BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25646_g3_i4 len=1805 path=[4971:0-86 5058:87-288 5260:289-336
4802:337-371 22435:372-384 5353:385-416 4344:417-455 5423:456-458
5426:459-536 5504:537-560 5528:561-599 5567:600-632 5599:633-664
1004:665-713 5678:714-720 1060:721-1056 417:1057-1094 6054:1095-1132
4865:1133-1142 2541:1143-1146 22744:1147-1166 6124:1167-1208
2385:1209-1287 2464:1288-1314 20930:1315-1335 6291:1336-1377
21018:1378-1482 6456:1483-1525 1085:1526-1563 1123:1564-1592
6564:1593-1731 18888:1732-1755 21479:1756-1804]

Length=1805
                                                                      Score     E

ref|XP_009599825.1|  PREDICTED: probable pectate lyase P59 isofor...    605   0.0      
ref|XP_009779191.1|  PREDICTED: probable pectate lyase P59              605   0.0      
ref|XP_009599826.1|  PREDICTED: probable pectate lyase P59 isofor...    602   0.0      
ref|XP_004234779.1|  PREDICTED: probable pectate lyase P59              602   0.0      
ref|XP_006361835.1|  PREDICTED: probable pectate lyase P59-like         598   0.0      
sp|P15722.1|PLY59_SOLLC  RecName: Full=Probable pectate lyase P59...    597   0.0      Solanum lycopersicum
ref|XP_009587689.1|  PREDICTED: probable pectate lyase P59              596   0.0      
ref|XP_006357122.1|  PREDICTED: probable pectate lyase P59-like         595   0.0      
ref|XP_009789921.1|  PREDICTED: probable pectate lyase P59              594   0.0      
ref|XP_009802165.1|  PREDICTED: probable pectate lyase P59              573   0.0      
ref|XP_004232242.1|  PREDICTED: probable pectate lyase P59              572   0.0      
ref|XP_009617495.1|  PREDICTED: probable pectate lyase P59              571   0.0      
ref|XP_006338480.1|  PREDICTED: probable pectate lyase P59-like         570   0.0      
ref|XP_011098575.1|  PREDICTED: probable pectate lyase P59              556   0.0      
emb|CDP02198.1|  unnamed protein product                                556   0.0      
ref|XP_010317101.1|  PREDICTED: probable pectate lyase P59              549   0.0      
gb|EPS66620.1|  hypothetical protein M569_08154                         550   0.0      
ref|XP_007032453.1|  Pectate lyase family protein                       532   0.0      
ref|XP_002282500.3|  PREDICTED: pectate lyase                           521   4e-177   Vitis vinifera
ref|XP_010256490.1|  PREDICTED: pectate lyase-like                      521   5e-177   
emb|CAN79927.1|  hypothetical protein VITISV_042447                     521   7e-177   Vitis vinifera
emb|CBI22159.3|  unnamed protein product                                521   1e-176   
ref|XP_008341537.1|  PREDICTED: pectate lyase-like                      520   2e-176   
ref|XP_010066949.1|  PREDICTED: pectate lyase                           519   3e-176   
ref|XP_010033216.1|  PREDICTED: pectate lyase-like                      516   4e-175   
ref|XP_007046218.1|  Pectate lyase family protein, putative             516   4e-175   
ref|XP_008357758.1|  PREDICTED: pectate lyase-like                      513   1e-173   
ref|XP_009342871.1|  PREDICTED: pectate lyase-like                      513   2e-173   
ref|XP_010112093.1|  putative pectate lyase 7                           512   2e-173   
gb|EYU34111.1|  hypothetical protein MIMGU_mgv1a006386mg                512   2e-173   
ref|XP_004165454.1|  PREDICTED: pectate lyase-like                      509   2e-172   
ref|XP_007037229.1|  Pectate lyase family protein                       509   2e-172   
ref|XP_002311599.2|  pectate lyase family protein                       509   3e-172   Populus trichocarpa [western balsam poplar]
gb|KCW52797.1|  hypothetical protein EUGRSUZ_J02132                     507   2e-171   
gb|EYU36839.1|  hypothetical protein MIMGU_mgv1a006379mg                506   6e-171   
ref|XP_011025954.1|  PREDICTED: probable pectate lyase P59              505   7e-171   
ref|XP_009369346.1|  PREDICTED: pectate lyase-like                      505   1e-170   
ref|XP_010242445.1|  PREDICTED: pectate lyase                           503   9e-170   
gb|KHG08055.1|  putative pectate lyase P59                              499   1e-168   
gb|KHG16093.1|  hypothetical protein F383_07683                         500   1e-168   
ref|XP_010068708.1|  PREDICTED: pectate lyase-like                      498   3e-168   
ref|XP_002520133.1|  Pectate lyase precursor, putative                  498   4e-168   Ricinus communis
ref|XP_008374522.1|  PREDICTED: pectate lyase-like                      498   7e-168   
ref|XP_002272638.2|  PREDICTED: pectate lyase-like                      496   4e-167   Vitis vinifera
ref|XP_002323835.1|  hypothetical protein POPTR_0017s11450g             496   6e-167   Populus trichocarpa [western balsam poplar]
ref|XP_011005067.1|  PREDICTED: probable pectate lyase P59              495   8e-167   
emb|CDP14850.1|  unnamed protein product                                494   1e-166   
ref|XP_007227702.1|  hypothetical protein PRUPE_ppa005744mg             495   1e-166   
ref|XP_004152537.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    494   1e-166   
ref|XP_007153840.1|  hypothetical protein PHAVU_003G069100g             492   1e-165   
ref|XP_009389712.1|  PREDICTED: pectate lyase-like                      490   7e-165   
ref|XP_002270089.1|  PREDICTED: pectate lyase                           490   7e-165   Vitis vinifera
ref|XP_010105747.1|  putative pectate lyase P59                         488   2e-164   
ref|XP_009381244.1|  PREDICTED: pectate lyase-like                      487   5e-164   
ref|XP_010528323.1|  PREDICTED: probable pectate lyase 19               488   6e-164   
ref|XP_009403112.1|  PREDICTED: pectate lyase-like                      487   1e-163   
ref|XP_011013803.1|  PREDICTED: pectate lyase-like                      486   2e-163   
ref|XP_011085780.1|  PREDICTED: probable pectate lyase P59              486   2e-163   
ref|XP_009408830.1|  PREDICTED: pectate lyase-like                      484   8e-163   
ref|XP_004490003.1|  PREDICTED: probable pectate lyase 3-like iso...    485   1e-162   
ref|XP_010678579.1|  PREDICTED: pectate lyase-like                      484   1e-162   
ref|XP_007209148.1|  hypothetical protein PRUPE_ppa005859mg             483   3e-162   
ref|XP_008239834.1|  PREDICTED: pectate lyase-like                      483   4e-162   
gb|AES91206.2|  pectate lyase P59-like protein                          482   6e-162   
ref|XP_011085777.1|  PREDICTED: probable pectate lyase P59              483   7e-162   
ref|XP_009615547.1|  PREDICTED: probable pectate lyase P59              482   8e-162   
ref|XP_006374492.1|  hypothetical protein POPTR_0015s07590g             482   1e-161   
ref|XP_002306040.1|  hypothetical protein POPTR_0004s12300g             481   2e-161   Populus trichocarpa [western balsam poplar]
ref|XP_006842121.1|  hypothetical protein AMTR_s00078p00106380          481   2e-161   
ref|XP_006354795.1|  PREDICTED: pectate lyase-like                      481   2e-161   
gb|KHN08855.1|  Putative pectate lyase P59                              479   1e-160   
ref|XP_009360393.1|  PREDICTED: probable pectate lyase 3                479   1e-160   
ref|XP_004147462.1|  PREDICTED: probable pectate lyase 7-like           478   2e-160   
gb|KGN59593.1|  hypothetical protein Csa_3G827350                       478   3e-160   
ref|XP_011009454.1|  PREDICTED: pectate lyase-like                      479   3e-160   
ref|XP_004302354.1|  PREDICTED: probable pectate lyase P59-like         478   4e-160   
ref|XP_008443432.1|  PREDICTED: probable pectate lyase 19               477   8e-160   
ref|XP_004155392.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    476   1e-159   
ref|XP_004135462.1|  PREDICTED: probable pectate lyase P59-like         476   2e-159   
ref|XP_008339935.1|  PREDICTED: probable pectate lyase 3                476   3e-159   
ref|XP_008446316.1|  PREDICTED: probable pectate lyase P59              475   4e-159   
ref|XP_008365507.1|  PREDICTED: pectate lyase-like                      474   4e-159   
ref|XP_008446067.1|  PREDICTED: pectate lyase-like                      473   6e-159   
ref|XP_008456459.1|  PREDICTED: pectate lyase-like                      474   6e-159   
ref|XP_006573090.1|  PREDICTED: probable pectate lyase 3-like           474   9e-159   
ref|XP_003609009.1|  Pectate lyase                                      474   1e-158   
ref|XP_009761969.1|  PREDICTED: probable pectate lyase P59              473   2e-158   
ref|XP_011087217.1|  PREDICTED: pectate lyase-like                      473   3e-158   
ref|XP_009788285.1|  PREDICTED: pectate lyase-like                      473   3e-158   
ref|XP_003519771.2|  PREDICTED: probable pectate lyase 3-like           473   4e-158   
gb|KHN08706.1|  Putative pectate lyase 3                                473   4e-158   
ref|XP_009598230.1|  PREDICTED: pectate lyase-like                      472   5e-158   
gb|KHG07401.1|  putative pectate lyase P59                              473   5e-158   
gb|KHN01171.1|  Putative pectate lyase 3                                472   6e-158   
ref|XP_008221660.1|  PREDICTED: probable pectate lyase 3                472   9e-158   
ref|XP_008389523.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    472   1e-157   
ref|XP_004162547.1|  PREDICTED: probable pectate lyase P59-like         471   2e-157   
ref|XP_004146792.1|  PREDICTED: probable pectate lyase P59-like         471   2e-157   
ref|XP_010550068.1|  PREDICTED: probable pectate lyase 19               472   2e-157   
ref|XP_008793504.1|  PREDICTED: pectate lyase-like                      471   3e-157   
ref|XP_008230729.1|  PREDICTED: pectate lyase                           470   5e-157   
ref|XP_010925369.1|  PREDICTED: pectate lyase                           470   5e-157   
ref|XP_003530685.1|  PREDICTED: probable pectate lyase 3-like           470   6e-157   
ref|XP_008366366.1|  PREDICTED: pectate lyase-like                      471   1e-156   
ref|XP_007215366.1|  hypothetical protein PRUPE_ppa005602mg             468   6e-156   
ref|XP_002871648.1|  pectate lyase family protein                       468   9e-156   
ref|XP_002511525.1|  Pectate lyase precursor, putative                  466   1e-155   Ricinus communis
ref|XP_004508770.1|  PREDICTED: probable pectate lyase P59-like         466   1e-155   
ref|XP_008221658.1|  PREDICTED: pectate lyase-like                      466   1e-155   
ref|XP_007138209.1|  hypothetical protein PHAVU_009G189800g             465   4e-155   
ref|XP_007224275.1|  hypothetical protein PRUPE_ppa019055mg             465   4e-155   
ref|XP_004490004.1|  PREDICTED: probable pectate lyase 3-like iso...    462   6e-155   
ref|XP_010513594.1|  PREDICTED: probable pectate lyase 7                466   6e-155   
ref|XP_006428983.1|  hypothetical protein CICLE_v10013750mg             464   7e-155   
ref|XP_008339934.1|  PREDICTED: probable pectate lyase 3                464   9e-155   
ref|XP_011098576.1|  PREDICTED: probable pectate lyase P56              465   9e-155   
ref|XP_009117903.1|  PREDICTED: probable pectate lyase 3                464   1e-154   
ref|XP_010463548.1|  PREDICTED: probable pectate lyase 7                465   1e-154   
ref|XP_006480843.1|  PREDICTED: probable pectate lyase 19-like          463   1e-154   
ref|XP_010915114.1|  PREDICTED: LOW QUALITY PROTEIN: pectate lyas...    464   1e-154   
ref|XP_007157384.1|  hypothetical protein PHAVU_002G065800g             464   2e-154   
ref|XP_006477525.1|  PREDICTED: pectate lyase-like                      463   2e-154   
ref|NP_001057945.1|  Os06g0583900                                       463   2e-154   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002270112.1|  PREDICTED: pectate lyase                           463   2e-154   Vitis vinifera
emb|CAN69904.1|  hypothetical protein VITISV_001006                     463   3e-154   Vitis vinifera
gb|KEH19822.1|  pectate lyase-like protein                              463   3e-154   
ref|XP_010485518.1|  PREDICTED: probable pectate lyase 7                464   4e-154   
ref|XP_006484673.1|  PREDICTED: probable pectate lyase 19-like          462   5e-154   
gb|KDP45476.1|  hypothetical protein JCGZ_09725                         463   6e-154   
ref|XP_004236194.1|  PREDICTED: probable pectate lyase P59              462   6e-154   
gb|KDO49230.1|  hypothetical protein CISIN_1g036607mg                   462   6e-154   
sp|Q9LFP5.1|PLY19_ARATH  RecName: Full=Probable pectate lyase 19;...    462   9e-154   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010420164.1|  PREDICTED: probable pectate lyase 19 isoform X2    462   1e-153   
ref|XP_004514773.1|  PREDICTED: probable pectate lyase 3-like           461   2e-153   
ref|XP_006344502.1|  PREDICTED: probable pectate lyase P59-like         460   2e-153   
ref|XP_002892805.1|  hypothetical protein ARALYDRAFT_471616             461   2e-153   
ref|XP_003552513.1|  PREDICTED: pectate lyase-like                      461   2e-153   
ref|NP_197015.4|  putative pectate lyase 19                             462   3e-153   Arabidopsis thaliana [mouse-ear cress]
emb|CAN77957.1|  hypothetical protein VITISV_021245                     459   3e-153   Vitis vinifera
gb|ABK28696.1|  unknown                                                 461   3e-153   Arabidopsis thaliana [mouse-ear cress]
gb|KHN13652.1|  Pectate lyase                                           460   5e-153   
emb|CDX70590.1|  BnaC03g06740D                                          461   7e-153   
ref|XP_006306515.1|  hypothetical protein CARUB_v10012514mg             460   7e-153   
ref|XP_010496063.1|  PREDICTED: probable pectate lyase 3                459   1e-152   
ref|XP_006439649.1|  hypothetical protein CICLE_v10020193mg             458   2e-152   
ref|XP_010492335.1|  PREDICTED: probable pectate lyase 19               460   2e-152   
ref|XP_010527872.1|  PREDICTED: probable pectate lyase 3 isoform X2     459   2e-152   
ref|XP_009131435.1|  PREDICTED: probable pectate lyase 19               459   3e-152   
ref|XP_010453638.1|  PREDICTED: probable pectate lyase 19               459   3e-152   
emb|CDY53552.1|  BnaA09g57110D                                          459   3e-152   
gb|KDO76053.1|  hypothetical protein CISIN_1g013757mg                   457   4e-152   
ref|XP_010476496.1|  PREDICTED: probable pectate lyase 3                458   4e-152   
ref|XP_010523445.1|  PREDICTED: probable pectate lyase 3                458   5e-152   
gb|KHG23093.1|  hypothetical protein F383_29772                         455   5e-152   
gb|KHG05193.1|  hypothetical protein F383_30875                         455   6e-152   
ref|XP_010670318.1|  PREDICTED: pectate lyase-like                      456   1e-151   
ref|XP_003613595.1|  Pectate lyase                                      456   2e-151   
ref|XP_006437462.1|  hypothetical protein CICLE_v10031653mg             455   2e-151   
ref|NP_186776.1|  putative pectate lyase 7                              456   4e-151   Arabidopsis thaliana [mouse-ear cress]
gb|AAM60924.1|  putative pectate lyase                                  456   4e-151   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003613596.1|  Pectate lyase                                      455   4e-151   
ref|XP_008786760.1|  PREDICTED: pectate lyase-like                      456   4e-151   
ref|NP_172894.1|  putative pectate lyase 3                              455   6e-151   Arabidopsis thaliana [mouse-ear cress]
gb|AAB69759.1|  putative pectate lyase                                  455   6e-151   Arabidopsis thaliana [mouse-ear cress]
gb|AAQ62996.1|  oil palm polygalacturonase allergen PEST361             454   7e-151   Elaeis guineensis
gb|AAQ62997.1|  oil palm polygalacturonase allergen PEST411             454   7e-151   Elaeis guineensis
ref|XP_009121613.1|  PREDICTED: probable pectate lyase 19               456   9e-151   
emb|CDX74293.1|  BnaA03g27540D                                          455   9e-151   
ref|XP_006299938.1|  hypothetical protein CARUB_v10016149mg             455   9e-151   
emb|CDX91953.1|  BnaC03g32550D                                          455   1e-150   
emb|CDX81636.1|  BnaC08g39650D                                          455   1e-150   
gb|ACU23277.1|  unknown                                                 454   1e-150   Glycine max [soybeans]
ref|XP_003543726.1|  PREDICTED: pectate lyase                           454   1e-150   
ref|XP_010683249.1|  PREDICTED: pectate lyase-like                      453   2e-150   
ref|XP_007139601.1|  hypothetical protein PHAVU_008G043600g             452   3e-150   
emb|CDY66593.1|  BnaCnng51570D                                          454   3e-150   
ref|XP_009110541.1|  PREDICTED: probable pectate lyase 3                453   4e-150   
ref|XP_009129128.1|  PREDICTED: probable pectate lyase 6                452   5e-150   
emb|CDY09356.1|  BnaA02g26540D                                          452   5e-150   
ref|XP_009125036.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    452   8e-150   
emb|CDY68729.1|  BnaCnng60280D                                          452   9e-150   
emb|CDX85564.1|  BnaA02g02490D                                          452   1e-149   
ref|XP_010551866.1|  PREDICTED: probable pectate lyase 19               452   2e-149   
emb|CDX96854.1|  BnaA08g23970D                                          451   2e-149   
emb|CDY28691.1|  BnaCnng05770D                                          451   2e-149   
ref|XP_004966014.1|  PREDICTED: pectate lyase-like                      452   2e-149   
ref|XP_006826355.1|  hypothetical protein AMTR_s00004p00123190          452   2e-149   
ref|XP_009134622.1|  PREDICTED: probable pectate lyase 7                451   3e-149   
ref|XP_006656188.1|  PREDICTED: pectate lyase-like                      450   4e-149   
gb|EYU22437.1|  hypothetical protein MIMGU_mgv1a006496mg                449   4e-149   
gb|KEH24975.1|  pectate lyase P59-like protein                          449   7e-149   
ref|XP_009148818.1|  PREDICTED: probable pectate lyase 3                449   8e-149   
emb|CDY39314.1|  BnaC05g10650D                                          449   8e-149   
ref|XP_006431087.1|  hypothetical protein CICLE_v10011762mg             449   8e-149   
dbj|BAK06965.1|  predicted protein                                      449   9e-149   
gb|KFK43687.1|  hypothetical protein AALP_AA1G160000                    449   1e-148   
ref|XP_006482544.1|  PREDICTED: probable pectate lyase 19-like          448   2e-148   
emb|CDY41679.1|  BnaC02g34750D                                          449   2e-148   
ref|XP_003563707.1|  PREDICTED: pectate lyase-like                      448   2e-148   
gb|KFK33456.1|  hypothetical protein AALP_AA5G015800                    449   2e-148   
ref|XP_002437204.1|  hypothetical protein SORBIDRAFT_10g022830          448   2e-148   Sorghum bicolor [broomcorn]
gb|KHN13240.1|  Putative pectate lyase 3                                447   3e-148   
ref|XP_006292606.1|  hypothetical protein CARUB_v10018855mg             447   6e-148   
gb|KFK37588.1|  hypothetical protein AALP_AA3G002600                    447   7e-148   
emb|CDP00293.1|  unnamed protein product                                446   9e-148   
ref|XP_009114192.1|  PREDICTED: probable pectate lyase 6                447   1e-147   
ref|XP_009126031.1|  PREDICTED: probable pectate lyase 19               447   1e-147   
emb|CDY45254.1|  BnaA06g09240D                                          446   1e-147   
emb|CDY04133.1|  BnaA09g19110D                                          447   1e-147   
gb|KHN13490.1|  Putative pectate lyase 3                                442   2e-147   
ref|XP_004489168.1|  PREDICTED: pectate lyase-like                      445   4e-147   
ref|XP_010514040.1|  PREDICTED: probable pectate lyase 6                444   7e-147   
sp|P40973.1|PLY_LILLO  RecName: Full=Pectate lyase; Flags: Precursor    443   1e-146   Lilium longiflorum [Easter lily]
ref|XP_002882189.1|  pectate lyase family protein                       444   1e-146   
ref|XP_003554335.1|  PREDICTED: pectate lyase-like                      443   2e-146   
ref|XP_004228388.1|  PREDICTED: pectate lyase                           442   3e-146   
ref|XP_010425041.1|  PREDICTED: probable pectate lyase 6                442   4e-146   
emb|CDY17432.1|  BnaC09g21050D                                          442   6e-146   
ref|XP_010502279.1|  PREDICTED: probable pectate lyase 6                442   8e-146   
gb|EYU28712.1|  hypothetical protein MIMGU_mgv1a006498mg                441   1e-145   
ref|XP_006286712.1|  hypothetical protein CARUB_v10002862mg             444   1e-145   
gb|EAY99626.1|  hypothetical protein OsI_21605                          440   2e-145   Oryza sativa Indica Group [Indian rice]
emb|CDY63769.1|  BnaCnng42620D                                          442   2e-145   
ref|XP_007151201.1|  hypothetical protein PHAVU_004G026400g             440   3e-145   
ref|XP_006363934.1|  PREDICTED: pectate lyase-like                      439   3e-145   
gb|EPS73633.1|  hypothetical protein M569_01123                         440   4e-145   
gb|AFW87059.1|  pectate lyase                                           439   6e-145   
ref|XP_007137422.1|  hypothetical protein PHAVU_009G125800g             439   7e-145   
ref|XP_011086389.1|  PREDICTED: pectate lyase-like                      438   2e-144   
ref|XP_004489374.1|  PREDICTED: pectate lyase-like                      438   2e-144   
ref|NP_001150723.1|  pectate lyase precursor                            438   3e-144   Zea mays [maize]
ref|NP_178375.1|  putative pectate lyase 6                              437   6e-144   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001046281.1|  Os02g0214400                                       436   7e-144   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011087066.1|  PREDICTED: pectate lyase                           434   3e-143   
ref|XP_004964534.1|  PREDICTED: pectate lyase-like                      434   4e-143   
gb|KFK25747.1|  hypothetical protein AALP_AA8G154300                    436   4e-143   
ref|XP_010420163.1|  PREDICTED: probable pectate lyase 19 isoform X1    436   5e-143   
ref|XP_008679844.1|  PREDICTED: pectate lyase                           434   7e-143   
gb|AAA16476.1|  pectate lyase homolog                                   434   7e-143   Zea mays [maize]
ref|XP_004298448.1|  PREDICTED: probable pectate lyase 3-like           434   9e-143   
ref|XP_002875142.1|  pectate lyase family protein                       434   1e-142   
ref|XP_002453531.1|  hypothetical protein SORBIDRAFT_04g007450          432   2e-142   Sorghum bicolor [broomcorn]
ref|XP_009758350.1|  PREDICTED: pectate lyase-like                      432   3e-142   
ref|XP_009380431.1|  PREDICTED: pectate lyase-like                      431   5e-142   
gb|ACF87417.1|  unknown                                                 432   5e-142   Zea mays [maize]
ref|XP_002437815.1|  hypothetical protein SORBIDRAFT_10g003090          431   6e-142   Sorghum bicolor [broomcorn]
ref|XP_002436463.1|  hypothetical protein SORBIDRAFT_10g003080          432   6e-142   Sorghum bicolor [broomcorn]
dbj|BAH20311.1|  AT3G01270                                              428   1e-141   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011071024.1|  PREDICTED: pectate lyase-like                      431   1e-141   
ref|XP_010420165.1|  PREDICTED: probable pectate lyase 19 isoform X3    433   1e-141   
ref|XP_009599232.1|  PREDICTED: pectate lyase-like                      430   2e-141   
ref|XP_010527871.1|  PREDICTED: probable pectate lyase 3 isoform X1     439   3e-141   
ref|NP_001056781.1|  Os06g0144200                                       430   3e-141   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD68402.1|  putative pectate lyase homolog                         429   4e-141   Oryza sativa Japonica Group [Japonica rice]
gb|EAY85003.1|  hypothetical protein OsI_06363                          428   8e-141   Oryza sativa Indica Group [Indian rice]
ref|XP_010096345.1|  putative pectate lyase 7                           426   1e-140   
ref|XP_011097774.1|  PREDICTED: pectate lyase-like                      427   2e-140   
gb|AGT16687.1|  pectate lyase                                           427   2e-140   
gb|AAA86241.1|  pectate lyase homolog                                   428   2e-140   Medicago sativa [alfalfa]
ref|XP_009101245.1|  PREDICTED: probable pectate lyase 6                427   3e-140   
gb|KHG08946.1|  Pectate lyase                                           425   4e-140   
emb|CDY45202.1|  BnaA06g34060D                                          426   8e-140   
ref|XP_006357289.1|  PREDICTED: probable pectate lyase 3-like           426   8e-140   
ref|NP_001150425.1|  LOC100284055 precursor                             425   2e-139   Zea mays [maize]
ref|XP_009797403.1|  PREDICTED: pectate lyase-like                      425   2e-139   
ref|XP_006579282.1|  PREDICTED: probable pectate lyase P59-like         424   3e-139   
gb|EPS62426.1|  hypothetical protein M569_12361                         423   4e-139   
ref|XP_003621115.1|  Pectate lyase                                      424   4e-139   
emb|CDY03043.1|  BnaC07g21840D                                          422   7e-138   
gb|EAY99621.1|  hypothetical protein OsI_21600                          421   7e-138   Oryza sativa Indica Group [Indian rice]
ref|NP_001056784.1|  Os06g0144900                                       421   8e-138   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006655782.1|  PREDICTED: pectate lyase-like                      417   1e-137   
ref|XP_004951474.1|  PREDICTED: pectate lyase-like                      419   2e-137   
ref|XP_009587688.1|  PREDICTED: pectate lyase-like                      416   9e-137   
ref|XP_009789922.1|  PREDICTED: pectate lyase-like                      415   3e-136   
gb|KDO49831.1|  hypothetical protein CISIN_1g044170mg                   413   6e-136   
ref|XP_004301165.1|  PREDICTED: probable pectate lyase P59-like         414   4e-135   
dbj|BAK05605.1|  predicted protein                                      414   6e-135   
gb|KGN47799.1|  hypothetical protein Csa_6G404140                       412   1e-134   
ref|XP_006357121.1|  PREDICTED: pectate lyase-like                      411   1e-134   
ref|XP_004233352.1|  PREDICTED: pectate lyase-like                      410   3e-134   
ref|XP_009627245.1|  PREDICTED: pectate lyase-like                      411   6e-134   
ref|XP_003571658.1|  PREDICTED: pectate lyase-like                      410   6e-134   
ref|NP_001056786.1|  Os06g0145100                                       407   7e-134   
emb|CDP02199.1|  unnamed protein product                                406   2e-133   
ref|XP_009757256.1|  PREDICTED: pectate lyase                           404   7e-132   
gb|EMS45831.1|  Pectate lyase                                           406   8e-131   
ref|XP_010450167.1|  PREDICTED: probable pectate lyase 15 isoform X1    401   7e-130   
ref|XP_010450168.1|  PREDICTED: probable pectate lyase 15 isoform X2    401   8e-130   
ref|XP_010435229.1|  PREDICTED: probable pectate lyase 15               401   8e-130   
ref|XP_010440536.1|  PREDICTED: probable pectate lyase 15 isoform X2    401   8e-130   
ref|XP_010440534.1|  PREDICTED: probable pectate lyase 15 isoform X1    400   1e-129   
gb|EYU30593.1|  hypothetical protein MIMGU_mgv1a007569mg                398   1e-129   
ref|XP_004171543.1|  PREDICTED: probable pectate lyase 15-like          398   4e-129   
ref|XP_008460726.1|  PREDICTED: probable pectate lyase 8 isoform X1     399   5e-129   
ref|XP_004234780.1|  PREDICTED: probable pectate lyase P56              396   5e-129   
ref|XP_006282594.1|  hypothetical protein CARUB_v10004736mg             399   5e-129   
ref|XP_004138973.1|  PREDICTED: probable pectate lyase 15-like          398   6e-129   
ref|XP_008460727.1|  PREDICTED: probable pectate lyase 1 isoform X2     397   1e-128   
ref|XP_002870357.1|  pectate lyase family protein                       398   2e-128   
ref|XP_006852264.1|  hypothetical protein AMTR_s00049p00173370          395   4e-128   
ref|XP_008460728.1|  PREDICTED: probable pectate lyase 1 isoform X3     393   4e-128   
gb|KHG22755.1|  hypothetical protein F383_29653                         394   5e-128   
ref|XP_006361836.1|  PREDICTED: probable pectate lyase P56-like         394   6e-128   
emb|CDY18738.1|  BnaC08g08780D                                          397   6e-128   
emb|CDY53564.1|  BnaC04g55760D                                          395   9e-128   
ref|XP_009107745.1|  PREDICTED: probable pectate lyase 15               395   1e-127   
ref|NP_567409.1|  probable pectate lyase 15                             395   2e-127   
ref|XP_009586995.1|  PREDICTED: probable pectate lyase 5                392   2e-127   
ref|NP_001190720.1|  probable pectate lyase 15                          394   2e-127   
emb|CAB36835.1|  putative pectate lyase A11 (fragment)                  391   3e-127   
dbj|BAF43573.1|  pectate lyase                                          392   5e-127   
ref|XP_008438392.1|  PREDICTED: probable pectate lyase 8                393   5e-127   
gb|EMT27253.1|  hypothetical protein F775_20306                         390   5e-127   
ref|XP_003555714.2|  PREDICTED: probable pectate lyase 1-like           394   6e-127   
ref|XP_011086987.1|  PREDICTED: probable pectate lyase 22               391   6e-127   
ref|XP_007222160.1|  hypothetical protein PRUPE_ppa005761mg             393   7e-127   
ref|XP_009139602.1|  PREDICTED: probable pectate lyase 15               393   8e-127   
emb|CDY01151.1|  BnaA04g06680D                                          392   9e-127   
ref|XP_010684949.1|  PREDICTED: probable pectate lyase 8                392   1e-126   
ref|XP_008667903.1|  PREDICTED: pectate lyase 8 isoform X1              393   2e-126   
ref|XP_003535958.1|  PREDICTED: probable pectate lyase 1-like           392   2e-126   
ref|XP_007037815.1|  Pectin lyase-like superfamily protein isoform 1    390   2e-126   
ref|XP_008223974.1|  PREDICTED: probable pectate lyase 8                391   4e-126   
ref|XP_010532807.1|  PREDICTED: probable pectate lyase 15               391   4e-126   
ref|XP_011072008.1|  PREDICTED: probable pectate lyase 18               389   4e-126   
ref|XP_004515847.1|  PREDICTED: probable pectate lyase 22-like          389   5e-126   
ref|XP_009397895.1|  PREDICTED: probable pectate lyase 8                391   5e-126   
ref|XP_004134015.1|  PREDICTED: probable pectate lyase 15-like          390   5e-126   
ref|XP_007145412.1|  hypothetical protein PHAVU_007G236800g             390   5e-126   
ref|XP_004501839.1|  PREDICTED: probable pectate lyase 5-like           389   6e-126   
dbj|BAI94495.1|  pectate lyase                                          389   6e-126   
ref|XP_009406385.1|  PREDICTED: probable pectate lyase 18               389   6e-126   
ref|XP_009804979.1|  PREDICTED: probable pectate lyase 5                389   7e-126   
ref|XP_003638513.1|  Pectate lyase                                      389   8e-126   
ref|XP_010106682.1|  hypothetical protein L484_004616                   388   8e-126   
ref|XP_003523121.1|  PREDICTED: probable pectate lyase 18-like          389   8e-126   
emb|CDP16631.1|  unnamed protein product                                389   9e-126   
ref|XP_010683248.1|  PREDICTED: pectate lyase-like                      390   1e-125   
ref|XP_007155507.1|  hypothetical protein PHAVU_003G207400g             388   1e-125   
gb|KHG30349.1|  hypothetical protein F383_15991                         391   1e-125   
emb|CDY56220.1|  BnaAnng14170D                                          388   1e-125   
ref|XP_007034463.1|  Pectin lyase-like superfamily protein              389   2e-125   
ref|XP_004152502.1|  PREDICTED: probable pectate lyase 22-like          388   2e-125   
ref|XP_011086701.1|  PREDICTED: probable pectate lyase 5                387   2e-125   
gb|KHG06252.1|  hypothetical protein F383_10745                         389   2e-125   
ref|XP_009599824.1|  PREDICTED: pectate lyase                           387   2e-125   
ref|NP_001147553.1|  pectate lyase 8                                    390   2e-125   
ref|XP_010532870.1|  PREDICTED: putative pectate lyase 14               389   3e-125   
gb|AAX88800.1|  ripening-related pectate lyase                          388   3e-125   
emb|CAN76500.1|  hypothetical protein VITISV_004734                     387   4e-125   
ref|XP_004289729.1|  PREDICTED: probable pectate lyase 15-like          389   4e-125   
gb|AEN70981.1|  pectate lyase                                           387   4e-125   
ref|XP_008391438.1|  PREDICTED: probable pectate lyase 8                388   4e-125   
gb|AAK66161.1|  pectate lyase                                           385   4e-125   
ref|XP_010663062.1|  PREDICTED: probable pectate lyase 5                387   4e-125   
ref|XP_008360481.1|  PREDICTED: probable pectate lyase 8                388   4e-125   
gb|ADB90475.1|  pectate lyase                                           387   5e-125   
ref|XP_010239620.1|  PREDICTED: probable pectate lyase 8 isoform X2     387   5e-125   
gb|AEN70964.1|  pectate lyase                                           387   6e-125   
gb|AEN70963.1|  pectate lyase                                           387   6e-125   
ref|XP_010320956.1|  PREDICTED: probable pectate lyase 5                386   6e-125   
ref|XP_010935686.1|  PREDICTED: probable pectate lyase 8 isoform X2     387   7e-125   
dbj|BAK06362.1|  predicted protein                                      388   7e-125   
gb|AEN70985.1|  pectate lyase                                           386   7e-125   
ref|XP_010935685.1|  PREDICTED: probable pectate lyase 8 isoform X1     388   7e-125   
gb|KHG19997.1|  hypothetical protein F383_02891                         386   7e-125   
ref|XP_010239619.1|  PREDICTED: probable pectate lyase 8 isoform X1     387   8e-125   
ref|XP_004157771.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    386   9e-125   
ref|XP_004515913.1|  PREDICTED: probable pectate lyase 12-like          388   1e-124   
gb|EYU22243.1|  hypothetical protein MIMGU_mgv1a007460mg                385   1e-124   
ref|XP_010527219.1|  PREDICTED: probable pectate lyase 10               385   1e-124   
ref|XP_008351757.1|  PREDICTED: probable pectate lyase 18               385   1e-124   
ref|XP_009385867.1|  PREDICTED: probable pectate lyase 8 isoform X2     387   1e-124   
gb|AAF19196.1|AF206320_1  pectate lyase 2                               387   2e-124   
gb|AEN70984.1|  pectate lyase                                           385   2e-124   
ref|XP_009105327.1|  PREDICTED: probable pectate lyase 5                385   2e-124   
gb|ADB90476.1|  pectate lyase                                           385   2e-124   
ref|XP_009362042.1|  PREDICTED: probable pectate lyase 8                386   2e-124   
gb|AAF19195.1|AF206319_1  pectate lyase 1                               385   2e-124   
ref|XP_002884619.1|  pectate lyase family protein                       385   2e-124   
ref|XP_009359518.1|  PREDICTED: probable pectate lyase 18               385   2e-124   
gb|EEE60442.1|  hypothetical protein OsJ_13660                          386   3e-124   
gb|EEE56553.1|  hypothetical protein OsJ_05879                          385   3e-124   
ref|XP_002318694.1|  pectate lyase 22 precursor family protein          384   3e-124   
gb|KFK39718.1|  hypothetical protein AALP_AA3G279700                    384   3e-124   
ref|XP_011040439.1|  PREDICTED: probable pectate lyase 18               384   3e-124   
ref|XP_010250930.1|  PREDICTED: probable pectate lyase 5                384   3e-124   
gb|KHN45481.1|  Putative pectate lyase 3                                383   3e-124   
gb|EEC76710.1|  hypothetical protein OsI_14719                          387   4e-124   
ref|XP_010023768.1|  PREDICTED: probable pectate lyase 1 isoform X2     385   4e-124   
dbj|BAB10313.1|  pectate lyase                                          384   4e-124   
ref|XP_009400924.1|  PREDICTED: probable pectate lyase 8 isoform X2     385   4e-124   
emb|CAE02420.2|  OSJNBa0095E20.8                                        387   4e-124   
ref|XP_009400922.1|  PREDICTED: probable pectate lyase 8 isoform X1     385   4e-124   
ref|XP_009385866.1|  PREDICTED: probable pectate lyase 8 isoform X1     387   4e-124   
emb|CDY01846.1|  BnaC06g28860D                                          384   5e-124   
ref|XP_010464311.1|  PREDICTED: probable pectate lyase 8                384   5e-124   
gb|KFK39719.1|  hypothetical protein AALP_AA3G279700                    385   5e-124   
ref|XP_010545988.1|  PREDICTED: probable pectate lyase 22               384   5e-124   
ref|NP_568705.1|  putative pectate lyase 20                             384   5e-124   
emb|CBI33346.3|  unnamed protein product                                385   5e-124   
ref|XP_010102919.1|  hypothetical protein L484_018936                   384   5e-124   
ref|XP_006341783.1|  PREDICTED: probable pectate lyase 5-like           384   6e-124   
ref|XP_010672089.1|  PREDICTED: probable pectate lyase 1                385   6e-124   
gb|AAY85180.1|  pectate lyase                                           384   6e-124   
ref|XP_009111089.1|  PREDICTED: probable pectate lyase 1                385   6e-124   
ref|XP_002304700.1|  pectate lyase family protein                       385   6e-124   
ref|XP_004497757.1|  PREDICTED: probable pectate lyase 15-like          385   6e-124   
gb|KHN34377.1|  Putative pectate lyase 22                               384   6e-124   
ref|XP_010264036.1|  PREDICTED: probable pectate lyase 8                385   7e-124   
emb|CDX86615.1|  BnaC08g00880D                                          384   7e-124   
ref|XP_006480190.1|  PREDICTED: probable pectate lyase 8-like           385   7e-124   
ref|XP_007137977.1|  hypothetical protein PHAVU_009G170500g             384   7e-124   
ref|XP_006283843.1|  hypothetical protein CARUB_v10004942mg             384   7e-124   
ref|XP_009804999.1|  PREDICTED: probable pectate lyase 8                385   7e-124   
ref|XP_008458848.1|  PREDICTED: pectate lyase-like                      384   8e-124   
gb|AEN70977.1|  pectate lyase                                           384   8e-124   
gb|KDO65869.1|  hypothetical protein CISIN_1g013239mg                   385   9e-124   
ref|XP_002322215.1|  pectate lyase 22 precursor family protein          383   9e-124   
ref|XP_002863927.1|  pectate lyase family protein                       384   9e-124   
emb|CDY66697.1|  BnaAnng22760D                                          385   1e-123   
ref|XP_004299169.1|  PREDICTED: probable pectate lyase 18-like          383   1e-123   
gb|KEH41255.1|  pectate lyase family protein                            385   1e-123   
ref|XP_010248740.1|  PREDICTED: probable pectate lyase 18               383   1e-123   
gb|ADB90479.1|  pectate lyase                                           383   1e-123   
ref|XP_004156698.1|  PREDICTED: putative pectate lyase 11-like          384   1e-123   
ref|XP_004142773.1|  PREDICTED: putative pectate lyase 11-like          384   1e-123   
ref|NP_001289258.1|  probable pectate lyase 18 precursor                383   1e-123   
ref|NP_001141589.1|  uncharacterized protein LOC100273705               385   1e-123   
ref|XP_007031685.1|  Pectin lyase-like superfamily protein              383   1e-123   
ref|XP_010447044.1|  PREDICTED: probable pectate lyase 8                383   1e-123   
ref|XP_002866540.1|  pectate lyase                                      383   1e-123   
dbj|BAB10560.1|  pectate lyase                                          383   1e-123   
ref|XP_009408120.1|  PREDICTED: probable pectate lyase 8                384   2e-123   
ref|XP_004236303.1|  PREDICTED: probable pectate lyase 18               382   2e-123   
ref|NP_568967.1|  putative pectate lyase 22                             384   2e-123   
ref|XP_010439830.1|  PREDICTED: probable pectate lyase 20               383   2e-123   
gb|KDP33375.1|  hypothetical protein JCGZ_12924                         384   2e-123   
ref|XP_010100325.1|  hypothetical protein L484_027633                   382   2e-123   
ref|XP_002285639.2|  PREDICTED: probable pectate lyase 8                384   2e-123   
gb|AEN70965.1|  pectate lyase                                           382   2e-123   
ref|XP_002885665.1|  pectate lyase family protein                       384   2e-123   
ref|XP_011073763.1|  PREDICTED: probable pectate lyase 8                384   2e-123   
ref|XP_006297684.1|  hypothetical protein CARUB_v10013715mg             384   2e-123   
ref|NP_187357.1|  putative pectate lyase 8                              382   2e-123   
ref|XP_011020694.1|  PREDICTED: probable pectate lyase 8                384   2e-123   
ref|XP_010023767.1|  PREDICTED: probable pectate lyase 8 isoform X1     384   3e-123   
gb|AAM63307.1|  pectate lyase                                           382   3e-123   
ref|XP_010243989.1|  PREDICTED: probable pectate lyase 8                384   3e-123   
emb|CDO99404.1|  unnamed protein product                                384   3e-123   
ref|XP_002285340.1|  PREDICTED: probable pectate lyase 5                382   3e-123   
gb|EYU46355.1|  hypothetical protein MIMGU_mgv1a007094mg                382   3e-123   
ref|XP_003549832.1|  PREDICTED: probable pectate lyase 18 isoform 1     382   3e-123   
ref|NP_189110.1|  probable pectate lyase 10                             383   3e-123   
ref|XP_006487597.1|  PREDICTED: probable pectate lyase 1-like           383   4e-123   
ref|XP_006484000.1|  PREDICTED: probable pectate lyase 5-like           382   4e-123   
ref|XP_010486231.1|  PREDICTED: probable pectate lyase 8                382   4e-123   
gb|ADB90478.1|  pectate lyase                                           382   4e-123   
gb|ADB90477.1|  pectate lyase                                           382   4e-123   
ref|XP_011005597.1|  PREDICTED: probable pectate lyase 18               381   5e-123   
ref|XP_010442341.1|  PREDICTED: probable pectate lyase 20               382   5e-123   
emb|CDY46471.1|  BnaC07g03950D                                          382   5e-123   
ref|XP_002297822.1|  pectate lyase family protein                       383   5e-123   
ref|XP_010940647.1|  PREDICTED: probable pectate lyase 8                383   5e-123   
emb|CDX77470.1|  BnaA07g06080D                                          383   5e-123   
gb|KDO82120.1|  hypothetical protein CISIN_1g015702mg                   381   5e-123   
gb|AEN70968.1|  pectate lyase                                           381   5e-123   
ref|XP_008444399.1|  PREDICTED: probable pectate lyase 5                382   5e-123   
ref|XP_009624534.1|  PREDICTED: probable pectate lyase 8                382   5e-123   
gb|AFK44189.1|  unknown                                                 381   6e-123   
emb|CAN78491.1|  hypothetical protein VITISV_004934                     382   6e-123   
gb|ACB12931.1|  pectate lyase 1-27                                      383   6e-123   
ref|XP_004143054.1|  PREDICTED: probable pectate lyase 5-like           381   7e-123   
ref|XP_009370039.1|  PREDICTED: probable pectate lyase 8                382   7e-123   
ref|XP_006297767.1|  hypothetical protein CARUB_v10013802mg             381   8e-123   
ref|XP_011091390.1|  PREDICTED: probable pectate lyase 8                382   8e-123   
ref|XP_009102560.1|  PREDICTED: probable pectate lyase 9                382   8e-123   
ref|XP_004975048.1|  PREDICTED: probable pectate lyase 15-like is...    382   9e-123   
ref|XP_009411363.1|  PREDICTED: probable pectate lyase 8                382   9e-123   
ref|XP_010918897.1|  PREDICTED: probable pectate lyase 8 isoform X2     381   9e-123   
ref|XP_008800564.1|  PREDICTED: probable pectate lyase 8 isoform X2     382   9e-123   
ref|XP_002887143.1|  pectate lyase family protein                       381   9e-123   
ref|XP_002515037.1|  Pectate lyase precursor, putative                  380   1e-122   
ref|XP_008800563.1|  PREDICTED: probable pectate lyase 8 isoform X1     382   1e-122   
ref|XP_009391056.1|  PREDICTED: probable pectate lyase 8                382   1e-122   
gb|KDP26717.1|  hypothetical protein JCGZ_17875                         380   1e-122   
gb|KHG22990.1|  hypothetical protein F383_28754                         380   1e-122   
gb|AAM67091.1|  putative pectate lyase                                  380   1e-122   
ref|XP_003608909.1|  Pectate lyase                                      380   1e-122   
ref|XP_010038352.1|  PREDICTED: probable pectate lyase 8                382   1e-122   
ref|XP_006438176.1|  hypothetical protein CICLE_v10031429mg             383   1e-122   
ref|NP_564906.1|  putative pectate lyase 5                              380   1e-122   
gb|AFZ78654.1|  pectate lyase                                           382   1e-122   
emb|CDY08948.1|  BnaC08g11780D                                          380   1e-122   
ref|XP_010918895.1|  PREDICTED: probable pectate lyase 8 isoform X1     382   1e-122   
ref|XP_003520660.1|  PREDICTED: probable pectate lyase 12-like          382   1e-122   
ref|XP_011097349.1|  PREDICTED: pectate lyase-like                      380   1e-122   
gb|KHN18683.1|  Putative pectate lyase 12                               382   1e-122   
gb|KFK28033.1|  hypothetical protein AALP_AA8G463100                    380   2e-122   



