-NLYYHEA  186

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             +   +  K     G   YDR+  GL+   AI  K   E+E PY+DY++ +F KP+LL+GP
Sbjct  187   KHLALKRKLEFGSGIFFYDRIYYGLSLSDAIGFKGIREIEGPYVDYLEQEFGKPVLLSGP  246

Query  792   VVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
             V+PEP   VLD+KW  WL+ F+  +++YC+ GSE+ L   Q  EL LGLELTG PF  +L
Sbjct  247   VLPEPPKTVLDEKWGSWLNGFKDGSLVYCALGSESKLSQKQFHELLLGLELTGYPFLAIL  306

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
               P   +   +   A P GF ERVK +GI+HSGW+QQQ IL HSSVGC+V H G  S+ E
Sbjct  307   KPPIGFETVED---AFPEGFEERVKEKGIVHSGWIQQQLILEHSSVGCFVTHCGAGSLTE  363

Query  432   GIVNDCQLVMLPQ-KGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE  256
             G++N+CQ+V++P   GD   N K++  ++K GVEVN+ DEDG F KE + +AV+ +M +E
Sbjct  364   GLINNCQIVLMPHLDGDHITNTKIMGRELKVGVEVNKGDEDGLFTKESVCEAVKIVMDDE  423

Query  255   ---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMAT  145
                G   R N +K +  LL+++++S  +    + ++ + +
Sbjct  424   NEIGREVRNNHDKLRNLLLNQDLESSCVDGFCEKLQKLVS  463



>ref|XP_004144610.1| PREDICTED: UDP-glycosyltransferase 79B1-like [Cucumis sativus]
 gb|KGN43443.1| hypothetical protein Csa_7G037470 [Cucumis sativus]
Length=477

 Score =   327 bits (837),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 186/460 (40%), Positives = 285/460 (62%), Gaps = 14/460 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ ++P+FA GH++PF+ LSNKL+  G KISFF     + + + +         +P+ +
Sbjct  16    LHIAMYPWFALGHLTPFLHLSNKLAKKGHKISFFIPTKTLPKFEPLNLFPNLITFIPVIV  75

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P V GLP G ++T D P     L+  +++L QPQI  LL  LKPH ++FDF  +WLP LA
Sbjct  76    PHVHGLPHGAETTCDVPYPLHNLIMTSMDLTQPQITLLLQTLKPHLILFDFT-HWLPKLA  134

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
             ++LGIK+I + V  A   A+   P+R    +   T E++ KPP G+P +++ +L   EAR
Sbjct  135   SQLGIKSIHYCVTSAAMIAYTLTPSR-QFYKNELTEEDLMKPPVGYPSSTI-NLHPHEAR  192

Query  969   DFVIIFKRPHNGGASV--YDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
              F    KR    G+ V  YDR     + C AI  +TC+E+E  +++Y++ +F+KP+LL G
Sbjct  193   VFAS--KRKWKFGSDVLFYDRQFVSFSDCDAIGFRTCHEIEGDFVNYLQFEFRKPVLLTG  250

Query  795   PVVPEPAS-GVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFL  619
              V+PE  +   L++KW  WL  F+  +V+YC+FGSE  L+ +Q +EL +G EL  +PF  
Sbjct  251   SVLPETLNPEALEEKWESWLLGFKEGSVVYCAFGSECTLQMEQFQELLMGFELLDMPFLA  310

Query  618   VLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSV  439
              L  P     A  +  ALP GF +RV GRG+++ GW+QQ++IL H SVGC+V H G +S+
Sbjct  311   ALKPPFG---AETVEAALPEGFAKRVGGRGVVYGGWIQQERILEHPSVGCFVTHCGSNSL  367

Query  438   IEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGE  259
              E +VN CQLV+LPQ GDQ +NA+++ ++++ GVEV +R EDG+F KE + KAV+ +M E
Sbjct  368   KEALVNKCQLVLLPQVGDQIINARMMGNNLRVGVEVEKRQEDGWFTKESVCKAVKIVMDE  427

Query  258   E---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
             +   G   R N  K ++ LL K+++  +I      + D+ 
Sbjct  428   DNEIGKEVRTNHSKIRDLLLKKDLEESYIDSFSYNICDLV  467



>ref|XP_009352835.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Pyrus x bretschneideri]
Length=471

 Score =   326 bits (835),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 198/468 (42%), Positives = 280/468 (60%), Gaps = 17/468 (4%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             LH+ ++P+FA GH++P   LSNKL+  G + SFF       ++++ LN +P     +P+ 
Sbjct  10    LHIAMYPWFAMGHLTPSPPLSNKLAERGHRTSFFVPTKTQQKLQA-LNFHPHLISFIPIT  68

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P V+GL PG ++T D P  +  LL  A++L QP I  L+ EL P+FV FDF   WLP L
Sbjct  69    VPHVDGLLPGAETTNDVPFPSNSLLMDAMDLTQPAILQLICELNPNFVFFDFTP-WLPKL  127

Query  1152  AAELGI--KTIffsvfvalatafatVPARLPGPERSPTVE-----EMKKPPPGFPPTSVA  994
               +LG   K+I++ +       +   P R    E+S   E     E+  PPP FPP+S+ 
Sbjct  128   LRQLGTGIKSIYYIIISPAIVGYVRSPERKVLMEKSVLTEDDLINELINPPPSFPPSSI-  186

Query  993   SLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKK  814
              L   EAR    +  +    G    +R +  LN C A   + C EME  Y DY+++Q +K
Sbjct  187   KLPAHEARMLAPLLLKEFGSGKKFIERQIISLNDCDAAAFRACREMEGKYCDYLETQLRK  246

Query  813   PLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTG  634
             P+L AGPVVPE  +  LD+KWA WL +FE  +VIYC+FG+E  LK DQ +EL LG ELTG
Sbjct  247   PVLRAGPVVPETPTAELDEKWAKWLERFEAKSVIYCAFGTECVLKIDQFQELLLGFELTG  306

Query  633   LPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHA  454
             LPFF  L  P  V+    +  ALP GF  RVKGRG++  GWVQQ  +L H SVGC+V H 
Sbjct  307   LPFFAALKPPMGVEA---IESALPEGFEGRVKGRGVVSWGWVQQPLMLKHPSVGCFVTHC  363

Query  453   GFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQ  274
             G SS++EG+V++CQLV+LP   DQ   A+++  D++ GVEV + +EDG F KE + KAV+
Sbjct  364   GPSSLMEGLVSECQLVLLPNVADQLAIARVMGRDLRVGVEVEKGEEDGVFTKEGVCKAVR  423

Query  273   TIMGEE---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
              +M EE   G   R N  KW+EFL  K +++ +I   V+ +  +  +N
Sbjct  424   DVMDEESEVGKEVRRNHAKWREFLSGKGLENSYIDSFVEKLHALLGLN  471



>gb|KFK27016.1| hypothetical protein AALP_AA8G323600 [Arabis alpina]
Length=447

 Score =   323 bits (829),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 172/458 (38%), Positives = 277/458 (60%), Gaps = 21/458 (5%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVP-LA  1333
              H  +FP+F FGH++ F+ L+NKL+  G KI+F      + +++  LN  P + +   L 
Sbjct  5     FHAFMFPWFGFGHMTAFLHLANKLAEKGHKINFLLPKKALKQLEP-LNLFPNSIVFHILT  63

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P V+GLP G ++TAD P +    L  A++  + Q+K ++   KP  + FDFA +W+P +
Sbjct  64    IPPVDGLPAGAETTADIPISLGSFLASAMDRTRNQVKEMVSNDKPDLIFFDFA-HWIPEI  122

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
             A E G KT+ +    A   A + VP R P        +++  PPPG+P + V  LR  E 
Sbjct  123   AKEYGAKTVNYVTISAACVAISFVPGRSP--------DDLAVPPPGYPSSKVL-LRGQET  173

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             +    +   P   G + Y+R++ GL  C  I  +TC EME  + D+++ Q ++ +LL GP
Sbjct  174   KSLSFL-SYPFGDGTTFYERIITGLTNCDVISIRTCQEMEGKFCDFIERQCQRKVLLTGP  232

Query  792   VVPE-PASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
             ++ E   S +L+++W+ WLS+F+P +VIYC+ GS+  L+ +Q +EL LG+ELTGLPF + 
Sbjct  233   MLSEQDNSKLLEEQWSQWLSRFKPGSVIYCALGSQIILEKNQFQELCLGMELTGLPFLVA  292

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             +  P  V   S +  ALP GF ERVKGRG++  GWVQQ  IL H S+GC+V H GF S+ 
Sbjct  293   VKPPKGV---STIQVALPEGFEERVKGRGVVWGGWVQQPLILAHPSIGCFVSHCGFGSMW  349

Query  435   EGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE  256
             E +VNDCQ+V +P   +Q  N +L++D+++  VEV +R+E G+F KE +  A++++M E+
Sbjct  350   EALVNDCQIVFIPHLAEQVFNTRLMSDELEVSVEV-KREEIGWFSKERLSGAIRSVMDED  408

Query  255   ---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                G   R N  KWKE L+   + + ++   ++ ++++
Sbjct  409   SELGNLVRRNHAKWKESLVKTGLMNDYVNKFIEALQEL  446



>ref|XP_004301656.1| PREDICTED: UDP-glycosyltransferase 79B3-like [Fragaria vesca 
subsp. vesca]
Length=471

 Score =   324 bits (831),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 180/458 (39%), Positives = 265/458 (58%), Gaps = 9/458 (2%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             +HV ++P+FA GH++ F+ +SNKL+  G KISFF       +++           +PL +
Sbjct  16    MHVAMYPWFAMGHLTAFLHISNKLAERGHKISFFLPIKTQSKLQHYNLHPHLITFIPLNV  75

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P V+GLPPGT++TAD P +   L+  A++L +PQI+  L++L+P +V FDF+ +WLP L 
Sbjct  76    PHVDGLPPGTETTADVPLSLGSLVATAMDLTRPQIEQHLLKLRPDYVFFDFS-HWLPALL  134

Query  1149  AELG--IKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFE  976
              +LG  IK++ + V    +  +               V++   P   F  +    L+  E
Sbjct  135   RQLGSNIKSVCYWVINPASVWYLLSLGLSRKKALDDVVDDPAHPSLCFSSSFSIKLKAHE  194

Query  975   ARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
             AR +  +    +  G     R L  L+ C AI  KTC E   P+ +Y + Q  KP++LAG
Sbjct  195   ARAYEAMANMEYGSGLPFVKRCLTSLSDCDAICFKTCREFAGPFRNYFEMQMNKPVILAG  254

Query  795   PVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
              V P+P S  L++KW  WL  FEP TVI+C+ GSE  L   Q+++L LG E TGLPFF  
Sbjct  255   LVTPDPPSSRLEEKWEKWLGGFEPRTVIFCALGSEYVLTKQQLQQLLLGFERTGLPFFAA  314

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             L  P  V+    +  ALP GF ERVKG+G++   WVQQ  IL H +VGC+V H G  S+ 
Sbjct  315   LKSPTGVE---SIESALPEGFEERVKGKGVVSGSWVQQPIILKHPAVGCFVTHCGSGSIN  371

Query  435   EGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE  256
             E ++N+CQLV LP  GD  +NA+L++  +K GVE+ + DEDG F KE + KAV+ +M E+
Sbjct  372   EALLNECQLVFLPNIGDHIINARLMSGYLKVGVEIEKGDEDGLFTKEGVCKAVKAVMDED  431

Query  255   ---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                G   R N  KW+EF  +K  +S +I   V+ + +M
Sbjct  432   SQVGKEVRTNHAKWREFFSNKGFESSYIDGFVQKLHEM  469



>ref|XP_006281795.1| hypothetical protein CARUB_v10027966mg [Capsella rubella]
 gb|EOA14693.1| hypothetical protein CARUB_v10027966mg [Capsella rubella]
Length=447

 Score =   323 bits (828),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 175/461 (38%), Positives = 276/461 (60%), Gaps = 21/461 (5%)
 Frame = -3

Query  1518  GDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIV-  1342
             G   H  +FP+F FGH++ F+ L+NKL+  G +I+F      + +++  LN  P   I  
Sbjct  2     GSKFHAFMFPWFGFGHMTAFLHLANKLAEGGHRITFLLPKKALKQLEP-LNLFPDFIIFQ  60

Query  1341  PLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWL  1162
              L +P+V+GLP G ++T+D P ++   L  A++  + Q++  +   KP  + FDFA +W+
Sbjct  61    TLTIPSVDGLPAGAETTSDIPISSGSFLASAMDRTRNQVEEAVSIGKPDLIFFDFA-HWI  119

Query  1161  PPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRT  982
             P +A E G K++ +    A   A + VP   P        + M  PPPG+P + V  LR 
Sbjct  120   PEIAREYGAKSVNYITISAACVAISFVPGHSP--------DAMAVPPPGYPSSKVL-LRG  170

Query  981   FEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLL  802
              E   F  +   P   G + Y+R++ GL  C  I  +TC EME  + D+++SQF++ +LL
Sbjct  171   QETNCFAFL-SYPFGDGTTFYERIMIGLKNCDIISIRTCQEMEGKFCDFIESQFQRKVLL  229

Query  801   AGPVVPEP-ASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPF  625
              GP++PEP  S  L+ +W  WL+Q+EP +VIYC+ GS+  L+ DQ +EL LG+ELTGLPF
Sbjct  230   TGPMLPEPDNSKPLEDQWRKWLNQYEPGSVIYCALGSQIILEKDQFQELCLGMELTGLPF  289

Query  624   FLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFS  445
              + +  P      S +  ALP GF ERVKGRG++  GWVQQ  IL H S+GC+V H GF 
Sbjct  290   LVAVKPPKGF---STIQEALPNGFEERVKGRGVVWGGWVQQPLILAHPSIGCFVSHCGFG  346

Query  444   SVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM  265
             S+ E +VNDCQ+V +P  G+Q LN +L++++++  VEV +R+E G+F KE +  +++++M
Sbjct  347   SMWEALVNDCQIVFIPHLGEQILNTRLMSEELEVSVEV-KREETGWFSKESLSDSIKSVM  405

Query  264   ---GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                 E G   R N  KWKE L+   + ++ +   ++ ++ +
Sbjct  406   DKDSELGNLVRRNHAKWKESLVSTGLMNRDVNKFIEALQKL  446



>ref|XP_007149722.1| hypothetical protein PHAVU_005G093600g [Phaseolus vulgaris]
 gb|ESW21716.1| hypothetical protein PHAVU_005G093600g [Phaseolus vulgaris]
Length=458

 Score =   323 bits (827),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 182/460 (40%), Positives = 278/460 (60%), Gaps = 10/460 (2%)
 Frame = -3

Query  1518  GDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVP  1339
             G  LH+ +FP+FA GH++P++ LSNKL+  G KISFF       +++            P
Sbjct  3     GSSLHIAMFPWFAMGHLTPYLHLSNKLAKRGHKISFFVPRRTQSKLEQFNLFPDLITFFP  62

Query  1338  LALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLP  1159
             + +P VEGLP G ++T+D   +   L+  A++  +  I+ LL++LKP  V FDF   WLP
Sbjct  63    INVPHVEGLPHGAETTSDVSFSLGPLIMTAMDRTERDIELLLLDLKPQIVFFDFTY-WLP  121

Query  1158  PLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTF  979
              + + LGIK+  + +      ++ T P R+   + S T  ++ +PP G+P +S+  L   
Sbjct  122   NITSRLGIKSFQYFIVSPATVSYTTAPPRM-NHKGSLTELDLMQPPLGYPVSSI-KLHAH  179

Query  978   EARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLA  799
             EA+            G   YDR+  GL    AI  K C E+E P++DY+  QF K ++L+
Sbjct  180   EAKFLASKRNWEFGSGVLFYDRLNNGLMLSDAIGFKGCREIEGPFVDYLAEQFGKSVVLS  239

Query  798   GPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFL  619
             GP++PEP + VLD+KW+ WL  F+  +V++C+ GSE  L   Q +EL LGLELTGLPF  
Sbjct  240   GPIIPEPPNTVLDEKWSAWLGSFKDGSVVFCALGSEWKLPHGQFQELLLGLELTGLPFLA  299

Query  618   VLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSV  439
             V+  P   +    +  ALP GF ER++GRGI+HSGW+QQQ IL HSSVGC++ H G  S+
Sbjct  300   VVKVPIGFET---IEAALPEGFKERIEGRGIVHSGWIQQQLILEHSSVGCFITHCGAGSL  356

Query  438   IEGIVNDCQLVMLPQ-KGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMG  262
              E +VN CQ+V+LPQ  GD  +NA+++  ++K GVEV + +EDG+F KE + KAV+ +M 
Sbjct  357   TEALVNKCQMVLLPQLDGDHIINARMMGSNLKVGVEVEKGEEDGWFTKESVSKAVKIVMD  416

Query  261   EE---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             EE   G   R N  K + FL+  +++S  + +  + ++++
Sbjct  417   EENEVGREVRENHAKLRNFLVSHDLESICVDNFCQKLQNL  456



>ref|XP_002866013.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42272.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=446

 Score =   322 bits (826),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 175/460 (38%), Positives = 274/460 (60%), Gaps = 22/460 (5%)
 Frame = -3

Query  1518  GDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVP  1339
             G   H  +FP+F FGH++ F+ L+NKL+  G KI+F      + +++ +     C     
Sbjct  2     GSKFHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKALKQLEPLNLFPHCIVFHT  61

Query  1338  LALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLP  1159
             L +P+V+GLP G ++T+D P +    L  A++  + Q++  +   +P  + FDFA +W+P
Sbjct  62    LTIPSVDGLPAGAETTSDIPISLGSFLASAMDRTRNQVEEAVSIRQPDMIFFDFA-HWIP  120

Query  1158  PLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTF  979
              +A E G K++ F    A   A + VP          + +++  PPPG+P + V  LR  
Sbjct  121   EIAREYGAKSVNFITISAACVAISFVPG--------CSQDDLGIPPPGYPSSKVL-LRGQ  171

Query  978   EARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLA  799
             E      +   P   G + Y+R++ GL  C  I  +TC E+E  + D+++ QF++ +LL 
Sbjct  172   ETNSLSFL-SYPFGDGTTFYERIMIGLKNCDVISIRTCQEIEGKFCDFIERQFQREVLLT  230

Query  798   GPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFL  619
             GP++P+P S  L+ +W  WLSQFEP +VIYC+ GS+  L+ DQ +EL LG+ELTGLPF +
Sbjct  231   GPMLPDPDSKPLEDQWRLWLSQFEPESVIYCALGSQIILEKDQFQELCLGMELTGLPFLV  290

Query  618   VLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSV  439
              +  P     A  +  ALP GF ERVKGRG++  GWV+Q  IL H S+GC+V H GF S+
Sbjct  291   AVKPPKG---AKTIQEALPKGFEERVKGRGVVWGGWVKQPLILAHPSIGCFVSHCGFGSM  347

Query  438   IEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM--  265
              E IVNDCQ+V +P  G+Q LN +L++++++  VEV +R++ G+F KE +  AV+++M  
Sbjct  348   WEAIVNDCQIVFIPHLGEQILNTRLMSEELEVSVEV-KREKAGWFSKESLSGAVRSVMDK  406

Query  264   -GEEGASTRANQEKWKEFLLDKEIQ----SKFIKDLVKVM  160
               E G   R N  KWKE L+   +     +KFI++L K++
Sbjct  407   DSELGNLVRRNHAKWKESLVSTGLMNGYVNKFIEELQKLV  446



>gb|AFJ52978.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=462

 Score =   322 bits (826),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 181/460 (39%), Positives = 275/460 (60%), Gaps = 14/460 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
              H+V+FP+ A GHI+PF+ LSN L+  G  I+F      + +  S  N +P      P+ 
Sbjct  10    FHIVMFPWLATGHITPFLHLSNTLASKGFTITFILPKKAIQQF-SRFNQHPNLIDFHPIT  68

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             LP V+GLP G ++ ++ P      L +A++  + Q++ ++    P  V++D A +W+  +
Sbjct  69    LPPVDGLPAGVETASEVPIEVTHFLCIAMDRTRDQVEKIIRGTNPKVVVYDMA-HWVSDI  127

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
              A LGIK++ ++V  A A AFA VP R     +  TV+E+  PPPG+P +++  LR  E 
Sbjct  128   TASLGIKSVNYTVLSAAAVAFADVPVRGIVKGKELTVDELAVPPPGYPSSTIV-LRPHEG  186

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             +    IF  P+    + ++R+  G+  C A+  +TC E+E    +Y+  Q+KK + L GP
Sbjct  187   KLLSFIF-FPYGEATTFWERISTGMRMCDALAIRTCDEIEGKLCEYLGEQYKKRVFLTGP  245

Query  792   VVPEPASGV--LDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFL  619
             V+ EPA+ V  L+ +W DWL +FEP +V++C+FGS+  L+  Q +EL LG EL+G PF +
Sbjct  246   VLTEPANDVVSLENQWIDWLGKFEPGSVVFCAFGSQIMLEKSQFQELVLGFELSGHPFLV  305

Query  618   VLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSV  439
              L  PA    +S +  ALP GF ERVKGRGII   WVQQ  IL H SVGC+V H GF S+
Sbjct  306   ALKPPAG---SSTIKEALPEGFEERVKGRGIIWGEWVQQVLILNHPSVGCFVNHCGFGSM  362

Query  438   IEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM--  265
              E +++D Q+V++P  GDQ LN +LLAD++K G+EV  RDE G+  KE +  A++ +M  
Sbjct  363   WESLMSDSQIVLVPHLGDQVLNTRLLADELKVGLEV-ERDEQGWVSKEKLSDAIKCVMDQ  421

Query  264   -GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
               E G S R N  KW+  + D +  S +I   V+ + D+ 
Sbjct  422   GNELGCSLRKNHSKWRGVVSDPDFMSSYIDKFVQNLHDLV  461



>ref|XP_004146274.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cucumis sativus]
Length=471

 Score =   322 bits (826),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 180/465 (39%), Positives = 280/465 (60%), Gaps = 20/465 (4%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             LH+++FP+FA GHI+PF+ +SN L+    +I+F     N   + S LN  P       L+
Sbjct  10    LHILMFPWFATGHITPFLHISNHLASKNHRITFL-LPNNPSSLFSSLNLYPDLISFHFLS  68

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             LP+V GLPP   S +D P +   LL  AL+L +PQ+  ++  L+P FV FDFA +W+P +
Sbjct  69    LPSVPGLPPSAHSASDIPLSLTPLLASALDLTRPQVDRIIHSLRPDFVFFDFA-HWIPDI  127

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
              A L I++I F+V  A + A    P R    +   T E+ ++PP G+P ++V    + E+
Sbjct  128   TAPLQIRSICFTVVSAASVAVTVFPGRRVSLDHPLTDEDFREPPVGYPSSTVVFHGSRES  187

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             R  + +   P   G + ++R +       AI  +TC E+E  + D++ +QF+K +LL GP
Sbjct  188   RSLLFL-SMPFGQGITFHERFMTSYKKSDAIAMRTCQEIEGDFCDFLSNQFQKKILLTGP  246

Query  792   VVPEPASGV----LDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPF  625
             ++  P+S +    LD++W  WL QF+  TVI+C+FGS+  L+  Q++EL LG+E TGLPF
Sbjct  247   LMAAPSSKIKATTLDKEWEKWLGQFQQKTVIFCAFGSQVILEKQQLEELVLGIEQTGLPF  306

Query  624   FLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFS  445
              + L  P   D   E   ALP GF ERVK RGI++ GWVQQ  IL HSS+GC+V H GF 
Sbjct  307   LVALKPPMGYDSMEE---ALPKGFEERVKERGIVYGGWVQQPLILNHSSIGCFVSHCGFG  363

Query  444   SVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM  265
             S+ E +++D Q+V++P  GDQ LN +LLA ++K GVEV +R+EDG F ++ +++A++ +M
Sbjct  364   SMWESLMSDAQIVLIPTLGDQILNTRLLAQELKVGVEV-KREEDGSFTRQSVRQAIELVM  422

Query  264   GEEGASTRA--------NQEKWKEFLLDKEIQSKFIKDLVKVMRD  154
              ++  + R+        N  KWK+ L        +I + VK +++
Sbjct  423   VDDKNNNRSGVGEIVKKNHAKWKDLLTKPGFLETYIDNFVKKLQE  467



>ref|XP_003527222.1| PREDICTED: UDP-glycosyltransferase 79B3-like [Glycine max]
Length=462

 Score =   322 bits (825),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 184/463 (40%), Positives = 275/463 (59%), Gaps = 12/463 (3%)
 Frame = -3

Query  1533  TNNHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPC  1354
             T NH   LLH+ +FP+FA GH++PF+ LSN+L+  G KI+F        +++ + N    
Sbjct  4     TRNH---LLHIAMFPWFATGHMTPFLHLSNELAKRGHKITFLLPKKAKLQLQHLNNHPHL  60

Query  1353  TQIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFA  1174
                  L +P V+GLP GT++ ++ P +   LL +A++  + Q++  L    P FV++D A
Sbjct  61    ITFHTLTIPHVKGLPHGTETASEIPISLNHLLVIAMDKTRDQVEHTLSATNPDFVLYDNA  120

Query  1173  QNWLPPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVA  994
               W+P +A +LGIKTI ++V  A + A   VPAR    +R  TVEE+ +PP G+P + V 
Sbjct  121   Y-WVPQIAKKLGIKTICYNVVCAASLAIVLVPARNVPKDRPITVEELSQPPEGYPSSKVV  179

Query  993   SLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKK  814
              L   EA   + I         + YDR+ + L    AI  +T  E+E  + DY+ SQF K
Sbjct  180   -LTGLEAESLMFISVPFGEDNITFYDRITSALRESDAIAIRTSREIEGNFCDYIASQFGK  238

Query  813   PLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTG  634
              +LL GPV+PE A G L++ WA+WL  F   +++YC+FGS+  L+ DQ +EL LG EL+G
Sbjct  239   KVLLTGPVLPEEAEGKLEENWANWLDAFANESIVYCAFGSQINLEKDQFQELLLGFELSG  298

Query  633   LPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHA  454
             LPF + L  P   +   E   ALP GF ERVKGRG++  GWVQQ  IL H SVGC+V H 
Sbjct  299   LPFLVALKTPRGCESVEE---ALPEGFEERVKGRGVVSRGWVQQLLILKHPSVGCFVNHC  355

Query  453   GFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQ  274
             GF S+ E +++D Q+V++PQ GDQ LN KLL +++   VEV  R  +G+  KE + KA++
Sbjct  356   GFGSMWESLMSDKQIVLVPQLGDQVLNTKLLVEELGVAVEV-ERGGNGWVSKESLSKAIK  414

Query  273   TIM---GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRD  154
              +M    E GA  + N  +WK+      + + ++   V+ ++D
Sbjct  415   LVMDGDSEVGARVKKNHMEWKKTGGSPNLMNGYMDRFVQNLQD  457



>ref|XP_004166346.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 79B6-like 
[Cucumis sativus]
Length=471

 Score =   322 bits (826),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 180/465 (39%), Positives = 280/465 (60%), Gaps = 20/465 (4%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             LH+++FP+FA GHI+PF+ +SN L+    +I+F     N   + S LN  P       L+
Sbjct  10    LHILMFPWFATGHITPFLHISNHLASKNHRITFL-LPNNPSSLFSSLNLYPDLISFHFLS  68

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             LP+V GLPP   S +D P +   LL  AL+L +PQ+  ++  L+P FV FDFA +W+P +
Sbjct  69    LPSVPGLPPSAHSASDIPLSLTPLLASALDLTRPQVDRIIHSLRPDFVFFDFA-HWIPDI  127

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
              A L I++I F+V  A + A    P R    +   T E+ ++PP G+P ++V    + E+
Sbjct  128   TAPLQIRSICFTVVSAASVAVTVFPGRRVSLDHPLTDEDFREPPVGYPSSTVVFHGSRES  187

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             R  + +   P   G + ++R +       AI  +TC E+E  + D++ +QF+K +LL GP
Sbjct  188   RSLLFL-SMPFGQGITFHERFMTSYKKSDAIAMRTCQEIEGDFCDFLSNQFQKKILLTGP  246

Query  792   VVPEPASGV----LDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPF  625
             ++  P+S +    LD++W  WL QF+  TVI+C+FGS+  L+  Q++EL LG+E TGLPF
Sbjct  247   LMAAPSSKIKATTLDKEWEKWLGQFQQKTVIFCAFGSQVILEKQQLEELVLGIEQTGLPF  306

Query  624   FLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFS  445
              + L  P   D   E   ALP GF ERVK RGI++ GWVQQ  IL HSS+GC+V H GF 
Sbjct  307   LVALKPPMGYDSMEE---ALPKGFEERVKERGIVYGGWVQQPLILNHSSIGCFVSHCGFG  363

Query  444   SVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM  265
             S+ E +++D Q+V++P  GDQ LN +LLA ++K GVEV +R+EDG F ++ +++A++ +M
Sbjct  364   SMWESLMSDAQIVLIPTLGDQILNTRLLAQELKVGVEV-KREEDGSFTRQSVRQAIELVM  422

Query  264   GEEGASTRA--------NQEKWKEFLLDKEIQSKFIKDLVKVMRD  154
              ++  + R+        N  KWK+ L        +I + VK +++
Sbjct  423   VDDKNNNRSGVGEIVXENHAKWKDLLTKPGFLETYIDNFVKKLQE  467



