BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25646_g4_i1 len=545 path=[4971:0-86 21674:87-209 1408:210-350
1549:351-510 1709:511-544]

Length=545
                                                                      Score     E

ref|XP_010317101.1|  PREDICTED: probable pectate lyase P59              187   4e-54   
ref|XP_006357122.1|  PREDICTED: probable pectate lyase P59-like         186   8e-53   
ref|XP_009789921.1|  PREDICTED: probable pectate lyase P59              184   3e-52   
ref|XP_009587689.1|  PREDICTED: probable pectate lyase P59              182   2e-51   
gb|AAB69766.1|  putative pectate lyase Nt59                             173   6e-51   Nicotiana tabacum [American tobacco]
ref|XP_009779191.1|  PREDICTED: probable pectate lyase P59              177   1e-49   
ref|XP_009802165.1|  PREDICTED: probable pectate lyase P59              177   2e-49   
ref|XP_009617495.1|  PREDICTED: probable pectate lyase P59              176   3e-49   
ref|XP_009599826.1|  PREDICTED: probable pectate lyase P59 isofor...    174   1e-48   
ref|XP_009599825.1|  PREDICTED: probable pectate lyase P59 isofor...    174   1e-48   
ref|XP_004234779.1|  PREDICTED: probable pectate lyase P59              172   6e-48   
ref|XP_006361835.1|  PREDICTED: probable pectate lyase P59-like         171   2e-47   
sp|P15722.1|PLY59_SOLLC  RecName: Full=Probable pectate lyase P59...    171   2e-47   Solanum lycopersicum
ref|XP_006338480.1|  PREDICTED: probable pectate lyase P59-like         170   5e-47   
ref|XP_004232242.1|  PREDICTED: probable pectate lyase P59              169   1e-46   
emb|CDP02198.1|  unnamed protein product                                167   7e-46   
gb|EPS66620.1|  hypothetical protein M569_08154                         161   1e-43   
ref|XP_011098575.1|  PREDICTED: probable pectate lyase P59              152   3e-40   
ref|XP_004147462.1|  PREDICTED: probable pectate lyase 7-like           151   4e-40   
gb|KGN59593.1|  hypothetical protein Csa_3G827350                       151   4e-40   
gb|EYU36839.1|  hypothetical protein MIMGU_mgv1a006379mg                151   5e-40   
gb|KHG20840.1|  Pectate lyase                                           142   9e-40   
gb|EYU34111.1|  hypothetical protein MIMGU_mgv1a006386mg                150   9e-40   
ref|XP_008443432.1|  PREDICTED: probable pectate lyase 19               150   1e-39   
emb|CBI15265.3|  unnamed protein product                                149   1e-39   
emb|CAN77957.1|  hypothetical protein VITISV_021245                     149   3e-39   Vitis vinifera
ref|XP_002272638.2|  PREDICTED: pectate lyase-like                      149   3e-39   Vitis vinifera
gb|KHG27438.1|  Pectate lyase                                           138   5e-38   
ref|XP_002282500.3|  PREDICTED: pectate lyase                           145   7e-38   Vitis vinifera
emb|CAN79927.1|  hypothetical protein VITISV_042447                     145   7e-38   Vitis vinifera
ref|XP_010242445.1|  PREDICTED: pectate lyase                           145   1e-37   
gb|EAZ35814.1|  hypothetical protein OsJ_20107                          139   1e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010033216.1|  PREDICTED: pectate lyase-like                      145   1e-37   
emb|CBI22159.3|  unnamed protein product                                145   1e-37   
ref|XP_010112093.1|  putative pectate lyase 7                           145   1e-37   
ref|XP_003552513.1|  PREDICTED: pectate lyase-like                      145   1e-37   
ref|XP_007153840.1|  hypothetical protein PHAVU_003G069100g             145   1e-37   
gb|KCW52797.1|  hypothetical protein EUGRSUZ_J02132                     145   1e-37   
ref|XP_008341537.1|  PREDICTED: pectate lyase-like                      145   2e-37   
gb|KHN13652.1|  Pectate lyase                                           144   2e-37   
ref|XP_009342871.1|  PREDICTED: pectate lyase-like                      144   3e-37   
ref|XP_010528323.1|  PREDICTED: probable pectate lyase 19               144   3e-37   
ref|XP_002517472.1|  pectate lyase, putative                            143   4e-37   Ricinus communis
ref|XP_002306040.1|  hypothetical protein POPTR_0004s12300g             143   5e-37   Populus trichocarpa [western balsam poplar]
ref|XP_011009454.1|  PREDICTED: pectate lyase-like                      143   5e-37   
ref|XP_010066949.1|  PREDICTED: pectate lyase                           142   7e-37   
ref|XP_009131435.1|  PREDICTED: probable pectate lyase 19               143   8e-37   
ref|XP_008357758.1|  PREDICTED: pectate lyase-like                      143   8e-37   
ref|XP_008339935.1|  PREDICTED: probable pectate lyase 3                142   9e-37   
ref|XP_002323835.1|  hypothetical protein POPTR_0017s11450g             142   9e-37   Populus trichocarpa [western balsam poplar]
ref|XP_008365507.1|  PREDICTED: pectate lyase-like                      142   9e-37   
ref|XP_008446067.1|  PREDICTED: pectate lyase-like                      141   9e-37   
ref|XP_004302354.1|  PREDICTED: probable pectate lyase P59-like         142   1e-36   
ref|XP_011005067.1|  PREDICTED: probable pectate lyase P59              142   2e-36   
ref|XP_011098576.1|  PREDICTED: probable pectate lyase P56              141   2e-36   
ref|XP_009360393.1|  PREDICTED: probable pectate lyase 3                141   2e-36   
ref|XP_010068708.1|  PREDICTED: pectate lyase-like                      141   3e-36   
ref|XP_007137422.1|  hypothetical protein PHAVU_009G125800g             140   4e-36   
emb|CDX70590.1|  BnaC03g06740D                                          141   4e-36   
ref|XP_008339934.1|  PREDICTED: probable pectate lyase 3                140   4e-36   
ref|NP_001057945.1|  Os06g0583900                                       140   4e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008366366.1|  PREDICTED: pectate lyase-like                      141   5e-36   
ref|NP_001056786.1|  Os06g0145100                                       139   6e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010105747.1|  putative pectate lyase P59                         140   7e-36   
ref|XP_010256490.1|  PREDICTED: pectate lyase-like                      139   9e-36   
dbj|BAD68402.1|  putative pectate lyase homolog                         139   1e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004165454.1|  PREDICTED: pectate lyase-like                      139   1e-35   
ref|XP_002311599.2|  pectate lyase family protein                       139   1e-35   Populus trichocarpa [western balsam poplar]
ref|NP_001056781.1|  Os06g0144200                                       139   1e-35   Oryza sativa Japonica Group [Japonica rice]
gb|EAY99626.1|  hypothetical protein OsI_21605                          139   1e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_010915114.1|  PREDICTED: LOW QUALITY PROTEIN: pectate lyas...    139   2e-35   
ref|XP_010678579.1|  PREDICTED: pectate lyase-like                      139   2e-35   
ref|XP_011025954.1|  PREDICTED: probable pectate lyase P59              139   2e-35   
ref|XP_009403112.1|  PREDICTED: pectate lyase-like                      139   2e-35   
gb|KHG08946.1|  Pectate lyase                                           138   2e-35   
ref|XP_009125036.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    139   3e-35   
ref|XP_007209148.1|  hypothetical protein PRUPE_ppa005859mg             138   3e-35   
ref|XP_010096345.1|  putative pectate lyase 7                           138   3e-35   
ref|XP_008239834.1|  PREDICTED: pectate lyase-like                      138   3e-35   
ref|XP_011013803.1|  PREDICTED: pectate lyase-like                      137   4e-35   
dbj|BAD95093.1|  pectate lyase like protein                             132   4e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007151201.1|  hypothetical protein PHAVU_004G026400g             138   4e-35   
emb|CDY28691.1|  BnaCnng05770D                                          138   5e-35   
ref|XP_007139601.1|  hypothetical protein PHAVU_008G043600g             137   6e-35   
ref|XP_002520133.1|  Pectate lyase precursor, putative                  137   6e-35   Ricinus communis
ref|XP_002270089.1|  PREDICTED: pectate lyase                           137   7e-35   Vitis vinifera
ref|XP_010492335.1|  PREDICTED: probable pectate lyase 19               137   8e-35   
ref|XP_004489168.1|  PREDICTED: pectate lyase-like                      137   9e-35   
ref|XP_003543726.1|  PREDICTED: pectate lyase                           137   1e-34   
gb|ACU23277.1|  unknown                                                 137   1e-34   Glycine max [soybeans]
gb|KHN13240.1|  Putative pectate lyase 3                                137   1e-34   
ref|XP_010550068.1|  PREDICTED: probable pectate lyase 19               137   1e-34   
ref|XP_010925369.1|  PREDICTED: pectate lyase                           136   1e-34   
dbj|BAJ99909.1|  predicted protein                                      134   1e-34   
emb|CDX74293.1|  BnaA03g27540D                                          137   1e-34   
ref|XP_007037229.1|  Pectate lyase family protein                       136   1e-34   
emb|CDX91953.1|  BnaC03g32550D                                          137   1e-34   
ref|XP_006656188.1|  PREDICTED: pectate lyase-like                      136   2e-34   
ref|XP_007227702.1|  hypothetical protein PRUPE_ppa005744mg             136   2e-34   
ref|XP_010417138.1|  PREDICTED: probable pectate lyase 7                130   2e-34   
ref|XP_008221658.1|  PREDICTED: pectate lyase-like                      136   2e-34   
ref|XP_007032453.1|  Pectate lyase family protein                       136   2e-34   
ref|XP_006655782.1|  PREDICTED: pectate lyase-like                      135   2e-34   
ref|XP_009134622.1|  PREDICTED: probable pectate lyase 7                136   2e-34   
ref|XP_004489374.1|  PREDICTED: pectate lyase-like                      135   3e-34   
ref|XP_004155392.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    135   3e-34   
ref|XP_006374492.1|  hypothetical protein POPTR_0015s07590g             135   3e-34   
ref|XP_006842121.1|  hypothetical protein AMTR_s00078p00106380          135   3e-34   
ref|XP_004135462.1|  PREDICTED: probable pectate lyase P59-like         135   3e-34   
ref|XP_007046218.1|  Pectate lyase family protein, putative             135   3e-34   
ref|XP_008793504.1|  PREDICTED: pectate lyase-like                      135   3e-34   
dbj|BAK05605.1|  predicted protein                                      135   4e-34   
ref|XP_007224275.1|  hypothetical protein PRUPE_ppa019055mg             135   4e-34   
ref|XP_008446316.1|  PREDICTED: probable pectate lyase P59              135   4e-34   
ref|XP_003563707.1|  PREDICTED: pectate lyase-like                      135   4e-34   
gb|KDP45476.1|  hypothetical protein JCGZ_09725                         135   4e-34   
gb|EMS65801.1|  hypothetical protein TRIUR3_32637                       132   4e-34   
gb|AAA86241.1|  pectate lyase homolog                                   135   5e-34   Medicago sativa [alfalfa]
emb|CDX85564.1|  BnaA02g02490D                                          135   6e-34   
ref|XP_009121613.1|  PREDICTED: probable pectate lyase 19               135   6e-34   
ref|XP_009126031.1|  PREDICTED: probable pectate lyase 19               135   7e-34   
ref|XP_008221660.1|  PREDICTED: probable pectate lyase 3                134   9e-34   
ref|XP_006286712.1|  hypothetical protein CARUB_v10002862mg             135   9e-34   
ref|XP_002437815.1|  hypothetical protein SORBIDRAFT_10g003090          134   9e-34   Sorghum bicolor [broomcorn]
gb|KHN08855.1|  Putative pectate lyase P59                              134   9e-34   
ref|XP_009389712.1|  PREDICTED: pectate lyase-like                      134   9e-34   
ref|XP_010445460.1|  PREDICTED: probable pectate lyase 15               128   1e-33   
emb|CDY63769.1|  BnaCnng42620D                                          134   1e-33   
ref|XP_004966014.1|  PREDICTED: pectate lyase-like                      134   1e-33   
ref|XP_003621115.1|  Pectate lyase                                      134   1e-33   
emb|CDY66593.1|  BnaCnng51570D                                          134   1e-33   
gb|AGT16687.1|  pectate lyase                                           134   1e-33   
ref|XP_010420163.1|  PREDICTED: probable pectate lyase 19 isoform X1    134   1e-33   
gb|AAA16476.1|  pectate lyase homolog                                   134   1e-33   Zea mays [maize]
ref|XP_010420165.1|  PREDICTED: probable pectate lyase 19 isoform X3    134   1e-33   
emb|CDP14850.1|  unnamed protein product                                133   2e-33   
ref|XP_010420164.1|  PREDICTED: probable pectate lyase 19 isoform X2    134   2e-33   
ref|XP_004964534.1|  PREDICTED: pectate lyase-like                      133   2e-33   
ref|XP_010670318.1|  PREDICTED: pectate lyase-like                      133   2e-33   
ref|XP_009369346.1|  PREDICTED: pectate lyase-like                      133   2e-33   
ref|XP_010453638.1|  PREDICTED: probable pectate lyase 19               134   2e-33   
ref|XP_008456459.1|  PREDICTED: pectate lyase-like                      132   3e-33   
gb|KHG05193.1|  hypothetical protein F383_30875                         132   3e-33   
ref|XP_002871648.1|  pectate lyase family protein                       133   3e-33   
dbj|BAH20311.1|  AT3G01270                                              131   4e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004228388.1|  PREDICTED: pectate lyase                           132   4e-33   
ref|XP_008389523.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    132   4e-33   
ref|XP_002270112.1|  PREDICTED: pectate lyase                           132   5e-33   Vitis vinifera
gb|AAM60924.1|  putative pectate lyase                                  132   5e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010551866.1|  PREDICTED: probable pectate lyase 19               132   5e-33   
ref|XP_006363934.1|  PREDICTED: pectate lyase-like                      132   5e-33   
emb|CAN69904.1|  hypothetical protein VITISV_001006                     132   5e-33   Vitis vinifera
ref|NP_186776.1|  putative pectate lyase 7                              132   5e-33   Arabidopsis thaliana [mouse-ear cress]
sp|P40973.1|PLY_LILLO  RecName: Full=Pectate lyase; Flags: Precursor    132   6e-33   Lilium longiflorum [Easter lily]
gb|AFK39232.1|  unknown                                                 126   6e-33   
gb|KEH24975.1|  pectate lyase P59-like protein                          132   7e-33   
ref|XP_002882189.1|  pectate lyase family protein                       132   8e-33   
ref|XP_007215366.1|  hypothetical protein PRUPE_ppa005602mg             132   8e-33   
gb|KFK25747.1|  hypothetical protein AALP_AA8G154300                    132   9e-33   
ref|NP_197015.4|  putative pectate lyase 19                             132   9e-33   Arabidopsis thaliana [mouse-ear cress]
sp|Q9LFP5.1|PLY19_ARATH  RecName: Full=Probable pectate lyase 19;...    132   9e-33   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28696.1|  unknown                                                 132   9e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008374522.1|  PREDICTED: pectate lyase-like                      131   9e-33   
ref|XP_009789922.1|  PREDICTED: pectate lyase-like                      131   1e-32   
gb|KGN47799.1|  hypothetical protein Csa_6G404140                       130   1e-32   
ref|XP_004146792.1|  PREDICTED: probable pectate lyase P59-like         130   2e-32   
ref|XP_009587688.1|  PREDICTED: pectate lyase-like                      130   2e-32   
ref|XP_010513594.1|  PREDICTED: probable pectate lyase 7                130   2e-32   
ref|XP_010463548.1|  PREDICTED: probable pectate lyase 7                130   2e-32   
ref|XP_004162547.1|  PREDICTED: probable pectate lyase P59-like         130   2e-32   
ref|XP_004298448.1|  PREDICTED: probable pectate lyase 3-like           130   3e-32   
gb|KDO49831.1|  hypothetical protein CISIN_1g044170mg                   129   3e-32   
dbj|BAK06965.1|  predicted protein                                      130   3e-32   
dbj|BAC42832.1|  putative pectate lyase                                 127   3e-32   Arabidopsis thaliana [mouse-ear cress]
gb|EMT25421.1|  Pectate lyase                                           128   3e-32   
ref|XP_003554335.1|  PREDICTED: pectate lyase-like                      130   4e-32   
ref|XP_004236194.1|  PREDICTED: probable pectate lyase P59              129   4e-32   
emb|CDY66697.1|  BnaAnng22760D                                          130   4e-32   
ref|XP_009761969.1|  PREDICTED: probable pectate lyase P59              129   4e-32   
ref|XP_009615547.1|  PREDICTED: probable pectate lyase P59              129   4e-32   
emb|CDX77470.1|  BnaA07g06080D                                          129   4e-32   
ref|XP_006428983.1|  hypothetical protein CICLE_v10013750mg             129   5e-32   
ref|XP_011085780.1|  PREDICTED: probable pectate lyase P59              129   5e-32   
gb|KHN01171.1|  Putative pectate lyase 3                                129   5e-32   
ref|XP_006573090.1|  PREDICTED: probable pectate lyase 3-like           129   5e-32   
ref|XP_006480843.1|  PREDICTED: probable pectate lyase 19-like          129   5e-32   
ref|XP_008230729.1|  PREDICTED: pectate lyase                           129   6e-32   
ref|XP_010488478.1|  PREDICTED: probable pectate lyase 9                129   6e-32   
ref|XP_009102560.1|  PREDICTED: probable pectate lyase 9                129   6e-32   
gb|KDO49230.1|  hypothetical protein CISIN_1g036607mg                   129   6e-32   
gb|KHG16093.1|  hypothetical protein F383_07683                         129   6e-32   
ref|XP_010485518.1|  PREDICTED: probable pectate lyase 7                129   7e-32   
ref|XP_006431087.1|  hypothetical protein CICLE_v10011762mg             129   7e-32   
ref|XP_006482544.1|  PREDICTED: probable pectate lyase 19-like          129   7e-32   
ref|XP_008786760.1|  PREDICTED: pectate lyase-like                      129   7e-32   
ref|XP_003609009.1|  Pectate lyase                                      129   8e-32   
gb|KHN13490.1|  Putative pectate lyase 3                                128   8e-32   
gb|AES91206.2|  pectate lyase P59-like protein                          129   8e-32   
ref|XP_009788285.1|  PREDICTED: pectate lyase-like                      129   8e-32   
ref|XP_009598230.1|  PREDICTED: pectate lyase-like                      129   9e-32   
ref|XP_009408830.1|  PREDICTED: pectate lyase-like                      129   9e-32   
ref|XP_009102476.1|  PREDICTED: probable pectate lyase 10               129   9e-32   
emb|CDY46471.1|  BnaC07g03950D                                          129   9e-32   
ref|XP_003530685.1|  PREDICTED: probable pectate lyase 3-like           129   1e-31   
ref|XP_003519771.2|  PREDICTED: probable pectate lyase 3-like           128   1e-31   
ref|XP_006344502.1|  PREDICTED: probable pectate lyase P59-like         128   1e-31   
gb|KHN08706.1|  Putative pectate lyase 3                                128   1e-31   
ref|XP_006484673.1|  PREDICTED: probable pectate lyase 19-like          128   1e-31   
ref|XP_003638493.1|  Pectate lyase                                      124   1e-31   
ref|XP_002511525.1|  Pectate lyase precursor, putative                  128   1e-31   Ricinus communis
ref|XP_010435229.1|  PREDICTED: probable pectate lyase 15               128   2e-31   
ref|XP_010450168.1|  PREDICTED: probable pectate lyase 15 isoform X2    128   2e-31   
ref|XP_010450167.1|  PREDICTED: probable pectate lyase 15 isoform X1    128   2e-31   
ref|XP_006439649.1|  hypothetical protein CICLE_v10020193mg             127   2e-31   
ref|XP_006299938.1|  hypothetical protein CARUB_v10016149mg             128   2e-31   
ref|XP_010440534.1|  PREDICTED: probable pectate lyase 15 isoform X1    128   2e-31   
ref|XP_010440536.1|  PREDICTED: probable pectate lyase 15 isoform X2    127   2e-31   
ref|XP_006477525.1|  PREDICTED: pectate lyase-like                      127   2e-31   
ref|XP_009797403.1|  PREDICTED: pectate lyase-like                      127   2e-31   
gb|KDO76053.1|  hypothetical protein CISIN_1g013757mg                   127   2e-31   
ref|XP_009107722.1|  PREDICTED: putative pectate lyase 14               122   2e-31   
ref|XP_009381244.1|  PREDICTED: pectate lyase-like                      127   2e-31   
ref|XP_002885665.1|  pectate lyase family protein                       127   3e-31   
gb|KHG23093.1|  hypothetical protein F383_29772                         127   3e-31   
ref|XP_009380431.1|  PREDICTED: pectate lyase-like                      127   3e-31   
ref|XP_006826355.1|  hypothetical protein AMTR_s00004p00123190          127   3e-31   
ref|XP_006297684.1|  hypothetical protein CARUB_v10013715mg             127   3e-31   
ref|XP_003613595.1|  Pectate lyase                                      127   3e-31   
gb|AAQ62996.1|  oil palm polygalacturonase allergen PEST361             127   3e-31   Elaeis guineensis
ref|XP_006437462.1|  hypothetical protein CICLE_v10031653mg             127   3e-31   
gb|AGT16685.1|  pectate lyase precursor                                 125   3e-31   
ref|NP_189110.1|  probable pectate lyase 10                             127   3e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004490004.1|  PREDICTED: probable pectate lyase 3-like iso...    126   3e-31   
ref|XP_011097349.1|  PREDICTED: pectate lyase-like                      126   4e-31   
gb|AFW87059.1|  pectate lyase                                           127   4e-31   
ref|NP_001150723.1|  pectate lyase precursor                            127   4e-31   Zea mays [maize]
ref|XP_004490003.1|  PREDICTED: probable pectate lyase 3-like iso...    127   4e-31   
ref|XP_007157384.1|  hypothetical protein PHAVU_002G065800g             126   5e-31   
gb|EAY99627.1|  hypothetical protein OsI_21606                          126   5e-31   Oryza sativa Indica Group [Indian rice]
gb|KEH19822.1|  pectate lyase-like protein                              126   7e-31   
emb|CDP02199.1|  unnamed protein product                                125   7e-31   
ref|XP_009586995.1|  PREDICTED: probable pectate lyase 5                125   7e-31   
ref|NP_001056784.1|  Os06g0144900                                       126   8e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009107745.1|  PREDICTED: probable pectate lyase 15               125   1e-30   
ref|NP_001150425.1|  LOC100284055 precursor                             125   1e-30   Zea mays [maize]
ref|XP_007138209.1|  hypothetical protein PHAVU_009G189800g             125   1e-30   
ref|XP_010532870.1|  PREDICTED: putative pectate lyase 14               125   1e-30   
gb|EPS62426.1|  hypothetical protein M569_12361                         125   1e-30   
gb|EAY85003.1|  hypothetical protein OsI_06363                          125   1e-30   Oryza sativa Indica Group [Indian rice]
gb|EEE56553.1|  hypothetical protein OsJ_05879                          125   1e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007031685.1|  Pectin lyase-like superfamily protein              125   1e-30   
gb|EAY99621.1|  hypothetical protein OsI_21600                          125   1e-30   Oryza sativa Indica Group [Indian rice]
gb|AAQ62997.1|  oil palm polygalacturonase allergen PEST411             125   1e-30   Elaeis guineensis
gb|KFK37588.1|  hypothetical protein AALP_AA3G002600                    125   1e-30   
ref|XP_006354795.1|  PREDICTED: pectate lyase-like                      125   1e-30   
ref|XP_009377460.1|  PREDICTED: probable pectate lyase 1                120   1e-30   
ref|NP_001046281.1|  Os02g0214400                                       125   1e-30   Oryza sativa Japonica Group [Japonica rice]
emb|CDY18738.1|  BnaC08g08780D                                          125   2e-30   
gb|ABG74583.1|  pectate lyase                                           119   2e-30   Musa acuminata [banana]
gb|KFK39788.1|  hypothetical protein AALP_AA3G287800                    125   2e-30   
gb|ACF85413.1|  unknown                                                 119   2e-30   Zea mays [maize]
gb|AFK46866.1|  unknown                                                 119   2e-30   
ref|XP_002437204.1|  hypothetical protein SORBIDRAFT_10g022830          125   2e-30   Sorghum bicolor [broomcorn]
emb|CDX77400.1|  BnaA07g05380D                                          125   2e-30   
ref|XP_004301165.1|  PREDICTED: probable pectate lyase P59-like         124   2e-30   
ref|XP_009371193.1|  PREDICTED: probable pectate lyase 8                124   3e-30   
gb|EMT27253.1|  hypothetical protein F775_20306                         124   3e-30   
ref|XP_010476496.1|  PREDICTED: probable pectate lyase 3                124   3e-30   
ref|XP_010496063.1|  PREDICTED: probable pectate lyase 3                124   3e-30   
ref|XP_002436463.1|  hypothetical protein SORBIDRAFT_10g003080          124   3e-30   Sorghum bicolor [broomcorn]
ref|XP_008372438.1|  PREDICTED: probable pectate lyase 8                124   3e-30   
ref|XP_010109687.1|  hypothetical protein L484_015172                   124   3e-30   
gb|AAL91924.1|  pectate lyase                                           118   3e-30   Musa acuminata [banana]
gb|KEH41255.1|  pectate lyase family protein                            124   3e-30   
gb|AAX88800.1|  ripening-related pectate lyase                          124   3e-30   Mangifera indica
ref|XP_004234780.1|  PREDICTED: probable pectate lyase P56              124   3e-30   
gb|AFG55523.1|  hypothetical protein 2_7792_01                          119   4e-30   
gb|AET83414.1|  hypothetical protein                                    119   4e-30   
ref|XP_011085777.1|  PREDICTED: probable pectate lyase P59              124   4e-30   
gb|AEW08373.1|  hypothetical protein 2_7792_01                          119   4e-30   
ref|XP_002870357.1|  pectate lyase family protein                       124   4e-30   
ref|XP_006282594.1|  hypothetical protein CARUB_v10004736mg             124   4e-30   
ref|XP_009804979.1|  PREDICTED: probable pectate lyase 5                124   4e-30   
gb|AET83399.1|  hypothetical protein                                    118   4e-30   
ref|XP_010488576.1|  PREDICTED: probable pectate lyase 10               124   4e-30   
gb|AEX12162.1|  hypothetical protein 0_514_01                           118   5e-30   
ref|NP_567409.1|  probable pectate lyase 15                             124   5e-30   
ref|XP_010466894.1|  PREDICTED: probable pectate lyase 10               124   5e-30   
gb|AEW08375.1|  hypothetical protein 2_7792_01                          118   5e-30   
ref|XP_002526952.1|  Pectate lyase precursor, putative                  123   5e-30   
ref|XP_006852264.1|  hypothetical protein AMTR_s00049p00173370          123   5e-30   
ref|XP_004497757.1|  PREDICTED: probable pectate lyase 15-like          124   6e-30   
emb|CAB41931.1|  pectate lyase like protein                             123   6e-30   
ref|NP_001190715.1|  putative pectate lyase 14                          124   6e-30   
ref|NP_001190720.1|  probable pectate lyase 15                          124   6e-30   
ref|XP_010513666.1|  PREDICTED: probable pectate lyase 10               123   6e-30   
ref|XP_009411363.1|  PREDICTED: probable pectate lyase 8                124   6e-30   
ref|XP_006357121.1|  PREDICTED: pectate lyase-like                      123   7e-30   
gb|ACF84425.1|  unknown                                                 121   7e-30   
ref|NP_193057.4|  putative pectate lyase 14                             123   7e-30   
ref|XP_002892805.1|  hypothetical protein ARALYDRAFT_471616             123   7e-30   
gb|AET83398.1|  hypothetical protein                                    117   8e-30   
ref|XP_009758350.1|  PREDICTED: pectate lyase-like                      123   8e-30   
gb|AEX12158.1|  hypothetical protein 0_514_01                           117   8e-30   
gb|KHG22755.1|  hypothetical protein F383_29653                         123   8e-30   
gb|AET83397.1|  hypothetical protein                                    117   8e-30   
ref|XP_010527219.1|  PREDICTED: probable pectate lyase 10               122   8e-30   
ref|XP_009599232.1|  PREDICTED: pectate lyase-like                      123   8e-30   
gb|KHG08055.1|  putative pectate lyase P59                              123   9e-30   
ref|XP_009397895.1|  PREDICTED: probable pectate lyase 8                123   9e-30   
ref|XP_009627245.1|  PREDICTED: pectate lyase-like                      123   9e-30   
ref|XP_004152537.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    123   9e-30   
gb|KHG12411.1|  hypothetical protein F383_06737                         122   9e-30   
emb|CAB36835.1|  putative pectate lyase A11 (fragment)                  122   9e-30   
gb|AET83408.1|  hypothetical protein                                    117   9e-30   
emb|CDX96854.1|  BnaA08g23970D                                          123   1e-29   
ref|NP_001234029.1|  probable pectate lyase P18 precursor               122   1e-29   
ref|XP_002964286.1|  hypothetical protein SELMODRAFT_81909              122   1e-29   
gb|EYU24412.1|  hypothetical protein MIMGU_mgv1a011674mg                120   1e-29   
emb|CDY68729.1|  BnaCnng60280D                                          123   1e-29   
ref|XP_002966799.1|  hypothetical protein SELMODRAFT_85792              122   1e-29   
gb|AEX12157.1|  hypothetical protein 0_514_01                           117   1e-29   
emb|CDY53564.1|  BnaC04g55760D                                          122   1e-29   
ref|XP_009139602.1|  PREDICTED: probable pectate lyase 15               122   1e-29   
ref|XP_011087066.1|  PREDICTED: pectate lyase                           122   1e-29   
ref|XP_009110541.1|  PREDICTED: probable pectate lyase 3                122   1e-29   
emb|CDY01151.1|  BnaA04g06680D                                          122   1e-29   
ref|XP_004514773.1|  PREDICTED: probable pectate lyase 3-like           122   1e-29   
gb|EPS60822.1|  hypothetical protein M569_13978                         122   2e-29   
emb|CAN76500.1|  hypothetical protein VITISV_004734                     122   2e-29   
ref|XP_009117903.1|  PREDICTED: probable pectate lyase 3                122   2e-29   
ref|XP_010663062.1|  PREDICTED: probable pectate lyase 5                122   2e-29   
ref|XP_010435301.1|  PREDICTED: putative pectate lyase 14 isoform X1    122   2e-29   
gb|EAZ01460.1|  hypothetical protein OsI_23496                          115   2e-29   
ref|XP_009757256.1|  PREDICTED: pectate lyase                           121   2e-29   
ref|XP_008438392.1|  PREDICTED: probable pectate lyase 8                122   2e-29   
ref|XP_010435302.1|  PREDICTED: putative pectate lyase 14 isoform X2    122   2e-29   
ref|XP_006361836.1|  PREDICTED: probable pectate lyase P56-like         121   2e-29   
emb|CDY05654.1|  BnaC02g38830D                                          119   2e-29   
ref|XP_009599824.1|  PREDICTED: pectate lyase                           121   2e-29   
ref|XP_002863264.1|  pectate lyase family protein                       121   3e-29   
ref|XP_004508770.1|  PREDICTED: probable pectate lyase P59-like         122   3e-29   
ref|XP_010033351.1|  PREDICTED: pectate lyase-like                      121   3e-29   
gb|KHN19379.1|  Putative pectate lyase P59                              119   3e-29   
gb|KFK39766.1|  hypothetical protein AALP_AA3G285000                    121   3e-29   
dbj|BAB01216.1|  pectate lyase                                          121   3e-29   
ref|XP_006306515.1|  hypothetical protein CARUB_v10012514mg             121   3e-29   
ref|XP_011073763.1|  PREDICTED: probable pectate lyase 8                121   3e-29   
gb|ACN35280.1|  unknown                                                 119   3e-29   
ref|XP_010440665.1|  PREDICTED: putative pectate lyase 14               121   4e-29   
ref|XP_011087217.1|  PREDICTED: pectate lyase-like                      121   4e-29   
ref|XP_010450305.1|  PREDICTED: putative pectate lyase 14               121   4e-29   
ref|XP_004489554.1|  PREDICTED: probable pectate lyase 5-like           121   4e-29   
ref|XP_003535958.1|  PREDICTED: probable pectate lyase 1-like           121   4e-29   
ref|XP_006341783.1|  PREDICTED: probable pectate lyase 5-like           121   4e-29   
gb|KDP46367.1|  hypothetical protein JCGZ_10207                         121   4e-29   
gb|AEX12165.1|  hypothetical protein 0_514_01                           115   4e-29   
ref|XP_006285259.1|  hypothetical protein CARUB_v10006630mg             120   4e-29   
ref|XP_009139642.1|  PREDICTED: putative pectate lyase 14               121   4e-29   
emb|CDY47327.1|  BnaCnng14640D                                          121   4e-29   
emb|CDY01119.1|  BnaA04g07000D                                          121   4e-29   
ref|XP_009408120.1|  PREDICTED: probable pectate lyase 8                121   5e-29   
ref|XP_002285340.1|  PREDICTED: probable pectate lyase 5                120   5e-29   
ref|XP_010243989.1|  PREDICTED: probable pectate lyase 8                121   5e-29   
emb|CDP16631.1|  unnamed protein product                                120   5e-29   
ref|XP_003571658.1|  PREDICTED: pectate lyase-like                      120   5e-29   
ref|XP_008391438.1|  PREDICTED: probable pectate lyase 8                121   5e-29   
ref|XP_008360481.1|  PREDICTED: probable pectate lyase 8                121   5e-29   
ref|XP_003555714.2|  PREDICTED: probable pectate lyase 1-like           121   5e-29   
ref|XP_010320956.1|  PREDICTED: probable pectate lyase 5                120   5e-29   
ref|XP_010528200.1|  PREDICTED: putative pectate lyase 11               120   5e-29   
emb|CDO99404.1|  unnamed protein product                                120   5e-29   
ref|XP_009391056.1|  PREDICTED: probable pectate lyase 8                120   6e-29   
emb|CAN71915.1|  hypothetical protein VITISV_007917                     120   6e-29   
gb|AFG55532.1|  hypothetical protein 2_7792_01                          115   6e-29   
ref|XP_008667903.1|  PREDICTED: pectate lyase 8 isoform X1              121   6e-29   
gb|KFK43687.1|  hypothetical protein AALP_AA1G160000                    120   6e-29   
gb|KDO82123.1|  hypothetical protein CISIN_1g015702mg                   119   6e-29   
emb|CDP00293.1|  unnamed protein product                                120   6e-29   
gb|EYU34765.1|  hypothetical protein MIMGU_mgv1a023431mg                120   6e-29   
gb|AET83413.1|  hypothetical protein                                    115   6e-29   
gb|EYU32621.1|  hypothetical protein MIMGU_mgv1a006198mg                120   7e-29   
ref|XP_010929962.1|  PREDICTED: probable pectate lyase 5                120   7e-29   
ref|XP_009349844.1|  PREDICTED: probable pectate lyase 8                120   7e-29   
ref|XP_007222160.1|  hypothetical protein PRUPE_ppa005761mg             120   7e-29   
ref|XP_008223974.1|  PREDICTED: probable pectate lyase 8                120   7e-29   
dbj|BAF43573.1|  pectate lyase                                          120   7e-29   
ref|XP_008367255.1|  PREDICTED: probable pectate lyase 1                120   7e-29   
gb|AAB69759.1|  putative pectate lyase                                  120   8e-29   
ref|NP_172894.1|  putative pectate lyase 3                              120   8e-29   
ref|XP_009370039.1|  PREDICTED: probable pectate lyase 8                120   8e-29   
ref|XP_006297643.1|  hypothetical protein CARUB_v10013661mg             120   8e-29   
ref|XP_009362042.1|  PREDICTED: probable pectate lyase 8                120   9e-29   
ref|XP_006357289.1|  PREDICTED: probable pectate lyase 3-like           120   9e-29   
ref|XP_010527872.1|  PREDICTED: probable pectate lyase 3 isoform X2     120   9e-29   
ref|XP_009148818.1|  PREDICTED: probable pectate lyase 3                120   9e-29   
emb|CDY39314.1|  BnaC05g10650D                                          120   1e-28   
emb|CDY45254.1|  BnaA06g09240D                                          120   1e-28   
ref|XP_010523445.1|  PREDICTED: probable pectate lyase 3                120   1e-28   
ref|XP_009111860.1|  PREDICTED: probable pectate lyase 20               120   1e-28   
ref|XP_009804999.1|  PREDICTED: probable pectate lyase 8                120   1e-28   
gb|KFK33456.1|  hypothetical protein AALP_AA5G015800                    120   1e-28   
ref|XP_004501839.1|  PREDICTED: probable pectate lyase 5-like           120   1e-28   
ref|XP_004975048.1|  PREDICTED: probable pectate lyase 15-like is...    120   1e-28   
ref|XP_007034463.1|  Pectin lyase-like superfamily protein              120   1e-28   
ref|XP_010023767.1|  PREDICTED: probable pectate lyase 8 isoform X1     120   1e-28   
ref|XP_010100325.1|  hypothetical protein L484_027633                   119   1e-28   
ref|XP_008339288.1|  PREDICTED: probable pectate lyase 8                120   1e-28   
ref|XP_011086701.1|  PREDICTED: probable pectate lyase 5                119   1e-28   
ref|XP_010023768.1|  PREDICTED: probable pectate lyase 1 isoform X2     119   1e-28   
ref|XP_008235520.1|  PREDICTED: probable pectate lyase 8                119   1e-28   
ref|XP_008460726.1|  PREDICTED: probable pectate lyase 8 isoform X1     119   1e-28   
ref|XP_004138973.1|  PREDICTED: probable pectate lyase 15-like          119   1e-28   
ref|XP_004171543.1|  PREDICTED: probable pectate lyase 15-like          119   1e-28   
ref|XP_006291220.1|  hypothetical protein CARUB_v10017351mg             119   1e-28   
ref|XP_010918895.1|  PREDICTED: probable pectate lyase 8 isoform X1     119   2e-28   
ref|XP_004975047.1|  PREDICTED: probable pectate lyase 15-like is...    119   2e-28   
ref|XP_007201029.1|  hypothetical protein PRUPE_ppa006229mg             119   2e-28   
ref|XP_004975046.1|  PREDICTED: probable pectate lyase 15-like is...    120   2e-28   
ref|XP_010918897.1|  PREDICTED: probable pectate lyase 8 isoform X2     119   2e-28   
ref|XP_008460727.1|  PREDICTED: probable pectate lyase 1 isoform X2     119   2e-28   
ref|XP_004156698.1|  PREDICTED: putative pectate lyase 11-like          119   2e-28   
ref|XP_004142773.1|  PREDICTED: putative pectate lyase 11-like          119   2e-28   
ref|XP_011086987.1|  PREDICTED: probable pectate lyase 22               119   2e-28   
ref|XP_007137977.1|  hypothetical protein PHAVU_009G170500g             119   2e-28   
ref|XP_006338637.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    119   2e-28   
ref|XP_008804450.1|  PREDICTED: probable pectate lyase 8 isoform X2     119   2e-28   
dbj|BAK06362.1|  predicted protein                                      119   2e-28   
ref|XP_008460728.1|  PREDICTED: probable pectate lyase 1 isoform X3     119   2e-28   
dbj|BAF01663.1|  pectate lyase like protein                             117   2e-28   
gb|EMS64552.1|  hypothetical protein TRIUR3_22914                       120   2e-28   
ref|XP_008804449.1|  PREDICTED: probable pectate lyase 8 isoform X1     119   2e-28   
ref|XP_011091390.1|  PREDICTED: probable pectate lyase 8                119   2e-28   
ref|XP_003613596.1|  Pectate lyase                                      119   2e-28   
gb|EMT28700.1|  hypothetical protein F775_17439                         119   2e-28   
ref|XP_010514040.1|  PREDICTED: probable pectate lyase 6                119   2e-28   
ref|XP_010527871.1|  PREDICTED: probable pectate lyase 3 isoform X1     121   2e-28   
ref|XP_007145412.1|  hypothetical protein PHAVU_007G236800g             119   2e-28   
ref|XP_008458848.1|  PREDICTED: pectate lyase-like                      119   2e-28   
gb|AAK66161.1|  pectate lyase                                           118   2e-28   
ref|XP_011072008.1|  PREDICTED: probable pectate lyase 18               119   3e-28   
gb|KHG30349.1|  hypothetical protein F383_15991                         119   3e-28   
gb|KDO82120.1|  hypothetical protein CISIN_1g015702mg                   119   3e-28   
ref|XP_006484000.1|  PREDICTED: probable pectate lyase 5-like           118   3e-28   
ref|XP_006438176.1|  hypothetical protein CICLE_v10031429mg             119   3e-28   
ref|XP_010425041.1|  PREDICTED: probable pectate lyase 6                119   3e-28   
ref|XP_004289729.1|  PREDICTED: probable pectate lyase 15-like          119   3e-28   
gb|KHG06252.1|  hypothetical protein F383_10745                         119   3e-28   
emb|CDY19932.1|  BnaA09g03190D                                          119   3e-28   
ref|XP_004134015.1|  PREDICTED: probable pectate lyase 15-like          119   3e-28   
emb|CDY56668.1|  BnaCnng30870D                                          118   3e-28   
ref|XP_008800563.1|  PREDICTED: probable pectate lyase 8 isoform X1     119   3e-28   
ref|NP_001141589.1|  uncharacterized protein LOC100273705               119   3e-28   
ref|XP_010502279.1|  PREDICTED: probable pectate lyase 6                119   3e-28   
ref|XP_004290232.1|  PREDICTED: probable pectate lyase 8-like           118   4e-28   
gb|EPS68938.1|  hypothetical protein M569_05827                         118   4e-28   
ref|XP_008800564.1|  PREDICTED: probable pectate lyase 8 isoform X2     118   4e-28   
ref|XP_002884619.1|  pectate lyase family protein                       118   4e-28   
gb|KHG07401.1|  putative pectate lyase P59                              118   4e-28   
emb|CAN78491.1|  hypothetical protein VITISV_004934                     118   4e-28   
ref|XP_010069078.1|  PREDICTED: probable pectate lyase 8                118   4e-28   
gb|KCW57296.1|  hypothetical protein EUGRSUZ_H00093                     118   4e-28   
gb|KHF99208.1|  hypothetical protein F383_08934                         118   4e-28   
ref|XP_010532807.1|  PREDICTED: probable pectate lyase 15               118   4e-28   
ref|XP_009624534.1|  PREDICTED: probable pectate lyase 8                118   4e-28   
ref|XP_006280540.1|  hypothetical protein CARUB_v10026482mg             118   4e-28   
emb|CDY53552.1|  BnaA09g57110D                                          119   4e-28   
gb|EYU43815.1|  hypothetical protein MIMGU_mgv1a006554mg                118   4e-28   
ref|XP_010264036.1|  PREDICTED: probable pectate lyase 8                118   5e-28   
emb|CBI33346.3|  unnamed protein product                                118   5e-28   
ref|XP_010464311.1|  PREDICTED: probable pectate lyase 8                118   5e-28   
gb|EPS63108.1|  hypothetical protein M569_11679                         117   5e-28   
gb|AAF19195.1|AF206319_1  pectate lyase 1                               118   5e-28   
ref|XP_010447044.1|  PREDICTED: probable pectate lyase 8                118   5e-28   
ref|XP_007037816.1|  Pectin lyase-like superfamily protein isoform 2    117   5e-28   
ref|XP_002285639.2|  PREDICTED: probable pectate lyase 8                118   5e-28   
emb|CDY34149.1|  BnaA02g28910D                                          117   5e-28   
ref|XP_003638513.1|  Pectate lyase                                      117   6e-28   
ref|XP_010486231.1|  PREDICTED: probable pectate lyase 8                118   6e-28   
gb|EYU22243.1|  hypothetical protein MIMGU_mgv1a007460mg                117   6e-28   
ref|XP_009406385.1|  PREDICTED: probable pectate lyase 18               117   6e-28   
gb|AAF19196.1|AF206320_1  pectate lyase 2                               118   6e-28   
gb|EEE60442.1|  hypothetical protein OsJ_13660                          118   6e-28   
ref|XP_006487597.1|  PREDICTED: probable pectate lyase 1-like           118   6e-28   
ref|XP_009385867.1|  PREDICTED: probable pectate lyase 8 isoform X2     118   6e-28   
ref|XP_010935685.1|  PREDICTED: probable pectate lyase 8 isoform X1     118   6e-28   
ref|XP_009111570.1|  PREDICTED: putative pectate lyase 11               117   6e-28   
emb|CDY00156.1|  BnaC09g01450D                                          117   6e-28   
gb|EPS69872.1|  hypothetical protein M569_04891                         117   6e-28   
ref|XP_006579282.1|  PREDICTED: probable pectate lyase P59-like         117   6e-28   
ref|XP_009385866.1|  PREDICTED: probable pectate lyase 8 isoform X1     118   7e-28   
gb|KFK31278.1|  hypothetical protein AALP_AA6G091900                    117   7e-28   
gb|EEC76710.1|  hypothetical protein OsI_14719                          118   7e-28   
emb|CDY20049.1|  BnaA09g02020D                                          117   7e-28   
ref|XP_010239619.1|  PREDICTED: probable pectate lyase 8 isoform X1     117   7e-28   
ref|XP_011024740.1|  PREDICTED: probable pectate lyase 20               117   7e-28   
ref|XP_010935686.1|  PREDICTED: probable pectate lyase 8 isoform X2     117   7e-28   
ref|XP_010250930.1|  PREDICTED: probable pectate lyase 5                117   7e-28   
ref|XP_010239620.1|  PREDICTED: probable pectate lyase 8 isoform X2     117   7e-28   
emb|CAE02420.2|  OSJNBa0095E20.8                                        117   7e-28   