>ref|XP_009599825.1| PREDICTED: probable pectate lyase P59 isoform X1 [Nicotiana tomentosiformis]
Length=445

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/440 (68%), Positives = 359/440 (82%), Gaps = 5/440 (1%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTL  1450
             FFLF++  A IIP  + HI ++DEVWRRRA EA ++A+Q YEPNP N++ +   +VR ++
Sbjct  11    FFLFII-FATIIPCLMAHIGDFDEVWRRRAEEAREYARQIYEPNPENVTLAFNQKVRDSM  69

Query  1449  SEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYK  1270
              E       +N + R  LG+KKY+GPC  TNPIDRCWRC  +WA NRKRLADCAMGFG K
Sbjct  70    KEVT----VSNNSTRRGLGTKKYKGPCMVTNPIDRCWRCDPNWADNRKRLADCAMGFGSK  125

Query  1269  TKGGKSGKFYTVTDKSDDQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKT  1090
               GGK G+ Y VTD SDD + PKPGTLR+AVIQK+PLWIIF   M I+LHQELIMQ DKT
Sbjct  126   ATGGKDGEIYIVTDNSDDYAEPKPGTLRYAVIQKEPLWIIFERSMTIRLHQELIMQSDKT  185

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             ID RGA VHI+ GAGIT+Q++KNVIIHG+HIH I EG+GG++RD +DH G+RT SDGDGI
Sbjct  186   IDARGANVHIAKGAGITLQYIKNVIIHGLHIHDIVEGSGGMVRDAVDHIGIRTVSDGDGI  245

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             SIFG+SN+WIDHVSMR CYDG+IDA+E STAITISNGHFTDHN+VMLFGA+D S+ D++M
Sbjct  246   SIFGASNIWIDHVSMRKCYDGIIDAVEGSTAITISNGHFTDHNEVMLFGASDSSSIDQVM  305

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             QITLAFNHFGKRL+QRMPRCR+GYIHVVNNDYTHWNMYAIGGS HPTII QGNRFIAPPD
Sbjct  306   QITLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPPD  365

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAE  370
             I KK++TKR     E WK WTWRS+G+++M GA+F++SGDP++  KH +LYDG+    AE
Sbjct  366   IFKKQVTKREYNPEEVWKHWTWRSEGNLFMNGAYFIESGDPDWSKKHKELYDGISAAPAE  425

Query  369   DVTWLTRFAGALNCRVGSPC  310
             +VTW+TRFAGAL C+ G  C
Sbjct  426   EVTWITRFAGALGCKKGKAC  445



>ref|XP_009779191.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/444 (67%), Positives = 361/444 (81%), Gaps = 3/444 (1%)
 Frame = -3

Query  1641  KNNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQV  1462
             K + FFLF++  A II   + HI ++DEVWRRRA EA ++A+Q YEPNP N++ +   +V
Sbjct  7     KYSFFFLFII-FATIIRNLMAHIGDFDEVWRRRAEEAREYARQIYEPNPENVTLAFNQKV  65

Query  1461  RRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMG  1282
             R T+ E     +T + + R  LG+KKY+GPC  TNPIDRCWRC  +WA NRKRLADCAMG
Sbjct  66    RDTMKEL--RQVTVSNSTRRGLGTKKYKGPCMVTNPIDRCWRCDPNWADNRKRLADCAMG  123

Query  1281  FGYKTKGGKSGKFYTVTDKSDDQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQ  1102
             FGYK  GGK G+ Y VTD SDD + PKPGTLR+AVIQK+PLWIIF   M I+LHQE+IMQ
Sbjct  124   FGYKATGGKDGEIYIVTDNSDDYAEPKPGTLRYAVIQKEPLWIIFERSMTIRLHQEMIMQ  183

Query  1101  GDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsd  922
              DKTID RGA VHI+ GAGIT+Q++KNVIIHG+HIH I EG+GG++RD +DH G+RT SD
Sbjct  184   SDKTIDARGANVHIAKGAGITLQYIKNVIIHGLHIHDIVEGSGGMVRDAVDHIGIRTVSD  243

Query  921   gdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTK  742
             GDGISIFG+SN+WIDHVSM+ CYDG+IDA+E ST ITISNGHFTDHN+VMLFGA+D S+ 
Sbjct  244   GDGISIFGASNIWIDHVSMKKCYDGIIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSI  303

Query  741   DKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFI  562
             D++MQITLAFNHFGKRL+QRMPRCR+GYIHVVNNDYTHWNMYAIGGS HPTII QGNRFI
Sbjct  304   DQVMQITLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFI  363

Query  561   APPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMT  382
             APPDI KK++TKR     E WK WTWRS+G+++M GA+F++SGDP++  KH +LYDG+  
Sbjct  364   APPDIFKKQVTKREYNPEEVWKQWTWRSEGNLFMNGAYFIESGDPDWSKKHKELYDGISA  423

Query  381   FKAEDVTWLTRFAGALNCRVGSPC  310
               AE+VTW+TRFAGAL C+ G  C
Sbjct  424   ASAEEVTWITRFAGALGCKEGKAC  447



>ref|XP_009599826.1| PREDICTED: probable pectate lyase P59 isoform X2 [Nicotiana tomentosiformis]
Length=444

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/440 (68%), Positives = 358/440 (81%), Gaps = 6/440 (1%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTL  1450
             FFLF++  A IIP  + HI ++DEVWRRRA EA ++A+Q YEPNP N++ +   +VR   
Sbjct  11    FFLFII-FATIIPCLMAHIGDFDEVWRRRAEEAREYARQIYEPNPENVTLAFNQKVRD--  67

Query  1449  SEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYK  1270
                + E   +N + R  LG+KKY+GPC  TNPIDRCWRC  +WA NRKRLADCAMGFG K
Sbjct  68    ---MKEVTVSNNSTRRGLGTKKYKGPCMVTNPIDRCWRCDPNWADNRKRLADCAMGFGSK  124

Query  1269  TKGGKSGKFYTVTDKSDDQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKT  1090
               GGK G+ Y VTD SDD + PKPGTLR+AVIQK+PLWIIF   M I+LHQELIMQ DKT
Sbjct  125   ATGGKDGEIYIVTDNSDDYAEPKPGTLRYAVIQKEPLWIIFERSMTIRLHQELIMQSDKT  184

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             ID RGA VHI+ GAGIT+Q++KNVIIHG+HIH I EG+GG++RD +DH G+RT SDGDGI
Sbjct  185   IDARGANVHIAKGAGITLQYIKNVIIHGLHIHDIVEGSGGMVRDAVDHIGIRTVSDGDGI  244

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             SIFG+SN+WIDHVSMR CYDG+IDA+E STAITISNGHFTDHN+VMLFGA+D S+ D++M
Sbjct  245   SIFGASNIWIDHVSMRKCYDGIIDAVEGSTAITISNGHFTDHNEVMLFGASDSSSIDQVM  304

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             QITLAFNHFGKRL+QRMPRCR+GYIHVVNNDYTHWNMYAIGGS HPTII QGNRFIAPPD
Sbjct  305   QITLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPPD  364

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAE  370
             I KK++TKR     E WK WTWRS+G+++M GA+F++SGDP++  KH +LYDG+    AE
Sbjct  365   IFKKQVTKREYNPEEVWKHWTWRSEGNLFMNGAYFIESGDPDWSKKHKELYDGISAAPAE  424

Query  369   DVTWLTRFAGALNCRVGSPC  310
             +VTW+TRFAGAL C+ G  C
Sbjct  425   EVTWITRFAGALGCKKGKAC  444



>ref|XP_004234779.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=449

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/440 (67%), Positives = 352/440 (80%), Gaps = 0/440 (0%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTL  1450
             F    ++ A IIP+ + HI  YDEVWRRRA EA ++A++ YEP+P N++ +   ++R T+
Sbjct  10    FLFLCITFATIIPSLMAHIGHYDEVWRRRAEEAKEYARKIYEPHPENVTLAFNQKLRDTM  69

Query  1449  SEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYK  1270
              E      T N + R  LG+KKY GPC  TNPID+CWRC  +WA NRK+LADCAMGFG K
Sbjct  70    KELKKVKGTHNNSTRRGLGTKKYTGPCMVTNPIDKCWRCDPNWADNRKKLADCAMGFGSK  129

Query  1269  TKGGKSGKFYTVTDKSDDQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKT  1090
               GGK G+FY VTD SDD ++PKPGTLRHAVIQK+PLWIIF   MNI+LHQE+IMQ DKT
Sbjct  130   AIGGKDGEFYVVTDNSDDYNDPKPGTLRHAVIQKEPLWIIFKRGMNIRLHQEMIMQSDKT  189

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             ID RG  VHI+ GAGIT+Q++KNVIIHG+HIH I EGNGG++RD +DH G+RTKSDGDGI
Sbjct  190   IDARGVNVHITKGAGITLQYIKNVIIHGLHIHDIVEGNGGMVRDAVDHIGIRTKSDGDGI  249

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             SIFG+SN+WIDHVSM+ CYDGLIDA+E ST ITISNGHFTDHN+VMLFGA+D S+ D++M
Sbjct  250   SIFGASNIWIDHVSMQRCYDGLIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQVM  309

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             QITLAFNHFGKRLIQRMPRCR+GYIHVVNNDYTHWNMYAIGGS HPTII QGNRFIAPPD
Sbjct  310   QITLAFNHFGKRLIQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPPD  369

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAE  370
             I KK++TKR       W  WTWRS+G+++M GA+F +SGDP +  KH  LYDG+    AE
Sbjct  370   IFKKQVTKREYNPESVWMQWTWRSEGNLFMNGAYFTESGDPEWSSKHKDLYDGISAAPAE  429

Query  369   DVTWLTRFAGALNCRVGSPC  310
             DVTW+TRFAG L C+ G PC
Sbjct  430   DVTWMTRFAGVLGCKPGKPC  449



>ref|XP_006361835.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=447

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/440 (68%), Positives = 356/440 (81%), Gaps = 2/440 (0%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTL  1450
             F    ++ A IIP+ + HI  YDEVWRRRA EA ++A+Q YE +P N++ +   ++R T+
Sbjct  10    FLFLCITFATIIPSLMAHIGHYDEVWRRRAEEAKEYARQIYERHPENVTLAFNQKLRNTM  69

Query  1449  SEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYK  1270
              E + E   TN+T R  LG+KKY GPC  TNPIDRCWRC  +WA NRKRLADCAMGFG K
Sbjct  70    KE-LKEVKGTNST-RRGLGTKKYCGPCIVTNPIDRCWRCDPNWADNRKRLADCAMGFGSK  127

Query  1269  TKGGKSGKFYTVTDKSDDQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKT  1090
               GGK+G+FY VTD SDD ++PKPGTLR+AVIQK+PLWIIF   MNI+LHQE+IMQ DKT
Sbjct  128   VTGGKNGEFYVVTDNSDDYNDPKPGTLRYAVIQKEPLWIIFKRGMNIRLHQEMIMQSDKT  187

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             ID RG  VHI+ GAGIT+Q++KNVIIHG+HIH I EGNGG++RD +DH G+RTKSDGDGI
Sbjct  188   IDARGVNVHITKGAGITLQYIKNVIIHGLHIHDIVEGNGGMVRDAVDHIGIRTKSDGDGI  247

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             SIFG+SN+WIDHVSM+ CYDGLIDA+E ST ITISNGHFTDHN+VMLFGA+D S+ D++M
Sbjct  248   SIFGASNIWIDHVSMQRCYDGLIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQVM  307

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             QITLAFNHFGKRL+QRMPRCR+GYIHVVNNDYTHWNMYAIGGS HPTII QGNRFIAPPD
Sbjct  308   QITLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPPD  367

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAE  370
             I KK++TKR       W  WTWRS+G+++M GA+F +SGDP++  KH  LYDG+    AE
Sbjct  368   IFKKQVTKREYNPESVWMQWTWRSEGNLFMNGAYFTESGDPDWSKKHKDLYDGISAAPAE  427

Query  369   DVTWLTRFAGALNCRVGSPC  310
             DVTW+TRFAG L C+ G PC
Sbjct  428   DVTWMTRFAGVLACKPGKPC  447



>sp|P15722.1|PLY59_SOLLC RecName: Full=Probable pectate lyase P59; Flags: Precursor [Solanum 
lycopersicum]
 emb|CAA33523.1| P59 protein [Solanum lycopersicum]
Length=449

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/440 (67%), Positives = 350/440 (80%), Gaps = 0/440 (0%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTL  1450
             F    ++ A IIP+ + HI  YDEVWRRRA EA ++A+  YEP+P N++ +   ++R T+
Sbjct  10    FLFLCITFATIIPSLMAHIGHYDEVWRRRAEEAKEYARNIYEPHPENVTLAFNQKLRDTM  69

Query  1449  SEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYK  1270
              E      T N + R  LG+KKY GPC  TNPID+CWRC  +WA NRK+LADCAMGFG K
Sbjct  70    KELKKVKGTHNNSTRRGLGTKKYTGPCMVTNPIDKCWRCDPNWADNRKKLADCAMGFGSK  129

Query  1269  TKGGKSGKFYTVTDKSDDQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKT  1090
               GGK G+FY VTD SDD ++PKPGTLRHAVIQK+PLWIIF   MNI+LHQE+IMQ DKT
Sbjct  130   AIGGKDGEFYVVTDNSDDYNDPKPGTLRHAVIQKEPLWIIFKRGMNIRLHQEMIMQSDKT  189

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             ID RG  VHI+ GAGIT+Q++KNVIIHG+HIH I EGNGG++RD +DH G+RTKSDGDGI
Sbjct  190   IDARGVNVHITKGAGITLQYIKNVIIHGLHIHDIVEGNGGMVRDAVDHIGIRTKSDGDGI  249

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             SIFG+S +WIDHVSM+ CYDGLIDA+E ST ITISNGHFTDHN+VMLFGA+D S+ D++M
Sbjct  250   SIFGASYIWIDHVSMQRCYDGLIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQVM  309

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             QITLAFNHFGKRLIQRMPRCR+GYIHVVNNDYTHWNMYAIGGS HPTII QGNRFIAPPD
Sbjct  310   QITLAFNHFGKRLIQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIIHQGNRFIAPPD  369

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAE  370
             I KK++TKR       W  WTWRS+G+++M GA+F +SGDP +  KH  LYDG+    AE
Sbjct  370   IFKKQVTKREYNPESVWMQWTWRSEGNLFMNGAYFTESGDPEWSSKHKDLYDGISAAPAE  429

Query  369   DVTWLTRFAGALNCRVGSPC  310
             DVTW+TRFAG L C+ G PC
Sbjct  430   DVTWMTRFAGVLGCKPGKPC  449



>ref|XP_009587689.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=447

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/440 (69%), Positives = 349/440 (79%), Gaps = 2/440 (0%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTL  1450
             FF+     AAIIP+ + HI E+DEVWRRRA EA K A Q YE  P N++ +   QVR  +
Sbjct  10    FFVLFFIFAAIIPSFLAHIGEFDEVWRRRAEEARKVALQTYESEPENVTLAFNKQVRDAM  69

Query  1449  SEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYK  1270
              E ++E +  N T R L G+KKY GPC  TNPID+CWRC  +WA NRK+LADCAMGFG K
Sbjct  70    KE-LSEVIPKNDTRREL-GTKKYTGPCMVTNPIDKCWRCDPNWADNRKKLADCAMGFGSK  127

Query  1269  TKGGKSGKFYTVTDKSDDQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKT  1090
               GGK+G+FY V D SDD ++PKPGTLRHAVIQK+PLWIIF   M I+LHQELIMQ DKT
Sbjct  128   ATGGKAGRFYVVNDPSDDYTDPKPGTLRHAVIQKEPLWIIFDRGMTIRLHQELIMQSDKT  187

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             ID RGA VHIS GAGI IQ+ KNVIIHG+HIH I +GNGG++RD +DH GLRT SDGDGI
Sbjct  188   IDARGANVHISGGAGIMIQYTKNVIIHGLHIHDIVQGNGGMVRDAVDHIGLRTMSDGDGI  247

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             SIFG+SN+WIDHVSM NCYDG+IDA+E ST ITISNGHFTDHN+VMLFGA+D S+ D+ M
Sbjct  248   SIFGASNIWIDHVSMWNCYDGIIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQQM  307

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             QITLAFNHFGKRL+QRMPRCR+GYIHVVNNDYTHWNMYAIGGS +PTII QGNRFIAPPD
Sbjct  308   QITLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRFIAPPD  367

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAE  370
             I KK+ITKR       W  WTWRS+GD+YM GA+FVQSGDP++  KH  LYDG+    A+
Sbjct  368   IFKKQITKREYSPESVWMQWTWRSEGDLYMNGAYFVQSGDPDWSKKHQNLYDGISAAPAD  427

Query  369   DVTWLTRFAGALNCRVGSPC  310
              VTW+TRFAGAL C VG  C
Sbjct  428   QVTWITRFAGALGCMVGQAC  447



>ref|XP_006357122.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=448

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/442 (67%), Positives = 349/442 (79%), Gaps = 3/442 (1%)
 Frame = -3

Query  1635  NCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRR  1456
             + F LF V   AIIPA   HI ++DEVWRRRA EA K   Q YE  P NI+ +   + R 
Sbjct  10    SLFVLFFV-FGAIIPAFNAHIGDFDEVWRRRAEEAMKFTIQTYESEPANITLAFNQKTRD  68

Query  1455  TLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFG  1276
             ++ E  A  + +    R  LG+KKY GPC  TNPID+CWRC  +WA NRK+L +C+MGFG
Sbjct  69    SVKELSA--VVSKNETRRELGTKKYEGPCTVTNPIDKCWRCDPNWADNRKKLVECSMGFG  126

Query  1275  YKTKGGKSGKFYTVTDKSDDQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGD  1096
             YKT GG+ GK+Y V+D SDD + PKPGTLRHAVIQK+PLWIIF  +M IKLHQELIMQGD
Sbjct  127   YKTTGGRDGKYYVVSDSSDDYTTPKPGTLRHAVIQKEPLWIIFDRNMKIKLHQELIMQGD  186

Query  1095  KTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgd  916
             KTIDGRGA VHI+ GA I IQ+ KNVIIHG+HIH I EGNGG++RD +DH G RTKSDGD
Sbjct  187   KTIDGRGATVHITGGASIMIQYTKNVIIHGLHIHDIVEGNGGMVRDAVDHIGFRTKSDGD  246

Query  915   gisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDK  736
             GISIFGSSN+WIDH+SM NCYDG+IDA+E ST ITISNGH+TDHN+VMLFGA+D S+ D+
Sbjct  247   GISIFGSSNIWIDHMSMENCYDGIIDAVEGSTGITISNGHYTDHNEVMLFGASDSSSIDQ  306

Query  735   IMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAP  556
              MQITLAFNHFGKRL+QRMPRCR+GYIHVVNNDYTHWNMYAIGGS +PTII QGNRFIAP
Sbjct  307   KMQITLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRFIAP  366

Query  555   PDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFK  376
             PDI KK+ITKR       W  WTWRS+GD+YM GA+FVQ+GDP++  KH  LYDG+    
Sbjct  367   PDIFKKQITKREYSPESVWMQWTWRSEGDLYMNGAYFVQAGDPDWSKKHQNLYDGIAAAP  426

Query  375   AEDVTWLTRFAGALNCRVGSPC  310
             A+ VTW+TRFAGALNC+VG  C
Sbjct  427   ADQVTWMTRFAGALNCKVGKAC  448



>ref|XP_009789921.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/440 (68%), Positives = 349/440 (79%), Gaps = 2/440 (0%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTL  1450
             FF+      AIIP+ + HI E+DEVWRRRA EA K A Q YE  P N++ +   QVR  +
Sbjct  10    FFVLFFIFTAIIPSFLAHIGEFDEVWRRRAEEARKVALQTYESEPENVTLAFNKQVRDAM  69

Query  1449  SEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYK  1270
              E ++E +  N T R L G+KKY GPC  TNPID+CWRC  +WA NRK+LADCAMGFG K
Sbjct  70    KE-LSEVIPKNDTRREL-GTKKYTGPCMVTNPIDKCWRCDPNWADNRKKLADCAMGFGSK  127

Query  1269  TKGGKSGKFYTVTDKSDDQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKT  1090
               GGK+G+FY V D SDD ++PKPGTLRHAVIQK+PLWIIF   M I+LHQELIMQ DKT
Sbjct  128   ATGGKAGRFYVVNDSSDDYTDPKPGTLRHAVIQKEPLWIIFDRGMTIRLHQELIMQSDKT  187

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             ID RGA VHI+ GAGI IQ+ KNVIIHG+HIH I +GNGG++RD +DH GLRT SDGDGI
Sbjct  188   IDARGANVHIAGGAGIMIQYTKNVIIHGLHIHDIVQGNGGMVRDAVDHIGLRTMSDGDGI  247

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             SIFG+SN+WIDHVSM NCYDG+IDA+E ST ITISNGHFTDHN+VMLFGA+D S+ D+ M
Sbjct  248   SIFGASNIWIDHVSMWNCYDGIIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQQM  307

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             QITLAFNHFGKRL+QRMPRCR+GYIHVVNNDYTHWNMYAIGGS +PTII QGNRFIAPPD
Sbjct  308   QITLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRFIAPPD  367

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAE  370
             I KK+ITKR       W  WTWRS+GD+YM GA+FVQSGDP++  KH  LYDG+    A+
Sbjct  368   IFKKQITKREYSPESVWMQWTWRSEGDLYMNGAYFVQSGDPDWSKKHQNLYDGISAAPAD  427

Query  369   DVTWLTRFAGALNCRVGSPC  310
              VTW+TRFAGAL C+VG  C
Sbjct  428   QVTWITRFAGALGCKVGQAC  447



>ref|XP_009802165.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=451

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/445 (69%), Positives = 352/445 (79%), Gaps = 3/445 (1%)
 Frame = -3

Query  1638  NNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVR  1459
             N   FLF  +  AIIP+  GHI  +DEVWRRRA EA + A +AYEP+P N++ +   Q R
Sbjct  8     NLSLFLFS-TFLAIIPSLNGHIGNFDEVWRRRAQEAEEWALKAYEPDPVNVTLAFAKQTR  66

Query  1458  RTLSE-AVAEDLTTNTTGRHLLGSKK-YRGPCNATNPIDRCWRCHADWASNRKRLADCAM  1285
              ++ E      L+TN T R L G  K Y GPC  TNPIDRCWRC  +WA NRKRLADCAM
Sbjct  67    ESMKELKEVNKLSTNETRRELRGFHKIYAGPCLVTNPIDRCWRCQGNWADNRKRLADCAM  126

Query  1284  GFGYKTKGGKSGKFYTVTDKSDDQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIM  1105
             GFG  T GGK+G+FY VTD SDD SNPKPGTLRHAVIQK+PLWIIFA  M I+LHQELIM
Sbjct  127   GFGKGTTGGKAGQFYVVTDSSDDSSNPKPGTLRHAVIQKEPLWIIFAKSMTIRLHQELIM  186

Query  1104  QGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKs  925
             Q DKTIDGRG  VHI+ GAGIT+Q+VKNVIIHG+HIH I  GNGG++   +DH G+RT+S
Sbjct  187   QSDKTIDGRGVNVHIAYGAGITLQYVKNVIIHGLHIHDIVVGNGGMVISAVDHVGIRTQS  246

Query  924   dgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLST  745
             DGDGISIFGSSN+WIDHVSM  C DGLIDA+E STAITISNGHFTDHN+VMLFGA+D S+
Sbjct  247   DGDGISIFGSSNIWIDHVSMWRCSDGLIDAVEGSTAITISNGHFTDHNEVMLFGASDSSS  306

Query  744   KDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRF  565
              D+ MQIT+AFNHFGKRL+QRMPRCR+G+IHVVNNDYTHWNMYAIGGS HPTII QGNRF
Sbjct  307   IDQRMQITVAFNHFGKRLVQRMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGNRF  366

Query  564   IAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVM  385
             IAPPD+ KKEITKR       WK WTWRSQGD++M GAFFV+SGDP++  KH  L+DG+ 
Sbjct  367   IAPPDMFKKEITKRDYAPESVWKQWTWRSQGDLFMNGAFFVESGDPDWTKKHQNLFDGIS  426

Query  384   TFKAEDVTWLTRFAGALNCRVGSPC  310
             +   E VTW+TRFAGALNCR G  C
Sbjct  427   SAPGEQVTWITRFAGALNCRPGHAC  451



>ref|XP_004232242.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=446

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/425 (67%), Positives = 341/425 (80%), Gaps = 1/425 (0%)
 Frame = -3

Query  1581  GHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTGRH  1402
             GHI E+DEVWRRRA EA + A +AY+P+P N++ +   +  + L E     L  N T R 
Sbjct  22    GHIGEFDEVWRRRAQEADEWAIKAYKPDPINVTLAFAKETGQALKEIKEAKLAVNGTRRE  81

Query  1401  LLGS-KKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDK  1225
             L G  KKY GPC+ TNPIDRCWRC  DWA NRKRLADCAMGF   T GGK+G+ Y VTD 
Sbjct  82    LKGGGKKYDGPCSVTNPIDRCWRCQPDWADNRKRLADCAMGFAKGTTGGKAGEIYVVTDS  141

Query  1224  SDDQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAG  1045
             SDD S+PKPGTLR+ VIQK+PLWIIFA  M I+LHQELI+Q DKTIDGRG  VHI++GAG
Sbjct  142   SDDTSDPKPGTLRYGVIQKEPLWIIFAKSMTIRLHQELIVQSDKTIDGRGVNVHIANGAG  201

Query  1044  ITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSM  865
               +Q+VKNVIIHG+ IH I  G+GG+IRD +DH G RT+SDGDGISIFGSSN+W+DHVSM
Sbjct  202   FMLQYVKNVIIHGLRIHDIVVGSGGMIRDAMDHVGQRTQSDGDGISIFGSSNIWVDHVSM  261

Query  864   RNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQ  685
              +CYDGL+DAIE STA+TISN HFTDHN+VMLFGA+D S+ D+ MQIT+A+NHFGKRLIQ
Sbjct  262   WSCYDGLVDAIEGSTAVTISNSHFTDHNEVMLFGASDSSSIDQRMQITVAYNHFGKRLIQ  321

Query  684   RMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPE  505
             RMPRCR+G+IHVVNNDYTHWNMYAIGGS HPTII QGNRFIAPPD+ KKE+TKR      
Sbjct  322   RMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGNRFIAPPDMFKKEVTKRDYSPES  381

Query  504   EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCR  325
              WK W+WRSQGD++M GAFFV+SGDP++  KH +L+DGV++   + VTW+TRF+GALNC+
Sbjct  382   VWKQWSWRSQGDLFMNGAFFVESGDPDWTQKHIQLFDGVVSASGDQVTWITRFSGALNCK  441

Query  324   VGSPC  310
              G  C
Sbjct  442   PGEAC  446



>ref|XP_009617495.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=451

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/445 (68%), Positives = 354/445 (80%), Gaps = 3/445 (1%)
 Frame = -3

Query  1638  NNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVR  1459
             N   FLF  +  AIIP+  GHI ++DEVWRRRA EA + A +AYEP+P N++ +   Q +
Sbjct  8     NLSLFLFS-TFLAIIPSLNGHIGDFDEVWRRRAQEAEEWALKAYEPDPVNVTLAFAKQTK  66

Query  1458  RTLSE-AVAEDLTTNTTGRHLLG-SKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAM  1285
              ++ E    + L TN T R L G  K Y GPC  TNPIDRCWRC  +WA NRKRLADCA+
Sbjct  67    ESMKELKEVKKLATNDTRRELRGFHKNYAGPCLVTNPIDRCWRCQGNWADNRKRLADCAL  126

Query  1284  GFGYKTKGGKSGKFYTVTDKSDDQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIM  1105
             GFG  T GGK+G+FY VTD SDD SNPKPGTLRHAVIQK+PLWIIFA  MNI+LHQELIM
Sbjct  127   GFGKGTTGGKAGRFYVVTDSSDDSSNPKPGTLRHAVIQKEPLWIIFAKSMNIRLHQELIM  186

Query  1104  QGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKs  925
             Q DKTIDGRG  VHI+ GAGIT+Q+VKNVIIHG+HIH I  GNGG++   +DH G+RT+S
Sbjct  187   QSDKTIDGRGVNVHIAYGAGITLQYVKNVIIHGLHIHDIVVGNGGMVISAVDHVGIRTQS  246

Query  924   dgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLST  745
             DGDGISIFGSSN+WIDHVSM  C DGLIDA+E STAITISNGHFTDHN+VMLFGA+D S+
Sbjct  247   DGDGISIFGSSNIWIDHVSMWRCSDGLIDAVEGSTAITISNGHFTDHNEVMLFGASDSSS  306

Query  744   KDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRF  565
              D+ MQIT+AFNHFGKRL+QRMPRCR+G+IHVVNNDYTHWNMYAIGGS HPTII QGNRF
Sbjct  307   IDQRMQITVAFNHFGKRLVQRMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGNRF  366

Query  564   IAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVM  385
             IAPP++ KKEITKR       WK WTWRSQGD++M GAFFV+SGDP++  KH  L+DG+ 
Sbjct  367   IAPPEMFKKEITKRDYAPESVWKQWTWRSQGDLFMNGAFFVESGDPDWTKKHQNLFDGIS  426

Query  384   TFKAEDVTWLTRFAGALNCRVGSPC  310
             +   E VTW+TRFAGALNC+ G  C
Sbjct  427   SAPGEQVTWITRFAGALNCKQGHAC  451



>ref|XP_006338480.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=446

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/428 (66%), Positives = 341/428 (80%), Gaps = 1/428 (0%)
 Frame = -3

Query  1590  ATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTT  1411
             A  GHI E+DEVWRRRA EA + A +AY+P+P N++ +   Q  + L E     L  N T
Sbjct  19    AINGHIGEFDEVWRRRAQEADEWAIKAYKPDPINVTLAFAKQTGQALKEIKEAKLAINGT  78

Query  1410  GRHLLGS-KKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTV  1234
              R L G  KKY GPC  TNPIDRCWRC  +WA NRKRLADCAMGF   T GGK+G+ Y V
Sbjct  79    RRELKGGGKKYNGPCLVTNPIDRCWRCQPNWADNRKRLADCAMGFAKGTTGGKAGEIYVV  138

Query  1233  TDKSDDQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISD  1054
             TD SDD S+PKPGTLR+ VIQK+PLWIIFA  M I+LHQELI+Q DKTIDGRG  VHI++
Sbjct  139   TDSSDDTSDPKPGTLRYGVIQKEPLWIIFAKSMTIRLHQELIVQSDKTIDGRGVNVHIAN  198

Query  1053  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  874
             GAG  +Q+VKNVIIHG+ IH I  G+GG+IRD +DH G RT+SDGDGISIFGSSN+W+DH
Sbjct  199   GAGFMLQYVKNVIIHGLRIHDIVVGSGGMIRDAMDHIGQRTQSDGDGISIFGSSNIWVDH  258

Query  873   VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKR  694
             VSM +CYDGL+DA+E STA+TISN HFTDHN+VMLFGA+D S+ D+ MQIT+A+NHFGKR
Sbjct  259   VSMWSCYDGLVDAVEGSTAVTISNSHFTDHNEVMLFGASDSSSIDQRMQITVAYNHFGKR  318

Query  693   LIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKG  514
             LIQRMPRCR+G+IHVVNNDYTHWNMYAIGGS HPTII QGNRFIAPPD+ KKE+TKR   
Sbjct  319   LIQRMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGNRFIAPPDMFKKEVTKRDYS  378

Query  513   TPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGAL  334
                 WK W+WRSQGD++M GAFFV+SGDP++  KH +L+DG+++   + VTW+TRF+GAL
Sbjct  379   PESVWKQWSWRSQGDLFMNGAFFVESGDPDWTKKHTELFDGIVSASGDQVTWITRFSGAL  438

Query  333   NCRVGSPC  310
             NC+ G  C
Sbjct  439   NCKPGEAC  446



>ref|XP_011098575.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=449

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/441 (64%), Positives = 339/441 (77%), Gaps = 5/441 (1%)
 Frame = -3

Query  1623  LFVVSVAAIIPATV-GHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
             LF+ + A+ +P  V  HIAE+DEVW+RRA EAW    ++YEP P  I + L   V R L 
Sbjct  11    LFLFAFASTLPGAVRAHIAEFDEVWQRRAEEAWNRTLESYEPAPAKIVSHLNLNVHRALK  70

Query  1446  EAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKT  1267
             E   E+L+ N+T R L  S  Y GPC  TNPIDRCWRC A+WA NR RLADC +GFGYK 
Sbjct  71    EVKEEELSLNSTRRQL--SHGYDGPCRVTNPIDRCWRCQANWAQNRFRLADCVLGFGYKA  128

Query  1266  KGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKT  1090
             KGGK+GK Y VTD SD D  NPKPGTLRHAVIQK+PLWIIF  DM I+L QELI+Q DKT
Sbjct  129   KGGKNGKIYVVTDPSDNDMVNPKPGTLRHAVIQKEPLWIIFQRDMLIRLSQELIVQSDKT  188

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             IDGRGA+V I++GAGIT+QFVKNVIIHGI I++I  G GG+IRD +DH+GLRT+SDGDGI
Sbjct  189   IDGRGARVLIANGAGITLQFVKNVIIHGIKIYNISPGQGGMIRDAVDHYGLRTRSDGDGI  248

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             SIFGS ++WIDHVSM NC DGLID I  ST +T+SN HFTDHN+ MLFGA+D  T+D  M
Sbjct  249   SIFGSQDIWIDHVSMLNCADGLIDVIMGSTGVTVSNSHFTDHNEAMLFGASDSHTQDVKM  308

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP-  553
             Q+T+AFNHFGKR++QRMPR RYGYIHVVNNDYTHWNMYA+GGS +P II QGNR+IAPP 
Sbjct  309   QVTVAFNHFGKRMVQRMPRARYGYIHVVNNDYTHWNMYAVGGSKNPIIISQGNRYIAPPT  368

Query  552   DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKA  373
             + + KE+TKR       WK+W WRS+GDI+  GAFFVQSGDP +  KH + YD +    A
Sbjct  369   NPYAKEVTKREYSPESVWKSWVWRSEGDIFQGGAFFVQSGDPTYTSKHPEKYDLIQAAPA  428

Query  372   EDVTWLTRFAGALNCRVGSPC  310
             ++V  +T+FAGAL C+VG PC
Sbjct  429   QNVAEITKFAGALGCKVGVPC  449



>emb|CDP02198.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/474 (63%), Positives = 344/474 (73%), Gaps = 26/474 (5%)
 Frame = -3

Query  1653  ERFNKNNCFFL--FVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISA  1480
             E  +K  C FL  F + V   +    G  +  +E WR RA EAW H  +AYE NPH +  
Sbjct  3     EPVSKLVCVFLCAFTIVVVPTLITAQGSGSAEEEYWRIRAEEAWNHTLKAYEANPHTVIG  62

Query  1479  SLIHQVRRT--LSEAVAED-----------------LTTNTTGRHLLGSKKYRGPCNATN  1357
             +   Q        +  A+D                 L+   + R  L  KK+ G C ATN
Sbjct  63    AFNKQASENEMPGKTAAQDDKLTKLNLPPCCHTQQFLSEKNSTRRELRGKKWGGGCLATN  122

Query  1356  PIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSDDQ-SNPKPGTLRHA  1180
             PIDRCWRC  +WA NRKRLADC +GFG  T GGK+G FY VTD SDD    PKPGTLRHA
Sbjct  123   PIDRCWRCQPNWADNRKRLADCVVGFGRGTTGGKNGAFYVVTDSSDDSILAPKPGTLRHA  182

Query  1179  VIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgih  1000
             VIQK+PLWIIF  DM I+L QELIMQGDKTIDGRG  VHI+ GAGITIQFVKNVIIHG+H
Sbjct  183   VIQKEPLWIIFERDMVIRLTQELIMQGDKTIDGRGVSVHIAYGAGITIQFVKNVIIHGLH  242

Query  999   ihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEAST  820
             IH I +G+GGL+RD +DHFG+RT SDGDGISIFGSSNVWIDHVSM  CYDGLIDA+EAST
Sbjct  243   IHDIHQGSGGLVRDSVDHFGIRTMSDGDGISIFGSSNVWIDHVSMWKCYDGLIDAVEAST  302

Query  819   AITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNN  640
             AITISN HFTDHN+VMLFGA+D  +KD +MQIT+AFNHFGKRLIQRMPRCR+G+IHVVNN
Sbjct  303   AITISNSHFTDHNEVMLFGASDSQSKDAVMQITVAFNHFGKRLIQRMPRCRWGFIHVVNN  362

Query  639   DYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKE----ITKRVKGTPEEWKTWTWRSQG  472
             DYTHW MYAIGGS HP II QGNRFIAPPDI KKE    +TKR       WK WTWRS+G
Sbjct  363   DYTHWEMYAIGGSQHPIIISQGNRFIAPPDIFKKEVRRTVTKRDYAEEARWKEWTWRSEG  422

Query  471   DIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             D++M GAFFVQSGDP+F  KH +++DG+    + +VTW+TRFAGAL CR GSPC
Sbjct  423   DLFMNGAFFVQSGDPDFTKKHPEIFDGIAPADSSEVTWITRFAGALMCRPGSPC  476



>ref|XP_010317101.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=389

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/373 (73%), Positives = 314/373 (84%), Gaps = 0/373 (0%)
 Frame = -3

Query  1428  LTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSG  1249
             ++ N T R  LG+KKY GPC  TNPID+CWRC  +WA NRK+L +C+MGFGYKT GG+ G
Sbjct  17    VSKNETIRRALGTKKYDGPCTVTNPIDKCWRCDPNWADNRKKLVECSMGFGYKTTGGRDG  76

Query  1248  KFYTVTDKSDDQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQ  1069
             +FY VTD SDD + PKPGTLRHAVIQK+PLWIIF  +M IKLHQELIMQGDKTIDGRGA 
Sbjct  77    EFYVVTDPSDDYTTPKPGTLRHAVIQKEPLWIIFEKNMKIKLHQELIMQGDKTIDGRGAT  136