>ref|XP_004487585.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Cicer arietinum]
 gb|AGU14140.1| UDP-glycosyltransferase [Cicer arietinum]
Length=457

 Score =   321 bits (823),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 190/459 (41%), Positives = 278/459 (61%), Gaps = 12/459 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             LH+ +FP+FA GH +PF+ LSNKL+  G KISFF     +++++  LN +P       + 
Sbjct  6     LHLAMFPWFAMGHFTPFLHLSNKLAQRGHKISFFIPKKTLNKLQH-LNLHPHLITFFTIN  64

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P V+GLP G ++T+D P +   L+  A++    +I+ LL ELKP  V FDF Q WLP L
Sbjct  65    VPHVDGLPYGAETTSDVPFSLFPLIATAMDQTDKEIELLLKELKPQIVFFDF-QYWLPNL  123

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
               +LGIK++ + +   + TA+     R     R  T  ++ KPP GFP + +    ++E 
Sbjct  124   TKKLGIKSVQYMIINPMTTAYLGTGPR-QSQGRELTEADLMKPPSGFPGSCI-KFHSYEL  181

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             R    I       G  +  R+  G +   AI  K C E++ PY++Y+++ + KP+LL+GP
Sbjct  182   RYLASIGNVVFGSGVLLMYRLDTGTSLADAIGYKGCKEIDGPYVEYLRTIYGKPVLLSGP  241

Query  792   VVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
             ++PEP    L++KW  WL  F+  +V+YC++GSE+ L+ +Q KEL LGLELTG PF + L
Sbjct  242   LLPEPTLSSLEEKWVSWLKGFKLGSVVYCAYGSESALEHNQFKELLLGLELTGFPFLVAL  301

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
               P   +   E   ALP GF ERVKGRGII+ GWVQQQ IL HSSVGC++ H G +S+ E
Sbjct  302   KPPIGFESIEE---ALPQGFNERVKGRGIIYGGWVQQQLILEHSSVGCFITHCGAASITE  358

Query  432   GIVNDCQLVMLPQKG-DQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE  256
             G+VN CQLV+LP  G D  +NA++++  +K GVEV + +EDG F KE + KAV T+M EE
Sbjct  359   GLVNMCQLVLLPHVGSDHIMNARMMSAKLKVGVEVEKGEEDGLFTKESVCKAVNTVMDEE  418

Query  255   ---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
                G   RAN  K +  LL   ++S  +    + + D+ 
Sbjct  419   NEVGREVRANHAKLRNILLSNNLKSSCVDSFCQELYDLV  457



>ref|XP_006361401.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Solanum tuberosum]
Length=463

 Score =   322 bits (824),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 182/459 (40%), Positives = 279/459 (61%), Gaps = 13/459 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             L +V+FP+ AFGH+ PF+ LSN+L+  G +ISF        ++++            L +
Sbjct  9     LQIVMFPWLAFGHLIPFLSLSNELAKKGHRISFLLPKNAEIKLQNFNLYPNLITFHTLKI  68

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P + GLP G ++TAD P +   LL  A++ +  +IK+ L  LKPHFV FDFA +W+P +A
Sbjct  69    PHIHGLPYGAETTADVPRSLETLLATAMDELYDEIKSFLRNLKPHFVFFDFA-HWVPEIA  127

Query  1149  AELG-IKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
              E+G IKT+ + +     +A++ V +       + T  E  +PPPG+P T+V  L   EA
Sbjct  128   TEIGGIKTLCYKIVCPATSAYSLVRSPKKSVFIASTAAEKVRPPPGYPSTTVV-LHEHEA  186

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             +    +F+  +  G ++Y+R+  G+  C AI  KTC E+E  + DY+ +QFKKP+L  GP
Sbjct  187   KLLEFLFQE-YGKGVTIYERLSKGVTLCDAIALKTCREIEGTFGDYIATQFKKPVLYTGP  245

Query  792   VVPEPASGVLDQK-WADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
             V+P+   G L++   ++WL +FEP +V++C+FGS+  L+  Q +EL LGLELTGLPF LV
Sbjct  246   VLPDSEKGPLEEHGLSNWLEKFEPGSVVFCAFGSQLILEKKQFQELVLGLELTGLPFLLV  305

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             +  P       E   ALP GF ERV+ +G+I   WV Q +IL H SVGC+V H G+ S+ 
Sbjct  306   VKPPEGTKSVEE---ALPEGFKERVQEKGLILDCWVPQLKILTHKSVGCFVSHCGYGSMW  362

Query  435   EGI-VNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGE  259
             E + + DCQLV+LP   DQ L+A+L+  D+K GVEV ++DE+G+F KE + KAV+ +M +
Sbjct  363   ESLALCDCQLVLLPSANDQTLSARLMEQDLKVGVEV-KKDENGWFSKESLCKAVKCVMDK  421

Query  258   E---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             +   G   + N  KWKE L      + +I   ++ + ++
Sbjct  422   DSQFGCLVKENHRKWKEVLSSPGFMNNYIDSFIQNLHEL  460



>gb|EYU44977.1| hypothetical protein MIMGU_mgv1a006277mg [Erythranthe guttata]
Length=450

 Score =   321 bits (823),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 187/451 (41%), Positives = 279/451 (62%), Gaps = 11/451 (2%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             L + +FP+ A GHI+PF+ L+N+L+  G  IS F    +V ++          +  P+ +
Sbjct  3     LKIAMFPWIAIGHITPFIHLANELAKRGHSISIFIPPKSVLQLAHHNLYPDLIEFTPVGV  62

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P V+GLP G ++ +D   +A + L VA + M   I+ LL  LKP  V +DFA +W+P LA
Sbjct  63    PHVDGLPTGAETASDIDISAKDPLAVAFDAMSGDIETLLQNLKPDIVFYDFA-DWIPALA  121

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
             A++G KT+ ++V  A   A   VPAR    +R  T++E+ +PP G+P ++V  LR  EA 
Sbjct  122   AKIGFKTVCYNVICASVMAIGIVPARSIPTDRPLTLQELMEPPSGYPSSTVV-LRGQEA-  179

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
                + F     G    + R+ A + GC AI  +TC E+E P +DY+ SQ+ KP+ L+GPV
Sbjct  180   -MTLSFIGMDYGATKFHVRIAAAMRGCDAIGIRTCRELEGPMVDYLSSQYNKPVFLSGPV  238

Query  789   VPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLN  610
             +PEPA   L++KW  WLS+F P +V+YC+FGS+  LK DQ +E+ LG E+TGLPFF+ ++
Sbjct  239   LPEPAKEPLEEKWLTWLSKFPPKSVVYCAFGSQMILKKDQFQEMVLGFEMTGLPFFVAVS  298

Query  609   FPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEG  430
              PA  D    +  ALP GF ERV GRG++H GWVQQ Q L H SVGC+V H GF S+ E 
Sbjct  299   KPAGAD---SIEEALPEGFLERVGGRGVVHGGWVQQIQFLNHPSVGCFVSHCGFGSMWES  355

Query  429   IVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE--  256
             +++DC++V++P+  DQ LN +LLA+++K  VEV  R   G+F KED+ KA+ + M EE  
Sbjct  356   LLSDCRIVLVPRLADQILNTRLLAEELKVAVEV-ERGVMGWFSKEDLSKAIVSAMDEESE  414

Query  255   -GASTRANQEKWKEFLLDKEIQSKFIKDLVK  166
              G   + N   WKE L++      ++ + ++
Sbjct  415   LGKMVKRNHAVWKETLVNPGYMDDYVDNFIQ  445



>ref|XP_003596670.1| Anthocyanidin 3-O-glucosyltransferase [Medicago truncatula]
Length=458

 Score =   321 bits (823),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 183/459 (40%), Positives = 277/459 (60%), Gaps = 14/459 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             LH+ +FP+FA GH++P++  SNKL++ G KISFF     +++++  LN +P      P+ 
Sbjct  7     LHIAMFPWFAMGHLTPYLHFSNKLAIRGHKISFFIPKNTLNKLQH-LNLHPNLITFFPIT  65

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P V GLP   ++T+D P +   L+  A++    QI+ LL ELKP  V FDF Q WLP L
Sbjct  66    VPHVNGLPHNAETTSDVPFSLFPLIATAMDQTDKQIELLLKELKPQIVFFDF-QYWLPNL  124

Query  1152  AAELGIKTIffsv-fvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFE  976
               +LGIK++ + +     +     +P +  G  +  T +++KKPP GFP +S+    + E
Sbjct  125   TQKLGIKSLQYLIWNPISSAYLGNIPRKSQG--KYLTKDDLKKPPAGFPDSSI-KFHSHE  181

Query  975   ARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
              R      K     G  +YDRV  G     A+  K C E++  Y DY+++ F KP+LL+G
Sbjct  182   LRFLASTRKIEFGSGVLLYDRVDTGTKSSDAVSFKGCREIDGLYADYLETVFGKPVLLSG  241

Query  795   PVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
             P++PEP    L++KW  WL +F+  +VI+C++GSE  L+ +Q +EL LGLELTG PF   
Sbjct  242   PLLPEPPKATLEEKWLTWLKEFKHGSVIFCAYGSEGPLETNQFQELLLGLELTGFPFLAA  301

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             L  P   +   E   ALP GF ER+KG+GI++  W+QQQ IL H SVGC++ H G +S+ 
Sbjct  302   LKPPIGFESIEE---ALPEGFNERIKGKGIVYGSWIQQQLILEHPSVGCFITHCGAASIT  358

Query  435   EGIVNDCQLVMLPQKG-DQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGE  259
             EG+VN CQLV+LP+ G D  +NA++++  +K G+EV R +EDG F KE +  AV+ +M +
Sbjct  359   EGLVNTCQLVLLPRAGADHIMNARMMSSTLKVGIEVERGEEDGLFTKESVGNAVRIVMDD  418

Query  258   E---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             E   G   RAN  K + FLL   ++S  +    + + D+
Sbjct  419   ENEVGKEVRANHAKMRNFLLSSNLESSCVNSFCQKLYDL  457



>ref|XP_004169305.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 79B1-like 
[Cucumis sativus]
Length=477

 Score =   321 bits (823),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 184/460 (40%), Positives = 283/460 (62%), Gaps = 14/460 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ ++P+FA GH++PF+ LSNKL+  G KISFF     + + + +         +P+ +
Sbjct  16    LHIAMYPWFALGHLTPFLHLSNKLAKKGHKISFFIPTKTLPKFEPLNLFPNLITFIPVIV  75

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P V GLP G ++T D P     L+  +++L QPQI  LL  L P  ++FDF  +WLP LA
Sbjct  76    PHVHGLPHGAETTCDVPYPLHNLIMTSMDLTQPQITLLLQTLNPXLILFDFT-HWLPKLA  134

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
             ++LGIK+I + V  A   A+   P+R    +   T E++ KPP G+P +++ +L   EAR
Sbjct  135   SQLGIKSIHYCVTSAAMIAYTLTPSR-QFYKNELTEEDLMKPPVGYPSSTI-NLHPHEAR  192

Query  969   DFVIIFKRPHNGGASV--YDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
              F    KR    G+ V  YDR     + C AI  +TC+E+E  +++Y++ +F+KP+LL G
Sbjct  193   VFAS--KRKWKFGSDVLFYDRQFVSFSDCDAIGFRTCHEIEGDFVNYLQFEFRKPVLLTG  250

Query  795   PVVPEPAS-GVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFL  619
              V+PE  +   L++KW  WL  F+  +V+YC+FGSE  L+ +Q +EL +G EL  +PF  
Sbjct  251   SVLPETLNPEALEEKWESWLLGFKEGSVVYCAFGSECTLQMEQFQELLMGFELLDMPFLA  310

Query  618   VLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSV  439
              L  P     A  +  ALP GF +RV GRG+++ GW+QQ++IL H SVGC+V H G +S+
Sbjct  311   ALKPPFG---AETVEAALPEGFAKRVGGRGVVYGGWIQQERILEHPSVGCFVTHCGSNSL  367

Query  438   IEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGE  259
              E +VN CQLV+LPQ GDQ +NA+++ ++++ GVEV +R EDG+F KE + KAV+ +M E
Sbjct  368   KEALVNKCQLVLLPQVGDQIINARMMGNNLRVGVEVEKRQEDGWFTKESVCKAVKIVMDE  427

Query  258   E---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
             +   G   R N  K ++ LL K+++  +I      + D+ 
Sbjct  428   DNEIGKEVRTNHSKIRDLLLKKDLEESYIDSFSYNICDLV  467



>gb|KGN57635.1| hypothetical protein Csa_3G236030 [Cucumis sativus]
Length=521

 Score =   322 bits (826),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 180/465 (39%), Positives = 280/465 (60%), Gaps = 20/465 (4%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             LH+++FP+FA GHI+PF+ +SN L+    +I+F     N   + S LN  P       L+
Sbjct  60    LHILMFPWFATGHITPFLHISNHLASKNHRITFL-LPNNPSSLFSSLNLYPDLISFHFLS  118

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             LP+V GLPP   S +D P +   LL  AL+L +PQ+  ++  L+P FV FDFA +W+P +
Sbjct  119   LPSVPGLPPSAHSASDIPLSLTPLLASALDLTRPQVDRIIHSLRPDFVFFDFA-HWIPDI  177

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
              A L I++I F+V  A + A    P R    +   T E+ ++PP G+P ++V    + E+
Sbjct  178   TAPLQIRSICFTVVSAASVAVTVFPGRRVSLDHPLTDEDFREPPVGYPSSTVVFHGSRES  237

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             R  + +   P   G + ++R +       AI  +TC E+E  + D++ +QF+K +LL GP
Sbjct  238   RSLLFL-SMPFGQGITFHERFMTSYKKSDAIAMRTCQEIEGDFCDFLSNQFQKKILLTGP  296

Query  792   VVPEPASGV----LDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPF  625
             ++  P+S +    LD++W  WL QF+  TVI+C+FGS+  L+  Q++EL LG+E TGLPF
Sbjct  297   LMAAPSSKIKATTLDKEWEKWLGQFQQKTVIFCAFGSQVILEKQQLEELVLGIEQTGLPF  356

Query  624   FLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFS  445
              + L  P   D   E   ALP GF ERVK RGI++ GWVQQ  IL HSS+GC+V H GF 
Sbjct  357   LVALKPPMGYDSMEE---ALPKGFEERVKERGIVYGGWVQQPLILNHSSIGCFVSHCGFG  413

Query  444   SVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM  265
             S+ E +++D Q+V++P  GDQ LN +LLA ++K GVEV +R+EDG F ++ +++A++ +M
Sbjct  414   SMWESLMSDAQIVLIPTLGDQILNTRLLAQELKVGVEV-KREEDGSFTRQSVRQAIELVM  472

Query  264   GEEGASTRA--------NQEKWKEFLLDKEIQSKFIKDLVKVMRD  154
              ++  + R+        N  KWK+ L        +I + VK +++
Sbjct  473   VDDKNNNRSGVGEIVKKNHAKWKDLLTKPGFLETYIDNFVKKLQE  517



>ref|XP_008226432.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Prunus mume]
Length=489

 Score =   321 bits (823),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 186/492 (38%), Positives = 280/492 (57%), Gaps = 24/492 (5%)
 Frame = -3

Query  1569  ATGKSRIMEREITNNHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNV  1390
             A+ K   M +   N       H+ +FP+FA GH  PF+ LSN+L+  G +ISF       
Sbjct  5     ASTKVDQMAQPNLNETSSSNFHIAMFPWFAMGHSIPFLHLSNELAARGHRISFLLPKKAQ  64

Query  1389  DRIKSMLNSNP-CTQIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALL  1213
               ++  LN +P       + +P +EGLP GT++ +D P +   LL  A++  + QI+  L
Sbjct  65    IHLQH-LNLHPHLIAFCSVTVPHIEGLPEGTETASDIPISLTPLLAAAMDRTRQQIQGFL  123

Query  1212  V-----ELKPHFVIFDFAQNWLPPLAAELGIKTIffsvfvalatafatVPARLPGPERSP  1048
             V     + K   + +DFA +W+P +   LGIK + + V  A  TA A VPAR    +R  
Sbjct  124   VSCGVNDRKVDMIFYDFA-HWVPEITRGLGIKCVNYGVACAAITAMAIVPARNVPKDRPV  182

Query  1047  TVEEMKKPPPGFPPTSVASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKT  868
             T E+++ PPPG+P ++V  L   E +  + I   P+  G + Y+R++    GC AI  +T
Sbjct  183   TEEDLRDPPPGYPSSTVVMLPGHEVQSLMFI-TMPYGDGITFYERLMTAKKGCDAICIRT  241

Query  867   CYEMEAPYIDYVKSQFKKPLLLAGPVV--------PEPASGVLDQKWADWLSQFEPSTVI  712
             C E+E  + DY+++Q+KKP+LL GPV+         +  S  L+  WA+W S FE  +V+
Sbjct  242   CREVEGVFCDYLEAQYKKPVLLTGPVLGAMDSNNKNKKKSEQLEDIWANWFSGFETESVV  301

Query  711   YCSFGSETFLKDDQIKELALGLELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGR  532
             +C FGS+  L+ DQ +EL LG ELTGLPFF+ L  P      + +  ALP GF ERVKGR
Sbjct  302   FCGFGSQWVLEKDQFQELVLGFELTGLPFFVALKPPVG---CATIEEALPQGFEERVKGR  358

Query  531   GIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADD  352
             G++  GWVQQ  IL H SVGC+V H GF ++ E +V++ Q+V++P   D  LN K+L  D
Sbjct  359   GVVFGGWVQQTLILSHPSVGCFVSHCGFGALWESLVSNNQIVLVPHGADHILNTKILVKD  418

Query  351   MKAGVEVNRRDEDGYFWKEDIQKAVQTIMG---EEGASTRANQEKWKEFLLDKEIQSKFI  181
             +K  VEV  R+E+G+F KE + KA+ T+M    E G   + N  KW+E L        +I
Sbjct  419   LKVAVEV-EREENGWFSKESLSKAITTVMAKDNEVGVMVKKNHAKWRETLSTPGFMDGYI  477

Query  180   KDLVKVMRDMAT  145
                V+ ++++ +
Sbjct  478   DRFVQKLKELVS  489



>ref|XP_008455478.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Cucumis melo]
Length=460

 Score =   320 bits (820),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 175/458 (38%), Positives = 284/458 (62%), Gaps = 11/458 (2%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ ++P+FA GH+  F+Q+ NKL+  G +ISFF  +    +++   +       VP+ +
Sbjct  8     LHIAMYPWFALGHLIAFLQIGNKLANKGHRISFFIPSKTQPKLQPFNHFPNLITFVPITV  67

Query  1329  PAVEGLPPGTQSTADFppaaae-llpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             P V+GLP G ++TAD    +   L+  +++  +P+I + L ++KP  + +D A  W+P L
Sbjct  68    PHVDGLPLGAETTADVSHPSQIPLIMTSMDRTEPEIASRLQDIKPEVIFYDLAY-WVPKL  126

Query  1152  AAELGIKTIffsvfvalatafatVPA-RLPGPERSPTVEEMKKPPPGFPPTSVASLRTFE  976
             A  LGIK+++F+   A+  ++      + PG   + T +++  PPP FP +S+  L   E
Sbjct  127   AHPLGIKSVYFTAVSAVTMSYIQCKLWKFPG-HYNLTRDDLLHPPPDFPCSSI-KLHAHE  184

Query  975   ARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
             A+      +    G  + ++R+   L+ C+AI  K+C E+E P+IDY++S  ++P+LL G
Sbjct  185   AQYLASFGRMKFGGDITFFERISNALSQCNAIALKSCREIEGPFIDYLESIVERPILLPG  244

Query  795   PVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
              V  EP +  L+++WA+WLS+F+  +VIYC+FGSE  L  +Q +EL LGLEL+ LPFF+ 
Sbjct  245   TVNLEPLTTSLEERWANWLSEFKSGSVIYCAFGSECILTKNQFQELLLGLELSNLPFFVA  304

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             L  P  +D    +  ALP GF +R++GRGI++ GWVQQQQIL H S+GC++ H G  S+ 
Sbjct  305   LKPPDGIDT---VEAALPKGFKQRIEGRGIVYGGWVQQQQILDHPSIGCFITHCGAESLS  361

Query  435   EGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE  256
             E +V  CQLV+  +  DQ   A+ ++  +K GVE+ + +EDG F KE + KAV+T+M EE
Sbjct  362   EAVVKKCQLVLFSRTTDQLFRARSMSKFLKVGVEIEKGEEDGVFSKESVCKAVKTVMDEE  421

Query  255   ---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                G   RAN+EK +E L+DK+++  +I + +  +  M
Sbjct  422   NESGKEIRANKEKLRELLVDKDLEESYINNFIHSLHSM  459



>ref|XP_004487586.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cicer arietinum]
Length=459

 Score =   320 bits (819),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 184/458 (40%), Positives = 270/458 (59%), Gaps = 10/458 (2%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ +FP+FA GH++P++ LSNKL+  G KISFF       +++            PL +
Sbjct  7     LHIAMFPWFAMGHLTPYLHLSNKLAKRGHKISFFIPKKTQTKLEQFNLYPNLITFFPLNV  66

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P V+GLP G ++T+D   +   L+  A++  Q QI+ LL +L P  + FDF   WLP ++
Sbjct  67    PHVDGLPLGAETTSDVSFSLGPLIMTAMDQTQNQIELLLTQLNPQIIFFDFT-FWLPKIS  125

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
               LGIK+  + +     T++ T P R+   E+   V+ MK PP G+P +S  +L+  EA+
Sbjct  126   QSLGIKSFLYLIVNPATTSYTTSPLRMCEAEKLTEVDLMK-PPKGYPISSF-NLQFHEAK  183

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
                   K     G   YDR+  GL+   AI  K C E+E  Y+DY++ QF KP+LL+GPV
Sbjct  184   HLASKRKLEFGSGVLFYDRIFHGLSFADAIGFKGCREIEGSYVDYLQEQFGKPVLLSGPV  243

Query  789   VPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLN  610
             +PE     LD+KW  WL  F+  +++YC+ GSE  LK DQ  EL LGLELTG PF  ++ 
Sbjct  244   LPEQPKTFLDEKWGSWLGGFKDGSLVYCALGSEWILKQDQFHELLLGLELTGFPFLAIVK  303

Query  609   FPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEG  430
              P   +    +  ALP GF ERVK +GI+HSGW+QQQ IL HSSVGC+V H G  S+ EG
Sbjct  304   PPIGFET---IEDALPEGFKERVKEKGIVHSGWIQQQLILEHSSVGCFVTHCGAGSLTEG  360

Query  429   IVNDCQLVMLPQ-KGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE-  256
             ++N CQ+V+LP    D  +NAK++   +K GVEV + +EDG F KE + +AV+ +M +E 
Sbjct  361   LMNSCQMVLLPHLDSDHIINAKIMGRHLKVGVEVKKGEEDGLFTKESVCEAVKIVMDDEN  420

Query  255   --GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
               G   R N  K +  LL   ++S  +    + ++++ 
Sbjct  421   EVGREVRINHAKVRSLLLSHGLESACVDTFCEKLQELV  458



>ref|XP_008226430.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Prunus mume]
Length=489

 Score =   320 bits (820),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 186/492 (38%), Positives = 281/492 (57%), Gaps = 24/492 (5%)
 Frame = -3

Query  1569  ATGKSRIMEREITNNHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNV  1390
             A+ K   M +   N       H+ +FP+FA GH  PF+ LSN+L+  G +ISF       
Sbjct  5     ASTKVDQMAQPNLNETSSSNFHIAMFPWFAMGHSIPFLHLSNELASRGHRISFLLPKKAQ  64

Query  1389  DRIKSMLNSNP-CTQIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALL  1213
              +++  LN +P       + +P +EGLP GT++ +D P +   LL  A++  + QI+  L
Sbjct  65    IQLQH-LNLHPHLIAFCSVTVPHIEGLPEGTETASDIPISLTPLLAAAMDRTRQQIQGFL  123

Query  1212  V-----ELKPHFVIFDFAQNWLPPLAAELGIKTIffsvfvalatafatVPARLPGPERSP  1048
             V     + K   + +DFA +W+P +   LGIK + + V  A  TA A VPAR    +R  
Sbjct  124   VSCGVNDRKVDMIFYDFA-HWVPEITRGLGIKCVNYGVACAAITAMAIVPARNVPKDRPV  182

Query  1047  TVEEMKKPPPGFPPTSVASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKT  868
             T E+++ PPPG+P ++V  L   E +  + I   P+  G + Y+R++    GC AI  +T
Sbjct  183   TEEDLRDPPPGYPSSTVVMLPGREVQSLMFI-TMPYGDGITFYERLMTAKKGCDAICIRT  241

Query  867   CYEMEAPYIDYVKSQFKKPLLLAGPVV--------PEPASGVLDQKWADWLSQFEPSTVI  712
             C E+E  + DY+++Q+KKP+LL GPV+         +  S  L+  WA+W S FE  +V+
Sbjct  242   CREVEGVFCDYLEAQYKKPVLLTGPVLGAMDSNNKNKKKSEQLEDIWANWFSGFETESVV  301

Query  711   YCSFGSETFLKDDQIKELALGLELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGR  532
             +C FGS+  L+ DQ +EL LG ELTGLPFF+ L  P      + +  ALP GF ERVKGR
Sbjct  302   FCGFGSQWVLEKDQFQELVLGFELTGLPFFVALKPPVG---CATIEEALPQGFEERVKGR  358

Query  531   GIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADD  352
             G++  GWVQQ  IL H SVGC+V H GF ++ E +V++ Q+V++P   D  LN K+L  D
Sbjct  359   GVVFGGWVQQTLILSHPSVGCFVSHCGFGALWESLVSNNQIVLVPHGADHILNTKILVKD  418

Query  351   MKAGVEVNRRDEDGYFWKEDIQKAVQTIMG---EEGASTRANQEKWKEFLLDKEIQSKFI  181
             +K  VEV  R+E+G+F KE + KA+ T+M    E G   + N  KW+E L        +I
Sbjct  419   LKVAVEV-EREENGWFSKESLSKAITTVMAKDNEVGVMVKKNHAKWRETLSTPGFMDGYI  477

Query  180   KDLVKVMRDMAT  145
                V+ ++++ +
Sbjct  478   DRFVQKLKELVS  489



>ref|XP_004238162.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Solanum lycopersicum]
Length=457

 Score =   319 bits (817),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 180/463 (39%), Positives = 273/463 (59%), Gaps = 13/463 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             + +V+FP+ A+GH+ PF+ LSN+L+  G KISF        R++ ++          L +
Sbjct  1     MEIVMFPWLAYGHLIPFMNLSNELAKRGHKISFLLPKTAETRLQKLIFYPSLINFHKLTI  60

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P V+GLP G ++TAD P     LL  A + +  +IK  L  LKPHFV FDFA  W+P LA
Sbjct  61    PHVDGLPYGAETTADVPGPLESLLATAFDELYDEIKCFLQNLKPHFVFFDFAY-WIPDLA  119

Query  1149  AEL-GIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
              E+ GIKT+F+ V     ++ + + +       + T  E+ KPPPG+P T+V  LR  EA
Sbjct  120   LEIGGIKTLFYRVVCPAVSSVSVIRSPDKAIFMASTAAELVKPPPGYPSTTVV-LRESEA  178

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             +    +F   +  G + Y+R+  G+  C AI  KTC E+E  +  Y+ +QF+KP+L  GP
Sbjct  179   KLLSFVFHE-YGNGVTFYERIKKGMTRCDAIAMKTCREIEGNFCTYISTQFEKPVLYTGP  237

Query  792   VVPEPASGVLDQK-WADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
             V+ EP +  L++    +WL +FEP +V++C+FGS+  L+  Q +EL LG ELT LPF LV
Sbjct  238   VISEPKNEPLEEHGLTNWLEKFEPGSVVFCAFGSQMILEKTQFQELVLGFELTELPFLLV  297

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             +  P   +   E   ALP GF ERV+ +G+I   WV Q +IL H SVGC+V H G+ S+ 
Sbjct  298   VKTPEGTNSVEE---ALPEGFKERVQEKGLILDCWVPQLEILRHKSVGCFVTHCGYGSMW  354

Query  435   EGI-VNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGE  259
             E + + DCQLV+LP+  D   NA+L+   +K G+EV  +DE+  F KE++ KAV+ +M +
Sbjct  355   ESLALCDCQLVLLPRPIDHIFNARLMEKQLKVGIEV-EKDENDMFTKENLCKAVKCVMDK  413

Query  258   E---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
             +   G   + N +KWKE L      S +I + ++ + ++   N
Sbjct  414   DSQIGCVVKENHKKWKELLSSPGFMSNYIDNFIQDLNELLVEN  456



>ref|XP_004293911.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Fragaria vesca 
subsp. vesca]
Length=451

 Score =   318 bits (816),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 179/458 (39%), Positives = 271/458 (59%), Gaps = 19/458 (4%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ ++P+FA GH++ F+ +SNKL+  G KISFF       +++           +PL++
Sbjct  6     LHIAMYPWFAMGHLTAFLHISNKLAERGNKISFFLPLKTRSKLQHYNLHPRLITFIPLSV  65

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P V+GLP GT++TAD   +   LL  A++L +PQI+  L+ELKP FV FD +  WLP + 
Sbjct  66    PHVDGLPLGTETTADIDLSLGSLLATAMDLTRPQIEQSLIELKPDFVFFDLSY-WLPAML  124