>ref|XP_010317101.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=389

 Score =   187 bits (476),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            Y HVVNNDYTHWNMYAIGGS +PTIISQGNRFIAP DI K++IT R  +    W QWTWR
Sbjct  273  YIHVVNNDYTHWNMYAIGGSKNPTIISQGNRFIAPPDIFKKEITKREYSPESVWMQWTWR  332

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD YMNGAYFVQ+GDP++  KH NLYDGI      +VTW+TRFAGALNCK+GLPC
Sbjct  333  SEGDLYMNGAYFVQAGDPDWSKKHQNLYDGIAPAPADQVTWITRFAGALNCKVGLPC  389



>ref|XP_006357122.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=448

 Score =   186 bits (471),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            Y HVVNNDYTHWNMYAIGGS +PTIISQGNRFIAP DI K+QIT R  +    W QWTWR
Sbjct  332  YIHVVNNDYTHWNMYAIGGSKNPTIISQGNRFIAPPDIFKKQITKREYSPESVWMQWTWR  391

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD YMNGAYFVQ+GDP++  KH NLYDGI A    +VTW+TRFAGALNCK+G  C
Sbjct  392  SEGDLYMNGAYFVQAGDPDWSKKHQNLYDGIAAAPADQVTWMTRFAGALNCKVGKAC  448



>ref|XP_009789921.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            Y HVVNNDYTHWNMYAIGGS +PTIISQGNRFIAP DI K+QIT R  +    W QWTWR
Sbjct  331  YIHVVNNDYTHWNMYAIGGSKNPTIISQGNRFIAPPDIFKKQITKREYSPESVWMQWTWR  390

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD YMNGAYFVQSGDP++  KH NLYDGI A    +VTW+TRFAGAL CK+G  C
Sbjct  391  SEGDLYMNGAYFVQSGDPDWSKKHQNLYDGISAAPADQVTWITRFAGALGCKVGQAC  447



>ref|XP_009587689.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=447

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 92/117 (79%), Gaps = 0/117 (0%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            Y HVVNNDYTHWNMYAIGGS +PTIISQGNRFIAP DI K+QIT R  +    W QWTWR
Sbjct  331  YIHVVNNDYTHWNMYAIGGSKNPTIISQGNRFIAPPDIFKKQITKREYSPESVWMQWTWR  390

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD YMNGAYFVQSGDP++  KH NLYDGI A    +VTW+TRFAGAL C +G  C
Sbjct  391  SEGDLYMNGAYFVQSGDPDWSKKHQNLYDGISAAPADQVTWITRFAGALGCMVGQAC  447



>gb|AAB69766.1| putative pectate lyase Nt59 [Nicotiana tabacum]
Length=171

 Score =   173 bits (438),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            Y HVVNNDYTHWNMYAIGGS  PTII+QGNRFIAP DI K Q+T R     E WK WTWR
Sbjct  55   YIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPPDIFKEQVTKREYNPEEVWKHWTWR  114

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEG+ +MNGAYF++SGDP++  KH  LYDGI A   +EVTW+TRFAGAL CK G  C
Sbjct  115  SEGNLFMNGAYFIESGDPDWSKKHKELYDGISAAPAEEVTWITRFAGALGCKKGKAC  171



>ref|XP_009779191.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 92/117 (79%), Gaps = 0/117 (0%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            Y HVVNNDYTHWNMYAIGGS  PTII+QGNRFIAP DI K+Q+T R     E WKQWTWR
Sbjct  331  YIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPPDIFKKQVTKREYNPEEVWKQWTWR  390

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEG+ +MNGAYF++SGDP++  KH  LYDGI A   +EVTW+TRFAGAL CK G  C
Sbjct  391  SEGNLFMNGAYFIESGDPDWSKKHKELYDGISAASAEEVTWITRFAGALGCKEGKAC  447



>ref|XP_009802165.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=451

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHWNMYAIGGS  PTIISQGNRFIAP D+ K++IT R  A    WKQWTWR
Sbjct  335  FIHVVNNDYTHWNMYAIGGSQHPTIISQGNRFIAPPDMFKKEITKRDYAPESVWKQWTWR  394

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD +MNGA+FV+SGDP++  KH NL+DGI +  G++VTW+TRFAGALNC+ G  C
Sbjct  395  SQGDLFMNGAFFVESGDPDWTKKHQNLFDGISSAPGEQVTWITRFAGALNCRPGHAC  451



>ref|XP_009617495.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=451

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHWNMYAIGGS  PTIISQGNRFIAP ++ K++IT R  A    WKQWTWR
Sbjct  335  FIHVVNNDYTHWNMYAIGGSQHPTIISQGNRFIAPPEMFKKEITKRDYAPESVWKQWTWR  394

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD +MNGA+FV+SGDP++  KH NL+DGI +  G++VTW+TRFAGALNCK G  C
Sbjct  395  SQGDLFMNGAFFVESGDPDWTKKHQNLFDGISSAPGEQVTWITRFAGALNCKQGHAC  451



>ref|XP_009599826.1| PREDICTED: probable pectate lyase P59 isoform X2 [Nicotiana tomentosiformis]
Length=444

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            Y HVVNNDYTHWNMYAIGGS  PTII+QGNRFIAP DI K+Q+T R     E WK WTWR
Sbjct  328  YIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPPDIFKKQVTKREYNPEEVWKHWTWR  387

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEG+ +MNGAYF++SGDP++  KH  LYDGI A   +EVTW+TRFAGAL CK G  C
Sbjct  388  SEGNLFMNGAYFIESGDPDWSKKHKELYDGISAAPAEEVTWITRFAGALGCKKGKAC  444



>ref|XP_009599825.1| PREDICTED: probable pectate lyase P59 isoform X1 [Nicotiana tomentosiformis]
Length=445

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            Y HVVNNDYTHWNMYAIGGS  PTII+QGNRFIAP DI K+Q+T R     E WK WTWR
Sbjct  329  YIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPPDIFKKQVTKREYNPEEVWKHWTWR  388