Query  1068  VHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSN  889
             VHI+ GA I IQ+ KNVIIHG+HIH I EG+GG++RD +DH GLRTKSDGDGISI+GSSN
Sbjct  137   VHITGGASIMIQYTKNVIIHGLHIHDIVEGSGGMVRDAVDHIGLRTKSDGDGISIYGSSN  196

Query  888   VWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFN  709
             +WIDH+SM NCYDGLIDA+E ST ITISNGH+TDHN+VMLFGA+D S+ D+ MQITLAFN
Sbjct  197   IWIDHMSMENCYDGLIDAVEGSTGITISNGHYTDHNEVMLFGASDSSSIDQKMQITLAFN  256

Query  708   HFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEIT  529
             HFGKRL+QRMPRCR+GYIHVVNNDYTHWNMYAIGGS +PTII QGNRFIAPPDI KKEIT
Sbjct  257   HFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRFIAPPDIFKKEIT  316

Query  528   KRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTR  349
             KR       W  WTWRS+GD+YM GA+FVQ+GDP++  KH  LYDG+    A+ VTW+TR
Sbjct  317   KREYSPESVWMQWTWRSEGDLYMNGAYFVQAGDPDWSKKHQNLYDGIAPAPADQVTWITR  376

Query  348   FAGALNCRVGSPC  310
             FAGALNC+VG PC
Sbjct  377   FAGALNCKVGLPC  389



>gb|EPS66620.1| hypothetical protein M569_08154, partial [Genlisea aurea]
Length=451

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/451 (64%), Positives = 339/451 (75%), Gaps = 12/451 (3%)
 Frame = -3

Query  1629  FFLFVVSVAAI----IPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQV  1462
             FF   +SV AI    +P +   IAEYD+ W++R AEAW     +YEPNP  I   L    
Sbjct  2     FFALALSVVAISSCLVPTSDARIAEYDDFWKKRRAEAWNRTLLSYEPNPAKIVTHLNLHS  61

Query  1461  RRTLSEAVAED---LTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADC  1291
              R L E  A D   L  N T R L G ++Y GPC  TNPIDRCWRC +DWA+NR RLADC
Sbjct  62    HRLLHELNATDHFHLVGNHTRRSLRG-RRYNGPCTVTNPIDRCWRCRSDWATNRFRLADC  120

Query  1290  AMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQE  1114
              +GFGYK KGGK+G  Y VTD SD D  NPKPGTLRHAVIQ  PLWI+FA  M I+L QE
Sbjct  121   GLGFGYKAKGGKNGPIYVVTDSSDNDMVNPKPGTLRHAVIQPGPLWIVFARSMVIRLSQE  180

Query  1113  LIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLR  934
             L++  DKTIDGRGA+VH++ GAGIT+QFV NVIIHG+HIH I +G+GG+IRD +DH+G R
Sbjct  181   LLVTSDKTIDGRGARVHVAYGAGITLQFVSNVIIHGLHIHDIVQGSGGMIRDSVDHYGFR  240

Query  933   TKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGAND  754
             T+SDGDGISIFGS ++WIDHVSMR CYDGLIDAI  ST ITISN HFTDHN+VMLFGA+D
Sbjct  241   TRSDGDGISIFGSQDLWIDHVSMRRCYDGLIDAIMGSTGITISNSHFTDHNEVMLFGASD  300

Query  753   LSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQG  574
               + D  MQ+T+AFNHFGKRLIQRMPRCR+GYIHVVNNDYTHWNMYAIGGSS PTII QG
Sbjct  301   GYSPDAKMQMTVAFNHFGKRLIQRMPRCRWGYIHVVNNDYTHWNMYAIGGSSAPTIISQG  360

Query  573   NRFIAPPD---IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK  403
             NR+IAPPD   ++ KE+TKR       W++WTWRS GD++M GA+F QSGDPN+M KH +
Sbjct  361   NRYIAPPDDVNMYAKEVTKRDYAPESVWQSWTWRSDGDVFMRGAYFTQSGDPNYMSKHPE  420

Query  402   LYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              YD +      +V  +TRFAGAL C+VG+PC
Sbjct  421   RYDLMQAADGSNVAAITRFAGALLCKVGAPC  451



>ref|XP_007032453.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY03379.1| Pectate lyase family protein [Theobroma cacao]
Length=454

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/450 (62%), Positives = 343/450 (76%), Gaps = 14/450 (3%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
              +F+ S AA+IP+    IAE+DEVW++RA +AWK+A +AYEP P N++++L + V + L 
Sbjct  8     LVFLFSFAALIPSLWADIAEFDEVWKQRAEQAWKNALEAYEPMPENVTSNLNYNVNKALL  67

Query  1446  EAVA------EDLTTNTTGRHLLGS-KKYRGPCNATNPIDRCWRCHADWASNRKRLADCA  1288
             +  A      E +TTN+T R+L G+ KKY GPC ATNPIDRCWRC  +WA NRK+LA+C 
Sbjct  68    KGRANKTRAFEGVTTNSTRRNLRGNHKKYIGPCMATNPIDRCWRCRKNWARNRKQLANCV  127

Query  1287  MGFGYKTKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQEL  1111
             +GFG+KT+GGK G +Y VTD SDD   NP+PGTLRHAVIQK+PLWIIFAHDMNIKL QEL
Sbjct  128   LGFGHKTEGGKQGGYYLVTDNSDDNVLNPRPGTLRHAVIQKEPLWIIFAHDMNIKLSQEL  187

Query  1110  IMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRT  931
             I+Q  KTIDGRGA VHI+ GAGIT+QFV NVIIH +HIHHI + +GGLIRD +DH+G RT
Sbjct  188   IVQSKKTIDGRGANVHIAYGAGITLQFVDNVIIHNLHIHHIRKSSGGLIRDSVDHYGFRT  247

Query  930   KsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDL  751
               DGDGISIFGS+N+W+DH+SM  C DGLIDAI+ STAITISN HFT HNDV+L GA+D 
Sbjct  248   VGDGDGISIFGSTNIWLDHLSMSECEDGLIDAIQGSTAITISNCHFTHHNDVILLGASDS  307

Query  750   STKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGN  571
              ++DK+MQ+T+AFNHFGK LIQRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII QGN
Sbjct  308   YSRDKLMQVTVAFNHFGKELIQRMPRCRWGFFHVVNNDYTHWKMYAIGGSQHPTIISQGN  367

Query  570   RFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDG  391
             RFIAP D   KEIT R       W+ W WRS+GD++M GAFF  SG P      H  Y+ 
Sbjct  368   RFIAPNDPWAKEITNRNYAPESVWRHWVWRSEGDLFMNGAFFRTSGPP---APPHLKYNK  424

Query  390   VMTFKAEDVTW---LTRFAGALNCRVGSPC  310
             +   KA+  T+   LTRF+GALNC+    C
Sbjct  425   LQMIKAKPATFVRRLTRFSGALNCKKRVKC  454



>ref|XP_002282500.3| PREDICTED: pectate lyase [Vitis vinifera]
Length=443

 Score =   521 bits (1343),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 272/434 (63%), Positives = 327/434 (75%), Gaps = 16/434 (4%)
 Frame = -3

Query  1602  AIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLT  1423
              + P+   HI E+DEVW++RA EA K A +AY+PNP  ++      VR+++         
Sbjct  23    VLAPSIRAHIGEFDEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKSMQ-------G  75

Query  1422  TNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKF  1243
             TNTT R+L   +   GPC ATNPIDRCWRC  DWA NRK+LADC +GFG +T GGK G+F
Sbjct  76    TNTTRRNL---RSNNGPCMATNPIDRCWRCKQDWAKNRKKLADCVLGFGRRTTGGKDGEF  132

Query  1242  YTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQV  1066
             Y VTD SD D  +PKPGTLRHAVIQK+PLWIIFA DM I+L QELIM G+KTIDGRGA V
Sbjct  133   YVVTDASDNDMIDPKPGTLRHAVIQKEPLWIIFARDMIIRLKQELIMAGNKTIDGRGANV  192

Query  1065  HISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNV  886
             HI+ G GITIQFVKN+IIH +HIH I    GG+IRD +DH+GLRT SDGDG+SIFGSSNV
Sbjct  193   HIAYGCGITIQFVKNIIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGDGVSIFGSSNV  252

Query  885   WIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNH  706
             W+DH+SM NC DGL+D I ASTAITISN HFT+HN+VMLFG ++    DKIMQ+T+AFNH
Sbjct  253   WVDHLSMSNCKDGLVDVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDKIMQVTVAFNH  312

Query  705   FGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITK  526
             +G+ L+QRMPRCRYG++HVVNNDYTHW MYAIGGS +PTII QGNRFIAPP++  KE+TK
Sbjct  313   YGRGLVQRMPRCRYGFVHVVNNDYTHWLMYAIGGSQNPTIISQGNRFIAPPNMACKEVTK  372

Query  525   RVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKL--YDGVMTFKAEDVTWLT  352
             R   +P+EWK+WTW SQGD+   GAFFVQSGDP    K H    YD +       V  LT
Sbjct  373   RDYASPDEWKSWTWISQGDLLQNGAFFVQSGDPK---KKHPFTRYDMIKAKPGTFVNRLT  429

Query  351   RFAGALNCRVGSPC  310
             RF+G+L C+V  PC
Sbjct  430   RFSGSLGCKVNQPC  443



>ref|XP_010256490.1| PREDICTED: pectate lyase-like [Nelumbo nucifera]
Length=441

 Score =   521 bits (1342),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 275/441 (62%), Positives = 329/441 (75%), Gaps = 10/441 (2%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTL  1450
              FL   ++A I P    HIAE+DEVW++RA EA K+A  AY PNP  +   L   V   +
Sbjct  10    LFLLAFNLAVITPTLRAHIAEFDEVWQKRAEEAKKNAMDAYHPNPDEVINHLNMNVHLAM  69

Query  1449  SEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYK  1270
              E       +N T R  L +K Y GPC ATNPIDRCWRC  +W+ NRK+LADC +GFG K
Sbjct  70    QE-------SNGT-RRSLKTKPYGGPCLATNPIDRCWRCQKNWSRNRKKLADCVVGFGRK  121

Query  1269  TKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDK  1093
             T GGK GKFY VTD SD D  NPKPGTLRHAVIQK+PLWIIFA DM I+L+QEL+M GDK
Sbjct  122   TIGGKLGKFYVVTDGSDNDMLNPKPGTLRHAVIQKEPLWIIFARDMVIRLNQELLMAGDK  181

Query  1092  TIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdg  913
             TID RGA VH++ GAGITIQFVKNVIIHG+H+H I  G+GGLIRD +DH+GLRT+SDGDG
Sbjct  182   TIDARGANVHVAYGAGITIQFVKNVIIHGLHVHDIVPGSGGLIRDSVDHYGLRTQSDGDG  241

Query  912   isifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKI  733
             IS+FG++NVWIDH+SM NC DGLIDAI ++TA+T+SN HFT HN+VMLFGA+   + D +
Sbjct  242   ISLFGATNVWIDHISMSNCKDGLIDAIMSTTAVTVSNCHFTHHNEVMLFGASGSYSGDAV  301

Query  732   MQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP  553
             MQIT+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII QGNRFIAPP
Sbjct  302   MQITVAFNHFGRGLVQRMPRCRWGFAHVVNNDYTHWIMYAIGGSEHPTIISQGNRFIAPP  361

Query  552   DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKA  373
              +  KE+TKR      EWK WTWRS+ D+ M GAFFVQSG+P+      K  D +     
Sbjct  362   TLAAKEVTKRDYAPESEWKHWTWRSEDDLMMNGAFFVQSGNPSRKHPFSK-KDMIPAKPG  420

Query  372   EDVTWLTRFAGALNCRVGSPC  310
               V+ LTRF+GAL C++  PC
Sbjct  421   TYVSTLTRFSGALGCKINKPC  441



>emb|CAN79927.1| hypothetical protein VITISV_042447 [Vitis vinifera]
Length=439

 Score =   521 bits (1341),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 272/434 (63%), Positives = 327/434 (75%), Gaps = 16/434 (4%)
 Frame = -3

Query  1602  AIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLT  1423
              + P+   HI E+DEVW++RA EA K A +AY+PNP  ++      VR+++         
Sbjct  19    VLAPSIRAHIGEFDEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKSMQ-------G  71

Query  1422  TNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKF  1243
             TNTT R+L   +   GPC ATNPIDRCWRC  DWA NRK+LADC +GFG +T GGK G+F
Sbjct  72    TNTTRRNL---RSNNGPCMATNPIDRCWRCKQDWAKNRKKLADCVLGFGRRTTGGKDGEF  128

Query  1242  YTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQV  1066
             Y VTD SD D  +PKPGTLRHAVIQK+PLWIIFA DM I+L QELIM G+KTIDGRGA V
Sbjct  129   YVVTDASDNDMIDPKPGTLRHAVIQKEPLWIIFARDMIIRLKQELIMAGNKTIDGRGANV  188

Query  1065  HISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNV  886
             HI+ G GITIQFVKN+IIH +HIH I    GG+IRD +DH+GLRT SDGDG+SIFGSSNV
Sbjct  189   HIAYGCGITIQFVKNIIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGDGVSIFGSSNV  248

Query  885   WIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNH  706
             W+DH+SM NC DGL+D I ASTAITISN HFT+HN+VMLFG ++    DKIMQ+T+AFNH
Sbjct  249   WVDHLSMSNCKDGLVDVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDKIMQVTVAFNH  308

Query  705   FGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITK  526
             +G+ L+QRMPRCRYG++HVVNNDYTHW MYAIGGS +PTII QGNRFIAPP++  KE+TK
Sbjct  309   YGRGLVQRMPRCRYGFVHVVNNDYTHWLMYAIGGSQNPTIISQGNRFIAPPNMACKEVTK  368

Query  525   RVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKL--YDGVMTFKAEDVTWLT  352
             R   +P+EWK+WTW SQGD+   GAFFVQSGDP    K H    YD +       V  LT
Sbjct  369   RDYASPDEWKSWTWISQGDLLQNGAFFVQSGDPK---KKHPFTRYDMIKAKPGTFVNRLT  425

Query  351   RFAGALNCRVGSPC  310
             RF+G+L C+V  PC
Sbjct  426   RFSGSLGCKVNQPC  439



>emb|CBI22159.3| unnamed protein product [Vitis vinifera]
Length=468

 Score =   521 bits (1342),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 272/434 (63%), Positives = 327/434 (75%), Gaps = 16/434 (4%)
 Frame = -3

Query  1602  AIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLT  1423
              + P+   HI E+DEVW++RA EA K A +AY+PNP  ++      VR+++         
Sbjct  48    VLAPSIRAHIGEFDEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKSMQ-------G  100

Query  1422  TNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKF  1243
             TNTT R+L   +   GPC ATNPIDRCWRC  DWA NRK+LADC +GFG +T GGK G+F
Sbjct  101   TNTTRRNL---RSNNGPCMATNPIDRCWRCKQDWAKNRKKLADCVLGFGRRTTGGKDGEF  157

Query  1242  YTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQV  1066
             Y VTD SD D  +PKPGTLRHAVIQK+PLWIIFA DM I+L QELIM G+KTIDGRGA V
Sbjct  158   YVVTDASDNDMIDPKPGTLRHAVIQKEPLWIIFARDMIIRLKQELIMAGNKTIDGRGANV  217

Query  1065  HISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNV  886
             HI+ G GITIQFVKN+IIH +HIH I    GG+IRD +DH+GLRT SDGDG+SIFGSSNV
Sbjct  218   HIAYGCGITIQFVKNIIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGDGVSIFGSSNV  277

Query  885   WIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNH  706
             W+DH+SM NC DGL+D I ASTAITISN HFT+HN+VMLFG ++    DKIMQ+T+AFNH
Sbjct  278   WVDHLSMSNCKDGLVDVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDKIMQVTVAFNH  337

Query  705   FGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITK  526
             +G+ L+QRMPRCRYG++HVVNNDYTHW MYAIGGS +PTII QGNRFIAPP++  KE+TK
Sbjct  338   YGRGLVQRMPRCRYGFVHVVNNDYTHWLMYAIGGSQNPTIISQGNRFIAPPNMACKEVTK  397

Query  525   RVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKL--YDGVMTFKAEDVTWLT  352
             R   +P+EWK+WTW SQGD+   GAFFVQSGDP    K H    YD +       V  LT
Sbjct  398   RDYASPDEWKSWTWISQGDLLQNGAFFVQSGDPK---KKHPFTRYDMIKAKPGTFVNRLT  454

Query  351   RFAGALNCRVGSPC  310
             RF+G+L C+V  PC
Sbjct  455   RFSGSLGCKVNQPC  468



>ref|XP_008341537.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=454

 Score =   520 bits (1340),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 282/445 (63%), Positives = 332/445 (75%), Gaps = 9/445 (2%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTL  1450
             F + V S+ A       +IAE+D VW++RA +A K A +AY+PNP  ++      V  T+
Sbjct  14    FCMLVPSLKAETQNDTLNIAEFDSVWQQRALKAQKAALKAYQPNPEQVTEDFNESVEMTI  73

Query  1449  SEAVAEDLTT--NTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFG  1276
              E   +D     N+TGRHLLG K+Y GPC ATNPIDRCWRC A+WA NRK LA C  GFG
Sbjct  74    IEDDHDDDHAAGNSTGRHLLG-KRYTGPCKATNPIDRCWRCQANWADNRKHLASCVKGFG  132

Query  1275  YKTKGGKSGKFYTVTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQG  1099
              KT+GGK G +Y VTD SDD   +PKPGTLRHAVIQK+PLWIIFA  M I+L QELI+  
Sbjct  133   RKTRGGKKGAYYIVTDSSDDNIHDPKPGTLRHAVIQKQPLWIIFARSMVIRLTQELIVTS  192

Query  1098  DKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdg  919
              KTID RGA VHI+ GAGIT+QFV+NVIIHG+HIH    GNGG+IRD +DH G+RT SDG
Sbjct  193   HKTIDARGANVHIAHGAGITLQFVQNVIIHGLHIHDTVPGNGGMIRDSVDHIGIRTHSDG  252

Query  918   dgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKD  739
             DGISI+GSSN+W+DH+SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D  + D
Sbjct  253   DGISIYGSSNIWLDHLSMWNCADGLIDAIQGSTAITISNSHFTRHNDVMLFGASDGFSGD  312

Query  738   KIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIA  559
              IMQIT+AFNHFGK LIQRMPRCR+G+IHVVNNDYTHW MYAIGGSSHPTII QGNRFIA
Sbjct  313   AIMQITVAFNHFGKGLIQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTIISQGNRFIA  372

Query  558   PPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKL--YDGVM  385
             PP+   KE+TKR       WK+W WRS+GD+ + GAFFVQSG P+   K+H     D + 
Sbjct  373   PPNQAAKEVTKRDYAPESVWKSWQWRSEGDLMINGAFFVQSGVPS---KNHGFGRLDVMK  429

Query  384   TFKAEDVTWLTRFAGALNCRVGSPC  310
                   VT LTRFAG+LNC+VG PC
Sbjct  430   ARPGTYVTRLTRFAGSLNCKVGHPC  454



>ref|XP_010066949.1| PREDICTED: pectate lyase [Eucalyptus grandis]
 gb|KCW65002.1| hypothetical protein EUGRSUZ_G02541 [Eucalyptus grandis]
Length=436

 Score =   519 bits (1336),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 278/447 (62%), Positives = 334/447 (75%), Gaps = 12/447 (3%)
 Frame = -3

Query  1647  FNKNNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIH  1468
              N++ CFFLF  S A ++P+   +I E+DE W +RA EA K A +AY+P+P  +++    
Sbjct  1     MNRHVCFFLFFSSFAVLVPSLQANIEEFDEYWAKRAEEAQKDALKAYDPHPETVTSLFNA  60

Query  1467  QVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCA  1288
             +V + +          N+T R L   KKY+GPC ATNPIDRCWRC+ +WA NRKRLA+C 
Sbjct  61    KVDKAVR-------GNNSTRRQL---KKYKGPCLATNPIDRCWRCNRNWARNRKRLANCV  110

Query  1287  MGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQEL  1111
             +GFG KT+GGK G FY VTD SD D  NPKPGTLRHAV+QK PLWIIFA  M I+L+QEL
Sbjct  111   LGFGRKTRGGKRGWFYVVTDSSDNDMVNPKPGTLRHAVVQKGPLWIIFAGSMVIRLNQEL  170

Query  1110  IMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRT  931
             IM  DKTID RGA VHI+ GAGIT+QF++NVIIHG+HIH I  G+GGLIRD  DH GLRT
Sbjct  171   IMTSDKTIDARGANVHIAYGAGITLQFIRNVIIHGLHIHDIVRGSGGLIRDAHDHVGLRT  230

Query  930   KsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDL  751
              SDGDGISIFGSS++WIDHVSM  C DGLIDAI+ STAITISN HFT HN+VMLFGA+D 
Sbjct  231   ASDGDGISIFGSSHLWIDHVSMSACSDGLIDAIQGSTAITISNCHFTHHNEVMLFGASDG  290

Query  750   STKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGN  571
              ++D+IMQIT+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII QGN
Sbjct  291   YSQDQIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGN  350

Query  570   RFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDG  391
             RFIAPP+I  KE+TKR   T ++WK W W+S+GD+ M GAFFV SG+P       +  D 
Sbjct  351   RFIAPPNIAAKEVTKRDYATEDQWKNWLWKSEGDLMMNGAFFVNSGNPRARFPFSR-RDV  409

Query  390   VMTFKAEDVTWLTRFAGALNCRVGSPC  310
             +       V  LTRFAG L CRVG PC
Sbjct  410   IKAKPGTYVRRLTRFAGKLGCRVGRPC  436



>ref|XP_010033216.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
Length=435

 Score =   516 bits (1329),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 271/440 (62%), Positives = 324/440 (74%), Gaps = 11/440 (3%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
             F+  +S+A ++P+   HI E+DE W++RA EA + A +A+ P P N++A     V + L 
Sbjct  6     FILALSLAVLVPSLEAHIKEFDEYWQKRAEEASQAALEAFNPEPENVTAQFNANVNKVLD  65

Query  1446  EAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKT  1267
                      N + R  L   KY GPC ATNPIDRCWRC  +WA +RKRLA C +GFG KT
Sbjct  66    --------GNNSTRRQLHMHKYSGPCLATNPIDRCWRCRKNWAKDRKRLAKCVLGFGRKT  117

Query  1266  KGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKT  1090
              GG  GK+Y V D SD D  NPKPGTLRHAVIQK+PLWIIFA  M I+L+QEL++   KT
Sbjct  118   TGGLKGKYYVVYDCSDNDVVNPKPGTLRHAVIQKRPLWIIFARSMVIRLNQELMVASHKT  177

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             IDGRGA VHI+ GAGITIQFV+NVIIH I IH I    GG+IRD +DH G+RT SDGDGI
Sbjct  178   IDGRGANVHIAFGAGITIQFVRNVIIHNIRIHDIVTRPGGIIRDAVDHVGIRTMSDGDGI  237

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             SIFGS+N+WIDHVSM+ C DGLIDAIE STAITISNGH+T HNDVMLFGA+DL  +DKIM
Sbjct  238   SIFGSTNIWIDHVSMKRCQDGLIDAIEGSTAITISNGHYTHHNDVMLFGASDLYPRDKIM  297

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             Q+T+AFNHFGK LIQRMPRCR+G+ HVVNNDYTHW MYAIGGSS PTII QGNRFIAPP+
Sbjct  298   QVTVAFNHFGKGLIQRMPRCRWGFFHVVNNDYTHWLMYAIGGSSQPTIISQGNRFIAPPN  357

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAE  370
             +  KE+TKR   TP+ W++WTWRSQGD+ + GAFFVQSG P  + K +   D +      
Sbjct  358   LAAKEVTKRDYATPDVWRSWTWRSQGDLLINGAFFVQSGQP--LKKKYGRKDMIKAKPGT  415

Query  369   DVTWLTRFAGALNCRVGSPC  310
              V  LTRF+G LNC+    C
Sbjct  416   FVRRLTRFSGTLNCKPKKRC  435



>ref|XP_007046218.1| Pectate lyase family protein, putative [Theobroma cacao]
 gb|EOY02050.1| Pectate lyase family protein, putative [Theobroma cacao]
Length=441

 Score =   516 bits (1329),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 269/436 (62%), Positives = 331/436 (76%), Gaps = 16/436 (4%)
 Frame = -3

Query  1605  AAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDL  1426
               IIP    HIAEYD+ WR+R AEA +H  +AY PNP  ++    H V RTL       +
Sbjct  18    VVIIPTLHAHIAEYDDYWRQREAEAKEHFNKAYNPNPEEVTQHFNHHVARTL-------M  70

Query  1425  TTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGK  1246
               N+T R L G K+  GPC ATNPID+CWRC  +W  NRKRLADC++GFG  T GGK+G+
Sbjct  71    GFNSTRRSLRG-KRRTGPCQATNPIDQCWRCDPNWHRNRKRLADCSLGFGRGTIGGKNGR  129

Query  1245  FYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQ  1069
             +Y VTD SD D  NPKPGTLRHAVIQK+PLWIIFA  M IKL+QELIM  DKTID RGA 
Sbjct  130   YYIVTDPSDNDMVNPKPGTLRHAVIQKRPLWIIFARSMIIKLNQELIMTSDKTIDARGAN  189

Query  1068  VHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSN  889
             VH++ GAGITIQF +N+IIHG+HIH I +G+GG+IRD +DH+G RTKSDGDG+S+FG++N
Sbjct  190   VHVAYGAGITIQFARNIIIHGLHIHDIVQGSGGMIRDSVDHYGFRTKSDGDGVSLFGATN  249

Query  888   VWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFN  709
             +W+DH+SM NCYDGLIDAI+ STAITISN HFT+HN+VMLFGA+D  ++D+ MQIT+AF 
Sbjct  250   IWLDHLSMYNCYDGLIDAIQGSTAITISNCHFTNHNEVMLFGASDSYSEDQKMQITVAFT  309

Query  708   HFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEIT  529
             HFGK L+QRMPRCR+G+IHVVNNDYTHW MYAIGGSSHPTII QGNRF+APP+   KE+T
Sbjct  310   HFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTIISQGNRFVAPPNAAAKEVT  369

Query  528   KRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED---VTW  358
             KR    PE WK W+WRS+GD+ + GAFF QSGDP    +  + + G     A+    V+ 
Sbjct  370   KRDYAPPEVWKNWSWRSEGDLMVNGAFFTQSGDP----RASRRFLGNFMISAKPGQMVSL  425

Query  357   LTRFAGALNCRVGSPC  310
             LTR++G+L+C    PC
Sbjct  426   LTRYSGSLDCVRRRPC  441



>ref|XP_008357758.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=459

 Score =   513 bits (1322),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 275/450 (61%), Positives = 329/450 (73%), Gaps = 12/450 (3%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVG-------HIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLI  1471
               LF++S   ++P+          +IA +D VW+ RA +A K A +AY+PNP  ++    
Sbjct  12    LVLFMISFCMLVPSLKAETANDTLNIANFDAVWQERAMKAQKAALKAYQPNPEQVTEDFN  71

Query  1470  HQVRRTLSEAVAEDLTT--NTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLA  1297
               V +T+ E   ED  +  N+T R+L G K Y+GPC ATNPIDRCWRC A+WA+NRK+LA
Sbjct  72    ESVEQTVVEEDLEDDQSAGNSTRRNLRG-KXYKGPCKATNPIDRCWRCRANWANNRKKLA  130

Query  1296  DCAMGFGYKTKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIKLH  1120
              C  GFG KT+GGK G +Y VTD SDD   +PKPGTLRHAVIQ +PLWIIFA  M I+L 
Sbjct  131   SCVKGFGRKTRGGKKGAYYIVTDSSDDNVHDPKPGTLRHAVIQTQPLWIIFARSMVIRLS  190

Query  1119  QELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFG  940
             QELI+   KTID RGA VHI+ GAGIT+QFV+NVIIHG+ IH    G+GG+IRD L H G
Sbjct  191   QELIVTSHKTIDARGANVHIAHGAGITLQFVQNVIIHGLRIHDTVPGSGGMIRDSLSHIG  250

Query  939   LRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGA  760
             +RT+SDGDGISI+GSSN+W+DH+SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA
Sbjct  251   IRTQSDGDGISIYGSSNIWLDHLSMWNCADGLIDAIQGSTAITISNCHFTHHNDVMLFGA  310

Query  759   NDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIIC  580
             +D    D IMQIT+AFNHFGK LIQRMPRCR+G++HVVNNDYTHW MYAIGGSSHPTII 
Sbjct  311   SDAFAGDAIMQITVAFNHFGKGLIQRMPRCRWGFVHVVNNDYTHWIMYAIGGSSHPTIIS  370

Query  579   QGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKL  400
             QGNRFIAPP+   KE+TKR       WK+W WRS+GD+ M GAFFVQSG PN      KL
Sbjct  371   QGNRFIAPPNQAAKEVTKRDYAPESVWKSWQWRSEGDLMMNGAFFVQSGVPNKKHGFGKL  430

Query  399   YDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              D +       V  LTRFAG+LNC+VG  C
Sbjct  431   -DMIKAKPGTFVRRLTRFAGSLNCKVGKKC  459



>ref|XP_009342871.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=454

 Score =   513 bits (1320),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 275/450 (61%), Positives = 328/450 (73%), Gaps = 12/450 (3%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVG-------HIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLI  1471
               LF++S   ++P+          +IA +D VW+ R  +A K A +AY+PNP  ++    
Sbjct  7     LVLFMISFCMLVPSLKAETANDTLNIANFDAVWQERGMKAQKAALKAYQPNPEQVTEDFN  66

Query  1470  HQVRRTLSEAVAEDLTT--NTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLA  1297
               V +T+ E   ED  +  N+T RHL G K  +GPC ATNPIDRCWRC A+WA+NRK+LA
Sbjct  67    ESVEQTVVEEDLEDDQSAGNSTRRHLRG-KHNKGPCKATNPIDRCWRCRANWANNRKKLA  125

Query  1296  DCAMGFGYKTKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIKLH  1120
              C  GFG KT+GGK G +Y VTD SDD   +PKPGTLRHAVIQ +PLWIIFA  M I+L 
Sbjct  126   SCVKGFGRKTRGGKKGAYYIVTDSSDDNVHDPKPGTLRHAVIQTQPLWIIFARSMVIRLS  185

Query  1119  QELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFG  940
             QELI+   KTID RGA VHI+ GAGIT+QFV+NVIIHG+ IH    G+GG+IRD L H G
Sbjct  186   QELIVTSHKTIDARGANVHIAHGAGITLQFVQNVIIHGLRIHDTVPGSGGMIRDSLSHIG  245

Query  939   LRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGA  760
             +RT+SDGDGISI+GSSN+W+DH+SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA
Sbjct  246   IRTQSDGDGISIYGSSNIWLDHLSMWNCADGLIDAIQGSTAITISNCHFTRHNDVMLFGA  305

Query  759   NDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIIC  580
             +D    D IMQIT+AFNHFGK LIQRMPRCR+G++HVVNNDYTHW MYAIGGSSHPTII 
Sbjct  306   SDAFAGDAIMQITVAFNHFGKGLIQRMPRCRWGFVHVVNNDYTHWIMYAIGGSSHPTIIS  365

Query  579   QGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKL  400
             QGNRFIAPP+   KE+TKR       WK+W WRS+GD+ M GAFFVQSG PN      KL
Sbjct  366   QGNRFIAPPNQAAKEVTKRDYAPESVWKSWQWRSEGDLMMNGAFFVQSGVPNRKHGFGKL  425

Query  399   YDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              D +       VT LTRFAG+LNC+VG  C
Sbjct  426   -DMIKAKPGTFVTRLTRFAGSLNCKVGKKC  454



>ref|XP_010112093.1| putative pectate lyase 7 [Morus notabilis]
 gb|EXC32626.1| putative pectate lyase 7 [Morus notabilis]
Length=437

 Score =   512 bits (1318),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 267/440 (61%), Positives = 329/440 (75%), Gaps = 12/440 (3%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
              +F++    +IP+   +I ++DE W++RA EA K A +AY+PNP  ++ S   +V + + 
Sbjct  9     LVFLIGFVVLIPSLQANIGDFDESWQQRAEEAHKAALEAYDPNPEEVTDSFNEEVDKVID  68

Query  1446  EAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKT  1267
                     +N+T R L   ++Y GPC ATNPIDRCWRC ++WASNRKRLA C +GFG KT
Sbjct  69    -------GSNSTRREL---RRYSGPCAATNPIDRCWRCRSNWASNRKRLARCVLGFGRKT  118

Query  1266  KGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKT  1090
              GG+SG++Y VTD SD D  NP+PGTLRHAVIQK+PLWIIFAH M I+L QEL++   KT
Sbjct  119   TGGRSGRYYVVTDPSDNDVQNPRPGTLRHAVIQKQPLWIIFAHSMIIRLSQELLITSHKT  178

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             ID RGA +HI++GAGITIQF +NVIIHG+HIH I    GG+IRD +DHFG RT +DGDGI
Sbjct  179   IDARGANIHIANGAGITIQFARNVIIHGLHIHDIVASGGGMIRDSVDHFGFRTPADGDGI  238

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             SIFGS+N+W+DH+SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D    DKIM
Sbjct  239   SIFGSTNIWLDHISMSNCQDGLIDAIQGSTAITISNCHFTHHNDVMLFGASDSFEGDKIM  298

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             Q+T+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGSSHPTII QGNRFIAPP+
Sbjct  299   QVTVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSSHPTIISQGNRFIAPPN  358

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAE  370
                K++TKR      EWK WTWRS+GD+ M GAFFVQSG+ +   +    +D +      
Sbjct  359   NAAKQVTKRDYAAEWEWKRWTWRSEGDLMMNGAFFVQSGNRS-KKRPFTRHDMIKAKPGT  417

Query  369   DVTWLTRFAGALNCRVGSPC  310
              VT LTRFAGALNC  G  C
Sbjct  418   FVTRLTRFAGALNCYAGKKC  437



>gb|EYU34111.1| hypothetical protein MIMGU_mgv1a006386mg [Erythranthe guttata]
Length=446

 Score =   512 bits (1319),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 272/442 (62%), Positives = 329/442 (74%), Gaps = 4/442 (1%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTL  1450
                 +++ A+ +P+   + A++D+ W +R+ +AW +  Q+YE +P  I + L    +R L
Sbjct  7     LLFLLIAFASALPSISANFADFDDYWLKRSVQAWNNTLQSYESHPAKIVSHLNLHSKRAL  66

Query  1449  SEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYK  1270
              E    +L +N++ R L  +  Y GPC ATNPIDRCWRC A+WA NR RLADC +GFGYK
Sbjct  67    KEIKDINLVSNSSRRQL--AHGYEGPCMATNPIDRCWRCQANWADNRFRLADCGLGFGYK  124

Query  1269  TKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDK  1093
              KGGK G+ Y V D SD D  NPKPGTLRHAVIQ +PLWIIF+  M I+L QELIMQ DK
Sbjct  125   AKGGKGGRIYVVNDSSDGDMVNPKPGTLRHAVIQTEPLWIIFSRSMVIRLSQELIMQSDK  184

Query  1092  TIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdg  913
             TIDGRG +VHI+ GAGITIQFVKN+IIHGI IH I  GNGGLIRD +DH+GLRT+SDGDG
Sbjct  185   TIDGRGVRVHITGGAGITIQFVKNIIIHGILIHDIVPGNGGLIRDSVDHYGLRTRSDGDG  244

Query  912   isifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKI  733
             ISI+G+ ++WIDHVSM  C DGLIDAI  ST ITISNGHFTDHN+ MLFGA+D  T+D  
Sbjct  245   ISIYGAQDIWIDHVSMTKCSDGLIDAIMGSTGITISNGHFTDHNEAMLFGASDSHTQDVK  304

Query  732   MQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP  553
             MQIT+AFNHFGKR++QRMPRCR+GYIHVVNNDYTHWNMYAIGGS +P II QGNRFIAPP
Sbjct  305   MQITVAFNHFGKRMVQRMPRCRFGYIHVVNNDYTHWNMYAIGGSKNPIIISQGNRFIAPP  364

Query  552   D-IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFK  376
             D    KE+TKR       W  W WRS+GDI++ GAFFVQSGD  +  KH + YD +    
Sbjct  365   DNPFAKEVTKREYSPESVWSQWIWRSEGDIFLRGAFFVQSGDATYTSKHPEKYDLIQAAS  424

Query  375   AEDVTWLTRFAGALNCRVGSPC  310
             A  V  +T+FAGAL C+VG PC
Sbjct  425   ATQVGIMTKFAGALGCKVGQPC  446



>ref|XP_004165454.1| PREDICTED: pectate lyase-like [Cucumis sativus]
 gb|KGN64253.1| hypothetical protein Csa_1G045510 [Cucumis sativus]
Length=439

 Score =   509 bits (1312),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 269/440 (61%), Positives = 327/440 (74%), Gaps = 14/440 (3%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
              L +     I P    +IA++DEVW++RA EA K + +AYEP+P   + +   QV R+L 
Sbjct  13    LLMIFGFVMIFPTLKANIADFDEVWQKRAIEAQKASFEAYEPHPEEETNNFNKQVHRSLD  72

Query  1446  EAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKT  1267
                      N T RHL   +KY GPC ATNPIDRCWRC  +WA NRK+LADCA+GFG +T
Sbjct  73    GG-------NNTRRHL---RKYTGPCLATNPIDRCWRCDRNWARNRKKLADCALGFGRRT  122

Query  1266  KGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKT  1090
              GGK GK Y V D SD D  NPKPGTLRHAVIQ++PLWIIFAHDM I+L +ELI+  DKT
Sbjct  123   TGGKDGKIYVVRDSSDNDLVNPKPGTLRHAVIQERPLWIIFAHDMVIRLSEELIVTDDKT  182

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             +DGRGA VHI++G  IT+QFVKN+IIH +HIH I  GNGG+IRD + H+G RT+SDGDGI
Sbjct  183   LDGRGANVHIANGGQITLQFVKNIIIHNLHIHDIKAGNGGMIRDSVSHYGFRTRSDGDGI  242

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             S+FG+S VWIDHVSM NC DGLIDA+ ASTAITISN HFT HNDV+L GA++  + D+IM
Sbjct  243   SMFGASRVWIDHVSMSNCQDGLIDAVMASTAITISNCHFTHHNDVILLGASNGYSNDQIM  302

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             Q+TLAFNHFGK L+QRMPRCR+G+IHVVNNDYTHW MYAIGGS +PTII QGNRFIAPP+
Sbjct  303   QVTLAFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSHNPTIISQGNRFIAPPN  362

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAE  370
              + KE+TKRV     EW++W WRS+GD+ M GAFF+QSG+P    K +   D + +    
Sbjct  363   PNCKEVTKRVYAPESEWRSWNWRSEGDLMMNGAFFIQSGNP---IKRYSKKDVIHSKPGT  419

Query  369   DVTWLTRFAGALNCRVGSPC  310
              VT LTRFAG L C+   PC
Sbjct  420   FVTRLTRFAGPLKCKKNQPC  439



>ref|XP_007037229.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY21730.1| Pectate lyase family protein [Theobroma cacao]
Length=434

 Score =   509 bits (1311),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 270/429 (63%), Positives = 319/429 (74%), Gaps = 14/429 (3%)
 Frame = -3

Query  1593  PATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNT  1414
             P    +I E+DEVW++RA EA K A +AYEPNP  ++ +L  +  + L         +N+
Sbjct  19    PIVKANIGEFDEVWQKRAEEAKKAALRAYEPNPEKVTDNLNKETGKALK-------GSNS  71

Query  1413  TGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTV  1234
             T R+L    +YRGPC ATNPIDRCWRC   WA NRK+LA C +GFG +T GGK G+FY V
Sbjct  72    TRRNL---GRYRGPCLATNPIDRCWRCDPHWAENRKKLATCVLGFGRRTTGGKDGRFYVV  128

Query  1233  TDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHIS  1057
             TD SD D  NPKPGT+RHAVIQK+PLWIIFAHDM I+L++ELIM  DKTIDGRGA VH  
Sbjct  129   TDPSDNDMINPKPGTIRHAVIQKEPLWIIFAHDMVIRLNEELIMTSDKTIDGRGANVHFF  188

Query  1056  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  877
              GA IT+Q+++NVIIHGIHI    E NGG+IRD +DHFG RTKSDGDGISIFGS N+WID
Sbjct  189   RGAQITLQYIQNVIIHGIHIRLSVEANGGMIRDSVDHFGFRTKSDGDGISIFGSHNIWID  248

Query  876   HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGK  697
             HVSM  C DGLID I+ASTAITISN HFTDHNDVMLFGA+D  + DKIMQ+T+AFNHFG+
Sbjct  249   HVSMSRCSDGLIDVIQASTAITISNCHFTDHNDVMLFGASDSFSDDKIMQVTVAFNHFGQ  308

Query  696   RLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVK  517
              L+QRMPRCR+G+IHVVNNDYTHW MYAIGGS+ PTI+ QGNRFIAPP+I  KE+TKR  
Sbjct  309   GLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSNQPTILSQGNRFIAPPNIACKEVTKREY  368

Query  516   GTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGA  337
                 EWK+W WRS+ D+ M GAFFVQSG P          D +       VT LTRF+GA
Sbjct  369   APESEWKSWNWRSENDLMMNGAFFVQSGSPIGRGNRQ---DVIKAKPGTFVTRLTRFSGA  425

Query  336   LNCRVGSPC  310
             L+C    PC
Sbjct  426   LHCFKNKPC  434



>ref|XP_002311599.2| pectate lyase family protein [Populus trichocarpa]
 gb|EEE88966.2| pectate lyase family protein [Populus trichocarpa]
Length=441

 Score =   509 bits (1310),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 269/450 (60%), Positives = 328/450 (73%), Gaps = 10/450 (2%)
 Frame = -3

Query  1656  MERFNKNNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISAS  1477
             M   N +  FF   VS+AA +P   GHI E+DE W+++A EA K AQ+A+ P+P N++  
Sbjct  1     MRTLNGHFLFFSLFVSLAAFVPTLQGHIGEFDEYWKKKADEALKAAQEAFYPDPMNVTNQ  60