Query  1149  AELG--IKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFE  976
               L   IK+I++SV           PA +    R+  +    +    +   S+  L+T E
Sbjct  125   RGLATNIKSIYYSVIN---------PATIWFGLRNLVLPRKNQLDEAYRSFSI-KLQTHE  174

Query  975   ARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
              R +  +    +    +   R++   + C AI  ++C E+  P+ +Y++ +  KP++LAG
Sbjct  175   VRAYDAMMNMKYGSEVTFSKRLMTSRSDCDAICFQSCRELAEPFSNYIEIRMNKPVILAG  234

Query  795   PVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
             PV+P+P S  L++KWA WL  FEP TVI+C+ GSE  L   Q+++L LG ELTG PFF  
Sbjct  235   PVMPDPPSSQLEEKWARWLGGFEPRTVIFCALGSEYILTKQQLQQLLLGFELTGFPFFAA  294

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             L  P  V+    +  ALP GF ERVKG+G+++  WVQQ  IL H SVGC+V H G  S+ 
Sbjct  295   LKPPTGVE---SIESALPEGFEERVKGKGVVYGSWVQQPLILKHPSVGCFVTHCGSGSLN  351

Query  435   EGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE  256
             E ++N+CQLV LP   DQ +NA++++ ++K GVEV + DEDG F KE + KAV+ +M E 
Sbjct  352   EALLNECQLVFLPNILDQIINARMMSGELKVGVEVEKGDEDGLFTKEGVCKAVKAVMDEN  411

Query  255   ---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                G   + N  KW+EFL  K ++S +I D V+ +  +
Sbjct  412   SEVGKEVKINHAKWREFLSSKGLESSYIDDFVQKLHKL  449



>ref|XP_004487588.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cicer arietinum]
 gb|AGU14137.1| UDP-glycosyltransferase [Cicer arietinum]
Length=457

 Score =   318 bits (816),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 192/462 (42%), Positives = 280/462 (61%), Gaps = 20/462 (4%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             LH+ +FP+FA GH++PF+ LSNKL+  G KISFF       +++  LN +P       + 
Sbjct  6     LHIAMFPWFAMGHLTPFLHLSNKLAQRGHKISFFIPKKTQTKLQH-LNLHPHLITFFTIN  64

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P V+GLP G ++T+D P +   L+  A++     I+ LL ELKP  V FDF Q+WLP L
Sbjct  65    VPHVDGLPYGAETTSDVPFSLFPLIATAMDQTDKDIELLLKELKPQIVFFDF-QHWLPNL  123

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVE----EMKKPPPGFPPTSVASLR  985
               + GIK++ + ++  ++TA+        GP +S   E    ++ KPP GFP T + +L 
Sbjct  124   TKKHGIKSLQYLIWNPISTAYLGT-----GPRQSQGRELNEVDLMKPPSGFPDTCI-NLH  177

Query  984   TFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLL  805
             + E R  V   K     G  +YDRV  G      I  K C E++ PY++Y+ S F K +L
Sbjct  178   SHELRFLVSSRKLEFGSGILLYDRVDLGARLADVIAFKGCKEIDGPYVEYLGSVFGKSVL  237

Query  804   LAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPF  625
             L+GP++PEP    L++KW  WL+ F+  +V+YC++GSE+ L+ +Q KEL LGLELTG PF
Sbjct  238   LSGPILPEPPMSTLEEKWVSWLNGFKQGSVVYCAYGSESALEHNQFKELLLGLELTGFPF  297

Query  624   FLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFS  445
                L  P   +   E   ALP GF ERVKGRGI + GWVQQQ IL H+S+GC++ H G +
Sbjct  298   LAALKPPVGFESIEE---ALPQGFNERVKGRGIAYGGWVQQQLILGHTSIGCFITHCGAA  354

Query  444   SVIEGIVNDCQLVMLPQKG-DQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTI  268
             S+ EG+VN CQLV+LP+ G D  +NA++++  +K GVE+ + +EDG F KE + KAV  +
Sbjct  355   SITEGLVNTCQLVLLPRLGSDHIMNARMMSAKLKVGVEIEKGEEDGLFTKESVCKAVNIV  414

Query  267   MGEE---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             M EE   G   RAN  K + FLL   ++S  +    + + D+
Sbjct  415   MDEENELGREVRANHAKLRNFLLCNNLESSSVDSFCQELYDL  456



>ref|XP_008456016.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 79B6-like 
[Cucumis melo]
Length=472

 Score =   319 bits (817),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 177/465 (38%), Positives = 275/465 (59%), Gaps = 20/465 (4%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             LH+++FP+FA GHI+PF+ +SN L+    +I+F     N       LN  P       L+
Sbjct  11    LHILMFPWFATGHITPFLHISNHLASKNHRITFL-LPNNPSPXFHSLNLYPNLISFHFLS  69

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             LP+V GLPP   S +D P +   LL  A +L +PQ+  ++  L+P FV FDFA +W+P +
Sbjct  70    LPSVPGLPPAAHSASDIPLSLTPLLASAFDLTRPQVHRIIHSLRPDFVFFDFA-HWIPDI  128

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
              A L I++I F+V  A + A    P R    +   T E+ ++PP G+P ++V    + E+
Sbjct  129   TAPLQIRSICFTVVSAASVAVTVFPGRRVSLDHPLTDEDFREPPVGYPSSTVVFHDSRES  188

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             R  + +   P   G + ++R++       AI  +TC E+E  + D++ +Q +K +LL GP
Sbjct  189   RSLLFL-SMPFGQGITFHERLMTSYKKSDAIAMRTCQEIEGDFCDFLSNQLQKKILLTGP  247

Query  792   VVPEPASGV----LDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPF  625
             ++  P+S +    LD++W  WL QF+P TVI+C+FGS+  L+  Q++EL LG+E TGLPF
Sbjct  248   LMAAPSSRIKATTLDKEWEKWLGQFQPKTVIFCAFGSQVILEKQQLEELVLGIEQTGLPF  307

Query  624   FLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFS  445
              + L  P   D   E   ALP GF ERVK RGI++ GWVQQ  IL HSS+GC+V H GF 
Sbjct  308   LVALKPPMGYDSMKE---ALPKGFEERVKERGIVYGGWVQQPLILNHSSIGCFVSHCGFG  364

Query  444   SVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM  265
             S+ E +++D Q+V++P  GDQ LN +LLA ++K GVEV +R+EDG F ++ +++A++ +M
Sbjct  365   SMWESLMSDAQIVLIPTLGDQILNTRLLAQELKVGVEV-KREEDGSFTRQSVRQAIELVM  423

Query  264   GEE--------GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRD  154
              ++        G   + N  KWK  L        +I + V  +++
Sbjct  424   VDDNNNNGSGIGEMVKKNHAKWKHLLTKPSFLETYIDNFVMNLQE  468



>ref|XP_004487587.1| PREDICTED: UDP-glycosyltransferase 79B1-like [Cicer arietinum]
 gb|AGU14138.1| UDP-glycosyltransferase [Cicer arietinum]
Length=455

 Score =   318 bits (815),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 190/459 (41%), Positives = 282/459 (61%), Gaps = 16/459 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             LH+ +FP+FA GH +PF+ LSNKL+  G KISFF     +++++  LN +P       + 
Sbjct  6     LHIAMFPWFAMGHFTPFLHLSNKLAQRGHKISFFIPKKTLNKLQH-LNLHPHLITFFTIN  64

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P V+GLP G ++T+D P     L+  A++  +  I+ LL ELKP  V FDF Q+WLP L
Sbjct  65    VPHVDGLPHGAETTSDVPFPLFPLIATAMDQTEKDIELLLKELKPQIVFFDF-QHWLPNL  123

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
               +LGIK++   +   ++TA+       P   R  T  ++ KPP GFP + + +L + E 
Sbjct  124   TKKLGIKSVQNWIMNPISTAYL---GNRPSQGRELTEVDLLKPPSGFPDSCI-NLHSHEL  179

Query  972   RDFVIIFKRPHNG-GASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
             R F++ FK+   G G   +DR+ +G     AI  K C E++  Y DY++   +KP+ L+G
Sbjct  180   R-FLVSFKKLEFGSGVLFFDRLESGSKLSDAIAFKGCKEIDGIYADYIEMVLRKPVFLSG  238

Query  795   PVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
             P++PEP    L++KW  WL+ F+  +V+YC++G+E+ L+ +Q +EL LGLELTG PF + 
Sbjct  239   PLLPEPTLSSLEEKWVSWLNGFKHGSVVYCAYGTESALEHNQFQELLLGLELTGFPFLVA  298

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             L  P   +   E   ALP GF ERVK RGI++ GWVQQQ IL HSSVGC++ H G +S+ 
Sbjct  299   LKPPIGFESIEE---ALPKGFNERVKERGIVYGGWVQQQLILEHSSVGCFITHCGAASIT  355

Query  435   EGIVNDCQLVMLPQKG-DQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGE  259
             EG+VN CQLV+LP  G D  LNA++++  +K GVEV + +EDG F KE + KAV  +M E
Sbjct  356   EGLVNTCQLVLLPHVGADYILNARMMSAKLKVGVEVEKGEEDGLFTKESVCKAVNIVMDE  415

Query  258   E---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                 G   RAN  K + FLL + ++S  +    + + D+
Sbjct  416   GNEIGREVRANHAKMRNFLLSENLESSCVDSFCRKLYDL  454



>ref|XP_006361070.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Solanum tuberosum]
Length=460

 Score =   318 bits (815),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 181/466 (39%), Positives = 270/466 (58%), Gaps = 29/466 (6%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             L  +++P++A GH++ F+ LSNKL+  G KI F      + +++             + +
Sbjct  6     LTFIMYPWYAMGHLTSFLHLSNKLAHRGHKIFFVHPTNTLSKLEKFNRYPELINFKSVTV  65

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P V+GLP G ++T+D P     LL  AL+L  P+I++L+ E+KPHF+ +DFA  W+P +A
Sbjct  66    PHVDGLPLGAETTSDVPIFNQNLLCQALDLTLPKIESLIQEIKPHFIFYDFAY-WVPSIA  124

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
              +  +K++ +      +         L   E   +  EM +PPPGFP  S   L   EAR
Sbjct  125   RKYKVKSVHYCSITPSSV------GYLMRGENPSSEAEMMEPPPGFPVDSSIKLHKHEAR  178

Query  969   DFVIIFKRPHNGGASVY----------DRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQF  820
               V +    H+ G +             R+L       AI  KT  E+E PY ++V+ +F
Sbjct  179   LIVAL----HSMGKNSSNSGSGSVSFTQRLLLAFQDGDAIAFKTTREIEGPYYEFVEHKF  234

Query  819   KKPLLLAGPVVPEP-ASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELAL-GL  646
             KKP++LAGPV+PEP  S   ++ W+ WL +F+  TVI C+FGSE  LK DQ +EL    L
Sbjct  235   KKPVVLAGPVLPEPIESSNTEENWSKWLEKFQEKTVILCAFGSECNLKKDQFQELGFWDL  294

Query  645   ELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCY  466
              L  + FF  L  P   +   E   ALP GF ER +G+GI+HSGW +QQ +L H SVGC+
Sbjct  295   NLLVIRFFAALKPPIEAETIEE---ALPEGFKERTQGKGIVHSGWAEQQLMLSHPSVGCF  351

Query  465   VCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQ  286
             V H G +S+ E ++N+CQLV++P  GDQF+N++L   D+KAGVEV R +E+G F K+ + 
Sbjct  352   VTHCGGNSLSEVMINECQLVLVPNFGDQFINSRLFGGDLKAGVEVERNEENGSFTKDGVC  411

Query  285   KAVQTIMG---EEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMR  157
             KA++ +M    EEG   RAN+ KW+EFLL K ++  +I  LV  ++
Sbjct  412   KAIKMVMNDESEEGCKIRANRAKWREFLLSKGLEDSYIDALVHKLQ  457



>ref|XP_004487584.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cicer arietinum]
Length=458

 Score =   318 bits (814),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 183/459 (40%), Positives = 271/459 (59%), Gaps = 11/459 (2%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ +FP+FA GH+ P++ LSNKL+  G KISFF+      +++            PL +
Sbjct  7     LHIAMFPWFAMGHLIPYLHLSNKLAKRGHKISFFTPKKTQTKLEQFNLYPNLITFYPLNV  66

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P V+GLP G ++T+D   +   +L  A++  Q QI+ LL +LKP  + FDF   WLP + 
Sbjct  67    PHVDGLPFGAETTSDVAISLGPILMTAMDQTQNQIELLLTQLKPQIIFFDFV-FWLPKIT  125

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
               LGIK+  + +      ++ T P R+   E    V+ MK PP G+P +   +L++ EA+
Sbjct  126   QRLGIKSFLYFIINPATISYTTSPPRMFEAENLTEVDLMK-PPKGYPTS--FNLQSHEAK  182

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
                   K     G     R    L+   AI  K C E+E PY+DY++ QF KP+LL+GPV
Sbjct  183   HLASTRKIEFGSGIPFSVRSYNCLSLTDAIGFKGCREIEGPYVDYLQEQFGKPVLLSGPV  242

Query  789   VPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLN  610
             +PE +   LD+KW  WL  F+  +++YC+ GSE  LK DQ  EL LGLELTG PF  +L 
Sbjct  243   LPEQSKTALDEKWGSWLGGFKDGSLVYCALGSELKLKQDQFHELLLGLELTGFPFLAILK  302

Query  609   FPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEG  430
              P   +   +   ALP GF ERVK +GI+HSGW+QQQ IL H SVGC+V H G  S+ EG
Sbjct  303   PPVGFETIED---ALPEGFKERVKEKGIVHSGWIQQQLILEHPSVGCFVTHCGAGSITEG  359

Query  429   IVNDCQLVMLPQ-KGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE-  256
             +VN+CQ+V+LPQ  GD  +NA+++   +K GVEV + +EDG F KE + +AV+ +M +E 
Sbjct  360   LVNNCQMVLLPQLNGDYIINARIMGRHLKVGVEVKKGEEDGLFTKESVYEAVKIVMDDEN  419

Query  255   --GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMAT  145
               G   R+N  K +  LL  +++S  +    + ++++ +
Sbjct  420   EIGREVRSNHTKVRNLLLRHDLESSCLDTFCEKLQELVS  458



>gb|AES66927.2| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=459

 Score =   318 bits (814),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 177/458 (39%), Positives = 274/458 (60%), Gaps = 10/458 (2%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ +FP+FA GH++P++ LSNKL+  G KISFF       +++            PL +
Sbjct  7     LHIAMFPWFAMGHLTPYLHLSNKLAKRGHKISFFIPTKTQTKLEQFNLYPNLITFYPLNV  66

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P + GLP G ++T+D   +   L+  A++  QPQ++ LL +L P  V FDFA  W+P +A
Sbjct  67    PHIHGLPFGAETTSDVSFSLGPLIMTAMDQTQPQVELLLAQLNPKMVFFDFA-FWIPKIA  125

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
               LGIK+  + +      ++   P+R+     + T  ++ KPP G+P +S  +L + EA+
Sbjct  126   QSLGIKSFQYWIVSPATISYTLSPSRM-CESINLTEFDLMKPPKGYPNSSF-TLYSHEAK  183

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
                +        G   YDR+  GL+   AI  K C ++E PY+DY++ +F KP+LL+GPV
Sbjct  184   YLALKRNFEFGSGVLFYDRLFNGLSLSDAIGFKGCRQIEGPYVDYLEQEFGKPVLLSGPV  243

Query  789   VPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLN  610
             +PEP   VLD+KW  WL  F+  +++YC+ GSE  L  +Q +EL LGLELTG PF  +L 
Sbjct  244   LPEPPKTVLDEKWGSWLGGFKDGSLVYCALGSECKLTLEQFQELLLGLELTGYPFLAILK  303

Query  609   FPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEG  430
              P   +   +   A P  F ERVK +GI+HSGW+QQQ IL HSSVGC+V H G  S+ EG
Sbjct  304   PPVGFETVED---AFPEEFEERVKEKGIVHSGWIQQQLILEHSSVGCFVTHCGAGSLTEG  360

Query  429   IVNDCQLVMLPQ-KGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE-  256
             + N+CQ+V++P    D  +NAK++   +K GVEV + +EDG F KE + +AV+ +M +E 
Sbjct  361   LTNNCQMVLIPHLDADHIINAKIMGMKLKVGVEVKKGEEDGLFTKESVCEAVKIVMDDEN  420

Query  255   --GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
               G   R N +K +  LL+++++S  +    + ++++ 
Sbjct  421   EIGREVRNNHDKLRNLLLNQDLESSCVDGFCEKLQELV  458



>ref|XP_003543299.2| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
Length=461

 Score =   317 bits (813),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 189/459 (41%), Positives = 277/459 (60%), Gaps = 13/459 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             +H+ ++P+FA GH  PF+ LSNKL+  G KISF        +I+  LN +P    +VP+ 
Sbjct  9     MHIAMYPWFAMGHFIPFLHLSNKLAKRGHKISFIVPKRTQTKIQH-LNQHPHLITLVPIT  67

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P V+GLP   ++T+D   +   LL  A++ ++  I+ LL ELKP  V FDF+  WLP L
Sbjct  68    VPHVDGLPHDAETTSDVLFSFFPLLATAMDRIEKDIELLLRELKPQIVFFDFS-FWLPNL  126

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
             A  LGIK++ + +  A++ A+   P R     R  +  +  KP PGFP +S+ +L   EA
Sbjct  127   ARSLGIKSVQYFIVNAVSVAYFGSPERYHN-GRDLSETDFTKPSPGFPDSSI-TLHEHEA  184

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             +  V + K     G  +YDR   G     AI  K C E+E PY+DY+++Q  KP+LL+GP
Sbjct  185   QFVVRMGKVEFGSGVLMYDRFDIGTRLSDAIGFKGCREIEGPYVDYLETQHGKPVLLSGP  244

Query  792   VVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
             ++PEP +  L+ KW  WL +F P +VI+C++GSET L+ +Q  EL LGLELTG PF   L
Sbjct  245   LLPEPPNTTLEGKWVKWLEEFNPGSVIFCAYGSETTLQQNQFLELLLGLELTGFPFLAAL  304

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
               P   +   E   ALP GF ERV+GRG+++ GWVQQQ IL H SVGC++ H G  S+ E
Sbjct  305   KPPNGFESIEE---ALPEGFRERVQGRGVVYEGWVQQQLILGHPSVGCFITHCGAGSITE  361

Query  432   GIVNDCQLVMLPQKG-DQFLNAKLLADDMKAGVEVNRRDE-DGYFWKEDIQKAVQTIMGE  259
              +V++CQLV LP+ G D  + A++++ ++K GVEV + +E DG F KE + KAV+ +M +
Sbjct  362   ALVSECQLVFLPRLGSDYVITARMMSRELKVGVEVEKSEEDDGSFTKESVCKAVKIVMDD  421

Query  258   E---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             E   G   R N  K +  LL   ++S  +  L   +R +
Sbjct  422   ENELGRQVRENHRKVRNILLSNNLESFHVDILCDKLRAL  460



>ref|XP_010520927.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase 
[Tarenaya hassleriana]
Length=468

 Score =   317 bits (811),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 186/479 (39%), Positives = 293/479 (61%), Gaps = 29/479 (6%)
 Frame = -3

Query  1548  MEREITNNHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFF---SAAGNVDRIK  1378
             MER  T    G  + +V++P+ A GH++ F+ LSNKL+  G +I F     A  +++ I 
Sbjct  1     MERFGTE---GSSMSIVMYPWLALGHMTAFLHLSNKLAEKGHRIVFLLPKKARAHLEPIN  57

Query  1377  SMLNSNPCTQIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKP  1198
               L+ N  T    +++P V GLP G ++ +D P     LL VA++  +P+++ ++  +KP
Sbjct  58    --LHPNLIT-FRTISIPHVHGLPLGAETNSDVPIFLTHLLAVAMDRTRPEVETVVRTVKP  114

Query  1197  HFVIFDFAQNWLPPLAAELGIKTIffsvfvalatafatVPA--RLPGPERSPTVEEMKKP  1024
               V +DFA +W+P ++A +G KT+ F    A + A   VPA  R        + +E+ +P
Sbjct  115   DLVFYDFA-DWVPGISAPVGAKTVCFDTASAASIALTLVPAAAREMADGAMLSGDELSRP  173

Query  1023  PPGFPPTSVASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPY  844
             PPG+P + V  LR  EAR    ++KR   G  S +++ ++ L  C AI  +TC E+E  +
Sbjct  174   PPGYPSSKVV-LRAHEARTLGFLWKR-FEGLVSFFEKKVSTLRNCDAIAIRTCREIEGKF  231

Query  843   IDYVKSQFKKPLLLAGPVVPEPA---SGVLDQKWADWLSQFEPSTVIYCSFGSETFL-KD  676
              +++ SQ+ +P+ L GPV+P+        L+ +WADWLS+FEP +V+YC+FGS+  L K 
Sbjct  232   CEFISSQYNRPVYLTGPVLPDTKPSDQAALEPRWADWLSKFEPGSVVYCAFGSQPVLDKL  291

Query  675   DQIKELALGLELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQ  496
             +Q +E+ LGLELTGLPF + L  P+      E   ALP GF ERVKGRG+++ GWVQQ  
Sbjct  292   EQFQEVCLGLELTGLPFLIALKPPSGFSTVEE---ALPEGFEERVKGRGVVYGGWVQQPL  348

Query  495   ILVHSSVGCYVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDE  316
             IL H SVGC+V H GF S+ E ++ DCQ+V++P  G+Q LNAKL++++M+  VEV +R+E
Sbjct  349   ILDHPSVGCFVSHCGFGSMWESLLRDCQIVLVPHLGEQILNAKLMSEEMEVAVEV-KREE  407

Query  315   DGYFWKEDIQKAVQTIM---GEEGASTRANQEKWKEFL----LDKEIQSKFIKDLVKVM  160
             +G+F +  ++ AV+++M    E G   R N +KWK+ L      +   SKF + L++++
Sbjct  408   NGWFSRHSLKDAVKSVMDKDSEIGEIVRKNHKKWKDVLGESGFSESYISKFEQSLLQLL  466



>ref|XP_003596668.1| Anthocyanidin 3-O-glucosyltransferase [Medicago truncatula]
Length=461

 Score =   316 bits (809),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 185/463 (40%), Positives = 279/463 (60%), Gaps = 22/463 (5%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             +H+ +FP+FA GH +P++  SNKL++ G KISFF     +++++  LN +P      P+ 
Sbjct  7     MHISMFPWFAMGHFTPYLHFSNKLAIRGHKISFFIPKNTLNKLQH-LNLHPNLITFFPIT  65

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P V GLP   ++T+D P +   L+  A++    QI+ LL ELKP  V FDF Q WLP L
Sbjct  66    VPHVNGLPHNAETTSDVPFSLFPLIATAMDQTDKQIELLLKELKPQIVFFDF-QYWLPNL  124

Query  1152  AAELGIKTIffsvfvalatafatVPARLPG-PERSP----TVEEMKKPPPGFPPTSVASL  988
               +LGIK++ + ++  ++      PA L   P +S     T +++KKPP GFP +S+   
Sbjct  125   TQKLGIKSLQYLIWSPIS------PAYLGSIPRKSQGTYLTEDDLKKPPTGFPDSSI-KF  177

Query  987   RTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPL  808
              + E R      K+    G  +YDRV  G     A+  K C E++  Y DY+++ F KP+
Sbjct  178   HSHELRFLASTRKQEFGSGVLLYDRVDTGTKFSDAVSFKGCREIDGLYADYLETVFGKPV  237

Query  807   LLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLP  628
             LL+GP++PE     L++KW  WL  F+  +V++C++GSE  L+ +Q +EL LGLELTG P
Sbjct  238   LLSGPLLPEAPKSTLEEKWLTWLEGFKHGSVVFCAYGSEGPLQHNQFQELLLGLELTGFP  297

Query  627   FFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGF  448
             F   L  P   D   E   ALP GF ERV G+GI++  W+QQQ IL H SVGC++ H G 
Sbjct  298   FLAALKPPIGFDSIEE---ALPEGFNERVNGKGIVYGNWIQQQLILEHPSVGCFITHCGA  354

Query  447   SSVIEGIVNDCQLVMLPQKG-DQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQT  271
             +S+ EG+VN CQLV+LP+ G D  +NA++++  +K GVEV + +EDG F KE + KAV+ 
Sbjct  355   ASITEGLVNTCQLVLLPRAGTDHIMNARMMSSKLKVGVEVEKGEEDGLFTKESVCKAVKI  414

Query  270   IMGEE---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             +M +E   G + RAN  K + FLL   ++S  +    + + D+
Sbjct  415   VMDDENEVGKAVRANHAKMRNFLLSSNLESSCVDSFCQKLYDL  457



>ref|XP_008226434.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Prunus mume]
Length=450

 Score =   315 bits (806),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 175/455 (38%), Positives = 269/455 (59%), Gaps = 13/455 (3%)
 Frame = -3

Query  1497  IFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLALPAVE  1318
             +FP+FA GHI+P++ L+N+L+  G +I+F        +++ ++  +      P+A+P V 
Sbjct  1     MFPWFAMGHINPYLHLANELASRGHRITFLVPNKARLQLQHLVLHSNLIVFSPVAVPHVH  60

Query  1317  GLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLAAELG  1138
             G P GT+  ++ P     LL  A++  + +I+  L   KP FV++D AQ W+P +A   G
Sbjct  61    GFPDGTEIASEIPIHMTHLLATAMDRTRGEIEQFLTVSKPDFVLYDTAQ-WVPEIARRNG  119

Query  1137  IKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEARDFVI  958
              KT+ ++   A A A   VPAR    +R  T EE+++PP G+P  +V  LR  EA+    
Sbjct  120   TKTVCYNFVCAAALAITLVPARNVPKDRPITEEELREPPAGYPSKNVV-LRGAEAKALTF  178

Query  957   IFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPVV---  787
             I   P+  G + Y+R    +  C  +  +TC E+E    DY+++Q+KKP+LL GPV+   
Sbjct  179   I-TLPYGEGITFYERTKTAMKECDVLSIRTCRELEGDLCDYIEAQYKKPVLLTGPVLGLG  237

Query  786   PEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLNF  607
              +  S  L+++W  W S FE  +V++C+FGS+  L+ DQ +EL LG ELT LPFF+ L  
Sbjct  238   SDKKSEKLEERWEKWFSGFEAGSVVFCAFGSQWILEKDQFQELVLGFELTRLPFFVALKP  297

Query  606   PANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEGI  427
             P      + +  ALP GF ERVKGRG++  GWVQQ  IL H SVGC+V H GF S+ E +
Sbjct  298   PLG---CATIEEALPNGFEERVKGRGVVFGGWVQQTAILSHKSVGCFVNHCGFGSMWESL  354

Query  426   VNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM---GEE  256
             +   Q+V++PQ GDQ LN KLL  ++K  VEV  R+E+G+F KE ++KA++++M    E 
Sbjct  355   MTHNQIVLVPQLGDQILNTKLLVKELKVAVEVE-REENGWFSKESLRKAIKSVMDKDSEV  413

Query  255   GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             G   + N  KW E L      S +I   V+ ++++
Sbjct  414   GVMIKENHAKWVETLSSPGFMSGYIDRFVQKLKEL  448



>emb|CAN63557.1| hypothetical protein VITISV_034121 [Vitis vinifera]
Length=447

 Score =   315 bits (806),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 185/461 (40%), Positives = 262/461 (57%), Gaps = 26/461 (6%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPC-TQIVPLA  1333
              HV +FP+FAFGH++ F+ LSNKL+  G KI+F        ++++ LN +P      PL+
Sbjct  9     FHVAMFPWFAFGHMTAFLHLSNKLAERGHKITFMLPKKAQSQLQT-LNFHPTLISFHPLS  67

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P V+GLPPG ++ +D P     LL  A++    Q++A L    P F+ +D   +  P L
Sbjct  68    IPHVDGLPPGAETASDIPIFLTHLLATAMDRATDQLEAALRASNPDFLFYD-CSHLAPVL  126

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
             A+ LGIK I ++V  A + A A VPAR    +R  T  E+  PP G+P +S A  R  E 
Sbjct  127   ASRLGIKAICYNVVCAASIAIALVPARGVSKDRPVTEAELAVPPSGYP-SSTAVFRRHEG  185

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             R    I   P   G S Y+R    +    AI  +TC E+E    DY+ +Q+ KP+ L GP
Sbjct  186   RALQFI-SAPFGDGISFYERTTTAMKESDAISIRTCREIEGNLCDYIGTQYGKPIFLTGP  244

Query  792   VVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
             V+PEP+   L+ +WA WLSQ+               L+ DQ +EL LGLELTGLPF + L
Sbjct  245   VLPEPSPTPLEDRWAQWLSQY--------------ILEKDQFQELVLGLELTGLPFLVAL  290

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
               P     A+ +  ALP GF ERV GR  +H GWVQQ  IL H SVGC+V H GF S+ E
Sbjct  291   KPPTG---AATIEEALPEGFKERVGGRAAVHGGWVQQPSILSHPSVGCFVSHCGFGSMWE  347

Query  432   GIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE-  256
              ++NDCQ+V++P  GDQ LN ++LA +++  VEV  R+E+G+F KE + KA++++M EE 
Sbjct  348   SLMNDCQIVLVPHLGDQILNTRVLAGELQVAVEVE-REENGWFSKESLCKAIKSVMDEES  406