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEG+ +MNGAYF++SGDP++  KH  LYDGI A   +EVTW+TRFAGAL CK G  C
Sbjct  389  SEGNLFMNGAYFIESGDPDWSKKHKELYDGISAAPAEEVTWITRFAGALGCKKGKAC  445



>ref|XP_004234779.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=449

 Score =   172 bits (437),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            Y HVVNNDYTHWNMYAIGGS  PTII+QGNRFIAP DI K+Q+T R       W QWTWR
Sbjct  333  YIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPPDIFKKQVTKREYNPESVWMQWTWR  392

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEG+ +MNGAYF +SGDP + SKH +LYDGI A   ++VTW+TRFAG L CK G PC
Sbjct  393  SEGNLFMNGAYFTESGDPEWSSKHKDLYDGISAAPAEDVTWMTRFAGVLGCKPGKPC  449



>ref|XP_006361835.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=447

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            Y HVVNNDYTHWNMYAIGGS  PTII+QGNRFIAP DI K+Q+T R       W QWTWR
Sbjct  331  YIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPPDIFKKQVTKREYNPESVWMQWTWR  390

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEG+ +MNGAYF +SGDP++  KH +LYDGI A   ++VTW+TRFAG L CK G PC
Sbjct  391  SEGNLFMNGAYFTESGDPDWSKKHKDLYDGISAAPAEDVTWMTRFAGVLACKPGKPC  447



>sp|P15722.1|PLY59_SOLLC RecName: Full=Probable pectate lyase P59; Flags: Precursor [Solanum 
lycopersicum]
 emb|CAA33523.1| P59 protein [Solanum lycopersicum]
Length=449

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            Y HVVNNDYTHWNMYAIGGS  PTII QGNRFIAP DI K+Q+T R       W QWTWR
Sbjct  333  YIHVVNNDYTHWNMYAIGGSMHPTIIHQGNRFIAPPDIFKKQVTKREYNPESVWMQWTWR  392

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEG+ +MNGAYF +SGDP + SKH +LYDGI A   ++VTW+TRFAG L CK G PC
Sbjct  393  SEGNLFMNGAYFTESGDPEWSSKHKDLYDGISAAPAEDVTWMTRFAGVLGCKPGKPC  449



>ref|XP_006338480.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=446

 Score =   170 bits (431),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHWNMYAIGGS  PTIISQGNRFIAP D+ K+++T R  +    WKQW+WR
Sbjct  330  FIHVVNNDYTHWNMYAIGGSQHPTIISQGNRFIAPPDMFKKEVTKRDYSPESVWKQWSWR  389

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD +MNGA+FV+SGDP++  KH  L+DGI +  G +VTW+TRF+GALNCK G  C
Sbjct  390  SQGDLFMNGAFFVESGDPDWTKKHTELFDGIVSASGDQVTWITRFSGALNCKPGEAC  446



>ref|XP_004232242.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=446

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHWNMYAIGGS  PTIISQGNRFIAP D+ K+++T R  +    WKQW+WR
Sbjct  330  FIHVVNNDYTHWNMYAIGGSQHPTIISQGNRFIAPPDMFKKEVTKRDYSPESVWKQWSWR  389

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD +MNGA+FV+SGDP++  KH  L+DG+ +  G +VTW+TRF+GALNCK G  C
Sbjct  390  SQGDLFMNGAFFVESGDPDWTQKHIQLFDGVVSASGDQVTWITRFSGALNCKPGEAC  446



>emb|CDP02198.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   167 bits (424),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 89/121 (74%), Gaps = 4/121 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHK----RQITHRVGAAPEQWKQ  377
            + HVVNNDYTHW MYAIGGS  P IISQGNRFIAP DI K    R +T R  A   +WK+
Sbjct  356  FIHVVNNDYTHWEMYAIGGSQHPIIISQGNRFIAPPDIFKKEVRRTVTKRDYAEEARWKE  415

Query  376  WTWRSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLP  197
            WTWRSEGD +MNGA+FVQSGDP+F  KH  ++DGI      EVTW+TRFAGAL C+ G P
Sbjct  416  WTWRSEGDLFMNGAFFVQSGDPDFTKKHPEIFDGIAPADSSEVTWITRFAGALMCRPGSP  475

Query  196  C  194
            C
Sbjct  476  C  476



>gb|EPS66620.1| hypothetical protein M569_08154, partial [Genlisea aurea]
Length=451

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 90/120 (75%), Gaps = 3/120 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSD---IHKRQITHRVGAAPEQWKQW  374
            Y HVVNNDYTHWNMYAIGGSS PTIISQGNR+IAP D   ++ +++T R  A    W+ W
Sbjct  332  YIHVVNNDYTHWNMYAIGGSSAPTIISQGNRYIAPPDDVNMYAKEVTKRDYAPESVWQSW  391

Query  373  TWRSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            TWRS+GD +M GAYF QSGDPN++SKH   YD ++A  G  V  +TRFAGAL CK+G PC
Sbjct  392  TWRSDGDVFMRGAYFTQSGDPNYMSKHPERYDLMQAADGSNVAAITRFAGALLCKVGAPC  451



>ref|XP_011098575.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=449

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAP-SDIHKRQITHRVGAAPEQWKQWTW  368
            Y HVVNNDYTHWNMYA+GGS +P IISQGNR+IAP ++ + +++T R  +    WK W W
Sbjct  332  YIHVVNNDYTHWNMYAVGGSKNPIIISQGNRYIAPPTNPYAKEVTKREYSPESVWKSWVW  391

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RSEGD +  GA+FVQSGDP + SKH   YD I+A   + V  +T+FAGAL CK+G+PC
Sbjct  392  RSEGDIFQGGAFFVQSGDPTYTSKHPEKYDLIQAAPAQNVAEITKFAGALGCKVGVPC  449



>ref|XP_004147462.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
 ref|XP_004163529.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
Length=431

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 87/117 (74%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTIISQGNRFIAP +   RQIT+R  A    WK WTWR
Sbjct  316  FFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPPNPAARQITNRNYATESVWKTWTWR  375

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  MNGAYFVQSG+P+   + ++ +D IKA  G  V  LTRF+G+LNC +G PC
Sbjct  376  SEGDLMMNGAYFVQSGNPS-KRRPYSRFDMIKAKPGTFVRRLTRFSGSLNCYVGRPC  431



>gb|KGN59593.1| hypothetical protein Csa_3G827350 [Cucumis sativus]
Length=441

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 87/117 (74%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTIISQGNRFIAP +   RQIT+R  A    WK WTWR
Sbjct  326  FFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPPNPAARQITNRNYATESVWKTWTWR  385

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  MNGAYFVQSG+P+   + ++ +D IKA  G  V  LTRF+G+LNC +G PC
Sbjct  386  SEGDLMMNGAYFVQSGNPS-KRRPYSRFDMIKAKPGTFVRRLTRFSGSLNCYVGRPC  441



>gb|EYU36839.1| hypothetical protein MIMGU_mgv1a006379mg [Erythranthe guttata]
Length=446

 Score =   151 bits (382),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 84/118 (71%), Gaps = 1/118 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSD-IHKRQITHRVGAAPEQWKQWTW  368
            Y HVVNNDYTHWNMYAIGGS +P IISQGNRFIAP D    +++T R  +    W QW W
Sbjct  329  YIHVVNNDYTHWNMYAIGGSKNPIIISQGNRFIAPPDNPFAKEVTKREYSPESVWSQWIW  388

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RSEGD ++ GA+FVQSGDP + SKH   YD I+A    +V  +T+FAGAL CKIG  C
Sbjct  389  RSEGDIFLRGAFFVQSGDPTYTSKHPEKYDLIQAASATQVEIMTKFAGALGCKIGQVC  446



>gb|KHG20840.1| Pectate lyase [Gossypium arboreum]
Length=124

 Score =   142 bits (359),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 80/117 (68%), Gaps = 0/117 (0%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTIISQGNRFIAP D++ +++THR+ A+  +WK W WR
Sbjct  8    FFHVVNNDYTHWKMYAIGGSMHPTIISQGNRFIAPHDLNAKEVTHRIYASESEWKNWVWR  67

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D  MNGA F  SG         N  D IKA  G  V  LTRFAG LNCK G+ C
Sbjct  68   SEEDLLMNGAIFRTSGPLTPPDLKFNEKDIIKAKPGTYVRTLTRFAGTLNCKKGIKC  124



>gb|EYU34111.1| hypothetical protein MIMGU_mgv1a006386mg [Erythranthe guttata]
Length=446

 Score =   150 bits (380),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 84/118 (71%), Gaps = 1/118 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSD-IHKRQITHRVGAAPEQWKQWTW  368
            Y HVVNNDYTHWNMYAIGGS +P IISQGNRFIAP D    +++T R  +    W QW W
Sbjct  329  YIHVVNNDYTHWNMYAIGGSKNPIIISQGNRFIAPPDNPFAKEVTKREYSPESVWSQWIW  388

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RSEGD ++ GA+FVQSGD  + SKH   YD I+A    +V  +T+FAGAL CK+G PC
Sbjct  389  RSEGDIFLRGAFFVQSGDATYTSKHPEKYDLIQAASATQVGIMTKFAGALGCKVGQPC  446



>ref|XP_008443432.1| PREDICTED: probable pectate lyase 19 [Cucumis melo]
Length=441

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 87/117 (74%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTIISQGNRFIAP +   RQIT+R  A    WK WTWR
Sbjct  326  FFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPPNPAARQITNRNYAPESVWKTWTWR  385

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  MNGAYF+QSG+P+   + ++ +D IKA  G  V  LTRF+G+LNC +G PC
Sbjct  386  SEGDLMMNGAYFIQSGNPS-KRRPYSRFDMIKAKPGTFVRRLTRFSGSLNCFVGRPC  441



>emb|CBI15265.3| unnamed protein product [Vitis vinifera]
Length=398

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 88/117 (75%), Gaps = 3/117 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTI+SQGNRFIAP DI+ +++T R  +    WK WTWR
Sbjct  285  FFHVVNNDYTHWLMYAIGGSHHPTILSQGNRFIAPPDINCKEVTKRDYSPESVWKSWTWR  344

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  MNGA+FV+SGDPNF     N Y  I+A  G  VT LTRF+GAL+C+ G+PC
Sbjct  345  SQGDLMMNGAFFVESGDPNF--DFSNKY-VIRAKPGAFVTRLTRFSGALSCREGMPC  398



>emb|CAN77957.1| hypothetical protein VITISV_021245 [Vitis vinifera]
Length=407

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 88/117 (75%), Gaps = 3/117 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTI+SQGNRFIAP DI+ +++T R  +    WK WTWR
Sbjct  294  FFHVVNNDYTHWLMYAIGGSHHPTILSQGNRFIAPPDINCKEVTKRDYSPESVWKSWTWR  353

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  MNGA+FV+SGDPNF     N Y  I+A  G  VT LTRF+GAL+C+ G+PC
Sbjct  354  SQGDLMMNGAFFVESGDPNF--DFSNKY-VIRAKPGAFVTRLTRFSGALSCREGMPC  407



>ref|XP_002272638.2| PREDICTED: pectate lyase-like [Vitis vinifera]
Length=434

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 88/117 (75%), Gaps = 3/117 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTI+SQGNRFIAP DI+ +++T R  +    WK WTWR
Sbjct  321  FFHVVNNDYTHWLMYAIGGSHHPTILSQGNRFIAPPDINCKEVTKRDYSPESVWKSWTWR  380

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  MNGA+FV+SGDPNF     N Y  I+A  G  VT LTRF+GAL+C+ G+PC
Sbjct  381  SQGDLMMNGAFFVESGDPNF--DFSNKY-VIRAKPGAFVTRLTRFSGALSCREGMPC  434



>gb|KHG27438.1| Pectate lyase [Gossypium arboreum]
 gb|KHG27552.1| Pectate lyase [Gossypium arboreum]
Length=124

 Score =   138 bits (348),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 79/117 (68%), Gaps = 0/117 (0%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTIISQGNRFIAP D++ +++THR+ A+  +WK W WR
Sbjct  8    FFHVVNNDYTHWKMYAIGGSMHPTIISQGNRFIAPHDLNAKEVTHRIYASESEWKNWVWR  67

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D  MNGA F  SG  +      N  D IKA  G  V  LTRFAG L CK  + C
Sbjct  68   SEEDLLMNGAIFRTSGPLSPPDLKFNEKDIIKAKPGTYVRTLTRFAGTLKCKKRIKC  124



>ref|XP_002282500.3| PREDICTED: pectate lyase [Vitis vinifera]
Length=443

 Score =   145 bits (367),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 86/118 (73%), Gaps = 3/118 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGS +PTIISQGNRFIAP ++  +++T R  A+P++WK WTW 
Sbjct  328  FVHVVNNDYTHWLMYAIGGSQNPTIISQGNRFIAPPNMACKEVTKRDYASPDEWKSWTWI  387

Query  364  SEGDTYMNGAYFVQSGDPNFVSKH-HNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD   NGA+FVQSGDP    KH    YD IKA  G  V  LTRF+G+L CK+  PC
Sbjct  388  SQGDLLQNGAFFVQSGDPK--KKHPFTRYDMIKAKPGTFVNRLTRFSGSLGCKVNQPC  443



>emb|CAN79927.1| hypothetical protein VITISV_042447 [Vitis vinifera]
Length=439

 Score =   145 bits (366),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 86/118 (73%), Gaps = 3/118 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGS +PTIISQGNRFIAP ++  +++T R  A+P++WK WTW 
Sbjct  324  FVHVVNNDYTHWLMYAIGGSQNPTIISQGNRFIAPPNMACKEVTKRDYASPDEWKSWTWI  383

Query  364  SEGDTYMNGAYFVQSGDPNFVSKH-HNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD   NGA+FVQSGDP    KH    YD IKA  G  V  LTRF+G+L CK+  PC
Sbjct  384  SQGDLLQNGAFFVQSGDPK--KKHPFTRYDMIKAKPGTFVNRLTRFSGSLGCKVNQPC  439



>ref|XP_010242445.1| PREDICTED: pectate lyase [Nelumbo nucifera]
Length=443

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 84/117 (72%), Gaps = 5/117 (4%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGSS+PTIISQGNRFIAP     +Q+T+R  A    WK WTWR
Sbjct  332  FFHVVNNDYTHWLMYAIGGSSNPTIISQGNRFIAPPTEAAKQVTNRNYAPESVWKHWTWR  391

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  MNGAYF+QSG P  + K  ++   I A KG  V  L RF+GALNCK+G  C
Sbjct  392  SEGDLMMNGAYFIQSGKP--IKKKRDM---ITAKKGTFVKRLVRFSGALNCKVGKRC  443



>gb|EAZ35814.1| hypothetical protein OsJ_20107 [Oryza sativa Japonica Group]
Length=193

 Score =   139 bits (351),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 86/117 (74%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP D++ +++T R     +++K+W W+
Sbjct  79   FFHVVNNDYTHWLMYAIGGNMNPTIISQGNRFIAPDDLNAKEVTKREYTPYDEYKEWVWK  138

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  MNGA+F +SG  N   + ++  D I A  GK V  LT+FAG LNC +G+PC
Sbjct  139  SQGDVMMNGAFFNESGGQN--ERSYDQLDFIPAKHGKYVGQLTKFAGTLNCHVGMPC  193



>ref|XP_010033216.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
Length=435

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 84/117 (72%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGSS PTIISQGNRFIAP ++  +++T R  A P+ W+ WTWR
Sbjct  321  FFHVVNNDYTHWLMYAIGGSSQPTIISQGNRFIAPPNLAAKEVTKRDYATPDVWRSWTWR  380

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  +NGA+FVQSG P  + K +   D IKA  G  V  LTRF+G LNCK    C
Sbjct  381  SQGDLLINGAFFVQSGQP--LKKKYGRKDMIKAKPGTFVRRLTRFSGTLNCKPKKRC  435



>emb|CBI22159.3| unnamed protein product [Vitis vinifera]
Length=468

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 86/118 (73%), Gaps = 3/118 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGS +PTIISQGNRFIAP ++  +++T R  A+P++WK WTW 
Sbjct  353  FVHVVNNDYTHWLMYAIGGSQNPTIISQGNRFIAPPNMACKEVTKRDYASPDEWKSWTWI  412

Query  364  SEGDTYMNGAYFVQSGDPNFVSKH-HNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD   NGA+FVQSGDP    KH    YD IKA  G  V  LTRF+G+L CK+  PC
Sbjct  413  SQGDLLQNGAFFVQSGDPK--KKHPFTRYDMIKAKPGTFVNRLTRFSGSLGCKVNQPC  468



>ref|XP_010112093.1| putative pectate lyase 7 [Morus notabilis]
 gb|EXC32626.1| putative pectate lyase 7 [Morus notabilis]
Length=437

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 86/117 (74%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGSS PTIISQGNRFIAP +   +Q+T R  AA  +WK+WTWR
Sbjct  322  FFHVVNNDYTHWLMYAIGGSSHPTIISQGNRFIAPPNNAAKQVTKRDYAAEWEWKRWTWR  381

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  MNGA+FVQSG+ +   +    +D IKA  G  VT LTRFAGALNC  G  C
Sbjct  382  SEGDLMMNGAFFVQSGNRS-KKRPFTRHDMIKAKPGTFVTRLTRFAGALNCYAGKKC  437



>ref|XP_003552513.1| PREDICTED: pectate lyase-like [Glycine max]
Length=440

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 84/117 (72%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HV+NNDYTHW MYAIGGSS+PTI+SQGNRFIAP++   ++ITHR  A PE+W +W W+
Sbjct  325  FVHVINNDYTHWLMYAIGGSSEPTILSQGNRFIAPNNNAAKEITHRDYAPPEEWSKWQWK  384

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D +MNGA F+QSG P       N    +K   G E   LTRFAGALNCK+G PC
Sbjct  385  SENDLFMNGATFLQSGSP-LGKLPFNKGLMMKPRPGAEANRLTRFAGALNCKVGKPC  440



>ref|XP_007153840.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
 gb|ESW25834.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
Length=447

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 83/117 (71%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGS  PTIIS+GNRFI P ++H ++IT R  +   +W  W WR
Sbjct  332  FVHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIGPDNVHAKEITKREYSPESEWSSWQWR  391

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S  D YMNGA+FVQSG P  V +  +  D IKA  G  V  LTR+AG+L+C++GLPC
Sbjct  392  SINDEYMNGAFFVQSG-PELVDRPFSRQDMIKAKPGSYVGRLTRYAGSLSCRVGLPC  447



>gb|KCW52797.1| hypothetical protein EUGRSUZ_J02132 [Eucalyptus grandis]
Length=451

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 84/117 (72%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGSS PTIISQGNRFIAP ++  +++T R  A P+ W+ WTWR
Sbjct  337  FFHVVNNDYTHWLMYAIGGSSQPTIISQGNRFIAPPNLAAKEVTKRDYATPDVWRSWTWR  396

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  +NGA+FVQSG P  + K +   D IKA  G  V  LTRF+G LNCK    C
Sbjct  397  SQGDLLINGAFFVQSGQP--LKKKYGRKDMIKAKPGTFVRRLTRFSGTLNCKPKKRC  451



>ref|XP_008341537.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=454

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 85/119 (71%), Gaps = 5/119 (4%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGSS PTIISQGNRFIAP +   +++T R  A    WK W WR
Sbjct  339  FIHVVNNDYTHWLMYAIGGSSHPTIISQGNRFIAPPNQAAKEVTKRDYAPESVWKSWQWR  398

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNL--YDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  +NGA+FVQSG P   SK+H     D +KA  G  VT LTRFAG+LNCK+G PC
Sbjct  399  SEGDLMINGAFFVQSGVP---SKNHGFGRLDVMKARPGTYVTRLTRFAGSLNCKVGHPC  454



>gb|KHN13652.1| Pectate lyase [Glycine soja]
Length=440

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 84/117 (72%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HV+NNDYTHW MYAIGGSS+PTI+SQGNRFIAP++   ++ITHR  A PE+W +W W+
Sbjct  325  FVHVINNDYTHWLMYAIGGSSEPTILSQGNRFIAPNNNAAKEITHRDYAPPEEWSKWQWK  384

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D +MNGA F+QSG P       N    +K   G E   LTRFAGALNCK+G PC
Sbjct  385  SENDLFMNGATFLQSGAP-LGKLPFNKGLMMKPRPGAEANRLTRFAGALNCKVGKPC  440



>ref|XP_009342871.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=454

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 83/118 (70%), Gaps = 3/118 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGSS PTIISQGNRFIAP +   +++T R  A    WK W WR
Sbjct  339  FVHVVNNDYTHWIMYAIGGSSHPTIISQGNRFIAPPNQAAKEVTKRDYAPESVWKSWQWR  398

Query  364  SEGDTYMNGAYFVQSGDPNFVSKH-HNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  MNGA+FVQSG PN   KH     D IKA  G  VT LTRFAG+LNCK+G  C
Sbjct  399  SEGDLMMNGAFFVQSGVPN--RKHGFGKLDMIKAKPGTFVTRLTRFAGSLNCKVGKKC  454



>ref|XP_010528323.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=458

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 85/118 (72%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIH-KRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW MYAIGGS  PTI+SQGNRFIAP  I   +Q+T R  A P +WK+WTW
Sbjct  342  FVHVVNNDYTHWEMYAIGGSQHPTILSQGNRFIAPPHISWAKQVTKRDYAQPSEWKRWTW  401

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            +SE D +MNGAYFV+SGDPNF  K     D I+A  G   + LTR+AG+L+C  G PC
Sbjct  402  QSEMDVFMNGAYFVESGDPNFKHK-FTRQDIIRAKHGMAASMLTRYAGSLHCFAGKPC  458



>ref|XP_002517472.1| pectate lyase, putative [Ricinus communis]
 gb|EEF45014.1| pectate lyase, putative [Ricinus communis]
Length=431

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 83/117 (71%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYT+W +YAIGGS  PTIISQGNRFIAP + + +++T R  A   +WK+WTWR
Sbjct  316  FFHVVNNDYTNWLLYAIGGSMHPTIISQGNRFIAPDNQYLKEVTKRDYATEAEWKKWTWR  375

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  MNGA+FVQSGDP    K    Y  IKA  G   T LTRFAGALNC  G  C
Sbjct  376  SEGDLLMNGAFFVQSGDPKLKVKPSKKYL-IKAKPGIYATRLTRFAGALNCIPGRKC  431



>ref|XP_002306040.1| hypothetical protein POPTR_0004s12300g [Populus trichocarpa]
 gb|EEE86551.1| hypothetical protein POPTR_0004s12300g [Populus trichocarpa]
Length=432

 Score =   143 bits (360),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 82/117 (70%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW +YAIGGS  PTIISQGNRFIAP + H +Q+T R  A   +W +WTWR
Sbjct  318  FFHVVNNDYTHWRLYAIGGSKHPTIISQGNRFIAPPESHLKQVTKRDYATKGEWSKWTWR  377

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D  MNGA+FVQSG P   +K  N    IKA  G   T +TRFAGAL+CK G  C
Sbjct  378  SENDLMMNGAFFVQSGQPR--TKKPNRKFMIKAKPGAVATRMTRFAGALDCKPGRKC  432



>ref|XP_011009454.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=474

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 82/117 (70%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW +YAIGGS  PTIISQGNRFIAP + H +Q+T R  A   +W +WTWR
Sbjct  360  FFHVVNNDYTHWRLYAIGGSKHPTIISQGNRFIAPPESHLKQVTKRDYATKGEWSKWTWR  419

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D  MNGA+FVQSG P   +K  N    IKA  G   T +TRFAGAL+CK G  C
Sbjct  420  SENDLMMNGAFFVQSGQPR--TKKPNRKFMIKAKPGAVATRMTRFAGALDCKPGREC  474



>ref|XP_010066949.1| PREDICTED: pectate lyase [Eucalyptus grandis]
 gb|KCW65002.1| hypothetical protein EUGRSUZ_G02541 [Eucalyptus grandis]
Length=436

 Score =   142 bits (359),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 82/117 (70%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTIISQGNRFIAP +I  +++T R  A  +QWK W W+
Sbjct  321  FFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPPNIAAKEVTKRDYATEDQWKNWLWK  380

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  MNGA+FV SG+P       +  D IKA  G  V  LTRFAG L C++G PC
Sbjct  381  SEGDLMMNGAFFVNSGNPR-ARFPFSRRDVIKAKPGTYVRRLTRFAGKLGCRVGRPC  436



>ref|XP_009131435.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
 emb|CDX78607.1| BnaA03g05190D [Brassica napus]
Length=475

 Score =   143 bits (360),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 85/118 (72%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDI-HKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+SQGNRFIAP  + H R++T R  A  E+WK W W
Sbjct  359  FVHVVNNDYTHWELYAIGGSQSPTILSQGNRFIAPPHLPHYREVTKRDYAPEEEWKHWNW  418

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RSE D +MNGAYF QSGDPN+ +  H   + IK   G  V+ LT++AGAL+C++G  C
Sbjct  419  RSEKDIFMNGAYFRQSGDPNYETD-HTRRNMIKPKNGYAVSKLTKYAGALDCRVGRRC  475



>ref|XP_008357758.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=459

 Score =   143 bits (360),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 82/119 (69%), Gaps = 5/119 (4%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGSS PTIISQGNRFIAP +   +++T R  A    WK W WR
Sbjct  344  FVHVVNNDYTHWIMYAIGGSSHPTIISQGNRFIAPPNQAAKEVTKRDYAPESVWKSWQWR  403

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNL--YDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  MNGA+FVQSG PN   K H     D IKA  G  V  LTRFAG+LNCK+G  C
Sbjct  404  SEGDLMMNGAFFVQSGVPN---KKHGFGKLDMIKAKPGTFVRRLTRFAGSLNCKVGKKC  459



>ref|XP_008339935.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score =   142 bits (359),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 82/117 (70%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP +   +Q+THR      +WK W WR
Sbjct  338  FFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIAPINGVTKQVTHRENTPEAEWKNWEWR  397