Query  1476  LIHQVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLA  1297
                QV + ++E       TN+T R L+   K  G C ATNPIDRCWRC  +WAS+R++LA
Sbjct  61    FNFQVNKVMTE-------TNSTRRSLV--SKRGGRCMATNPIDRCWRCDPNWASHRQKLA  111

Query  1296  DCAMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLH  1120
             DC +GFG+KT GGK GK Y VTD SD D  NPKPGTLRHAVIQK+PLWIIF+  M I+L+
Sbjct  112   DCVLGFGHKTVGGKYGKIYVVTDASDNDMLNPKPGTLRHAVIQKEPLWIIFSGSMVIRLN  171

Query  1119  QELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFG  940
             QEL++  +KTID RGA+VHI+ GAGIT+QFV+NVIIHG+ IH I  G+GGL+RD +DH+G
Sbjct  172   QELMVASNKTIDSRGAKVHIAYGAGITLQFVQNVIIHGLRIHDIVIGSGGLVRDSVDHYG  231

Query  939   LRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGA  760
              RTKSDGDGISIFGSSN+WIDHVSM NC DGLID I  S AITISN HFT HN+VMLFGA
Sbjct  232   FRTKSDGDGISIFGSSNIWIDHVSMSNCQDGLIDVIMGSNAITISNSHFTRHNEVMLFGA  291

Query  759   NDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIIC  580
             +D  + D IMQIT+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS +PTI+ 
Sbjct  292   SDSYSGDSIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSHNPTIVS  351

Query  579   QGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKL  400
             QGNRFIAP +   KE+TKR      EWK W WRS  D+ M GAFFVQSG P    +    
Sbjct  352   QGNRFIAPNNTFAKEVTKRDYAVESEWKNWNWRSDNDLMMNGAFFVQSGSPITSSRRISR  411

Query  399   YDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             +  + +     VT LTRF+G+L C  G PC
Sbjct  412   FHVMKSKPGTFVTRLTRFSGSLGCFKGKPC  441



>gb|KCW52797.1| hypothetical protein EUGRSUZ_J02132 [Eucalyptus grandis]
Length=451

 Score =   507 bits (1306),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 271/453 (60%), Positives = 324/453 (72%), Gaps = 24/453 (5%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
             F+  +S+A ++P+   HI E+DE W++RA EA + A +A+ P P N++A     V + L 
Sbjct  9     FILALSLAVLVPSLEAHIKEFDEYWQKRAEEASQAALEAFNPEPENVTAQFNANVNKVLD  68

Query  1446  EAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKT  1267
                      N + R  L   KY GPC ATNPIDRCWRC  +WA +RKRLA C +GFG KT
Sbjct  69    --------GNNSTRRQLHMHKYSGPCLATNPIDRCWRCRKNWAKDRKRLAKCVLGFGRKT  120

Query  1266  KGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKT  1090
              GG  GK+Y V D SD D  NPKPGTLRHAVIQK+PLWIIFA  M I+L+QEL++   KT
Sbjct  121   TGGLKGKYYVVYDCSDNDVVNPKPGTLRHAVIQKRPLWIIFARSMVIRLNQELMVASHKT  180

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             IDGRGA VHI+ GAGITIQFV+NVIIH I IH I    GG+IRD +DH G+RT SDGDGI
Sbjct  181   IDGRGANVHIAFGAGITIQFVRNVIIHNIRIHDIVTRPGGIIRDAVDHVGIRTMSDGDGI  240

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHND-------------VML  769
             SIFGS+N+WIDHVSM+ C DGLIDAIE STAITISNGH+T HND             VML
Sbjct  241   SIFGSTNIWIDHVSMKRCQDGLIDAIEGSTAITISNGHYTHHNDTLMFNLHPGTYVQVML  300

Query  768   FGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPT  589
             FGA+DL  +DKIMQ+T+AFNHFGK LIQRMPRCR+G+ HVVNNDYTHW MYAIGGSS PT
Sbjct  301   FGASDLYPRDKIMQVTVAFNHFGKGLIQRMPRCRWGFFHVVNNDYTHWLMYAIGGSSQPT  360

Query  588   IICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKH  409
             II QGNRFIAPP++  KE+TKR   TP+ W++WTWRSQGD+ + GAFFVQSG P  + K 
Sbjct  361   IISQGNRFIAPPNLAAKEVTKRDYATPDVWRSWTWRSQGDLLINGAFFVQSGQP--LKKK  418

Query  408   HKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             +   D +       V  LTRF+G LNC+    C
Sbjct  419   YGRKDMIKAKPGTFVRRLTRFSGTLNCKPKKRC  451



>gb|EYU36839.1| hypothetical protein MIMGU_mgv1a006379mg [Erythranthe guttata]
Length=446

 Score =   506 bits (1302),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 269/442 (61%), Positives = 325/442 (74%), Gaps = 4/442 (1%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTL  1450
                  ++ A  +P+   +  + DE W +R+ +AW +  ++YEP+P  I + L     R L
Sbjct  7     LLFLSIAFAYALPSISANFLDSDEYWVKRSVQAWNNTLESYEPHPAKIVSHLNLHSTRAL  66

Query  1449  SEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYK  1270
              E    +L +N++ RHL  +  Y GPC ATNPIDRCWRC A+WA NR RLADC +GFGYK
Sbjct  67    EEIKDLELVSNSSRRHL--AHGYDGPCMATNPIDRCWRCQANWADNRFRLADCGLGFGYK  124

Query  1269  TKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDK  1093
              KGGK G+ Y V D SD D  NP PGTLRHAVIQ +PLWIIF+  M I+L QELIMQ DK
Sbjct  125   AKGGKGGRIYVVNDSSDSDMVNPIPGTLRHAVIQTEPLWIIFSRSMVIRLSQELIMQSDK  184

Query  1092  TIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdg  913
             TIDGRG +VHI+ GAGITIQFVKN+IIHG+ IH I  G+GG+IRD +DH+G RT+SDGDG
Sbjct  185   TIDGRGVRVHITGGAGITIQFVKNIIIHGLLIHDIVPGDGGMIRDSVDHYGFRTRSDGDG  244

Query  912   isifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKI  733
             ISI+G+ ++WIDHVSM NC DGLIDAI  ST ITISNGHFTDHN+ MLFGA+D  T+D  
Sbjct  245   ISIYGAQDIWIDHVSMTNCSDGLIDAIMGSTGITISNGHFTDHNEAMLFGASDSHTQDVK  304

Query  732   MQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP  553
             MQIT+AFNHFGKRL+QRMPRCR+GYIHVVNNDYTHWNMYAIGGS +P II QGNRFIAPP
Sbjct  305   MQITVAFNHFGKRLVQRMPRCRFGYIHVVNNDYTHWNMYAIGGSKNPIIISQGNRFIAPP  364

Query  552   D-IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFK  376
             D    KE+TKR       W  W WRS+GDI++ GAFFVQSGDP +  KH + YD +    
Sbjct  365   DNPFAKEVTKREYSPESVWSQWIWRSEGDIFLRGAFFVQSGDPTYTSKHPEKYDLIQAAS  424

Query  375   AEDVTWLTRFAGALNCRVGSPC  310
             A  V  +T+FAGAL C++G  C
Sbjct  425   ATQVEIMTKFAGALGCKIGQVC  446



>ref|XP_011025954.1| PREDICTED: probable pectate lyase P59 [Populus euphratica]
Length=441

 Score =   505 bits (1301),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 268/450 (60%), Positives = 327/450 (73%), Gaps = 10/450 (2%)
 Frame = -3

Query  1656  MERFNKNNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISAS  1477
             M   N +  FF   VS+A  +P   GHI E+DE W+++A EA K AQ+A+ P+P N+++ 
Sbjct  1     MRTLNGHFLFFSLFVSLAVFVPTLQGHIGEFDEYWKKKADEARKAAQEAFYPDPLNVTSQ  60

Query  1476  LIHQVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLA  1297
                QV + L+E       TN+T R L+  +K  G C ATNPIDRCWRC  +WAS+R++LA
Sbjct  61    FNFQVNKVLTE-------TNSTRRSLV--RKRGGRCIATNPIDRCWRCDPNWASHRQKLA  111

Query  1296  DCAMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLH  1120
             DC +GFG+KT GGK GK Y VTD SD D  NPKPGTLRHAVIQK+PLWIIF+  M I+L+
Sbjct  112   DCVLGFGHKTVGGKYGKIYVVTDASDNDMLNPKPGTLRHAVIQKEPLWIIFSGSMVIRLN  171

Query  1119  QELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFG  940
             QEL++  +KTID RG +VHI+ GAGIT+QF +NVIIHG+ IH I  G+GGLIRD +DH+G
Sbjct  172   QELMVASNKTIDSRGFKVHIAYGAGITLQFAQNVIIHGLRIHDIVSGSGGLIRDSVDHYG  231

Query  939   LRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGA  760
              RTKSDGDGISIFGSSN+WIDHVSM NC DGLID I  S AITISN HFT HN+VMLFGA
Sbjct  232   FRTKSDGDGISIFGSSNIWIDHVSMSNCQDGLIDVIMGSNAITISNSHFTRHNEVMLFGA  291

Query  759   NDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIIC  580
             +D  + D IMQIT++FNHFGK L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS +PTI+ 
Sbjct  292   SDSYSGDSIMQITVSFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSHNPTIVS  351

Query  579   QGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKL  400
             QGNRFIAP +   KE+TKR      EWK W WRS  D+ M GAFFVQSG P    +    
Sbjct  352   QGNRFIAPGNTFAKEVTKRDYAVESEWKNWNWRSDNDLMMNGAFFVQSGSPITSSRRISR  411

Query  399   YDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             +  + +     VT LTRF+G+L C  G PC
Sbjct  412   FHVMKSKPGTFVTRLTRFSGSLGCFKGKPC  441



>ref|XP_009369346.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=441

 Score =   505 bits (1300),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 272/451 (60%), Positives = 325/451 (72%), Gaps = 14/451 (3%)
 Frame = -3

Query  1656  MERFNKNNCFFLFVVSVAAIIPATV-GHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISA  1480
             ME   K N F L +  VA  IPATV  +IA +DE W+ RA EA + A +AY  NP  ++ 
Sbjct  3     MEAAYKLNVFILCIFIVAITIPATVTANIAVFDEHWQGRAKEAKQAANKAYNKNPAEVTG  62

Query  1479  SLIHQVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRL  1300
             S   +V  T         + N T R+L   +KY+GPC ATNPIDRCWRC  +W +NRK+L
Sbjct  63    SFNKEVHNTFD-------SMNNTRRNL--KEKYKGPCLATNPIDRCWRCDPNWETNRKKL  113

Query  1299  ADCAMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKL  1123
             ADCA GFG+KT GGK+G+ Y VTD SD D  NPKPGTLRHAVIQ  PLWIIFAHDM IKL
Sbjct  114   ADCAQGFGHKTTGGKAGEIYVVTDNSDNDLVNPKPGTLRHAVIQTGPLWIIFAHDMKIKL  173

Query  1122  HQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHF  943
              +EL++  DKTID RGA VHI DG  IT+QFVKNVIIH +HIH    GNGG+IRD ++H+
Sbjct  174   SEELMVTSDKTIDARGANVHIQDGGQITLQFVKNVIIHNLHIHDNKAGNGGMIRDSVNHY  233

Query  942   GLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFG  763
             G RT+SDGDGIS++G+SNVWIDHVS  NC DGLIDAI+ STAITISN HFT+HNDVMLFG
Sbjct  234   GQRTRSDGDGISMYGASNVWIDHVSASNCEDGLIDAIQGSTAITISNCHFTNHNDVMLFG  293

Query  762   ANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTII  583
             ++D +++D++MQITLAFNHFG+ L QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII
Sbjct  294   SSDSNSQDEVMQITLAFNHFGQGLTQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTII  353

Query  582   CQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK  403
              QGNRFIAP +   KE+TKR       WK+W WRS+ D+ M GAFFV+SG P    ++  
Sbjct  354   SQGNRFIAPLNEASKEVTKREYAAENVWKSWNWRSENDLMMNGAFFVESGSP---IRNLP  410

Query  402   LYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
               D +       V  LTRFAG L C  G PC
Sbjct  411   EADMIQAKPGTFVAKLTRFAGPLKCIKGKPC  441



>ref|XP_010242445.1| PREDICTED: pectate lyase [Nelumbo nucifera]
Length=443

 Score =   503 bits (1294),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 267/433 (62%), Positives = 313/433 (72%), Gaps = 10/433 (2%)
 Frame = -3

Query  1605  AAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDL  1426
             AAIIP    HI ++DEVW++RA EA  +A +AY P+P  +     H V      A AE  
Sbjct  20    AAIIPTLRAHIGDFDEVWQKRAEEAKSNALEAYHPDPDEVINHFNHHVHL----ATAEVR  75

Query  1425  TTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGK  1246
             + N++ R  L +K+Y+GPC ATNPIDRCWRC + W  NRK+LADC +GFG KT GGK GK
Sbjct  76    SGNSSTRRSLRNKEYKGPCMATNPIDRCWRCRSKWGKNRKKLADCVLGFGRKTVGGKYGK  135

Query  1245  FYTVTDKSDD-QSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQ  1069
             FY VTD SDD   NPKPGTLRHAVIQ +PLWIIF HDM I+L QELIM  DKT+DGRGA+
Sbjct  136   FYVVTDGSDDDMENPKPGTLRHAVIQTEPLWIIFEHDMIIRLKQELIMTSDKTLDGRGAR  195

Query  1068  VHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSN  889
             VHI+ GAGITIQF+KNVIIH +H H I    GG+IRD ++H G RT SDGD ISIFGS+N
Sbjct  196   VHIAYGAGITIQFIKNVIIHNLHFHDIVAREGGMIRDSVNHLGFRTASDGDAISIFGSTN  255

Query  888   VWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFN  709
             VWIDH SM NC DGL+DAI  STAITISN H T HN+VMLFGA+D    D  MQIT+AFN
Sbjct  256   VWIDHNSMSNCKDGLVDAIMGSTAITISNNHLTHHNEVMLFGASDSYPDDSKMQITVAFN  315

Query  708   HFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEIT  529
             HFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGSS+PTII QGNRFIAPP    K++T
Sbjct  316   HFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSSNPTIISQGNRFIAPPTEAAKQVT  375

Query  528   KRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTR  349
              R       WK WTWRS+GD+ M GA+F+QSG P       K  D +   K   V  L R
Sbjct  376   NRNYAPESVWKHWTWRSEGDLMMNGAYFIQSGKPI-----KKKRDMITAKKGTFVKRLVR  430

Query  348   FAGALNCRVGSPC  310
             F+GALNC+VG  C
Sbjct  431   FSGALNCKVGKRC  443



>gb|KHG08055.1| putative pectate lyase P59 [Gossypium arboreum]
 gb|KHG08558.1| putative pectate lyase P59 [Gossypium arboreum]
Length=440

 Score =   499 bits (1286),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 272/444 (61%), Positives = 323/444 (73%), Gaps = 10/444 (2%)
 Frame = -3

Query  1638  NNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVR  1459
             N  F L +   AAIIPA  GHI EYDE W++R  EA ++ +QAY PNP  ++  + H V 
Sbjct  6     NRSFKLLLFLFAAIIPALQGHIGEYDENWKQRELEAKENTEQAYNPNPEEVTQHVNHLVS  65

Query  1458  RTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGF  1279
             R+L       +  N+T RHL   KK  GPC+ TNPID+CWRC  +W  NR+RLADCA+GF
Sbjct  66    RSL-------MGLNSTRRHLRARKK-GGPCDPTNPIDQCWRCDRNWEKNRQRLADCAIGF  117

Query  1278  GYKTKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQ  1102
                T GGK G+ Y VTD SDD   NPKPGTLRHAVIQK+PLWIIFA  M I+L +ELIM 
Sbjct  118   ARGTIGGKYGRIYVVTDPSDDDLLNPKPGTLRHAVIQKEPLWIIFARAMIIRLKEELIMS  177

Query  1101  GDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsd  922
             G+KTID RGA VH++ GAGITIQ+V+NVIIHG+HIHHI  GNGG+IRD ++H+G RTKSD
Sbjct  178   GNKTIDARGANVHVAYGAGITIQYVRNVIIHGLHIHHIVPGNGGMIRDSVNHYGFRTKSD  237

Query  921   gdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTK  742
             GDGIS+FG++NVW+DH+SM  C DGLIDAI+ STAITISN HFT H+ VMLFGAND    
Sbjct  238   GDGISLFGATNVWLDHLSMYKCRDGLIDAIQGSTAITISNCHFTHHDQVMLFGANDNHKM  297

Query  741   DKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFI  562
             D+ MQITL FNHFGK L+QRMPRCR+G+IHVVNNDYTHW MYAIGGSSHPT+I QGNR+I
Sbjct  298   DEKMQITLVFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTVISQGNRYI  357

Query  561   APPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMT  382
             A   +  KE+TKR    PE WKTW WRS+GD+ + GAFF QSGDP    K  K    V  
Sbjct  358   ARRHVASKEVTKRDYAPPEVWKTWNWRSEGDLLLNGAFFSQSGDPKASSK-FKGDTKVSA  416

Query  381   FKAEDVTWLTRFAGALNCRVGSPC  310
               A  V  LT+ +G L C  G  C
Sbjct  417   KPAYKVDLLTKDSGTLICIRGRAC  440



>gb|KHG16093.1| hypothetical protein F383_07683 [Gossypium arboreum]
Length=454

 Score =   500 bits (1287),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 270/451 (60%), Positives = 327/451 (73%), Gaps = 16/451 (4%)
 Frame = -3

Query  1626  FLFVVSVAAIIPAT---VGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRR  1456
              +F+ S A +IP      G+IA++D+VW+RRA +AWK+   AYEP+P N+++     V +
Sbjct  8     LVFLFSFATLIPTLWGGGGNIADFDDVWKRRADQAWKNTLAAYEPSPENVTSKFNENVHK  67

Query  1455  TL---SEAVAEDLTTNTTGRHLLGS-KKYRGPCNATNPIDRCWRCHADWASNRKRLADCA  1288
              L        +DL  +   R+L G  KKY GPC ATNPIDRCWRC  DWA NRKRL  C 
Sbjct  68    ALVANKSNKTKDLEGSEDRRNLRGKHKKYTGPCMATNPIDRCWRCRPDWAENRKRLTQCV  127

Query  1287  MGFGYKTKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQEL  1111
             +GFG++T+GG+ GK+Y VTD SDD   NPKPGTLR AVIQK+PLWIIFAHDM+IKL +EL
Sbjct  128   IGFGHRTEGGEKGKYYEVTDNSDDDPVNPKPGTLRFAVIQKRPLWIIFAHDMHIKLSREL  187

Query  1110  IMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRT  931
             I+Q  KTIDGRGA VHI+ GAGIT+QFV +VIIH IHIHHI     GLIRD +DH GLRT
Sbjct  188   IVQSKKTIDGRGANVHIAHGAGITLQFVDDVIIHSIHIHHIGPSKAGLIRDSVDHIGLRT  247

Query  930   KsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDL  751
               DGDGI+IFGS+N+W+DH+SM  C DGLIDAI+ STAITISN HFT HNDV+L GA+D 
Sbjct  248   TGDGDGINIFGSTNIWLDHLSMSECQDGLIDAIQGSTAITISNCHFTHHNDVILLGASDT  307

Query  750   STKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGN  571
               +DK+MQ+T+AFNHFGK LIQRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII QGN
Sbjct  308   YERDKLMQVTVAFNHFGKELIQRMPRCRWGFFHVVNNDYTHWKMYAIGGSMHPTIISQGN  367

Query  570   RFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKL-YD  394
             RFIAP D   KEIT R      EW  W WRS+GD+ + GA F +SG     DK  +  + 
Sbjct  368   RFIAPDDPKAKEITNRNYAPQSEWSKWVWRSEGDLLLNGARFTKSGP----DKSPQFDFT  423

Query  393   GVMTFKAEDVTW---LTRFAGALNCRVGSPC  310
              +   KA+  T+   LTRFAGAL+C  G+ C
Sbjct  424   KMQMIKAKPATFVRRLTRFAGALDCEKGNKC  454



>ref|XP_010068708.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
 gb|KCW64557.1| hypothetical protein EUGRSUZ_G02162 [Eucalyptus grandis]
Length=435

 Score =   498 bits (1283),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 268/435 (62%), Positives = 327/435 (75%), Gaps = 16/435 (4%)
 Frame = -3

Query  1608  VAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAED  1429
             +A  +P    +IA++DEVW++RA EA K   +AYEP+P  ++    H+V   +       
Sbjct  15    LAVAVPVLRANIADFDEVWQKRAEEAKKATIKAYEPDPAKVAEDFNHRVHEDMQR-----  69

Query  1428  LTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSG  1249
               +N T R L   K+ +G C ATNPIDRCWRC  DWAS+RKRLA+CA+GFG  T GGK+G
Sbjct  70    --SNNTRRSL---KRTKGGCLATNPIDRCWRCRKDWASHRKRLANCALGFGRGTTGGKAG  124

Query  1248  KFYTVTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGA  1072
             K Y VTD SDD   NPKPGTLRHAVIQ +PLWIIFAH+M I+L +ELI+  +KTIDGRGA
Sbjct  125   KIYKVTDPSDDNLMNPKPGTLRHAVIQPEPLWIIFAHNMVIRLSEELIVTDNKTIDGRGA  184

Query  1071  QVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsS  892
              VHI DGA IT+QFV+NVIIHG+HIH    GNGGLIRD L+H+G RT SDGDGIS+FG++
Sbjct  185   NVHICDGAQITLQFVRNVIIHGLHIHDTHPGNGGLIRDSLEHYGFRTGSDGDGISLFGAT  244

Query  891   NVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAF  712
             NVWIDHVSM +CYDGLID I+ASTAITISN HFT HN+VMLFG +D  + D  MQIT+AF
Sbjct  245   NVWIDHVSMSHCYDGLIDVIQASTAITISNCHFTRHNEVMLFGGSDTYSDDAHMQITVAF  304

Query  711   NHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEI  532
             NHFG+ L+QRMPRCR+G++HVVNNDYTHW MYAIGGS HPTII QGNRFIAP D + KE+
Sbjct  305   NHFGQGLVQRMPRCRWGFVHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPLDPNCKEV  364

Query  531   TKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDP-NFMDKHHKLYDGVMTFKAEDVTWL  355
             TKR     + WK+W+WRS+ D+ + GAFFVQSG P   ++K++ +     +F    VT L
Sbjct  365   TKRDYAAEDVWKSWSWRSEDDLMLNGAFFVQSGSPIRNVNKNNVIKAKPGSF----VTRL  420

Query  354   TRFAGALNCRVGSPC  310
             TRFAGALNC  G PC
Sbjct  421   TRFAGALNCVKGKPC  435



>ref|XP_002520133.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF42188.1| Pectate lyase precursor, putative [Ricinus communis]
Length=440

 Score =   498 bits (1283),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 271/453 (60%), Positives = 328/453 (72%), Gaps = 17/453 (4%)
 Frame = -3

Query  1656  MERFNKNNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISAS  1477
             M   NK+   F+   S A I P    +I ++DE W+++A  A + A ++Y PNP N+S  
Sbjct  1     MVIMNKSLFTFVLFASFAVIFPTLHANIGDFDEYWKQKADIAREAAYRSYNPNPFNVSNQ  60

Query  1476  LIHQVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLA  1297
             L +QV + +S        TN+T R+L+  +K  GPC ATNPIDRCWRC   WA NRKRL 
Sbjct  61    LNYQVNKAVS-------GTNSTRRNLM-RRKGGGPCKATNPIDRCWRCDPKWALNRKRLV  112

Query  1296  DCAMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLH  1120
             +C +GFG+ T GGK GKFY VTD SD D  NPKPGTLRHAVIQ +PLWIIFA  M I+L+
Sbjct  113   ECVLGFGHSTTGGKDGKFYIVTDPSDNDMVNPKPGTLRHAVIQNEPLWIIFARSMIIRLN  172

Query  1119  QELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFG  940
             QEL++  +KTID RGA VHI+ GAG+T+QFV+NVIIHGI IH I  G+GGL+RD +DH+G
Sbjct  173   QELMISSNKTIDARGANVHIAGGAGLTLQFVQNVIIHGIRIHDIVSGSGGLVRDSVDHYG  232

Query  939   LRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGA  760
              RTKSDGDGISIFGSSN+WIDHVSM NC DGLIDAI  ST+ITISN HFT+HN+VMLFGA
Sbjct  233   FRTKSDGDGISIFGSSNIWIDHVSMSNCQDGLIDAIMGSTSITISNCHFTNHNEVMLFGA  292

Query  759   NDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIIC  580
             +D  + D IMQIT+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTII 
Sbjct  293   SDGYSADTIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSRKPTIIS  352

Query  579   QGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKL  400
             QGNRFIAP +I  KE+TKR      EWK W WRS  D+ M GA FV+SG P   D     
Sbjct  353   QGNRFIAPNNIFSKEVTKREYSLESEWKNWNWRSDRDLMMNGAVFVESGKPITHD-----  407

Query  399   YDGVMTFKAED---VTWLTRFAGALNCRVGSPC  310
             +  +   KA+    VT LTR++GAL+C VG PC
Sbjct  408   FSRLQLIKAKPGTFVTRLTRYSGALDCFVGKPC  440



>ref|XP_008374522.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=441

 Score =   498 bits (1281),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 268/451 (59%), Positives = 324/451 (72%), Gaps = 14/451 (3%)
 Frame = -3

Query  1656  MERFNKNNCFFLFVVSVAAIIPATV-GHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISA  1480
             ME   K   F L +  VA  IPATV  +IA +DE W+ RA EA + A +AY  NP  ++ 
Sbjct  3     MEAAYKLFVFILCIFIVAITIPATVTANIAVFDEHWQGRAKEAKQAANKAYNKNPAEVTG  62

Query  1479  SLIHQVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRL  1300
             S   +V  T         + N T R+L   +KY+GPC ATNPIDRCWRC  +W +NRK+L
Sbjct  63    SFNKEVHNTFD-------SMNNTRRNL--KEKYKGPCVATNPIDRCWRCDPNWETNRKKL  113

Query  1299  ADCAMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKL  1123
             ADCA GFG+KT GGK+G+ Y VTD SD D  NPKPGTLRHAVIQ  PLWIIFAHDM IKL
Sbjct  114   ADCAKGFGHKTTGGKAGEIYVVTDNSDNDLVNPKPGTLRHAVIQTGPLWIIFAHDMKIKL  173

Query  1122  HQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHF  943
              +EL++  DKTID RGA VHI DG  IT+QFVKNVIIH +HIH    GNGG+IRD ++H+
Sbjct  174   SEELMVTSDKTIDARGANVHIQDGGQITLQFVKNVIIHNLHIHDNKAGNGGMIRDSVNHY  233

Query  942   GLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFG  763
             G RT+SDGDGIS++G+SNVWIDHVS  NC DGLIDAI+ STAITISN HFT+HNDVMLFG
Sbjct  234   GQRTRSDGDGISMYGASNVWIDHVSASNCEDGLIDAIQGSTAITISNCHFTNHNDVMLFG  293

Query  762   ANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTII  583
             ++D +++D++MQIT+AFNHFG+ L QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII
Sbjct  294   SSDSNSQDEVMQITIAFNHFGQGLTQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTII  353

Query  582   CQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK  403
              QGNRFIAP +   KE+TKR       WK+W WRS+ D+ + GAFF++SG P    ++  
Sbjct  354   SQGNRFIAPXNEASKEVTKREYAAENVWKSWNWRSENDLMVNGAFFIESGSP---IRNLP  410

Query  402   LYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
               D +       V  LTRFAG L C  G PC
Sbjct  411   EADMIQAKPGTFVAKLTRFAGPLKCIKGKPC  441



>ref|XP_002272638.2| PREDICTED: pectate lyase-like [Vitis vinifera]
Length=434

 Score =   496 bits (1276),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 274/443 (62%), Positives = 330/443 (74%), Gaps = 14/443 (3%)
 Frame = -3

Query  1635  NCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRR  1456
             N   + ++    I+PA   +I ++DEVW+ RA EA K A QAY P+P  ++ +   +V +
Sbjct  5     NMRLVILIPFLVIVPAVTANIGDFDEVWQTRAEEARKAALQAYNPHPEKVTDNFNKKVHK  64

Query  1455  TLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFG  1276
             +         +TN T R+L    K+ G C ATNPIDRCWRC +DWASNR +LADC +GFG
Sbjct  65    SFD-------STNHTRRNL---SKFSGLCMATNPIDRCWRCRSDWASNRMKLADCVLGFG  114

Query  1275  YKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQG  1099
              KT GGK GK Y VTD SD D  NPKPGTLRHA IQ++PLWIIFAH M I+L++ELIM  
Sbjct  115   QKTTGGKGGKIYVVTDPSDNDMVNPKPGTLRHAAIQEEPLWIIFAHSMAIRLNEELIMTS  174

Query  1098  DKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdg  919
             +KTID RGA VHI++GAG+T+QFV N+IIHG+HIH I  GNGGLIRD   H+G RT+SDG
Sbjct  175   NKTIDARGANVHIANGAGLTLQFVHNIIIHGLHIHDIKVGNGGLIRDSASHYGFRTRSDG  234

Query  918   dgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKD  739
             DGISIFG++N+WIDH+SM NC DGLIDAI ASTAITISN HFT HN+VMLFGA+D  + D
Sbjct  235   DGISIFGATNIWIDHISMSNCADGLIDAIMASTAITISNCHFTHHNEVMLFGASDGYSGD  294

Query  738   KIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIA  559
              IMQIT+ FNHFG+ L QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTI+ QGNRFIA
Sbjct  295   AIMQITITFNHFGQGLTQRMPRCRWGFFHVVNNDYTHWLMYAIGGSHHPTILSQGNRFIA  354

Query  558   PPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTF  379
             PPDI+ KE+TKR       WK+WTWRSQGD+ M GAFFV+SGDPNF D  +K    +   
Sbjct  355   PPDINCKEVTKRDYSPESVWKSWTWRSQGDLMMNGAFFVESGDPNF-DFSNKYV--IRAK  411

Query  378   KAEDVTWLTRFAGALNCRVGSPC  310
                 VT LTRF+GAL+CR G PC
Sbjct  412   PGAFVTRLTRFSGALSCREGMPC  434



>ref|XP_002323835.1| hypothetical protein POPTR_0017s11450g [Populus trichocarpa]
 gb|EEF03968.1| hypothetical protein POPTR_0017s11450g [Populus trichocarpa]
Length=452

 Score =   496 bits (1276),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 264/448 (59%), Positives = 326/448 (73%), Gaps = 12/448 (3%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
              +F +++A +IP  +  IA +DEVW++RA EA K    +Y PNP + +     +V  TL 
Sbjct  8     LIFAITLATLIPGLLADIAFFDEVWQKRAEEAKKVTLNSYIPNPEDATDDFNFEVNNTLV  67

Query  1446  E------AVAEDLTTNTTGRHL-LGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCA  1288
             +          +L  N+T R+L  G KKY GPC  TNPID+CWRC  +WA NRKRLA CA
Sbjct  68    DFDDDRNDAGFELHANSTRRNLKQGKKKYLGPCKVTNPIDKCWRCRRNWARNRKRLAKCA  127

Query  1287  MGFGYKTKGGKSGKFYTVTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQEL  1111
             +GFG +  GG  G+ Y VT+ SDD   NPKPGTLRHAVIQK PLWIIF+ +MNI+L +EL
Sbjct  128   LGFGRRATGGLKGRVYVVTENSDDDVMNPKPGTLRHAVIQKGPLWIIFSKNMNIRLSKEL  187

Query  1110  IMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRT  931
             IM   KTIDGRG  +HI+ GAGITIQF++NVIIHGI IHHI   +GG IRD ++H+G+RT
Sbjct  188   IMTSHKTIDGRGHHIHIAYGAGITIQFIQNVIIHGIRIHHIVATSGGNIRDSVEHYGIRT  247

Query  930   KsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDL  751
              SDGDGISIFGSSN+WIDHVSM  C DGLIDAI  STAITISN HFT HND +L GA+D 
Sbjct  248   NSDGDGISIFGSSNIWIDHVSMSRCTDGLIDAIMGSTAITISNSHFTHHNDAILLGASDS  307

Query  750   STKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGN  571
              + D++MQ+T+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII QGN
Sbjct  308   FSGDELMQVTVAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWRMYAIGGSKHPTIISQGN  367

Query  570   RFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDG  391
             RFIAPP++H K++TKR   T  EWKTWTWRS+ D+ M GAFF++SG P     H K    
Sbjct  368   RFIAPPELHLKQVTKRDYATESEWKTWTWRSENDLMMNGAFFIESGKPRTKRPHKKF---  424

Query  390   VMTFKAEDV-TWLTRFAGALNCRVGSPC  310
             ++T K   + T +T FAGAL+C+ G  C
Sbjct  425   MITAKPGSLATRMTLFAGALDCKSGRKC  452



>ref|XP_011005067.1| PREDICTED: probable pectate lyase P59 [Populus euphratica]
Length=452

 Score =   495 bits (1275),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 263/448 (59%), Positives = 326/448 (73%), Gaps = 12/448 (3%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
              +F +++A +IPA +  IA +DEVW++RA EA K    +Y PNP + +     +V  TL 
Sbjct  8     LIFAITLATLIPALLADIAFFDEVWQKRAEEAKKVTLNSYVPNPEDATDDFNFEVNNTLV  67

Query  1446  E------AVAEDLTTNTTGRHL-LGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCA  1288
             +          +L  N+T R+L  G KKY GPC  TNPID+CWRC  +WA NRKRLA CA
Sbjct  68    DFDDDGNDAGFELLANSTRRNLKQGKKKYLGPCKVTNPIDKCWRCRRNWARNRKRLAKCA  127

Query  1287  MGFGYKTKGGKSGKFYTVTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQEL  1111
             +GFG +  GG  G+ Y VT+ SDD   NPKPGTLRHAVIQK+PLWIIF+ +MNI+L +EL
Sbjct  128   LGFGRRATGGLKGRVYVVTENSDDDVMNPKPGTLRHAVIQKEPLWIIFSKNMNIRLSKEL  187

Query  1110  IMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRT  931
             IM   KTIDGRG  +HI+ GAGITIQF++NVIIHGI IHHI   +GG IRD + H+G+RT
Sbjct  188   IMTSHKTIDGRGHHIHIAYGAGITIQFIQNVIIHGIRIHHIVATSGGNIRDSVGHYGIRT  247

Query  930   KsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDL  751
              SDGDGISIFGSSN+WIDHVSM  C DGLIDAI  STAITISN HFT HND +L GA+D 
Sbjct  248   NSDGDGISIFGSSNIWIDHVSMSRCTDGLIDAIMGSTAITISNSHFTHHNDAILLGASDS  307

Query  750   STKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGN  571
              + D++MQ+T+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTI+ QGN
Sbjct  308   FSGDELMQVTVAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWRMYAIGGSKHPTIVSQGN  367

Query  570   RFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDG  391
             RFIAPP++H K++TKR      EWKTWTWRS+ D+ M GAFF++SG P     H K    
Sbjct  368   RFIAPPELHLKQVTKRDYAPESEWKTWTWRSENDLMMNGAFFIESGKPRTKRPHKKF---  424

Query  390   VMTFKAEDV-TWLTRFAGALNCRVGSPC  310
             ++T K   + T +T FAGAL+C+ G  C
Sbjct  425   MITAKPGSLATRMTLFAGALDCKSGRKC  452



>emb|CDP14850.1| unnamed protein product [Coffea canephora]
Length=435

 Score =   494 bits (1273),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 262/448 (58%), Positives = 323/448 (72%), Gaps = 15/448 (3%)
 Frame = -3

Query  1650  RFNKNNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLI  1471
              F K++    F  ++ A++     HIAE+DEVW++RA EA K A+QAY PNP N+++   
Sbjct  2     EFKKSSLILAF--ALIALVYTIEAHIAEFDEVWQKRAEEAKKAARQAYHPNPENVTSHFN  59

Query  1470  HQVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADC  1291
              +V R++          N+  R L    KY GPC ATNPID+CWRC  +W  NR +LADC
Sbjct  60    EEVHRSID-------GHNSRRRDL---HKYNGPCTATNPIDQCWRCQKNWRKNRMKLADC  109

Query  1290  AMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQE  1114
             A+GFG    GGK G+ Y VTD SD D  NPKPGTLRHA+IQ +PLW+IF  +M I+L QE
Sbjct  110   ALGFGRHATGGKGGRIYKVTDPSDNDLVNPKPGTLRHALIQPEPLWVIFTKNMVIRLSQE  169

Query  1113  LIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLR  934
             LIM  +KTIDGRG QVHI+ GAG T+QFV N+IIH +HIH I  GNGG+IRD ++H+G+R
Sbjct  170   LIMTSNKTIDGRGVQVHIAYGAGFTLQFVHNIIIHNLHIHDIKSGNGGMIRDSVNHYGIR  229

Query  933   TKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGAND  754
             ++SDGDGISI+GS+N+WIDH+SM NC DGLIDA++ASTAITISNGHFT HN+ MLFGA+D
Sbjct  230   SRSDGDGISIYGSTNIWIDHISMSNCNDGLIDAVQASTAITISNGHFTHHNEAMLFGASD  289

Query  753   LSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQG  574
               + D IMQITLAFNHFG+ + QRMPR R+G++HVVNNDYTHW MYAIGGS HPTI+ QG
Sbjct  290   SYSDDSIMQITLAFNHFGQGIEQRMPRARWGFVHVVNNDYTHWLMYAIGGSQHPTILSQG  349

Query  573   NRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYD  394
             NRFIAP + + KE+TKR       WK W W+SQGD+ M GAFFVQSGDPN     +   D
Sbjct  350   NRFIAPENPYAKEVTKRDYAPESVWKDWVWKSQGDLMMNGAFFVQSGDPNHNFGSNA--D  407

Query  393   GVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              +     E    LTRFAGALNC    PC
Sbjct  408   LIGPKPGEFANRLTRFAGALNCIAKRPC  435



>ref|XP_007227702.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
 gb|EMJ28901.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
Length=446

 Score =   495 bits (1274),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 268/423 (63%), Positives = 308/423 (73%), Gaps = 12/423 (3%)
 Frame = -3

Query  1572  AEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTGRHLLG  1393
              + D  W++RA EA K A Q++E +P  ++      V   L       +  N T RHL G
Sbjct  34    VQLDIYWKQRAEEAKKEAMQSFETDPEQVTEEFNSNVGELL-------MKQNGTRRHLRG  86

Query  1392  SKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD-D  1216
             +KKY GPC ATNP+D CWRC  +WA NRKRLADC  GFG KT GGK+G  Y VTD SD D
Sbjct  87    NKKYNGPCMATNPMDACWRCDKNWAKNRKRLADCVQGFGKKTTGGKAGPIYVVTDPSDLD  146

Query  1215  QSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITI  1036
               NPKPGTLRHAVIQK PLWIIFA +M I+L QEL++  DKTIDGRGA V+I +GAGIT+
Sbjct  147   LVNPKPGTLRHAVIQKGPLWIIFARNMVIRLQQELLVTSDKTIDGRGANVNIHNGAGITL  206

Query  1035  QFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNC  856
             QFVKNVII  +HI  I    GG+IRD +DH G RTKSDGDGISIFGSSNVWIDHVSM NC
Sbjct  207   QFVKNVIITNLHIKKIVPKQGGMIRDSVDHIGRRTKSDGDGISIFGSSNVWIDHVSMENC  266

Query  855   YDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMP  676
              DGLIDAI  STAITISN HFT HNDVMLFGA++  T+DKIMQIT+AFNHFG+ L+QRMP
Sbjct  267   ADGLIDAIMGSTAITISNSHFTHHNDVMLFGASNSYTQDKIMQITVAFNHFGQGLVQRMP  326

Query  675   RCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEEWK  496
             RCR+G+ HVVNNDYTHW MYAIGGS +PTII QGNRFIAPP+   KE+TKR      EWK
Sbjct  327   RCRHGFFHVVNNDYTHWLMYAIGGSMNPTIISQGNRFIAPPNQGAKEVTKRDHTAEAEWK  386

Query  495   TWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED-VTWLTRFAGALNCRVG  319
              W WRS+GD+ M GA FVQSG      KH    D +M FK    V  LT+F+GAL+C VG
Sbjct  387   NWEWRSEGDLMMNGAVFVQSGSGK--SKHPAKMD-LMPFKPGTYVAKLTKFSGALDCFVG  443

Query  318   SPC  310
              PC
Sbjct  444   KPC  446



>ref|XP_004152537.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=434

 Score =   494 bits (1272),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 265/440 (60%), Positives = 322/440 (73%), Gaps = 19/440 (4%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
              L +     I P    +IA++DEVW++RA EA K + +AYEP+P   + +   QV R+L 
Sbjct  13    LLMIFGFVMIFPTLKANIADFDEVWQKRAIEAQKASFEAYEPHPEEETNNFNKQVHRSLD  72

Query  1446  EAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKT  1267
                      N T RHL   +KY GPC ATNPIDRCWRC  +WA NRK+LADCA+GFG +T
Sbjct  73    GG-------NNTRRHL---RKYTGPCLATNPIDRCWRCDRNWARNRKKLADCALGFGRRT  122

Query  1266  KGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKT  1090
              GGK GK Y V D SD D  NPKPGTLRHAVIQ++PLWIIFAHDM I+L +ELI+  DKT
Sbjct  123   TGGKDGKIYVVRDSSDNDLVNPKPGTLRHAVIQERPLWIIFAHDMVIRLSEELIVTDDKT  182

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             +DGRGA VHI++G  IT+QFVKN+IIH +HIH I  GNGG+IRD + H+G RT+SDGDGI
Sbjct  183   LDGRGANVHIANGGQITLQFVKNIIIHNLHIHDIKAGNGGMIRDSVSHYGFRTRSDGDGI  242

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             S+FG+S VWIDHVSM NC DGLIDA+ ASTAITISN HFT HNDV+L GA++  + D+IM
Sbjct  243   SMFGASRVWIDHVSMSNCQDGLIDAVMASTAITISNCHFTHHNDVILLGASNGYSNDQIM  302