Query  255   --GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
               G   R N  KWKE        S ++   V  ++ +   N
Sbjct  407   EVGGLVRKNHAKWKETFARPGFMSNYVDKFVGQLQGLLDHN  447



>ref|XP_008349217.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Malus domestica]
Length=456

 Score =   315 bits (806),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 191/464 (41%), Positives = 274/464 (59%), Gaps = 20/464 (4%)
 Frame = -3

Query  1497  IFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLALPAV  1321
             ++P+FA GH++ ++ LSNKL+  G +ISFF       ++++ LN +P     +P+ +P V
Sbjct  1     MYPWFAMGHLTSYLHLSNKLAERGHRISFFVPTKTQQKLQA-LNLHPHLISFIPITVPHV  59

Query  1320  EGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLAAEL  1141
             +GLPPG ++T D P  +  L+  A++L QP I   + EL P FV FDF   WLP L  +L
Sbjct  60    DGLPPGAETTNDVPIPSYSLIMAAMDLTQPAILQAICELNPDFVFFDFTP-WLPKLLRQL  118

Query  1140  G--IKTIffsvfvalatafatVPARLPGPERSPTVEE-----MKKPPPGFPPTSVASLRT  982
             G  IK+I + +       +   P R    E+S   E+     +  PPP FPP+S+  L  
Sbjct  119   GTGIKSINYIIISPAFVGYVRSPERKVLMEKSVLTEDDLIYDLVNPPPSFPPSSI-KLPA  177

Query  981   FEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLL  802
              EAR       +    G    +R +  LN C A   +TC EME  Y DY+++Q +KP+LL
Sbjct  178   HEARMLAPFLLKEFGSGRKFIERQMISLNDCDAAAFRTCREMEGKYCDYLETQLRKPVLL  237

Query  801   AGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFF  622
             AGP+VPE  +  LD+KWA WL +FE  +VIYC+FG+E  LK DQ +EL LG ELTGLPFF
Sbjct  238   AGPLVPETPTTELDEKWAKWLERFEAKSVIYCAFGTECVLKIDQFQELLLGFELTGLPFF  297

Query  621   LVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSS  442
               L  P  V+    +  ALP GF  RVKGRG++  GWVQQ  +L H S   +V H G SS
Sbjct  298   AALKPPMGVEA---IESALPEGFEGRVKGRGVVSWGWVQQPLMLKHPS---FVTHCGSSS  351

Query  441   VIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMG  262
             ++EG+V++CQLV+LP   DQ   A+++  D++ GVEV + +EDG F KE + KAV+ +M 
Sbjct  352   LMEGLVSECQLVLLPNVADQLAIARVMGRDLRVGVEVEKGEEDGVFTKEGVCKAVRDVMD  411

Query  261   EE---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
              E   G   R N  K +EFL  K +++ +I   V+ +  +  +N
Sbjct  412   AESEVGKEVRRNHAKLREFLSSKGLENSYIDSFVEKLHALLGLN  455



>gb|EYU28028.1| hypothetical protein MIMGU_mgv1a006231mg [Erythranthe guttata]
Length=451

 Score =   315 bits (806),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 190/451 (42%), Positives = 266/451 (59%), Gaps = 20/451 (4%)
 Frame = -3

Query  1503  VVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLALP  1327
             +V++P+ A GH++ F+ +SNKL+  G +I F     N        N +P      P+ +P
Sbjct  8     IVMYPWLAIGHLTSFLHISNKLAERGHRI-FLILPLNTQSKLQQFNLHPNLITFNPITVP  66

Query  1326  AVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLAA  1147
              VE LP GT++T+D P    + L  A++L +P I  LL EL+P FV+FDFA +WLP +A 
Sbjct  67    QVENLPNGTETTSDVPFPLYKNLRHAMDLTKPAITHLLQELEPDFVLFDFA-HWLPAVAR  125

Query  1146  ELGIKTIffsvfvalatafatVPARLPGPERS-PTVEEMKKPPPGFPPTSVASLRTFEAR  970
              LGIK+I++             PA +    R   + +   +PPPGFP   +  L   EAR
Sbjct  126   SLGIKSIYYCTIS---------PAAVGYLVREESSADAFVEPPPGFPSRGIFKLYRHEAR  176

Query  969   DFVIIFKRPH-NGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
                 I          +   R+L     C AI  K+C EME  Y ++++ +FKKP++LAGP
Sbjct  177   AIERINNEMEFENSINFVQRMLIAAGECDAIGFKSCREMEGTYCEFLEKKFKKPIILAGP  236

Query  792   VVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
             V+ +     LD+KWA WLS+FE  +VIYC+FGSE  L+  Q +EL LGLELTGLPFF  L
Sbjct  237   VLHKAPISTLDEKWASWLSRFEARSVIYCAFGSEARLEKGQFQELLLGLELTGLPFFAAL  296

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
               P  V+   E   ALP GF +R  GRG++H GWVQQQ +L H SVGC+V H G  S+ E
Sbjct  297   KPPRGVETVEE---ALPRGFADRTLGRGVVHGGWVQQQLMLSHPSVGCFVTHCGSGSLSE  353

Query  432   GIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM---G  262
              +VN+C+LV++P  GDQ +NA+L+A D+K GVEV R DEDG F KE + KAV+ +M    
Sbjct  354   AMVNECRLVLIPHAGDQIINARLMAGDLKVGVEVERGDEDGLFSKEGVMKAVKLVMEGDC  413

Query  261   EEGASTRANQEKWKEFLLDKEIQSKFIKDLV  169
             E G     N  KW++FLL + ++  +I   +
Sbjct  414   EVGKEIGENHAKWRDFLLGEGLEDSYIDGFI  444



>gb|KHN27959.1| UDP-glycosyltransferase 79B3 [Glycine soja]
Length=461

 Score =   314 bits (804),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 195/462 (42%), Positives = 276/462 (60%), Gaps = 19/462 (4%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             LHV IFP+FA GH++P + LSNKL+  G +ISF        +++  LN +P     VP+ 
Sbjct  9     LHVAIFPWFAMGHLTPILHLSNKLAQRGHRISFIVPKRTQTKLQH-LNLHPHLITFVPIT  67

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P V+GLP   ++T+D P +   LL  AL+  +  I+ LL ELKP FV FDF Q+WLP L
Sbjct  68    VPRVDGLPQDAETTSDIPFSLFPLLATALDRTEKDIELLLRELKPQFVFFDF-QHWLPNL  126

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVE----EMKKPPPGFPPTSVASLR  985
                LGIK++ + +   L+ A+        GP +S   E    +  +PP GFP  +    +
Sbjct  127   TRSLGIKSVAYFIVNPLSIAYLGN-----GPRQSQGRELTEVDFMEPPQGFPDDACIKFQ  181

Query  984   TFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLL  805
               E R  V   K     G  +YDR+        AI  K C E+E PY +Y+++ + KP+L
Sbjct  182   PHELRFLVSTRKLEFGSGVFLYDRLHTSTCLADAIGFKGCREIEGPYAEYLETVYGKPVL  241

Query  804   LAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPF  625
             L+GP++PEP +  L++KW  WL +F+P +VI+C++GSE+ L  +Q +EL LGLELTG PF
Sbjct  242   LSGPLLPEPPNTTLEEKWVAWLGRFKPGSVIFCAYGSESPLPQNQFQELLLGLELTGFPF  301

Query  624   FLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFS  445
                L  P N  V+ E   ALP GF+ERVKGRG+   GWVQQQ IL H SVGC++ H G +
Sbjct  302   LAALK-PPNGFVSIE--EALPEGFSERVKGRGVACGGWVQQQLILEHPSVGCFITHCGAA  358

Query  444   SVIEGIVNDCQLVMLPQKG-DQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTI  268
             SV E +VN CQLV LP+ G D  +NA++ +  +K GVEV + DEDG F KE + KAV+T+
Sbjct  359   SVTEALVNKCQLVFLPRLGADHVINARMFSKKLKVGVEVEKGDEDGLFTKESVCKAVKTV  418

Query  267   M---GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             M    E G   R N  K + FLL   ++S  +    + ++D+
Sbjct  419   MEDGNEVGRKVRENHAKLRNFLLSDSLESTCVDGFCQQLQDL  460



>ref|XP_003540412.2| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
Length=478

 Score =   313 bits (802),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 194/462 (42%), Positives = 276/462 (60%), Gaps = 19/462 (4%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             LHV IFP+FA GH++P + LSNKL+  G +ISF        +++  LN +P     VP+ 
Sbjct  26    LHVAIFPWFAMGHLTPILHLSNKLAQRGHRISFIVPKRTQTKLQH-LNLHPHLITFVPIT  84

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P V+GLP   ++T+D P +   LL  AL+  +  I+ LL ELKP FV FDF Q+WLP L
Sbjct  85    VPRVDGLPQDAETTSDIPFSLFPLLATALDRTEKDIELLLRELKPQFVFFDF-QHWLPNL  143

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVE----EMKKPPPGFPPTSVASLR  985
                LGIK++ + +   L+ A+        GP +S   E    +  +PP GFP  +    +
Sbjct  144   TRSLGIKSVAYFIVNPLSIAYLGN-----GPRQSQGRELTEVDFMEPPQGFPDDACIKFQ  198

Query  984   TFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLL  805
               E R  V   K     G  +YDR+        AI  K C E+E PY +Y+++ + KP+L
Sbjct  199   PHELRFLVSTRKLEFGSGVFLYDRLHTSTCLADAIGFKGCREIEGPYAEYLETVYGKPVL  258

Query  804   LAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPF  625
             L+GP++PEP +  L++KW  WL +F+P +VI+C++GSE+ L  +Q +EL LGLELTG PF
Sbjct  259   LSGPLLPEPPNTTLEEKWVAWLGRFKPGSVIFCAYGSESPLPQNQFQELLLGLELTGFPF  318

Query  624   FLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFS  445
                L  P N  V+ E   ALP GF+ERVKGRG+   GWVQQQ IL H SVGC++ H G +
Sbjct  319   LAALK-PPNGFVSIE--EALPEGFSERVKGRGVACGGWVQQQLILEHPSVGCFITHCGAA  375

Query  444   SVIEGIVNDCQLVMLPQKG-DQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTI  268
             SV E +VN CQL+ LP+ G D  +NA++ +  +K GVEV + DEDG F KE + KAV+T+
Sbjct  376   SVTEALVNKCQLLFLPRLGADHVINARMFSKKLKVGVEVEKGDEDGLFTKESVCKAVKTV  435

Query  267   M---GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             M    E G   R N  K + FLL   ++S  +    + ++D+
Sbjct  436   MEDGNEVGRKVRENHAKLRNFLLSDSLESTCVDGFCQQLQDL  477



>ref|XP_007132948.1| hypothetical protein PHAVU_011G138500g [Phaseolus vulgaris]
 gb|ESW04942.1| hypothetical protein PHAVU_011G138500g [Phaseolus vulgaris]
Length=448

 Score =   312 bits (799),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 182/457 (40%), Positives = 269/457 (59%), Gaps = 20/457 (4%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ +FP+FA GH++PF+ LSNKL+  G KISFF       +++            P+ +
Sbjct  6     LHIAMFPWFAMGHLTPFLHLSNKLAKRGHKISFFIPTRTQSKLEQFNLFPDLITFFPINV  65

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P VEGLP G ++T+D   +   L+  A++  +  I+ LL++LKP  V FDF   WLP + 
Sbjct  66    PHVEGLPHGAETTSDVSFSLGPLIMTAMDRTEKDIELLLLDLKPQIVFFDFTY-WLPNIT  124

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
             + LGIK+  + +      ++           RSP  + M+ PPPG+P +S+  L   EA+
Sbjct  125   SRLGIKSFQYFIVSPATVSYI----------RSPQSDLMQ-PPPGYPVSSI-KLHLDEAK  172

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
                         G   YDR   GL    AI  K C E+E PY+DY+  Q  K +LL+GP+
Sbjct  173   FLASKRNWEFGSGVLFYDRFEYGLMLSDAIGFKGCREIEGPYVDYLAEQLGKSVLLSGPI  232

Query  789   VPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLN  610
             +PEP + VL++ W+ WL  F+  +VI+C+ GSE  L   Q +EL LGLELTGLPF  V+ 
Sbjct  233   IPEPPNTVLEENWSAWLGGFKDGSVIFCALGSEWKLPHGQFQELLLGLELTGLPFLAVVK  292

Query  609   FPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEG  430
              P   +    +  ALP GF E V+GRGI+HSGW+QQQ IL HSSVGC++ H G  S+ E 
Sbjct  293   VPVGFET---IEAALPEGFKEGVEGRGIVHSGWIQQQLILEHSSVGCFITHCGAGSLTEA  349

Query  429   IVNDCQLVMLPQ-KGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE-  256
             +VN CQ+V+LPQ   D  +NA+++  ++K GVEV + +EDG+F KE + KAV+T+M EE 
Sbjct  350   LVNKCQMVLLPQLDADHIINARMMGSNLKVGVEVQKGEEDGWFTKESVSKAVKTVMDEEN  409

Query  255   --GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
               G   R N  K +  L+  +++S  + +  + ++D+
Sbjct  410   EVGREVRENHAKLRNCLVSPDLESICVDNFCQKLQDL  446



>ref|XP_010319271.1| PREDICTED: UDP-glycosyltransferase 79B8 isoform X2 [Solanum lycopersicum]
Length=507

 Score =   313 bits (803),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 190/505 (38%), Positives = 281/505 (56%), Gaps = 61/505 (12%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             L +V+FP+ A GHI PF+ LSN+L+  G KISF        ++++ LN  P       L 
Sbjct  9     LQIVMFPWLALGHIIPFLNLSNELAKKGHKISFLLPKNAQIKLQN-LNLYPNLITFHTLK  67

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P + GLP G ++TAD P +   LL  A++ +  +IK+ L  LKPHFV FDFA +W+  +
Sbjct  68    IPHIHGLPYGAETTADVPRSLETLLATAMDELYDEIKSFLQNLKPHFVFFDFA-HWVTEI  126

Query  1152  AAELG----------------IKTIffsvfvalatafatVPARLPGPE------------  1057
             A E+G                I  I          + A    R P PE            
Sbjct  127   ALEIGDINTICYKLTSPATSAISLIRSPEKSVFMASTAAEKVR-PPPEIGGIKTLCYKTV  185

Query  1056  ----------RSP--------TVEEMKKPPPGFPPTSVASLRTFEARDFVIIFKRPHNGG  931
                       RSP        T  E  +PPPG+P T+V  L   EA+    +F+  +  G
Sbjct  186   CPATSAYSLVRSPEKSVFMASTAAEKVRPPPGYPSTTVV-LHEHEAKLLEFLFQE-YGKG  243

Query  930   ASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPVVPEPASGVL-DQK  754
              ++Y+R+  G+  C AI  KTC E+E  + DY+ +QFKKP+L  GPV+P+P  G L +  
Sbjct  244   VTIYERLTKGMTLCDAIALKTCREIEGTFGDYIATQFKKPVLYTGPVLPDPEKGPLAEHG  303

Query  753   WADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLNFPANVDVASELN  574
              ++WL +FEP +V++C+FGS+  L+  Q +EL LGLELTGLPF +VL  P   +   E  
Sbjct  304   LSNWLEKFEPGSVVFCAFGSQLILEKKQFQELVLGLELTGLPFLVVLKPPEGTNSVEE--  361

Query  573   RALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEGI-VNDCQLVMLP  397
              ALP GF ERV+ +G++ + WV Q +IL H SVGC+V H G+ S+ E + + DCQLV+LP
Sbjct  362   -ALPEGFKERVQEKGLVLACWVPQLKILTHKSVGCFVSHCGYGSMWESLALCDCQLVLLP  420

Query  396   QKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE---GASTRANQEK  226
                DQ L+A+++  D+K GVEV ++DE+G+F KE + KAV+ +M ++   G   + N  K
Sbjct  421   SANDQTLSARMMEQDLKVGVEV-KKDENGWFSKESLCKAVKCVMDKDSQVGCLVKENHRK  479

Query  225   WKEFLLDKEIQSKFIKDLVKVMRDM  151
             WKE L      S +I   ++++ ++
Sbjct  480   WKEVLSSPGFMSNYIDSFIQILYEL  504



>ref|XP_009132454.1| PREDICTED: UDP-glycosyltransferase 79B6 [Brassica rapa]
Length=447

 Score =   311 bits (798),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 169/462 (37%), Positives = 271/462 (59%), Gaps = 21/462 (5%)
 Frame = -3

Query  1518  GDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVP  1339
             G   H  +FP+F FGH++ F+ L+NKL+  G KI+F      + +++  LN  P + +  
Sbjct  2     GSKFHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKGLKQLEP-LNLFPKSIVFH  60

Query  1338  -LALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWL  1162
              L +P+V+GLP G ++T+D P      L  A++  + Q++  +   KP  + FDFA +W+
Sbjct  61    ILTIPSVDGLPDGAETTSDIPITLGSFLASAMDRTRGQVEETVRLGKPDLIFFDFA-HWI  119

Query  1161  PPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRT  982
             P +A E G K++ F    A   A + VP R P        +E+  PPPG+P + V  L  
Sbjct  120   PDIAREYGAKSVNFVTISAACVAISFVPGRSP--------DELAIPPPGYPSSKV--LLH  169

Query  981   FEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLL  802
              +    +     P   G + Y+R++ GL  C  I  +TC EME  + D+++ +F++ +LL
Sbjct  170   GQETSSLSFLSYPFGDGVTFYERIMTGLVNCDVISIRTCQEMEGKFCDFIEREFQRKVLL  229

Query  801   AGPVVPEPAS-GVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPF  625
              GP++PEP +   L+ +W+ WL++F+P +V+YCS GS+  L+ +Q +EL LG+ELTGLPF
Sbjct  230   TGPMLPEPDNIKPLEDQWSHWLNRFKPGSVVYCSLGSQIILEKEQFQELCLGMELTGLPF  289

Query  624   FLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFS  445
              + +  P     AS +  ALP GF ER K RG++   WV Q  IL H S+GC+V H GF 
Sbjct  290   LVAVKPPKG---ASTIQEALPKGFEERFKERGVVWGEWVHQPLILAHPSIGCFVSHCGFG  346

Query  444   SVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM  265
             S+ E ++NDCQ+V +P  G+Q  N +L++++++  VEV +R+E G+F KE +  AV+++M
Sbjct  347   SMWESLLNDCQIVFIPHLGEQIFNTRLMSEELEVSVEV-KREETGWFSKESLSGAVRSVM  405

Query  264   GEE---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
              ++   G   R N  KWKE LL   I S ++   V+ +  + 
Sbjct  406   DKDTELGNLVRRNHAKWKESLLSSGIISGYVNKYVEALEKLV  447



>gb|KHN27960.1| UDP-glycosyltransferase 79B3 [Glycine soja]
Length=519

 Score =   314 bits (804),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 180/447 (40%), Positives = 264/447 (59%), Gaps = 15/447 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPC-TQIVPLA  1333
             +H+ +FP+FA GH  PF+ LSNKL+  G KISFF+      +++  LN +P     VP+ 
Sbjct  8     MHIAMFPWFAMGHFIPFLHLSNKLAKRGHKISFFTPRRTQTKLQH-LNLHPHHITFVPIN  66

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P V+GLP   ++T+D P +   L+  A++  +  I+ LL ELKP  V FDF Q+WLP +
Sbjct  67    VPHVDGLPHDAETTSDVPSSLFPLIATAMDSTEKHIELLLRELKPQIVFFDF-QHWLPNI  125

Query  1152  AAELGIKTIffsvfvalatafa-tVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFE  976
                LGIK I + +      A+    P ++ G E +    ++ KPP GFP +S+  L   E
Sbjct  126   TRSLGIKCIQYWILNPSTIAYLWNGPRQIQGGELTEV--DLMKPPKGFPDSSI-KLHAHE  182

Query  975   ARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
              R      K     G  +YDR+  G +   AI  K C E++  Y DY++  ++KP+L +G
Sbjct  183   LRFLAATRKLEFGSGVFLYDRLGLGSSLADAIGFKGCREIDGTYADYLEIVYRKPVLFSG  242

Query  795   PVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
             P++PEP +  L++KW  WL  F P +V++C++GSE  L ++Q +EL LGLE  G PF   
Sbjct  243   PILPEPPNSTLEEKWVSWLEGFNPGSVVFCAYGSEGSLPENQFQELLLGLEQAGFPFLAA  302

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             L  P   +   E   A+P GF ERV+GRGI+  GWV QQ IL H SVGC++ H G +SV 
Sbjct  303   LKPPNGFESIEE---AMPKGFGERVQGRGIVDEGWVPQQLILGHRSVGCFITHCGAASVT  359

Query  435   EGIVNDCQLVMLPQKG-DQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGE  259
             E +VN CQLV LP+ G D  +NA++ +  +K GVEV + +EDG F KE + KAV+T+M +
Sbjct  360   EALVNKCQLVFLPRLGADHIINARMFSRKLKVGVEVEKGEEDGLFTKESVCKAVKTVMED  419

Query  258   EGASTRA----NQEKWKEFLLDKEIQS  190
             E    R       E +KE  L+ +++S
Sbjct  420   ETEVGREVPRPRSEIFKELPLEHKVRS  446



>emb|CDP05960.1| unnamed protein product [Coffea canephora]
Length=456

 Score =   311 bits (798),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 190/466 (41%), Positives = 280/466 (60%), Gaps = 25/466 (5%)
 Frame = -3

Query  1518  GDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVP  1339
             G  LHV +FP  A GH++PF+ L+N+L+  G K+S+        + K  L    C  + P
Sbjct  6     GKRLHVAMFPGLATGHMTPFLHLANELAKRGHKVSYLL----TKKAKIQLE---CGNLYP  58

Query  1338  -------LALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFD  1180
                    L +P VEGLPPGT++ ++ P     L  +A + M  Q++A L +L P  V++D
Sbjct  59    DVVTFHVLPVPHVEGLPPGTENASEIPIFLNSLFALAFDNMSDQVEAALSDLNPDVVLYD  118

Query  1179  FAQNWLPPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTS  1000
              A   +   A ++G KT+ ++V  A + A A VPAR    +R  T EE+ +PPPG+P +S
Sbjct  119   TAFR-ITDFAPKIGFKTVCYNVVSAASIALALVPARQMPKDRPLTEEELMEPPPGYPSSS  177

Query  999   VASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQF  820
             V  LR  EA+  V+ F     G  + YDR++  L GC AI  ++C E+E  + DY+  Q+
Sbjct  178   VV-LRKHEAK--VLAFMSSEFGARTFYDRIITALKGCHAIAIRSCQELEGQFCDYIGGQY  234

Query  819   KKPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLEL  640
             +KP+ L+GPV+PE     LD KWA+WL +FE  +V++C+FGS+  L+  Q +EL LG EL
Sbjct  235   QKPVFLSGPVLPEQEKQPLDGKWAEWLGKFEQKSVVFCAFGSQIILEKQQFQELVLGFEL  294

Query  639   TGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVC  460
             TGLPFF+ L  P        +  +LP GF ERV GRG+++ GWVQQ QIL H SVGC+V 
Sbjct  295   TGLPFFVALKPPLGT---GSIEESLPDGFEERVGGRGVVYGGWVQQPQILSHPSVGCFVN  351

Query  459   HAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKA  280
             H GF S+ E +++DCQ+V++P  GDQ LN++LL  D+K  VEV  RDE G+F KE +  A
Sbjct  352   HCGFGSMWESLMSDCQIVLVPHLGDQILNSRLLCGDLKVAVEV-ERDESGWFSKESLSSA  410

Query  279   VQTIMG---EEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             +  +MG   E G+S R +  K KE L      S +++  ++ + ++
Sbjct  411   INAVMGPDSEVGSSLRKSHLKVKEILSSPGYMSNYVESFIQNLYEL  456



>ref|XP_004487589.1| PREDICTED: UDP-glycosyltransferase 79B1-like [Cicer arietinum]
 gb|AGU14103.1| UDP-glycosyltransferase [Cicer arietinum]
Length=457

 Score =   311 bits (797),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 186/459 (41%), Positives = 277/459 (60%), Gaps = 14/459 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             LH+ +FP+ A GH +P++ LSNKL+  G KISFF     +++++  LN NP     VP+ 
Sbjct  6     LHLAMFPWLAMGHFTPYLHLSNKLAKRGHKISFFIPKNTLNKLQH-LNLNPHLITFVPIT  64

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P V+GLP   ++ +D P +   L+  A++  + +I+ LL ELKP  V FDF Q W+P L
Sbjct  65    VPHVDGLPHDAETASDVPFSLLPLIATAMDETKKEIELLLKELKPQIVFFDF-QYWVPNL  123

Query  1152  AAELGIKTIff-svfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFE  976
               +LGIK++ +        + F   P +  G E   TV+++KKPP G+P +S+  L + E
Sbjct  124   TKKLGIKSVQYWIASPYSISYFFHGPRQSLGKEL--TVDDLKKPPSGYPDSSI-KLHSHE  180

Query  975   ARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
              +      K     G  +YDR+  G +   AI  K C E++ PY  Y+ + + KP LL+G
Sbjct  181   LQFLASSRKLVFGSGVLLYDRLHFGTSLADAIGFKGCKEIDGPYAQYLGTVYGKPSLLSG  240

Query  795   PVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
             P++PE     LD+KW  WL  F+  +V+YC++GSE  L+++Q KEL LGLELTG PF   
Sbjct  241   PLLPESPLTTLDEKWVSWLKGFKHGSVVYCAYGSEGPLQENQFKELLLGLELTGFPFVAA  300

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             L  P   +   E   ALP GF ERVKGRGI++ GWVQQQ IL H SVGC++ H G +S+ 
Sbjct  301   LKPPVGFESIEE---ALPQGFNERVKGRGIVYGGWVQQQLILEHPSVGCFITHCGAASIT  357

Query  435   EGIVNDCQLVMLPQKG-DQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGE  259
             E +VN CQLV+LP+ G D  +NA++++  +K GVEV + DEDG F KE +  AV  +M E
Sbjct  358   EALVNTCQLVLLPRVGVDHIMNARMMSTKLKVGVEVEKGDEDGLFTKESVCNAVNIVMDE  417

Query  258   E---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                 G   +AN  + ++FLL + ++S  + +  + +R +
Sbjct  418   GNEIGREVKANHIQLRKFLLSENLESSCVDNFCQKLRHL  456



>ref|XP_003596675.1| Anthocyanidin 3-O-glucosyltransferase [Medicago truncatula]
 gb|AES66926.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=458

 Score =   311 bits (797),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 181/458 (40%), Positives = 272/458 (59%), Gaps = 12/458 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             LH+ +FP+FA GH++P++ LSNKL++ G KISFF     +++++  LN  P      P+ 
Sbjct  7     LHIAMFPWFAMGHLTPYLHLSNKLALRGHKISFFIPKNTLNKLQ-YLNLYPNLITFFPIT  65

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P V GLP   ++T+D P +   L+  A++  +  I+ LL E+KP  V FDF Q WLP L
Sbjct  66    VPHVNGLPLDAETTSDVPFSLVPLIATAMDQTEKDIEILLKEIKPQIVFFDF-QYWLPKL  124

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
                L IK++ + +   ++TA+     +L   +    V+ MK PP GFP + +   +  E 
Sbjct  125   TKNLDIKSLQYIILTPVSTAYLGCLQKLSLGKDLTDVDIMK-PPSGFPDSCIKFYK-HEL  182

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             R      K     G  ++DR+  G     A+  K C E++ PY DY+++ F KP+LL+GP
Sbjct  183   RFLASTRKIAFGSGVFLFDRLHIGTTSADAVGFKGCNEVDGPYADYIETVFGKPVLLSGP  242

Query  792   VVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
             V+PEP +  L++KW  WL  FE  +V++C++GSE  L+ +Q  EL LGLELTG PF   L
Sbjct  243   VLPEPTNTTLEEKWISWLKGFENGSVVFCAYGSEGPLEKNQFLELLLGLELTGFPFLAAL  302

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
               P   +   E   ALP GF ER+KG+GI++  W+QQQ IL H SVGC++ H G +S+ E
Sbjct  303   KPPIGFESIEE---ALPEGFNERIKGKGIVYGSWIQQQLILEHPSVGCFITHCGAASITE  359

Query  432   GIVNDCQLVMLPQKG-DQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE  256
             G+VN CQLV+LP+ G D  +NA++++   K GVEV + DEDG F KE + KA + +M +E
Sbjct  360   GLVNTCQLVLLPRLGSDHIMNARVMSSKFKVGVEVEKGDEDGLFTKESVCKAAKIVMDDE  419

Query  255   ---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                G   RAN  K + FLL   ++S  +    + +  +
Sbjct  420   NEIGREVRANHAKMRNFLLSNNLESSCVDSFCQKLYHL  457



>gb|AFK34819.1| unknown [Medicago truncatula]
Length=458

 Score =   311 bits (796),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 181/458 (40%), Positives = 272/458 (59%), Gaps = 12/458 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             LH+ +FP+FA GH++P++ LSNKL++ G KISFF     +++++  LN  P      P+ 
Sbjct  7     LHIAMFPWFAMGHLTPYLHLSNKLALRGHKISFFIPKNTLNKLQ-YLNLYPNLITFFPIT  65

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P V GLP   ++T+D P +   L+  A++  +  I+ LL E+KP  V FDF Q WLP L
Sbjct  66    VPHVNGLPLDAETTSDVPFSLVPLIATAMDQTEKDIEILLKEIKPQIVFFDF-QYWLPKL  124