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  MNGA+FV+SG  +  SKH    D +    G  V  LT+F+GALNC +G PC
Sbjct  398  SEGDLMMNGAFFVESG--SGASKHPAKLDXMPFKPGTXVXTLTKFSGALNCAVGKPC  452



>ref|XP_002323835.1| hypothetical protein POPTR_0017s11450g [Populus trichocarpa]
 gb|EEF03968.1| hypothetical protein POPTR_0017s11450g [Populus trichocarpa]
Length=452

 Score =   142 bits (359),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTIISQGNRFIAP ++H +Q+T R  A   +WK WTWR
Sbjct  338  FFHVVNNDYTHWRMYAIGGSKHPTIISQGNRFIAPPELHLKQVTKRDYATESEWKTWTWR  397

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D  MNGA+F++SG P     H      I A  G   T +T FAGAL+CK G  C
Sbjct  398  SENDLMMNGAFFIESGKPRTKRPHKKFM--ITAKPGSLATRMTLFAGALDCKSGRKC  452



>ref|XP_008365507.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=396

 Score =   142 bits (357),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 82/119 (69%), Gaps = 5/119 (4%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGSS PTIISQGNRFIAP +   +++T R  A    WK W WR
Sbjct  281  FVHVVNNDYTHWIMYAIGGSSHPTIISQGNRFIAPPNQAAKEVTKRDYAPESVWKSWQWR  340

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNL--YDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  MNGA+FVQSG PN   K H     D IKA  G  V  LTRFAG+LNCK+G  C
Sbjct  341  SEGDLMMNGAFFVQSGVPN---KKHGFGKLDMIKAKPGTFVRRLTRFAGSLNCKVGKKC  396



>ref|XP_008446067.1| PREDICTED: pectate lyase-like, partial [Cucumis melo]
Length=381

 Score =   141 bits (356),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 85/117 (73%), Gaps = 3/117 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGS +PTIISQGNRFIAP + + +++T RV A+  +W+ W WR
Sbjct  268  FIHVVNNDYTHWLMYAIGGSHNPTIISQGNRFIAPPNPNSKEVTKRVYASEREWRSWNWR  327

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  MNGA+F+QSG+P    + ++  D I +  G  VT LTRFAG L CK+  PC
Sbjct  328  SEGDLMMNGAFFIQSGNP---IRRYSKKDVIHSKPGTFVTRLTRFAGPLKCKMNQPC  381



>ref|XP_004302354.1| PREDICTED: probable pectate lyase P59-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 81/118 (69%), Gaps = 1/118 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQ-WKQWTW  368
            +FHVVNNDYTHW MYAIGGSS PTIISQGNR++AP D   ++IT R  + PE  WK W W
Sbjct  330  FFHVVNNDYTHWQMYAIGGSSHPTIISQGNRYVAPPDPKLKEITSRAYSTPEAVWKTWQW  389

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RSEGD   NGAYF +SG+P     H + +D I A  G  V  LTRFAG L C++G  C
Sbjct  390  RSEGDLMENGAYFRESGEPRKGRGHFSRFDVINAKPGSFVRRLTRFAGTLGCRVGKAC  447



>ref|XP_011005067.1| PREDICTED: probable pectate lyase P59 [Populus euphratica]
Length=452

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTI+SQGNRFIAP ++H +Q+T R  A   +WK WTWR
Sbjct  338  FFHVVNNDYTHWRMYAIGGSKHPTIVSQGNRFIAPPELHLKQVTKRDYAPESEWKTWTWR  397

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D  MNGA+F++SG P     H      I A  G   T +T FAGAL+CK G  C
Sbjct  398  SENDLMMNGAFFIESGKPRTKRPHKKFM--ITAKPGSLATRMTLFAGALDCKSGRKC  452



>ref|XP_011098576.1| PREDICTED: probable pectate lyase P56 [Sesamum indicum]
Length=465

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 87/118 (74%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPE-QWKQWTW  368
            +FH+VNNDYTHW MYAIGGS   TIISQGNR+IAP    KRQ+THR   +PE +W++WTW
Sbjct  349  FFHLVNNDYTHWLMYAIGGSHHATIISQGNRYIAPPLPDKRQVTHREADSPESEWRKWTW  408

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
             ++ D ++NGAYFV SGDPN  + +  L + I+   G++V  LTRFAGAL C + LPC
Sbjct  409  VTDHDVFLNGAYFVPSGDPNGAATYLAL-EKIRPAPGEQVYDLTRFAGALKCVVSLPC  465



>ref|XP_009360393.1| PREDICTED: probable pectate lyase 3 [Pyrus x bretschneideri]
Length=452

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP++   +Q+THR      +WK W WR
Sbjct  338  FFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIAPANAATKQVTHREHTPESEWKNWEWR  397

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  MNGA+FV+SG  +  S+H    D +    G   T LT+F+GALNC +G PC
Sbjct  398  SEGDLMMNGAFFVESG--SGASQHPAKLDMMPFQPGTFATKLTKFSGALNCVVGKPC  452



>ref|XP_010068708.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
 gb|KCW64557.1| hypothetical protein EUGRSUZ_G02162 [Eucalyptus grandis]
Length=435

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 84/117 (72%), Gaps = 3/117 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGS  PTIISQGNRFIAP D + +++T R  AA + WK W+WR
Sbjct  322  FVHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPLDPNCKEVTKRDYAAEDVWKSWSWR  381

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D  +NGA+FVQSG P    ++ N  + IKA  G  VT LTRFAGALNC  G PC
Sbjct  382  SEDDLMLNGAFFVQSGSP---IRNVNKNNVIKAKPGSFVTRLTRFAGALNCVKGKPC  435



>ref|XP_007137422.1| hypothetical protein PHAVU_009G125800g [Phaseolus vulgaris]
 gb|ESW09416.1| hypothetical protein PHAVU_009G125800g [Phaseolus vulgaris]
Length=439

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHV+NNDYTHW MYAIGGS+ PTI+SQGNRFIAP++   ++ITHRV A PE WK W W+
Sbjct  325  FFHVLNNDYTHWMMYAIGGSAAPTILSQGNRFIAPNNDAAKEITHRVDAEPEVWKNWQWQ  384

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+ D  MNGA F  SG P        L   +K   G  V+ LTR AGALNC +GLPC
Sbjct  385  SDMDLLMNGATFNTSGSPITTQYKKGLL--MKPRDGTHVSRLTRHAGALNCFVGLPC  439



>emb|CDX70590.1| BnaC03g06740D [Brassica napus]
Length=475

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 85/118 (72%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDI-HKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+SQGNRFIAP  + H R++T R  A  E+WK W W
Sbjct  359  FVHVVNNDYTHWELYAIGGSQSPTILSQGNRFIAPPHLPHYREVTKRDYAPEEEWKHWNW  418

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RSE D +MNGAYF QSG+PN+ +  H   + IK   G  V+ LT++AGAL+C++G  C
Sbjct  419  RSEKDIFMNGAYFRQSGNPNYETD-HTRRNMIKPKNGYAVSKLTKYAGALDCRVGRRC  475



>ref|XP_008339934.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 82/117 (70%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP +   +Q+THR      +WK W WR
Sbjct  338  FFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIAPINGVTKQVTHRENTPEAEWKNWEWR  397

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  MNGA+FV+SG  +  SKH    D +    G  V  LT+F+GALNC +G PC
Sbjct  398  SEGDLMMNGAFFVESG--SGASKHPAKLDMMPFKPGTFVATLTKFSGALNCAVGKPC  452



>ref|NP_001057945.1| Os06g0583900 [Oryza sativa Japonica Group]
 dbj|BAD68734.1| putative pectate lyase [Oryza sativa Japonica Group]
 dbj|BAF19859.1| Os06g0583900 [Oryza sativa Japonica Group]
 dbj|BAG93046.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80871.1| hypothetical protein OsI_23497 [Oryza sativa Indica Group]
Length=448

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 82/117 (70%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS +PTIISQGNR+IAP ++  ++IT ++GA  E+WK W W 
Sbjct  334  FFHVVNNDYTHWLMYAIGGSKNPTIISQGNRYIAPPNLAAKRITKQLGATEEEWKNWVWH  393

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D +M GAYF  SG P  + K  +  D IK   G  VT LTRFAG++ C  G PC
Sbjct  394  SEEDLFMEGAYFTTSGGP--IQKQFSNKDLIKPKPGSYVTRLTRFAGSIPCVAGKPC  448



>ref|XP_008366366.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=479

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 80/117 (68%), Gaps = 3/117 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTIISQGNRFIAPS+   +++T R   A  +WK W WR
Sbjct  366  FFHVVNNDYTHWIMYAIGGSQHPTIISQGNRFIAPSNNASKEVTKRTSGAENEWKSWNWR  425

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D  MNGA+FV+SG P    ++    D IKA  G  VT LTRFAG L C  G PC
Sbjct  426  SENDLMMNGAFFVESGSP---IRNLPKADMIKAKPGTFVTRLTRFAGPLKCIKGKPC  479



>ref|NP_001056786.1| Os06g0145100 [Oryza sativa Japonica Group]
 dbj|BAD68408.1| putative pectate lyase homolog [Oryza sativa Japonica Group]
 dbj|BAD68763.1| putative pectate lyase homolog [Oryza sativa Japonica Group]
 dbj|BAF18700.1| Os06g0145100 [Oryza sativa Japonica Group]
 gb|EAZ35810.1| hypothetical protein OsJ_20102 [Oryza sativa Japonica Group]
Length=348

 Score =   139 bits (349),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 86/117 (74%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP D++ +++T R     +++K+W W+
Sbjct  234  FFHVVNNDYTHWLMYAIGGNMNPTIISQGNRFIAPDDLNAKEVTKREYTPYDEYKEWVWK  293

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  MNGA+F +SG  N   + ++  D I A  GK V  LT+FAG LNC +G+PC
Sbjct  294  SQGDVMMNGAFFNESGGQN--ERSYDQLDFIPAKHGKYVGQLTKFAGTLNCHVGMPC  348



>ref|XP_010105747.1| putative pectate lyase P59 [Morus notabilis]
 gb|EXC05967.1| putative pectate lyase P59 [Morus notabilis]
Length=421

 Score =   140 bits (352),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 82/118 (69%), Gaps = 3/118 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTIISQGNRFIAP D++ +Q+T R  A    WK W WR
Sbjct  306  FFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPLDLNAKQVTKRDYAPESDWKNWRWR  365

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFK-GKEVTWLTRFAGALNCKIGLPC  194
            SEGD  MNGA+FVQSG    +SK      G+  +K G  VT LTR+AG L C IG PC
Sbjct  366  SEGDLLMNGAFFVQSG--KRLSKRRYSRPGMIKYKPGTFVTRLTRYAGTLVCGIGRPC  421



>ref|XP_010256490.1| PREDICTED: pectate lyase-like [Nelumbo nucifera]
Length=441

 Score =   139 bits (351),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 82/119 (69%), Gaps = 5/119 (4%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGS  PTIISQGNRFIAP  +  +++T R  A   +WK WTWR
Sbjct  326  FAHVVNNDYTHWIMYAIGGSEHPTIISQGNRFIAPPTLAAKEVTKRDYAPESEWKHWTWR  385

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLY--DGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D  MNGA+FVQSG+P   S+ H     D I A  G  V+ LTRF+GAL CKI  PC
Sbjct  386  SEDDLMMNGAFFVQSGNP---SRKHPFSKKDMIPAKPGTYVSTLTRFSGALGCKINKPC  441



>dbj|BAD68402.1| putative pectate lyase homolog [Oryza sativa Japonica Group]
Length=438

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 86/117 (74%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP D++ +++T R     +++K+W W+
Sbjct  324  FFHVVNNDYTHWLMYAIGGNMNPTIISQGNRFIAPDDLNAKEVTKREYTPYDEYKEWVWK  383

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  MNGA+F +SG  N   + ++  D I A  GK V  LT+FAG LNC +G+PC
Sbjct  384  SQGDVMMNGAFFNESGGQN--ERSYDQLDFIPAKHGKYVGQLTKFAGTLNCHVGMPC  438



>ref|XP_004165454.1| PREDICTED: pectate lyase-like [Cucumis sativus]
 gb|KGN64253.1| hypothetical protein Csa_1G045510 [Cucumis sativus]
Length=439

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 83/117 (71%), Gaps = 3/117 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGS +PTIISQGNRFIAP + + +++T RV A   +W+ W WR
Sbjct  326  FIHVVNNDYTHWLMYAIGGSHNPTIISQGNRFIAPPNPNCKEVTKRVYAPESEWRSWNWR  385

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  MNGA+F+QSG+P    K ++  D I +  G  VT LTRFAG L CK   PC
Sbjct  386  SEGDLMMNGAFFIQSGNP---IKRYSKKDVIHSKPGTFVTRLTRFAGPLKCKKNQPC  439



>ref|XP_002311599.2| pectate lyase family protein [Populus trichocarpa]
 gb|EEE88966.2| pectate lyase family protein [Populus trichocarpa]
Length=441

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS +PTI+SQGNRFIAP++   +++T R  A   +WK W WR
Sbjct  325  FFHVVNNDYTHWMMYAIGGSHNPTIVSQGNRFIAPNNTFAKEVTKRDYAVESEWKNWNWR  384

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+ D  MNGA+FVQSG P   S+  + +  +K+  G  VT LTRF+G+L C  G PC
Sbjct  385  SDNDLMMNGAFFVQSGSPITSSRRISRFHVMKSKPGTFVTRLTRFSGSLGCFKGKPC  441



>ref|NP_001056781.1| Os06g0144200 [Oryza sativa Japonica Group]
 dbj|BAF18695.1| Os06g0144200 [Oryza sativa Japonica Group]
Length=450

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 86/117 (74%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP D++ +++T R     +++K+W W+
Sbjct  336  FFHVVNNDYTHWLMYAIGGNMNPTIISQGNRFIAPDDLNAKEVTKREYTPYDEYKEWVWK  395

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  MNGA+F +SG  N   + ++  D I A  GK V  LT+FAG LNC +G+PC
Sbjct  396  SQGDVMMNGAFFNESGGQN--ERSYDQLDFIPAKHGKYVGQLTKFAGTLNCHVGMPC  450



>gb|EAY99626.1| hypothetical protein OsI_21605 [Oryza sativa Indica Group]
Length=441

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 86/117 (74%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDY HW MYAIGG+ +PTIISQGNRFIAP D++ +++T R     +++K+W W+
Sbjct  327  FFHVVNNDYMHWLMYAIGGNMNPTIISQGNRFIAPDDVNAKEVTKREYTPYDEYKEWVWK  386

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  MNGA+F +SG  N   + ++  D I A  GK V  LT+FAGALNC +G+PC
Sbjct  387  SQGDVMMNGAFFNESGGQN--ERSYDQLDFIPAKHGKYVGQLTKFAGALNCHVGMPC  441



>ref|XP_010915114.1| PREDICTED: LOW QUALITY PROTEIN: pectate lyase-like [Elaeis guineensis]
Length=444

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 82/117 (70%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYT W MYAIGGS  PTIISQGNRF+AP  +  +++T R  A  + WKQWTWR
Sbjct  330  FFHVVNNDYTQWIMYAIGGSQHPTIISQGNRFVAPRMLFSKEVTKRDYATEDVWKQWTWR  389

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD   NGA+F +SG+PN  ++  +  D IKA  G  V  LTRFAG L C+ G PC
Sbjct  390  SEGDLMQNGAFFRESGNPN--ARKFDRKDFIKAKPGTWVRRLTRFAGPLGCRAGRPC  444



>ref|XP_010678579.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=443

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 81/121 (67%), Gaps = 9/121 (7%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHV+NNDYTHW MYAIGGS  PTII QGNRFIAP +I  +++T R  A    WK W W 
Sbjct  328  FFHVLNNDYTHWEMYAIGGSQHPTIICQGNRFIAPPNIFAKEVTKREYAPYSVWKDWLWT  387

Query  364  SEGDTYMNGAYFVQSGD----PNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLP  197
            SE D  MNGA+F QSGD    P++  K     D IKA  G EVT LTRFAGALNCK G  
Sbjct  388  SEDDIMMNGAFFNQSGDTSKKPSYAKK-----DMIKAKPGSEVTHLTRFAGALNCKEGTA  442

Query  196  C  194
            C
Sbjct  443  C  443



>ref|XP_011025954.1| PREDICTED: probable pectate lyase P59 [Populus euphratica]
Length=441

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 82/117 (70%), Gaps = 0/117 (0%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS +PTI+SQGNRFIAP +   +++T R  A   +WK W WR
Sbjct  325  FFHVVNNDYTHWMMYAIGGSHNPTIVSQGNRFIAPGNTFAKEVTKRDYAVESEWKNWNWR  384

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+ D  MNGA+FVQSG P   S+  + +  +K+  G  VT LTRF+G+L C  G PC
Sbjct  385  SDNDLMMNGAFFVQSGSPITSSRRISRFHVMKSKPGTFVTRLTRFSGSLGCFKGKPC  441



>ref|XP_009403112.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=437

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYA+GGS  PTI+SQGNR+IAP  +  +++T R  A    WK WTWR
Sbjct  323  FVHVVNNDYTHWLMYAVGGSQHPTILSQGNRYIAPHSLAAKEVTKRDYAPQAVWKDWTWR  382

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD   NGA+FV+SG PN +    N  D IKA  G  VT LTRF+GALNC  G PC
Sbjct  383  SEGDLMQNGAFFVESGPPNRMK--FNTKDLIKAKPGSFVTRLTRFSGALNCFPGRPC  437



>gb|KHG08946.1| Pectate lyase [Gossypium arboreum]
Length=405

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 82/117 (70%), Gaps = 0/117 (0%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS+ PTIIS+GNR+IAP D + ++IT+R  A   +WK W WR
Sbjct  289  FFHVVNNDYTHWKMYAIGGSTHPTIISEGNRYIAPDDPNTKEITNRNYAPESEWKNWVWR  348

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD YMNGA+F  SG P+  +   +  D IKA     V  LTRFAG LNCK  + C
Sbjct  349  SEGDLYMNGAFFRTSGPPSPPNLSFSEKDVIKAKPATFVRRLTRFAGTLNCKQYVKC  405



>ref|XP_009125036.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 7 [Brassica 
rapa]
Length=470

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 82/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDI-HKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP  I H R++T R  A   +WK W W
Sbjct  354  FVHVVNNDYTHWELYAIGGSQSPTILSHGNRFIAPPHIQHYREVTKRDSAPESEWKNWNW  413

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RSE D +MN AYF QSG+P F+   H+    IK   G  V+ LT++AGAL+C++G PC
Sbjct  414  RSEKDIFMNNAYFRQSGNPKFMCS-HSRQQMIKPKHGVAVSKLTKYAGALDCRVGKPC  470



>ref|XP_007209148.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
 gb|EMJ10347.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
Length=440

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 80/117 (68%), Gaps = 3/117 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTIISQGNRFIAPS+   +++THR  A   +W+ W WR
Sbjct  327  FFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPSNQATKEVTHRNNAQEGEWRSWNWR  386

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D  MNGA+FVQSG P    ++    D I+A  G  VT LTRFAG L C    PC
Sbjct  387  SENDLMMNGAFFVQSGSP---IRNLPKADMIQAKPGSFVTRLTRFAGPLKCVKNKPC  440



>ref|XP_010096345.1| putative pectate lyase 7 [Morus notabilis]
 gb|EXB63820.1| putative pectate lyase 7 [Morus notabilis]
Length=399

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 79/117 (68%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTIISQGNRFIAP +   +Q+T R  A   +WK W WR
Sbjct  284  FFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPPNDAAKQVTKRDYAPESEWKNWQWR  343

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  MNGA+FVQSG      +  +  D IK   G  VT LTR+AG L C +G PC
Sbjct  344  SEGDLLMNGAFFVQSGK-RLSKRRFSRLDMIKYKPGTFVTRLTRYAGTLLCGVGRPC  399



>ref|XP_008239834.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=438

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 80/117 (68%), Gaps = 3/117 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTIISQGNRFIAPS+   +++THR  A   +W+ W WR
Sbjct  325  FFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPSNQATKEVTHRNNAQEGEWRSWNWR  384

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D  MNGA+FVQSG P    ++    D I+A  G  VT LTRFAG L C    PC
Sbjct  385  SENDLMMNGAFFVQSGSP---IRNLPKADMIQAKPGSFVTRLTRFAGPLKCIKNKPC  438



>ref|XP_011013803.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=419

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 80/117 (68%), Gaps = 3/117 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGS  PTIISQGNRFIAP D+  +++T R  A    WK W WR
Sbjct  306  FAHVVNNDYTHWEMYAIGGSQHPTIISQGNRFIAPPDLACKEVTKRDYAVESVWKSWNWR  365

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  +NGA+FVQSG+     K  N    I A  G+ V+ LTRF+GAL+C  G PC
Sbjct  366  SEGDLMLNGAFFVQSGN---AIKTMNKQGVINAMPGRHVSRLTRFSGALDCVRGRPC  419



>dbj|BAD95093.1| pectate lyase like protein [Arabidopsis thaliana]
Length=174

 Score =   132 bits (332),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 81/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  A+  +WK W W
Sbjct  58   FVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYASESEWKNWNW  117

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RSE D +MN AYF QSG+P+F    H+    IK   G  V+ LT++AGAL+C++G  C
Sbjct  118  RSEKDVFMNNAYFRQSGNPHFKCS-HSRQQMIKPKNGMAVSKLTKYAGALDCRVGKAC  174



>ref|XP_007151201.1| hypothetical protein PHAVU_004G026400g [Phaseolus vulgaris]
 gb|ESW23195.1| hypothetical protein PHAVU_004G026400g [Phaseolus vulgaris]
Length=441

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHV+NNDYTHW MYAIGGS+ PTI+SQGNRFIAP++   ++ITHR  A PE+WK W W+
Sbjct  327  FFHVLNNDYTHWMMYAIGGSAGPTILSQGNRFIAPNNDAAKEITHRDYATPEEWKNWQWQ  386

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+ D  MNGA F  SG P  ++  H     +K   G  V+ LTR +GALNC +GLPC
Sbjct  387  SDMDLLMNGATFNSSGSP--IAMKHKKGFIMKPRDGTHVSRLTRHSGALNCFVGLPC  441



>emb|CDY28691.1| BnaCnng05770D [Brassica napus]
Length=469

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 82/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDI-HKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP  + H R++T R  A   +WK W W
Sbjct  353  FVHVVNNDYTHWELYAIGGSQSPTILSHGNRFIAPPHLQHYREVTKRDSAPESEWKNWNW  412

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RSE D +MN AYF QSG+P F+   H+    IK   G  V+ LT++AGAL+C++G PC
Sbjct  413  RSEKDIFMNNAYFRQSGNPKFMCS-HSRQQMIKPKHGVAVSKLTKYAGALDCRVGKPC  469



>ref|XP_007139601.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
 gb|ESW11595.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
Length=444

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 81/117 (69%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHV+NNDYTHW MYAIGGSS PTI+SQGNRFIAP++   +++THR  A P  W++W WR
Sbjct  329  FFHVLNNDYTHWLMYAIGGSSAPTILSQGNRFIAPNNNAAKEVTHRDYAEPSVWEKWQWR  388

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D +MNGA FVQSG P       N    +K   G +   LTRFAGALNCK   PC
Sbjct  389  SENDVFMNGANFVQSGPP-LGKLPFNKGFLMKPRHGSQANRLTRFAGALNCKANSPC  444



>ref|XP_002520133.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF42188.1| Pectate lyase precursor, putative [Ricinus communis]
Length=440

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTIISQGNRFIAP++I  +++T R  +   +WK W WR
Sbjct  326  FFHVVNNDYTHWLMYAIGGSRKPTIISQGNRFIAPNNIFSKEVTKREYSLESEWKNWNWR  385

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+ D  MNGA FV+SG P  ++   +    IKA  G  VT LTR++GAL+C +G PC
Sbjct  386  SDRDLMMNGAVFVESGKP--ITHDFSRLQLIKAKPGTFVTRLTRYSGALDCFVGKPC  440



>ref|XP_002270089.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32015.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   137 bits (345),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 85/121 (70%), Gaps = 5/121 (4%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDI----HKRQITHRVGAAPEQWKQ  377
            +FHVVNNDYTHWNMYAIGGS+ PTIISQGNR+ AP  +      +Q+T R  A   +WK+
Sbjct  324  FFHVVNNDYTHWNMYAIGGSAHPTIISQGNRYTAPHLVDPKHDAKQVTKRDYAMESEWKK  383

Query  376  WTWRSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLP  197
            WTWRSEGD   NGA+FV SG+P+    +  L D IKA  G  V+ LTRF+GAL C+ G P
Sbjct  384  WTWRSEGDLMRNGAFFVPSGNPSKRMPYSRL-DMIKAKPGTYVSRLTRFSGALTCRRGGP  442

Query  196  C  194
            C
Sbjct  443  C  443



>ref|XP_010492335.1| PREDICTED: probable pectate lyase 19 [Camelina sativa]
Length=499

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 83/118 (70%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  A  ++WK WTW
Sbjct  383  FVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYAPEDEWKHWTW  442

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RSE D +MNGAYF QSG+P+F S  H     IK   G  V+ LT++AGAL+C++G  C
Sbjct  443  RSEKDVFMNGAYFRQSGNPHFKSA-HTRKQMIKPKNGMAVSKLTKYAGALDCRVGKRC  499



>ref|XP_004489168.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=444

 Score =   137 bits (345),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 84/119 (71%), Gaps = 5/119 (4%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHV+NNDYTHW MYAIGGSS PTI+SQGNRFIAP++   + ITHR  A+ + W +W WR
Sbjct  329  FFHVLNNDYTHWLMYAIGGSSGPTILSQGNRFIAPNNNAAKTITHRDYASQDVWSKWQWR  388