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             Q+TLAFNHFGK L+QRMPRCR+G+IHVVNNDYTHW MYAIGGS       QGNRFIAPP+
Sbjct  303   QVTLAFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSHX-----QGNRFIAPPN  357

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAE  370
              + KE+TKRV     EW++W WRS+GD+ M GAFF+QSG+P    K +   D + +    
Sbjct  358   PNCKEVTKRVYAPESEWRSWNWRSEGDLMMNGAFFIQSGNP---IKRYSKKDVIHSKPGT  414

Query  369   DVTWLTRFAGALNCRVGSPC  310
              VT LTRFAG L C+   PC
Sbjct  415   FVTRLTRFAGPLKCKKNQPC  434



>ref|XP_007153840.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
 gb|ESW25834.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
Length=447

 Score =   492 bits (1267),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 263/424 (62%), Positives = 309/424 (73%), Gaps = 11/424 (3%)
 Frame = -3

Query  1578  HIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTGRHL  1399
             H  E+D  W+ RA  A      AY P+P+++S +L        S +V+E +      R+L
Sbjct  34    HENEFDPYWKGRAETAAVDNNAAYFPDPYSVSGNL--------SSSVSELIVGKDKRRNL  85

Query  1398  LGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD  1219
              G ++Y GPC ATNPIDRCWRC  +WA+NR++LADC  GFG  T GGK G FY VTD SD
Sbjct  86    KG-QRYTGPCMATNPIDRCWRCDPNWANNRQKLADCVQGFGRNTVGGKGGPFYVVTDPSD  144

Query  1218  DQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGI  1042
             D   + KPGTLRHAV +  PLWIIF   M IKL QELIM  DKTIDGRG +V+I+ GAGI
Sbjct  145   DNMVDLKPGTLRHAVTRTGPLWIIFERSMMIKLKQELIMTSDKTIDGRGVEVYIASGAGI  204

Query  1041  TIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMR  862
             T+QF++NVIIHGI ++ I    GG+IRD   H+GLRT+SDGDGISIFGSSN+WIDHVSMR
Sbjct  205   TVQFIRNVIIHGIKVYDIQVHGGGMIRDSETHYGLRTQSDGDGISIFGSSNIWIDHVSMR  264

Query  861   NCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQR  682
             NCYDGLIDAI  STAITISN HFTDHN+ MLFGA+D   KDKIMQITLAFNHFGKRL+QR
Sbjct  265   NCYDGLIDAIMGSTAITISNSHFTDHNEAMLFGASDSYDKDKIMQITLAFNHFGKRLVQR  324

Query  681   MPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEE  502
             MPRCRYG++HVVNNDYTHW MYAIGGS HPTII +GNRFI P ++H KEITKR      E
Sbjct  325   MPRCRYGFVHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIGPDNVHAKEITKREYSPESE  384

Query  501   WKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRV  322
             W +W WRS  D YM GAFFVQSG P  +D+     D +       V  LTR+AG+L+CRV
Sbjct  385   WSSWQWRSINDEYMNGAFFVQSG-PELVDRPFSRQDMIKAKPGSYVGRLTRYAGSLSCRV  443

Query  321   GSPC  310
             G PC
Sbjct  444   GLPC  447



>ref|XP_009389712.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=438

 Score =   490 bits (1261),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 262/441 (59%), Positives = 320/441 (73%), Gaps = 11/441 (2%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTL  1450
             FF  +V +A+   A   HIA++DE W+++A  A   A+ +Y P+P +++        R  
Sbjct  8     FFFSLVFLASAAFANA-HIADFDEYWQKKAEVAQSKARNSYNPDPESVT--------RHF  58

Query  1449  SEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYK  1270
             +EAV ED  TN T R L G K+  GPC ATNPIDRCWRC+ +W  +RK+LA CA GFG  
Sbjct  59    NEAVYEDAQTNVTRRGLRGQKRSHGPCLATNPIDRCWRCNENWIHHRKQLATCAKGFGRH  118

Query  1269  TKGGKSGKFYTVTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDK  1093
             T GGK+GKFY VTD SDD   NPK GTLR+ VIQ +PLWI+FAHDM I+L +ELI+   K
Sbjct  119   TIGGKNGKFYVVTDASDDDLVNPKKGTLRYGVIQDRPLWIVFAHDMVIRLTEELIVNSYK  178

Query  1092  TIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdg  913
             TIDGRGA V I  GAG+TIQ+V NVI+H +HI  I  GNGG+IRD   H+GLRT+SDGDG
Sbjct  179   TIDGRGANVQIMGGAGVTIQYVHNVIVHNLHIQDIKAGNGGMIRDSEHHYGLRTRSDGDG  238

Query  912   isifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKI  733
             ISI+GSSN+WIDHVSM NC DGLIDAIE STAITISN HFT HN+ MLFGA+D  + D I
Sbjct  239   ISIYGSSNIWIDHVSMSNCMDGLIDAIEGSTAITISNSHFTRHNEAMLFGASDAYSPDAI  298

Query  732   MQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP  553
             MQIT+AFNHFGK L+QRMPRCR+G++HVVNNDYTHW MYA+GGS HPTII QGNR+IAP 
Sbjct  299   MQITVAFNHFGKGLVQRMPRCRWGFVHVVNNDYTHWEMYAVGGSQHPTIISQGNRYIAPS  358

Query  552   DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKA  373
             +   KE+TKR   T   WK WTWRS+GD+ + GAFFV+SG    + K+ K  D +     
Sbjct  359   NPFAKEVTKRDYATESVWKQWTWRSEGDLMLNGAFFVKSGGGGGLQKYDKT-DIIKAKPG  417

Query  372   EDVTWLTRFAGALNCRVGSPC  310
               VT LTR++GAL+C    PC
Sbjct  418   SFVTRLTRYSGALDCFPQRPC  438



>ref|XP_002270089.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32015.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   490 bits (1261),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 271/438 (62%), Positives = 320/438 (73%), Gaps = 18/438 (4%)
 Frame = -3

Query  1605  AAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDL  1426
             A I P    HIAEYD+ W+ R  EA K A +A+ P P         +V    +  V ++L
Sbjct  18    AVIAPTIRAHIAEYDDYWKEREEEAKKAALEAFHPTPQ--------EVNDHFNLHVEDEL  69

Query  1425  T-TNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSG  1249
             T +N T R L  +K   GPC ATNPIDRCWRC  +WAS RKRLADC +GFG  T GGK G
Sbjct  70    TGSNGTRRSLRVNK---GPCKATNPIDRCWRCRPNWASQRKRLADCVLGFGRNTVGGKYG  126

Query  1248  KFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGA  1072
             K+Y VTD SD D  NPK GTLRHAVIQ +PLWI+FA  M I+L+QELIM  DKTIDGRG 
Sbjct  127   KYYFVTDPSDNDMVNPKKGTLRHAVIQPRPLWIVFARSMIIRLNQELIMTSDKTIDGRGV  186

Query  1071  QVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsS  892
              VHI+ GAGITIQFVKNVIIHG+HIH I  G+GGLIRD ++HFG R++SDGDGISI+GSS
Sbjct  187   NVHIAYGAGITIQFVKNVIIHGLHIHDIVSGSGGLIRDSVNHFGYRSRSDGDGISIYGSS  246

Query  891   NVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAF  712
             +VWIDH SM NC DGLIDAI+ STAITISN HFT HN+VMLFGA+D ++ D+IMQIT+AF
Sbjct  247   HVWIDHNSMSNCKDGLIDAIQGSTAITISNNHFTKHNEVMLFGASDSNSADEIMQITVAF  306

Query  711   NHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAP----PDIH  544
             NHFG+ LIQRMPRCR+G+ HVVNNDYTHWNMYAIGGS+HPTII QGNR+ AP    P   
Sbjct  307   NHFGRGLIQRMPRCRWGFFHVVNNDYTHWNMYAIGGSAHPTIISQGNRYTAPHLVDPKHD  366

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDV  364
              K++TKR      EWK WTWRS+GD+   GAFFV SG+P+    + +L D +       V
Sbjct  367   AKQVTKRDYAMESEWKKWTWRSEGDLMRNGAFFVPSGNPSKRMPYSRL-DMIKAKPGTYV  425

Query  363   TWLTRFAGALNCRVGSPC  310
             + LTRF+GAL CR G PC
Sbjct  426   SRLTRFSGALTCRRGGPC  443



>ref|XP_010105747.1| putative pectate lyase P59 [Morus notabilis]
 gb|EXC05967.1| putative pectate lyase P59 [Morus notabilis]
Length=421

 Score =   488 bits (1256),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 271/426 (64%), Positives = 316/426 (74%), Gaps = 12/426 (3%)
 Frame = -3

Query  1578  HIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTGRHL  1399
             HIAE+D+ W+ RA +A K A QAY P+P  ++  L + V   L+         N+T R L
Sbjct  5     HIAEFDDYWKSRAEQAQKDALQAYHPHPEEVTNQLNYDVEEALT-------VKNSTRRVL  57

Query  1398  LGSK-KYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKS  1222
              G K K  GPC ATNPIDRCWRC  +WASNRKRLADCA GFG  + GGK G++Y VTD S
Sbjct  58    RGKKNKKGGPCMATNPIDRCWRCDPNWASNRKRLADCARGFGRNSVGGKFGRYYVVTDSS  117

Query  1221  D-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAG  1045
             D D  NPKPGTLRHAVIQK PLWIIFA  M I+L +ELIM GDKTIDGRGA V I+ GAG
Sbjct  118   DTDLVNPKPGTLRHAVIQKAPLWIIFARSMIIRLSEELIMTGDKTIDGRGANVRIAYGAG  177

Query  1044  ITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSM  865
             ITIQFVKNVIIH IHIH I  G+GG IRD ++H G RTKSDGDGISIFGSS++WIDHVSM
Sbjct  178   ITIQFVKNVIIHNIHIHDINAGSGGNIRDSINHIGFRTKSDGDGISIFGSSHIWIDHVSM  237

Query  864   RNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQ  685
              NC DGLIDAI  STAITISN HFT HN+VMLFGA+D  + D+ MQ+T+AFNHFG+ L+Q
Sbjct  238   SNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDSYSDDQRMQVTVAFNHFGQGLVQ  297

Query  684   RMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPE  505
             RMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII QGNRFIAP D++ K++TKR      
Sbjct  298   RMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPLDLNAKQVTKRDYAPES  357

Query  504   EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED-VTWLTRFAGALNC  328
             +WK W WRS+GD+ M GAFFVQSG    + K      G++ +K    VT LTR+AG L C
Sbjct  358   DWKNWRWRSEGDLLMNGAFFVQSGKR--LSKRRYSRPGMIKYKPGTFVTRLTRYAGTLVC  415

Query  327   RVGSPC  310
              +G PC
Sbjct  416   GIGRPC  421



>ref|XP_009381244.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=423

 Score =   487 bits (1254),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 257/425 (60%), Positives = 309/425 (73%), Gaps = 11/425 (3%)
 Frame = -3

Query  1581  GHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTGRH  1402
              HIAE+DE W+++ A A  + Q AY PNP +++        +  ++AV +DL  N T R 
Sbjct  9     AHIAEFDEYWQKKEAMARANVQNAYNPNPESVT--------KHFNDAVLKDLEKNNTRRG  60

Query  1401  LLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKS  1222
             L G ++Y GPC ATNPIDRCWRC  +WA +RKRLA CA GFG    GGK+G FY VTD S
Sbjct  61    LRGKRRYDGPCMATNPIDRCWRCQENWAHHRKRLATCAKGFGRHVTGGKNGDFYVVTDPS  120

Query  1221  D-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAG  1045
             D D  NP+ GTLR+ VIQ +PLWI+FA DM I+L +ELI+  +KTIDGRG  V I +GAG
Sbjct  121   DLDLVNPRKGTLRYGVIQDRPLWIVFARDMVIRLTEELIVNSNKTIDGRGVDVQIMNGAG  180

Query  1044  ITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSM  865
             ITIQ+V N+IIH + IH I  GNGG+IRD   H+GLRT+SDGDGISIFG+SNVWIDHVSM
Sbjct  181   ITIQYVDNIIIHNLRIHDIKAGNGGMIRDSEHHYGLRTRSDGDGISIFGASNVWIDHVSM  240

Query  864   RNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQ  685
              NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D  + D +MQIT+AFNHFGK L+Q
Sbjct  241   SNCMDGLIDAIQGSTAITISNSHFTQHNDVMLFGASDAFSGDAVMQITVAFNHFGKGLVQ  300

Query  684   RMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPE  505
             RMPRCR+G++HVVNNDYTHW MYAIGGS HPTI+ QGNRFIAPP +  KE+TKR     E
Sbjct  301   RMPRCRWGFVHVVNNDYTHWMMYAIGGSQHPTILSQGNRFIAPPTLFAKEVTKREYSPEE  360

Query  504   EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCR  325
              WK+W WRS+GD+   GAFFV SG     +  +K  D +       VT LTRF+GAL C 
Sbjct  361   VWKSWQWRSEGDLLKNGAFFVPSGAGKLGNVSYK--DLIKAKPGTFVTRLTRFSGALKCV  418

Query  324   VGSPC  310
                PC
Sbjct  419   PNRPC  423



>ref|XP_010528323.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=458

 Score =   488 bits (1257),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 264/460 (57%), Positives = 325/460 (71%), Gaps = 13/460 (3%)
 Frame = -3

Query  1656  MERFNKNNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISAS  1477
             ME+     C+ +F+V   + IP   G I EYD+  R++ AEA + A +AY+P        
Sbjct  1     MEKTKMIACY-VFLVCFVSQIPNLRGKIGEYDDYLRKQEAEAQEQALRAYDPEFDQTVKK  59

Query  1476  LIHQ------VRRTLSEAVAEDLTTNTTGRHLLGS---KKYRGPCNATNPIDRCWRCHAD  1324
               H          ++      +  T +T R L G    KK  GPC ATNP+D+CWRC AD
Sbjct  60    FDHNDPSHQNATISIKGGYRPNKNTTSTRRSLRGRGNWKKIAGPCKATNPVDKCWRCQAD  119

Query  1323  WASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSDD-QSNPKPGTLRHAVIQKKPLWIIF  1147
             WA NRKRL  C  GFG+KT GG SGKFY VTD SDD   NPKPGT+RHAVIQK PLWIIF
Sbjct  120   WAQNRKRLVSCVRGFGHKTTGGFSGKFYKVTDPSDDDMQNPKPGTIRHAVIQKVPLWIIF  179

Query  1146  AHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGL  967
             A  M+I+L QEL++  +KTID RGA VHI+ GAGITIQF +NVIIHG+HIHHI   NGG+
Sbjct  180   ARSMHIRLKQELMITSNKTIDARGANVHIAFGAGITIQFAQNVIIHGLHIHHIVTSNGGM  239

Query  966   IRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTD  787
             IRD +DH G+RT++DGDGIS+FGSSNVW+DH+SM  C DGLID I+ STAITISN HFT 
Sbjct  240   IRDSVDHIGIRTQADGDGISVFGSSNVWLDHLSMSRCQDGLIDVIQGSTAITISNCHFTH  299

Query  786   HNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIG  607
             HNDV+L GA+D  + D IMQ+T+A+NHFGK L+QRMPRCR+G++HVVNNDYTHW MYAIG
Sbjct  300   HNDVILLGASDQFSGDSIMQVTIAYNHFGKGLVQRMPRCRWGFVHVVNNDYTHWEMYAIG  359

Query  606   GSSHPTIICQGNRFIAPPDIH-KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGD  430
             GS HPTI+ QGNRFIAPP I   K++TKR    P EWK WTW+S+ D++M GA+FV+SGD
Sbjct  360   GSQHPTILSQGNRFIAPPHISWAKQVTKRDYAQPSEWKRWTWQSEMDVFMNGAYFVESGD  419

Query  429   PNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             PNF  K  +  D +        + LTR+AG+L+C  G PC
Sbjct  420   PNFKHKFTR-QDIIRAKHGMAASMLTRYAGSLHCFAGKPC  458



>ref|XP_009403112.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=437

 Score =   487 bits (1253),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 260/424 (61%), Positives = 310/424 (73%), Gaps = 11/424 (3%)
 Frame = -3

Query  1578  HIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTGRHL  1399
             HI ++DE W+++A  A   AQ +Y P+P +++ S         +EAV++DL  N T R L
Sbjct  24    HIGDFDEYWQKKAEAARDRAQGSYNPDPESVTQSF--------NEAVSKDLEGNVTRRSL  75

Query  1398  LGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD  1219
              G  K+ GPC ATNPIDRCWRC  DW  NRKRLA CA GFG  T GGK+G  Y VTD SD
Sbjct  76    RGKHKFNGPCVATNPIDRCWRCKKDWMQNRKRLAKCAKGFGRHTIGGKNGDLYVVTDASD  135

Query  1218  -DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGI  1042
              D  +PK GTLR+ VIQ +PLWI+FA DM I+L++EL++  DKTID RG+ VHI  GAGI
Sbjct  136   NDLISPKKGTLRYGVIQDRPLWIVFASDMIIRLNEELLVTSDKTIDARGSNVHIMGGAGI  195

Query  1041  TIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMR  862
              +QFV NVIIHG+HIH I  GNGG+IRD   HFGLRT+SDGDGISI+GSSN+WIDHVSM 
Sbjct  196   MLQFVHNVIIHGLHIHDIKAGNGGMIRDSEHHFGLRTRSDGDGISIYGSSNIWIDHVSMS  255

Query  861   NCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQR  682
             NC DGLID I+ STAITISN HFT HNDVMLFGA+D    D +MQIT+AFNHFGK L+QR
Sbjct  256   NCMDGLIDVIQGSTAITISNSHFTKHNDVMLFGASDSYQGDAMMQITVAFNHFGKGLVQR  315

Query  681   MPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEE  502
             MPRCR+G++HVVNNDYTHW MYA+GGS HPTI+ QGNR+IAP  +  KE+TKR       
Sbjct  316   MPRCRWGFVHVVNNDYTHWLMYAVGGSQHPTILSQGNRYIAPHSLAAKEVTKRDYAPQAV  375

Query  501   WKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRV  322
             WK WTWRS+GD+   GAFFV+SG PN M  + K  D +       VT LTRF+GALNC  
Sbjct  376   WKDWTWRSEGDLMQNGAFFVESGPPNRMKFNTK--DLIKAKPGSFVTRLTRFSGALNCFP  433

Query  321   GSPC  310
             G PC
Sbjct  434   GRPC  437



>ref|XP_011013803.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=419

 Score =   486 bits (1250),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 259/425 (61%), Positives = 318/425 (75%), Gaps = 18/425 (4%)
 Frame = -3

Query  1575  IAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTGRHLL  1396
             IA +DE W++RA EA + +++AYEPNP  ++     +V ++L          N+T R+L 
Sbjct  10    IANFDEYWKKRAEEAKEASREAYEPNPEKVAKHFNDEVHKSLEGG-------NSTRRNL-  61

Query  1395  GSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD-  1219
                KY+GPC ATNPIDRCWRC  +WA NRK+L  CA+GFG KT GGK+GK+Y VTD SD 
Sbjct  62    --GKYKGPCLATNPIDRCWRCDKNWAKNRKKLGGCALGFGRKTIGGKNGKYYRVTDPSDN  119

Query  1218  DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGIT  1039
             D  NPKPGTLR+ VIQ KPLWIIFAHDM I+L +EL++  +KTIDGRG  VHI +GA IT
Sbjct  120   DMVNPKPGTLRYGVIQDKPLWIIFAHDMVIRLSEELMVASNKTIDGRGVNVHIYNGAQIT  179

Query  1038  IQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRN  859
             +QFVKNVIIHGIHIH    GNGG+IRD +DH+G R++SDGDGISIFGS+++WIDH+S+ N
Sbjct  180   LQFVKNVIIHGIHIHDAKAGNGGMIRDSVDHYGFRSRSDGDGISIFGSTDIWIDHISLSN  239

Query  858   CYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRM  679
             C DGLIDA+  S AITISN HFT HNDVMLFGA+D  + D +MQIT+AFNHFG+ L+QRM
Sbjct  240   CEDGLIDAVMGSNAITISNCHFTKHNDVMLFGASDGYSGDSVMQITVAFNHFGRGLVQRM  299

Query  678   PRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEEW  499
             PR R+G+ HVVNNDYTHW MYAIGGS HPTII QGNRFIAPPD+  KE+TKR       W
Sbjct  300   PRVRWGFAHVVNNDYTHWEMYAIGGSQHPTIISQGNRFIAPPDLACKEVTKRDYAVESVW  359

Query  498   KTWTWRSQGDIYMEGAFFVQSGDP-NFMDKHHKLYDGVM-TFKAEDVTWLTRFAGALNCR  325
             K+W WRS+GD+ + GAFFVQSG+    M+K      GV+       V+ LTRF+GAL+C 
Sbjct  360   KSWNWRSEGDLMLNGAFFVQSGNAIKTMNKQ-----GVINAMPGRHVSRLTRFSGALDCV  414

Query  324   VGSPC  310
              G PC
Sbjct  415   RGRPC  419



>ref|XP_011085780.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=447

 Score =   486 bits (1252),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 266/448 (59%), Positives = 319/448 (71%), Gaps = 9/448 (2%)
 Frame = -3

Query  1641  KNNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQV  1462
             K N   +  ++ A+I+P     IAEYDEVWRRRAAEA+    QAY P+P  +       V
Sbjct  5     KLNWLLISFLAFASILPLLRADIAEYDEVWRRRAAEAYNRTVQAYHPDPLKVVMHFNKHV  64

Query  1461  RRTLSEAVAED--LTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCA  1288
              + + E+   D  +  NTT RHL   K Y+GPC  TNPID CWRC+  W  NR RLADC 
Sbjct  65    NKHVEESGGLDDVMMLNTTRRHL--GKAYKGPCKVTNPIDACWRCNPKWHLNRFRLADCG  122

Query  1287  MGFGYKTKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQEL  1111
             MGFG K  GGK G+ Y VTDKSDD   NPKPGTLRHAVIQ++PLWI F  +M IKL QEL
Sbjct  123   MGFGSKATGGKGGRIYMVTDKSDDDVLNPKPGTLRHAVIQEEPLWITFRRNMVIKLKQEL  182

Query  1110  IMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRT  931
             ++  DKTIDGRGA V I+ GAGITIQFVKNVIIH + IHHI E +GGLIRD   H GLRT
Sbjct  183   MVTSDKTIDGRGAIVQIAYGAGITIQFVKNVIIHNLKIHHIVEKDGGLIRDSASHTGLRT  242

Query  930   KsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDL  751
             +SDGDGISIFGS ++WIDHVSM  C DGLID I+ ST ITISN HFTDH+  MLFG ND 
Sbjct  243   QSDGDGISIFGSQDIWIDHVSMTRCADGLIDIIQGSTGITISNSHFTDHDHAMLFGGNDK  302

Query  750   STKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGN  571
                D+ MQIT+AFNHFGKR++QRMPRCRYG+ HVVNNDYTHW MYAIGGSSHPTII QGN
Sbjct  303   YPGDEKMQITVAFNHFGKRMVQRMPRCRYGFFHVVNNDYTHWKMYAIGGSSHPTIISQGN  362

Query  570   RFIAPPDIHKKEITKRVKGTPE-EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYD  394
             R+IA    + K++TKR    PE EWK WTW + GD+++ GA+F+ SGD ++  KH +  D
Sbjct  363   RYIADHP-YAKQVTKR--ECPESEWKHWTWVTDGDLFLRGAYFIPSGDQDWPSKHPEKSD  419

Query  393   GVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              +    A+ V+ +T+FAG L C++   C
Sbjct  420   NIKPASAKLVSQMTKFAGRLGCKLKYAC  447



>ref|XP_009408830.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=436

 Score =   484 bits (1247),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 261/429 (61%), Positives = 312/429 (73%), Gaps = 16/429 (4%)
 Frame = -3

Query  1587  TVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTG  1408
             T  HIA+YDE W+++AA A  HA  AY PNP +++           +EAV  DL +N+T 
Sbjct  21    TSAHIADYDEYWQKKAALARSHANNAYNPNPESVT--------HHFNEAVMRDLASNSTR  72

Query  1407  RHLLGSKKYR-GPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVT  1231
             R L G  +   G C ATNPIDRC+RC ++W  +RK+LA CA GFG    GGK+G FY VT
Sbjct  73    RGLRGKMRNEDGACQATNPIDRCFRCQSNWVHHRKKLATCAKGFGRHATGGKNGDFYVVT  132

Query  1230  DKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISD  1054
             D SD D  NP+ GTLRHAVIQ +PLWI+FAHDM I+L +ELI+  +KTIDGRGA V I+ 
Sbjct  133   DSSDADLVNPRNGTLRHAVIQDRPLWIVFAHDMLIRLTEELIINSNKTIDGRGANVQIAY  192

Query  1053  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  874
             GAG+TIQFV NVI+H I IH I  GNGG+IRD  +H+GLRT+SDGDGISIFG+SN+WIDH
Sbjct  193   GAGLTIQFVHNVIVHNIRIHDIKAGNGGMIRDSEEHYGLRTRSDGDGISIFGASNIWIDH  252

Query  873   VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKR  694
             VSM NC DGLIDAIE STAITISN HFT HNDVMLFGA+D  + D IMQIT+AFNHFGK 
Sbjct  253   VSMSNCMDGLIDAIEGSTAITISNSHFTQHNDVMLFGASDAFSGDAIMQITVAFNHFGKG  312

Query  693   LIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKG  514
             L+QRMPRCR+G++HVVNNDYTHW MYA+GGS HPTI+ QGNRFIAPP +  KE+TKR   
Sbjct  313   LVQRMPRCRWGFVHVVNNDYTHWMMYAVGGSQHPTILSQGNRFIAPPTLFAKEVTKREYS  372

Query  513   TPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED-VTWLTRFAGA  337
                 WK W+WRS+GD+   GAFFV+SG P       K Y  ++  K    VT LTRFAG+
Sbjct  373   PEPVWKQWSWRSEGDLMANGAFFVESGAPIT-----KPYADLIKAKPGSFVTRLTRFAGS  427

Query  336   LNCRVGSPC  310
               C    PC
Sbjct  428   RPCIPNQPC  436



>ref|XP_004490003.1| PREDICTED: probable pectate lyase 3-like isoform X1 [Cicer arietinum]
Length=450

 Score =   485 bits (1248),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 256/419 (61%), Positives = 305/419 (73%), Gaps = 10/419 (2%)
 Frame = -3

Query  1563  DEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTGRHLLGSKK  1384
             D  W+ +A  A K  ++AY P+P+ +S +L        +  ++E +     GR  L  +K
Sbjct  41    DSYWKEKAEIAAKANEEAYTPDPYAVSGNL--------TSTISEMIIGGKKGRRNLRGRK  92

Query  1383  YRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD-DQSN  1207
               GPC ATNPIDRCWRC  +WA+NRK+LADC  GFG KT GGK+G FY VTD SD D  N
Sbjct  93    TAGPCMATNPIDRCWRCDPNWANNRKKLADCVQGFGRKTTGGKAGPFYVVTDPSDSDMVN  152

Query  1206  PKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFV  1027
             P+PGTLRHAV +  PLWIIFA  MNI+L+QELIM  DKTIDGRGA + I++GAGITIQ++
Sbjct  153   PRPGTLRHAVTRNGPLWIIFARSMNIRLNQELIMTSDKTIDGRGADIVIANGAGITIQYI  212

Query  1026  KNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDG  847
             +NVIIHGI +  I  G+GGL+RD  +H+GLRT SDGDGISIFGSSN+WIDHVSMRNC DG
Sbjct  213   RNVIIHGIKVFDIVVGSGGLVRDSENHYGLRTMSDGDGISIFGSSNIWIDHVSMRNCRDG  272

Query  846   LIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCR  667
             LIDAI  STAITISN HFTDHN+VMLFGA+D    D+ MQIT+AFNHFGKRLIQRMPRCR
Sbjct  273   LIDAIMGSTAITISNSHFTDHNEVMLFGASDGYDADQKMQITVAFNHFGKRLIQRMPRCR  332

Query  666   YGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWT  487
             +G+IHVVNNDYTHW MYAIGGS HPTII +GNRFIAP + + KEITKR      EWK W 
Sbjct  333   FGFIHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIAPDNGYAKEITKREYSPESEWKNWQ  392

Query  486   WRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             WRS  D+YM GAFF Q G     ++     D +       V  LTR++G+L C VG PC
Sbjct  393   WRSINDVYMNGAFFRQGGS-ELTNRPFSKKDMITAKPGAYVGRLTRYSGSLKCIVGKPC  450



>ref|XP_010678579.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=443

 Score =   484 bits (1247),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 264/444 (59%), Positives = 316/444 (71%), Gaps = 9/444 (2%)
 Frame = -3

Query  1635  NCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQV-R  1459
             N    F++     +     +I  YD+ W++R   A  +A +AY  +PH I+    HQ  +
Sbjct  7     NLMLFFMLVSIIFLQHVEANIGNYDDHWKQREQAAKANAARAYNTDPHGIT----HQTNQ  62

Query  1458  RTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGF  1279
             R  +  +     TN   R  LG  KY GPC A NPIDRCWRC  +W+ +R++LADC +GF
Sbjct  63    RVHNMGMNRTNRTNNYARRGLG--KYEGPCQADNPIDRCWRCDDNWSKDRQKLADCVVGF  120

Query  1278  GYKTKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQ  1102
             G+KT GGK G  Y VTD SD++  +PKPGTLRHAVIQ  PLWIIF H M IKL +EL++ 
Sbjct  121   GHKTTGGKKGNIYVVTDDSDNELLDPKPGTLRHAVIQDGPLWIIFKHGMVIKLKEELLVS  180

Query  1101  GDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsd  922
              +KTIDGRG  VHI+ GAGI +QFV NVIIH +HIH I  G GG IRD + HFG RT SD
Sbjct  181   SNKTIDGRGGHVHIAGGAGIMLQFVDNVIIHNVHIHDIKTGGGGFIRDSVSHFGFRTASD  240

Query  921   gdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTK  742
             GDGISIFGS+N+WIDHVSM NC DGLIDAIEASTAIT+SN HFTDHNDVMLFGA D S++
Sbjct  241   GDGISIFGSTNIWIDHVSMSNCMDGLIDAIEASTAITVSNCHFTDHNDVMLFGARDSSSQ  300

Query  741   DKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFI  562
             D+IMQ+T+AFNHFGKRLIQRMPRCR+G+ HV+NNDYTHW MYAIGGS HPTIICQGNRFI
Sbjct  301   DEIMQVTIAFNHFGKRLIQRMPRCRFGFFHVLNNDYTHWEMYAIGGSQHPTIICQGNRFI  360

Query  561   APPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMT  382
             APP+I  KE+TKR       WK W W S+ DI M GAFF QSGD +    + K  D +  
Sbjct  361   APPNIFAKEVTKREYAPYSVWKDWLWTSEDDIMMNGAFFNQSGDTSKKPSYAK-KDMIKA  419

Query  381   FKAEDVTWLTRFAGALNCRVGSPC  310
                 +VT LTRFAGALNC+ G+ C
Sbjct  420   KPGSEVTHLTRFAGALNCKEGTAC  443



>ref|XP_007209148.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
 gb|EMJ10347.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
Length=440

 Score =   483 bits (1244),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 268/446 (60%), Positives = 321/446 (72%), Gaps = 14/446 (3%)
 Frame = -3

Query  1641  KNNCFFLFVVSVAAIIPATV-GHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQ  1465
             K N   L V  +A  IP TV  +IA++DE W++RAAEA K A +AY  +P  ++     Q
Sbjct  7     KLNVVILCVFVIAITIPTTVRANIADFDEHWQQRAAEAKKAAHEAYHDDPIAVTEHFNKQ  66

Query  1464  VRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAM  1285
             V  T   A       N T R+L  ++KY+GPC ATNPIDRCWRC  +W  NRKRLADCA+
Sbjct  67    VLDTFDYA-------NNTRRNL--NQKYKGPCMATNPIDRCWRCDPNWEKNRKRLADCAL  117

Query  1284  GFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELI  1108
             GFG K  GGK G  Y VTD +D D  NPKPGTLRHAVIQ  PLWIIFA DM IKL +EL+
Sbjct  118   GFGRKATGGKLGPIYVVTDNTDADLVNPKPGTLRHAVIQNGPLWIIFARDMRIKLTEELL  177

Query  1107  MQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTK  928
             +  DKTID RGA VHI DGA I++QFVKNVII  +HIH+   GNGG+IRD ++HFG RT+
Sbjct  178   VASDKTIDARGANVHILDGAQISLQFVKNVIITNLHIHNNKPGNGGMIRDSINHFGQRTR  237

Query  927   sdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLS  748
             SDGDGIS+FG++NVWIDHVS+ NC DGLIDAI+ STAITISN H T+HNDVMLFG++D +
Sbjct  238   SDGDGISMFGATNVWIDHVSLSNCADGLIDAIQGSTAITISNCHLTNHNDVMLFGSSDSN  297

Query  747   TKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNR  568
             ++D++MQITLAFNHFGK L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII QGNR
Sbjct  298   SQDQVMQITLAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNR  357

Query  567   FIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGV  388
             FIAP +   KE+T R      EW++W WRS+ D+ M GAFFVQSG P    ++    D +
Sbjct  358   FIAPSNQATKEVTHRNNAQEGEWRSWNWRSENDLMMNGAFFVQSGSP---IRNLPKADMI  414

Query  387   MTFKAEDVTWLTRFAGALNCRVGSPC  310
                    VT LTRFAG L C    PC
Sbjct  415   QAKPGSFVTRLTRFAGPLKCVKNKPC  440



>ref|XP_008239834.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=438

 Score =   483 bits (1243),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 268/446 (60%), Positives = 320/446 (72%), Gaps = 14/446 (3%)
 Frame = -3

Query  1641  KNNCFFLFVVSVAAIIPATV-GHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQ  1465
             K N   L V   A  IP TV  +IA++DE W++RAAEA K A +AY  +P  ++     Q
Sbjct  5     KLNVVILCVFVTAITIPTTVRANIADFDEHWQQRAAEAKKAAHEAYHDDPIAVTEHFNKQ  64

Query  1464  VRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAM  1285
             V  T   A       N T R+L  ++KY+GPC ATNPIDRCWRC  +W  NRKRLADCA+
Sbjct  65    VLDTFDYA-------NNTRRNL--NQKYKGPCMATNPIDRCWRCDPNWEKNRKRLADCAL  115

Query  1284  GFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELI  1108
             GFG K  GGK G  Y VTD +D D  NPKPGTLRHAVIQ  PLWIIFA DM IKL +EL+
Sbjct  116   GFGRKATGGKLGPIYVVTDNTDADLVNPKPGTLRHAVIQNGPLWIIFARDMRIKLTEELL  175

Query  1107  MQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTK  928
             +  DKTID RGA VHI DGA I++QFVKNVII  +HIH+   GNGGLIRD ++HFG RT+
Sbjct  176   VASDKTIDARGANVHILDGAQISLQFVKNVIITNLHIHNNKPGNGGLIRDSINHFGQRTR  235

Query  927   sdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLS  748
             SDGDGIS++G++NVWIDHVS+ NC DGLIDAI+ STAITISN H T+HNDVMLFG++D +
Sbjct  236   SDGDGISMYGATNVWIDHVSLSNCADGLIDAIQGSTAITISNCHLTNHNDVMLFGSSDSN  295

Query  747   TKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNR  568
             ++D++MQITLAFNHFGK L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII QGNR
Sbjct  296   SQDQVMQITLAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNR  355

Query  567   FIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGV  388
             FIAP +   KE+T R      EW++W WRS+ D+ M GAFFVQSG P    ++    D +
Sbjct  356   FIAPSNQATKEVTHRNNAQEGEWRSWNWRSENDLMMNGAFFVQSGSP---IRNLPKADMI  412

Query  387   MTFKAEDVTWLTRFAGALNCRVGSPC  310
                    VT LTRFAG L C    PC
Sbjct  413   QAKPGSFVTRLTRFAGPLKCIKNKPC  438



>gb|AES91206.2| pectate lyase P59-like protein [Medicago truncatula]
Length=434

 Score =   482 bits (1241),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 260/444 (59%), Positives = 317/444 (71%), Gaps = 24/444 (5%)
 Frame = -3

Query  1632  CFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRT  1453
             C F       AI+P    +I  +D+ W+ R+ +A K AQQAY+PNP  I+++L   V + 
Sbjct  12    CVFFL-----AIVPIFEANIVHFDQYWQNRSDDAKKAAQQAYKPNPQEITSNLNMHVHKA  66

Query  1452  LSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGY  1273
             LS        +N+T R L    KY+GPC+ATNPID CWRC  +W  NRK+LADC +GFG+
Sbjct  67    LS-------GSNSTRREL---AKYKGPCSATNPIDSCWRCDPNWEKNRKKLADCVLGFGH  116

Query  1272  KTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGD  1096
              T GGK+GK Y VTD SD D   PKPGTLR A IQK+PLWIIF H+MNIKL  EL++  D
Sbjct  117   GTTGGKAGKIYVVTDSSDNDLVTPKPGTLRFAAIQKEPLWIIFKHNMNIKLKAELLLTSD  176

Query  1095  KTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgd  916
             KTID RGA VHIS+GA IT+Q+VKN+IIHG+HIH   + +GG IRD +DH+G R+ SDGD
Sbjct  177   KTIDARGANVHISEGAQITLQYVKNIIIHGLHIHDTKKTSGGQIRDSMDHYGSRSASDGD  236

Query  915   gisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDK  736
              IS+FG+S+VWIDH+SM NC DGL+DA+  STAITISN H T HNDVMLFGAND  + D+
Sbjct  237   AISMFGASHVWIDHISMWNCADGLVDAVAGSTAITISNCHMTRHNDVMLFGANDGFSGDQ  296

Query  735   IMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAP  556
             I QIT+AFNHFGK LIQRMPRCR+G+ H+VNNDYTHW MYAIGGS+HPTI+ QGNRFIAP
Sbjct  297   ISQITVAFNHFGKGLIQRMPRCRWGFFHIVNNDYTHWLMYAIGGSTHPTILSQGNRFIAP  356

Query  555   PDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGD--PNFMDKHHKLYDGVMT  382
             P+ + KE+TKR       WK W+WRS+ D+ M GAFF QSG    NF     K   G  +
Sbjct  357   PNPNAKEVTKRDYAPESVWKAWSWRSENDLMMNGAFFKQSGTKAANFPKSDIKAKPG--S  414

Query  381   FKAEDVTWLTRFAGALNCRVGSPC  310
             F A     LTRF+G L C VG PC
Sbjct  415   FAAA----LTRFSGCLKCEVGKPC  434



>ref|XP_011085777.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=446

 Score =   483 bits (1242),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 267/451 (59%), Positives = 320/451 (71%), Gaps = 7/451 (2%)
 Frame = -3

Query  1656  MERFNKNNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISAS  1477
             ME    N    LF V VA+I+P    +IAEYDEVWRRRAAEA+    QAYEP+P  +   
Sbjct  1     MEGTKVNWLPILFFV-VASILPVLRANIAEYDEVWRRRAAEAYNRTLQAYEPDPLKVVMH  59

Query  1476  LIHQVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLA  1297
                 V R + E+   D+    + R  LG KKYRGPC  TNPID CWRC  +W  NR +LA
Sbjct  60    FNENVHRHIKESGGVDMMMLNSTRRRLG-KKYRGPCKVTNPIDACWRCDPNWHLNRFKLA  118

Query  1296  DCAMGFGYKTKGGKSGKFYTVTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLH  1120
             DC++GFG K  GGK G+ Y VTD SDD    PKPGTLRHAVIQ++PLWI F   M I L 
Sbjct  119   DCSLGFGRKATGGKGGRIYVVTDPSDDDILTPKPGTLRHAVIQEEPLWITFKRSMVITLA  178

Query  1119  QELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFG  940
             QELIM  DKTIDGRG +V I+ GAGIT+Q+V+N+IIH I IH+I E  GG+IRD   H G
Sbjct  179   QELIMTSDKTIDGRGVKVQIAHGAGITVQYVRNIIIHNIKIHNIVEKKGGIIRDSTTHSG  238

Query  939   LRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGA  760
             LRT+SDGDGISIFG+ ++WIDHVSM  C DGLIDAI+ STAITISNGHFTDH+  MLFGA
Sbjct  239   LRTQSDGDGISIFGAQDIWIDHVSMTRCDDGLIDAIQGSTAITISNGHFTDHDHAMLFGA  298

Query  759   NDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIIC  580
             ND    D+ MQIT+AFNHFGKR++QRMPRCRYG+ HVVNNDYTHW MYAIGGSSHPTII 
Sbjct  299   NDKYPGDEKMQITVAFNHFGKRMVQRMPRCRYGFFHVVNNDYTHWKMYAIGGSSHPTIIS  358

Query  579   QGNRFIAPPDIHKKEITKRVKGTPE-EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK  403
             QGNR+IA    + K++TKR    PE EW+ WTW + GDI++ GA+F  SGD ++  KH +
Sbjct  359   QGNRYIA-DHPYAKQVTKR--ECPESEWRHWTWVTDGDIFLNGAYFRASGDQDWHHKHPE  415

Query  402   LYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
               DG+    A  V  +T+FAG L+C+    C
Sbjct  416   KSDGIKPGPATLVAQMTQFAGRLDCKKKYAC  446



>ref|XP_009615547.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=434

 Score =   482 bits (1241),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 269/449 (60%), Positives = 328/449 (73%), Gaps = 20/449 (4%)
 Frame = -3

Query  1647  FNKNNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIH  1468
             F KNN  FLFV+ V  ++ +   HI E+DEVWR+RA +A K A+ AY PNP  ++  L +
Sbjct  3     FTKNN-LFLFVMFV--LVLSIEAHIGEFDEVWRKRAQQAKKAARHAYHPNPKIVADHLNN  59

Query  1467  QVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCA  1288
             QV + +         +N+  R L    +Y G C ATNPID+CWRC  +WA NR +LADC 
Sbjct  60    QVDKAVR-------GSNSRRRDL---HRYNGQCKATNPIDQCWRCDPNWARNRMKLADCV  109