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
                L IK++ + +   ++TA+     +L   +    V+ MK PP GFP + +   +  E 
Sbjct  125   TKNLDIKSLQYIILTPVSTAYLGCLQKLSLGKDLTDVDIMK-PPSGFPDSCIKFYK-HEL  182

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             R      K     G  ++DR+  G     A+  K C E++ PY DY+++ F KP+LL+GP
Sbjct  183   RFLASTGKIAFGSGVFLFDRLHIGTTSADAVGFKGCNEVDGPYADYIETVFGKPVLLSGP  242

Query  792   VVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
             V+PEP +  L++KW  WL  FE  +V++C++GSE  L+ +Q  EL LGLELTG PF   L
Sbjct  243   VLPEPTNTTLEEKWISWLKGFENGSVVFCAYGSEGPLEKNQFLELLLGLELTGFPFLAAL  302

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
               P   +   E   ALP GF ER+KG+GI++  W+QQQ IL H SVGC++ H G +S+ E
Sbjct  303   KPPIGFESIEE---ALPEGFNERIKGKGIVYGSWIQQQLILEHPSVGCFITHCGAASITE  359

Query  432   GIVNDCQLVMLPQKG-DQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE  256
             G+VN CQLV+LP+ G D  +NA++++   K GVEV + DEDG F KE + KA + +M +E
Sbjct  360   GLVNTCQLVLLPRLGSDHIMNARVMSSKFKVGVEVEKGDEDGLFTKESVCKAAKIVMDDE  419

Query  255   ---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                G   RAN  K + FLL   ++S  +    + +  +
Sbjct  420   NEIGREVRANHAKMRNFLLSNNLESSCVDSFCQKLYHL  457



>ref|XP_004236774.1| PREDICTED: UDP-glycosyltransferase 79B6 isoform X1 [Solanum lycopersicum]
Length=509

 Score =   313 bits (801),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 188/506 (37%), Positives = 280/506 (55%), Gaps = 61/506 (12%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             L +V+FP+ A GHI PF+ LSN+L+  G KISF        ++++ LN  P       L 
Sbjct  9     LQIVMFPWLALGHIIPFLNLSNELAKKGHKISFLLPKNAQIKLQN-LNLYPNLITFHTLK  67

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P + GLP G ++TAD P +   LL  A++ +  +IK+ L  LKPHFV FDFA +W+  +
Sbjct  68    IPHIHGLPYGAETTADVPRSLETLLATAMDELYDEIKSFLQNLKPHFVFFDFA-HWVTEI  126

Query  1152  AAELG----------------IKTIffsvfvalatafatVPARLP---------------  1066
             A E+G                I  I          + A    R P               
Sbjct  127   ALEIGDINTICYKLTSPATSAISLIRSPEKSVFMASTAAEKVRPPPATEIGGIKTLCYKT  186

Query  1065  ------------GPERS----PTVEEMKKPPPGFPPTSVASLRTFEARDFVIIFKRPHNG  934
                          PE+S     T  E  +PPPG+P T+V  L   EA+    +F+  +  
Sbjct  187   VCPATSAYSLVRSPEKSVFMASTAAEKVRPPPGYPSTTVV-LHEHEAKLLEFLFQE-YGK  244

Query  933   GASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPVVPEPASGVL-DQ  757
             G ++Y+R+  G+  C AI  KTC E+E  + DY+ +QFKKP+L  GPV+P+P  G L + 
Sbjct  245   GVTIYERLTKGMTLCDAIALKTCREIEGTFGDYIATQFKKPVLYTGPVLPDPEKGPLAEH  304

Query  756   KWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLNFPANVDVASEL  577
               ++WL +FEP +V++C+FGS+  L+  Q +EL LGLELTGLPF +VL  P   +   E 
Sbjct  305   GLSNWLEKFEPGSVVFCAFGSQLILEKKQFQELVLGLELTGLPFLVVLKPPEGTNSVEE-  363

Query  576   NRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEGI-VNDCQLVML  400
               ALP GF ERV+ +G++ + WV Q +IL H SVGC+V H G+ S+ E + + DCQLV+L
Sbjct  364   --ALPEGFKERVQEKGLVLACWVPQLKILTHKSVGCFVSHCGYGSMWESLALCDCQLVLL  421

Query  399   PQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE---GASTRANQE  229
             P   DQ L+A+++  D+K GVEV ++DE+G+F KE + KAV+ +M ++   G   + N  
Sbjct  422   PSANDQTLSARMMEQDLKVGVEV-KKDENGWFSKESLCKAVKCVMDKDSQVGCLVKENHR  480

Query  228   KWKEFLLDKEIQSKFIKDLVKVMRDM  151
             KWKE L      S +I   ++++ ++
Sbjct  481   KWKEVLSSPGFMSNYIDSFIQILYEL  506



>ref|XP_009339314.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Pyrus x bretschneideri]
Length=464

 Score =   310 bits (795),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 175/459 (38%), Positives = 268/459 (58%), Gaps = 13/459 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
              H+ +FP+ A GHI+P+V LSN+L+  G +++       + +++ + +        P+ +
Sbjct  11    FHLAMFPWLAMGHITPYVHLSNELAARGHRVTLLVPKKAILQLEHLNHHPNLITFSPVTV  70

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P  +GLP GT+  ++ P      L  A++L + QI+  L   KP FV++D A +W+P +A
Sbjct  71    PHFDGLPEGTEIASEIPIHNIHFLAAAMDLTRDQIEHFLSANKPDFVLYD-AAHWVPEIA  129

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
              + GIK++ ++V  A A A A VPAR     R  T +E+  PP G+P T+V  L+  EAR
Sbjct  130   RKNGIKSVCYNVVCAAALAIALVPARQVPKARPITAKELGVPPAGYPSTTVV-LQGHEAR  188

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
                 I   P   G   YDR +  +  C A+  +TC E+E    DY++ Q+K+P+LL GPV
Sbjct  189   SLTFI-TEPFGDGIRFYDRTIICMKECDALSIRTCRELEGDMCDYMEDQYKRPVLLTGPV  247

Query  789   V---PEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFL  619
             +    +  +  L+ +WA W + FE  ++++C+FGS+  L+  Q +EL LG ELTGLPFF+
Sbjct  248   LGLGSDNNTEQLEDRWAKWFAGFEAGSMVFCAFGSQWVLEKSQFQELVLGFELTGLPFFV  307

Query  618   VLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSV  439
              L  P   +   E   ALP GF ERVKGRG++   WVQQ  IL H +VGC+V H GF S+
Sbjct  308   ALKPPLGCETIEE---ALPEGFEERVKGRGVVVGSWVQQTLILNHPAVGCFVNHCGFGSM  364

Query  438   IEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGE  259
              E +++D Q+V++P  GDQ LN KLL   ++  VEV  R+E G+F KE + KAV+++M E
Sbjct  365   WESLMSDKQIVLVPHLGDQILNTKLLVKKLEVAVEVG-REESGWFSKESLSKAVKSVMDE  423

Query  258   E---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             E   G   + N  KW E L      S +I   V+ ++++
Sbjct  424   ESEVGVMVKKNHAKWMEALTTPGFMSGYIDRFVQKLKEL  462



>ref|XP_009132456.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Brassica rapa]
Length=447

 Score =   309 bits (792),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 172/460 (37%), Positives = 268/460 (58%), Gaps = 19/460 (4%)
 Frame = -3

Query  1518  GDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVP  1339
             G   H  +FP+F FGH++ F+ L+NKL+  G KI+F      + +++ +     C     
Sbjct  2     GSKFHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKALKQLEPLNLFPECIVFHT  61

Query  1338  LALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLP  1159
             L +P+V+GLP G Q+TAD P      L  A++  + Q++  +   KP  + FDFA +W+P
Sbjct  62    LTIPSVDGLPDGAQTTADIPITLGGFLASAMDRTRGQVEEAVRLGKPDLIFFDFA-HWIP  120

Query  1158  PLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTF  979
              +A E G K + F    A   A + VP R P        +E+  PPPG+P + V  LR  
Sbjct  121   EVAKEYGAKCVNFLTISAACVAISFVPGRSP--------DELTVPPPGYPSSKVV-LRGQ  171

Query  978   EARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLA  799
             E  +F+     P   G + Y+R++ GL  C  I  +TC E+E  + D+++ +F++ +LL 
Sbjct  172   ET-NFLSFLSYPFGDGVTFYERIMTGLVKCDVISIRTCQEIEGIFCDFIEREFQRKVLLT  230

Query  798   GPVVPEPAS-GVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFF  622
             GP++PEP +   L+ +W  WL++FEP +V+YCS GS+  L+ ++ +EL LG+ELTGLPF 
Sbjct  231   GPMLPEPDNIKPLEDRWHQWLNRFEPGSVVYCSLGSQIILEKEEFQELCLGMELTGLPFL  290

Query  621   LVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSS  442
             + +  P     AS +  ALP GF +RVK RG++    VQQ  IL H S+GC+V H GF S
Sbjct  291   VAVKPPKG---ASTIQEALPEGFEDRVKERGVVWGEGVQQPLILAHPSIGCFVSHCGFGS  347

Query  441   VIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMG  262
             + E ++NDCQ+V +P  G+Q  N +L++++++  VEV +R+E G+F KE+I  AV+++M 
Sbjct  348   MWESLLNDCQIVFIPHLGEQIFNTRLMSEELEVSVEV-KREETGWFSKENISGAVRSVMD  406

Query  261   ---EEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                E G   R N  K KE LL   I S +    V+ +  +
Sbjct  407   NDTELGNLVRRNHAKLKESLLSSGIISGYANKYVEALEKL  446



>ref|XP_006397072.1| hypothetical protein EUTSA_v10028656mg [Eutrema salsugineum]
 gb|ESQ38525.1| hypothetical protein EUTSA_v10028656mg [Eutrema salsugineum]
Length=443

 Score =   309 bits (792),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 172/460 (37%), Positives = 275/460 (60%), Gaps = 29/460 (6%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIV--PL  1336
              H +++P+FA GH++PF+ L+NKL+  G +++F      + + +  LN  P  +IV   +
Sbjct  5     FHALMYPWFATGHMTPFLHLANKLADKGHRVTFLLPKKTLKQYEH-LNLFP-DKIVFHSV  62

Query  1335  ALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPP  1156
              +P V+GLP GT++ ++ P ++  LL  A++L + QI+  ++ +KP  + FDFA +W+P 
Sbjct  63    TVPHVDGLPIGTETASEIPVSSTNLLASAMDLTRAQIEDQVLAVKPDLIFFDFA-HWIPE  121

Query  1155  LAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFE  976
             +A + G+KT+ + V  A   A   V              E+  PPPG+P + V  LR   
Sbjct  122   MAKDFGVKTVMYVVVSASTIASMLVQGG-----------ELGVPPPGYPSSKVL-LR---  166

Query  975   ARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
              +  +   K  +N G    +R+   L  C  I  +T  E+E  + DY++   KK +LL G
Sbjct  167   -KQDLYSMKSINNDGTKFMERITTSLMNCDVIAIRTVREIEGSFCDYIEKHCKKRVLLTG  225

Query  795   PVVPEP-ASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFL  619
             P+ PEP  +  L++KW++WLS FEP +V++C+ G++  L+ DQ +EL L +ELTGLPF L
Sbjct  226   PMFPEPDETKQLEEKWSNWLSGFEPDSVVFCALGTQVVLQKDQFQELCLAMELTGLPFLL  285

Query  618   VLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSV  439
              +  P  +   S +  ALP GF ERVKGRG++  GWVQQ+ IL H SVGC+V H GF S+
Sbjct  286   AVKPPRGI---STIQEALPDGFEERVKGRGVVWGGWVQQELILSHPSVGCFVSHCGFGSM  342

Query  438   IEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM--  265
              E ++NDCQ+V++PQ GDQ LN +LL+++++  VEV  R+E G+F KE ++ A+ ++M  
Sbjct  343   WESLMNDCQIVLIPQLGDQILNTRLLSEELEVSVEV-AREETGWFSKESLRDAITSVMER  401

Query  264   -GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
               E G   R N  KW+E L    +   ++ + V  ++D+ 
Sbjct  402   ESETGKLVRMNHNKWRETLFSPGVMIGYVNNSVNSLQDLV  441



>gb|AEM37037.1| UDP-glucose:flavonoid 3-O-glucosyltransferase 2 [Brassica rapa 
subsp. oleifera]
Length=468

 Score =   310 bits (793),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 181/474 (38%), Positives = 288/474 (61%), Gaps = 23/474 (5%)
 Frame = -3

Query  1536  ITNNHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP  1357
             +  + G   + +V++P+ AFGH++ F+ LSNKL+  G +I F      +D++K +     
Sbjct  3     VFGSDGSSSMSIVMYPWLAFGHMTAFLHLSNKLAEKGHEIVFLLPKKALDQVKPLNLYPN  62

Query  1356  CTQIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDF  1177
                   +++P V+GLPPG ++ +D P     LL VA+N  +P+++ +L   KP  V +D 
Sbjct  63    LITFHTISIPHVKGLPPGAETNSDVPFFLTHLLAVAMNQTRPEVETILRTNKPDLVFYDS  122

Query  1176  AQNWLPPLAAELGIKTIffsvfvalatafatVPAR----LPGPERSPTVEEMKKPPPGFP  1009
             A +W+P +A  +G KT+ ++   A + A   VPA     + G E S   EE+ KPP G+P
Sbjct  123   A-DWIPEIARPVGAKTVCYNTVSAASIALTLVPAAEREIIDGKEMS--AEELAKPPLGYP  179

Query  1008  PTSVASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVK  829
              + V  L   EA+    +++R H G  S +D  +  +  C AI  +TC E E  + DY++
Sbjct  180   SSKVV-LLAREAKTLSFVWRR-HEGIGSFFDGKVTAMRNCDAIAIRTCRETEGKFCDYIE  237

Query  828   SQFKKPLLLAGPVVP--EPASGVLDQKWADWLSQFEPSTVIYCSFGSETFL-KDDQIKEL  658
             SQ+ +P+ L GPV+P  EP    L+ +WADWL++F+P +V++C+FGS+  + K DQ +EL
Sbjct  238   SQYNRPVYLTGPVLPVDEPNKTSLEPRWADWLAKFKPGSVVFCAFGSQPVVEKIDQFQEL  297

Query  657   ALGLELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSS  478
              LGLE TGLPF + +  P+ V    E   ALP GF ERV+GRG+++ GWVQQ  IL H S
Sbjct  298   CLGLEATGLPFLVAIKPPSGVSTVEE---ALPEGFQERVRGRGVVYGGWVQQPMILDHPS  354

Query  477   VGCYVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWK  298
             VGC+V H GF S+ E +++DCQ+V++PQ G+Q LNA+L+A++M+       R+E+G+F +
Sbjct  355   VGCFVSHCGFGSMWESLMSDCQMVLVPQHGEQILNARLMAEEMEV-AVEVEREENGWFSR  413

Query  297   EDIQKAVQTIMGEE---GASTRANQEKWKEFLLDKEIQ----SKFIKDLVKVMR  157
               ++ AV+++MGE    G   R N +KW+  L D        SKF ++L ++++
Sbjct  414   RSLEDAVKSVMGEGSEVGEKVRKNHDKWRCVLSDSGFADGYISKFEQNLTELVK  467



>ref|XP_004144600.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cucumis sativus]
 ref|XP_004164965.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cucumis sativus]
 gb|KGN43488.1| hypothetical protein Csa_7G041330 [Cucumis sativus]
Length=461

 Score =   309 bits (792),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 175/458 (38%), Positives = 277/458 (60%), Gaps = 11/458 (2%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ ++P+FA GH+  F+Q+ NKL+  G +ISFF  +    +++   +       VP+ +
Sbjct  8     LHIAMYPWFALGHLIAFLQIGNKLASKGHRISFFIPSKTQPKLQPFNHFPNLITFVPITV  67

Query  1329  PAVEGLPPGTQSTADFppaaae-llpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             P V+GLP G ++TAD    +   L+  +++  +P+I + L E+KP  + +D A  W+P L
Sbjct  68    PHVDGLPLGAETTADVSHPSQIPLIMTSMDRTEPEIASRLQEIKPEAIFYDLA-CWVPKL  126

Query  1152  AAELGIKTIffsvfvalatafatVPA-RLPGPERSPTVEEMKKPPPGFPPTSVASLRTFE  976
             A  LGIK+++FS    +   +      + PG   + T +++  PPP FP  S+  L   E
Sbjct  127   AHPLGIKSVYFSAVSPVTMGYIQCKLWKFPG-HYNLTQDDLLHPPPDFPCPSI-KLLAHE  184

Query  975   ARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
             A+      +       + ++R    L+ CSA+  K+C E+E P+I+Y++S  K+P+ L G
Sbjct  185   AQYLASFGQMKFGSDITFFERNSRALSQCSAMALKSCREIEGPFIEYLESIVKRPIFLPG  244

Query  795   PVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
              V  EP +  L+++WA WLS+F   +VIYC+FGSE  L  +Q +EL LGLEL+ LPFF+ 
Sbjct  245   FVNLEPLTTSLEERWAKWLSKFNSGSVIYCAFGSECILNKNQFQELLLGLELSNLPFFVA  304

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
             L  P  +D    +  ALP GF +RV+GRGI++ GWVQQQQIL H S+GC++ H G  S+ 
Sbjct  305   LKPPDGIDT---VEAALPEGFEQRVEGRGIVYGGWVQQQQILDHPSIGCFITHCGAGSLS  361

Query  435   EGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE  256
             E +V  CQLV+  +  DQ   A+L++   K GVE+ + +EDG F KE + KAV+T+M EE
Sbjct  362   EAVVKKCQLVLFSRTTDQLFRARLMSKFSKVGVEIEKGEEDGVFSKESVCKAVKTVMDEE  421

Query  255   ---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                G   RAN+E+ +E L+DK+++  +I + +  +R +
Sbjct  422   NESGKEIRANKERLRESLVDKDLEESYINNFIHSLRSL  459



>ref|XP_008355387.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Malus domestica]
Length=460

 Score =   309 bits (791),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 174/459 (38%), Positives = 267/459 (58%), Gaps = 13/459 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
              H+ +FP+ A GHI+P+V LSN+L+  G +++       + +++ + +        P+ +
Sbjct  7     FHLAMFPWLAMGHITPYVHLSNELAARGHRVTLLVPKKAILQLEHLNHHPNLITFSPVTV  66

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P   GLP GT+  ++ P      L  A++L + QI+  L   KP FV++D A +W+P +A
Sbjct  67    PHFNGLPEGTEIASEIPIHNIHFLAAAMDLTRDQIEHFLSANKPDFVLYD-AAHWVPEIA  125

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
              + GIK++ ++V  A A A A VPAR    +R  T +E+  PP G+P T+V  L+  EAR
Sbjct  126   RKNGIKSVCYNVVCAAALAIALVPARQVPKDRPITAKELGVPPAGYPSTTVV-LQGHEAR  184

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
                 I   P   G   YDR +  +  C A+  +TC E+E    DY++ Q+K+P+LL GPV
Sbjct  185   SLTFI-TEPFGDGIRFYDRTIICMKECDALSIRTCRELEGDMCDYMEDQYKRPVLLTGPV  243

Query  789   V---PEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFL  619
             +    +  +  L+ +WA W + FE  +V++C+FGS+  L+  Q +EL LG ELTGLPFF+
Sbjct  244   LGLGSDNNTEQLEDRWAKWFAGFEAGSVVFCAFGSQWVLEKSQFQELVLGFELTGLPFFV  303

Query  618   VLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSV  439
              L  P   +   E   ALP GF ERVKGRG++   WVQQ  IL H +VGC+V H GF S+
Sbjct  304   ALKPPLGCETIEE---ALPEGFEERVKGRGVVVGSWVQQTLILNHPAVGCFVNHCGFGSM  360

Query  438   IEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGE  259
              E +++D Q+V++P  GDQ LN KLL   ++  VEV  R+E G+F KE + KA+ ++M +
Sbjct  361   WESLMSDKQIVLVPHLGDQILNTKLLVKKLEVAVEVG-REESGWFSKESLSKAIXSVMDK  419

Query  258   E---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             E   G   + N  KW E L      S +I   V+ ++++
Sbjct  420   ESEVGVMVKKNHAKWMETLXTPGFMSGYIDRFVQKLKEL  458



>gb|KHN36713.1| UDP-glycosyltransferase 79B6 [Glycine soja]
Length=461

 Score =   309 bits (791),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 187/459 (41%), Positives = 274/459 (60%), Gaps = 13/459 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             +H+ ++P+FA GH  PF+ LSNKL+  G KISF        +I+  LN +P    +VP+ 
Sbjct  9     MHIAMYPWFAMGHFIPFLHLSNKLAKRGHKISFIVPKRTQTKIQH-LNQHPHLITLVPIT  67

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P V+GLP   ++T D   +   LL  A++ ++  I+ LL ELKP  V FDF+  WLP L
Sbjct  68    VPHVDGLPHDAETTLDVLFSFFPLLATAMDRIEKDIELLLRELKPQIVFFDFS-FWLPNL  126

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
             A  LGIK++ + +  A++ A+   P R     R  +  +  KP PGFP +S+ +L   EA
Sbjct  127   ARSLGIKSVQYFIVNAVSVAYFGSPERYHN-GRDLSETDFTKPSPGFPDSSI-TLHEHEA  184

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             +  V + K     G  +YDR   G     AI  K C E+E PY+DY+++Q  KP+LL+GP
Sbjct  185   QFVVRMGKVEFGSGVLMYDRFDIGTRLSDAIGFKGCREIEGPYVDYLETQHGKPVLLSGP  244

Query  792   VVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
             ++PEP +  L+ KW  WL +F   +VI+C++GSET L+ +Q  EL LGLELTG PF   L
Sbjct  245   LLPEPPNTTLEGKWVKWLEEFNSGSVIFCAYGSETTLQQNQFLELLLGLELTGFPFLAAL  304

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
               P   +   E   ALP GF ERV+GRG+++ GWVQQQ IL H SVGC++   G  S+ E
Sbjct  305   KPPNGFESIEE---ALPEGFRERVQGRGVVYEGWVQQQLILGHPSVGCFITLCGAGSITE  361

Query  432   GIVNDCQLVMLPQKG-DQFLNAKLLADDMKAGVEVNRRDE-DGYFWKEDIQKAVQTIMGE  259
              +V++CQLV LP+ G D  + A++++ ++K GVEV + +E DG F KE + KAV+ +M +
Sbjct  362   ALVSECQLVFLPRLGSDYVITARMMSRELKVGVEVEKSEEDDGSFTKESVCKAVKIVMDD  421

Query  258   E---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             E   G   R N  K +  LL   ++S  +  L   +R +
Sbjct  422   ENELGRQVRENHRKVRNILLSNNLESFHVDILCDKLRAL  460



>gb|KHN13063.1| UDP-glycosyltransferase 79B3 [Glycine soja]
Length=480

 Score =   309 bits (792),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 184/481 (38%), Positives = 275/481 (57%), Gaps = 30/481 (6%)
 Frame = -3

Query  1533  TNNHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPC  1354
             T NH   LLH+ +FP+FA GH++PF+ LSN+L+  G KI+F        +++ + N    
Sbjct  4     TRNH---LLHIAMFPWFATGHMTPFLHLSNELAKRGHKITFLLPKKAKLQLQHLNNHPHL  60

Query  1353  TQIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFA  1174
                  L +P V+GLP GT++ ++ P +   LL +A++  + Q++  L    P FV++D A
Sbjct  61    ITFHTLTIPHVKGLPHGTETASEIPISLNHLLVIAMDKTRDQVEHTLSATNPDFVLYDNA  120

Query  1173  QNWLPPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVA  994
               W+P +A +LGIKTI ++V  A + A   VPAR    +R  TVEE+ +PP G+P + V 
Sbjct  121   Y-WVPQIAKKLGIKTICYNVVCAASLAIVLVPARNVPKDRPITVEELSQPPEGYPSSKVV  179

Query  993   SLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKK  814
              L   EA   + I         + YDR+ + L    AI  +T  E+E  + DY+ SQF K
Sbjct  180   -LTGLEAESLMFISVPFGEDNITFYDRITSALRESDAIAIRTSREIEGNFCDYIASQFGK  238

Query  813   PLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTG  634
              +LL GPV+PE A G L++ WA+WL  F   +++YC+FGS+  L+ DQ +EL LG EL+G
Sbjct  239   KVLLTGPVLPEEAEGKLEENWANWLDAFANESIVYCAFGSQINLEKDQFQELLLGFELSG  298

Query  633   LPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHA  454
             LPF + L  P   +   E   ALP GF ERVKGRG++  GWVQQ  IL H SVGC+V H 
Sbjct  299   LPFLVALKTPRGCESVEE---ALPEGFEERVKGRGVVSRGWVQQLLILKHPSVGCFVNHC  355

Query  453   GFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADD------------------MKAGVEVN  328
             GF S+ E +++D Q+V++PQ GDQ LN KLL ++                  +   VEV 
Sbjct  356   GFGSMWESLMSDKQIVLVPQLGDQVLNTKLLVEELGVAGGGGGGGGGGGAASLGVAVEV-  414

Query  327   RRDEDGYFWKEDIQKAVQTIM---GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMR  157
              R  +G+  KE + KA++ +M    E GA  + N  +WK+      + + ++   V+ ++
Sbjct  415   ERGGNGWVSKESLSKAIKLVMDGDSEVGARVKKNHMEWKKTGGSPNLMNGYMDRFVQNLQ  474

Query  156   D  154
             D
Sbjct  475   D  475



>gb|AEM37036.1| UDP-glucose:flavonoid 3-O-glucosyltransferase 1 [Brassica rapa 
subsp. oleifera]
Length=468

 Score =   308 bits (790),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 181/474 (38%), Positives = 288/474 (61%), Gaps = 23/474 (5%)
 Frame = -3

Query  1536  ITNNHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP  1357
             +  + G   + +V++P+ AFGH++ F+ LSNKL+  G +I F      +D++K +     
Sbjct  3     VFGSDGSSSMSIVMYPWLAFGHMTAFLHLSNKLAEKGHEIVFLLPKKALDQVKPLNLYPN  62

Query  1356  CTQIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDF  1177
                   +++P V+GLPPG ++ +D P     LL VA+N  +P+++ +L   KP  V +D 
Sbjct  63    LITFHTISIPHVKGLPPGAETNSDVPFFLTHLLAVAMNQTRPEVETILRTNKPDLVFYDS  122

Query  1176  AQNWLPPLAAELGIKTIffsvfvalatafatVPAR----LPGPERSPTVEEMKKPPPGFP  1009
             A +W+P +A  +G KT+ ++   A + A   VPA     + G E S   EE+ KPP G+P
Sbjct  123   A-DWIPEIARPVGAKTVCYNTVSAASIALTLVPAAEREIIDGKEMSG--EELAKPPLGYP  179

Query  1008  PTSVASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVK  829
              + V  L   EA+    +++R H G  S +D  +  +  C AI  +TC E E  + DY++
Sbjct  180   SSKVV-LLAREAKTLSFVWRR-HEGIGSFFDGKVTAMRNCDAIAIRTCRETEGKFCDYIE  237

Query  828   SQFKKPLLLAGPVVP--EPASGVLDQKWADWLSQFEPSTVIYCSFGSETFL-KDDQIKEL  658
             SQ+ +P+ L GPV+P  EP    L+ +WADWL++F+P +V++C+FGS+  + K DQ +EL
Sbjct  238   SQYNRPVYLTGPVLPVDEPNKTSLEPRWADWLAKFKPGSVVFCAFGSQPVVEKIDQFQEL  297

Query  657   ALGLELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSS  478
              LGLE TGLPF + +  P+ V    E   ALP GF ERV+GRG+++ GWVQQ  IL H S
Sbjct  298   CLGLEATGLPFLVAIKPPSGVSTVEE---ALPEGFQERVRGRGVVYGGWVQQPMILDHPS  354

Query  477   VGCYVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWK  298
             VGC+V H GF S+ E +++DCQ+V++PQ G+Q LNA+L+A++M+       R+E+G+F +
Sbjct  355   VGCFVSHCGFGSMWESLMSDCQMVLVPQHGEQILNARLMAEEMEV-AVEVEREENGWFSR  413

Query  297   EDIQKAVQTIMGEE---GASTRANQEKWKEFLLDKEIQ----SKFIKDLVKVMR  157
               ++ AV+++MGE    G   R N +KW+  L D        SKF ++L ++++
Sbjct  414   RSLEDAVKSVMGEGSEVGEKVRKNHDKWRCVLSDSGFADGYISKFEQNLTELVK  467



>ref|XP_007149716.1| hypothetical protein PHAVU_005G093300g [Phaseolus vulgaris]
 gb|ESW21710.1| hypothetical protein PHAVU_005G093300g [Phaseolus vulgaris]
Length=475

 Score =   308 bits (790),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 187/459 (41%), Positives = 269/459 (59%), Gaps = 12/459 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ IFP+FA GH++P + LSNKL+  G +ISF        ++  +         +P+ L
Sbjct  9     LHIAIFPWFAMGHLTPNLHLSNKLAERGHRISFIVPQRTQTKLHHLNLHPHLITFIPIKL  68

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P V GLP   ++T+D P +   LL  A++  Q  I+ LL +L P  V FDF Q+WLP L+
Sbjct  69    PHVHGLPHHAETTSDVPFSLFPLLTTAMDRTQKDIELLLRDLNPQIVFFDF-QHWLPNLS  127