Query  364  SEGDTYMNGAYFVQSGDP--NFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D +MNGA F++SG P  N   K   L   +K   G +   LTR+AGALNC+IG PC
Sbjct  389  SENDLFMNGATFIESGAPIKNLPFKKGYL---MKPRPGTQANRLTRYAGALNCQIGRPC  444



>ref|XP_003543726.1| PREDICTED: pectate lyase [Glycine max]
Length=443

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HV+NNDYTHW MYAIGGSS PTI+SQGNRFIAP++ + ++ITHR  A P+ WK W W+
Sbjct  329  FVHVLNNDYTHWLMYAIGGSSGPTILSQGNRFIAPNNDNAKEITHRDYAGPDVWKNWQWQ  388

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D +MNGA FV SG P  ++    L   +K   G  V+ LTR AGALNC +G PC
Sbjct  389  SEMDLFMNGAKFVTSGSPIKMTYKKGLI--MKPRDGTHVSRLTRHAGALNCFVGKPC  443



>gb|ACU23277.1| unknown [Glycine max]
Length=443

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HV+NNDYTHW MYAIGGSS PTI+SQGNRFIAP++ + ++ITHR  A P+ WK W W+
Sbjct  329  FVHVLNNDYTHWLMYAIGGSSGPTILSQGNRFIAPNNDNAKEITHRDYAGPDVWKNWQWQ  388

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D +MNGA FV SG P  ++    L   +K   G  V+ LTR AGALNC +G PC
Sbjct  389  SEMDLFMNGAKFVTSGSPIKMTYKKGLI--MKPRDGTHVSRLTRHAGALNCFVGKPC  443



>gb|KHN13240.1| Putative pectate lyase 3 [Glycine soja]
Length=446

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HV+NNDYTHW MYAIGGSS PTI+SQGNRFIAP++ + ++ITHR  A P+ WK W W+
Sbjct  332  FVHVLNNDYTHWLMYAIGGSSGPTILSQGNRFIAPNNDNAKEITHRDYAGPDVWKNWQWQ  391

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D +MNGA FV SG P  ++    L   +K   G  V+ LTR AGALNC +G PC
Sbjct  392  SEMDLFMNGAKFVTSGSPIKMTYKKGLI--MKPRDGTHVSRLTRHAGALNCFVGKPC  446



>ref|XP_010550068.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=469

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 82/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHK-RQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP  I + +++T R  A   +WK W W
Sbjct  353  FVHVVNNDYTHWELYAIGGSQSPTILSHGNRFIAPPHIPQYKEVTKRDYAPEAEWKNWNW  412

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RSE D +MNGA+F QSG+PNF    H     IK   G  V+ LT++AGAL+CK+G PC
Sbjct  413  RSERDIFMNGAFFRQSGNPNFRCT-HTRQQMIKPKHGLAVSMLTKYAGALDCKVGRPC  469



>ref|XP_010925369.1| PREDICTED: pectate lyase [Elaeis guineensis]
Length=444

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTIISQGNRFIAP     +++T R  A  + WKQWTWR
Sbjct  330  FFHVVNNDYTHWMMYAIGGSKHPTIISQGNRFIAPPLRFAKEVTKRDYATEDVWKQWTWR  389

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD   NGA+F +SG PN  + H    D I+A  G  V  LTRFAG L CK G  C
Sbjct  390  SEGDLMQNGAFFRESGTPNTRTFHRK--DFIRAKPGTWVRRLTRFAGPLGCKAGRAC  444



>dbj|BAJ99909.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 80/117 (68%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGSS+PTIISQGNR+IAP ++  +Q+T R  A    WK W WR
Sbjct  188  FFHVVNNDYTHWLMYAIGGSSEPTIISQGNRYIAPPNMAAKQVTKRDYAPEAVWKNWVWR  247

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  MN A+F  SG    +S+  N  D IK   G+ VT LTRF+G L CK G  C
Sbjct  248  SEGDLMMNNAFFQTSGGQ--ISQKLNGKDLIKPKPGEYVTRLTRFSGTLACKPGCAC  302



>emb|CDX74293.1| BnaA03g27540D [Brassica napus]
Length=471

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 82/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDI-HKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP  I H R++T R  A   +WK W W
Sbjct  355  FVHVVNNDYTHWELYAIGGSQSPTILSHGNRFIAPPHIQHYREVTKRDYAPESEWKNWNW  414

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RS+ D +MN AYF QSG+P F+   H+    IK   G  V+ LT++AGAL+C++G PC
Sbjct  415  RSDKDIFMNNAYFRQSGNPKFMCS-HSRQQMIKPKHGSAVSKLTKYAGALDCRVGKPC  471



>ref|XP_007037229.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY21730.1| Pectate lyase family protein [Theobroma cacao]
Length=434

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 80/117 (68%), Gaps = 3/117 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGS+ PTI+SQGNRFIAP +I  +++T R  A   +WK W WR
Sbjct  321  FIHVVNNDYTHWLMYAIGGSNQPTILSQGNRFIAPPNIACKEVTKREYAPESEWKSWNWR  380

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D  MNGA+FVQSG P       N  D IKA  G  VT LTRF+GAL+C    PC
Sbjct  381  SENDLMMNGAFFVQSGSP---IGRGNRQDVIKAKPGTFVTRLTRFSGALHCFKNKPC  434



>emb|CDX91953.1| BnaC03g32550D [Brassica napus]
Length=471

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 82/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDI-HKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP  I H R++T R  A   +WK W W
Sbjct  355  FVHVVNNDYTHWELYAIGGSQSPTILSHGNRFIAPPHIQHYREVTKRDYAPESEWKNWNW  414

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RS+ D +MN AYF QSG+P F+   H+    IK   G  V+ LT++AGAL+C++G PC
Sbjct  415  RSDKDIFMNNAYFRQSGNPKFMCS-HSRQQMIKPKHGSAVSKLTKYAGALDCRVGKPC  471



>ref|XP_006656188.1| PREDICTED: pectate lyase-like [Oryza brachyantha]
Length=446

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 80/117 (68%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS +PTIISQGNR+IAP ++  +QIT ++GA   +WK W W 
Sbjct  332  FFHVVNNDYTHWLMYAIGGSKNPTIISQGNRYIAPPNLAAKQITKQLGAEESEWKNWVWH  391

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D +M GAYF  SG    +    N  D IK   G  VT LTRFAG++ C+ G PC
Sbjct  392  SEEDLFMEGAYFTTSGGA--IRTSINKKDLIKPKPGSYVTRLTRFAGSIPCRPGKPC  446



>ref|XP_007227702.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
 gb|EMJ28901.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
Length=446

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 80/117 (68%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS +PTIISQGNRFIAP +   +++T R   A  +WK W WR
Sbjct  332  FFHVVNNDYTHWLMYAIGGSMNPTIISQGNRFIAPPNQGAKEVTKRDHTAEAEWKNWEWR  391

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  MNGA FVQSG     SKH    D +    G  V  LT+F+GAL+C +G PC
Sbjct  392  SEGDLMMNGAVFVQSGSGK--SKHPAKMDLMPFKPGTYVAKLTKFSGALDCFVGKPC  446



>ref|XP_010417138.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=169

 Score =   130 bits (327),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 81/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  A   +WK W W
Sbjct  53   FVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYAPEAEWKNWNW  112

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RSE D ++NGAYF QSG+P+F    H+    IK   G  V+ LT++AGAL+C++G  C
Sbjct  113  RSEKDYFLNGAYFRQSGNPHFKCS-HSRQQMIKPKHGVAVSKLTKYAGALDCRVGKAC  169



>ref|XP_008221658.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=443

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 82/117 (70%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS +PTIISQGNRFIA  +   +++T R   A  +WK W W+
Sbjct  329  FFHVVNNDYTHWLMYAIGGSMNPTIISQGNRFIAGLNSAAKEVTKREYTAEAEWKNWLWK  388

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD +MNGA+FV+SG P   +   +  D I    G  VT LT+FAGAL+C +G PC
Sbjct  389  SEGDLFMNGAFFVESGSP--ANLRADKLDMIPFKPGTYVTKLTKFAGALDCFVGKPC  443



>ref|XP_007032453.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY03379.1| Pectate lyase family protein [Theobroma cacao]
Length=454

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 79/117 (68%), Gaps = 0/117 (0%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTIISQGNRFIAP+D   ++IT+R  A    W+ W WR
Sbjct  338  FFHVVNNDYTHWKMYAIGGSQHPTIISQGNRFIAPNDPWAKEITNRNYAPESVWRHWVWR  397

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD +MNGA+F  SG P      +N    IKA     V  LTRF+GALNCK  + C
Sbjct  398  SEGDLFMNGAFFRTSGPPAPPHLKYNKLQMIKAKPATFVRRLTRFSGALNCKKRVKC  454



>ref|XP_006655782.1| PREDICTED: pectate lyase-like [Oryza brachyantha]
Length=351

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 84/117 (72%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGG+ +PTIISQGNRF AP D   +++T R   A E++K+W W+
Sbjct  237  FFHVVNNDYTHWMMYAIGGNMNPTIISQGNRFRAPDDGELKEVTKREYTAYEEYKEWVWK  296

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD ++NGA+F QSG  N   + ++  D I A  G  V  LT+FAG LNC++G PC
Sbjct  297  SQGDLFLNGAFFNQSGGRN--ERRYDQLDFIPAKHGSYVGQLTQFAGTLNCRVGHPC  351



>ref|XP_009134622.1| PREDICTED: probable pectate lyase 7 [Brassica rapa]
Length=471

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 82/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDI-HKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP  + H R++T R  A   +WK W W
Sbjct  355  FVHVVNNDYTHWELYAIGGSQSPTILSHGNRFIAPPHLQHYREVTKRDYAPESEWKNWNW  414

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RS+ D +MN AYF QSG+P F+   H+    IK   G  V+ LT++AGAL+C++G PC
Sbjct  415  RSDKDIFMNNAYFRQSGNPKFMCS-HSRQQMIKPKHGSAVSTLTKYAGALDCRVGKPC  471



>ref|XP_004489374.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=447

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 80/117 (68%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGSS PTI+SQGNRFIAP +   ++ITHR  A PE WK W W+
Sbjct  332  FVHVVNNDYTHWQMYAIGGSSGPTILSQGNRFIAPDNDAAKEITHRDYAEPEVWKNWQWQ  391

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D +MNGA FV SG P   +     +  +K   G  V+ LTR +GALNC +G PC
Sbjct  392  SEMDLFMNGAKFVTSGSPINKAPFKKGFI-MKPRDGSHVSRLTRHSGALNCVVGKPC  447



>ref|XP_004155392.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=432

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 82/117 (70%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTI+SQGNRFIAP +++ +++T R  +  + WK WTWR
Sbjct  317  FFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNVYAKEVTKREYSPEQVWKSWTWR  376

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  MNGA+FV SGD +   +  +  D I    G  V  +TRFAG+L C +G PC
Sbjct  377  SEGDLMMNGAFFVTSGDQS-KRRPFSRMDMISYKPGTYVKRMTRFAGSLACFVGRPC  432



>ref|XP_006374492.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
 gb|ERP52289.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
Length=435

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 79/117 (68%), Gaps = 3/117 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGS  PTIISQGNRF+AP D   +++T R  A    WK W WR
Sbjct  322  FVHVVNNDYTHWEMYAIGGSQHPTIISQGNRFVAPPDPACKEVTKRDYAVESVWKSWNWR  381

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  +NGA+FVQSG+     K  N    I A  G+ V+ LTRF+GALNC  G PC
Sbjct  382  SEGDLMLNGAFFVQSGN---AIKTMNKQAVISAKPGRYVSRLTRFSGALNCVRGRPC  435



>ref|XP_006842121.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
 gb|ERN03796.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
Length=438

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 82/117 (70%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYA+GGS  PTIISQGNR+IAP+  + +++T R  A+ + WKQWTWR
Sbjct  324  FFHVVNNDYTHWGMYAVGGSQHPTIISQGNRYIAPTANYAKEVTKRDYASEDVWKQWTWR  383

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD   NGA+F +SG P+  +  +   D I A  G  V  LTRFAGAL CK   PC
Sbjct  384  SEGDVMKNGAFFRESGPPS--TDKYTRQDKITAKPGTFVGRLTRFAGALVCKRKSPC  438



>ref|XP_004135462.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
 gb|KGN51889.1| hypothetical protein Csa_5G604340 [Cucumis sativus]
Length=432

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 82/117 (70%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTI+SQGNRFIAP +++ +++T R  +  + WK WTWR
Sbjct  317  FFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNVYAKEVTKREYSPEQVWKSWTWR  376

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  MNGA+FV SGD +   +  +  D I    G  V  +TRFAG+L C +G PC
Sbjct  377  SEGDLMMNGAFFVTSGDQS-KRRPFSRMDMISYKPGTYVKRMTRFAGSLACFVGRPC  432



>ref|XP_007046218.1| Pectate lyase family protein, putative [Theobroma cacao]
 gb|EOY02050.1| Pectate lyase family protein, putative [Theobroma cacao]
Length=441

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 82/117 (70%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGSS PTIISQGNRF+AP +   +++T R  A PE WK W+WR
Sbjct  326  FIHVVNNDYTHWLMYAIGGSSHPTIISQGNRFVAPPNAAAKEVTKRDYAPPEVWKNWSWR  385

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  +NGA+F QSGDP    +    +  I A  G+ V+ LTR++G+L+C    PC
Sbjct  386  SEGDLMVNGAFFTQSGDPRASRRFLGNF-MISAKPGQMVSLLTRYSGSLDCVRRRPC  441



>ref|XP_008793504.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=446

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 78/117 (67%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYT W MYAIGGS  PTIISQGNRFIAP     +++T R  A  + WKQWTWR
Sbjct  332  FVHVVNNDYTQWIMYAIGGSQHPTIISQGNRFIAPLMQFAKEVTKRDYATEDVWKQWTWR  391

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD   NGA+F +SG PN  S H    D IKA  G  V  LTRFAG L C+ G PC
Sbjct  392  SEGDLMQNGAFFRESGSPNTKSFHRK--DFIKAKPGTWVRRLTRFAGPLGCRAGRPC  446



>dbj|BAK05605.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=448

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGG+ DPTIISQGNRFIAP D + +++T R      ++K W W+
Sbjct  334  FFHVVNNDYTHWKMYAIGGNRDPTIISQGNRFIAPDDPNAKEVTKREYTPYNEYKDWVWK  393

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  MNGA+F QSG  N   + +   D I A  GK V  LT+FAG L C++G PC
Sbjct  394  SQGDVMMNGAFFNQSGGQN--ERTYGNMDFIPAKHGKYVGQLTQFAGTLECRVGKPC  448



>ref|XP_007224275.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
 gb|EMJ25474.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
Length=443

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 82/117 (70%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS +PTIISQGNRFIA  +   +++T R   A  +WK W W+
Sbjct  329  FFHVVNNDYTHWLMYAIGGSMNPTIISQGNRFIAGLNSATKEVTKREYTAEAEWKNWLWK  388

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD +MNGA+FV+SG P   +   +  D I    G  VT +T+FAGAL+C +G PC
Sbjct  389  SEGDLFMNGAFFVESGSP--ANLRADKLDMIPFKPGTYVTKMTKFAGALDCFVGKPC  443



>ref|XP_008446316.1| PREDICTED: probable pectate lyase P59 [Cucumis melo]
Length=432

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 82/121 (68%), Gaps = 9/121 (7%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTI+SQGNRFIAP +++ +++T R  +  + WK WTWR
Sbjct  317  FFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNVYAKEVTKREYSPEQVWKSWTWR  376

Query  364  SEGDTYMNGAYFVQSGDPN----FVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLP  197
            SEGD  MNGA+FV SGD      F SK     D I    G  V  +TRF+GAL C +G P
Sbjct  377  SEGDLMMNGAFFVTSGDQRKRRPFSSK-----DMISYKPGTYVKRMTRFSGALACFVGRP  431

Query  196  C  194
            C
Sbjct  432  C  432



>ref|XP_003563707.1| PREDICTED: pectate lyase-like [Brachypodium distachyon]
Length=448

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 82/117 (70%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS DPTI+SQGNR+IAP ++  +QIT ++GAA  +WK W W 
Sbjct  334  FFHVVNNDYTHWLMYAIGGSKDPTILSQGNRYIAPPNLAAKQITKQIGAAEPEWKNWVWH  393

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+ D  MNGA+F ++G    + +  +  D IK   G  VT LTR+AG + C+ G PC
Sbjct  394  SQEDLLMNGAFFTETGGD--IKRKFDKDDLIKPKPGTYVTRLTRYAGCIPCRPGKPC  448



>gb|KDP45476.1| hypothetical protein JCGZ_09725 [Jatropha curcas]
Length=462

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 84/117 (72%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW +YAIGGS  PTI+SQGN+F+AP D + +++T R  A   +WK+W WR
Sbjct  347  FFHVVNNDYTHWLLYAIGGSMHPTIVSQGNQFVAPDDKYIKEVTKRDYAPMSEWKKWNWR  406

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  +NGA+FV+SG+P    +    +  IKA  G+  T +TRFAGAL+CK G  C
Sbjct  407  SEGDLMVNGAFFVESGEPALHLRPSKKF-MIKAKHGRFATQMTRFAGALDCKYGKKC  462



>gb|EMS65801.1| hypothetical protein TRIUR3_32637 [Triticum urartu]
Length=273

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +F VVNNDYTHW MYAIGG+ DPTIISQGNRFIAP D + +++T R  A   ++K W W+
Sbjct  159  FFQVVNNDYTHWQMYAIGGNRDPTIISQGNRFIAPDDGNAKEVTKREYAPYTEYKDWVWK  218

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  +NGA+F +SG  N   + +   D I A  G+ V  LTRFAG L+C IG PC
Sbjct  219  SQGDVMVNGAFFNESGGQN--ERRYGNMDFIPAKHGRYVGQLTRFAGVLDCGIGKPC  273



>gb|AAA86241.1| pectate lyase homolog [Medicago sativa]
Length=450

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 81/119 (68%), Gaps = 5/119 (4%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHV+NNDYTHW MYAIGGSS PTI+SQGNRFIAP +   + +THR  A    W +W WR
Sbjct  335  FFHVLNNDYTHWIMYAIGGSSAPTILSQGNRFIAPHNNAAKTVTHRDYAPESVWSKWQWR  394

Query  364  SEGDTYMNGAYFVQSGDP--NFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD +MNGA F+QSG P  N   K   L   +K   G +   LTRF+GALNC +G PC
Sbjct  395  SEGDHFMNGATFIQSGPPIKNLPFKKGFL---MKPRHGSQANRLTRFSGALNCVVGRPC  450



>emb|CDX85564.1| BnaA02g02490D [Brassica napus]
Length=473

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 82/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  A+  +WK W W
Sbjct  357  FVHVVNNDYTHWELYAIGGSQAPTILSHGNRFIAPPHKPHYREVTKRDYASEHEWKHWNW  416

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RS+ D +MNGAYF QSG+P+F   HH     IK   G  V+ LT++AGAL+C++G  C
Sbjct  417  RSDKDMFMNGAYFRQSGNPHFKC-HHTRKQMIKPKHGIAVSMLTKYAGALDCRVGKRC  473



>ref|XP_009121613.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
 emb|CDX69550.1| BnaA10g18990D [Brassica napus]
Length=499

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 85/118 (72%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDI-HKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP  + + +++T R  A+ ++WK WTW
Sbjct  383  FVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHLPYYKEVTKRDYASEDEWKHWTW  442

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RSE D +MNGA+F QSGDP++ S  H     IK   G  V+ LT++AGAL+C++G  C
Sbjct  443  RSEKDIFMNGAFFRQSGDPHYKSA-HTRKQMIKPKNGYAVSKLTKYAGALDCRVGRRC  499



>ref|XP_009126031.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
Length=481

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 82/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  A+  +WK W W
Sbjct  365  FVHVVNNDYTHWELYAIGGSQAPTILSHGNRFIAPPHKPHYREVTKRDYASEHEWKHWNW  424

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RS+ D +MNGAYF QSG+P+F   HH     IK   G  V+ LT++AGAL+C++G  C
Sbjct  425  RSDKDMFMNGAYFRQSGNPHFKC-HHTRKQMIKPKHGIAVSMLTKYAGALDCRVGKRC  481



>ref|XP_008221660.1| PREDICTED: probable pectate lyase 3 [Prunus mume]
Length=443

 Score =   134 bits (337),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS +PTIISQGNRFIAP +   +++T R      +WK+W WR
Sbjct  329  FFHVVNNDYTHWLMYAIGGSMNPTIISQGNRFIAPPNQGAKEVTKRDHTPEAEWKKWEWR  388

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  MNGA FVQSG     S H    D +    G  V  LT+FAGAL+C +G PC
Sbjct  389  SEGDLMMNGAIFVQSGSGK--SNHPAKMDLMPFKPGTYVAELTKFAGALDCFVGKPC  443



>ref|XP_006286712.1| hypothetical protein CARUB_v10002862mg [Capsella rubella]
 gb|EOA19610.1| hypothetical protein CARUB_v10002862mg [Capsella rubella]
Length=512

 Score =   135 bits (339),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 81/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  A+ ++WK W W
Sbjct  396  FVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYASEDEWKHWNW  455

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RSE D +MNGAYF QSGDP +    H     IK   G  V+ LT++AGAL+C++G  C
Sbjct  456  RSEKDVFMNGAYFRQSGDPKYKCA-HTRQQMIKPKHGLAVSKLTKYAGALDCRVGKRC  512



>ref|XP_002437815.1| hypothetical protein SORBIDRAFT_10g003090 [Sorghum bicolor]
 gb|EER89182.1| hypothetical protein SORBIDRAFT_10g003090 [Sorghum bicolor]
Length=444

 Score =   134 bits (337),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP D + +++T R   A + +K+W W+
Sbjct  330  FFHVVNNDYTHWIMYAIGGNKNPTIISQGNRFIAPDDPNAKEVTKREYTAYKDYKEWVWK  389

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  MNGA+F +SG  N   + ++  D I A  G+ V  LTRFAG L C +G PC
Sbjct  390  SQGDVMMNGAFFNESGGQN--ERKYDELDFIPAKHGRYVGQLTRFAGPLKCIVGQPC  444



>gb|KHN08855.1| Putative pectate lyase P59 [Glycine soja]
Length=435

 Score =   134 bits (337),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 81/117 (69%), Gaps = 4/117 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FH+VNNDYTHW MYAIGGS  PTIISQGNRFIAP+D + +++T R  A    WK W WR
Sbjct  323  FFHIVNNDYTHWLMYAIGGSQQPTIISQGNRFIAPNDRNAKEVTKRDYAPESVWKNWNWR  382

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  MNGA+FVQSG    V+K  N    I A  GK V+ LTRFAG L C++   C
Sbjct  383  SEGDLLMNGAFFVQSGKN--VAK--NPKAEIIAKPGKAVSSLTRFAGPLKCEVNKSC  435



>ref|XP_009389712.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=438

 Score =   134 bits (337),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 83/117 (71%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYA+GGS  PTIISQGNR+IAPS+   +++T R  A    WKQWTWR
Sbjct  323  FVHVVNNDYTHWEMYAVGGSQHPTIISQGNRYIAPSNPFAKEVTKRDYATESVWKQWTWR  382

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  +NGA+FV+SG    + K ++  D IKA  G  VT LTR++GAL+C    PC
Sbjct  383  SEGDLMLNGAFFVKSGGGGGLQK-YDKTDIIKAKPGSFVTRLTRYSGALDCFPQRPC  438



>ref|XP_010445460.1| PREDICTED: probable pectate lyase 15 [Camelina sativa]
Length=170

 Score =   128 bits (322),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 75/117 (64%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            YFHVVNNDYTHW MYAIGGS++PTI SQGNR+ AP D   +++T RV     +WK+W WR
Sbjct  56   YFHVVNNDYTHWEMYAIGGSAEPTINSQGNRYAAPMDRFAKEVTKRVETDASEWKKWNWR  115

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  +NGAYF  SG+    S  +     + A     V  +T  AGAL C+ G PC
Sbjct  116  SEGDLLLNGAYFRSSGEE--ASASYGRASSLAAKPSSMVDTITSTAGALGCRKGRPC  170



>emb|CDY63769.1| BnaCnng42620D [Brassica napus]
Length=479

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 82/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRF+AP    H R++T R  A+  +WK W W
Sbjct  363  FVHVVNNDYTHWELYAIGGSQAPTILSHGNRFVAPPHKPHYREVTKRDYASEHEWKHWNW  422

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RS+ D +MNGAYF QSG+P+F   HH     IK   G  V+ LT++AGAL+C++G  C
Sbjct  423  RSDKDMFMNGAYFRQSGNPHFKC-HHTRKQMIKPKHGIAVSMLTKYAGALDCRVGKRC  479



>ref|XP_004966014.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=486

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 80/117 (68%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTIISQGNR+IAP ++  +Q+T +  A   +WK W W 
Sbjct  372  FFHVVNNDYTHWLMYAIGGSKAPTIISQGNRYIAPPNLAAKQVTKQHDAPESEWKNWVWH  431

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D +M GAYF  +G    +++  N  D IK   G  VT LTRFAG+L+CK G PC
Sbjct  432  SEDDLFMEGAYFTVTGGQ--INRQFNKKDLIKPKPGSYVTRLTRFAGSLDCKPGKPC  486



>ref|XP_003621115.1| Pectate lyase [Medicago truncatula]
 gb|AES77333.1| pectate lyase P59-like protein [Medicago truncatula]
Length=451

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 80/119 (67%), Gaps = 5/119 (4%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHV+NNDYTHW MYAIGGSS PTI+SQGNRFIAP +   + ITHR  A    W +W WR
Sbjct  336  FFHVLNNDYTHWIMYAIGGSSAPTILSQGNRFIAPHNNAAKTITHRDYAPEAVWSKWQWR  395

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDG--IKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD +MNGA F+QSG P    K      G  +K   G +   LTRF+GALNC +G PC
Sbjct  396  SEGDHFMNGANFIQSGPP---IKSLPFKKGFLMKPRHGSQANRLTRFSGALNCVVGRPC  451