Query  1287  MGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQEL  1111
             +GFG KT GGK GK Y VTD SD D  NPKPGTLRHAVIQ +PLWIIFA +M I+L++EL
Sbjct  110   LGFGRKTTGGKGGKSYVVTDNSDNDLVNPKPGTLRHAVIQPQPLWIIFAKNMVIRLNEEL  169

Query  1110  IMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRT  931
             IM  +KTID RG QVHI+ G G+ +QF+ NVII  + IH    GNGGLIRD ++H+G RT
Sbjct  170   IMTSNKTIDARGKQVHIAHGGGLMLQFIHNVIISNLRIHDTKAGNGGLIRDSVNHYGYRT  229

Query  930   KsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDL  751
             KSDGDGISIFGS+NVWIDHVSM NC DGLIDA+EASTAITISN HFT HN+VMLFGA+D 
Sbjct  230   KSDGDGISIFGSTNVWIDHVSMSNCQDGLIDAVEASTAITISNCHFTKHNEVMLFGASDS  289

Query  750   STKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGN  571
             S++D IMQITLAFNHFG+ L QRMPR R+G++H VNNDYTHW MYAIGGS HPTI+ QGN
Sbjct  290   SSRDSIMQITLAFNHFGQGLRQRMPRVRWGFVHAVNNDYTHWLMYAIGGSMHPTILSQGN  349

Query  570   RFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN--FMDKHHKLY  397
             RFIAPP+ + KE+TKR       WK W W+SQGD+ M GAFFV+SG+PN  F+    +  
Sbjct  350   RFIAPPNPNAKEVTKRDYAPESVWKNWVWKSQGDLMMNGAFFVESGNPNHAFL----RSP  405

Query  396   DGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             D + +     V+ LTRF+G+LNC  G PC
Sbjct  406   DMISSKPGSFVSSLTRFSGSLNCIEGKPC  434



>ref|XP_006374492.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
 gb|ERP52289.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
Length=435

 Score =   482 bits (1240),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 262/444 (59%), Positives = 324/444 (73%), Gaps = 19/444 (4%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATV-GHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRT  1453
             + L V    A+  +T+   IA +DE W++RA EA + +++AYEPNP  ++     +V ++
Sbjct  7     YMLLVFFALAMQTSTLKAGIANFDEYWKKRAEEAKEASREAYEPNPAKVTKHFNDEVHKS  66

Query  1452  LSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGY  1273
             L          N+T R+L    K +GPC ATNPIDRCWRC  +WA NRK+L  CA+GFG 
Sbjct  67    LEGG-------NSTRRNL---GKNKGPCLATNPIDRCWRCDKNWAKNRKKLGGCALGFGR  116

Query  1272  KTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGD  1096
             KT GGK GK+Y VTD SD D  NPK GTLR+ VIQ KPLWIIFAHDM I+L +EL++  +
Sbjct  117   KTIGGKHGKYYRVTDPSDNDMVNPKAGTLRYGVIQDKPLWIIFAHDMVIRLSEELMVASN  176

Query  1095  KTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgd  916
             KTIDGRG  VHI +GA IT+QFVKNVIIHGIHIH    GNGG+IRD +DH+G R++SDGD
Sbjct  177   KTIDGRGVNVHIYNGAQITLQFVKNVIIHGIHIHDAKAGNGGMIRDSVDHYGFRSRSDGD  236

Query  915   gisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDK  736
             GISIFGS+++WIDH+S+ NC DGLIDAI  S AITISN HFT HNDVMLFGA+D  + D 
Sbjct  237   GISIFGSTDIWIDHISLSNCEDGLIDAIMGSNAITISNCHFTKHNDVMLFGASDSYSGDS  296

Query  735   IMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAP  556
             +MQIT+AFNHFG+ L+QRMPR R+G++HVVNNDYTHW MYAIGGS HPTII QGNRF+AP
Sbjct  297   VMQITVAFNHFGRGLVQRMPRVRWGFVHVVNNDYTHWEMYAIGGSQHPTIISQGNRFVAP  356

Query  555   PDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDP-NFMDKHHKLYDGVMTF  379
             PD   KE+TKR       WK+W WRS+GD+ + GAFFVQSG+    M+K       V++ 
Sbjct  357   PDPACKEVTKRDYAVESVWKSWNWRSEGDLMLNGAFFVQSGNAIKTMNKQ-----AVISA  411

Query  378   K-AEDVTWLTRFAGALNCRVGSPC  310
             K    V+ LTRF+GALNC  G PC
Sbjct  412   KPGRYVSRLTRFSGALNCVRGRPC  435



>ref|XP_002306040.1| hypothetical protein POPTR_0004s12300g [Populus trichocarpa]
 gb|EEE86551.1| hypothetical protein POPTR_0004s12300g [Populus trichocarpa]
Length=432

 Score =   481 bits (1238),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 257/442 (58%), Positives = 314/442 (71%), Gaps = 18/442 (4%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTL  1450
               +FV ++A +IP+ +  I  +D+VW++RA +A K   +AY P+P   + +         
Sbjct  7     MLIFVFTLATLIPSLLADIGIFDDVWQKRAQDAKKMTLEAYVPDPEEATDAF--------  58

Query  1449  SEAVAEDLTTNTTGRHL-LGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGY  1273
                   ++  N T R+L  G KKY GPC  TNPIDRCWRC  +WA NRK+LA CA+GFG 
Sbjct  59    ------NVEVNNTRRNLRQGRKKYAGPCQVTNPIDRCWRCQRNWAKNRKQLAKCALGFGR  112

Query  1272  KTKGGKSGKFYTVTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGD  1096
             +T GG +G+ Y VTD SD+    PKPGTLRHAVIQK+PLWIIF+ +MNIKL +ELIM   
Sbjct  113   RTTGGMAGRIYVVTDSSDNNVMKPKPGTLRHAVIQKEPLWIIFSKNMNIKLSKELIMSSH  172

Query  1095  KTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgd  916
             KTIDGRG  VHIS G GITIQF+ NVIIHGI IHHI   +GG IRD +DH+G+RT SDGD
Sbjct  173   KTIDGRGHHVHISYGGGITIQFIHNVIIHGIRIHHIIATSGGNIRDSVDHYGIRTNSDGD  232

Query  915   gisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDK  736
             GISIFGS++VWIDHVSM  C DGLIDAI  STAITISN HFT HND +L GA+D  + D 
Sbjct  233   GISIFGSTDVWIDHVSMSRCTDGLIDAIMGSTAITISNCHFTHHNDAILLGASDSYSGDH  292

Query  735   IMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAP  556
             +MQ+T+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW +YAIGGS HPTII QGNRFIAP
Sbjct  293   LMQVTVAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWRLYAIGGSKHPTIISQGNRFIAP  352

Query  555   PDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFK  376
             P+ H K++TKR   T  EW  WTWRS+ D+ M GAFFVQSG P     + K    +    
Sbjct  353   PESHLKQVTKRDYATKGEWSKWTWRSENDLMMNGAFFVQSGQPRTKKPNRKFM--IKAKP  410

Query  375   AEDVTWLTRFAGALNCRVGSPC  310
                 T +TRFAGAL+C+ G  C
Sbjct  411   GAVATRMTRFAGALDCKPGRKC  432



>ref|XP_006842121.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
 gb|ERN03796.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
Length=438

 Score =   481 bits (1239),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 266/445 (60%), Positives = 318/445 (71%), Gaps = 18/445 (4%)
 Frame = -3

Query  1629  FFLFVVSVAA----IIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQV  1462
             F LFVV V A     +P    HIA++DE W+ R+A A + A +AY   PHN++  + H V
Sbjct  7     FGLFVVLVLASSSFTVPKAEAHIADFDETWQNRSAIARQVALEAYVHEPHNVTDHVNHMV  66

Query  1461  RRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMG  1282
              + L          N+T RHL    KY G C ATNPIDRCWRC  +WA +RKRLA CA+G
Sbjct  67    HKALE--------GNSTRRHL---GKYTGACMATNPIDRCWRCQRNWARDRKRLAKCALG  115

Query  1281  FGYKTKGGKSGKFYTVTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIM  1105
             FG KT GG  G+FY VTD SD+  ++PKPGTLRHAVIQ +PLWI F HDM I+L +EL++
Sbjct  116   FGRKTTGGLKGRFYVVTDASDESLTDPKPGTLRHAVIQDRPLWITFKHDMIIRLTEELLV  175

Query  1104  QGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKs  925
                KTIDGRG  VHI+ GAGITIQ+ KNVIIHG+HIH I  GNGG+IRD  +H+GLRTKS
Sbjct  176   NSHKTIDGRGTNVHIAYGAGITIQYQKNVIIHGLHIHDIKAGNGGMIRDSPEHYGLRTKS  235

Query  924   dgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLST  745
             DGD ISIF SS VWIDH SM NC DGLIDAI  STAITISN HFT+HN+V L GA+D  +
Sbjct  236   DGDAISIFASSFVWIDHNSMSNCMDGLIDAIMGSTAITISNNHFTNHNEVSLMGASDSFS  295

Query  744   KDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRF  565
              DKIMQ+T AFNHFG+ LIQRMPRCR+G+ HVVNNDYTHW MYA+GGS HPTII QGNR+
Sbjct  296   DDKIMQVTFAFNHFGRGLIQRMPRCRWGFFHVVNNDYTHWGMYAVGGSQHPTIISQGNRY  355

Query  564   IAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVM  385
             IAP   + KE+TKR   + + WK WTWRS+GD+   GAFF +SG P+  DK+ +  D + 
Sbjct  356   IAPTANYAKEVTKRDYASEDVWKQWTWRSEGDVMKNGAFFRESGPPS-TDKYTR-QDKIT  413

Query  384   TFKAEDVTWLTRFAGALNCRVGSPC  310
                   V  LTRFAGAL C+  SPC
Sbjct  414   AKPGTFVGRLTRFAGALVCKRKSPC  438



>ref|XP_006354795.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=435

 Score =   481 bits (1238),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 270/444 (61%), Positives = 325/444 (73%), Gaps = 22/444 (5%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTL  1450
             FF+ + ++   I A +G   E+DEVWR RA +A K+A+++Y P+P  ++A+L   V R+ 
Sbjct  10    FFVILCTLVFSIEANIG---EFDEVWRTRATQANKNAKESYNPHPEKVAANLNKHVHRS-  65

Query  1449  SEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYK  1270
                   +  +N+T R L    KY GPC ATNPIDRCWRC   WA NR++LADC +GFG+ 
Sbjct  66    ------EEGSNSTRRDL---HKYNGPCVATNPIDRCWRCDPHWAKNRQKLADCVLGFGHH  116

Query  1269  TKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDK  1093
             T GGK GK Y VTD  D D  NPKPGTLRHAVIQ  PLWIIFAH M IKL+QELIM GDK
Sbjct  117   TTGGKGGKIYIVTDPGDNDMVNPKPGTLRHAVIQPGPLWIIFAHHMVIKLNQELIMTGDK  176

Query  1092  TIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdg  913
             TID RG QVHI+ GA + +Q++ NVIIHG+HIH I  GNGGLIRD ++H+G RT+SDGDG
Sbjct  177   TIDARGQQVHITGGASLMLQYINNVIIHGLHIHDIKSGNGGLIRDSINHYGFRTRSDGDG  236

Query  912   isifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKI  733
             ISIFGS+N+WIDHVSM NC DGLIDA++ASTAITISN HFT HNDVMLFGA+D   +D I
Sbjct  237   ISIFGSTNIWIDHVSMSNCDDGLIDAVQASTAITISNCHFTHHNDVMLFGASDSYKQDAI  296

Query  732   MQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP  553
             +QITLAFNHFG+ LIQRMPR R+G++H VNNDYTHW MYAIGGS HPTI+ QGNRFIAPP
Sbjct  297   LQITLAFNHFGQGLIQRMPRVRWGFVHAVNNDYTHWIMYAIGGSQHPTILSQGNRFIAPP  356

Query  552   DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDG---VMT  382
             + + KE+TKR       WK W WRSQGD+ M GAFFV+SG+ N     HK   G   +  
Sbjct  357   NPNAKEVTKRDYSPESVWKNWVWRSQGDLMMNGAFFVESGNRN-----HKFMTGPDMIHP  411

Query  381   FKAEDVTWLTRFAGALNCRVGSPC  310
                 D   LTRF+G+LNC  G PC
Sbjct  412   RAGSDAGRLTRFSGSLNCIEGKPC  435



>gb|KHN08855.1| Putative pectate lyase P59 [Glycine soja]
Length=435

 Score =   479 bits (1232),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 259/441 (59%), Positives = 311/441 (71%), Gaps = 14/441 (3%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTL  1450
                F V   AI P    +I  +D VW RR  EA + A+QAY+PNP  ++A     V R +
Sbjct  8     LLFFYVICLAIFPTLNANIGHFDHVWHRRLKEAREAAKQAYKPNPMKVTAEFNTHVIRAM  67

Query  1449  SEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYK  1270
                      +N + R L  S +Y GPC ATNPID+CWRC  +W  NRKRLADCA+GFG+ 
Sbjct  68    R-------GSNNSRRGL--SNQYDGPCKATNPIDKCWRCDPNWEKNRKRLADCALGFGHG  118

Query  1269  TKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDK  1093
             T GGK GK Y V D SD D  NPKPGTLRHA IQ++PLWIIF  +MNIKLH EL++  +K
Sbjct  119   TTGGKDGKIYVVNDSSDNDLVNPKPGTLRHAAIQREPLWIIFDRNMNIKLHAELMLTDNK  178

Query  1092  TIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdg  913
             TID RGA VHIS+GA IT+Q+VKN+IIHG+HIH I + +GGLIRD +DH+G+R  SDGD 
Sbjct  179   TIDARGANVHISEGAQITLQYVKNIIIHGLHIHDIKKCSGGLIRDSMDHYGVRAMSDGDA  238

Query  912   isifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKI  733
             IS+FGS+ VWIDHVS  NC DGLID + ASTA+TISN H T HNDV+LFGA+D  + DKI
Sbjct  239   ISVFGSTYVWIDHVSFTNCDDGLIDVVSASTAVTISNCHLTKHNDVLLFGASDSYSGDKI  298

Query  732   MQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP  553
             MQ+TLAFNHFGK LIQRMPRCR+G+ H+VNNDYTHW MYAIGGS  PTII QGNRFIAP 
Sbjct  299   MQVTLAFNHFGKGLIQRMPRCRWGFFHIVNNDYTHWLMYAIGGSQQPTIISQGNRFIAPN  358

Query  552   DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKA  373
             D + KE+TKR       WK W WRS+GD+ M GAFFVQSG    + K+ K    ++    
Sbjct  359   DRNAKEVTKRDYAPESVWKNWNWRSEGDLLMNGAFFVQSGKN--VAKNPKAE--IIAKPG  414

Query  372   EDVTWLTRFAGALNCRVGSPC  310
             + V+ LTRFAG L C V   C
Sbjct  415   KAVSSLTRFAGPLKCEVNKSC  435



>ref|XP_009360393.1| PREDICTED: probable pectate lyase 3 [Pyrus x bretschneideri]
Length=452

 Score =   479 bits (1234),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 258/425 (61%), Positives = 301/425 (71%), Gaps = 14/425 (3%)
 Frame = -3

Query  1575  IAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLT-TNTTGRHL  1399
             + + D  W+ RA EA K A ++Y  NP         Q        VAE L+  NTT R+L
Sbjct  39    VLDLDAYWKERAQEALKEAMESYHKNPE--------QAAEEFHTGVAELLSKENTTRRNL  90

Query  1398  LGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD  1219
              G+K Y GPC ATNPID CWRC A+WA+NRK++  CA GFG K  GGK G  Y VT  +D
Sbjct  91    RGNKGYNGPCMATNPIDACWRCDANWANNRKKIVGCAQGFGKKATGGKDGPIYVVTVGTD  150

Query  1218  -DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGI  1042
              D  NPKPGTLRHAVIQK PLWIIFA  M I+L QEL++  DKTIDGRGA V I +G GI
Sbjct  151   NDVQNPKPGTLRHAVIQKGPLWIIFARSMVIRLEQELMVTSDKTIDGRGANVVIEEGGGI  210

Query  1041  TIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMR  862
             T+QFVKNVII  +HI  I    GG+IRD +DH GLRTKSDGDGIS+FG+SNVWIDHVSM 
Sbjct  211   TLQFVKNVIITNLHIKMIVSKPGGMIRDSVDHMGLRTKSDGDGISLFGASNVWIDHVSMS  270

Query  861   NCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQR  682
              C DGLIDA+ ASTAITISN HFTDH+DVMLFGAN+  T+DKIMQITLAFNHFG+ L+QR
Sbjct  271   RCADGLIDAVMASTAITISNSHFTDHDDVMLFGANNAHTQDKIMQITLAFNHFGQGLVQR  330

Query  681   MPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEE  502
             MPR R+G+ HVVNNDYTHW MYAIGG+ +PTII QGNRFIAP +   K++T R      E
Sbjct  331   MPRVRHGFFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIAPANAATKQVTHREHTPESE  390

Query  501   WKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED-VTWLTRFAGALNCR  325
             WK W WRS+GD+ M GAFFV+SG        H     +M F+     T LT+F+GALNC 
Sbjct  391   WKNWEWRSEGDLMMNGAFFVESGSG---ASQHPAKLDMMPFQPGTFATKLTKFSGALNCV  447

Query  324   VGSPC  310
             VG PC
Sbjct  448   VGKPC  452



>ref|XP_004147462.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
 ref|XP_004163529.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
Length=431

 Score =   478 bits (1231),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 254/439 (58%), Positives = 318/439 (72%), Gaps = 9/439 (2%)
 Frame = -3

Query  1623  LFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSE  1444
             + +VS+A ++P     IAE+D+   +++ EA + + +A+ P+P N++      V   L E
Sbjct  1     MVLVSMAVLMPTLRAGIAEFDDFLLQKSEEAKQASLEAFHPDPMNVTDHFNQHVHLAL-E  59

Query  1443  AVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTK  1264
              +     +N+T R L    KY GPC ATNPIDRCWRC  +WA NRK+LA C +GFG KT 
Sbjct  60    GIEG---SNSTRRSL---SKYNGPCLATNPIDRCWRCDPNWAKNRKKLAKCVLGFGRKTT  113

Query  1263  GGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTI  1087
             GGK G+ Y VTD SD D  NP+PGTLR+  +QKKPLWIIFA  M I+L +EL++   KTI
Sbjct  114   GGKKGRIYVVTDPSDNDVINPRPGTLRYGALQKKPLWIIFARSMIIRLSKELMITSHKTI  173

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             D RGA VHI+ GAG++IQF +NVIIHG+ IHH+    GG+IRD  +H GLRT SDGDGIS
Sbjct  174   DARGANVHIAYGAGLSIQFARNVIIHGLRIHHVISTGGGMIRDTANHVGLRTVSDGDGIS  233

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             IFGS+N+W+DH+SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D    D IMQ
Sbjct  234   IFGSTNIWLDHLSMSNCQDGLIDAIQGSTAITISNSHFTHHNDVMLFGASDSYQGDSIMQ  293

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             +T+AFNHFGK L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII QGNRFIAPP+ 
Sbjct  294   VTVAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPPNP  353

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED  367
               ++IT R   T   WKTWTWRS+GD+ M GA+FVQSG+P+   + +  +D +       
Sbjct  354   AARQITNRNYATESVWKTWTWRSEGDLMMNGAYFVQSGNPS-KRRPYSRFDMIKAKPGTF  412

Query  366   VTWLTRFAGALNCRVGSPC  310
             V  LTRF+G+LNC VG PC
Sbjct  413   VRRLTRFSGSLNCYVGRPC  431



>gb|KGN59593.1| hypothetical protein Csa_3G827350 [Cucumis sativus]
Length=441

 Score =   478 bits (1230),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 254/439 (58%), Positives = 318/439 (72%), Gaps = 9/439 (2%)
 Frame = -3

Query  1623  LFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSE  1444
             + +VS+A ++P     IAE+D+   +++ EA + + +A+ P+P N++      V   L E
Sbjct  11    MVLVSMAVLMPTLRAGIAEFDDFLLQKSEEAKQASLEAFHPDPMNVTDHFNQHVHLAL-E  69

Query  1443  AVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTK  1264
              +     +N+T R L    KY GPC ATNPIDRCWRC  +WA NRK+LA C +GFG KT 
Sbjct  70    GIEG---SNSTRRSL---SKYNGPCLATNPIDRCWRCDPNWAKNRKKLAKCVLGFGRKTT  123

Query  1263  GGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTI  1087
             GGK G+ Y VTD SD D  NP+PGTLR+  +QKKPLWIIFA  M I+L +EL++   KTI
Sbjct  124   GGKKGRIYVVTDPSDNDVINPRPGTLRYGALQKKPLWIIFARSMIIRLSKELMITSHKTI  183

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             D RGA VHI+ GAG++IQF +NVIIHG+ IHH+    GG+IRD  +H GLRT SDGDGIS
Sbjct  184   DARGANVHIAYGAGLSIQFARNVIIHGLRIHHVISTGGGMIRDTANHVGLRTVSDGDGIS  243

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             IFGS+N+W+DH+SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D    D IMQ
Sbjct  244   IFGSTNIWLDHLSMSNCQDGLIDAIQGSTAITISNSHFTHHNDVMLFGASDSYQGDSIMQ  303

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             +T+AFNHFGK L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII QGNRFIAPP+ 
Sbjct  304   VTVAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPPNP  363

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED  367
               ++IT R   T   WKTWTWRS+GD+ M GA+FVQSG+P+   + +  +D +       
Sbjct  364   AARQITNRNYATESVWKTWTWRSEGDLMMNGAYFVQSGNPS-KRRPYSRFDMIKAKPGTF  422

Query  366   VTWLTRFAGALNCRVGSPC  310
             V  LTRF+G+LNC VG PC
Sbjct  423   VRRLTRFSGSLNCYVGRPC  441



>ref|XP_011009454.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=474

 Score =   479 bits (1234),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 263/471 (56%), Positives = 321/471 (68%), Gaps = 32/471 (7%)
 Frame = -3

Query  1632  CFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRR-  1456
                +FV ++A +IP+ +  +  +D+VWR+RA EA K   +AY P+P   + +   +V + 
Sbjct  6     AMLIFVFTLATLIPSLLADLGIFDDVWRKRAEEAKKMTLEAYVPDPEEATDAFNVEVNKY  65

Query  1455  -------TLSEAVAEDLTT--------------------NTTGRHL-LGSKKYRGPCNAT  1360
                    +L  A      T                    N+T R+L  G KKY GPC  T
Sbjct  66    SLAKNSSSLYGAFGSTNITNLDLDDIDDNDNDADFEQFANSTRRNLRQGRKKYAGPCQVT  125

Query  1359  NPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSDDQ-SNPKPGTLRH  1183
             NPIDRCWRC  +WA NRK+LA CA+GFG +T GG +G+ Y VTD SD+    PKPGTLRH
Sbjct  126   NPIDRCWRCQRNWAKNRKQLAKCALGFGRRTTGGMAGRIYVVTDSSDNNVMKPKPGTLRH  185

Query  1182  AVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgi  1003
             AVIQK+PLWIIF+ +MNIKL +ELIM   KTIDGRG  VHIS GAGITIQF+ NVIIHGI
Sbjct  186   AVIQKEPLWIIFSKNMNIKLSKELIMSSHKTIDGRGHHVHISYGAGITIQFIHNVIIHGI  245

Query  1002  hihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEAS  823
              IHHI   +GG IRD +DH+G+RT SDGDGISIFGS++VWIDHVSM  C DGLIDAI  S
Sbjct  246   RIHHIIATSGGNIRDSVDHYGIRTNSDGDGISIFGSTDVWIDHVSMSRCTDGLIDAIMGS  305

Query  822   TAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVN  643
             TAITISN HFT HND +L GA+D  + D +MQ+T+AFNHFG+ L+QRMPRCR+G+ HVVN
Sbjct  306   TAITISNCHFTHHNDAILLGASDSYSGDHLMQVTVAFNHFGQGLVQRMPRCRWGFFHVVN  365

Query  642   NDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIY  463
             NDYTHW +YAIGGS HPTII QGNRFIAPP+ H K++TKR   T  EW  WTWRS+ D+ 
Sbjct  366   NDYTHWRLYAIGGSKHPTIISQGNRFIAPPESHLKQVTKRDYATKGEWSKWTWRSENDLM  425

Query  462   MEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             M GAFFVQSG P     + K    +        T +TRFAGAL+C+ G  C
Sbjct  426   MNGAFFVQSGQPRTKKPNRKFM--IKAKPGAVATRMTRFAGALDCKPGREC  474



>ref|XP_004302354.1| PREDICTED: probable pectate lyase P59-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score =   478 bits (1230),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 271/449 (60%), Positives = 320/449 (71%), Gaps = 18/449 (4%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATV-------GHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLI  1471
               LF+ S   I+P          G IA +D V + R   A   A +AY+P+P +++  LI
Sbjct  8     LVLFMCSFCVILPCLKAGADSDDGTIAVFDPVLQEREKRAEIAALKAYQPDPESVTDELI  67

Query  1470  HQVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADC  1291
               V  ++         +NTT RHL  +KK +  C ATNPIDRCWRC+ DWA NRK+LA+C
Sbjct  68    KDVETSIER-------SNTTRRHL--AKKIKAECTATNPIDRCWRCNPDWAKNRKQLANC  118

Query  1290  AMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQE  1114
              +GFG +T+GGK G  Y V D SD D +NPKPGTLRHAVIQ  PLWIIF H M IKL++E
Sbjct  119   VLGFGRRTRGGKRGPIYVVHDSSDNDMANPKPGTLRHAVIQTGPLWIIFKHSMTIKLNKE  178

Query  1113  LIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLR  934
             LIM   KTIDGRGA VHI+ GAGITIQFV+NVIIHGIHIH I    GGLIRD LDH GLR
Sbjct  179   LIMTSHKTIDGRGANVHIAHGAGITIQFVENVIIHGIHIHDIVSVGGGLIRDSLDHIGLR  238

Query  933   TKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGAND  754
              +SDGDGI++FGSS++W+DH+SM NCYDGL D ++ STAITISN HFT HNDVMLFGAND
Sbjct  239   GQSDGDGITVFGSSHIWLDHLSMWNCYDGLTDVVQGSTAITISNCHFTRHNDVMLFGAND  298

Query  753   LSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQG  574
             L  +D+IMQIT+AFNHFGK LIQRMPRCR+G+ HVVNNDYTHW MYAIGGSSHPTII QG
Sbjct  299   LYERDQIMQITVAFNHFGKGLIQRMPRCRFGFFHVVNNDYTHWQMYAIGGSSHPTIISQG  358

Query  573   NRFIAPPDIHKKEITKRVKGTPEE-WKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLY  397
             NR++APPD   KEIT R   TPE  WKTW WRS+GD+   GA+F +SG+P     H   +
Sbjct  359   NRYVAPPDPKLKEITSRAYSTPEAVWKTWQWRSEGDLMENGAYFRESGEPRKGRGHFSRF  418

Query  396   DGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             D +       V  LTRFAG L CRVG  C
Sbjct  419   DVINAKPGSFVRRLTRFAGTLGCRVGKAC  447



>ref|XP_008443432.1| PREDICTED: probable pectate lyase 19 [Cucumis melo]
Length=441

 Score =   477 bits (1228),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 253/441 (57%), Positives = 318/441 (72%), Gaps = 9/441 (2%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTL  1450
               + +VS+A ++P     IAE+D+   ++A EA + + +A+ P+P N++      V   L
Sbjct  9     LLMVLVSMAVLMPTLRAGIAEFDDYLLQKAEEAKQASLEAFHPDPMNVTDHFNQHVHLAL  68

Query  1449  SEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYK  1270
              E +     +N+T R L    KY+GPC ATNPIDRCWRC  +WA NRK+LA C +GFG K
Sbjct  69    -EGIEG---SNSTRRSL---AKYKGPCLATNPIDRCWRCDPNWAKNRKKLAKCVLGFGRK  121

Query  1269  TKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDK  1093
             T GGK G+ Y VTD SD D  NPKPGTLR+  +QK+PLWIIFA  M I+L +EL++   K
Sbjct  122   TTGGKKGRIYVVTDPSDNDVVNPKPGTLRYGALQKRPLWIIFARSMIIRLSKELMVTSHK  181

Query  1092  TIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdg  913
             TID RG+ VHI+ GAG++IQF +NVIIHG+ IHH+    GG+IRD  +H GLRT SDGDG
Sbjct  182   TIDARGSNVHIAYGAGLSIQFARNVIIHGLRIHHVISTGGGMIRDTANHVGLRTVSDGDG  241

Query  912   isifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKI  733
             ISIFGSSN+W+DH+SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D    D I
Sbjct  242   ISIFGSSNIWLDHLSMSNCQDGLIDAIQGSTAITISNSHFTHHNDVMLFGASDSYQGDSI  301

Query  732   MQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP  553
             MQ+T+AFNHFGK L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII QGNRFIAPP
Sbjct  302   MQVTVAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPP  361

Query  552   DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKA  373
             +   ++IT R       WKTWTWRS+GD+ M GA+F+QSG+P+   + +  +D +     
Sbjct  362   NPAARQITNRNYAPESVWKTWTWRSEGDLMMNGAYFIQSGNPS-KRRPYSRFDMIKAKPG  420

Query  372   EDVTWLTRFAGALNCRVGSPC  310
               V  LTRF+G+LNC VG PC
Sbjct  421   TFVRRLTRFSGSLNCFVGRPC  441



>ref|XP_004155392.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=432

 Score =   476 bits (1226),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 263/423 (62%), Positives = 318/423 (75%), Gaps = 12/423 (3%)
 Frame = -3

Query  1575  IAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTGRHLL  1396
             I ++D+ W+ RAA A K A  AY+P+P  ++ S+  ++    S         N+T R+L 
Sbjct  21    IGDFDDYWKARAAAAEKAAADAYDPDPETVANSVNAEIAHASS-------GRNSTRRNL-  72

Query  1395  GSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD-  1219
               KKY GPC ATNPIDRCWRC  +WA NRK+LADC +GFG KT GGK G +Y V D SD 
Sbjct  73    --KKYAGPCLATNPIDRCWRCDPNWAQNRKKLADCVLGFGRKTTGGKLGPYYVVNDSSDS  130

Query  1218  DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGIT  1039
             D  NPKPGTLRHAVIQK PLWIIF+ +M I+L QELIM  DKTID RGA V I+ GAGIT
Sbjct  131   DLMNPKPGTLRHAVIQKGPLWIIFSXNMAIRLSQELIMTSDKTIDARGANVQIAYGAGIT  190

Query  1038  IQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRN  859
             +Q+++NVIIHG+ IHHI  G+GG+IRD +DH GLRT SDGDGISIFGSSNVWIDHVSM N
Sbjct  191   LQYIRNVIIHGLRIHHIVVGSGGMIRDAVDHVGLRTMSDGDGISIFGSSNVWIDHVSMSN  250

Query  858   CYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRM  679
             C+DGLIDAI  STAITISN HFT HN+VMLFGA+D  ++D+IMQIT+AFNHFG+ L+QRM
Sbjct  251   CHDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDGYSQDQIMQITVAFNHFGQGLVQRM  310

Query  678   PRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEEW  499
             PRCR+G+ HVVNNDYTHW MYAIGGS HPTI+ QGNRFIAPP+++ KE+TKR     + W
Sbjct  311   PRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNVYAKEVTKREYSPEQVW  370

Query  498   KTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVG  319
             K+WTWRS+GD+ M GAFFV SGD +      ++ D +       V  +TRFAG+L C VG
Sbjct  371   KSWTWRSEGDLMMNGAFFVTSGDQSKRRPFSRM-DMISYKPGTYVKRMTRFAGSLACFVG  429

Query  318   SPC  310
              PC
Sbjct  430   RPC  432



>ref|XP_004135462.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
 gb|KGN51889.1| hypothetical protein Csa_5G604340 [Cucumis sativus]
Length=432

 Score =   476 bits (1225),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 263/423 (62%), Positives = 318/423 (75%), Gaps = 12/423 (3%)
 Frame = -3

Query  1575  IAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTGRHLL  1396
             I ++D+ W+ RAA A K A  AY+P+P  ++ S+  ++    S         N+T R+L 
Sbjct  21    IGDFDDYWKARAAAAEKAAADAYDPDPETVANSVNAEIAHASS-------GRNSTRRNL-  72

Query  1395  GSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD-  1219
               KKY GPC ATNPIDRCWRC  +WA NRK+LADC +GFG KT GGK G +Y V D SD 
Sbjct  73    --KKYAGPCLATNPIDRCWRCDPNWAQNRKKLADCVLGFGRKTTGGKLGPYYVVNDSSDS  130

Query  1218  DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGIT  1039
             D  NPKPGTLRHAVIQK PLWIIF+ +M I+L QELIM  DKTID RGA V I+ GAGIT
Sbjct  131   DLMNPKPGTLRHAVIQKGPLWIIFSTNMAIRLSQELIMTSDKTIDARGANVQIAYGAGIT  190

Query  1038  IQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRN  859
             +Q+++NVIIHG+ IHHI  G+GG+IRD +DH GLRT SDGDGISIFGSSNVWIDHVSM N
Sbjct  191   LQYIRNVIIHGLRIHHIVVGSGGMIRDAVDHVGLRTMSDGDGISIFGSSNVWIDHVSMSN  250

Query  858   CYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRM  679
             C+DGLIDAI  STAITISN HFT HN+VMLFGA+D  ++D+IMQIT+AFNHFG+ L+QRM
Sbjct  251   CHDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDGYSQDQIMQITVAFNHFGQGLVQRM  310

Query  678   PRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEEW  499
             PRCR+G+ HVVNNDYTHW MYAIGGS HPTI+ QGNRFIAPP+++ KE+TKR     + W
Sbjct  311   PRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNVYAKEVTKREYSPEQVW  370

Query  498   KTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVG  319
             K+WTWRS+GD+ M GAFFV SGD +      ++ D +       V  +TRFAG+L C VG
Sbjct  371   KSWTWRSEGDLMMNGAFFVTSGDQSKRRPFSRM-DMISYKPGTYVKRMTRFAGSLACFVG  429

Query  318   SPC  310
              PC
Sbjct  430   RPC  432



>ref|XP_008339935.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score =   476 bits (1225),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 256/431 (59%), Positives = 307/431 (71%), Gaps = 12/431 (3%)
 Frame = -3

Query  1596  IPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTN  1417
             +P     + + D  W+ RA EA K A ++Y  NP  ++     +V + +S+        N
Sbjct  32    VPNEDTLVLDLDAYWKERAEEAEKVAMESYNKNPEKVTEEFNTEVGKLMSKE-------N  84

Query  1416  TTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYT  1237
             TT R+L G+K Y GPC ATNP+D CWRC  +WA+NRK++  CA GFG KT GGK G FY 
Sbjct  85    TTRRNLRGNKAYTGPCMATNPMDACWRCDPNWANNRKKIVGCAQGFGKKTTGGKDGPFYV  144

Query  1236  VTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHI  1060
             VT  +DD   NPKPGTLRHAVIQK PLWIIF   M I+L QEL++  DKTID RGA V I
Sbjct  145   VTMGTDDDVQNPKPGTLRHAVIQKGPLWIIFTKSMVIRLQQELMVTSDKTIDARGANVVI  204

Query  1059  SDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWI  880
              +GAGIT+QFVKNVII  +HI  I    GGLIRD +DH GLRT+SDGDGIS+FG+SNVWI
Sbjct  205   EEGAGITLQFVKNVIITNLHIKMIVTKPGGLIRDSVDHIGLRTQSDGDGISLFGASNVWI  264

Query  879   DHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFG  700
             DHVSM  C DGLIDAI  STAITISN HFTDH++ MLFGAN+  T+DKIMQITLAFNHFG
Sbjct  265   DHVSMSRCADGLIDAIMGSTAITISNSHFTDHDEAMLFGANNAHTQDKIMQITLAFNHFG  324

Query  699   KRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRV  520
             + L+QRMPR R+G+ HVVNNDYTHW MYAIGG+ +PTII QGNRFIAP +   K++T R 
Sbjct  325   QGLVQRMPRVRHGFFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIAPINGVTKQVTHR-  383

Query  519   KGTPE-EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFA  343
             + TPE EWK W WRS+GD+ M GAFFV+SG  +   KH    D +       V  LT+F+
Sbjct  384   ENTPEAEWKNWEWRSEGDLMMNGAFFVESG--SGASKHPAKLDXMPFKPGTXVXTLTKFS  441

Query  342   GALNCRVGSPC  310
             GALNC VG PC
Sbjct  442   GALNCAVGKPC  452



>ref|XP_008446316.1| PREDICTED: probable pectate lyase P59 [Cucumis melo]
Length=432

 Score =   475 bits (1222),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 268/423 (63%), Positives = 317/423 (75%), Gaps = 12/423 (3%)
 Frame = -3

Query  1575  IAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTGRHLL  1396
             I ++D+ W+ RAAEA + A  AYEPNP  I+ SL  +V + LS        +N+T R+L 
Sbjct  21    IGDFDDYWKARAAEAEQAAADAYEPNPETIADSLNAEVGQALSG-------SNSTRRNL-  72

Query  1395  GSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD-  1219
               KKY GPC ATNPIDRCWRC  +WA NRK+LADC +GFG KT GGK G +Y V D SD 
Sbjct  73    --KKYTGPCRATNPIDRCWRCDPNWAQNRKKLADCVLGFGRKTIGGKLGPYYVVNDSSDS  130

Query  1218  DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGIT  1039
             D  NPKPGTLRHAVIQK PLWI F+ +M I+L QELI+  DKTID RGA V I+ GAGIT
Sbjct  131   DLMNPKPGTLRHAVIQKGPLWITFSTNMAIRLTQELIVTSDKTIDARGANVQIAYGAGIT  190

Query  1038  IQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRN  859
             +Q+V+NVIIHG+ IHHI  GNGG+IRD +DH GLRT SDGDGISIFGSSNVWIDHVSM N
Sbjct  191   LQYVRNVIIHGLRIHHIVVGNGGMIRDAVDHVGLRTMSDGDGISIFGSSNVWIDHVSMSN  250

Query  858   CYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRM  679
             C DGLIDAI  STAITISN HFT HN+VMLFGA+D  + D+IMQ+T+AFNHFG+ L+QRM
Sbjct  251   CQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDGYSNDQIMQVTVAFNHFGQGLVQRM  310

Query  678   PRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEEW  499
             PRCR+G+ HVVNNDYTHW MYAIGGS HPTI+ QGNRFIAPP+++ KE+TKR     + W
Sbjct  311   PRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNVYAKEVTKREYSPEQVW  370

Query  498   KTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVG  319
             K+WTWRS+GD+ M GAFFV SGD     +     D +       V  +TRF+GAL C VG
Sbjct  371   KSWTWRSEGDLMMNGAFFVTSGDQR-KRRPFSSKDMISYKPGTYVKRMTRFSGALACFVG  429

Query  318   SPC  310
              PC
Sbjct  430   RPC  432



>ref|XP_008365507.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=396

 Score =   474 bits (1219),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 250/383 (65%), Positives = 292/383 (76%), Gaps = 2/383 (1%)
 Frame = -3

Query  1455  TLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFG  1276
              + E + +D +   + R  L  K+Y+GPC ATNPIDRCWRC A+WA+NRK+LA C  GFG
Sbjct  15    VVEEDLEDDQSAGNSTRRNLRGKQYKGPCKATNPIDRCWRCRANWANNRKKLASCVKGFG  74

Query  1275  YKTKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQG  1099
              KT+GGK G +Y VTD SDD   +PKPGTLRHAVIQ +PLWIIFA  M I+L QELI+  
Sbjct  75    RKTRGGKKGAYYIVTDSSDDNVHDPKPGTLRHAVIQTQPLWIIFARSMVIRLSQELIVTS  134

Query  1098  DKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdg  919
              KTID RGA VHI+ GAGIT+QFV+NVIIHG+ IH    G+GG+IRD L H G+RT+SDG
Sbjct  135   HKTIDARGANVHIAHGAGITLQFVQNVIIHGLRIHDTVPGSGGMIRDSLSHIGIRTQSDG  194

Query  918   dgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKD  739
             DGISI+GSSN+W+DH+SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D    D
Sbjct  195   DGISIYGSSNIWLDHLSMWNCADGLIDAIQGSTAITISNCHFTHHNDVMLFGASDAFAGD  254

Query  738   KIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIA  559
              IMQIT+AFNHFGK LIQRMPRCR+G++HVVNNDYTHW MYAIGGSSHPTII QGNRFIA
Sbjct  255   AIMQITVAFNHFGKGLIQRMPRCRWGFVHVVNNDYTHWIMYAIGGSSHPTIISQGNRFIA  314

Query  558   PPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTF  379
             PP+   KE+TKR       WK+W WRS+GD+ M GAFFVQSG PN      KL D +   
Sbjct  315   PPNQAAKEVTKRDYAPESVWKSWQWRSEGDLMMNGAFFVQSGVPNKKHGFGKL-DMIKAK  373

Query  378   KAEDVTWLTRFAGALNCRVGSPC  310
                 V  LTRFAG+LNC+VG  C
Sbjct  374   PGTFVRRLTRFAGSLNCKVGKKC  396



>ref|XP_008446067.1| PREDICTED: pectate lyase-like, partial [Cucumis melo]
Length=381

 Score =   473 bits (1216),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 252/387 (65%), Positives = 298/387 (77%), Gaps = 14/387 (4%)
 Frame = -3

Query  1467  QVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCA  1288
             QV R+L  A       N T RHL   +KY GPC ATNPIDRCWRC  +WA NRK+LADCA
Sbjct  8     QVHRSLDGA-------NNTRRHL---RKYTGPCLATNPIDRCWRCDRNWARNRKKLADCA  57

Query  1287  MGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQEL  1111
             +GFG  T GGK GK Y V D SD D  NPKPGTLRHAVIQ++PLWIIFAHDM I+L +EL
Sbjct  58    LGFGRGTTGGKDGKIYVVRDSSDNDLVNPKPGTLRHAVIQERPLWIIFAHDMVIRLSEEL  117

Query  1110  IMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRT  931
             IM  +KT+DGRGA VHI++G  IT+QFV+N+IIH +HIH I  GNGG IRD + H+G RT
Sbjct  118   IMTDNKTLDGRGANVHIANGGQITLQFVRNIIIHNLHIHDIKAGNGGFIRDSVSHYGYRT  177