Query  1149  AELGIKTIffsvfv-alatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
               L IK++ + +     +      P R  G  R  T  ++ +PPPGFP + +   +  E 
Sbjct  128   RSLSIKSVMYLILHPLSSAYLVEDPRRSQG--RELTELDLMEPPPGFPDSCI-KFQPHEL  184

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             R  V I K     G  +YDR   G     AI  K C E++ PY +Y+++ + KP+LL+GP
Sbjct  185   RCLVEIRKLEFGSGVLLYDRGYKGFCSADAIGFKGCREIDGPYAEYLQTVYGKPVLLSGP  244

Query  792   VVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
             ++PEP +  L++KWA WL  F P +VI+C++GSE+ L  +Q++EL LGLELTG PF   L
Sbjct  245   LLPEPPNTTLEEKWASWLGGFNPGSVIFCAYGSESPLPQNQLQELLLGLELTGFPFLAAL  304

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
               P   D    +  ALP GF ERVKGRGI + GWVQQQ IL H SVGC++ H G +SV E
Sbjct  305   KPP---DGFESIEEALPEGFGERVKGRGIAYGGWVQQQLILGHPSVGCFITHCGAASVTE  361

Query  432   GIVNDCQLVMLPQKG-DQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE  256
              +VN C LV+LP+ G D  +NAK+L+  +K GV+V + +EDG F KE + KAVQT+M + 
Sbjct  362   ALVNKCGLVLLPRLGTDHIMNAKMLSMILKVGVQVEKGEEDGLFTKESVCKAVQTVMEDG  421

Query  255   ---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
                G   R N  K + FLL   ++S  +    + ++D+ 
Sbjct  422   NVVGREVRENHAKLRNFLLSDNLESSCVDRFCQQLQDIC  460



>ref|XP_003596671.1| Anthocyanidin 3-O-glucosyltransferase [Medicago truncatula]
 gb|AES66922.1| UDP-glucosyltransferase family protein [Medicago truncatula]
 gb|AFK38670.1| unknown [Medicago truncatula]
Length=458

 Score =   308 bits (789),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 182/462 (39%), Positives = 278/462 (60%), Gaps = 20/462 (4%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             LH+ +FP+FA GH +P++ LSNKL+  G KISFF       +++  LN NP      PL 
Sbjct  7     LHIAMFPWFAMGHFTPYLHLSNKLAKKGHKISFFIPKKTQTKLQH-LNLNPNLITFYPLN  65

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P ++GLP G ++++D P +   L+  A++  + QI+ LL EL P  V FDF Q WLP L
Sbjct  66    VPHIDGLPDGAETSSDVPFSLVPLIATAMDQTEKQIEHLLKELNPQIVFFDF-QYWLPNL  124

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSP----TVEEMKKPPPGFPPTSVASLR  985
               +LGIK++ + +    + ++        GP  S     TV+++KKPP G+P  S+  L 
Sbjct  125   TQKLGIKSLQYWITSPFSISYFWN-----GPRHSQGKGLTVDDLKKPPSGYPDGSI-KLY  178

Query  984   TFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLL  805
               E +      K     G  +YDR+  G +   AI  K C E++ PY +++ + + KP L
Sbjct  179   QHELQFLSSTRKLVFGSGVFLYDRLHIGTSLADAIGFKGCKELDEPYAEFLGNFYGKPYL  238

Query  804   LAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPF  625
             L+GP++PE     LD+KW  WL  F+P +V++C++GSE  L+ +Q +EL LGLELTG PF
Sbjct  239   LSGPLLPETPKTTLDEKWESWLKGFKPGSVVFCAYGSEGPLEKNQFQELLLGLELTGFPF  298

Query  624   FLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFS  445
                L  P   +   E   ALP GF ERVKG+GI++  W+QQQ IL H SVGC++ H G +
Sbjct  299   LAALKPPNGFESIEE---ALPEGFNERVKGKGIVYGSWIQQQLILEHPSVGCFITHCGAA  355

Query  444   SVIEGIVNDCQLVMLPQKG-DQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTI  268
             S+ E +VN CQLV+LP+ G D  +NA+++++ MK GVEV + DEDG F KE + +AV+ +
Sbjct  356   SITEALVNTCQLVLLPRVGVDHIMNARMMSEKMKVGVEVEKGDEDGLFTKESVCEAVKIV  415

Query  267   MGEE---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             M +E   G   R N  + ++FLL + ++S  + +  + ++ +
Sbjct  416   MDDENKVGREVRKNHSELRKFLLSENLESSCVDNFCEKLQGL  457



>ref|XP_002282717.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Vitis vinifera]
Length=459

 Score =   308 bits (788),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 189/459 (41%), Positives = 279/459 (61%), Gaps = 18/459 (4%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPC-TQIVPLA  1333
             LH+ +FP+FAFGH+ P++ LSN+L+  G KI+F        +++  LN +P      PL 
Sbjct  9     LHIAMFPWFAFGHMIPYLNLSNELAGRGHKITFILPRKAQSKLQH-LNFHPALITFHPLI  67

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P V+GLPPGT++ +D P +   LL  AL+  + Q++A L  L P  + +DFA  W P L
Sbjct  68    VPHVDGLPPGTETASDIPVSLTYLLATALDRTRDQVEAALRTLNPDLLFYDFAY-WAPAL  126

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKK-PPPGFPPTSVASLRTFE  976
             A++LGIK+I++ V  A A A   +PA+    + S    ++   PPPG+P ++V  LR  E
Sbjct  127   ASQLGIKSIYYCVVCAAAVAHTPIPAQ----QGSKDCRQLTDVPPPGYPSSTVV-LRPHE  181

Query  975   ARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
             AR    +F  P+  G +   R +     C AI  +TC E E P  DY+ SQ+ KP+ L G
Sbjct  182   ARLMDFMFA-PYGEGITFQQRHITARTSCDAISIRTCQETEGPICDYIGSQYGKPVFLTG  240

Query  795   PVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
             PV+P P+   L+ +WA WL  F+P +VI+C+FGS+   + DQ +EL LGLELTGLPFF  
Sbjct  241   PVLPNPSVEPLEDRWAQWLGGFKPGSVIFCAFGSQNVHEKDQFQELLLGLELTGLPFFAA  300

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSG-WVQQQQILVHSSVGCYVCHAGFSSV  439
             L  P     A+ +  ALP GF ERV GRG++H G WVQQ  +L H SVGC+V H G+ S+
Sbjct  301   LKPPTG---AATIEEALPEGFQERVGGRGLVHGGWWVQQPSVLSHPSVGCFVSHCGYGSM  357

Query  438   IEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGE  259
              E + +D Q+V++P+  DQ LN++LLA+++K  VEV  R+E+G F KE +  A++T+M E
Sbjct  358   WESLTSDPQIVLVPELPDQILNSRLLAEELKVAVEV-EREENGLFSKESLCDAIKTVMDE  416

Query  258   E---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                 G   + N  KWKE L  +   S ++ + V  ++ +
Sbjct  417   NSEVGGLVKKNHAKWKEALTSQSFLSNYVDNFVGQLQGL  455



>ref|XP_010695817.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Beta vulgaris subsp. vulgaris]
Length=452

 Score =   307 bits (787),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 171/471 (36%), Positives = 266/471 (56%), Gaps = 28/471 (6%)
 Frame = -3

Query  1530  NNHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCT  1351
              N    +L V  +P+FA GH++ F++L+NKL+  G ++S+F       ++ S  +     
Sbjct  3     ENKESQVLKVAFYPWFALGHLTSFLRLANKLAERGHQVSYFLPKNTQLKLASQNHFPDHL  62

Query  1350  QIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQ  1171
               +P+ +P+V+GLPPG ++T D   + A L+  A+++ +  I A L  LKP FV +DFA 
Sbjct  63    TFIPITVPSVDGLPPGAETTNDVSLSGAHLIMAAMDMTRDTIDAHLALLKPDFVFYDFAY  122

Query  1170  NWLPPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPP---TS  1000
              W+P LA + GIK++ +   +      A   +R+ G                +PP   + 
Sbjct  123   -WMPQLARKHGIKSVHYITGLIARYTLAI--SRITG---------------AYPPDLSSP  164

Query  999   VASLRTFEARDFVIIFKRPHN-GGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQ  823
             +  +R  E +    I ++P   GG ++ +        C A+  KTC EME  Y ++ +  
Sbjct  165   IFQMRAHEMKVMEHISEKPFAPGGVTLPEMFRISFEECDAVGVKTCKEMEGIYCEFAEKT  224

Query  822   FKKPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLE  643
               KP+LLAGPVVP+  S  LD     WLS F   TVI+C+ GSE  L+ +Q +++ LGLE
Sbjct  225   LDKPVLLAGPVVPKLPSSKLDDYVDAWLSTFGSGTVIFCALGSECILEQNQFQDILLGLE  284

Query  642   LTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYV  463
             LTG PF   L  P N      L   LP GF+ERV+GRG+IH GWVQQQ IL H SVGC++
Sbjct  285   LTGKPFLAALKPPKN---CKSLESGLPEGFSERVRGRGMIHGGWVQQQLILQHPSVGCFI  341

Query  462   CHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQK  283
              H G  S+ E +V+ CQ+V++PQ  DQF+NA+ ++ ++K GVEV   + DG+F +E + K
Sbjct  342   THCGVGSLSEAMVSQCQVVLMPQAVDQFMNARQMSLELKIGVEVESTETDGFFTREALCK  401

Query  282   AVQTIMGEEGASTR---ANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATMN  139
             AV  +M E+    R   AN  KW++F+L + ++  +I   ++ ++ +  MN
Sbjct  402   AVSLVMDEQSEVAREVKANHAKWRDFILTEGLEDSYISSFIQSLQHLLQMN  452



>gb|AES66921.2| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=434

 Score =   306 bits (783),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 169/459 (37%), Positives = 262/459 (57%), Gaps = 38/459 (8%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             LH+ +FP+FA GH++P++  SNKL++ G KISFF     +++++  LN +P      P+ 
Sbjct  7     LHIAMFPWFAMGHLTPYLHFSNKLAIRGHKISFFIPKNTLNKLQH-LNLHPNLITFFPIT  65

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P V GLP   ++T+D P +   L+  A++    QI+ LL ELKP  V FDF Q WLP L
Sbjct  66    VPHVNGLPHNAETTSDVPFSLFPLIATAMDQTDKQIELLLKELKPQIVFFDF-QYWLPNL  124

Query  1152  AAELGIKTIffsv-fvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFE  976
               +LGIK++ + +     +     +P +  G  +  T +++KKPP GFP +S+    + E
Sbjct  125   TQKLGIKSLQYLIWNPISSAYLGNIPRKSQG--KYLTKDDLKKPPAGFPDSSI-KFHSHE  181

Query  975   ARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
              R      K     G  +YDRV  G     A+  K C E++  Y DY+++ F KP+LL+G
Sbjct  182   LRFLASTRKIEFGSGVLLYDRVDTGTKSSDAVSFKGCREIDGLYADYLETVFGKPVLLSG  241

Query  795   PVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
             P++PEP    L++KW  WL +F+  +VI+C++GSE         +  +G E         
Sbjct  242   PLLPEPPKATLEEKWLTWLKEFKHGSVIFCAYGSEAL-------KPPIGFE---------  285

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVI  436
                         +  ALP GF ER+KG+GI++  W+QQQ IL H SVGC++ H G +S+ 
Sbjct  286   -----------SIEEALPEGFNERIKGKGIVYGSWIQQQLILEHPSVGCFITHCGAASIT  334

Query  435   EGIVNDCQLVMLPQKG-DQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGE  259
             EG+VN CQLV+LP+ G D  +NA++++  +K G+EV R +EDG F KE +  AV+ +M +
Sbjct  335   EGLVNTCQLVLLPRAGADHIMNARMMSSTLKVGIEVERGEEDGLFTKESVGNAVRIVMDD  394

Query  258   E---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             E   G   RAN  K + FLL   ++S  +    + + D+
Sbjct  395   ENEVGKEVRANHAKMRNFLLSSNLESSCVNSFCQKLYDL  433



>ref|XP_006281777.1| hypothetical protein CARUB_v10027945mg [Capsella rubella]
 gb|EOA14675.1| hypothetical protein CARUB_v10027945mg [Capsella rubella]
Length=469

 Score =   307 bits (786),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 172/469 (37%), Positives = 284/469 (61%), Gaps = 19/469 (4%)
 Frame = -3

Query  1527  NHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQ  1348
             ++G   + +V++P+ AFGH++PF+ LSNKL+  G KI F      +++++ +        
Sbjct  6     SNGSSSMSIVMYPWLAFGHMTPFLHLSNKLAEKGHKIVFLLPKKALNQLEPLNLYPKLIT  65

Query  1347  IVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQN  1168
                +++P V+GLPPG ++ +D P     LL VA++  +P+++ +   +KP  V +D A +
Sbjct  66    FHTISIPQVKGLPPGAETNSDVPFFLTHLLAVAMDQTRPEVETIFRTIKPDLVFYDSA-H  124

Query  1167  WLPPLAAELGIKTIffsvfvalatafatVPAR----LPGPERSPTVEEMKKPPPGFPPTS  1000
             W+P +A  +G KT+ F +  A + A + VPA     + G E S   EE+ K P G+P + 
Sbjct  125   WIPEIAKPMGAKTVCFHIVSAASIALSLVPAAEREVIDGKEMSG--EELAKTPLGYPSSK  182

Query  999   VASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQF  820
             V  LR  EA+    ++++ H G AS +D  +A +  C AI  +TC E E  + DY+ SQ+
Sbjct  183   VV-LRAHEAKLLSFVWRK-HEGIASFFDVQVAAMRNCDAIAIRTCRETEGKFCDYISSQY  240

Query  819   KKPLLLAGPVVP--EPASGVLDQKWADWLSQFEPSTVIYCSFGSETFL-KDDQIKELALG  649
              KP+ L GPV+P  +P    L+ +WA+WL++F+P++V++C+FGS+  + K DQ +EL LG
Sbjct  241   NKPVNLTGPVLPGSQPNQPSLEPQWAEWLAKFKPNSVVFCAFGSQPVVDKIDQFQELCLG  300

Query  648   LELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGC  469
             LE TGLPF + +  P+ V    E   ALP GF ERV+GRG+++ GW+QQ  +L H SVGC
Sbjct  301   LESTGLPFLVAIKPPSGVSTVEE---ALPEGFKERVQGRGVVYGGWIQQPLVLDHPSVGC  357

Query  468   YVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDI  289
             +V H GF S+ E +++DCQ+V++P  G+Q LNA+L+ ++M+       R E+G+F +  +
Sbjct  358   FVSHCGFGSMWESLMSDCQIVLVPHHGEQILNARLMTEEMEV-AVEVERGENGWFSRRSL  416

Query  288   QKAVQTIM---GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             + AV+++M    E G   R N +KW+  L D      +I    + + ++
Sbjct  417   EDAVKSVMEEGSEVGVKVRKNHDKWRCVLSDSGFADGYINTFEQSLTEL  465



>gb|EPS58858.1| glucosyltransferase, partial [Genlisea aurea]
Length=450

 Score =   306 bits (784),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 176/460 (38%), Positives = 275/460 (60%), Gaps = 22/460 (5%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGN-VDRIKSMLNSNPCTQIVPLA  1333
             L +++FP+FA GH++ F+ +SNKL+  G    FF+   N + R++ +       + +PLA
Sbjct  5     LKIMMFPWFAMGHLTTFLHISNKLAQRGGHRIFFAVPRNSIARVRHLNRFPELIEFLPLA  64

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P VEGLP G + TAD P     L+  A++L +PQI+ L+ EL+P+FV+FDF+ +WLP  
Sbjct  65    VPHVEGLPAGAELTADVPFPMIPLILTAMDLTRPQIEDLISELRPNFVLFDFS-HWLPGS  123

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
             AA+ G KT+F++   A A  +          + + TV+++ +PPPG+P + +  L T EA
Sbjct  124   AAKFGAKTVFYNTISAAAVGWLFR-------DLTATVDDIMRPPPGYPSSGI-KLTTQEA  175

Query  972   RDFVIIFKR--PHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLA  799
                  + K   P  G     +R+ A    C +++ K+  E+E+ Y D++  ++ KP+  A
Sbjct  176   CAVHDMNKTGPPGAGELKFVERLEACARDCDSMVFKSYMELESQYFDFLSKKYSKPVSPA  235

Query  798   GPVVPE-PASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFF  622
             GPV+PE P     D KW++WL +FE  +VIYC+FGSE  L+  Q +EL LGLELTG P+ 
Sbjct  236   GPVLPEAPKLDDADGKWSEWLDKFESKSVIYCAFGSEARLRTIQFQELILGLELTGKPYL  295

Query  621   LVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSS  442
             +    P   +   E   A+P G    + GRG++H GWV QQ +L H S GC+V H G+ S
Sbjct  296   VAAKPPIGAETVEE---AMPEG---ELSGRGVVHGGWVPQQLMLSHPSTGCFVTHCGWGS  349

Query  441   VIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM-  265
             + EGI+++CQLV++P   DQ +NA+L+  ++  G+E+ + DEDG F KE ++KAV + + 
Sbjct  350   LFEGILSECQLVLMPLFADQPINARLMGGELGIGIEMEKGDEDGMFRKESVKKAVDSALD  409

Query  264   --GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
               G  GA  RAN  KW+E ++       +I DL+   R +
Sbjct  410   FAGGIGAKIRANHAKWREVMMKDGFDDSYIDDLILKFRAL  449



>ref|XP_007021621.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY13146.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=581

 Score =   310 bits (793),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 168/464 (36%), Positives = 271/464 (58%), Gaps = 18/464 (4%)
 Frame = -3

Query  1527  NHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQ  1348
             N     LH+ +FP+F+FGH  P++ LSNKL+  G ++SF    G   +++ +       Q
Sbjct  129   NPNSSKLHLAMFPWFSFGHFIPYLHLSNKLAEKGHEVSFLLPKGAQPKLEQLNQYPNLIQ  188

Query  1347  IVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQN  1168
               PL +  V+G+ PG Q+T+D P     L  +A +  + Q++A+L  +KP  V  D    
Sbjct  189   FFPLVVSHVDGILPGAQTTSDVPLPLHSLFAIAFDQTRDQVEAILRAIKPDIVFHDLGY-  247

Query  1167  WLPPLAAELGIKTIffsvfvalatafatVPARLPGPE--RSPTVEEMKKPPPGFPPTSVA  994
             W+P LA ++GIK+I++    A A       A LP  +  R  TVEE+ + PPG+P + V 
Sbjct  248   WIPALAHQIGIKSIYYPPVTAAAH------ALLPTKKVTREMTVEELMEVPPGYPSSKV-  300

Query  993   SLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKK  814
              LR  E  D     K     G S  DR++  +N    I  +   E+E PY DYV   F K
Sbjct  301   KLRAEEVSDLTTALKI-FGIGLSFRDRIITSMNDSDVIAFRAHREIEGPYCDYVAQHFGK  359

Query  813   PLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTG  634
             P +L G  +PE  +  L+ KWA+WLS FEPS+V++C+FGS+  L+ ++ +EL LGLEL+G
Sbjct  360   PAMLTGTCLPETNATQLEDKWANWLSNFEPSSVVFCAFGSQITLQKEEFQELVLGLELSG  419

Query  633   LPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHA  454
              PF + L  P   D  + +  ALP GF ER++GRG++H GW  Q+ +L H S+GC+V H 
Sbjct  420   QPFLVALTPP---DGCTRIEEALPEGFQERIQGRGLLHGGWFPQELLLSHPSIGCFVNHC  476

Query  453   GFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQ  274
             G  ++ E +++DCQ+V +P+ GDQ LN +L+ +++K  VE   + E+    KE++ KA++
Sbjct  477   GPGTMWESLLSDCQIVFIPRLGDQILNTRLMVEELKVAVEA-EKGENSKISKENLSKAIK  535

Query  273   TIMGEEGAST---RANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
              +M ++   +   + N  K K+ L ++++Q ++I + +K ++D+
Sbjct  536   LVMDKDNEISVLLKRNHAKLKKILSNRDLQEEYINNFIKGLQDL  579



>ref|XP_010446338.1| PREDICTED: UDP-glycosyltransferase 79B6-like isoform X1 [Camelina 
sativa]
Length=447

 Score =   305 bits (782),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 167/457 (37%), Positives = 270/457 (59%), Gaps = 19/457 (4%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
              H  +FP+F FGH++ F+ L+NKL+  G KI+F      + +++ +           L +
Sbjct  5     FHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKALKQLEPLNLFPDYIFFHTLTI  64

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P+V+GLP G ++T+D   ++   L  A++  + Q++  +   KP  + FDFA +W+P +A
Sbjct  65    PSVDGLPAGAETTSDIQISSGSFLASAMDRTRNQVQEAVSIGKPDLIFFDFA-HWIPEIA  123

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEAR  970
              E G +++ F    A   A + VP R P        +++  PPPG+P + V  LR  E  
Sbjct  124   GEYGARSVNFITISAACVAISFVPGRSP--------DDLAVPPPGYPSSKVL-LRGQETN  174

Query  969   DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
              F  +   P     + Y+R++ GL  C  I  +TC EME  + D+++SQF++ +LL GP+
Sbjct  175   CFSFL-SHPFGDNTTFYERIMIGLTNCDVISIRTCQEMEGKFCDFIESQFQREVLLTGPM  233

Query  789   VPEP-ASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
             +PEP  S  L+ +W  WLS+FEP +V+YC+ GS+  L+ DQ +EL LG+ELTGLPF + +
Sbjct  234   LPEPDNSKPLEDQWMQWLSRFEPGSVVYCALGSQIILEKDQFQELCLGMELTGLPFLVAV  293

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
               P     +S +  ALP GF ERVKGRG++   WVQQ  IL H S+GC+V H GF S+ E
Sbjct  294   KPPKG---SSTIQEALPNGFEERVKGRGVVWGRWVQQPLILAHPSIGCFVSHCGFGSMWE  350

Query  432   GIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM---G  262
             G+VNDCQ+V +P  G+Q  N +L++++++  VEV R D  G+F KE +  +++++M    
Sbjct  351   GLVNDCQIVFIPHLGEQIFNTRLMSEELEVSVEVERED-TGWFSKESLSGSIRSVMDKDS  409

Query  261   EEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             E G   R N  KWK+ L+   + + ++   ++ ++ +
Sbjct  410   ELGNLVRRNHAKWKDSLVSTGLMNGYVNKFIEALQKL  446



>ref|XP_008226433.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Prunus mume]
Length=439

 Score =   305 bits (780),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 172/455 (38%), Positives = 266/455 (58%), Gaps = 24/455 (5%)
 Frame = -3

Query  1497  IFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLALPAVE  1318
             +FP+FA GHI+P++ L+N+L+  G + +         +++ ++         P+A+P V 
Sbjct  1     MFPWFAIGHITPYLHLANELASRGHRTTLLVPNKARLQLQHLVLHADLIVFSPVAIPHVH  60

Query  1317  GLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLAAELG  1138
             GLP GT+  ++ P     LL  A++  + +I+  L   KP FV++D AQ W+P +A   G
Sbjct  61    GLPEGTEIASEIPIHMTHLLATAMDRTRGEIEQFLTISKPDFVLYDTAQ-WVPGIARRNG  119

Query  1137  IKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEARDFVI  958
             IKT+ ++V  A A A A VPAR            +++PP G+P  +V  L   EA+    
Sbjct  120   IKTVCYNVVCAAALAIALVPAR-----------NLREPPAGYPSKNVV-LCGAEAKALTF  167

Query  957   IFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPVV---  787
             I   P+  G + Y+R    +  C  +  +TC E+E    DY+++Q+KKP++L GPV+   
Sbjct  168   I-SLPYGEGITFYERTTTAMKECDVLSIRTCRELEGDLCDYMEAQYKKPVILTGPVLGLG  226

Query  786   PEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLNF  607
              +  S  LD++W  W S FE  +V++C+FG++  L+ DQ +EL LG ELTGLPFF+ L  
Sbjct  227   SDKKSEKLDERWEKWFSGFEAGSVVFCAFGTQWILEKDQFQELVLGFELTGLPFFVALKP  286

Query  606   PANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEGI  427
             P+     + +  ALP GF ERVKGRG++  GWVQQ  IL H SVGC+V H GF S+ E +
Sbjct  287   PSG---CATIEEALPNGFEERVKGRGVVFGGWVQQTAILSHKSVGCFVNHCGFGSMWESL  343

Query  426   VNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM---GEE  256
             + D Q+V++P  GDQ LN KLL  ++K  VEV  R+E+G+F KE ++KA++++M    E 
Sbjct  344   MTDNQIVLVPHLGDQILNTKLLVKELKVAVEVE-REENGWFSKESLRKAIKSVMDKDSEV  402

Query  255   GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             G   + N  KW E L      S +I   V+ ++++
Sbjct  403   GVMVKKNHAKWVETLSSPGFMSGYIDRFVQKLKEL  437



>ref|XP_007213912.1| hypothetical protein PRUPE_ppa005654mg [Prunus persica]
 gb|EMJ15111.1| hypothetical protein PRUPE_ppa005654mg [Prunus persica]
Length=449

 Score =   305 bits (780),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 171/456 (38%), Positives = 270/456 (59%), Gaps = 13/456 (3%)
 Frame = -3

Query  1497  IFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLALPAVE  1318
             +FP+FA GHI+P++ L+N+L+  G +I+         +++ ++         P+A+P V 
Sbjct  1     MFPWFAIGHITPYIHLANELASRGHRITLLVPNKARLQLQHLVLHADLIVFSPVAVPHVH  60

Query  1317  GLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLAAELG  1138
             GLP GT+  ++ P     LL  A++  + +I+  L   K  FV++D AQ W+P +A   G
Sbjct  61    GLPEGTEIASEIPIHMTHLLATAMDRTRGEIEQFLTVSKLDFVLYDTAQ-WVPGIARRNG  119

Query  1137  IKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEARDFVI  958
             IKT+ ++V  A A A A VPAR    +R  T EE+++ P G+P  +V  L   EA+    
Sbjct  120   IKTVCYNVVCAAALAIALVPARNVPKDRPITEEELREAPAGYPSKNVV-LCGAEAKALTF  178

Query  957   IFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPVV---  787
             I   P+  G + Y+R    +  C  +  +TC E+E    DY+++Q+KKP++L GPV+   
Sbjct  179   I-SLPYGEGITFYERTTTAMKECDVLSIRTCRELEGDLCDYMEAQYKKPVILTGPVLGLG  237

Query  786   PEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLNF  607
              +  S  L+++W  W S FE  +V++C+FG++  L+ +Q +EL LG ELTGLPFF+ L  
Sbjct  238   SDKKSEKLEERWEKWFSGFEAGSVVFCAFGTQWILEKEQFQELVLGFELTGLPFFVALKP  297

Query  606   PANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEGI  427
             P+     + +  ALP GF ERVKGRG++  GWVQQ  IL H SVGC+V H GF S+ E +
Sbjct  298   PSG---CATIEEALPNGFEERVKGRGVVFGGWVQQTAILSHKSVGCFVNHCGFGSMWESL  354

Query  426   VNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM---GEE  256
             + D Q+V++P  GDQ LN KLL  ++K  VEV  R+E+G+  K+ ++KA++++M    E 
Sbjct  355   MTDNQIVLVPHLGDQILNTKLLVKELKVAVEVE-REENGWLSKDSLRKAIKSVMDKDSEV  413

Query  255   GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
             G   + N  KW E L      S +I   V+ +++++
Sbjct  414   GVMVKKNHAKWVETLSSPGFMSGYIDRFVQKLKEIS  449



>gb|KDO77744.1| hypothetical protein CISIN_1g017557mg [Citrus sinensis]
Length=369

 Score =   301 bits (772),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 159/368 (43%), Positives = 228/368 (62%), Gaps = 10/368 (3%)
 Frame = -3

Query  1236  QPQIKALLVELKPHFVIFDFAQNWLPPLAAELGIKTIffsvfvalatafatVPARLPGPE  1057
             +P I+A++ ++KP+ V FDF   WLP LA +LGIK+I F         +   P R    +
Sbjct  8     EPAIEAIVRDIKPNIVFFDFTY-WLPSLARKLGIKSIAFVTVSPATVGYLLSPER-KLRD  65

Query  1056  RSPTVEEMKKPPPGFPPTSVASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAIL  877
             +  T  ++ +PP GFPP+ +  LR  EAR       +   GG S  +R+L  L  C AI 
Sbjct  66    KFLTEADLLQPPQGFPPSKI-KLRAHEARGLAAATVKDF-GGLSFMERLLLCLTECDAIG  123

Query  876   AKTCYEMEAPYIDYVKSQFKKPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFG  697
              KTC E+E  Y D V+SQF+K ++LAGPV+PEP + VL++++    S F+  ++I+C+ G
Sbjct  124   FKTCREIEGAYCDCVESQFEKRVILAGPVLPEPPASVLEEEFEMLFSSFKAKSLIFCALG  183

Query  696   SETFLKDDQIKELALGLELTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHS  517
             SE  LK DQ +EL LG ELTGLPFF  L  P   D    +  ALP GF ERVKGRG +H 
Sbjct  184   SECVLKKDQFQELILGFELTGLPFFAALKPPTGHDT---IESALPEGFEERVKGRGFVHG  240