>emb|CDY66593.1| BnaCnng51570D [Brassica napus]
Length=499

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 84/118 (71%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDI-HKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP  + + +++T R  A  ++WK WTW
Sbjct  383  FVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHLPYYKEVTKRDYALEDEWKHWTW  442

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RSE D +MNGA+F QSGDP++ S  H     IK   G  V+ LT++AGAL+C++G  C
Sbjct  443  RSEKDIFMNGAFFRQSGDPHYKSA-HTRKQMIKPKNGYAVSKLTKYAGALDCRVGKRC  499



>gb|AGT16687.1| pectate lyase [Saccharum hybrid cultivar R570]
Length=441

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP D + +++T R     + +K+W W+
Sbjct  327  FFHVVNNDYTHWLMYAIGGNKNPTIISQGNRFIAPDDPNAKEVTKREYTPYKDYKEWVWK  386

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  MNGA+F +SG  N   + ++ +D I A  G+ V  LTRFAG L C +G PC
Sbjct  387  SQGDVMMNGAFFNESGGQN--ERKYDKFDFIPAKHGRYVGQLTRFAGPLKCIVGQPC  441



>ref|XP_010420163.1| PREDICTED: probable pectate lyase 19 isoform X1 [Camelina sativa]
Length=499

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 81/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  A  ++WK W W
Sbjct  383  FVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYAPEDEWKHWIW  442

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RSE D +MNGAYF QSG+P+F    H     IK   G  V+ LT++AGAL+C++G  C
Sbjct  443  RSEKDVFMNGAYFRQSGNPHFKCA-HTRKQMIKPKNGMAVSKLTKYAGALDCRVGKRC  499



>gb|AAA16476.1| pectate lyase homolog [Zea mays]
 gb|AFW85884.1| hypothetical protein ZEAMMB73_308319 [Zea mays]
Length=438

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP D + +++T R     + +K+W W+
Sbjct  324  FFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIAPDDPNAKEVTKREYTPYKDYKEWVWK  383

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  MNGA+F +SG  N   + ++ +D I A  G+ V  LTRFAG L C +G PC
Sbjct  384  SQGDVMMNGAFFNESGGQN--ERKYDRFDFIPAKHGRYVGQLTRFAGPLKCIVGQPC  438



>ref|XP_010420165.1| PREDICTED: probable pectate lyase 19 isoform X3 [Camelina sativa]
Length=506

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 81/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  A  ++WK W W
Sbjct  390  FVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYAPEDEWKHWIW  449

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RSE D +MNGAYF QSG+P+F    H     IK   G  V+ LT++AGAL+C++G  C
Sbjct  450  RSEKDVFMNGAYFRQSGNPHFKCA-HTRKQMIKPKNGMAVSKLTKYAGALDCRVGKRC  506



>emb|CDP14850.1| unnamed protein product [Coffea canephora]
Length=435

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 79/120 (66%), Gaps = 8/120 (7%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGS  PTI+SQGNRFIAP + + +++T R  A    WK W W+
Sbjct  321  FVHVVNNDYTHWLMYAIGGSQHPTILSQGNRFIAPENPYAKEVTKRDYAPESVWKDWVWK  380

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNL---YDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  MNGA+FVQSGDPN     HN     D I    G+    LTRFAGALNC    PC
Sbjct  381  SQGDLMMNGAFFVQSGDPN-----HNFGSNADLIGPKPGEFANRLTRFAGALNCIAKRPC  435



>ref|XP_010420164.1| PREDICTED: probable pectate lyase 19 isoform X2 [Camelina sativa]
Length=472

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 81/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  A  ++WK W W
Sbjct  356  FVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYAPEDEWKHWIW  415

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RSE D +MNGAYF QSG+P+F    H     IK   G  V+ LT++AGAL+C++G  C
Sbjct  416  RSEKDVFMNGAYFRQSGNPHFKCA-HTRKQMIKPKNGMAVSKLTKYAGALDCRVGKRC  472



>ref|XP_004964534.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=438

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP D + +++T R      ++K W W+
Sbjct  324  FFHVVNNDYTHWQMYAIGGNKNPTIISQGNRFIAPDDPNAKEVTKREYTPYSEYKDWVWK  383

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  MNGA+F +SG  N   + ++  D I A  G  V  LT+FAG LNC+ G PC
Sbjct  384  SQGDVMMNGAFFNESGGQN--ERKYDQLDFIPARHGSYVGELTKFAGTLNCRAGKPC  438



>ref|XP_010670318.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=450

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHV+NNDYTHW MYAIGG+S PTIISQGNRFIAP +   + IT+R     + WK+W WR
Sbjct  336  FFHVLNNDYTHWIMYAIGGTSHPTIISQGNRFIAPPNPTAKMITNRNNVVGDDWKKWIWR  395

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D ++NGAYFV+SG P  + +     D IKA  G  V  LTRF+G L C++G  C
Sbjct  396  SENDQFVNGAYFVESGHP--LDETRFKKDFIKAKPGTYVRRLTRFSGQLRCRVGQSC  450



>ref|XP_009369346.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=441

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 78/117 (67%), Gaps = 3/117 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTIISQGNRFIAP +   +++T R  AA   WK W WR
Sbjct  328  FFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPLNEASKEVTKREYAAENVWKSWNWR  387

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D  MNGA+FV+SG P    ++    D I+A  G  V  LTRFAG L C  G PC
Sbjct  388  SENDLMMNGAFFVESGSP---IRNLPEADMIQAKPGTFVAKLTRFAGPLKCIKGKPC  441



>ref|XP_010453638.1| PREDICTED: probable pectate lyase 19 [Camelina sativa]
Length=490

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 81/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  A  ++WK W W
Sbjct  374  FVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYAPEDEWKHWNW  433

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RSE D +MNGAYF QSG+P+F    H     IK   G  V+ LT++AGAL+C++G  C
Sbjct  434  RSEKDVFMNGAYFRQSGNPHFKCT-HTRKQMIKHKNGMAVSKLTKYAGALDCRVGKRC  490



>ref|XP_008456459.1| PREDICTED: pectate lyase-like [Cucumis melo]
Length=434

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 78/118 (66%), Gaps = 1/118 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTI+SQGNRFIAP + + +Q+T R  A  ++WK W+WR
Sbjct  317  FFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNPNAKQVTKREYAMEDEWKHWSWR  376

Query  364  SEGDTYMNGAYFVQSGDPNFVSKH-HNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  MNGA F+ SGD     K   + YD I    G  V  L RF+G L C  G PC
Sbjct  377  SEGDELMNGAVFIPSGDQTKGKKKGLSRYDMISFKPGTYVRRLARFSGTLECTPGKPC  434



>gb|KHG05193.1| hypothetical protein F383_30875 [Gossypium arboreum]
Length=385

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 80/117 (68%), Gaps = 0/117 (0%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            YFHVVNNDYTHW +YAIGGS+ PTIISQGNRFIAP D   ++ITHR  A   +W+ W WR
Sbjct  269  YFHVVNNDYTHWKLYAIGGSTHPTIISQGNRFIAPDDPLTKEITHRNYAPESEWRNWIWR  328

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD +MNGA+FV SG P+         D IKA     V  LT+F+G L CK G+ C
Sbjct  329  SEGDRFMNGAFFVTSGPPSPPHLKLKKKDIIKAKPAIFVGRLTKFSGTLKCKEGVKC  385



>ref|XP_002871648.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47907.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=472

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 81/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  A+ ++WK W W
Sbjct  356  FVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYASEDEWKHWNW  415

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RSE D +MNGAYF QSG+P +    H     IK   G  V+ LT++AGAL+C++G  C
Sbjct  416  RSEKDVFMNGAYFRQSGNPQYKCA-HTRQQMIKPKHGLAVSKLTKYAGALDCRVGKRC  472



>dbj|BAH20311.1| AT3G01270 [Arabidopsis thaliana]
Length=365

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 81/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  A+  +WK W W
Sbjct  249  FVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYASESEWKNWNW  308

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RSE D +MN AYF QSG+P+F    H+    IK   G  V+ LT++AGAL+C++G  C
Sbjct  309  RSEKDVFMNNAYFRQSGNPHFKCS-HSRQQMIKPKNGMAVSKLTKYAGALDCRVGKAC  365



>ref|XP_004228388.1| PREDICTED: pectate lyase [Solanum lycopersicum]
Length=439

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 83/121 (69%), Gaps = 8/121 (7%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS+ PTIISQGNRF A  + + +Q+T R  A   +WK+W W 
Sbjct  323  FFHVVNNDYTHWQMYAIGGSAHPTIISQGNRFKASDNPNTKQVTKRDYATESEWKKWQWV  382

Query  364  SEGDTYMNGAYFVQSGDPN----FVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLP  197
            SEGD+++NGAYFV+SG  +     ++K+H     IK   G     LTRFAG L CK G+P
Sbjct  383  SEGDSFLNGAYFVESGPQDKKKTALTKNHK----IKFKPGSHAGRLTRFAGVLKCKPGIP  438

Query  196  C  194
            C
Sbjct  439  C  439



>ref|XP_008389523.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 3 [Malus 
domestica]
Length=452

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FH+VNNDY HW MYAIGG+ +PTIISQGNRFIAP +   +Q+THR      +WK W WR
Sbjct  338  FFHLVNNDYNHWIMYAIGGNMNPTIISQGNRFIAPVNEATKQVTHREHTPESEWKNWEWR  397

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  MNGA+FV+SG  +  S++    D +    G   T LT+F+GAL+C +G PC
Sbjct  398  SEGDLMMNGAFFVESG--SRASQNPAKLDMMPFQPGTFATKLTKFSGALSCVVGKPC  452



>ref|XP_002270112.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32014.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 84/121 (69%), Gaps = 5/121 (4%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDI----HKRQITHRVGAAPEQWKQ  377
            +FHVVNNDYTHWNMYA+GGS+ PTI+SQGNR++A   +      +++T R  A   +W +
Sbjct  324  FFHVVNNDYTHWNMYAVGGSAHPTIVSQGNRYVAAPLMDPKHDAKEVTKRDHATKAEWSK  383

Query  376  WTWRSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLP  197
            WTWRSEGD  +NGA+FVQSG P F  K  + YD IKA  GK V  LTR++GAL C    P
Sbjct  384  WTWRSEGDLMVNGAFFVQSGVP-FKKKPFSRYDMIKAKPGKFVPRLTRYSGALTCWRTSP  442

Query  196  C  194
            C
Sbjct  443  C  443



>gb|AAM60924.1| putative pectate lyase [Arabidopsis thaliana]
Length=475

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 81/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  A+  +WK W W
Sbjct  359  FVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYASESEWKNWNW  418

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RSE D +MN AYF QSG+P+F    H+    IK   G  V+ LT++AGAL+C++G  C
Sbjct  419  RSEKDVFMNNAYFRQSGNPHFKCS-HSRQQMIKPKNGMAVSKLTKYAGALDCRVGKAC  475



>ref|XP_010551866.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=475

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 82/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHK-RQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP  I + +++T R  A   +W++W W
Sbjct  359  FVHVVNNDYTHWQLYAIGGSQGPTILSHGNRFIAPPHIPQYKEVTKRDYAPESEWRKWNW  418

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RSE D +MNGA+F QSG+P F    H     I+   G  V+ LT++AG+L+CK+G PC
Sbjct  419  RSEKDVFMNGAFFRQSGNPKFRCT-HTRQQMIRPKHGMAVSMLTKYAGSLDCKVGRPC  475



>ref|XP_006363934.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=439

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 83/121 (69%), Gaps = 8/121 (7%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS+ PTIISQGNRF A  + + +Q+T R  A   +WK+W W 
Sbjct  323  FFHVVNNDYTHWQMYAIGGSAHPTIISQGNRFKAADNPNTKQVTKRDYAPESEWKKWQWV  382

Query  364  SEGDTYMNGAYFVQSGDPN----FVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLP  197
            SEGD+++NGAYFV+SG  +     ++K+H     IK   G     LTRFAG L CK G+P
Sbjct  383  SEGDSFLNGAYFVESGPQDKKKTALTKNHK----IKFKPGSHAGRLTRFAGVLKCKPGIP  438

Query  196  C  194
            C
Sbjct  439  C  439



>emb|CAN69904.1| hypothetical protein VITISV_001006 [Vitis vinifera]
Length=443

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 84/121 (69%), Gaps = 5/121 (4%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDI----HKRQITHRVGAAPEQWKQ  377
            +FHVVNNDYTHWNMYA+GGS+ PTI+SQGNR++A   +      +++T R  A   +W +
Sbjct  324  FFHVVNNDYTHWNMYAVGGSAHPTIVSQGNRYVAAPLMDPKHDAKEVTKRDHATKAEWSK  383

Query  376  WTWRSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLP  197
            WTWRSEGD  +NGA+FVQSG P F  K  + YD IKA  GK V  LTR++GAL C    P
Sbjct  384  WTWRSEGDLMVNGAFFVQSGVP-FKKKPFSRYDMIKAKPGKFVPRLTRYSGALTCWRTSP  442

Query  196  C  194
            C
Sbjct  443  C  443



>ref|NP_186776.1| putative pectate lyase 7 [Arabidopsis thaliana]
 sp|Q9SRH4.1|PLY7_ARATH RecName: Full=Probable pectate lyase 7; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF03499.1|AC010676_9 putative pectate lyase [Arabidopsis thaliana]
 gb|AAF26147.1|AC008261_4 putative pectate lyase [Arabidopsis thaliana]
 gb|ABI93918.1| At3g01270 [Arabidopsis thaliana]
 gb|AEE73631.1| putative pectate lyase 7 [Arabidopsis thaliana]
Length=475

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 81/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  A+  +WK W W
Sbjct  359  FVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYASESEWKNWNW  418

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RSE D +MN AYF QSG+P+F    H+    IK   G  V+ LT++AGAL+C++G  C
Sbjct  419  RSEKDVFMNNAYFRQSGNPHFKCS-HSRQQMIKPKNGMAVSKLTKYAGALDCRVGKAC  475



>sp|P40973.1|PLY_LILLO RecName: Full=Pectate lyase; Flags: Precursor [Lilium longiflorum]
 emb|CAA78976.1| pectate lyase [Lilium longiflorum]
 gb|AAA33398.1| pectate lyase [Lilium longiflorum]
Length=434

 Score =   132 bits (331),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 84/117 (72%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYA+GGS  PTIISQGNR+IAP     +++T R  A P +W +WTW+
Sbjct  320  FVHVVNNDYTHWIMYAVGGSQHPTIISQGNRYIAPHIEAAKEVTKRDYAEPAEWSKWTWK  379

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD +++GA+FV+SG P F +K+    D IKA  G  V  LTRF+GALNCK  + C
Sbjct  380  SQGDLFVSGAFFVESGGP-FENKYSK-KDLIKAKPGTFVQRLTRFSGALNCKENMEC  434



>gb|AFK39232.1| unknown [Medicago truncatula]
Length=161

 Score =   126 bits (316),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 79/124 (64%), Gaps = 8/124 (6%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSD-------IHKRQITHRVGAAPEQ  386
            + H VNNDYTHW MYAIGGS +PTIIS+GNRFI P +       I+ ++IT R      +
Sbjct  39   FVHCVNNDYTHWEMYAIGGSQNPTIISEGNRFIGPYNKMLGNDLINSKEITKREYTEESE  98

Query  385  WKQWTWRSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKI  206
            WK W WRS  D Y+NGA+FVQSG P    +  +  D IKA  G  V  LTR++G L C++
Sbjct  99   WKTWQWRSINDEYINGAFFVQSG-PELKDRPFSQKDMIKAKPGSFVGRLTRYSGNLRCRV  157

Query  205  GLPC  194
            G PC
Sbjct  158  GEPC  161



>gb|KEH24975.1| pectate lyase P59-like protein [Medicago truncatula]
Length=453

 Score =   132 bits (331),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 78/117 (67%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HV+NNDYTHW MYAIGGSS PTI+SQGNRFIAP +   +++THR  A P+ WK W W 
Sbjct  338  FVHVLNNDYTHWIMYAIGGSSSPTILSQGNRFIAPDNGAAKEVTHRDYAPPDVWKNWQWS  397

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D +MNGA FV SG P         Y  ++   G  V+ LTR AGALNC +G PC
Sbjct  398  SELDVFMNGAKFVPSGAPINRKPFKKAY-MMQPRDGSHVSRLTRNAGALNCVVGKPC  453



>ref|XP_002882189.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58448.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=475

 Score =   132 bits (331),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 81/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  A+  +WK W W
Sbjct  359  FVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYASESEWKNWNW  418

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RSE D +MN AYF QSG+P+F    H+    IK   G  V+ LT++AGAL+C++G  C
Sbjct  419  RSEKDVFMNNAYFRQSGNPHFKCS-HSRQQMIKPKHGVAVSKLTKYAGALDCRVGKAC  475



>ref|XP_007215366.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
 gb|EMJ16565.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
Length=452

 Score =   132 bits (331),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 80/119 (67%), Gaps = 5/119 (4%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGSS PTIISQGNRFIAP +   +++T R  A  + WK W WR
Sbjct  337  FIHVVNNDYTHWLMYAIGGSSHPTIISQGNRFIAPPNHAAKEVTKRDYAPVDVWKNWQWR  396

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNL--YDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  +NGA+FV+SG      K+H     D + A  G  VT LTRFAG L C++G  C
Sbjct  397  SEGDLMLNGAFFVESG---VAKKNHGFGKLDMMTAKPGTFVTRLTRFAGTLGCRVGQKC  452



>gb|KFK25747.1| hypothetical protein AALP_AA8G154300 [Arabis alpina]
Length=504

 Score =   132 bits (331),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 80/118 (68%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  A+ ++WK W W
Sbjct  388  FVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYASEDEWKHWNW  447

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RSE D +MNGAYF QSG P +    H     IK   G  V+ LT++AGAL+C++G  C
Sbjct  448  RSEKDIFMNGAYFRQSGTPGYKCA-HTRKQMIKPKNGMAVSKLTKYAGALDCRVGKRC  504



>ref|NP_197015.4| putative pectate lyase 19 [Arabidopsis thaliana]
 gb|AED92118.1| putative pectate lyase 19 [Arabidopsis thaliana]
Length=472

 Score =   132 bits (331),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 81/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  A+ ++WK W W
Sbjct  356  FVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYASEDEWKHWNW  415

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RS+ D +MNGAYF QSG+P +    H     IK   G  V+ LT++AGAL+C++G  C
Sbjct  416  RSDKDVFMNGAYFRQSGNPQYKCA-HTRQQMIKPKNGLAVSKLTKYAGALDCRVGRRC  472



>sp|Q9LFP5.1|PLY19_ARATH RecName: Full=Probable pectate lyase 19; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAC01830.1| pectate lyase-like protein [Arabidopsis thaliana]
Length=472

 Score =   132 bits (331),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 81/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  A+ ++WK W W
Sbjct  356  FVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYASEDEWKHWNW  415

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RS+ D +MNGAYF QSG+P +    H     IK   G  V+ LT++AGAL+C++G  C
Sbjct  416  RSDKDVFMNGAYFRQSGNPQYKCA-HTRQQMIKPKNGLAVSKLTKYAGALDCRVGRRC  472



>gb|ABK28696.1| unknown [Arabidopsis thaliana]
Length=473

 Score =   132 bits (331),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 81/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  A+ ++WK W W
Sbjct  356  FVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYASEDEWKHWNW  415

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RS+ D +MNGAYF QSG+P +    H     IK   G  V+ LT++AGAL+C++G  C
Sbjct  416  RSDKDVFMNGAYFRQSGNPQYKCA-HTRQQMIKPKNGLAVSKLTKYAGALDCRVGRRC  472



>ref|XP_008374522.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=441

 Score =   131 bits (330),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 78/117 (67%), Gaps = 3/117 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTIISQGNRFIAP +   +++T R  AA   WK W WR
Sbjct  328  FFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPXNEASKEVTKREYAAENVWKSWNWR  387

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D  +NGA+F++SG P    ++    D I+A  G  V  LTRFAG L C  G PC
Sbjct  388  SENDLMVNGAFFIESGSP---IRNLPEADMIQAKPGTFVAKLTRFAGPLKCIKGKPC  441



>ref|XP_009789922.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=396

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 81/117 (69%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FH+VNNDYTHW  YAIGGSS+ TIISQGNRFIA  ++  +++THR  A   +W+ WTW 
Sbjct  281  FFHLVNNDYTHWMRYAIGGSSEATIISQGNRFIAQHNVDIKEVTHREKAQESEWRHWTWL  340

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+ D   NGA+F  SGDPN +SK  NL + + A     V  LT+F+G+L C +G PC
Sbjct  341  SQDDDMQNGAFFRTSGDPNALSKFKNL-NLMPAEPSYRVGILTKFSGSLGCTVGRPC  396



>gb|KGN47799.1| hypothetical protein Csa_6G404140 [Cucumis sativus]
Length=415

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 77/118 (65%), Gaps = 1/118 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTI+SQGNRFIAP + + +QIT R  A  ++WK W+WR
Sbjct  298  FFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNPNAKQITKREYAMEDEWKHWSWR  357

Query  364  SEGDTYMNGAYFVQSGDPNFVSKH-HNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  MNGA F+ SGD     K   + YD I    G  V  L R +G + C  G PC
Sbjct  358  SEGDELMNGAVFIASGDQTKGKKKGLSRYDMISFKPGTYVRRLVRLSGTIECTPGKPC  415



>ref|XP_004146792.1| PREDICTED: probable pectate lyase P59-like, partial [Cucumis 
sativus]
Length=442

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 77/118 (65%), Gaps = 1/118 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTI+SQGNRFIAP + + +QIT R  A  ++WK W+WR
Sbjct  325  FFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNPNAKQITKREYAMEDEWKHWSWR  384

Query  364  SEGDTYMNGAYFVQSGDPNFVSKH-HNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  MNGA F+ SGD     K   + YD I    G  V  L R +G + C  G PC
Sbjct  385  SEGDELMNGAVFIASGDQTKGKKKGLSRYDMISFKPGTYVRRLVRLSGTIECTPGKPC  442



>ref|XP_009587688.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=396

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 80/117 (68%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FH+VNNDYTHW  YAIGGSS+ TIISQGNRFIA  ++  +++THR  A   +W+ WTW 
Sbjct  281  FFHLVNNDYTHWMRYAIGGSSEATIISQGNRFIAQHNVDIKEVTHREKAQESEWRHWTWL  340

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S  D   NGA+F  SGDPN +SK  NL + + A     V  LT+F+G+L C +G PC
Sbjct  341  SRDDDMQNGAFFRTSGDPNALSKFKNL-NLMPAEPSYRVGILTKFSGSLGCTVGRPC  396



>ref|XP_010513594.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 81/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  A   +WK W W
Sbjct  357  FVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYAPEAEWKNWNW  416

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RSE D ++NGAYF QSG+P+F    H+    IK   G  V+ LT++AGAL+C++G  C
Sbjct  417  RSEKDYFLNGAYFRQSGNPHFKCS-HSRQQMIKPKHGVAVSKLTKYAGALDCRVGKAC  473



>ref|XP_010463548.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 81/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  A   +WK W W
Sbjct  357  FVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYAPEAEWKNWNW  416

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RSE D ++NGAYF QSG+P+F    H+    IK   G  V+ LT++AGAL+C++G  C
Sbjct  417  RSEKDYFLNGAYFRQSGNPHFKCS-HSRQQMIKPKHGVAVSKLTKYAGALDCRVGKAC  473



>ref|XP_004162547.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
Length=435

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 77/118 (65%), Gaps = 1/118 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTI+SQGNRFIAP + + +Q+T R  A  ++WK W+WR
Sbjct  318  FFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNPNAKQVTKREYAMEDEWKHWSWR  377

Query  364  SEGDTYMNGAYFVQSGDPNFVSKH-HNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  MNGA F+ SGD     K   + YD I    G  V  L R +G + C  G PC
Sbjct  378  SEGDELMNGAVFIASGDQTKGKKKGLSRYDMISFKPGTYVRRLVRLSGTIECTPGKPC  435



>ref|XP_004298448.1| PREDICTED: probable pectate lyase 3-like [Fragaria vesca subsp. 
vesca]
Length=443

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 80/118 (68%), Gaps = 4/118 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYT W MYAIGG+ +PTIISQGNRFIAP     +++T R      +WK W WR
Sbjct  329  FFHVVNNDYTQWIMYAIGGNMNPTIISQGNRFIAPESHVAKEVTKREYTDESEWKNWNWR  388

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFK-GKEVTWLTRFAGALNCKIGLPC  194
            SEGD   NGA+FV+SG+PN  +K  N+   +  FK GK    LT FAGAL C +G PC
Sbjct  389  SEGDVMENGAFFVESGNPN-CAKSTNIE--MMPFKPGKLAPQLTSFAGALECFVGRPC  443



>gb|KDO49831.1| hypothetical protein CISIN_1g044170mg, partial [Citrus sinensis]
Length=372

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 77/117 (66%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDY  W MYAIGG   PTI+SQGNRF A  + + +++T R+  +PE+ K W WR
Sbjct  257  FAHVVNNDYNQWEMYAIGGLKGPTILSQGNRFFASDNQNTKEVTKRMNCSPEEGKSWIWR  316

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD ++NGAYF  SGDP      + + D IK   G EV  +T+FAGAL CK G  C
Sbjct  317  SEGDVFLNGAYFNSSGDPK-KQIEYQMDDVIKPKPGTEVERITKFAGALVCKPGQKC  372



>dbj|BAK06965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 77/117 (66%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS +PTIISQGNR+IAP ++  + IT R+GA+  +WK W W 
Sbjct  330  FFHVVNNDYTHWLMYAIGGSKNPTIISQGNRYIAPPNLAAKLITKRLGASEAEWKNWVWH  389

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+ D  +N A F  SG  N   +  +  D I    G  VT LTRFAG L CK G PC
Sbjct  390  SQDDLLLNDAVFADSGGAN--ERKFDKDDLITPKPGSYVTRLTRFAGCLPCKPGKPC  444