Query  930   KsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDL  751
             +SDGDGIS+FGSS VWIDHVSM NC DGLIDA+ ASTAITISN HFT HNDV+L GA+D 
Sbjct  178   QSDGDGISMFGSSRVWIDHVSMSNCQDGLIDAVMASTAITISNCHFTHHNDVILLGASDS  237

Query  750   STKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGN  571
              + DKIMQ+TLAFNHFGK L+QRMPRCR+G+IHVVNNDYTHW MYAIGGS +PTII QGN
Sbjct  238   YSNDKIMQVTLAFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSHNPTIISQGN  297

Query  570   RFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDG  391
             RFIAPP+ + KE+TKRV  +  EW++W WRS+GD+ M GAFF+QSG+P    + +   D 
Sbjct  298   RFIAPPNPNSKEVTKRVYASEREWRSWNWRSEGDLMMNGAFFIQSGNP---IRRYSKKDV  354

Query  390   VMTFKAEDVTWLTRFAGALNCRVGSPC  310
             + +     VT LTRFAG L C++  PC
Sbjct  355   IHSKPGTFVTRLTRFAGPLKCKMNQPC  381



>ref|XP_008456459.1| PREDICTED: pectate lyase-like [Cucumis melo]
Length=434

 Score =   474 bits (1221),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 261/440 (59%), Positives = 313/440 (71%), Gaps = 14/440 (3%)
 Frame = -3

Query  1623  LFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSE  1444
             LFV S+   + A      + DE W  RA EA K A+ A+ PNP  ++ +L   V R +  
Sbjct  7     LFVCSLLFFVVANAN--VDEDEYWNTRATEAKKVAKSAFNPNPEIVTDNLNAAVSRAM--  62

Query  1443  AVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTK  1264
                  +  N+T R L   KKYRGPC ATNPIDRCWRC  +WA NRK+LA+C +GFG++T 
Sbjct  63    -----VGRNSTRRSL---KKYRGPCLATNPIDRCWRCDRNWAKNRKKLAECPLGFGHQTI  114

Query  1263  GGKSGKFYTVTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTI  1087
             GGK G  Y VTD SDD   NPKPGTLR+ VIQK PLWIIF   M I+L QEL++  DKTI
Sbjct  115   GGKRGPIYVVTDASDDDLVNPKPGTLRYGVIQKGPLWIIFGRSMIIRLSQELMISSDKTI  174

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             D RGA VHI+ GAG+TIQFV NVIIH +HIH I   +GG+IRD +DH+G RT+SDGDGIS
Sbjct  175   DARGANVHIAFGAGLTIQFVNNVIIHNLHIHDIISKSGGMIRDSVDHYGFRTQSDGDGIS  234

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             IFGSS+VWIDHVSM NC DGLIDAI  STAITISN HFT HN+VMLFGA+D   +D+IMQ
Sbjct  235   IFGSSHVWIDHVSMSNCEDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDSYAEDEIMQ  294

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             +TLAFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTI+ QGNRFIAPP+ 
Sbjct  295   VTLAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNP  354

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED  367
             + K++TKR     +EWK W+WRS+GD  M GA F+ SGD     K       +++FK   
Sbjct  355   NAKQVTKREYAMEDEWKHWSWRSEGDELMNGAVFIPSGDQTKGKKKGLSRYDMISFKPGT  414

Query  366   -VTWLTRFAGALNCRVGSPC  310
              V  L RF+G L C  G PC
Sbjct  415   YVRRLARFSGTLECTPGKPC  434



>ref|XP_006573090.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=448

 Score =   474 bits (1221),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 263/453 (58%), Positives = 308/453 (68%), Gaps = 25/453 (6%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAE-------------YDEVWRRRAAEAWKHAQQAYEPNPHNI  1486
             F  +  +  +IP    ++ E              D  W+ RA+ A K  QQAY  +P+++
Sbjct  7     FYLLTCLVVMIPTLYANVKEDEAYWKRQSEVLLVDSYWQERASIAEKENQQAYTSDPYSL  66

Query  1485  SASLIHQVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRK  1306
             + +L   V    SE +  + +           +   G C ATNPIDRCWRC  +WA+NRK
Sbjct  67    TKNLTFSV----SEIIIGEKSGRRN------LRGRGGKCMATNPIDRCWRCDPNWANNRK  116

Query  1305  RLADCAMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNI  1129
             +LADC  GFG  T GGK+G FY V    D D  NP PGTLRHAV +  PLWIIFA  MNI
Sbjct  117   KLADCVQGFGRNTIGGKNGPFYVVNSSLDNDMVNPAPGTLRHAVTRSGPLWIIFARSMNI  176

Query  1128  KLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLD  949
             +L QELIM  DKTIDGRG  V+I++GAGITIQF+KNVIIHGI I +I  GNGGLIRD   
Sbjct  177   RLSQELIMTSDKTIDGRGVDVYIANGAGITIQFIKNVIIHGIKIFNIQVGNGGLIRDSET  236

Query  948   HFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVML  769
             H+G RT SDGDGISIFGSSNVWIDHVSMRNC DGLIDAI+ STAITISNGHFTDHN+VML
Sbjct  237   HYGFRTYSDGDGISIFGSSNVWIDHVSMRNCKDGLIDAIQGSTAITISNGHFTDHNEVML  296

Query  768   FGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPT  589
             FGA+D    DKIMQITLAFNHFGKRL+QRMPRCRYG++HVVNNDYTHW MYAIGGS HPT
Sbjct  297   FGASDSYDGDKIMQITLAFNHFGKRLVQRMPRCRYGFVHVVNNDYTHWEMYAIGGSKHPT  356

Query  588   IICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKH  409
             II +GNRFIAP +++ KEITKR     +EWK W WRS  D YM GAFF + G     D+ 
Sbjct  357   IISEGNRFIAPNNVYAKEITKREYSPEQEWKNWQWRSINDEYMNGAFF-REGGSQITDRP  415

Query  408   HKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
                 D +       V  LTR+AG+L C VG PC
Sbjct  416   FSRQDMITAKPGSYVGRLTRYAGSLRCIVGKPC  448



>ref|XP_003609009.1| Pectate lyase [Medicago truncatula]
Length=445

 Score =   474 bits (1221),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 260/455 (57%), Positives = 317/455 (70%), Gaps = 35/455 (8%)
 Frame = -3

Query  1632  CFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRT  1453
             C F       AI+P    +I  +D+ W+ R+ +A K AQQAY+PNP  I+++L   V + 
Sbjct  12    CVFFL-----AIVPIFEANIVHFDQYWQNRSDDAKKAAQQAYKPNPQEITSNLNMHVHKA  66

Query  1452  LSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGY  1273
             LS        +N+T R L    KY+GPC+ATNPID CWRC  +W  NRK+LADC +GFG+
Sbjct  67    LS-------GSNSTRREL---AKYKGPCSATNPIDSCWRCDPNWEKNRKKLADCVLGFGH  116

Query  1272  KTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGD  1096
              T GGK+GK Y VTD SD D   PKPGTLR A IQK+PLWIIF H+MNIKL  EL++  D
Sbjct  117   GTTGGKAGKIYVVTDSSDNDLVTPKPGTLRFAAIQKEPLWIIFKHNMNIKLKAELLLTSD  176

Query  1095  KTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgd  916
             KTID RGA VHIS+GA IT+Q+VKN+IIHG+HIH   + +GG IRD +DH+G R+ SDGD
Sbjct  177   KTIDARGANVHISEGAQITLQYVKNIIIHGLHIHDTKKTSGGQIRDSMDHYGSRSASDGD  236

Query  915   gisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDV-----------ML  769
              IS+FG+S+VWIDH+SM NC DGL+DA+  STAITISN H T HNDV           ML
Sbjct  237   AISMFGASHVWIDHISMWNCADGLVDAVAGSTAITISNCHMTRHNDVINNISSTYSFVML  296

Query  768   FGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPT  589
             FGAND  + D+I QIT+AFNHFGK LIQRMPRCR+G+ H+VNNDYTHW MYAIGGS+HPT
Sbjct  297   FGANDGFSGDQISQITVAFNHFGKGLIQRMPRCRWGFFHIVNNDYTHWLMYAIGGSTHPT  356

Query  588   IICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGD--PNFMD  415
             I+ QGNRFIAPP+ + KE+TKR       WK W+WRS+ D+ M GAFF QSG    NF  
Sbjct  357   ILSQGNRFIAPPNPNAKEVTKRDYAPESVWKAWSWRSENDLMMNGAFFKQSGTKAANFPK  416

Query  414   KHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
                K   G  +F A     LTRF+G L C VG PC
Sbjct  417   SDIKAKPG--SFAAA----LTRFSGCLKCEVGKPC  445



>ref|XP_009761969.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=434

 Score =   473 bits (1218),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 269/450 (60%), Positives = 326/450 (72%), Gaps = 20/450 (4%)
 Frame = -3

Query  1650  RFNKNNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLI  1471
              F KNN F   +V +   I A   HI E+DEVWR+RA +A K A+ AY PNP  ++  L 
Sbjct  2     EFTKNNLFLFVMVVLVLSIEA---HIGEFDEVWRKRAEKAKKAARHAYHPNPKIVADHLN  58

Query  1470  HQVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADC  1291
             +QV + +         +N+  R L    +Y G C ATNPID+CWRC  +WA NR +LADC
Sbjct  59    NQVDKAVR-------GSNSRRRDL---HRYNGQCKATNPIDQCWRCDPNWARNRMKLADC  108

Query  1290  AMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQE  1114
              +GFG KT GGK GK Y VTD SD D  NPKPGTLRHAVIQ +PLWIIFA +M I+L++E
Sbjct  109   VLGFGRKTTGGKGGKIYVVTDNSDSDLVNPKPGTLRHAVIQPQPLWIIFAKNMVIRLNEE  168

Query  1113  LIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLR  934
             LIM  +KTID RG QVHI+ G G+ +QF+ NVII  + IH    GNGGLIRD +DH+G R
Sbjct  169   LIMTSNKTIDARGKQVHIAHGGGLMLQFIHNVIISNLRIHDTKAGNGGLIRDSVDHYGYR  228

Query  933   TKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGAND  754
             TKSDGDGISIFGS+NVWIDHVSM NC DGLIDA+EASTAITISN HFT HN+VMLFGA+D
Sbjct  229   TKSDGDGISIFGSTNVWIDHVSMSNCQDGLIDAVEASTAITISNSHFTKHNEVMLFGASD  288

Query  753   LSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQG  574
              S++D IMQITLAFNHFG+ L+QRMPR R+G++H VNNDYTHW MYAIGGS HPTI+ QG
Sbjct  289   SSSRDSIMQITLAFNHFGQGLMQRMPRVRWGFVHAVNNDYTHWLMYAIGGSMHPTILSQG  348

Query  573   NRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN--FMDKHHKL  400
             NRFIAPP+ + KE+TKR       WK W W+SQGD+ M GAFFV+SG+PN  F+    + 
Sbjct  349   NRFIAPPNPNAKEVTKRDYAPESVWKNWVWKSQGDLMMNGAFFVESGNPNHAFL----RS  404

Query  399   YDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              D + +     V+ LTRF+G+LNC  G PC
Sbjct  405   PDMISSKPGSFVSSLTRFSGSLNCIEGKPC  434



>ref|XP_011087217.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=436

 Score =   473 bits (1217),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 254/443 (57%), Positives = 315/443 (71%), Gaps = 18/443 (4%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
              +F++S+  +     G+I  +D VW+ R   A K A+QAY+PNP         +V   L+
Sbjct  8     LVFLISLFVVFTTVAGNIGVHDAVWQERREAAKKAARQAYQPNPG--------EVLDHLN  59

Query  1446  EAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKT  1267
             E V + +  +   R   G  KY+G C ATNPID+CWRC  +WA+NRK+L DCA+GFG  T
Sbjct  60    ENVHKSVEGSNNQRR--GLSKYKGSCLATNPIDQCWRCQPNWANNRKKLVDCALGFGRHT  117

Query  1266  KGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKT  1090
              GGK+GK Y VTD SD D  +PK GTLRHAVIQ +PLWIIF ++MNI+L +ELIM  +KT
Sbjct  118   TGGKAGKMYVVTDPSDSDLVSPKKGTLRHAVIQPEPLWIIFKNNMNIRLSEELIMTSNKT  177

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             IDGRGAQVHI++GAGIT+Q++ NVIIH I +H I  GNGG+IRD   H+G RT+SDGDGI
Sbjct  178   IDGRGAQVHIANGAGITLQYIHNVIIHNIRVHDIKTGNGGMIRDSATHYGFRTRSDGDGI  237

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             S+FGS+N+WIDHVS+  C DGLIDAIEASTAITISN HF  HNDV+LFGA+D  ++D IM
Sbjct  238   SLFGSTNIWIDHVSLSRCDDGLIDAIEASTAITISNCHFAHHNDVLLFGASDSRSEDHIM  297

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             QIT+AFNHFGK LIQRMPR R+G++H+VNNDYT W MYAIGGS  PTI+ QGNRF+AP +
Sbjct  298   QITVAFNHFGKGLIQRMPRVRWGFVHIVNNDYTRWQMYAIGGSQQPTILSQGNRFVAPDN  357

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDG---VMTF  379
                KE+TKR   T   WK W W+S+GD+   GAFFVQSGD      HHK   G   V   
Sbjct  358   PFAKEVTKRDYATESVWKNWVWKSEGDVMNNGAFFVQSGDV----AHHKFAKGPDMVTPK  413

Query  378   KAEDVTWLTRFAGALNCRVGSPC  310
                  + L++FAG LNC  G PC
Sbjct  414   PGGFASKLSQFAGPLNCIPGKPC  436



>ref|XP_009788285.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=434

 Score =   473 bits (1217),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 264/441 (60%), Positives = 324/441 (73%), Gaps = 18/441 (4%)
 Frame = -3

Query  1623  LFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSE  1444
             +F VSV  ++ +   +I+E+DEVW+ RA +A K AQ +Y P+P  ++ +L   V  +   
Sbjct  9     IFFVSVTLVL-SIEANISEFDEVWQTRATQAKKTAQDSYNPHPETVADNLNKHVHTS---  64

Query  1443  AVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTK  1264
                 +  +N+T R L    KY GPC +TNPIDRCWRC  +WA  R +LADC +GFG+ T 
Sbjct  65    ----EEGSNSTRRDL---HKYNGPCMSTNPIDRCWRCDPNWAKTRMKLADCVLGFGHHTT  117

Query  1263  GGKSGKFYTVTDKSDD-QSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTI  1087
             GGK GK Y VTD SDD   NPKPGTLRHAVIQ +PLWIIF H M I+L+QELIM  +KTI
Sbjct  118   GGKGGKIYVVTDPSDDDMVNPKPGTLRHAVIQPEPLWIIFKHHMVIRLNQELIMTSNKTI  177

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             D RG QVHI+ GA   +QF+ NVIIHG+HIH I  GNGGLIRD ++H+G R++SDGDGIS
Sbjct  178   DARGQQVHIAFGASFMLQFINNVIIHGLHIHDIKAGNGGLIRDSINHYGFRSRSDGDGIS  237

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             IFGS+N+WIDHVSM NC DGLIDA++ASTAITISN HFT+HNDVMLFGA+D  ++D I+Q
Sbjct  238   IFGSTNIWIDHVSMSNCDDGLIDAVQASTAITISNCHFTNHNDVMLFGASDSYSEDSILQ  297

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             ITLAFNHFG+ LIQRMPR R+G++H VNNDYTHW MYAIGGS HPTI+ QGNRFIAPP+ 
Sbjct  298   ITLAFNHFGQGLIQRMPRVRWGFVHAVNNDYTHWLMYAIGGSQHPTILSQGNRFIAPPNP  357

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN--FMDKHHKLYDGVMTFKA  373
             + KE+TKR       WK W WRSQGD+ M GAFFV+SG+PN  FM    K  D +     
Sbjct  358   NAKEVTKREYSPESVWKNWVWRSQGDLMMNGAFFVESGNPNHIFM----KGPDMIHPRPG  413

Query  372   EDVTWLTRFAGALNCRVGSPC  310
                + LTRF+G+LNC  G PC
Sbjct  414   SYASRLTRFSGSLNCIEGKPC  434



>ref|XP_003519771.2| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=447

 Score =   473 bits (1217),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 258/452 (57%), Positives = 312/452 (69%), Gaps = 24/452 (5%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAE------------YDEVWRRRAAEAWKHAQQAYEPNPHNIS  1483
             F  +  +  IIP    ++ E             D  W+++A+ A K  +QAY  +P++++
Sbjct  7     FFLLTCLIVIIPTLHANVKEDEIYWKRQSQILNDSYWKQKASVAEKENKQAYTSDPYSLT  66

Query  1482  ASLIHQVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKR  1303
                     + L+ +V+E +     GR  L  K   G C ATNPIDRCWRC  +WA+NRK+
Sbjct  67    --------KNLTYSVSEIIVGEQNGRRNLKGKG--GNCMATNPIDRCWRCDPNWANNRKK  116

Query  1302  LADCAMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIK  1126
             LA+C  GFG  T GGK+G FY VT   D D  NP PGTLRHAV +  PLWIIFAH M I+
Sbjct  117   LANCVQGFGRNTVGGKNGPFYVVTSNLDNDMVNPVPGTLRHAVTRTGPLWIIFAHSMKIR  176

Query  1125  LHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDH  946
             L+QELIM  DKTIDGRG  V+++ GAGITIQF+KNVIIHG+ I  I  GNGGLI D  +H
Sbjct  177   LNQELIMASDKTIDGRGVDVYLAGGAGITIQFIKNVIIHGVKIFDIQVGNGGLIIDSENH  236

Query  945   FGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLF  766
             +GLRT SDGDGISIFGSSN+WIDHVSMR C DGLIDAI+ STAITISN HFTDHN+VMLF
Sbjct  237   YGLRTMSDGDGISIFGSSNIWIDHVSMRKCKDGLIDAIQGSTAITISNSHFTDHNEVMLF  296

Query  765   GANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTI  586
             GA+D    D IMQITLAFNHFGKRL+QRMPRCRYG++HVVNNDYTHW MYAIGGS HPTI
Sbjct  297   GASDSYDGDTIMQITLAFNHFGKRLVQRMPRCRYGFVHVVNNDYTHWEMYAIGGSKHPTI  356

Query  585   ICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHH  406
             I +GNRFIAP +I+ KEITKR     +EWK+W WRS  D Y+ G FF + G     D+ +
Sbjct  357   ISEGNRFIAPDNINAKEITKREYSPEQEWKSWQWRSINDEYLNGGFF-REGGAQLTDRPY  415

Query  405   KLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
               +D +       V  LTR+AG+L C VG PC
Sbjct  416   SRHDMMTARPGSYVGRLTRYAGSLKCMVGKPC  447



>gb|KHN08706.1| Putative pectate lyase 3 [Glycine soja]
Length=444

 Score =   473 bits (1217),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 258/452 (57%), Positives = 312/452 (69%), Gaps = 24/452 (5%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAE------------YDEVWRRRAAEAWKHAQQAYEPNPHNIS  1483
             F  +  +  IIP    ++ E             D  W+++A+ A K  +QAY  +P++++
Sbjct  4     FFLLTCLIVIIPTLHANVKEDEIYWKRQSQILNDSYWKQKASVAEKENKQAYTSDPYSLT  63

Query  1482  ASLIHQVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKR  1303
                     + L+ +V+E +     GR  L  K   G C ATNPIDRCWRC  +WA+NRK+
Sbjct  64    --------KNLTYSVSEIIVGEQNGRRNLKGKG--GNCMATNPIDRCWRCDPNWANNRKK  113

Query  1302  LADCAMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIK  1126
             LA+C  GFG  T GGK+G FY VT   D D  NP PGTLRHAV +  PLWIIFAH M I+
Sbjct  114   LANCVQGFGRNTVGGKNGPFYVVTSNLDNDMVNPVPGTLRHAVTRTGPLWIIFAHSMKIR  173

Query  1125  LHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDH  946
             L+QELIM  DKTIDGRG  V+++ GAGITIQF+KNVIIHG+ I  I  GNGGLI D  +H
Sbjct  174   LNQELIMASDKTIDGRGVDVYLAGGAGITIQFIKNVIIHGVKIFDIQVGNGGLIIDSENH  233

Query  945   FGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLF  766
             +GLRT SDGDGISIFGSSN+WIDHVSMR C DGLIDAI+ STAITISN HFTDHN+VMLF
Sbjct  234   YGLRTMSDGDGISIFGSSNIWIDHVSMRKCKDGLIDAIQGSTAITISNSHFTDHNEVMLF  293

Query  765   GANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTI  586
             GA+D    D IMQITLAFNHFGKRL+QRMPRCRYG++HVVNNDYTHW MYAIGGS HPTI
Sbjct  294   GASDSYDGDTIMQITLAFNHFGKRLVQRMPRCRYGFVHVVNNDYTHWEMYAIGGSKHPTI  353

Query  585   ICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHH  406
             I +GNRFIAP +I+ KEITKR     +EWK+W WRS  D Y+ G FF + G     D+ +
Sbjct  354   ISEGNRFIAPDNINAKEITKREYSPEQEWKSWQWRSINDEYLNGGFF-REGGAQLTDRPY  412

Query  405   KLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
               +D +       V  LTR+AG+L C VG PC
Sbjct  413   SRHDMMTARPGSYVGRLTRYAGSLKCMVGKPC  444



>ref|XP_009598230.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=434

 Score =   472 bits (1215),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 265/447 (59%), Positives = 325/447 (73%), Gaps = 20/447 (4%)
 Frame = -3

Query  1641  KNNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQV  1462
             KN   F  +V++   I A   +I+E+DEVW+ RA +A K AQ +Y P+P  ++ +L   V
Sbjct  5     KNRLIFFVLVTLVLSIEA---NISEFDEVWQTRATQAKKTAQDSYNPHPETVADNLNKHV  61

Query  1461  RRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMG  1282
              +        +  +N+T R L    KY GPC +TNPIDRCWRC  +W  NR +LADC +G
Sbjct  62    HKW-------EEGSNSTRRDL---HKYDGPCMSTNPIDRCWRCDPNWVKNRMKLADCVLG  111

Query  1281  FGYKTKGGKSGKFYTVTDKSDD-QSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIM  1105
             FG+ T GGK GK Y VTD SDD   NPKPGTLRHAVIQ +PLWIIF H M I+L+QELIM
Sbjct  112   FGHHTTGGKGGKIYVVTDPSDDDMVNPKPGTLRHAVIQPEPLWIIFKHHMVIRLNQELIM  171

Query  1104  QGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKs  925
               +KTID RG +VHI+ GA   +QF+ NVIIHG+HIH I  GNGGLIRD ++H+G R++S
Sbjct  172   TSNKTIDARGQKVHIAFGASFMLQFINNVIIHGLHIHDIKAGNGGLIRDSINHYGFRSRS  231

Query  924   dgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLST  745
             DGDGISIFGS+N+WIDHVSM NC DGLIDA++ASTAITISN HFT+HNDVMLFGA+D  +
Sbjct  232   DGDGISIFGSTNIWIDHVSMSNCDDGLIDAVQASTAITISNSHFTNHNDVMLFGASDSYS  291

Query  744   KDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRF  565
             +D I+QITLAFNHFG+ LIQRMPR R+G++H VNNDYTHW MYAIGGS HPTI+ QGNRF
Sbjct  292   EDSILQITLAFNHFGQGLIQRMPRVRWGFVHAVNNDYTHWLMYAIGGSQHPTILSQGNRF  351

Query  564   IAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN--FMDKHHKLYDG  391
             IAPP+ + KE+TKR       WK W WRSQGD+ M GAFFV+SG+PN  FM    K  D 
Sbjct  352   IAPPNPNAKEVTKREYSPESVWKNWVWRSQGDLMMNGAFFVESGNPNHIFM----KGPDM  407

Query  390   VMTFKAEDVTWLTRFAGALNCRVGSPC  310
             +        + LTRF+G+LNC  G PC
Sbjct  408   IHPRPGSYASRLTRFSGSLNCIEGKPC  434



>gb|KHG07401.1| putative pectate lyase P59 [Gossypium arboreum]
Length=442

 Score =   473 bits (1216),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 255/446 (57%), Positives = 313/446 (70%), Gaps = 10/446 (2%)
 Frame = -3

Query  1644  NKNNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQ  1465
             N++    L+ + +  IIP+   HIAEYD+ WR R  +A ++ ++AY PNP  ++      
Sbjct  6     NRSFSLILYFLCLGVIIPSLEAHIAEYDDYWRERELQAKENLEKAYNPNPEEVTQHFNDH  65

Query  1464  VRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAM  1285
             V R L         TN+T R L   K+  GPC ATNPID+CWRC  +W  NRK+LADCA+
Sbjct  66    VARILM-----GFRTNSTRRML--KKRKGGPCEATNPIDQCWRCDRNWEKNRKKLADCAL  118

Query  1284  GFGYKTKGGKSGKFYTVTDKSDDQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIM  1105
             GFG  T GGK G  Y VTD +DD  NP  GTLRHAVIQ +PLWI FA  M I+L +EL+M
Sbjct  119   GFGRGTTGGKDGPIYVVTDPTDDVLNPSRGTLRHAVIQNRPLWITFARGMIIRLKEELLM  178

Query  1104  QGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKs  925
               +KTIDGRGA VHI+ GAGITIQF KNVIIH IHIH+IF   GG I+DG +H GLRT+S
Sbjct  179   TSNKTIDGRGANVHIAYGAGITIQFAKNVIIHNIHIHNIFPSKGGKIKDGENHLGLRTRS  238

Query  924   dgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLST  745
             DGDGIS+FG++NVW+DH+S+  C DG+IDAI+ STAITISN HFTDHNDVMLFGA+D  +
Sbjct  239   DGDGISLFGATNVWLDHLSVYKCSDGIIDAIQGSTAITISNCHFTDHNDVMLFGASDSYS  298

Query  744   KDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRF  565
              D+ MQIT+AF HFGK L+QRMPR R+G++HVVNNDY HW M AIGGSSHPTII  GNRF
Sbjct  299   ADEKMQITVAFTHFGKNLVQRMPRVRFGFVHVVNNDYRHWIMSAIGGSSHPTIISHGNRF  358

Query  564   IAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVM  385
              AP +I  KE+ KR   T +EWK W WRS+GD+ + GA F QSGDP    K     D ++
Sbjct  359   RAPRNIAAKEVCKREYATEQEWKNWDWRSEGDLMLNGAIFTQSGDPRAAKKFGG--DKMI  416

Query  384   TFK-AEDVTWLTRFAGALNCRVGSPC  310
              +K A  V  L R++G L CR   PC
Sbjct  417   AYKPAHMVPLLVRWSGTLECRPNKPC  442



>gb|KHN01171.1| Putative pectate lyase 3 [Glycine soja]
Length=433

 Score =   472 bits (1215),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 258/419 (62%), Positives = 297/419 (71%), Gaps = 12/419 (3%)
 Frame = -3

Query  1563  DEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTGRHLLGSKK  1384
             D  W+ RA+ A K  QQAY  +P++++ +L   V   +   + E              + 
Sbjct  26    DSYWQERASIAEKENQQAYTSDPYSLTKNLTFSVSEII---IGEKNGRRNL-------RG  75

Query  1383  YRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD-DQSN  1207
               G C ATNPIDRCWRC  +WA+NRK+LADC  GFG  T GGK+G FY V    D D  N
Sbjct  76    RGGKCMATNPIDRCWRCDPNWANNRKKLADCVQGFGRNTIGGKNGPFYVVNSSLDNDMVN  135

Query  1206  PKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFV  1027
             P PGTLRHAV +  PLWIIFA  MNI+L QELIM  DKTIDGRG  V+I++GAGITIQF+
Sbjct  136   PAPGTLRHAVTRSGPLWIIFARSMNIRLSQELIMTSDKTIDGRGVDVYIANGAGITIQFI  195

Query  1026  KNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDG  847
             KNVIIHGI I +I  GNGGLIRD   H+G RT SDGDGISIFGSSNVWIDHVSMRNC DG
Sbjct  196   KNVIIHGIKIFNIQVGNGGLIRDSETHYGFRTYSDGDGISIFGSSNVWIDHVSMRNCKDG  255

Query  846   LIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCR  667
             LIDAI+ STAITISNGHFTDHN+VMLFGA+D    DKIMQITLAFNHFGKRL+QRMPRCR
Sbjct  256   LIDAIQGSTAITISNGHFTDHNEVMLFGASDSYDGDKIMQITLAFNHFGKRLVQRMPRCR  315

Query  666   YGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWT  487
             YG++HVVNNDYTHW MYAIGGS HPTII +GNRFIAP +++ KEITKR     +EWK W 
Sbjct  316   YGFVHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIAPNNVYAKEITKREYSPEQEWKNWQ  375

Query  486   WRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             WRS  D YM GAFF + G     D+     D +       V  LTR+AG+L C VG PC
Sbjct  376   WRSINDEYMNGAFF-REGGSQITDRPFSRQDMITAKPGSYVGRLTRYAGSLRCIVGKPC  433



>ref|XP_008221660.1| PREDICTED: probable pectate lyase 3 [Prunus mume]
Length=443

 Score =   472 bits (1214),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 266/423 (63%), Positives = 304/423 (72%), Gaps = 12/423 (3%)
 Frame = -3

Query  1572  AEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTGRHLLG  1393
              + D  W++RA EA K A Q+++ +P  ++      V   L       +  N T R+L G
Sbjct  31    VQLDAYWKQRAEEAEKVAMQSFQTDPELVTEEFNSNVGELL-------MKLNGTRRNLRG  83

Query  1392  SKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD-D  1216
              KKY GPC ATNPID CWRC  +WA NRKRLA+C  GFG KT GGK G  Y VTD SD D
Sbjct  84    VKKYNGPCMATNPIDACWRCDKNWAKNRKRLANCVQGFGRKTTGGKGGPIYVVTDPSDLD  143

Query  1215  QSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITI  1036
               NPKPGTLRHAVIQK PLWIIFA  M I+L QELI+  DKTIDGRGA V+I DGAGIT+
Sbjct  144   LVNPKPGTLRHAVIQKGPLWIIFARSMVIRLQQELIVTSDKTIDGRGANVNIHDGAGITL  203

Query  1035  QFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNC  856
             QFVKNVII  +HI  I    GG+IRD +DH G RT+SDGDGISIFGSSNVWIDHVSM NC
Sbjct  204   QFVKNVIITNLHIKRIVPKGGGMIRDSVDHLGQRTRSDGDGISIFGSSNVWIDHVSMENC  263

Query  855   YDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMP  676
              DGLIDAI  STAITISN HFT HNDVMLFGA++  T+DKIMQIT+AFNHFG+ L+QRMP
Sbjct  264   ADGLIDAIMGSTAITISNSHFTHHNDVMLFGASNSYTQDKIMQITVAFNHFGQGLVQRMP  323

Query  675   RCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEEWK  496
             RCR+G+ HVVNNDYTHW MYAIGGS +PTII QGNRFIAPP+   KE+TKR      EWK
Sbjct  324   RCRHGFFHVVNNDYTHWLMYAIGGSMNPTIISQGNRFIAPPNQGAKEVTKRDHTPEAEWK  383

Query  495   TWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED-VTWLTRFAGALNCRVG  319
              W WRS+GD+ M GA FVQSG       +H     +M FK    V  LT+FAGAL+C VG
Sbjct  384   KWEWRSEGDLMMNGAIFVQSGSGK---SNHPAKMDLMPFKPGTYVAELTKFAGALDCFVG  440

Query  318   SPC  310
              PC
Sbjct  441   KPC  443



>ref|XP_008389523.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 3 [Malus 
domestica]
Length=452

 Score =   472 bits (1215),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 254/430 (59%), Positives = 303/430 (70%), Gaps = 24/430 (6%)
 Frame = -3

Query  1575  IAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLT-TNTTGRHL  1399
             + + D  W+ RA EA K A ++Y  NP         QV    +  VAE L+  NTT R+L
Sbjct  39    VLDLDAYWKERAQEALKEAMESYHKNPE--------QVTEEFNTGVAELLSKENTTRRNL  90

Query  1398  LGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD  1219
              G+K Y GPC ATNPID CWRC  +WA NRK++  CA GFG K  GGK G  Y VT  +D
Sbjct  91    RGNKGYNGPCMATNPIDACWRCDPNWADNRKKIVGCAQGFGKKATGGKDGPIYVVTVGTD  150

Query  1218  DQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGI  1042
             D   NPKPGTLRHAVIQK PLWIIFA  M I+L QEL++  DKTIDGRGA V I +G GI
Sbjct  151   DDVQNPKPGTLRHAVIQKGPLWIIFARSMVIRLQQELMVTSDKTIDGRGANVVIEEGGGI  210

Query  1041  TIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMR  862
             T+QFVKNVI+  +HI  I    GG+IRD +DH GLRTKSDGDGIS+FG+SNVWIDH+SM 
Sbjct  211   TLQFVKNVILTNLHIKMIVSKTGGMIRDSVDHMGLRTKSDGDGISLFGASNVWIDHMSMS  270

Query  861   NCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQR  682
              C DGLIDA+ ASTAITISN HFTDH+DVMLFGAN+  T+DKIMQITLAFNHFG+ L+QR
Sbjct  271   RCADGLIDAVMASTAITISNSHFTDHDDVMLFGANNAHTQDKIMQITLAFNHFGRGLVQR  330

Query  681   MPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEE  502
             MPR R+G+ H+VNNDY HW MYAIGG+ +PTII QGNRFIAP +   K++T R      E
Sbjct  331   MPRVRHGFFHLVNNDYNHWIMYAIGGNMNPTIISQGNRFIAPVNEATKQVTHREHTPESE  390

Query  501   WKTWTWRSQGDIYMEGAFFVQSG-----DPNFMDKHHKLYDGVMTFKAED-VTWLTRFAG  340
             WK W WRS+GD+ M GAFFV+SG     +P  +D        +M F+     T LT+F+G
Sbjct  391   WKNWEWRSEGDLMMNGAFFVESGSRASQNPAKLD--------MMPFQPGTFATKLTKFSG  442

Query  339   ALNCRVGSPC  310
             AL+C VG PC
Sbjct  443   ALSCVVGKPC  452



>ref|XP_004162547.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
Length=435

 Score =   471 bits (1212),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 260/440 (59%), Positives = 311/440 (71%), Gaps = 13/440 (3%)
 Frame = -3

Query  1623  LFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSE  1444
             LFV S+   + A      + DE W  RA EA K AQ A+  NP  ++ +L   V RT+  
Sbjct  7     LFVCSLLFFVVANAN--VDEDEYWETRATEAKKVAQGAFNANPEIVTDTLNAAVSRTM--  62

Query  1443  AVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTK  1264
                  L  N+T R L   KKYRGPC ATNPIDRCWRC  +WA NR++LA+C +GFG++T 
Sbjct  63    -----LGHNSTRRSL--RKKYRGPCLATNPIDRCWRCDRNWAKNRRKLAECPLGFGHQTI  115

Query  1263  GGKSGKFYTVTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTI  1087
             GGK G  Y VTD SDD   NPKPGTLRH VIQK PLWIIF   M I+L QEL++   KTI
Sbjct  116   GGKRGPIYVVTDASDDDLVNPKPGTLRHGVIQKGPLWIIFGRSMVIRLSQELMISSHKTI  175

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             D RGA VHI+ GAG+TIQFV NVIIH +HIH I   +GG+IRD +DH+G RT+SDGDGIS
Sbjct  176   DARGANVHIAFGAGLTIQFVNNVIIHNLHIHDIVSKSGGMIRDSVDHYGFRTQSDGDGIS  235

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             IFGSS+VWIDHVSM NC DGLIDAI  STAITISN HFT HN+VMLFGA+D   +D+IMQ
Sbjct  236   IFGSSHVWIDHVSMSNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDSYAEDEIMQ  295

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             +TLAFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTI+ QGNRFIAPP+ 
Sbjct  296   VTLAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNP  355

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFK-AE  370
             + K++TKR     +EWK W+WRS+GD  M GA F+ SGD     K       +++FK   
Sbjct  356   NAKQVTKREYAMEDEWKHWSWRSEGDELMNGAVFIASGDQTKGKKKGLSRYDMISFKPGT  415

Query  369   DVTWLTRFAGALNCRVGSPC  310
              V  L R +G + C  G PC
Sbjct  416   YVRRLVRLSGTIECTPGKPC  435



>ref|XP_004146792.1| PREDICTED: probable pectate lyase P59-like, partial [Cucumis 
sativus]
Length=442

 Score =   471 bits (1212),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 261/440 (59%), Positives = 312/440 (71%), Gaps = 13/440 (3%)
 Frame = -3

Query  1623  LFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSE  1444
             LFV S+   + A      + DE W+ RA EA K AQ A+  NP  ++ +L   V RT+  
Sbjct  14    LFVCSLLFFVVANAN--VDEDEYWQTRATEAKKVAQGAFNANPEIVTDTLNAAVSRTM--  69

Query  1443  AVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTK  1264
                  L  N+T R L   KKYRGPC ATNPIDRCWRC  +WA NR++LA+C +GFG++T 
Sbjct  70    -----LGHNSTRRSL--RKKYRGPCLATNPIDRCWRCDRNWAKNRRKLAECPLGFGHQTI  122

Query  1263  GGKSGKFYTVTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTI  1087
             GGK G  Y VTD SDD   NPKPGTLRH VIQK PLWIIF   M I+L QEL++   KTI
Sbjct  123   GGKRGPIYVVTDASDDDLVNPKPGTLRHGVIQKGPLWIIFGRSMVIRLSQELMISSHKTI  182

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             D RGA VHI+ GAG+TIQFV NVIIH +HIH I   +GG+IRD +DH+G RT+SDGDGIS
Sbjct  183   DARGANVHIAFGAGLTIQFVNNVIIHNLHIHDIVSKSGGMIRDSVDHYGFRTQSDGDGIS  242

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             IFGSS+VWIDHVSM NC DGLIDAI  STAITISN HFT HN+VMLFGA+D   +D+IMQ
Sbjct  243   IFGSSHVWIDHVSMSNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDSYAEDEIMQ  302

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             +TLAFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTI+ QGNRFIAPP+ 
Sbjct  303   VTLAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNP  362

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED  367
             + K+ITKR     +EWK W+WRS+GD  M GA F+ SGD     K       +++FK   
Sbjct  363   NAKQITKREYAMEDEWKHWSWRSEGDELMNGAVFIASGDQTKGKKKGLSRYDMISFKPGT  422

Query  366   -VTWLTRFAGALNCRVGSPC  310
              V  L R +G + C  G PC
Sbjct  423   YVRRLVRLSGTIECTPGKPC  442



>ref|XP_010550068.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=469

 Score =   472 bits (1214),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 259/464 (56%), Positives = 323/464 (70%), Gaps = 28/464 (6%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNI----------SAS  1477
              + VV +A++IPA   +IAE DE W++R+ EA KH+  AY  +P  I          +++
Sbjct  9     LICVVCIASLIPAIRSNIAELDEYWQQRSEEAEKHSLAAYHSDPFEIVDHFHERHYDNST  68

Query  1476  LIHQVRRTLSEAVAEDLTTNTTGR-------------HLLGSKKYRGPCNATNPIDRCWR  1336
              I   R+   E   ED     TG                    K +GPC+A+NPID+CWR
Sbjct  69    DIETERQDDQEE--EDSIAMLTGSINSTRRSLRGGRRGRGKWSKLKGPCSASNPIDKCWR  126

Query  1335  CHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPL  1159
             C  DWA  R++LADC  GFGYKT GGK G+ Y VT   D D  NP+PGTLRHAVIQK+PL
Sbjct  127   CMPDWARRRQKLADCVRGFGYKTTGGKLGRIYVVTSNLDNDLINPRPGTLRHAVIQKEPL  186

Query  1158  WIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEG  979
             WIIF +DMNI+L QEL++   KTID RGA VHI+ GAGIT+QFV N+IIHG+HIHHI   
Sbjct  187   WIIFKNDMNIRLQQELMINSHKTIDARGANVHIAYGAGITMQFVTNIIIHGLHIHHIVSS  246

Query  978   NGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNG  799
             NGG+IRD +DH+G RT++DGDG+SIFG+SN+WIDHVSM  C DGLIDAI+ ST ITISN 
Sbjct  247   NGGMIRDSVDHYGFRTRADGDGLSIFGASNIWIDHVSMSRCQDGLIDAIDGSTGITISNS  306

Query  798   HFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNM  619
             HFT HNDVML GA+++  KDK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW +
Sbjct  307   HFTHHNDVMLLGAHNVIDKDKRMQVTVAYNHFGKGLVQRMPRVRWGFVHVVNNDYTHWEL  366

Query  618   YAIGGSSHPTIICQGNRFIAPPDIHK-KEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFV  442
             YAIGGS  PTI+  GNRFIAPP I + KE+TKR      EWK W WRS+ DI+M GAFF 
Sbjct  367   YAIGGSQSPTILSHGNRFIAPPHIPQYKEVTKRDYAPEAEWKNWNWRSERDIFMNGAFFR  426

Query  441   QSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             QSG+PNF   H +    +       V+ LT++AGAL+C+VG PC
Sbjct  427   QSGNPNFRCTHTR-QQMIKPKHGLAVSMLTKYAGALDCKVGRPC  469



>ref|XP_008793504.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=446

 Score =   471 bits (1212),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 260/430 (60%), Positives = 309/430 (72%), Gaps = 17/430 (4%)
 Frame = -3

Query  1581  GHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTGRH  1402
              ++AE+D+ W+++A EA+  ++ AY P+P  ++      V   +S+A       N+T R 
Sbjct  28    ANMAEFDDHWQKKAEEAFARSRAAYHPDPEAVTNKFNKAVHLAVSQA------RNSTRRA  81

Query  1401  L--LGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTD  1228
             L   G  K++GPC ATNPIDRCWRC  +W  NRK+LA CA GFG    GGK G FY VTD
Sbjct  82    LRSAGVNKFKGPCVATNPIDRCWRCRENWMENRKKLAGCAKGFGRNAVGGKDGDFYVVTD  141