Query  516   GWVQQQQILVHSSVGCYVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGV  337
             GWVQQQ IL H SVGC+V H G  S+ E +VN+CQLV+LP  GDQ +N++L+ +D+K GV
Sbjct  241   GWVQQQLILKHPSVGCFVTHCGSGSLSEAMVNECQLVLLPNVGDQIINSRLMGEDLKVGV  300

Query  336   EVNRRDEDGYFWKEDIQKAVQTIMGEE---GASTRANQEKWKEFLLDKEIQSKFIKDLVK  166
             EV R DEDG F ++ + KAV+ +M ++   G   R N  + +EFL+   +++ ++   V+
Sbjct  301   EVERGDEDGLFTRDGVCKAVKAVMDDDSEVGKDARQNHAELREFLISPGLENSYVDGFVQ  360

Query  165   VMRDMATM  142
              +  +A +
Sbjct  361   ELHSLADL  368



>ref|XP_009127123.1| PREDICTED: UDP-glycosyltransferase 79B10-like [Brassica rapa]
Length=451

 Score =   304 bits (778),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 178/464 (38%), Positives = 270/464 (58%), Gaps = 33/464 (7%)
 Frame = -3

Query  1518  GDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIV-  1342
             G   H  +FP+FAFGH++P+V L+NKL+  G +++F        +++  LN  P + +  
Sbjct  6     GQKFHAFMFPWFAFGHMTPYVHLANKLAEKGHRVTFLLPKKAKKQLEH-LNLFPDSIVFH  64

Query  1341  PLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWL  1162
             P+ +P V+GLP G ++ +D P      L  A++L + Q++A +  L+P  ++FD A  W+
Sbjct  65    PITIPHVDGLPAGAETPSDIPVTLWRFLSTAMDLTRDQVEAAVRALRPDIILFDLAY-WI  123

Query  1161  PPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRT  982
               +A E GIK++ ++V  A + A   VP             E+  PPPG+P +S    R 
Sbjct  124   TEVAKEHGIKSMLYNVISATSIAHDLVPGG-----------ELGVPPPGYP-SSTLLFRR  171

Query  981   FEAR---DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKP  811
              +A     F + +KR        Y RV  GL  C  I  +TC E+E  + DY+  Q++K 
Sbjct  172   HDAHALLSFAVYYKR-------FYYRVTTGLTDCDFISIRTCEEIEGKFCDYIGRQYQKK  224

Query  810   LLLAGPVVPEP-ASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTG  634
             +LL GP++PEP  S  L+ KW +WLS FEP +V+YC+ GS+  L+ DQ +EL LGLELTG
Sbjct  225   VLLTGPMLPEPDKSKPLEDKWNNWLSGFEPGSVVYCALGSQITLEKDQFQELCLGLELTG  284

Query  633   LPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHA  454
             LPFF+ +  P     A  +  ALP GF ERVKGRG++   WVQQ  IL H SVGC+V H 
Sbjct  285   LPFFVAVTPPKG---AKTIQEALPEGFEERVKGRGVVWGEWVQQPLILAHPSVGCFVSHC  341

Query  453   GFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQ  274
             GF S+ E +++DCQ+V+LP   DQ LN +LL D+++  VEV  R++ G+F KE++  AV 
Sbjct  342   GFGSMWESLMSDCQIVLLPYLADQVLNTRLLTDELEVSVEVP-REKTGWFSKENLSVAVT  400

Query  273   TIM---GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             ++M    E G   R N  K KE ++   + + +  + V  + ++
Sbjct  401   SVMDKDSEIGNLVRRNHSKLKEVVVSPGLLTGYTDNFVVTLENL  444



>gb|AFK39154.1| unknown [Lotus japonicus]
Length=457

 Score =   303 bits (777),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 180/458 (39%), Positives = 270/458 (59%), Gaps = 12/458 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             +H+ +FP+FA GH++PF+ LSNKL+  G +ISF        +++  LN +P     VP+ 
Sbjct  6     MHIAMFPWFAMGHLTPFLHLSNKLARRGHRISFLIPKRTQAKLEH-LNLHPQLITFVPIT  64

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P V+GLP   ++T+D P +    L  AL+L +  I+ LL++LKP  V FDF Q WLP +
Sbjct  65    VPHVDGLPHDAETTSDVPFSLFSNLATALDLTEKDIEPLLMDLKPQIVFFDF-QYWLPNM  123

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
             A  LGIK++ + +     +A+   P    G E   T  +  KPP GFP          E 
Sbjct  124   ARSLGIKSVQYFIVNPATSAYFGTPRPSQGSEI--TEVDCMKPPLGFPDDPPLKFYAHEI  181

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             R      K     G    DR   G      +  K C E+E PY+DY++S +KKP+LL+GP
Sbjct  182   RFIASFAKVVFGSGIFFPDRFGMGTRFADLMAFKGCREIEGPYVDYLESVYKKPVLLSGP  241

Query  792   VVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
             ++PEP++  L++KW  WL +F+  +V++C++GSE  L+ +Q +EL LGLEL+G PF   L
Sbjct  242   LLPEPSTSTLEEKWVSWLGKFKAGSVVFCAYGSEGPLQQNQFQELLLGLELSGFPFLAAL  301

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
               P   +   E   ALP GF ERV GRGI + GW+QQQ IL H SVGC++ H G +S+ E
Sbjct  302   KPPTGFESIEE---ALPEGFLERVHGRGIAYGGWIQQQLILEHPSVGCFITHCGGASITE  358

Query  432   GIVNDCQLVMLPQKG-DQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE  256
              +VN CQ+V+LP+ G D   NA++++  ++ GVEV + +EDG F KE + KAV+T+M +E
Sbjct  359   ALVNTCQMVLLPRLGSDHVTNARVMSAKLRVGVEVEKGEEDGLFTKESVCKAVKTVMDDE  418

Query  255   ---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                G   RAN  K +  LL + ++S  +    + ++ +
Sbjct  419   SELGKEVRANHTKLRNLLLSENLESSCVDTFCQRLQKL  456



>gb|AFJ52975.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=468

 Score =   304 bits (778),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 174/469 (37%), Positives = 266/469 (57%), Gaps = 33/469 (7%)
 Frame = -3

Query  1506  HVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLAL  1330
             HV +FP+FAFGHI+P++ L+N L+  G ++SF        +  + LN +P      P+ +
Sbjct  13    HVAMFPWFAFGHITPYLHLANHLASRGHRVSFLIPKRTQSKF-TKLNRHPHLITFHPITV  71

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P V+GLPPG +++ D P      L  A +  QPQ++ +L EL P  V++D A +W+P L 
Sbjct  72    PHVDGLPPGAETSYDAPFPLVMFLFTAFDRTQPQVREILTELNPSLVLYDLA-HWIPSLG  130

Query  1149  AELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVA------SL  988
              ELG K + +    A+++A   +P+      +  T  E+ +PPPG+P + V         
Sbjct  131   LELGFKKVAYVTASAVSSALRILPSV--KMVKGMTDAELMRPPPGYPSSVVVPRLDEVDQ  188

Query  987   RTFEARDFVIIFKRPHNGGASV--YDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKK  814
               F A DF         GG++V  Y+R+ A  +G  AI  +TC E+E  + DY+  Q+ K
Sbjct  189   ARFLAEDF---------GGSAVPFYERLTASNSGGDAIAFRTCRELEGQFCDYLGQQYGK  239

Query  813   PLLLAGPVVPEPASGVL---DQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLE  643
             P+LL GP++P+     +   D+K   WL  F+  +V+YC+FGSE  L  DQ +EL  G E
Sbjct  240   PILLTGPILPDEDKTPMTAEDEKLFSWLGNFDGGSVVYCAFGSEIALGKDQFQELLNGFE  299

Query  642   LTGLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYV  463
             L GLPF   L  PA     S +  A P GF ++V+GRG +  GWV QQ+IL H+SVGC+V
Sbjct  300   LCGLPFLAALKPPAG---CSTVEEAFPEGFEDKVRGRGWVTGGWVPQQRILDHASVGCFV  356

Query  462   CHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFW--KEDI  289
              H GF S+ EG+++ CQLVM P  GDQ +   L+ +++K  VEV +      +W  KE +
Sbjct  357   SHCGFGSMWEGLLSKCQLVMAPTLGDQIMGTMLMVNELKVAVEVEKIKSGDRWWIAKEKL  416

Query  288   QKAVQTIM---GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
              +A++ +M   GE G   R N  K++E L +K++  K++ D V  + D+
Sbjct  417   SEAIRAVMDGDGEVGGEVRRNHLKFREVLGEKKVHDKYVDDFVVQIHDL  465



>ref|XP_006354934.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Solanum tuberosum]
Length=455

 Score =   303 bits (776),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 177/462 (38%), Positives = 266/462 (58%), Gaps = 18/462 (4%)
 Frame = -3

Query  1521  GGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIV  1342
             G   L +V+FP+ A GH+ P++ LSN+L+  G KISF        R++ +       +  
Sbjct  2     GESKLEIVMFPWLALGHLIPYMNLSNELAKRGHKISFLLPRNAEIRLQKLNLYPNLIKFH  61

Query  1341  PLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWL  1162
              L +P V+GLP G ++TAD   +   LL  A + +  +IK+ L  LKPHFV FDFA  W+
Sbjct  62    KLTIPHVDGLPYGAETTADVHRSLESLLATAFDELYDEIKSFLQNLKPHFVFFDFAY-WI  120

Query  1161  PPLAAELG-IKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLR  985
             P +A E+G IKT+F+ +    A + +   A       + T  E+ KPPPG+P T+V  LR
Sbjct  121   PDIAREIGGIKTLFYLLVSPAAMSISPDKATF----MTSTAAELVKPPPGYPSTTVV-LR  175

Query  984   TFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLL  805
               EA+    +F   +  G +  +R+  G   C  I  KTC E+E  + DYV +  +KP+L
Sbjct  176   ESEAKLLSFLFHE-YGKGVTFQERLSKGFTQCDVIAVKTCREIEGIFCDYVATLLEKPVL  234

Query  804   LAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPF  625
              AGPV+P+P       + ++WL +FEP +V++C+FGS+  L+  Q ++L LGLELT LPF
Sbjct  235   YAGPVIPDPKKE--QHELSNWLEKFEPGSVVFCAFGSQLILEKKQFQQLVLGLELTELPF  292

Query  624   FLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFS  445
              LV+  P   +   E   ALP GF +RV+ +G+I   WV Q +IL H SVGC+V H G+ 
Sbjct  293   LLVVKPPQGTNSVEE---ALPEGFKQRVQEKGLILDCWVPQLEILRHKSVGCFVTHCGYG  349

Query  444   SVIEGIVN-DCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTI  268
             S+ E +V  DCQLV+LP+  D    A+L+   +K GVEV  +DE+  F KE++ KAV+ +
Sbjct  350   SMWESLVMCDCQLVLLPRPIDHIFTARLMEQHLKVGVEV-EKDENDLFTKENLCKAVKCV  408

Query  267   MGEE---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             M ++   G   + N  KWKE L      S +I + ++ +  +
Sbjct  409   MDKDSQIGCLVKENHRKWKELLSSPGFMSNYIDNFIQDLHGL  450



>emb|CDY28802.1| BnaA02g09940D [Brassica napus]
Length=451

 Score =   302 bits (774),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 177/464 (38%), Positives = 269/464 (58%), Gaps = 33/464 (7%)
 Frame = -3

Query  1518  GDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIV-  1342
             G   H  +FP+FAFGH++P+V L+NKL+  G +++F       ++    LN  P + +  
Sbjct  6     GQKFHAFMFPWFAFGHMTPYVHLANKLAEKGHRVTFL-LPKKANKQLEHLNLFPDSIVFH  64

Query  1341  PLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWL  1162
             P+ +P V+GLP G ++ +D P      L  A++L + Q++A +  L+P  ++FD A  W+
Sbjct  65    PITIPHVDGLPAGAETPSDIPVTLWRFLSTAMDLTRDQVEAAVRALRPDIILFDLAY-WI  123

Query  1161  PPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRT  982
               +A E GIK++ ++V  A + A   VP             E+  PPPG+P +S    R 
Sbjct  124   TEVAKEHGIKSMLYNVISATSIAHDLVPGG-----------ELGVPPPGYP-SSTLLFRR  171

Query  981   FEAR---DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKP  811
              +A     F + +KR        Y RV  GL  C  I  +TC E+E  + DY+  Q++K 
Sbjct  172   HDAHALLSFAVYYKR-------FYYRVTTGLTDCDFISIRTCEEIEGKFCDYIGRQYQKK  224

Query  810   LLLAGPVVPEP-ASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTG  634
             +LL GP++PEP  S  L+ KW +WLS FEP +V+YC+ GS+  L+ +Q +EL LGLELTG
Sbjct  225   VLLTGPMLPEPDKSKPLEDKWNNWLSGFEPGSVVYCALGSQITLEKNQFQELCLGLELTG  284

Query  633   LPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHA  454
             LPFF+ +  P     A  +  ALP GF ERVKGRG++   WVQQ  IL H SVGC+V H 
Sbjct  285   LPFFVAVTPPKG---AKTIQEALPEGFEERVKGRGVVWGEWVQQPLILAHPSVGCFVSHC  341

Query  453   GFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQ  274
             GF S+ E +++DCQ+V+LP   DQ LN +LL D+++  VEV  R++ G+F KE++  AV 
Sbjct  342   GFGSMWESLMSDCQIVLLPYLADQVLNTRLLTDELEVSVEVP-REKTGWFSKENLSVAVT  400

Query  273   TIM---GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             ++M    E G   R N  K KE ++   + + +  + V  + ++
Sbjct  401   SVMDKDSEIGNLVRRNHSKLKEVVVSPGLLTGYTDNFVVTLENL  444



>ref|XP_003634640.2| PREDICTED: UDP-glycosyltransferase 79B9-like [Vitis vinifera]
Length=457

 Score =   302 bits (773),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 186/459 (41%), Positives = 279/459 (61%), Gaps = 18/459 (4%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPC-TQIVPLA  1333
             LH+ +FP+FAFGH+ P++ LSN+L+  G KI+F        +++  LN +P      PL 
Sbjct  7     LHIAMFPWFAFGHMIPYLNLSNELAGRGHKITFILPRKAQSKLQH-LNFHPALITFHPLI  65

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P V+GLPPGT++ +D P +   LL  AL+  + Q++A L  L PH + +DFA  W P L
Sbjct  66    VPHVDGLPPGTETASDIPVSLTYLLATALDRTRDQVEAALRTLNPHLLFYDFAY-WAPAL  124

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKK-PPPGFPPTSVASLRTFE  976
             A++LGIK+I++S   A A A   +PA+    + S    ++   PPPG+P ++V  LR  E
Sbjct  125   ASQLGIKSIYYSAVCAAAVAHIPIPAQ----QGSKDCRQLTDVPPPGYPSSTVV-LRPHE  179

Query  975   ARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAG  796
             AR    +F  P+  G +   RV        AI  +TC E + P  DY+ SQ+ KP+ L G
Sbjct  180   ARLMDFMFA-PYGEGITFQQRVTTARARGDAISIRTCQETDGPICDYIGSQYGKPVFLTG  238

Query  795   PVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLV  616
             PV+P+P+   L+ +WA WL  F+P +VI+C+FGS+   + DQ +EL LGLELTGLPFF  
Sbjct  239   PVLPKPSVEPLEDRWAQWLGGFKPGSVIFCAFGSQNVHEKDQFQELLLGLELTGLPFFAA  298

Query  615   LNFPANVDVASELNRALPAGFTERVKGRGIIHSG-WVQQQQILVHSSVGCYVCHAGFSSV  439
             +     V   + +  ALP GF ERV GRG++H G WVQQ  +L H SVGC+V H G+ S+
Sbjct  299   VKPRTGV---ATIEEALPEGFQERVGGRGLVHGGWWVQQPSVLSHPSVGCFVSHCGYGSM  355

Query  438   IEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGE  259
              E + +D Q+V++P+  DQ LN++LLA+++K  VEV  R+E+G F KE +  A++++M E
Sbjct  356   WESLTSDPQIVLVPELADQILNSRLLAEELKVAVEVE-REENGLFSKESLCDAIKSVMDE  414

Query  258   E---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                 G   + N  KWKE L  +   S ++ + V  ++ +
Sbjct  415   NSEVGGLVKKNHAKWKEALTSQSFLSNYVDNFVGQLQGL  453



>gb|AFJ52977.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=471

 Score =   302 bits (773),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 178/476 (37%), Positives = 267/476 (56%), Gaps = 33/476 (7%)
 Frame = -3

Query  1533  TNNHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-  1357
             T     + L+V +FP FA GHI+PF+ L+N+L+  G +ISF      + ++ +++NS+  
Sbjct  4     TGGESNNQLNVAMFPLFAMGHITPFLHLANQLAARGHRISFLLPTRTIPKVTNLINSHAD  63

Query  1356  CTQIVPLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDF  1177
                  P+ +P V GLP G +  AD PP  A  +  A++  + Q  + L  + P  VIFD 
Sbjct  64    LVTFHPITVPHVAGLPQGAELIADVPPHLAAHIFAAMDATEDQFTSALRRVNPDIVIFD-  122

Query  1176  AQNWLPPLAAELGIKTIffsvfvalatafatVP-ARLPGPERSPTVEEMKKPPPGFPPTS  1000
             A  W+   A ELG   + +    A+  A   VP AR+    +  T EE+ + PPG+P ++
Sbjct  123   AAPWVSRAARELGCVPVSYGTSSAVWAAMRIVPSARIV---KEMTDEELGRTPPGYPSSA  179

Query  999   V-------ASLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYI  841
             V       A  R F AR+F         G +S+Y+R++A + G  A+  ++C E+E  Y+
Sbjct  180   VVPRRDEIAGARLF-AREF---------GSSSLYERIVAVIQGSEAMAMRSCRELEGKYL  229

Query  840   DYVKSQFKKPLLLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKE  661
             DY+  Q  K +LL GPV+P+P    LD+    WLS+FEP +V+YC+FGSE  L  DQ +E
Sbjct  230   DYLGEQHGKRVLLTGPVLPKPDGLGLDENLGSWLSKFEPGSVVYCAFGSEVVLHKDQFQE  289

Query  660   LALGLELTGLPFFLVLNFPANVDVASELNRALPAGFTERV---KGRGIIHSGWVQQQQIL  490
             L  GLE  G PF   L  P       E   ALP GF ERV    GRG++H GWVQQ QIL
Sbjct  290   LLRGLEQCGRPFLTALKPPHGCKTVEE---ALPEGFKERVIIKDGRGMVHEGWVQQPQIL  346

Query  489   VHSSVGCYVCHAGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDG  310
              H SVGC+V H GF S+ E +++DCQ++++P   +Q L    +  ++K  +EVN +DE+G
Sbjct  347   GHRSVGCFVSHCGFGSMWEALLSDCQILLVPNISEQILCTMFMVKELKVALEVN-KDENG  405

Query  309   YFWKEDIQKAVQTIMGEE---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             +  KE++ +AV  +M E+   G   R +  K +E L D  +  K++ D V  +R +
Sbjct  406   WISKEEVCRAVGAVMDEDSELGKEVRRHHLKLREVLGDDHLLDKYVDDFVAQLRTL  461



>ref|XP_003543300.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
 gb|KHN36712.1| UDP-glycosyltransferase 79B6 [Glycine soja]
Length=468

 Score =   301 bits (772),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 183/465 (39%), Positives = 273/465 (59%), Gaps = 20/465 (4%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             LH+ IFP+FA GH++P + LSNKL+  G +ISF        +++  LN +P     VP+ 
Sbjct  9     LHIAIFPWFAMGHLTPSLHLSNKLAQRGHRISFIGPKKTQTKLQH-LNLHPHLITFVPIK  67

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P V GLP   ++T+D P +   L+  A++  +  I+ LL ELKP  V FDF Q+WLP L
Sbjct  68    VPHVNGLPHDAETTSDVPFSLFPLIAEAMDRTEKDIEILLRELKPQIVFFDF-QHWLPNL  126

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVE----EMKKPPPGFPPTSVASLR  985
                LGIK++ + +   L+TA+        GP +S   E    ++  PP GFP + +   +
Sbjct  127   TRRLGIKSVMYVIINPLSTAYFAN-----GPRKSKGRELTELDLMVPPQGFPDSCI-KFQ  180

Query  984   TFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLL  805
               E R  V + K     G  +YDR     +   AI  K C E++ PY +Y+++ + KP+L
Sbjct  181   PHELRFLVGVRKLEFGSGVLLYDRYHTAASMADAIGFKGCKEIDGPYAEYLETVYGKPVL  240

Query  804   LAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPF  625
             L+GP++PEP +  L+ KW  WL +F P +V++C++GSE+ L  +Q++EL LGLELTG PF
Sbjct  241   LSGPLLPEPPNTTLEGKWVSWLGRFNPGSVVFCAYGSESRLPQNQLQELLLGLELTGFPF  300

Query  624   FLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFS  445
                L  P   +   E   ALP GF ERV+GRGI+  GWVQQQ IL H SVGC++ H G +
Sbjct  301   LAALKPPNGFESIEE---ALPEGFRERVQGRGIVDEGWVQQQLILGHPSVGCFITHCGAA  357

Query  444   SVIEGIVNDCQLVMLPQKG-DQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTI  268
             S+ E +VN C+LV LP  G DQ +N ++ +  ++ GVE+ + +EDG F KE + KAV+ +
Sbjct  358   SLTEALVNKCRLVFLPHLGADQLINCRMFSRKLRVGVEIEKGEEDGLFTKESVCKAVKIV  417

Query  267   M---GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMATM  142
             M    E G   R N  K + FLL   ++S+ +    K + D+  +
Sbjct  418   MDDGNEVGREVRENHSKLRNFLLSDNVESECVDGFCKGLHDLLNL  462



>gb|ADV71366.1| glycosyltransferase GT10J15 [Pueraria montana var. lobata]
Length=460

 Score =   301 bits (771),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 186/462 (40%), Positives = 271/462 (59%), Gaps = 20/462 (4%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             LH+ IFP+FA GH++P + LSNKL+  G KISF        +++  LN +P     VP+ 
Sbjct  9     LHIAIFPWFAMGHLTPTLHLSNKLAQRGHKISFIIPKTTQTKLQH-LNLHPHLITFVPIK  67

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P V+GLP   ++T+D P +   LL  AL+  +  I+ LL +LKP  V FDF Q+WLP L
Sbjct  68    VPHVDGLPHDAETTSDLPFSLFPLLATALDRTEKDIELLLRKLKPQIVFFDF-QHWLPNL  126

Query  1152  AAELGIKTIffsvfvalatafatVPARLPGPERSPTVE----EMKKPPPGFPPTSVASLR  985
                LGIK++ + +   L+ A+        GP +S   E    ++ +PP GFP  S     
Sbjct  127   TRSLGIKSVMYFITHPLSAAYLGN-----GPRKSQGRELTELDLMEPPQGFP-DSCFKFH  180

Query  984   TFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLL  805
               E R  V   K     G  +YDR+        AI  K C E++ PY +Y+++ + KP+L
Sbjct  181   AHELRFLVAARKLEFGSGVFLYDRLHTSTILADAIGFKGCKEIDGPYAEYLETVYGKPVL  240

Query  804   LAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPF  625
             L+GP++PEP +  L++KW  W  +F P +VI+C++GSE+ L  +Q +EL LGLELTG PF
Sbjct  241   LSGPLLPEPPNSTLEEKWVAWFGRFNPGSVIFCAYGSESPLPQNQFQELLLGLELTGFPF  300

Query  624   FLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFS  445
                L  P   +    +  ALP GF ERV+ RGI H GWVQQQ IL H S+GC++ H G +
Sbjct  301   LAALKPPNGFE---SIEDALPEGFGERVQERGIAHGGWVQQQLILGHPSIGCFITHCGAA  357

Query  444   SVIEGIVNDCQLVMLPQKG-DQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTI  268
             SV E +VN CQLV+LP+ G D  +NA++++  +K GVEV + +EDG F KE + KAV+ +
Sbjct  358   SVTEALVNKCQLVLLPRLGSDHIMNARMMSVKLKVGVEVEKGEEDGLFTKESVCKAVKIV  417

Query  267   M---GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             M    E G   R N  K + FLL   ++S  +    + ++D+
Sbjct  418   MDDGNEVGREVRENHAKLRNFLLSDNLESSCVDSFCQQLQDL  459



>ref|XP_002867497.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43756.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=460

 Score =   301 bits (770),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 171/463 (37%), Positives = 280/463 (60%), Gaps = 26/463 (6%)
 Frame = -3

Query  1521  GGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIV  1342
             GG   HV+++P+FA GH++PF+ L+NKL+  G  ++F      + +++  LN  P   + 
Sbjct  2     GGLRFHVLMYPWFATGHMTPFLYLANKLAEKGHMVTFLLPKKALKQLEH-LNLFPHNIVF  60

Query  1341  -PLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNW  1165
               + +P V+GLP GT++ ++ P  +A+LL  A++L + Q++ +L  ++P  + FDFA +W
Sbjct  61    RSVTIPHVDGLPVGTETVSEIPVTSADLLMSAMDLTRDQVEVVLRAVEPDLIFFDFA-HW  119

Query  1164  LPPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLR  985
             +P +A +LGIKT+ + V  A   A   VP             E+  PPPG+P + V  LR
Sbjct  120   IPQVARDLGIKTVKYVVVSASTIASMLVPGG-----------ELGVPPPGYPSSKVL-LR  167

Query  984   TFEARDFVIIFKRPH-NGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPL  808
               +A  + +    P  + G ++ +RV   L     I  +T  E+E  + DY++   +K +
Sbjct  168   KQDA--YTMKNLEPTIDAGPNLLERVTTSLMNSDVIAIRTVREIEGNFCDYIEKHCRKKV  225

Query  807   LLAGPVVPEP-ASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGL  631
             LL GP+ PEP  +  L+++W  WLS +EP +V++C+ G++  L+ DQ +EL LG+ELTG 
Sbjct  226   LLTGPMFPEPDKTRELEERWVKWLSGYEPDSVVFCALGTQVILEKDQFQELCLGMELTGS  285

Query  630   PFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAG  451
             PF + +  P     +S +  ALP GF ERVKGRG++  GWVQQ  IL H SVGC+V H G
Sbjct  286   PFLVAVKPPRG---SSTIEEALPEGFKERVKGRGVVWGGWVQQPLILSHPSVGCFVSHCG  342

Query  450   FSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQT  271
             F S+ E +++DCQ+V++PQ GDQ LN +L++D++K  VEV  R+E G+F KE ++ A+ +
Sbjct  343   FGSMWESLLSDCQIVLVPQLGDQVLNTRLMSDELKVSVEV-VREETGWFSKESLRDAINS  401

Query  270   IM---GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             +M    E G   + N  KW+E L    + S ++ + ++ ++D+
Sbjct  402   VMKRDSEIGNLVKKNHTKWRETLASPGLLSGYVDNFIESLQDL  444



>ref|XP_007021619.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY13144.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=505

 Score =   302 bits (774),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 173/516 (34%), Positives = 290/516 (56%), Gaps = 36/516 (7%)
 Frame = -3

Query  1683  SKANLSTTFLQIVQLINYKTWNVWYIYKGEELPGKSRVATGKSRIMEREITNNHGGDLLH  1504
             S++ ++++F+  + LIN   +         EL   +     K R        N     LH
Sbjct  19    SRSKIASSFVSYIMLINITCF---------ELSNTTHRLQAKMR--------NSNSSSLH  61

Query  1503  VVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLALPA  1324
             V +FP+FAFGH  P++ LSNKL+  G K+SF    G   +++ +       Q  PL +  
Sbjct  62    VAMFPWFAFGHFIPYLHLSNKLAEKGHKVSFLLPKGAQPKLEQLNQYPNLLQFFPLVVSH  121

Query  1323  VEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLAAE  1144
             V+G+PPG ++ +D P     LL +A +  + Q++A+L  +K   V  D   +W+P LA +
Sbjct  122   VDGMPPGAETASDVPQPLHSLLAIAFDQTRDQVEAILRAIKADVVFHDMG-HWIPALAHQ  180

Query  1143  LGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEARDF  964
             +GIK+I+++   A A A            +  TVEE+ + PPG+P + V     F+A + 
Sbjct  181   IGIKSIYYAAVSAAANAHLAKEV-----SKEMTVEELIEVPPGYPSSKV----RFKAEEA  231

Query  963   VIIFKRPH--NGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGPV  790
              I+   P     G S  DR++  +     I  +T  E+E P+ DY+   F KP++L GP 
Sbjct  232   AIVTILPEIFGIGLSFQDRIITAMKDSDVIAFRTYREIEGPFCDYIAQHFGKPVMLTGPS  291

Query  789   VPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVLN  610
             +PE  +  L+ KWA+WLS FEPS+V++CSFGS+  L+  + +EL LG EL+G PF + L 
Sbjct  292   LPETNATQLEDKWANWLSNFEPSSVVFCSFGSQIALQKGEFQELVLGFELSGQPFLVALT  351

Query  609   FPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIEG  430
              P   D    +  ALP GF ER++GRG+++ GWV Q+ +L HSSVGC+V H G+ ++ E 
Sbjct  352   PP---DGCITIEEALPEGFHERIQGRGLVYGGWVPQELLLSHSSVGCFVNHCGYGTMWES  408

Query  429   IVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIM---GE  259
             +++DCQ+V++P+ GDQ LN +L+ ++++      ++ E+    KE++ KA++ +M    E
Sbjct  409   LLSDCQIVLIPRLGDQILNTRLMVEELEV-AVEVQKGENREISKENLSKAIKMVMDKDNE  467