>dbj|BAC42832.1| putative pectate lyase [Arabidopsis thaliana]
Length=274

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            YFHVVNNDYTHW MYAIGGS++PTI SQGNRF+AP +   +++T RVG+   +WKQW WR
Sbjct  160  YFHVVNNDYTHWVMYAIGGSANPTINSQGNRFLAPGNPFAKEVTKRVGSWQGEWKQWNWR  219

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  +NGAYF +SG     S       G K      V+ LT  +GAL C+IG+ C
Sbjct  220  SQGDLMLNGAYFTKSGAAAPASYARASSLGAK--PASVVSMLTYSSGALKCRIGMRC  274



>gb|EMT25421.1| Pectate lyase [Aegilops tauschii]
Length=323

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 75/117 (64%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS +PTIISQGNR+IAP ++  + IT R+ A   +WK W W 
Sbjct  209  FFHVVNNDYTHWLMYAIGGSKNPTIISQGNRYIAPPNLAAKLITKRLYAEEAEWKNWVWH  268

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  +N A F  SG PN   +     D I    G  VT LTR AG L CK G PC
Sbjct  269  SEGDLMLNDAVFADSGGPN--QRKFEKDDLIPPKPGSYVTRLTRSAGCLPCKPGKPC  323



>ref|XP_003554335.1| PREDICTED: pectate lyase-like [Glycine max]
Length=443

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HV+NNDYTHW MYAIGGSS PTI+SQGNRFIAP++   + ITHR  A P+ WK W W+
Sbjct  329  FVHVLNNDYTHWMMYAIGGSSGPTILSQGNRFIAPNNNAAKLITHRDYAEPQVWKNWQWQ  388

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D ++NGA F+ SG P   +    L   +K   G   + LTR +GALNC +G PC
Sbjct  389  SEMDLFINGAQFIPSGSPIKTTYKKGLL--MKPRDGTHASRLTRNSGALNCIVGRPC  443



>ref|XP_004236194.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=435

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 81/119 (68%), Gaps = 6/119 (5%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGS  PTI+SQGNRFIAP + + +++T R  A    WK W W+
Sbjct  321  FVHVVNNDYTHWLMYAIGGSMHPTILSQGNRFIAPPNPNAKEVTKRDYAPENVWKNWVWK  380

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLY--DGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  MNGA+FV+SGDP    KH  L   D I +  G  V+ LT+F+G+L C  G PC
Sbjct  381  SQGDLMMNGAFFVESGDP----KHAFLKGPDMITSKPGSSVSSLTQFSGSLKCIEGRPC  435



>emb|CDY66697.1| BnaAnng22760D [Brassica napus]
Length=447

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            YFHVVNNDYTHW MYAIGGS++PTI SQGNR+ AP + + +Q+T RV     +WK+W WR
Sbjct  332  YFHVVNNDYTHWEMYAIGGSANPTIKSQGNRYAAPKNRYAKQVTKRVRTEKSEWKKWNWR  391

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  +NGA+F+QSG+    + ++     + A     V  +T  AGAL C+ G PC
Sbjct  392  SEGDMLVNGAFFIQSGEG--ATANYESASSLAAKPASMVGSITSTAGALGCRSGKPC  446



>ref|XP_009761969.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=434

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 81/119 (68%), Gaps = 6/119 (5%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + H VNNDYTHW MYAIGGS  PTI+SQGNRFIAP + + +++T R  A    WK W W+
Sbjct  320  FVHAVNNDYTHWLMYAIGGSMHPTILSQGNRFIAPPNPNAKEVTKRDYAPESVWKNWVWK  379

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLY--DGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  MNGA+FV+SG+PN    H  L   D I +  G  V+ LTRF+G+LNC  G PC
Sbjct  380  SQGDLMMNGAFFVESGNPN----HAFLRSPDMISSKPGSFVSSLTRFSGSLNCIEGKPC  434



>ref|XP_009615547.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=434

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 81/119 (68%), Gaps = 6/119 (5%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + H VNNDYTHW MYAIGGS  PTI+SQGNRFIAP + + +++T R  A    WK W W+
Sbjct  320  FVHAVNNDYTHWLMYAIGGSMHPTILSQGNRFIAPPNPNAKEVTKRDYAPESVWKNWVWK  379

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLY--DGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  MNGA+FV+SG+PN    H  L   D I +  G  V+ LTRF+G+LNC  G PC
Sbjct  380  SQGDLMMNGAFFVESGNPN----HAFLRSPDMISSKPGSFVSSLTRFSGSLNCIEGKPC  434



>emb|CDX77470.1| BnaA07g06080D [Brassica napus]
Length=459

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            YFHVVNNDYTHW MYAIGGS++PTI SQGNR+ AP + + +Q+T RV     +WK+W WR
Sbjct  344  YFHVVNNDYTHWEMYAIGGSANPTINSQGNRYAAPKNRYAKQVTKRVRTEKSEWKKWNWR  403

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  +NGA+F+QSG+    + ++     + A     V  +T  AGAL C+ G PC
Sbjct  404  SEGDMLVNGAFFIQSGEG--ATANYESASSLAAKPASMVGSITSTAGALGCRSGRPC  458



>ref|XP_006428983.1| hypothetical protein CICLE_v10013750mg [Citrus clementina]
 gb|ESR42223.1| hypothetical protein CICLE_v10013750mg [Citrus clementina]
Length=438

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 77/117 (66%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDY  W MYAIGG   PTI+SQGNRF A  + + +++T R+  +PE+ K W WR
Sbjct  323  FAHVVNNDYNQWEMYAIGGLKGPTILSQGNRFFASDNQNTKEVTKRMNCSPEEGKSWIWR  382

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD ++NGAYF  SGDP      + + D IK   G EV  +T+FAGAL CK G  C
Sbjct  383  SEGDVFLNGAYFNSSGDPK-KQIEYQMDDVIKPKPGTEVERITKFAGALVCKPGQKC  438



>ref|XP_011085780.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=447

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 82/118 (69%), Gaps = 4/118 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPE-QWKQWTW  368
            +FHVVNNDYTHW MYAIGGSS PTIISQGNR+IA    + +Q+T R    PE +WK WTW
Sbjct  333  FFHVVNNDYTHWKMYAIGGSSHPTIISQGNRYIADHP-YAKQVTKR--ECPESEWKHWTW  389

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
             ++GD ++ GAYF+ SGD ++ SKH    D IK    K V+ +T+FAG L CK+   C
Sbjct  390  VTDGDLFLRGAYFIPSGDQDWPSKHPEKSDNIKPASAKLVSQMTKFAGRLGCKLKYAC  447



>gb|KHN01171.1| Putative pectate lyase 3 [Glycine soja]
Length=433

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 79/117 (68%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGS  PTIIS+GNRFIAP++++ ++IT R  +  ++WK W WR
Sbjct  318  FVHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIAPNNVYAKEITKREYSPEQEWKNWQWR  377

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S  D YMNGA+F + G      +  +  D I A  G  V  LTR+AG+L C +G PC
Sbjct  378  SINDEYMNGAFF-REGGSQITDRPFSRQDMITAKPGSYVGRLTRYAGSLRCIVGKPC  433



>ref|XP_006573090.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=448

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 79/117 (68%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGS  PTIIS+GNRFIAP++++ ++IT R  +  ++WK W WR
Sbjct  333  FVHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIAPNNVYAKEITKREYSPEQEWKNWQWR  392

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S  D YMNGA+F + G      +  +  D I A  G  V  LTR+AG+L C +G PC
Sbjct  393  SINDEYMNGAFF-REGGSQITDRPFSRQDMITAKPGSYVGRLTRYAGSLRCIVGKPC  448



>ref|XP_006480843.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=436

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 77/117 (66%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDY  W MYAIGG   PTI+SQGNRF A  + + +++T R+  +PE+ K W WR
Sbjct  321  FAHVVNNDYNQWEMYAIGGLKGPTILSQGNRFFASDNQNTKEVTKRMNCSPEEGKNWIWR  380

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD ++NGAYF  SGDP      + + D IK   G EV  +T+FAGAL CK G  C
Sbjct  381  SEGDVFLNGAYFNSSGDPK-KQIEYQMDDVIKPKPGTEVERITKFAGALVCKPGQKC  436



>ref|XP_008230729.1| PREDICTED: pectate lyase [Prunus mume]
Length=452

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 79/119 (66%), Gaps = 5/119 (4%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGSS PTIISQGNRFIAP +   +++T R  A    WK W WR
Sbjct  337  FIHVVNNDYTHWLMYAIGGSSHPTIISQGNRFIAPPNQAAKEVTKRDYAPMGVWKNWQWR  396

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNL--YDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  +NGA+FV+SG      K+H     D + A  G  V+ LTRFAG L C++G  C
Sbjct  397  SEGDLMLNGAFFVESG---VAKKNHGFGKLDMMTAKPGTFVSRLTRFAGTLGCRVGQKC  452



>ref|XP_010488478.1| PREDICTED: probable pectate lyase 9 [Camelina sativa]
Length=452

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 77/117 (66%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            YFHVVNNDYTHW MYAIGGS++PTIISQGNR+ AP +   +++T RVG    +WK+W WR
Sbjct  337  YFHVVNNDYTHWEMYAIGGSANPTIISQGNRYAAPKNRFAKEVTKRVGTEENEWKKWNWR  396

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D  +NGA+F  SGD     K H+L   + A     V  +T  AGAL C+ G  C
Sbjct  397  SENDLLVNGAFFTPSGDGASAKKAHDL--SLPARPASMVDSITATAGALGCRRGKRC  451



>ref|XP_009102560.1| PREDICTED: probable pectate lyase 9 [Brassica rapa]
Length=447

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            YFHVVNNDYTHW MYAIGGS++PTI SQGNR+ AP + + +Q+T RV     +WK+W WR
Sbjct  332  YFHVVNNDYTHWEMYAIGGSANPTINSQGNRYAAPKNRYAKQVTKRVRTEKSEWKKWNWR  391

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  +NGA+F+QSG+    + ++     + A     V  +T  AGAL C+ G PC
Sbjct  392  SEGDMLVNGAFFIQSGEG--ATANYESASSLAAKPASMVGSITSTAGALGCRSGKPC  446



>gb|KDO49230.1| hypothetical protein CISIN_1g036607mg [Citrus sinensis]
Length=436

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 77/117 (66%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDY  W MYAIGG   PTI+SQGNRF A ++ + +++T R+  +PE+ K W WR
Sbjct  321  FAHVVNNDYNQWEMYAIGGLQGPTILSQGNRFFASNNQNAKEVTKRMNCSPEEGKSWIWR  380

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  +NGAYF  SGDP      + + D IK   G EV  +T+FAGAL CK G  C
Sbjct  381  SEGDVLLNGAYFNSSGDPK-KQIQYQMDDVIKPESGTEVERITKFAGALVCKPGQEC  436



>gb|KHG16093.1| hypothetical protein F383_07683 [Gossypium arboreum]
Length=454

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 75/117 (64%), Gaps = 0/117 (0%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTIISQGNRFIAP D   ++IT+R  A   +W +W WR
Sbjct  338  FFHVVNNDYTHWKMYAIGGSMHPTIISQGNRFIAPDDPKAKEITNRNYAPQSEWSKWVWR  397

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  +NGA F +SG              IKA     V  LTRFAGAL+C+ G  C
Sbjct  398  SEGDLLLNGARFTKSGPDKSPQFDFTKMQMIKAKPATFVRRLTRFAGALDCEKGNKC  454



>ref|XP_010485518.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   129 bits (324),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 81/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  A   +WK W W
Sbjct  357  FVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYAPEAEWKNWNW  416

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RS+ D ++NGAYF QSG+P+F    H+    IK   G  V+ LT++AGAL+C++G  C
Sbjct  417  RSDKDYFLNGAYFRQSGNPHFKCS-HSRQQMIKPKHGVAVSKLTKYAGALDCRVGKAC  473



>ref|XP_006431087.1| hypothetical protein CICLE_v10011762mg [Citrus clementina]
 ref|XP_006431088.1| hypothetical protein CICLE_v10011763mg [Citrus clementina]
 gb|ESR44327.1| hypothetical protein CICLE_v10011762mg [Citrus clementina]
 gb|ESR44328.1| hypothetical protein CICLE_v10011763mg [Citrus clementina]
Length=435

 Score =   129 bits (324),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 77/117 (66%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDY  W MYAIGG   PTI+SQGNRF A  + + +++T R+  +PE+   W WR
Sbjct  320  FAHVVNNDYNQWEMYAIGGLKGPTILSQGNRFFASDNKNAKEVTKRMDCSPEEGNGWIWR  379

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD ++NGAYF  SGDP    K+  L D IK   G EV  +T+FAGAL CK G  C
Sbjct  380  SEGDVFLNGAYFNASGDPKKQIKYE-LNDVIKPAPGTEVQRITKFAGALVCKPGQQC  435



>ref|XP_006482544.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=435

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 77/117 (66%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDY  W MYAIGG   PTI+SQGNRF A  + + +++T R+  +PE+   W WR
Sbjct  320  FAHVVNNDYNQWEMYAIGGLKGPTILSQGNRFFASDNKNAKEVTKRMDCSPEEGNGWIWR  379

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD ++NGAYF  SGDP    K+  L D IK   G EV  +T+FAGAL CK G  C
Sbjct  380  SEGDVFLNGAYFNASGDPKKQIKYE-LNDVIKPAPGTEVQRITKFAGALVCKPGQQC  435



>ref|XP_008786760.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=467

 Score =   129 bits (324),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 78/120 (65%), Gaps = 8/120 (7%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTIISQGNRF+AP     ++IT R  A  + WK WTWR
Sbjct  353  FFHVVNNDYTHWMMYAIGGSQHPTIISQGNRFLAPPMRFAKEITKRDYATEDVWKHWTWR  412

Query  364  SEGDTYMNGAYFVQSGDP---NFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD   NGA+F +SG P   NF  K     D IKA  G  V  LTR+AG L C+ G  C
Sbjct  413  SEGDLMQNGAFFRESGAPAKNNFDKK-----DFIKAKPGTWVKRLTRYAGPLGCRAGRAC  467



>ref|XP_003609009.1| Pectate lyase [Medicago truncatula]
Length=445

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 79/118 (67%), Gaps = 6/118 (5%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FH+VNNDYTHW MYAIGGS+ PTI+SQGNRFIAP + + +++T R  A    WK W+WR
Sbjct  333  FFHIVNNDYTHWLMYAIGGSTHPTILSQGNRFIAPPNPNAKEVTKRDYAPESVWKAWSWR  392

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNL-YDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D  MNGA+F QSG     +K  N     IKA  G     LTRF+G L C++G PC
Sbjct  393  SENDLMMNGAFFKQSG-----TKAANFPKSDIKAKPGSFAAALTRFSGCLKCEVGKPC  445



>gb|KHN13490.1| Putative pectate lyase 3, partial [Glycine soja]
Length=364

 Score =   128 bits (321),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 77/118 (65%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + H VNNDYTHW MYAIGGS +PTIIS+GNRFIAP +   +QIT R  A    W  W WR
Sbjct  248  FVHSVNNDYTHWEMYAIGGSKNPTIISEGNRFIAPDNQFAKQITKREYAPENVWANWQWR  307

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAG-ALNCKIGLPC  194
            S  D YMNGA+FVQSG P   S+  +  D I A  G  V  LTR++G  L C++G PC
Sbjct  308  SINDVYMNGAFFVQSG-PELASRPFSREDMITAKVGNYVGRLTRYSGNLLKCRVGRPC  364



>gb|AES91206.2| pectate lyase P59-like protein [Medicago truncatula]
Length=434

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 79/118 (67%), Gaps = 6/118 (5%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FH+VNNDYTHW MYAIGGS+ PTI+SQGNRFIAP + + +++T R  A    WK W+WR
Sbjct  322  FFHIVNNDYTHWLMYAIGGSTHPTILSQGNRFIAPPNPNAKEVTKRDYAPESVWKAWSWR  381

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNL-YDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D  MNGA+F QSG     +K  N     IKA  G     LTRF+G L C++G PC
Sbjct  382  SENDLMMNGAFFKQSG-----TKAANFPKSDIKAKPGSFAAALTRFSGCLKCEVGKPC  434



>ref|XP_009788285.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=434

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 78/117 (67%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + H VNNDYTHW MYAIGGS  PTI+SQGNRFIAP + + +++T R  +    WK W WR
Sbjct  320  FVHAVNNDYTHWLMYAIGGSQHPTILSQGNRFIAPPNPNAKEVTKREYSPESVWKNWVWR  379

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  MNGA+FV+SG+PN +       D I    G   + LTRF+G+LNC  G PC
Sbjct  380  SQGDLMMNGAFFVESGNPNHIFMKGP--DMIHPRPGSYASRLTRFSGSLNCIEGKPC  434



>ref|XP_009598230.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=434

 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 78/117 (67%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + H VNNDYTHW MYAIGGS  PTI+SQGNRFIAP + + +++T R  +    WK W WR
Sbjct  320  FVHAVNNDYTHWLMYAIGGSQHPTILSQGNRFIAPPNPNAKEVTKREYSPESVWKNWVWR  379

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  MNGA+FV+SG+PN +       D I    G   + LTRF+G+LNC  G PC
Sbjct  380  SQGDLMMNGAFFVESGNPNHIFMKGP--DMIHPRPGSYASRLTRFSGSLNCIEGKPC  434



>ref|XP_009408830.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=436

 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 80/117 (68%), Gaps = 4/117 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYA+GGS  PTI+SQGNRFIAP  +  +++T R  +    WKQW+WR
Sbjct  324  FVHVVNNDYTHWMMYAVGGSQHPTILSQGNRFIAPPTLFAKEVTKREYSPEPVWKQWSWR  383

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD   NGA+FV+SG P  ++K +   D IKA  G  VT LTRFAG+  C    PC
Sbjct  384  SEGDLMANGAFFVESGAP--ITKPY--ADLIKAKPGSFVTRLTRFAGSRPCIPNQPC  436



>ref|XP_009102476.1| PREDICTED: probable pectate lyase 10 [Brassica rapa]
Length=439

 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            YFHVVNNDYTHW MYAIGGS++PTI SQGNRF+AP++   +++T RVG+   +WKQW WR
Sbjct  325  YFHVVNNDYTHWVMYAIGGSANPTINSQGNRFLAPANPFAKEVTKRVGSWQGEWKQWNWR  384

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  +NGAYF +SG     S  +     + A     V+ LT  +GAL C+IG+ C
Sbjct  385  SQGDLMLNGAYFTRSGAATPAS--YARASSLGAKPSSVVSMLTYSSGALKCRIGMRC  439



>emb|CDY46471.1| BnaC07g03950D [Brassica napus]
Length=439

 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            YFHVVNNDYTHW MYAIGGS++PTI SQGNRF+AP++   +++T RVG+   +WKQW WR
Sbjct  325  YFHVVNNDYTHWVMYAIGGSANPTINSQGNRFLAPANPFAKEVTKRVGSWQGEWKQWNWR  384

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  +NGAYF +SG     S  +     + A     V+ LT  +GAL C+IG+ C
Sbjct  385  SQGDLMLNGAYFTRSGAATPAS--YARASSLGAKPSSVVSMLTYSSGALKCRIGMRC  439



>ref|XP_003530685.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=451

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 77/118 (65%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + H VNNDYTHW MYAIGGS +PTIIS+GNRFIAP +   +QIT R  A    W  W WR
Sbjct  335  FVHSVNNDYTHWEMYAIGGSKNPTIISEGNRFIAPDNQFAKQITKREYAPENVWANWQWR  394

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAG-ALNCKIGLPC  194
            S  D YMNGA+FVQSG P   S+  +  D I A  G  V  LTR++G  L C++G PC
Sbjct  395  SINDVYMNGAFFVQSG-PELASRPFSREDMITAKVGNYVGRLTRYSGNLLKCRVGRPC  451



>ref|XP_003519771.2| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=447

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 79/117 (68%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGS  PTIIS+GNRFIAP +I+ ++IT R  +  ++WK W WR
Sbjct  332  FVHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIAPDNINAKEITKREYSPEQEWKSWQWR  391

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S  D Y+NG +F + G      + ++ +D + A  G  V  LTR+AG+L C +G PC
Sbjct  392  SINDEYLNGGFF-REGGAQLTDRPYSRHDMMTARPGSYVGRLTRYAGSLKCMVGKPC  447



>ref|XP_006344502.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=435

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 80/119 (67%), Gaps = 6/119 (5%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + H VNNDYTHW MYAIGGS  PTI+SQGNRFIAP + + +++T R  A    WK W W+
Sbjct  321  FVHAVNNDYTHWLMYAIGGSMHPTILSQGNRFIAPPNPNAKEVTKRDYAPENVWKNWVWK  380

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLY--DGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  MNGA+FV+SGDP    KH  L   D I +  G  V+ LTRF+G+L C  G PC
Sbjct  381  SQGDLMMNGAFFVESGDP----KHAFLKGPDMITSKPGSFVSSLTRFSGSLKCIEGRPC  435



>gb|KHN08706.1| Putative pectate lyase 3 [Glycine soja]
Length=444

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 79/117 (68%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGS  PTIIS+GNRFIAP +I+ ++IT R  +  ++WK W WR
Sbjct  329  FVHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIAPDNINAKEITKREYSPEQEWKSWQWR  388

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S  D Y+NG +F + G      + ++ +D + A  G  V  LTR+AG+L C +G PC
Sbjct  389  SINDEYLNGGFF-REGGAQLTDRPYSRHDMMTARPGSYVGRLTRYAGSLKCMVGKPC  444



>ref|XP_006484673.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=436

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 78/117 (67%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDY  W MYAIGG   PTI+SQGNRF A ++ + +++T R+  +PE+ K W WR
Sbjct  321  FAHVVNNDYNQWEMYAIGGLQGPTILSQGNRFFASNNQNTKEVTKRMNCSPEEGKSWIWR  380

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD ++NGAYF  SGDP      + + + IK   G EV  +T+FAGAL CK G  C
Sbjct  381  SEGDVFLNGAYFNSSGDPK-KQIQYQMDNVIKPESGTEVERITKFAGALVCKPGQEC  436



>ref|XP_003638493.1| Pectate lyase [Medicago truncatula]
Length=218

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 74/117 (63%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            YFHVVNNDYTHW MYAIGGS+DPTI SQGNR+ AP +   +++T RV  A  QWK W WR
Sbjct  104  YFHVVNNDYTHWEMYAIGGSADPTINSQGNRYNAPVNPFAKEVTKRVETAETQWKGWNWR  163

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD Y+NGAYF  SG     S       G K+     V  +T  AGAL CK G  C
Sbjct  164  SEGDLYLNGAYFTASGAGASASYARASSLGAKS--SAMVGTMTSNAGALGCKRGRQC  218



>ref|XP_002511525.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF52127.1| Pectate lyase precursor, putative [Ricinus communis]
Length=433

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 76/115 (66%), Gaps = 4/115 (3%)
 Frame = -2

Query  538  HVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWRSE  359
            HVVNNDYT W MYAIGGS  PTIISQGNRF+AP D   +Q+T R      +WK W WRSE
Sbjct  323  HVVNNDYTSWEMYAIGGSEHPTIISQGNRFLAPPDPDCKQVTKRNVEPESEWKSWNWRSE  382

Query  358  GDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            GD  +NGA+FV+SG P  +  H    + + A  G  V  LTR+AGAL+CK   PC
Sbjct  383  GDLMLNGAFFVESGSP--IETHGK--EEVHAMPGTLVHRLTRYAGALHCKKQKPC  433



>ref|XP_010435229.1| PREDICTED: probable pectate lyase 15 [Camelina sativa]
Length=461

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 75/117 (64%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            YFHVVNNDYTHW MYAIGGS++PTI SQGNR+ AP D   +++T RV     +WK+W WR
Sbjct  347  YFHVVNNDYTHWEMYAIGGSAEPTINSQGNRYAAPMDRFAKEVTKRVETDASEWKKWNWR  406

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  +NGAYF  SG+    S  +     + A     V  +T  AGAL C+ G PC
Sbjct  407  SEGDLLLNGAYFRSSGEE--ASASYGRASSLAAKPSSMVDTITSTAGALGCRKGRPC  461



>ref|XP_010450168.1| PREDICTED: probable pectate lyase 15 isoform X2 [Camelina sativa]
Length=461

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 75/117 (64%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            YFHVVNNDYTHW MYAIGGS++PTI SQGNR+ AP D   +++T RV     +WK+W WR
Sbjct  347  YFHVVNNDYTHWEMYAIGGSAEPTINSQGNRYAAPMDRFAKEVTKRVETDASEWKKWNWR  406

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  +NGAYF  SG+    S  +     + A     V  +T  AGAL C+ G PC
Sbjct  407  SEGDLLLNGAYFRSSGEE--ASASYGRASSLAAKPSSMVDTITSTAGALGCRKGRPC  461



>ref|XP_010450167.1| PREDICTED: probable pectate lyase 15 isoform X1 [Camelina sativa]
Length=465

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 75/117 (64%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            YFHVVNNDYTHW MYAIGGS++PTI SQGNR+ AP D   +++T RV     +WK+W WR
Sbjct  351  YFHVVNNDYTHWEMYAIGGSAEPTINSQGNRYAAPMDRFAKEVTKRVETDASEWKKWNWR  410

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  +NGAYF  SG+    S  +     + A     V  +T  AGAL C+ G PC
Sbjct  411  SEGDLLLNGAYFRSSGEE--ASASYGRASSLAAKPSSMVDTITSTAGALGCRKGRPC  465



>ref|XP_006439649.1| hypothetical protein CICLE_v10020193mg [Citrus clementina]
 gb|ESR52889.1| hypothetical protein CICLE_v10020193mg [Citrus clementina]
Length=437