Query  258   EGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
                  + N  K K  L ++++Q ++I + ++ ++D+
Sbjct  468   IAGLLKRNHAKLKNILSNRDLQEEYINNFIEGLQDL  503



>ref|XP_007132949.1| hypothetical protein PHAVU_011G138600g [Phaseolus vulgaris]
 gb|ESW04943.1| hypothetical protein PHAVU_011G138600g [Phaseolus vulgaris]
Length=466

 Score =   301 bits (770),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 182/459 (40%), Positives = 264/459 (58%), Gaps = 12/459 (3%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVPLAL  1330
             LH+ IFP+ A GH++P + LSNKL+  G +ISF        ++  +         +P+ L
Sbjct  9     LHIAIFPWLAMGHLTPNLLLSNKLAERGHRISFIVPQRTQTKLHHLNLHPHLITFIPIKL  68

Query  1329  PAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPLA  1150
             P V GLP   ++T+D P +   LL  A++  Q  I+ LL +L P  V FDF Q+WLP L+
Sbjct  69    PHVHGLPHHAETTSDIPFSLFPLLATAMDRTQKDIELLLRDLNPQIVFFDF-QHWLPNLS  127

Query  1149  AELGIKTIffsvfv-alatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFEA  973
               LGIK++ + +     +      P R  G  R  T  ++ +PP GFP + +   +  E 
Sbjct  128   RSLGIKSVMYLMLHPLSSAYLVEEPRRSQG--RELTELDLMEPPLGFPDSCI-KFQLHEL  184

Query  972   RDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLAGP  793
             R  V I K     G  +YDR   G      I  K C E++ PY +Y+++ + KP+LL+GP
Sbjct  185   RFLVAIRKLEFGSGVLLYDRAYKGFRSADVIGFKGCREIDGPYAEYLQTVYGKPVLLSGP  244

Query  792   VVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLPFFLVL  613
             ++PEP +  L++KW  WL  F P +VI+C++GSE  L  +Q++EL LGLELTG PF   L
Sbjct  245   LLPEPPNTTLEEKWVSWLGGFNPGSVIFCAYGSENPLPQNQLQELLLGLELTGFPFLAAL  304

Query  612   NFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGFSSVIE  433
               P   D    +  ALP GF ERVKGRGI + GWVQQQ IL H SVGC++ H G +S+ E
Sbjct  305   KPP---DEFESIEEALPEGFEERVKGRGIAYGGWVQQQLILGHPSVGCFITHCGAASMTE  361

Query  432   GIVNDCQLVMLPQKG-DQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTIMGEE  256
              +VN C LV+LP+ G D  +NAK+L+  +K GV+V + +EDG F KE + KAVQT+M + 
Sbjct  362   ALVNKCGLVLLPRLGSDHIMNAKMLSMILKVGVQVEKGEEDGLFTKESVCKAVQTVMDDG  421

Query  255   GA---STRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMA  148
                    R N  K + FLL   ++S  +    + ++D+ 
Sbjct  422   NVVCREVRENHAKLRNFLLSDNLESSCVDRFCQQLQDIC  460



>gb|EYU19000.1| hypothetical protein MIMGU_mgv1a021196mg [Erythranthe guttata]
Length=464

 Score =   301 bits (770),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 185/461 (40%), Positives = 271/461 (59%), Gaps = 15/461 (3%)
 Frame = -3

Query  1527  NHGGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQ  1348
              +G  LLH+ +FP+   GH++ F+ L N+LS  G +ISF      + ++    + +   +
Sbjct  7     ENGHKLLHIAMFPWIGMGHVTTFLHLGNELSQRGHRISFLLPMKALVKLDHNHDHSHPIK  66

Query  1347  IVPLALPAVEGLPPGTQSTADFppaaaell--pvalnLMQPQIKALLVELKPHFVIFDFA  1174
                L +P V+GLPPG ++ +D      E     VA + M  Q++ALL  L P  V +DFA
Sbjct  67    FHILNVPHVDGLPPGAETCSDIDDNLTEKNPLAVAFDAMSEQVEALLRSLNPDIVFYDFA  126

Query  1173  QNWLPPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVA  994
              +W+P LAA +G KT+ ++   A   ++  VPAR    +R  T EE+ +PP G+P ++V 
Sbjct  127   -HWIPRLAAVIGFKTVCYNTVSASCMSYTVVPARRIPKDRMMTAEELAEPPEGYPSSTVV  185

Query  993   SLRTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKK  814
              LR  E    ++ F     G      R+   L GC AI  +TC EME P  +YV  Q+ K
Sbjct  186   -LRGQEG--LMMSFICEDYGDVKFDVRMSTALWGCDAIGVRTCSEMEGPMCEYVSRQYGK  242

Query  813   PLLLAGPVVPEPASGV-LDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELT  637
             P++L GPV+P     V L++KW  WLS+F+  +V+YC+FGS+T L+  Q +E+ LG E+T
Sbjct  243   PVILTGPVLPRVQEEVPLEEKWDTWLSKFDEKSVVYCAFGSQTILQKKQFQEMLLGFEMT  302

Query  636   GLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCH  457
             GLPF + ++ P   D   E   ALP GFTERV GRG++H GWVQQ QIL H SVGC+V H
Sbjct  303   GLPFIVAMSKPHGADTIEE---ALPEGFTERVGGRGVVHGGWVQQTQILNHPSVGCFVSH  359

Query  456   AGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAV  277
              GF S+ E +++D Q+V +PQ GDQ LNA+L+A ++K  VEV  R E G+F KED+  AV
Sbjct  360   CGFGSMCESLMSDAQIVAVPQFGDQVLNARLMAAELKVAVEV-ERGEMGWFSKEDLSNAV  418

Query  276   QTIMGEEGAS----TRANQEKWKEFLLDKEIQSKFIKDLVK  166
             ++ + + G+      R N  KWKE  +  +    +I   +K
Sbjct  419   KSSVMDVGSDVGEIVRENHAKWKETFVAPKFMDDYIDRFIK  459



>gb|AES66919.2| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=437

 Score =   300 bits (767),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 172/463 (37%), Positives = 263/463 (57%), Gaps = 46/463 (10%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVPLA  1333
             +H+ +FP+FA GH +P++  SNKL++ G KISFF     +++++  LN +P      P+ 
Sbjct  7     MHISMFPWFAMGHFTPYLHFSNKLAIRGHKISFFIPKNTLNKLQH-LNLHPNLITFFPIT  65

Query  1332  LPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPPL  1153
             +P V GLP   ++T+D P +   L+  A++    QI+ LL ELKP  V FDF Q WLP L
Sbjct  66    VPHVNGLPHNAETTSDVPFSLFPLIATAMDQTDKQIELLLKELKPQIVFFDF-QYWLPNL  124

Query  1152  AAELGIKTIffsvfvalatafatVPARLPG-PERSP----TVEEMKKPPPGFPPTSVASL  988
               +LGIK++ + ++  ++      PA L   P +S     T +++KKPP GFP +S+   
Sbjct  125   TQKLGIKSLQYLIWSPIS------PAYLGSIPRKSQGTYLTEDDLKKPPTGFPDSSI-KF  177

Query  987   RTFEARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPL  808
              + E R      K+    G  +YDRV  G     A+  K C E++  Y DY+++ F KP+
Sbjct  178   HSHELRFLASTRKQEFGSGVLLYDRVDTGTKFSDAVSFKGCREIDGLYADYLETVFGKPV  237

Query  807   LLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLP  628
             LL+GP++PE     L++KW  WL  F+  +V++C++GSE                     
Sbjct  238   LLSGPLLPEAPKSTLEEKWLTWLEGFKHGSVVFCAYGSE---------------------  276

Query  627   FFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGF  448
                 L  P   D   E   ALP GF ERV G+GI++  W+QQQ IL H SVGC++ H G 
Sbjct  277   ---ALKPPIGFDSIEE---ALPEGFNERVNGKGIVYGNWIQQQLILEHPSVGCFITHCGA  330

Query  447   SSVIEGIVNDCQLVMLPQKG-DQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQT  271
             +S+ EG+VN CQLV+LP+ G D  +NA++++  +K GVEV + +EDG F KE + KAV+ 
Sbjct  331   ASITEGLVNTCQLVLLPRAGTDHIMNARMMSSKLKVGVEVEKGEEDGLFTKESVCKAVKI  390

Query  270   IMGEE---GASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             +M +E   G + RAN  K + FLL   ++S  +    + + D+
Sbjct  391   VMDDENEVGKAVRANHAKMRNFLLSSNLESSCVDSFCQKLYDL  433



>ref|NP_194487.1| UDP-glycosyltransferase 79B3 [Arabidopsis thaliana]
 sp|Q9T081.1|U79B3_ARATH RecName: Full=UDP-glycosyltransferase 79B3 [Arabidopsis thaliana]
 emb|CAB38269.1| UDP rhamnose--anthocyanidin-3-glucoside rhamnosyltransferase-like 
protein [Arabidopsis thaliana]
 emb|CAB81407.1| UDP rhamnose--anthocyanidin-3-glucoside rhamnosyltransferase-like 
protein [Arabidopsis thaliana]
 dbj|BAC43080.1| putative UDP rhamnose--anthocyanidin-3-glucoside rhamnosyltransferase 
[Arabidopsis thaliana]
 gb|AAO63434.1| At4g27570 [Arabidopsis thaliana]
 gb|AEE85358.1| UDP-glycosyltransferase 79B3 [Arabidopsis thaliana]
 gb|AHL38673.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=453

 Score =   299 bits (766),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 172/467 (37%), Positives = 278/467 (60%), Gaps = 28/467 (6%)
 Frame = -3

Query  1521  GGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIV  1342
             GG   HV+++P+FA GH++PF+ L+NKL+  G  ++F     ++ +++   N  P   + 
Sbjct  2     GGLKFHVLMYPWFATGHMTPFLFLANKLAEKGHTVTFLLPKKSLKQLEH-FNLFPHNIVF  60

Query  1341  -PLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNW  1165
               + +P V+GLP GT++ ++ P  + +LL  A++L + Q++A++  ++P  + FDFA +W
Sbjct  61    RSVTVPHVDGLPVGTETASEIPVTSTDLLMSAMDLTRDQVEAVVRAVEPDLIFFDFA-HW  119

Query  1164  LPPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLR  985
             +P +A + G+KT+ + V  A   A   VP             E+  PPPG+P + V  LR
Sbjct  120   IPEVARDFGLKTVKYVVVSASTIASMLVPGG-----------ELGVPPPGYPSSKVL-LR  167

Query  984   TFEARDFVIIFKRPHNG---GASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKK  814
               +A  + +    P N    G ++ +RV   L     I  +T  E+E  + DY++   +K
Sbjct  168   KQDA--YTMKKLEPTNTIDVGPNLLERVTTSLMNSDVIAIRTAREIEGNFCDYIEKHCRK  225

Query  813   PLLLAGPVVPEP-ASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELT  637
              +LL GPV PEP  +  L+++W  WLS +EP +V++C+ GS+  L+ DQ +EL LG+ELT
Sbjct  226   KVLLTGPVFPEPDKTRELEERWVKWLSGYEPDSVVFCALGSQVILEKDQFQELCLGMELT  285

Query  636   GLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCH  457
             G PF + +  P     +S +  ALP GF ERVKGRG++  GWVQQ  IL H SVGC+V H
Sbjct  286   GSPFLVAVKPPRG---SSTIQEALPEGFEERVKGRGLVWGGWVQQPLILSHPSVGCFVSH  342

Query  456   AGFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAV  277
              GF S+ E +++DCQ+V++PQ GDQ LN +LL+D++K  VEV  R+E G+F KE +  AV
Sbjct  343   CGFGSMWESLLSDCQIVLVPQLGDQVLNTRLLSDELKVSVEVA-REETGWFSKESLCDAV  401

Query  276   QTIM---GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMAT  145
              ++M    E G   R N  KW+E +    + + ++   V+ ++D+ +
Sbjct  402   NSVMKRDSELGNLVRKNHTKWRETVASPGLMTGYVDAFVESLQDLVS  448



>ref|NP_189604.1| UDP-glycosyltransferase 79B4 [Arabidopsis thaliana]
 sp|Q9LJA6.1|U79B4_ARATH RecName: Full=UDP-glycosyltransferase 79B4 [Arabidopsis thaliana]
 dbj|BAB01199.1| UDP-glycose: flavonoid glucosyltransferase-like protein [Arabidopsis 
thaliana]
 gb|AEE77593.1| UDP-glycosyltransferase 79B4 [Arabidopsis thaliana]
Length=448

 Score =   298 bits (764),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 169/461 (37%), Positives = 266/461 (58%), Gaps = 26/461 (6%)
 Frame = -3

Query  1518  GDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVP  1339
             G   H  ++P+F FGH+ P++ L+NKL+  G +++F +      +++ +           
Sbjct  2     GSKFHAFLYPWFGFGHMIPYLHLANKLAEKGHRVTFLAPKKAQKQLEPLNLFPNSIHFEN  61

Query  1338  LALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLP  1159
             + LP V+GLP G ++TAD P ++  +L  A++L++ QI+  +  LKP  + FDF  +W+P
Sbjct  62    VTLPHVDGLPVGAETTADLPNSSKRVLADAMDLLREQIEVKIRSLKPDLIFFDFV-DWIP  120

Query  1158  PLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTF  979
              +A ELGIK++ + +  A   A    P             E+  PPPGFP + VA LR  
Sbjct  121   QMAKELGIKSVSYQIISAAFIAMFFAPR-----------AELGSPPPGFPSSKVA-LRGH  168

Query  978   EARDFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLLLA  799
             +A     I+    N    ++DRV  GL  C  I  +TC E+E    D+++ Q ++ +LL 
Sbjct  169   DAN----IYSLFANTRKFLFDRVTTGLKNCDVIAIRTCAEIEGNLCDFIERQCQRKVLLT  224

Query  798   GPVV--PEPASGV-LDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLP  628
             GP+   P+  SG  L+ +W +WL+ FEPS+V+YC+FG+  F + DQ +EL LG+ELTGLP
Sbjct  225   GPMFLDPQGKSGKPLEDRWNNWLNGFEPSSVVYCAFGTHFFFEIDQFQELCLGMELTGLP  284

Query  627   FFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGF  448
             F + +  P     +S +  ALP GF ER+KGRGI+  GWV+Q  IL H S+GC+V H GF
Sbjct  285   FLVAVMPPRG---SSTIQEALPEGFEERIKGRGIVWGGWVEQPLILSHPSIGCFVNHCGF  341

Query  447   SSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTI  268
              S+ E +V+DCQ+V +PQ  DQ L  +LL ++++  V+V R +  G+F KE ++  V+++
Sbjct  342   GSMWESLVSDCQIVFIPQLVDQVLTTRLLTEELEVSVKVKRDEITGWFSKESLRDTVKSV  401

Query  267   M---GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRD  154
             M    E G   R N +K KE L+   + S +    V  + +
Sbjct  402   MDKNSEIGNLVRRNHKKLKETLVSPGLLSSYADKFVDELEN  442



>ref|XP_002866011.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42270.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=447

 Score =   298 bits (764),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 170/465 (37%), Positives = 264/465 (57%), Gaps = 31/465 (7%)
 Frame = -3

Query  1518  GDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIVP  1339
             G   H  +FP+FA+GH++P++ L+NKL+  G +++F        +++            P
Sbjct  2     GQKFHAFMFPWFAYGHMTPYLHLANKLAEKGHRVTFLLPKKAQKQLEHHNLFPDSIVFYP  61

Query  1338  LALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLP  1159
             L +P V+GLP G ++ +D P +  + L  A++L + Q++A +  LKP  + FDFA  W+P
Sbjct  62    LTIPHVDGLPDGAETASDIPISLGKFLTAAMDLTRDQVEAAVRALKPDLIFFDFAY-WVP  120

Query  1158  PLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTF  979
              +A E  +K++ + V  A + A   VP             E+  PPPG+P T V   R  
Sbjct  121   EMAREHNVKSVLYFVVSANSIAHELVPGG-----------ELGVPPPGYPSTKVL-YRGH  168

Query  978   EAR---DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPL  808
             +A     F I ++R H        R+  GL  C  I  +TC E+E  + DY++ Q+++ +
Sbjct  169   DAHALLTFAIFYERLHY-------RITTGLKNCDFISIRTCKEVEGKFCDYIEKQYQRKV  221

Query  807   LLAGPVVPEP-ASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGL  631
             LL GP++PEP  S  L+ +W  WL+ FEP +VIYC+ GS+  L+ DQ +EL LG+ELTGL
Sbjct  222   LLTGPMLPEPDNSRPLEDRWDHWLNHFEPGSVIYCALGSQITLEKDQFQELCLGMELTGL  281

Query  630   PFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAG  451
             PF + +  P     A  +  ALP GF ERVK  G++   WVQQ  IL H SVGC+V H G
Sbjct  282   PFLVAVKPPKG---AKTIQEALPEGFAERVKNHGVVWGEWVQQPLILAHPSVGCFVNHCG  338

Query  450   FSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQT  271
             F S+ E +V+DCQ+V+LP   DQ LN +L++++++  VEV +R+E G+F KE +  A+  
Sbjct  339   FGSMWESLVSDCQIVLLPYLCDQVLNTRLMSEELEVSVEV-KREETGWFSKESLCVAITL  397

Query  270   IM---GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMAT  145
             +M    E G   R N  K KE L+   + + +    V+ ++D+  
Sbjct  398   VMDKDSELGNLVRTNHAKLKEVLVSHGLLTDYTDKFVETLQDLVN  442



>ref|XP_011096374.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Sesamum indicum]
Length=461

 Score =   298 bits (764),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 178/456 (39%), Positives = 272/456 (60%), Gaps = 24/456 (5%)
 Frame = -3

Query  1515  DLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNP-CTQIVP  1339
             D L ++++P FA GH++P++  +NKL+  G K+       +  +++  LN +P   Q  P
Sbjct  16    DSLTILMYPLFAMGHLTPYLLTANKLAQRGHKVFIVVPPKSQSKLRP-LNLHPDLIQFKP  74

Query  1338  LALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLP  1159
             +++P VEGLPP  ++TAD      +LL  AL+L QP I+++L +L+PHFV FDF  +WLP
Sbjct  75    ISIPRVEGLPPDVETTADITIMEHDLLLHALDLTQPAIESMLSDLQPHFVFFDF-MHWLP  133

Query  1158  PLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTF  979
              LA  L IK++++S     A  F             P VE++   PPGFP      +R +
Sbjct  134   GLARSLKIKSVYYSPASPAAVGFLFA--------EGPFVEDLMNGPPGFP----TRIRLY  181

Query  978   EARDFVIIFKRPHNG---GASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPL  808
             +     +++     G   G ++  R +AG+    AI   TC E E  Y  +++++F KP+
Sbjct  182   KHAALQLMWFNAAKGRGSGITLRQRFMAGMWESDAIGFATCEETEGIYCQFLENKFDKPI  241

Query  807   LLAGPVVPEPASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLP  628
             LLAGP V +     L++KWA WL +F+P +V++C+FGSE  L+ DQ ++L LGLELTGLP
Sbjct  242   LLAGPTVQKIQISSLEEKWATWLGKFKPKSVVFCAFGSEAVLEKDQFEQLLLGLELTGLP  301

Query  627   FFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGF  448
             F   L  P+ VD   E   ALP GF ER   RG+++ GWV Q  IL H  VGC+V H G+
Sbjct  302   FLAALKPPSGVDSVEE---ALPNGFKERSGERGVVYGGWVPQPLILNHPCVGCFVTHCGY  358

Query  447   SSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTI  268
              S  EG++++CQLV+L Q+GDQ+++AKLL+ D+  GVE+ + DEDG F +E +  A+   
Sbjct  359   GSSWEGLMSECQLVLLSQQGDQYVDAKLLSGDLGVGVEIEKGDEDGRFTREAVSGAIMGA  418

Query  267   MGEE---GASTRANQEKWKEFLLDKEIQSKFIKDLV  169
             MG++   G   RA  ++W+E L  +  Q  ++ + V
Sbjct  419   MGDQSEVGKRVRAKHDEWRELLFGEGFQDSYLDNFV  454



>emb|CDY65923.1| BnaCnng49110D [Brassica napus]
Length=448

 Score =   298 bits (762),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 174/462 (38%), Positives = 261/462 (56%), Gaps = 34/462 (7%)
 Frame = -3

Query  1509  LHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFF--SAAGNVDRIKSMLNSNPCTQIVPL  1336
              H  +FP+FAFGH+ P++ L+NKL+  G +++F     A       S+   N      PL
Sbjct  5     FHAFMFPWFAFGHMIPYLHLANKLAEKGHRVTFLLPKKAQKQLEYHSLFPDNILFH--PL  62

Query  1335  ALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWLPP  1156
              +P V+GLP G ++ +D   +    L  A++L + Q+ A +  L+P  ++FDFA  W+P 
Sbjct  63    TIPPVDGLPAGAETASDISISWGNFLFAAMDLTRDQVTATVHALRPDLILFDFAY-WVPE  121

Query  1155  LAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRTFE  976
             +A E  +K++ ++V  A   A   VP             E+  PPPG+P   V   R  +
Sbjct  122   MAKEHRVKSVVYNVVSATTIAHNQVPG-----------SELGVPPPGYPSAKVV-YRAHD  169

Query  975   AR---DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKPLL  805
             A       I ++R        Y RV  GL  C  I  +TC E+E  + DY+  Q++K +L
Sbjct  170   AHALSSLSIYYER------LFYYRVTTGLTNCDFISIRTCEEIEGKFCDYIGRQYQKKVL  223

Query  804   LAGPVVPEP-ASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTGLP  628
             L GP++PEP  S  L+ KW +WLS+FEP +V+YC+ GS+  L+ DQ +EL LGLELTGLP
Sbjct  224   LTGPMLPEPDKSKPLEDKWNNWLSRFEPGSVVYCALGSQITLEKDQFQELCLGLELTGLP  283

Query  627   FFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHAGF  448
             FF+ +  P     A  +  ALP GF E VKGRG++   WVQQ  IL H SVGC+V H GF
Sbjct  284   FFVAVTPPKG---AKTIQEALPEGFEEGVKGRGVVWGEWVQQPLILAHPSVGCFVSHCGF  340

Query  447   SSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQTI  268
              S+ E +++DCQ+V+LP   DQ LN +LL D+++  VEV  R++ G+F KE++  AV ++
Sbjct  341   GSMWESLMSDCQIVLLPYLADQVLNTRLLTDELEVSVEVP-REKTGWFSKENLSAAVTSV  399

Query  267   M---GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDM  151
             M    E G   R N  K KE ++   + + +  + V  + ++
Sbjct  400   MDKDSEIGNLVRRNHSKLKEVVVSPGLLTGYTDNFVVTLENL  441



>ref|XP_010448113.1| PREDICTED: UDP-glycosyltransferase 79B3-like isoform X1 [Camelina 
sativa]
 ref|XP_010448114.1| PREDICTED: UDP-glycosyltransferase 79B3-like isoform X1 [Camelina 
sativa]
 ref|XP_010448115.1| PREDICTED: UDP-glycosyltransferase 79B3-like isoform X2 [Camelina 
sativa]
 ref|XP_010448116.1| PREDICTED: UDP-glycosyltransferase 79B3-like isoform X3 [Camelina 
sativa]
Length=453

 Score =   298 bits (763),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 170/469 (36%), Positives = 276/469 (59%), Gaps = 32/469 (7%)
 Frame = -3

Query  1521  GGDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIV  1342
             G    H +++P+FA GHI+PF+ L+NKL+  G  ++F      + +++  LN  P   + 
Sbjct  2     GSSRFHALMYPWFAAGHITPFLYLANKLAEKGHMVTFLLPKKALKQLEH-LNLFPHNIVF  60

Query  1341  P-LALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNW  1165
               + +P V+GLP GT++ ++ P +   LL  A++L + Q++A++  ++P  + FDFA +W
Sbjct  61    RFVTVPHVDGLPIGTETASEIPVSTNNLLMSAMDLTRDQVEAVVRAVEPDLIFFDFA-HW  119

Query  1164  LPPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLR  985
             +P +A + G+KT+ + V  A   A   VP             E+  PPPG+P + V  LR
Sbjct  120   IPEVARDFGLKTVKYVVVSASTVASILVPGG-----------ELGVPPPGYPSSKVL-LR  167

Query  984   TFEARDFVIIFKRPH---NGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKK  814
               +        K P+   + G + Y+RV   L  C AI  +T  E+E    DY++   +K
Sbjct  168   KQDG----YTMKNPNPTIDVGPNFYERVTTSLMNCDAIAIRTVREIEGDLCDYIEKHSRK  223

Query  813   PLLLAGPVVPEPASGV-LDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELT  637
              +L+ GPV PEP   + L+++W  WLS FEP +V++C+ GS+  L+ DQ +EL LG+ELT
Sbjct  224   KVLVTGPVFPEPDKTIQLEERWVKWLSGFEPDSVVFCALGSQIILEKDQFQELCLGMELT  283

Query  636   GLPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCH  457
             G PF +V+  P     +S +  ALP GF ER+KGRG++  GWVQQ  IL H SVGC+V H
Sbjct  284   GSPFLVVVKPPRG---SSTVQEALPEGFEERIKGRGVVWEGWVQQPLILSHPSVGCFVSH  340

Query  456   AGFSSVIEGIVNDCQLVMLPQK--GDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQK  283
              GF S+ E +++DCQ+V++PQ   GD   NA+L+ D++K  VEV  R+E G+F KE ++ 
Sbjct  341   CGFGSMWESLLSDCQIVLVPQAQLGDHIRNARLMTDELKVSVEV-VREETGWFSKESLRD  399

Query  282   AVQTIM---GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMAT  145
             A+ ++M    E G   + N  KW+E L    + + ++ + ++ ++D+ +
Sbjct  400   AINSVMKSDSEIGNLVKKNHTKWREPLASPGLMTGYVDNFIESLKDLVS  448



>ref|XP_010446317.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Camelina sativa]
Length=447

 Score =   298 bits (762),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 168/466 (36%), Positives = 276/466 (59%), Gaps = 33/466 (7%)
 Frame = -3

Query  1518  GDLLHVVIFPFFAFGHISPFVQLSNKLSVHGVKISFFSAAGNVDRIKSMLNSNPCTQIV-  1342
             G   H V+FP+FAFGH++P++ L+NKL+ +G +++F        +++   N  P + +  
Sbjct  2     GKKFHAVMFPWFAFGHMTPYLHLANKLAENGHRVTFLLPKKAQKQLEHQ-NMFPDSIVFH  60

Query  1341  PLALPAVEGLPPGTQSTADFppaaaellpvalnLMQPQIKALLVELKPHFVIFDFAQNWL  1162
             PL +P V+GLP G ++ +D P +  + L  A++L + Q++A + +L+P  + FD+A  W+
Sbjct  61    PLTIPHVDGLPAGAETASDIPISLGKFLTAAMDLTRDQVEAAVRDLRPDLIFFDYAY-WV  119

Query  1161  PPLAAELGIKTIffsvfvalatafatVPARLPGPERSPTVEEMKKPPPGFPPTSVASLRT  982
               +A E  +K++ + V  A + A   VP             ++  PPPG+P + V   R 
Sbjct  120   AEMAKEHRVKSVMYFVISANSIAHEHVPGG-----------KLGVPPPGYPSSKVL-YRE  167

Query  981   FEAR---DFVIIFKRPHNGGASVYDRVLAGLNGCSAILAKTCYEMEAPYIDYVKSQFKKP  811
              +A     + I ++R       +Y R+  GL  C  I  +TC E+E  + DY++SQ+++ 
Sbjct  168   HDAHALLSYSIYYER-------MYHRITTGLMNCDFISIRTCKEVEGKFCDYIESQYQRK  220

Query  810   LLLAGPVVPEP-ASGVLDQKWADWLSQFEPSTVIYCSFGSETFLKDDQIKELALGLELTG  634
             + L GP++P+P  S  L+ +W+ WLS+FE  +VIYC+ GS+ +L+ +Q +EL LG+ELTG
Sbjct  221   VFLTGPMLPDPDNSKELEDRWSHWLSRFETGSVIYCALGSQIYLEKNQFQELCLGMELTG  280

Query  633   LPFFLVLNFPANVDVASELNRALPAGFTERVKGRGIIHSGWVQQQQILVHSSVGCYVCHA  454
             LPF + +  P  V+   E   ALP GF ERVK RG++   WVQQ  IL H SVGC+V H 
Sbjct  281   LPFLVAVKPPKGVETIQE---ALPEGFEERVKNRGVVWGEWVQQPLILAHPSVGCFVNHC  337

Query  453   GFSSVIEGIVNDCQLVMLPQKGDQFLNAKLLADDMKAGVEVNRRDEDGYFWKEDIQKAVQ  274
             GF S+ E +V+DCQ+V+LP   DQ LN +L+ ++++  VEV +R+E G+F KE +  A+ 
Sbjct  338   GFGSMWESLVSDCQIVLLPYLCDQVLNTRLMTEELEVSVEV-QREETGWFAKESLSVAIT  396

Query  273   TIM---GEEGASTRANQEKWKEFLLDKEIQSKFIKDLVKVMRDMAT  145
             ++M    E G   R N  K KE L+   + + +    V+ ++++A 
Sbjct  397   SVMDKDSEVGNRVRRNHAKKKEILVSPGLLTGYTDKFVETLQNLAN  442



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4956472883014