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 78/117 (67%), Gaps = 3/117 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGS  PTI+SQGNRF+A +  H +++T R  +    WK W WR
Sbjct  324  FAHVVNNDYTHWLMYAIGGSQHPTILSQGNRFLASNSHHSKEVTKRDSSPQSVWKTWNWR  383

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D  MNGA+FV+SG      ++ N  D I A  GK  + +TRF+GALNC +  PC
Sbjct  384  SEMDLMMNGAFFVESGSD---VRNVNRQDVIPAKPGKFASQMTRFSGALNCYVNKPC  437



>ref|XP_006299938.1| hypothetical protein CARUB_v10016149mg [Capsella rubella]
 gb|EOA32836.1| hypothetical protein CARUB_v10016149mg [Capsella rubella]
Length=472

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 82/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVGAAPEQWKQWTW  368
            + HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  A+  +WK W W
Sbjct  356  FVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYASEGEWKHWNW  415

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RSE D ++NGA+F +SG+P+F    H+    IK   G  V+ LT++AGAL+C++G  C
Sbjct  416  RSEKDYFLNGAHFRESGNPHFKCS-HSRQQMIKPKHGVAVSKLTKYAGALDCRVGKAC  472



>ref|XP_010440534.1| PREDICTED: probable pectate lyase 15 isoform X1 [Camelina sativa]
Length=466

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 75/117 (64%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            YFHVVNNDYTHW MYAIGGS++PTI SQGNR+ AP D   +++T RV     +WK+W WR
Sbjct  352  YFHVVNNDYTHWEMYAIGGSAEPTINSQGNRYAAPMDRFAKEVTKRVETDASEWKKWNWR  411

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  +NGAYF  SG+    S  +     + A     V  +T  AGAL C+ G PC
Sbjct  412  SEGDLLLNGAYFRSSGEE--ASASYGRASSLAAKPSSMVDTITSTAGALGCRKGRPC  466



>ref|XP_010440536.1| PREDICTED: probable pectate lyase 15 isoform X2 [Camelina sativa]
Length=462

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 75/117 (64%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            YFHVVNNDYTHW MYAIGGS++PTI SQGNR+ AP D   +++T RV     +WK+W WR
Sbjct  348  YFHVVNNDYTHWEMYAIGGSAEPTINSQGNRYAAPMDRFAKEVTKRVETDASEWKKWNWR  407

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  +NGAYF  SG+    S  +     + A     V  +T  AGAL C+ G PC
Sbjct  408  SEGDLLLNGAYFRSSGEE--ASASYGRASSLAAKPSSMVDTITSTAGALGCRKGRPC  462



>ref|XP_006477525.1| PREDICTED: pectate lyase-like [Citrus sinensis]
Length=437

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 78/117 (67%), Gaps = 3/117 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGS  PTI+SQGNRF+A +  H +++T R  +    WK W WR
Sbjct  324  FAHVVNNDYTHWLMYAIGGSQHPTILSQGNRFLASNSHHSKEVTKRDSSPQSVWKTWNWR  383

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D  MNGA+FV+SG      ++ N  D I A  GK  + +TRF+GALNC +  PC
Sbjct  384  SEMDLMMNGAFFVESGSD---VRNVNRQDVIPAKPGKFASQMTRFSGALNCYVNKPC  437



>ref|XP_009797403.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=439

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 76/117 (65%), Gaps = 0/117 (0%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDY+HW MYAIGGS++PTIISQGNRF A ++ + +Q+T R  A    WK W W 
Sbjct  323  FFHVVNNDYSHWQMYAIGGSANPTIISQGNRFKAANNPNTKQVTKRDYAPESVWKNWQWV  382

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD ++NGAYFV+SG  N           IK   G     LTR+AG   CKIG PC
Sbjct  383  SEGDLFLNGAYFVESGPQNKKKSALTKPHRIKFKPGSYAGRLTRYAGVRKCKIGTPC  439



>gb|KDO76053.1| hypothetical protein CISIN_1g013757mg [Citrus sinensis]
Length=437

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 78/117 (67%), Gaps = 3/117 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGS  PTI+SQGNRF+A +  H +++T R  +    WK W WR
Sbjct  324  FAHVVNNDYTHWLMYAIGGSQHPTILSQGNRFLASNSHHSKEVTKRDSSPQSVWKTWNWR  383

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D  MNGA+FV+SG      ++ N  D I A  GK  + +TRF+GALNC +  PC
Sbjct  384  SEMDLMMNGAFFVESGSD---VRNVNRQDVIPAKPGKFASQMTRFSGALNCYVNKPC  437



>ref|XP_009107722.1| PREDICTED: putative pectate lyase 14 [Brassica rapa]
 emb|CDY34547.1| BnaA08g05020D [Brassica napus]
Length=155

 Score =   122 bits (305),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 75/117 (64%), Gaps = 3/117 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            YFHVVNNDYTHW MYAIGGS++PT+ SQGNRF+A  +   +++T RVGA   +W QW WR
Sbjct  42   YFHVVNNDYTHWEMYAIGGSANPTVNSQGNRFLASGNRFAKEVTKRVGAGEGEWNQWNWR  101

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  +NGAYF  SG     S   +    + A     +  LT  +G L C+IG PC
Sbjct  102  SQGDLLLNGAYFTSSGAEASSSYARSS---LAAKSSSLIDMLTYSSGVLKCRIGTPC  155



>ref|XP_009381244.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=423

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 76/117 (65%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGS  PTI+SQGNRFIAP  +  +++T R  +  E WK W WR
Sbjct  309  FVHVVNNDYTHWMMYAIGGSQHPTILSQGNRFIAPPTLFAKEVTKREYSPEEVWKSWQWR  368

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD   NGA+FV SG     +  +   D IKA  G  VT LTRF+GAL C    PC
Sbjct  369  SEGDLLKNGAFFVPSGAGKLGNVSYK--DLIKAKPGTFVTRLTRFSGALKCVPNRPC  423



>ref|XP_002885665.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61924.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=440

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            YFHVVNNDYTHW MYAIGGS++PTI SQGNRF+AP +   +++T RVG+   +WKQW WR
Sbjct  326  YFHVVNNDYTHWVMYAIGGSANPTINSQGNRFLAPGNPFAKEVTKRVGSWQGEWKQWNWR  385

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  +NGAYF +SG     S       G K      V+ LT  +GAL C+IG+ C
Sbjct  386  SQGDLMLNGAYFTKSGAAAPASYARASSLGAK--PASVVSMLTYSSGALRCRIGMRC  440



>gb|KHG23093.1| hypothetical protein F383_29772 [Gossypium arboreum]
Length=385

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 79/117 (68%), Gaps = 0/117 (0%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            YFHVVNNDYTHW +YAIGGS+ PTIISQGNRFIAP D   ++IT+R  A+  +W+ W WR
Sbjct  269  YFHVVNNDYTHWKLYAIGGSTHPTIISQGNRFIAPDDPLTKEITNRNYASESEWRHWVWR  328

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD +MNGA+FV SG  +         D IK      V  LT+F+G L CK G+ C
Sbjct  329  SEGDRFMNGAFFVTSGPHSPPRLKFKKKDIIKPKPAIFVGRLTKFSGTLKCKEGVKC  385



>ref|XP_009380431.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=436

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 75/117 (64%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYA+GGS  PTIISQGNRF+ P     +++THR  A   +WK W W 
Sbjct  322  FFHVVNNDYTHWMMYAVGGSQHPTIISQGNRFVGPPIQFAKEVTHREYAPESEWKNWIWT  381

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D + +GA+F+QSG        H+ YD IKA  G     LTRF+GAL C    PC
Sbjct  382  SEDDEFKSGAFFIQSGHK--YQGKHSRYDVIKAKPGSIAGRLTRFSGALQCSPNRPC  436



>ref|XP_006826355.1| hypothetical protein AMTR_s00004p00123190 [Amborella trichopoda]
 gb|ERM93592.1| hypothetical protein AMTR_s00004p00123190 [Amborella trichopoda]
Length=479

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 78/117 (67%), Gaps = 5/117 (4%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            YFHVVNNDYTHW  YAIGGS +PTI+SQGNRF+AP D + ++IT R G   + W  W W+
Sbjct  368  YFHVVNNDYTHWGKYAIGGSMNPTILSQGNRFVAPLDPYFKEITKRFGPDLD-WGSWNWK  426

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD + NGA F QSG+     + +     I+A  G  V  LTRF+GAL CK G PC
Sbjct  427  SEGDLFKNGAIFTQSGN----GRKYERKISIRAKPGSYVGILTRFSGALKCKTGTPC  479



>ref|XP_006297684.1| hypothetical protein CARUB_v10013715mg [Capsella rubella]
 gb|EOA30582.1| hypothetical protein CARUB_v10013715mg [Capsella rubella]
Length=442

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            YFHVVNNDYTHW MYAIGGS++PTI SQGNRF+AP +   +++T RVG+   +WKQW WR
Sbjct  328  YFHVVNNDYTHWVMYAIGGSANPTINSQGNRFLAPGNPFAKEVTKRVGSWQGEWKQWNWR  387

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  +NGAYF +SG     S       G K      V+ LT  +GAL C+IG+ C
Sbjct  388  SQGDQMLNGAYFTRSGAAAPASYARASSLGAK--PASVVSMLTYSSGALKCRIGMRC  442



>ref|XP_003613595.1| Pectate lyase [Medicago truncatula]
 gb|AES96553.1| pectate lyase P59-like protein [Medicago truncatula]
Length=449

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 77/117 (66%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HV+NNDYTHW MYAIGGS  PTIIS+GNRFIAP++ H ++IT R       WK W WR
Sbjct  334  FIHVLNNDYTHWEMYAIGGSMHPTIISEGNRFIAPNNGHAKEITKREYVDESVWKSWQWR  393

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S  D Y+NGA+F Q G P    +  +  D IK+  G  V  LTR++G+L C +G PC
Sbjct  394  SINDVYLNGAFFRQGG-PELKDRPFSRKDMIKSRPGTYVGRLTRYSGSLRCIVGKPC  449



>gb|AAQ62996.1| oil palm polygalacturonase allergen PEST361 [Elaeis guineensis]
Length=447

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 77/109 (71%), Gaps = 2/109 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYT W MYAIGGS  PTIISQGNRF+AP  +  +++T R  A  + WKQWTWR
Sbjct  330  FFHVVNNDYTQWIMYAIGGSQHPTIISQGNRFVAPRMLFSKEVTKRDYATEDVWKQWTWR  389

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGAL  218
            SEGD   NGA+F +SG+PN  ++  +  D IKA  G  V  LTRFAG L
Sbjct  390  SEGDLMQNGAFFRESGNPN--ARKFDRKDFIKAKPGTWVRRLTRFAGPL  436



>ref|XP_006437462.1| hypothetical protein CICLE_v10031653mg [Citrus clementina]
 gb|ESR50702.1| hypothetical protein CICLE_v10031653mg [Citrus clementina]
Length=419

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 77/117 (66%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDY  W MYAIGG   PTI+SQGNRF A ++ + +++T R+  +PE+ K W WR
Sbjct  304  FAHVVNNDYNQWEMYAIGGLQGPTILSQGNRFFASNNQNAKEVTKRMNCSPEEGKSWIWR  363

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  +NGAYF  SGDP      + + + IK   G EV  +T+FAGAL CK G  C
Sbjct  364  SEGDVLLNGAYFNSSGDPK-KQIQYQMDNVIKPESGTEVERITKFAGALVCKPGQEC  419



>gb|AGT16685.1| pectate lyase precursor [Saccharum hybrid cultivar R570]
Length=326

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 80/117 (68%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS +PTIISQGNRF A  D + +++T R      Q+K W W+
Sbjct  212  FFHVVNNDYTHWLMYAIGGSQNPTIISQGNRFRAVDDRNFKEVTKREYTPYSQYKDWVWK  271

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+ D ++NGA+F QSG  N   +  +  D I+A  G+    LTR+AGALNC++G  C
Sbjct  272  SQDDLFLNGAFFNQSGGQN--ERRFDRLDLIQAKGGQYAESLTRYAGALNCRVGKKC  326



>ref|NP_189110.1| probable pectate lyase 10 [Arabidopsis thaliana]
 sp|Q9LJ42.2|PLY10_ARATH RecName: Full=Probable pectate lyase 10; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE76935.1| probable pectate lyase 10 [Arabidopsis thaliana]
Length=440

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            YFHVVNNDYTHW MYAIGGS++PTI SQGNRF+AP +   +++T RVG+   +WKQW WR
Sbjct  326  YFHVVNNDYTHWVMYAIGGSANPTINSQGNRFLAPGNPFAKEVTKRVGSWQGEWKQWNWR  385

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  +NGAYF +SG     S       G K      V+ LT  +GAL C+IG+ C
Sbjct  386  SQGDLMLNGAYFTKSGAAAPASYARASSLGAK--PASVVSMLTYSSGALKCRIGMRC  440



>ref|XP_004490004.1| PREDICTED: probable pectate lyase 3-like isoform X2 [Cicer arietinum]
Length=376

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 77/117 (66%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGS  PTIIS+GNRFIAP + + ++IT R  +   +WK W WR
Sbjct  261  FIHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIAPDNGYAKEITKREYSPESEWKNWQWR  320

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S  D YMNGA+F Q G     ++  +  D I A  G  V  LTR++G+L C +G PC
Sbjct  321  SINDVYMNGAFFRQGGS-ELTNRPFSKKDMITAKPGAYVGRLTRYSGSLKCIVGKPC  376



>ref|XP_011097349.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=406

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 75/117 (64%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            YFHVVNNDYTHW MYAIGGS+ PTI SQGNRF+AP+D  ++Q+T    A   +W+ W WR
Sbjct  292  YFHVVNNDYTHWEMYAIGGSASPTIYSQGNRFLAPNDRDRKQVTKHEDAPESEWRHWNWR  351

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  +NGAYF+QSG        +     + A     V  +T  AGALNCK G  C
Sbjct  352  SEGDLMLNGAYFLQSG--TGAGATYARASSLSARPSSLVASITTAAGALNCKRGARC  406



>gb|AFW87059.1| pectate lyase [Zea mays]
Length=451

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 76/117 (65%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTIISQGNR+IAP ++  +Q+T +       WK W W 
Sbjct  337  FFHVVNNDYTHWLMYAIGGSKAPTIISQGNRYIAPPNLAAKQVTKQHDTPESVWKNWVWH  396

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D +M GAYF  +G    +++  N  D IK   G  VT LTR+AG+L C  G PC
Sbjct  397  SENDLFMEGAYFTVTGGQ--INRQFNKKDLIKPRNGSYVTRLTRYAGSLACTPGKPC  451



>ref|NP_001150723.1| pectate lyase precursor [Zea mays]
 gb|ACG40127.1| pectate lyase precursor [Zea mays]
Length=451

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 76/117 (65%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS  PTIISQGNR+IAP ++  +Q+T +       WK W W 
Sbjct  337  FFHVVNNDYTHWLMYAIGGSKAPTIISQGNRYIAPPNLAAKQVTKQHDTPESVWKNWVWH  396

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SE D +M GAYF  +G    +++  N  D IK   G  VT LTR+AG+L C  G PC
Sbjct  397  SENDLFMEGAYFTVTGGQ--INRQFNKKDLIKPRNGSYVTRLTRYAGSLACTPGKPC  451



>ref|XP_004490003.1| PREDICTED: probable pectate lyase 3-like isoform X1 [Cicer arietinum]
Length=450

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 77/117 (66%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGS  PTIIS+GNRFIAP + + ++IT R  +   +WK W WR
Sbjct  335  FIHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIAPDNGYAKEITKREYSPESEWKNWQWR  394

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S  D YMNGA+F Q G     ++  +  D I A  G  V  LTR++G+L C +G PC
Sbjct  395  SINDVYMNGAFFRQGGS-ELTNRPFSKKDMITAKPGAYVGRLTRYSGSLKCIVGKPC  450



>ref|XP_007157384.1| hypothetical protein PHAVU_002G065800g [Phaseolus vulgaris]
 gb|ESW29378.1| hypothetical protein PHAVU_002G065800g [Phaseolus vulgaris]
Length=448

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 77/117 (66%), Gaps = 1/117 (1%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + HVVNNDYTHW MYAIGGS  PTIIS+GNRF+AP     +QIT R  +   +WK+W WR
Sbjct  333  FIHVVNNDYTHWEMYAIGGSKHPTIISEGNRFVAPDSKDAKQITKREYSLEPEWKKWQWR  392

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S  D  +NGA+F++SG P+  ++     D I +  G  V  LTR AG+L C +G PC
Sbjct  393  SIKDEVINGAFFIESG-PDLTNRPFTRKDMISSRPGTYVGRLTRHAGSLRCIVGKPC  448



>gb|EAY99627.1| hypothetical protein OsI_21606 [Oryza sativa Indica Group]
Length=403

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FH+VNNDYTHW MYAIGG+ +PTIISQGNRF A  D+  +++T R   + +++K+W W+
Sbjct  289  FFHMVNNDYTHWLMYAIGGNMNPTIISQGNRFRASDDMKLKEVTKREYTSYDEYKEWVWK  348

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+ D ++NGA+F +SG  N   + +N  D I+A  G+ V  +TRFAG L C++G  C
Sbjct  349  SQDDLFLNGAFFNESGGRN--ERRYNRLDLIQARNGRYVGRMTRFAGTLPCRVGKKC  403



>gb|KEH19822.1| pectate lyase-like protein [Medicago truncatula]
Length=455

 Score =   126 bits (317),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 79/124 (64%), Gaps = 8/124 (6%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSD-------IHKRQITHRVGAAPEQ  386
            + H VNNDYTHW MYAIGGS +PTIIS+GNRFI P +       I+ ++IT R      +
Sbjct  333  FVHCVNNDYTHWEMYAIGGSQNPTIISEGNRFIGPYNKMLGNDLINSKEITKREYTEESE  392

Query  385  WKQWTWRSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKI  206
            WK W WRS  D Y+NGA+FVQSG P    +  +  D IKA  G  V  LTR++G L C++
Sbjct  393  WKTWQWRSINDEYINGAFFVQSG-PELKDRPFSQKDMIKAKPGSFVGRLTRYSGNLRCRV  451

Query  205  GLPC  194
            G PC
Sbjct  452  GEPC  455



>emb|CDP02199.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   125 bits (314),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 82/119 (69%), Gaps = 5/119 (4%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAP--SDIHKRQITHRVGAAPEQWKQWT  371
            +FH+VNNDYTHW MYAIGGS D TIISQGNRFIAP  S   K ++THR  A    W +WT
Sbjct  238  FFHLVNNDYTHWEMYAIGGSHDATIISQGNRFIAPPLSQFFK-EVTHR-DAPVALWSKWT  295

Query  370  WRSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            W S+GD ++NGA FV SG+P+   +   L + IKA  G EV  LTRF+G L+C IG  C
Sbjct  296  WVSDGDVFLNGARFVPSGNPDGARQFAAL-ELIKAAPGTEVFTLTRFSGFLSCVIGRAC  353



>ref|XP_009586995.1| PREDICTED: probable pectate lyase 5 [Nicotiana tomentosiformis]
Length=404

 Score =   125 bits (315),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 77/117 (66%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            YFHVVNNDYTHW MYA+GGS+ PTI SQGNRF+AP+DI  +++T    AA  +WK W WR
Sbjct  290  YFHVVNNDYTHWEMYAVGGSASPTINSQGNRFLAPNDIFNKEVTKHEDAAESEWKNWNWR  349

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  +NGA+F +SG     SK +     + A     V+ +T  AGAL CK G  C
Sbjct  350  SEGDLMLNGAFFTRSGAG--ASKSYAKASSLSARPSTLVSSITVNAGALGCKKGKRC  404



>ref|NP_001056784.1| Os06g0144900 [Oryza sativa Japonica Group]
 dbj|BAD68407.1| putative pectate lyase homolog [Oryza sativa Japonica Group]
 dbj|BAD68762.1| putative pectate lyase homolog [Oryza sativa Japonica Group]
 dbj|BAF18698.1| Os06g0144900 [Oryza sativa Japonica Group]
 gb|EAZ35811.1| hypothetical protein OsJ_20103 [Oryza sativa Japonica Group]
 dbj|BAG91996.1| unnamed protein product [Oryza sativa Japonica Group]
Length=448

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FH+VNNDYTHW MYAIGG+ +PTIISQGNRF A  D+  +++T R   + +++K+W W+
Sbjct  334  FFHMVNNDYTHWLMYAIGGNMNPTIISQGNRFRASDDMKLKEVTKREYTSYDEYKEWVWK  393

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+ D ++NGA+F +SG  N   + +N  D I+A  G+ V  +TRFAG L C++G  C
Sbjct  394  SQDDLFLNGAFFNESGGRN--ERRYNRLDLIQARNGRYVGRMTRFAGTLPCRVGKKC  448



>ref|XP_009107745.1| PREDICTED: probable pectate lyase 15 [Brassica rapa]
Length=451

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 74/117 (63%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            YFHVVNNDYTHW MYAIGGS++PTI SQGNR+ AP D   +++T RVG     WK+W WR
Sbjct  337  YFHVVNNDYTHWEMYAIGGSAEPTINSQGNRYAAPMDRFAKEVTKRVGTDASDWKKWNWR  396

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD  +NGA+F  SG     S  +     + A     V  +T  AGAL C+ G PC
Sbjct  397  SEGDLLLNGAFFRASGAG--TSASYGRASSLAAKPSSMVRTITSTAGALGCRKGRPC  451



>ref|NP_001150425.1| LOC100284055 precursor [Zea mays]
 gb|ACG39044.1| pectate lyase precursor [Zea mays]
 gb|ACR35178.1| unknown [Zea mays]
 gb|AFW75496.1| pectate lyase [Zea mays]
Length=453

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 80/117 (68%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FHVVNNDYTHW MYAIGGS +PTIISQGNRF A  D   +++T R      ++K W W+
Sbjct  339  FFHVVNNDYTHWLMYAIGGSRNPTIISQGNRFRAVDDSRFKEVTKREYTQYSEYKNWVWK  398

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+ D ++NGA+F QSG  N   + ++  D I+A  G+    LTR+AGALNC++G  C
Sbjct  399  SQDDLFLNGAFFNQSGGQN--ERKYDRLDLIQAKGGQYAESLTRYAGALNCRVGRKC  453



>ref|XP_007138209.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
 gb|ESW10203.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
Length=434

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 77/117 (66%), Gaps = 4/117 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            +FH+VNNDYTHW MYA+GGS  PTIISQGNRF+AP D + +++T R  A   +WK W WR
Sbjct  322  FFHIVNNDYTHWLMYAVGGSQQPTIISQGNRFVAPKDRNAKEVTKRDYAPESEWKNWNWR  381

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            SEGD + NGA+FV+SG    V+K        KA   K V +LT+ AG + C    PC
Sbjct  382  SEGDLFENGAFFVESGKK--VTKFPKT--DAKAVSAKSVAFLTKDAGPIKCIPNKPC  434



>ref|XP_010532870.1| PREDICTED: putative pectate lyase 14 [Tarenaya hassleriana]
Length=440

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            YFHVVNNDYTHW MYAIGGS++PT+ SQGNRF+AP++   +++T RVGA   +WKQW WR
Sbjct  326  YFHVVNNDYTHWVMYAIGGSANPTVNSQGNRFLAPANRFAKEVTKRVGAGKGEWKQWNWR  385

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD  +NGAYF  SG     S ++     + A     +  LT  +GAL C+IG  C
Sbjct  386  SQGDLMLNGAYFTSSGSR--ASANYARASSLAAKSSSLIGTLTYSSGALKCRIGSRC  440



>gb|EPS62426.1| hypothetical protein M569_12361, partial [Genlisea aurea]
Length=410

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 77/117 (66%), Gaps = 4/117 (3%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWR  365
            + H+VNNDYT W MYAIGGS  PTI+SQGNRF AP +   +++T R  +    WK W W+
Sbjct  298  FVHIVNNDYTKWEMYAIGGSQHPTILSQGNRFHAPDNAAAKEVTKREYSPESVWKNWNWK  357

Query  364  SEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            S+GD++ NGA+FV+SGD NF    + + D + A  GKEV  LT FAG L C  G  C
Sbjct  358  SQGDSFSNGAFFVESGDKNF----NYVSDSVGAKSGKEVGELTEFAGPLACFAGKAC  410



>gb|EAY85003.1| hypothetical protein OsI_06363 [Oryza sativa Indica Group]
Length=439

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 79/118 (67%), Gaps = 5/118 (4%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPE-QWKQWTW  368
            +FHVVNNDYTHW MYAIGG   PTI+SQGNR+IAP +I  + IT     APE +WK W W
Sbjct  326  FFHVVNNDYTHWLMYAIGGGMSPTILSQGNRYIAPPNIAAKLITRHY--APEWEWKNWAW  383

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RS+GD +MNGAYF  S     +++     D +K   G  V  LTRFAGAL+C+ G PC
Sbjct  384  RSDGDLFMNGAYFQASN--GAINRKVKGSDMVKPKPGSYVRRLTRFAGALSCRPGEPC  439



>gb|EEE56553.1| hypothetical protein OsJ_05879 [Oryza sativa Japonica Group]
Length=410

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 79/118 (67%), Gaps = 5/118 (4%)
 Frame = -2

Query  544  YFHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPE-QWKQWTW  368
            +FHVVNNDYTHW MYAIGG   PTI+SQGNR+IAP +I  + IT     APE +WK W W
Sbjct  297  FFHVVNNDYTHWLMYAIGGGMSPTILSQGNRYIAPPNIAAKLITRHY--APEWEWKNWAW  354

Query  367  RSEGDTYMNGAYFVQSGDPNFVSKHHNLYDGIKAFKGKEVTWLTRFAGALNCKIGLPC  194
            RS+GD +MNGAYF  S     +++     D +K   G  V  LTRFAGAL+C+ G PC
Sbjct  355  RSDGDLFMNGAYFQASN--GAINRKVKGSDMVKPKPGSYVRRLTRFAGALSCRPGEPC  410



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 533345884428