Query  1227  KSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDG  1051
              SD D  NPK GTLR  VIQ +PLWIIFA DM I+L +EL++  +KTIDGRGA V I+ G
Sbjct  142   PSDNDLVNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELMINSNKTIDGRGANVRIAYG  201

Query  1050  AGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHV  871
             A IT+QFV NVIIHGIHIH I   NGG+IRD L HFG+RTKSDGDGISI+GSS++WIDH 
Sbjct  202   AQITLQFVHNVIIHGIHIHDIKPSNGGIIRDSLQHFGIRTKSDGDGISIYGSSDIWIDHC  261

Query  870   SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRL  691
             S+RNC DGLIDAIE STAITISN HFT HNDV+LFGA+D +  D IMQIT+AFNHFGK L
Sbjct  262   SLRNCADGLIDAIEGSTAITISNCHFTHHNDVLLFGASDSNEHDSIMQITVAFNHFGKGL  321

Query  690   IQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGT  511
             +QRMPRCR+G++HVVNNDYT W MYAIGGS HPTII QGNRFIAP     KE+TKR   T
Sbjct  322   VQRMPRCRWGFVHVVNNDYTQWIMYAIGGSQHPTIISQGNRFIAPLMQFAKEVTKRDYAT  381

Query  510   PEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTW---LTRFAG  340
              + WK WTWRS+GD+   GAFF +SG PN    H K +      KA+  TW   LTRFAG
Sbjct  382   EDVWKQWTWRSEGDLMQNGAFFRESGSPNTKSFHRKDF-----IKAKPGTWVRRLTRFAG  436

Query  339   ALNCRVGSPC  310
              L CR G PC
Sbjct  437   PLGCRAGRPC  446



>ref|XP_008230729.1| PREDICTED: pectate lyase [Prunus mume]
Length=452

 Score =   470 bits (1210),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 269/450 (60%), Positives = 323/450 (72%), Gaps = 14/450 (3%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVGHIA------EYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIH  1468
               LF++S   ++P+    IA      ++D VW+ R  +A K A +AY+ NP  ++     
Sbjct  7     LVLFMISFCILVPSLRASIANDSNVGQFDAVWKERELKAEKTALKAYQRNPEKVTDDFNE  66

Query  1467  QVRRTLSEAVAED-LTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADC  1291
              V+        +D   +N TGRHLLG KKY+GPC ATNPIDRCWRC  DWA++RK+LA+C
Sbjct  67    SVQEVDDLNFEDDDQVSNITGRHLLG-KKYKGPCKATNPIDRCWRCRKDWANDRKKLANC  125

Query  1290  AMGFGYKTKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQE  1114
               GFG +T+GGK G+FY VTD SD     PKPGTLRHAVIQ +PLWIIFA  M I+L QE
Sbjct  126   VKGFGRRTRGGKRGEFYVVTDPSDSNVVEPKPGTLRHAVIQPQPLWIIFARSMTIRLTQE  185

Query  1113  LIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLR  934
             LIM   KTID RGA VHI+ GAG+T+QFV+NVIIHG+HIH I  G+GG IRD +DHFG R
Sbjct  186   LIMTSHKTIDARGANVHIAHGAGLTLQFVQNVIIHGLHIHDIVPGSGGTIRDSVDHFGTR  245

Query  933   TKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGAND  754
             T+SDGDGISIFGSS+VW+DH+SM NC DGLID I+ STA+TISN HFT HNDV+LFGA+D
Sbjct  246   TQSDGDGISIFGSSHVWLDHLSMWNCADGLIDVIQGSTAVTISNCHFTRHNDVLLFGASD  305

Query  753   LSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQG  574
                 D IMQIT+AFNHFGK L+QRMPRCR+G+IHVVNNDYTHW MYAIGGSSHPTII QG
Sbjct  306   SFAGDAIMQITVAFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTIISQG  365

Query  573   NRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKL--  400
             NRFIAPP+   KE+TKR       WK W WRS+GD+ + GAFFV+SG      K+H    
Sbjct  366   NRFIAPPNQAAKEVTKRDYAPMGVWKNWQWRSEGDLMLNGAFFVESG---VAKKNHGFGK  422

Query  399   YDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              D +       V+ LTRFAG L CRVG  C
Sbjct  423   LDMMTAKPGTFVSRLTRFAGTLGCRVGQKC  452



>ref|XP_010925369.1| PREDICTED: pectate lyase [Elaeis guineensis]
Length=444

 Score =   470 bits (1209),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 265/455 (58%), Positives = 313/455 (69%), Gaps = 17/455 (4%)
 Frame = -3

Query  1656  MERFNKNNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISAS  1477
             ME       FFL  +   A    +   I E D+ W+++A EA   ++ AY P+P  ++  
Sbjct  1     MEGVRTKPSFFLCSLIFLASAALSGADIPELDDHWQKKAEEALARSRAAYHPDPEAVTNH  60

Query  1476  LIHQVRRTLSEAVAEDLTTNTTGRHL--LGSKKYRGPCNATNPIDRCWRCHADWASNRKR  1303
                 V   L+EA       N+T R L  +G KK++G C ATNPIDRCWRC  +W  +RK+
Sbjct  61    FNKAVHLALAEA------RNSTRRSLRAVGVKKFKGKCVATNPIDRCWRCQKNWIKHRKK  114

Query  1302  LADCAMGFGYKTKGGKSGKFYTVTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIK  1126
             LA C  GFG    GGK+G FY VTD SDD   NPK GTLR  VIQ +PLWI+FA DM I+
Sbjct  115   LATCGKGFGRHATGGKAGDFYVVTDPSDDDLVNPKFGTLRWGVIQDRPLWIVFARDMIIR  174

Query  1125  LHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDH  946
             L +EL++  +KTID RGA VHI+ GA ITIQFV NVIIHG+HIH I   NGG+IRD L H
Sbjct  175   LSEELMINSNKTIDARGANVHIAYGAQITIQFVNNVIIHGLHIHDIKPSNGGMIRDSLHH  234

Query  945   FGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLF  766
             FGLRTKSDGDGISI+GSS+VWIDH SMRNC DGLIDAIE STAITISN HFT HNDV+LF
Sbjct  235   FGLRTKSDGDGISIYGSSDVWIDHCSMRNCADGLIDAIEGSTAITISNCHFTHHNDVLLF  294

Query  765   GANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTI  586
             GA+D +  D IMQ T+AFNHFGK L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTI
Sbjct  295   GASDSNENDSIMQATVAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSKHPTI  354

Query  585   ICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHH  406
             I QGNRFIAPP    KE+TKR   T + WK WTWRS+GD+   GAFF +SG PN    H 
Sbjct  355   ISQGNRFIAPPLRFAKEVTKRDYATEDVWKQWTWRSEGDLMQNGAFFRESGTPNTRTFHR  414

Query  405   KLYDGVMTFKAEDVTW---LTRFAGALNCRVGSPC  310
             K +      +A+  TW   LTRFAG L C+ G  C
Sbjct  415   KDF-----IRAKPGTWVRRLTRFAGPLGCKAGRAC  444



>ref|XP_003530685.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=451

 Score =   470 bits (1210),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 265/460 (58%), Positives = 311/460 (68%), Gaps = 29/460 (6%)
 Frame = -3

Query  1635  NC--FFLFVVSVAAIIPAT-----------VGHIAEYDEVWRRRAAEAWKHAQQAYEPNP  1495
             NC  ++  ++S+A  IP               H+ E+D  W+ RA  A   +Q AY  +P
Sbjct  3     NCQQYYFLLLSLAIFIPTLNANSLEKDEYWQSHVYEFDSYWQERAKAAKVDSQAAYFEDP  62

Query  1494  HNISASLIHQVRR-TLSEAVAEDLTTNTTGRHLLGSKKYRG--PCNATNPIDRCWRCHAD  1324
             +++S++    V   T+ +   +DL  N  G       KYRG  PC ATNPIDRCWRC  +
Sbjct  63    YSVSSNFTSSVSELTIGK---KDLRRNLKG-------KYRGDGPCIATNPIDRCWRCDPN  112

Query  1323  WASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSDD-QSNPKPGTLRHAVIQKKPLWIIF  1147
             WA+NR++LADC  GFG  T GGK G FY VTD SDD   NPKPGTLRHAV +  PLWIIF
Sbjct  113   WANNRQKLADCVQGFGRNTVGGKGGPFYVVTDPSDDDMVNPKPGTLRHAVTRDGPLWIIF  172

Query  1146  AHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGL  967
             A  M I L QELIM  +KTIDGRG  V+I+ GAGIT+QFVKN+IIHGI +  I    GG+
Sbjct  173   ARSMFITLQQELIMNSNKTIDGRGVDVYIAKGAGITVQFVKNIIIHGIKVFDIVIREGGM  232

Query  966   IRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTD  787
             IRD   H+G RTKSDGDGISIFGSSNVWIDHVSMRNC DGLIDAI  STAITISN HFTD
Sbjct  233   IRDSETHYGFRTKSDGDGISIFGSSNVWIDHVSMRNCSDGLIDAIMGSTAITISNSHFTD  292

Query  786   HNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIG  607
             HN+VMLFGA+D  + DKIMQITLAFNHFGKRL+QRMPR RYG++H VNNDYTHW MYAIG
Sbjct  293   HNEVMLFGASDSYSDDKIMQITLAFNHFGKRLVQRMPRVRYGFVHSVNNDYTHWEMYAIG  352

Query  606   GSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDP  427
             GS +PTII +GNRFIAP +   K+ITKR       W  W WRS  D+YM GAFFVQSG P
Sbjct  353   GSKNPTIISEGNRFIAPDNQFAKQITKREYAPENVWANWQWRSINDVYMNGAFFVQSG-P  411

Query  426   NFMDKHHKLYDGVMTFKAEDVTWLTRFAG-ALNCRVGSPC  310
                 +     D +       V  LTR++G  L CRVG PC
Sbjct  412   ELASRPFSREDMITAKVGNYVGRLTRYSGNLLKCRVGRPC  451



>ref|XP_008366366.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=479

 Score =   471 bits (1211),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 245/371 (66%), Positives = 288/371 (78%), Gaps = 6/371 (2%)
 Frame = -3

Query  1419  NTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFY  1240
             N T R+L   +KY+GPC ATNPIDRCWRC  +W +NRK+LADCA GFG+KT GGK+GK Y
Sbjct  114   NKTRRNL--KQKYKGPCLATNPIDRCWRCDPNWETNRKKLADCAKGFGHKTTGGKAGKIY  171

Query  1239  TVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVH  1063
              VTD SD D  NPKPGTLRHAVIQ  PLWIIFA DM IKL +EL++  DKTID RGA VH
Sbjct  172   VVTDNSDNDMVNPKPGTLRHAVIQTGPLWIIFARDMRIKLREELMVTSDKTIDARGANVH  231

Query  1062  ISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVW  883
             I DGA IT+QFV NVIIH +HIH    GNGG+IRD ++H+G RT+SDGDGIS++G+SNVW
Sbjct  232   IEDGAQITLQFVXNVIIHNLHIHDTKPGNGGMIRDSVNHYGQRTRSDGDGISMYGASNVW  291

Query  882   IDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHF  703
             IDHVS  NC DGL+DAI+ STAITISN HFT+HNDVMLFG++D +++D++MQITLAFNHF
Sbjct  292   IDHVSGSNCADGLVDAIQGSTAITISNCHFTNHNDVMLFGSSDSNSQDEVMQITLAFNHF  351

Query  702   GKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKR  523
             G+ LIQRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII QGNRFIAP +   KE+TKR
Sbjct  352   GQGLIQRMPRCRWGFFHVVNNDYTHWIMYAIGGSQHPTIISQGNRFIAPSNNASKEVTKR  411

Query  522   VKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFA  343
               G   EWK+W WRS+ D+ M GAFFV+SG P    ++    D +       VT LTRFA
Sbjct  412   TSGAENEWKSWNWRSENDLMMNGAFFVESGSP---IRNLPKADMIKAKPGTFVTRLTRFA  468

Query  342   GALNCRVGSPC  310
             G L C  G PC
Sbjct  469   GPLKCIKGKPC  479



>ref|XP_007215366.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
 gb|EMJ16565.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
Length=452

 Score =   468 bits (1203),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 270/450 (60%), Positives = 324/450 (72%), Gaps = 14/450 (3%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVGHIA------EYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIH  1468
               LF++S   ++P+    IA      ++D VW+ R  +A K A +AY+PNP  ++     
Sbjct  7     LVLFMISFCILVPSLRASIANDSNVGQFDAVWKERELKAEKAALKAYQPNPEKVTDDFNE  66

Query  1467  QVRRTLSEAVAED-LTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADC  1291
              V+        +D   +N TGRHLLG KKY+GPC ATNPIDRCWRC  DWA++RK+LA+C
Sbjct  67    SVQEFDDLNFEDDDQVSNITGRHLLG-KKYKGPCKATNPIDRCWRCRKDWANDRKKLANC  125

Query  1290  AMGFGYKTKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQE  1114
               GFG +T+GGK G FY VTD SD    +PKPGTLRHAVIQ +PLWIIFA  M I+L QE
Sbjct  126   VKGFGRRTRGGKRGGFYVVTDPSDSNVVDPKPGTLRHAVIQPQPLWIIFARSMTIRLTQE  185

Query  1113  LIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLR  934
             LI+   KTID RGA V I+ GAGIT+QFV+NVIIHG+HIH I  G+GG IRD +DHFG R
Sbjct  186   LILTSHKTIDARGANVRIAHGAGITLQFVQNVIIHGLHIHDIVPGSGGTIRDSVDHFGTR  245

Query  933   TKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGAND  754
             T+SDGDGISIFGSS++W+DH+SM NC DGLID I+ STAITISN HFT HNDV+LFGA+D
Sbjct  246   TQSDGDGISIFGSSHIWLDHLSMWNCGDGLIDVIQGSTAITISNCHFTRHNDVLLFGASD  305

Query  753   LSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQG  574
                 D IMQIT+AFNHFGK L+QRMPRCR+G+IHVVNNDYTHW MYAIGGSSHPTII QG
Sbjct  306   SFAGDAIMQITVAFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTIISQG  365

Query  573   NRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKL--  400
             NRFIAPP+   KE+TKR     + WK W WRS+GD+ + GAFFV+SG      K+H    
Sbjct  366   NRFIAPPNHAAKEVTKRDYAPVDVWKNWQWRSEGDLMLNGAFFVESG---VAKKNHGFGK  422

Query  399   YDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              D +       VT LTRFAG L CRVG  C
Sbjct  423   LDMMTAKPGTFVTRLTRFAGTLGCRVGQKC  452



>ref|XP_002871648.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47907.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=472

 Score =   468 bits (1204),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 255/475 (54%), Positives = 326/475 (69%), Gaps = 31/475 (7%)
 Frame = -3

Query  1656  MERFNKNNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISAS  1477
             M R +K     +F+  +A +IP   G+I+E DE W +RA EA +   QAY  +P+ I   
Sbjct  3     MARLSK----LMFMFCIAVLIPTIRGNISELDEYWSQRADEAREFTLQAYHSDPYEIVDH  58

Query  1476  LIHQ-------VRRTLSEAVAEDL------------TTNTTGRHLLGS-----KKYRGPC  1369
                +       V  T  E  A+              +TN+T R L G       K +GPC
Sbjct  59    FHERHYDNSTDVTTTEEEGDAKPEEEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPC  118

Query  1368  NATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDK-SDDQSNPKPGT  1192
              A+NPID+CWRC +DWA  RKRL  C  GFG++T GGK G+ Y VT    DD  NPKPGT
Sbjct  119   TASNPIDKCWRCRSDWAKRRKRLTRCVRGFGHRTTGGKRGRIYVVTSNLDDDMVNPKPGT  178

Query  1191  LRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNVii  1012
             LRHAVIQK+PLWIIF +DM+I+L+QEL++   KTID RGA VH++ GAGIT+QFVKNVII
Sbjct  179   LRHAVIQKEPLWIIFKNDMSIRLNQELLINSHKTIDARGANVHVAHGAGITMQFVKNVII  238

Query  1011  hgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAI  832
             HG+HIHHI E +GG+IRD +DHFG+RT++DGDG+SI+GSSN+W+DH+SM  C DGLIDAI
Sbjct  239   HGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISMSKCQDGLIDAI  298

Query  831   EASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIH  652
               ST ITISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK L+QRMPR R+G++H
Sbjct  299   VGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWGFVH  358

Query  651   VVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQ  475
             VVNNDYTHW +YAIGGS  PTI+  GNRFIAPP   H +E+TKR   + +EWK W WRS+
Sbjct  359   VVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYASEDEWKHWNWRSE  418

Query  474   GDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              D++M GA+F QSG+P +   H +    +       V+ LT++AGAL+CRVG  C
Sbjct  419   KDVFMNGAYFRQSGNPQYKCAHTR-QQMIKPKHGLAVSKLTKYAGALDCRVGKRC  472



>ref|XP_002511525.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF52127.1| Pectate lyase precursor, putative [Ricinus communis]
Length=433

 Score =   466 bits (1199),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 256/439 (58%), Positives = 314/439 (72%), Gaps = 15/439 (3%)
 Frame = -3

Query  1623  LFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSE  1444
             L V++ A IIP    +IA +D+VW++RA EA   A QAY PNP +I      +V ++L++
Sbjct  9     LLVIAFATIIPTLKANIAHFDKVWQQRAKEASHAALQAYHPNPEDIVNHFNKEVAKSLND  68

Query  1443  AVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTK  1264
                     ++T   L    +++ PC+ATNPIDRCWRC A+WASNRK+LA CA+GFG  T 
Sbjct  69    F-------SSTSSQL---SQHKRPCHATNPIDRCWRCDANWASNRKKLAGCALGFGRMTT  118

Query  1263  GGKSGKFYTVTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTI  1087
             GGK G +Y VTD SDD   NP+ GTLR+ VIQ +PLWI FA DM I L QELI+  +KTI
Sbjct  119   GGKDGDYYVVTDPSDDDLVNPREGTLRYGVIQDRPLWITFAGDMVITLSQELIINSNKTI  178

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             DGRGA VHIS GA ITIQ+ +N+IIHGIHIH I  G+GG IRD   HFG RT SDGDGIS
Sbjct  179   DGRGANVHISCGAQITIQYARNIIIHGIHIHDIRGGSGGKIRDSETHFGKRTASDGDGIS  238

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             I+GS+N+WIDHVS+ NC DGLIDAI ASTAITISN HFT HN VML G N+  + D +MQ
Sbjct  239   IYGSNNIWIDHVSISNCTDGLIDAIMASTAITISNCHFTRHNTVMLLGGNNKFSADSVMQ  298

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             +T+AFNHF ++L+QRMPR RYG  HVVNNDYT W MYAIGGS HPTII QGNRF+APPD 
Sbjct  299   VTVAFNHFDRKLVQRMPRVRYGLAHVVNNDYTSWEMYAIGGSEHPTIISQGNRFLAPPDP  358

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED  367
               K++TKR      EWK+W WRS+GD+ + GAFFV+SG P  ++ H K  + V       
Sbjct  359   DCKQVTKRNVEPESEWKSWNWRSEGDLMLNGAFFVESGSP--IETHGK--EEVHAMPGTL  414

Query  366   VTWLTRFAGALNCRVGSPC  310
             V  LTR+AGAL+C+   PC
Sbjct  415   VHRLTRYAGALHCKKQKPC  433



>ref|XP_004508770.1| PREDICTED: probable pectate lyase P59-like [Cicer arietinum]
Length=434

 Score =   466 bits (1199),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 254/444 (57%), Positives = 319/444 (72%), Gaps = 22/444 (5%)
 Frame = -3

Query  1632  CFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRT  1453
             CF +F +++   + A++ H A++   W+ RA EA + AQ+AY+PNPH+I+ +    V ++
Sbjct  10    CFCVFYLALFPTLRASIAHDAQF---WQTRAREAKQAAQKAYKPNPHDIALTFNKHVDKS  66

Query  1452  LSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGY  1273
                      ++N T R   G  KY GPC ATNPID+CWRC  +W  NRK+LA+CA+GFG+
Sbjct  67    FK-------SSNGTRR---GLSKYTGPCLATNPIDKCWRCDPNWEKNRKKLANCALGFGH  116

Query  1272  KTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGD  1096
              T GGK+GK Y VTD SD D  NPKPGTLRHAVIQ +PLWIIF H MNIKL  ELI   +
Sbjct  117   GTTGGKNGKIYVVTDSSDHDLINPKPGTLRHAVIQNEPLWIIFKHSMNIKLSSELIFTDN  176

Query  1095  KTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgd  916
             KTID RGA VHIS+GA +T+Q+VKN+IIHG+HIH I +G GGLIRD ++H+G R+ SDGD
Sbjct  177   KTIDARGANVHISNGAQMTLQYVKNIIIHGLHIHDIKKGGGGLIRDSVNHYGYRSSSDGD  236

Query  915   gisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDK  736
              IS+FGSS+VWIDH+S+ NC DGLID +E STAITISN H T HNDVMLFGA+D  + DK
Sbjct  237   AISLFGSSHVWIDHISLWNCDDGLIDVVEGSTAITISNCHMTRHNDVMLFGASDGYSGDK  296

Query  735   IMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAP  556
             ++Q+T+AFNHFGK LIQRMPRCR+G+ H+VNNDYT W MYAIGGS  PTI+ QGNRFIAP
Sbjct  297   VLQVTVAFNHFGKGLIQRMPRCRWGFFHIVNNDYTQWVMYAIGGSQQPTILSQGNRFIAP  356

Query  555   PDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDP--NFMDKHHKLYDGVMT  382
              + + KE+TKR       WKTW+W S+ D+   GAFFVQSG    NF     K   G  +
Sbjct  357   NNPNAKEVTKRDYAAESVWKTWSWTSENDLMRNGAFFVQSGKKSGNFPKTDIKAKPG--S  414

Query  381   FKAEDVTWLTRFAGALNCRVGSPC  310
             + A     LTRF+GA+ C V  PC
Sbjct  415   YAAS----LTRFSGAIKCVVNKPC  434



>ref|XP_008221658.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=443

 Score =   466 bits (1200),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 264/435 (61%), Positives = 311/435 (71%), Gaps = 13/435 (3%)
 Frame = -3

Query  1605  AAIIP-ATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAED  1429
             AAII  A      E DE W++RA +A  +  ++YEPNP  ++     QV   +       
Sbjct  19    AAIIANAETDQPQELDEYWKKRADQAENYTMESYEPNPERVTDEFNAQVGELI-------  71

Query  1428  LTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSG  1249
             +  N T R+L G KKY GPC  TNPID CWRC  +WA+NR ++ DC  GFG KT GGK G
Sbjct  72    MGKNETRRNLKGQKKYVGPCTVTNPIDACWRCDPNWANNRMKIVDCIQGFGRKTTGGKGG  131

Query  1248  KFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGA  1072
               Y VTD SD D  NP+PGTLRHAVIQK PLWI FA +M IKL QEL++  DKTIDGRGA
Sbjct  132   PIYVVTDPSDGDLVNPRPGTLRHAVIQKGPLWITFARNMVIKLQQELMVASDKTIDGRGA  191

Query  1071  QVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsS  892
              V+I DGA ITIQFVKNVII  IHI  I    GG+IRD +DHFG RTKSDGDGISI+GSS
Sbjct  192   NVNIFDGACITIQFVKNVIITNIHIKQIKAKEGGMIRDSVDHFGQRTKSDGDGISIYGSS  251

Query  891   NVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAF  712
             N+WIDHVSM NC DGLID I  ST ITISN HFT HN+VMLFGA++  T+DK+MQIT+AF
Sbjct  252   NIWIDHVSMENCTDGLIDVIMGSTGITISNSHFTKHNEVMLFGASNSYTQDKMMQITVAF  311

Query  711   NHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEI  532
             NHFGK L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS +PTII QGNRFIA  +   KE+
Sbjct  312   NHFGKGLVQRMPRCRHGFFHVVNNDYTHWLMYAIGGSMNPTIISQGNRFIAGLNSAAKEV  371

Query  531   TKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED-VTWL  355
             TKR      EWK W W+S+GD++M GAFFV+SG P  + +  KL   ++ FK    VT L
Sbjct  372   TKREYTAEAEWKNWLWKSEGDLFMNGAFFVESGSPANL-RADKL--DMIPFKPGTYVTKL  428

Query  354   TRFAGALNCRVGSPC  310
             T+FAGAL+C VG PC
Sbjct  429   TKFAGALDCFVGKPC  443



>ref|XP_007138209.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
 gb|ESW10203.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
Length=434

 Score =   465 bits (1196),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 250/446 (56%), Positives = 309/446 (69%), Gaps = 15/446 (3%)
 Frame = -3

Query  1644  NKNNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQ  1465
             + N     F V   AI+P    +I ++D VW RR  EA + A+QAY+PNP  ++A     
Sbjct  3     SSNFSLLFFYVIFLAILPTLQANIGQFDHVWHRRLKEAREAAKQAYKPNPMKVTAEFNTH  62

Query  1464  VRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAM  1285
             V R +         +N+T R   G  K    C A NPID+CWRC  DW  NRK+LADCA+
Sbjct  63    VMRAMK-------GSNSTRR---GLGKKNDECEAANPIDKCWRCDPDWEKNRKKLADCAI  112

Query  1284  GFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELI  1108
             GFG+ T GGK GK Y V D SD D  NPKPGTLRHAVIQ +PLWIIF+ +MNI+L  EL+
Sbjct  113   GFGHGTTGGKDGKIYVVGDNSDKDLVNPKPGTLRHAVIQTEPLWIIFSRNMNIRLTAELL  172

Query  1107  MQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTK  928
             +  +KTID RGA VHI DGA +TIQFVKN+IIHG+HIH I   +GGLIRD + H+G+R  
Sbjct  173   ITDNKTIDARGANVHILDGAQMTIQFVKNIIIHGLHIHDIQPISGGLIRDSMSHYGVRAM  232

Query  927   sdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLS  748
             SDGDGIS+FGS+++WIDHVSM NC DGLID + ASTA+TISN HF  HNDV+LFGA D  
Sbjct  233   SDGDGISVFGSTHIWIDHVSMTNCSDGLIDVVSASTAVTISNCHFVKHNDVLLFGATDSF  292

Query  747   TKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNR  568
             ++DK+MQ+TLAFNHFGK L+QRMPRCR+G+ H+VNNDYTHW MYA+GGS  PTII QGNR
Sbjct  293   SRDKVMQVTLAFNHFGKGLVQRMPRCRWGFFHIVNNDYTHWLMYAVGGSQQPTIISQGNR  352

Query  567   FIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGV  388
             F+AP D + KE+TKR      EWK W WRS+GD++  GAFFV+SG    + K  K     
Sbjct  353   FVAPKDRNAKEVTKRDYAPESEWKNWNWRSEGDLFENGAFFVESGKK--VTKFPKT--DA  408

Query  387   MTFKAEDVTWLTRFAGALNCRVGSPC  310
                 A+ V +LT+ AG + C    PC
Sbjct  409   KAVSAKSVAFLTKDAGPIKCIPNKPC  434



>ref|XP_007224275.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
 gb|EMJ25474.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
Length=443

 Score =   465 bits (1197),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 262/435 (60%), Positives = 313/435 (72%), Gaps = 13/435 (3%)
 Frame = -3

Query  1605  AAIIP-ATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAED  1429
             AAII  A      + DE W++RA +A  +  ++YEPNP  ++     +V   +       
Sbjct  19    AAIIANAESDQPQQLDEYWKKRAEQAENYTMESYEPNPQRVTDEFNAEVGELI-------  71

Query  1428  LTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSG  1249
             +  N T R+L G KKY GPC  TNPID CWRC  +WA+NR ++ DC  GFG KT GGK G
Sbjct  72    MGKNETRRNLKGQKKYVGPCKVTNPIDSCWRCDPNWANNRMKIVDCIQGFGRKTTGGKGG  131

Query  1248  KFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGA  1072
               Y VTD SD D  NP+PGTLRHAVIQK PLWI FA +M IKL QEL++  DKTIDGRGA
Sbjct  132   PIYVVTDPSDGDLVNPRPGTLRHAVIQKGPLWITFARNMVIKLQQELMVASDKTIDGRGA  191

Query  1071  QVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsS  892
              V+I DGAGITIQFVKNVII  +HI  I    GG+IRD +DHFG RTKSDGDGISIFGSS
Sbjct  192   NVNIFDGAGITIQFVKNVIITNLHIKQIKAKEGGIIRDSVDHFGQRTKSDGDGISIFGSS  251

Query  891   NVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAF  712
             N+WIDHVSM NC DGLIDAI  ST ITISN HFT HN+V+LFGA++  T+DK+MQIT+AF
Sbjct  252   NIWIDHVSMENCTDGLIDAIMGSTGITISNCHFTKHNEVLLFGASNSYTQDKMMQITVAF  311

Query  711   NHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEI  532
             NHFGK L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS +PTII QGNRFIA  +   KE+
Sbjct  312   NHFGKGLVQRMPRCRHGFFHVVNNDYTHWLMYAIGGSMNPTIISQGNRFIAGLNSATKEV  371

Query  531   TKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED-VTWL  355
             TKR      EWK W W+S+GD++M GAFFV+SG P  + +  KL   ++ FK    VT +
Sbjct  372   TKREYTAEAEWKNWLWKSEGDLFMNGAFFVESGSPANL-RADKL--DMIPFKPGTYVTKM  428

Query  354   TRFAGALNCRVGSPC  310
             T+FAGAL+C VG PC
Sbjct  429   TKFAGALDCFVGKPC  443



>ref|XP_004490004.1| PREDICTED: probable pectate lyase 3-like isoform X2 [Cicer arietinum]
Length=376

 Score =   462 bits (1189),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 244/368 (66%), Positives = 281/368 (76%), Gaps = 2/368 (1%)
 Frame = -3

Query  1410  GRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVT  1231
             GR  L  +K  GPC ATNPIDRCWRC  +WA+NRK+LADC  GFG KT GGK+G FY VT
Sbjct  10    GRRNLRGRKTAGPCMATNPIDRCWRCDPNWANNRKKLADCVQGFGRKTTGGKAGPFYVVT  69

Query  1230  DKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISD  1054
             D SD D  NP+PGTLRHAV +  PLWIIFA  MNI+L+QELIM  DKTIDGRGA + I++
Sbjct  70    DPSDSDMVNPRPGTLRHAVTRNGPLWIIFARSMNIRLNQELIMTSDKTIDGRGADIVIAN  129

Query  1053  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  874
             GAGITIQ+++NVIIHGI +  I  G+GGL+RD  +H+GLRT SDGDGISIFGSSN+WIDH
Sbjct  130   GAGITIQYIRNVIIHGIKVFDIVVGSGGLVRDSENHYGLRTMSDGDGISIFGSSNIWIDH  189

Query  873   VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKR  694
             VSMRNC DGLIDAI  STAITISN HFTDHN+VMLFGA+D    D+ MQIT+AFNHFGKR
Sbjct  190   VSMRNCRDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDGYDADQKMQITVAFNHFGKR  249

Query  693   LIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKG  514
             LIQRMPRCR+G+IHVVNNDYTHW MYAIGGS HPTII +GNRFIAP + + KEITKR   
Sbjct  250   LIQRMPRCRFGFIHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIAPDNGYAKEITKREYS  309

Query  513   TPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGAL  334
                EWK W WRS  D+YM GAFF Q G     ++     D +       V  LTR++G+L
Sbjct  310   PESEWKNWQWRSINDVYMNGAFFRQGGS-ELTNRPFSKKDMITAKPGAYVGRLTRYSGSL  368

Query  333   NCRVGSPC  310
              C VG PC
Sbjct  369   KCIVGKPC  376



>ref|XP_010513594.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   466 bits (1198),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 252/466 (54%), Positives = 317/466 (68%), Gaps = 28/466 (6%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASL--IHQVRRT  1453
              + V+ +A++IP  + ++AE DE W  +A EA KH   AY P+P++I       H    T
Sbjct  9     LVCVICIASLIPTILANVAETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYDNST  68

Query  1452  LSEAVAEDLT----------------TNTTGRHLLGSK-------KYRGPCNATNPIDRC  1342
               E   ED                  TN+T R L G +       K +GPC A+NPID+C
Sbjct  69    DVEGTEEDKAVDSTEDEDVIEMTSSPTNSTRRSLSGKRRGRGKWSKLKGPCTASNPIDKC  128

Query  1341  WRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTD-KSDDQSNPKPGTLRHAVIQKK  1165
             WRC  DWA  RKRL  C  GFGY+T GGK G+ Y VT  + DD  NP+PGTLRHAVIQK+
Sbjct  129   WRCQPDWARRRKRLVRCVRGFGYRTTGGKRGRIYVVTSPRDDDTVNPRPGTLRHAVIQKE  188

Query  1164  PLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIF  985
             PLWIIF HDM+I+L QEL++   KTID RGA VHI+ GAGIT+Q+V N+IIHG+H+HHI 
Sbjct  189   PLWIIFKHDMSIRLSQELMIASHKTIDARGANVHIAYGAGITMQYVHNIIIHGLHVHHIV  248

Query  984   EGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITIS  805
               +GGLIRD +DHFG R ++DGDGISIFG++N+W+DH+SM  C DGLIDAI  STAITIS
Sbjct  249   SSSGGLIRDSIDHFGQRGQADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTAITIS  308

Query  804   NGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHW  625
             N HFT HNDVML GA D +  DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW
Sbjct  309   NSHFTHHNDVMLLGAQDHNQDDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHW  368

Query  624   NMYAIGGSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAF  448
              +YAIGGS  PTI+  GNRFIAPP   H +E+TKR      EWK W WRS+ D ++ GA+
Sbjct  369   ELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYAPEAEWKNWNWRSEKDYFLNGAY  428

Query  447   FVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             F QSG+P+F   H +    +       V+ LT++AGAL+CRVG  C
Sbjct  429   FRQSGNPHFKCSHSR-QQMIKPKHGVAVSKLTKYAGALDCRVGKAC  473



>ref|XP_006428983.1| hypothetical protein CICLE_v10013750mg [Citrus clementina]
 gb|ESR42223.1| hypothetical protein CICLE_v10013750mg [Citrus clementina]
Length=438

 Score =   464 bits (1195),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 251/448 (56%), Positives = 317/448 (71%), Gaps = 14/448 (3%)
 Frame = -3

Query  1650  RFNKNNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLI  1471
                K   FFLF  S AA+IP    +I+E DEVWRRRA EA +  +Q Y+PNP  I++ L 
Sbjct  4     ELTKLRLFFLF--SFAALIPCLSANISEVDEVWRRRAEEAMQTTEQYYDPNPVAIASHLN  61

Query  1470  HQVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADC  1291
              +V         +DL+  T  R  L + +  G C ATNPID CWRC  +WA NR+ LA C
Sbjct  62    MKV---------QDLSKQTAARRGLLNAE-SGQCEATNPIDNCWRCKENWAENRQALAGC  111

Query  1290  AMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQE  1114
             A+GFG K  GGK GK Y VTD SD D  NPK GTLRHAVIQK+PLWIIFA DMNIKL QE
Sbjct  112   ALGFGIKATGGKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQE  171

Query  1113  LIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLR  934
             LI+QG KTIDGRGA VHI++GAG  +QFV+NVIIHGIHIH+I   +GG+IRD +DH G R
Sbjct  172   LIVQGKKTIDGRGANVHIANGAGFMLQFVQNVIIHGIHIHNISPRSGGMIRDSVDHVGKR  231

Query  933   TKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGAND  754
              +SDGD +SIFGSSN+W+DH+++   +DGLIDAI+ASTAITISN HF++H+  +L GA+D
Sbjct  232   GQSDGDAVSIFGSSNIWLDHLTLSQAHDGLIDAIQASTAITISNCHFSNHDKAILLGASD  291

Query  753   LSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQG  574
               T+DK MQ+T+AFN F K L+QRMP  R+G+ HVVNNDY  W MYAIGG   PTI+ QG
Sbjct  292   TFTEDKKMQVTVAFNRFDKGLVQRMPCVRFGFAHVVNNDYNQWEMYAIGGLKGPTILSQG  351

Query  573   NRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYD  394
             NRF A  + + KE+TKR+  +PEE K+W WRS+GD+++ GA+F  SGDP      +++ D
Sbjct  352   NRFFASDNQNTKEVTKRMNCSPEEGKSWIWRSEGDVFLNGAYFNSSGDPK-KQIEYQMDD  410

Query  393   GVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              +      +V  +T+FAGAL C+ G  C
Sbjct  411   VIKPKPGTEVERITKFAGALVCKPGQKC  438



>ref|XP_008339934.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score =   464 bits (1195),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 257/432 (59%), Positives = 311/432 (72%), Gaps = 14/432 (3%)
 Frame = -3

Query  1596  IPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTN  1417
             +P     + + D  W++RA EA K A ++Y  NP  ++    ++V + +       L  N
Sbjct  32    VPNEDTQVLDLDAYWKQRAEEAEKEALESYNKNPEQVTEEFNNEVGKLM-------LKEN  84

Query  1416  TTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYT  1237
             TT R+L G+K Y+GPC ATNPID CWRC   WA+NRK++  CA GFG K  GGK G FY 
Sbjct  85    TTRRNLRGNKAYKGPCMATNPIDACWRCDPYWANNRKKIVGCAQGFGKKATGGKDGPFYV  144

Query  1236  VTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHI  1060
             VT  +DD   NPKPGTLRHAVIQK PLWIIFA  M I+L QEL++  DKTID RGA V I
Sbjct  145   VTMGTDDDVQNPKPGTLRHAVIQKGPLWIIFAKSMVIRLQQELMVTSDKTIDARGANVVI  204

Query  1059  SDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWI  880
              +GAGIT+QFVKNVII  +HI  I    GG+IRD +DH GLRT+SDGDGIS+FG+SNVWI
Sbjct  205   EEGAGITLQFVKNVIITNLHIKMIVPKPGGMIRDSVDHIGLRTQSDGDGISLFGASNVWI  264

Query  879   DHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFG  700
             DHVSM  C DGLIDA+  ST+ITISN HFTDH++ MLFGAN+  T+DKIMQITLAFNHFG
Sbjct  265   DHVSMSRCADGLIDAVMGSTSITISNSHFTDHDEAMLFGANNAHTQDKIMQITLAFNHFG  324

Query  699   KRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRV  520
             + L+QRMPR R+G+ HVVNNDYTHW MYAIGG+ +PTII QGNRFIAP +   K++T R 
Sbjct  325   QGLVQRMPRVRHGFFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIAPINGVTKQVTHR-  383

Query  519   KGTPE-EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED-VTWLTRF  346
             + TPE EWK W WRS+GD+ M GAFFV+SG  +   KH    D +M FK    V  LT+F
Sbjct  384   ENTPEAEWKNWEWRSEGDLMMNGAFFVESG--SGASKHPAKLD-MMPFKPGTFVATLTKF  440

Query  345   AGALNCRVGSPC  310
             +GALNC VG PC
Sbjct  441   SGALNCAVGKPC  452



>ref|XP_011098576.1| PREDICTED: probable pectate lyase P56 [Sesamum indicum]
Length=465

 Score =   465 bits (1197),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 250/451 (55%), Positives = 299/451 (66%), Gaps = 5/451 (1%)
 Frame = -3

Query  1656  MERFNKNNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISAS  1477
             ME+       FLF +S A I  +   +   +D  W+ RAA A     QAY PNP  I   
Sbjct  18    MEKNFSITFLFLFFISAAFIPTSGANYTDSHDVYWQERAALARARILQAYNPNPEAIVTD  77

Query  1476  LIHQVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLA  1297
                + +  L  +       N T R+L   +KY GPC ATNPIDRCWRC+ +WA NR++LA
Sbjct  78    FNQKTKEALEHSQVNRAPHNGTRRNL--GRKYMGPCVATNPIDRCWRCNPNWALNRQKLA  135

Query  1296  DCAMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLH  1120
             DCA GFG    GGK G  Y V D SD D  NPKPGTLRHAVIQ  PLWIIF+H MNIKL+
Sbjct  136   DCAQGFGAAATGGKFGPIYVVRDPSDNDMMNPKPGTLRHAVIQPGPLWIIFSHSMNIKLN  195

Query  1119  QELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFG  940
             QELIM  DKTIDGRGA + I+ GAG+TIQFV N+II  + I +I    GG IRD ++HFG
Sbjct  196   QELIMTSDKTIDGRGALIQITGGAGLTIQFVHNIIITNLKITNIVPSPGGTIRDSVNHFG  255

Query  939   LRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGA  760
              RT SDGD I+IFGS N+WIDH+SM    DGLIDA+  STAITISN HF  H+ V+LFG 
Sbjct  256   FRTGSDGDAINIFGSHNIWIDHLSMSGGADGLIDAVMGSTAITISNCHFVRHDKVLLFGG  315

Query  759   NDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIIC  580
              D+   D  MQITLAFNHFGK L+QRMPRCR G+ H+VNNDYTHW MYAIGGS H TII 
Sbjct  316   RDMDEIDSKMQITLAFNHFGKHLVQRMPRCRRGFFHLVNNDYTHWLMYAIGGSHHATIIS  375

Query  579   QGNRFIAPPDIHKKEITKRVKGTPE-EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK  403
             QGNR+IAPP   K+++T R   +PE EW+ WTW +  D+++ GA+FV SGDPN    +  
Sbjct  376   QGNRYIAPPLPDKRQVTHREADSPESEWRKWTWVTDHDVFLNGAYFVPSGDPNGAATYLA  435

Query  402   LYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             L + +     E V  LTRFAGAL C V  PC
Sbjct  436   L-EKIRPAPGEQVYDLTRFAGALKCVVSLPC  465



>ref|XP_009117903.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=452

 Score =   464 bits (1194),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 249/446 (56%), Positives = 309/446 (69%), Gaps = 11/446 (2%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
             +  V  +A ++P    ++A +D  W +R  +A K    +Y+PNP N++  L + V    +
Sbjct  11    YTLVFLLAILVPHVQSNVAVFDNYWTQRQGDALKQTIASYDPNPLNVTDHLNYHV----A  66

Query  1446  EAVAEDLTTNTTGRHLLGSKKYRGP--CNATNPIDRCWRCHADWASNRKRLADCAMGFGY  1273
              AV    +TN T R L+G K   G   C A NPID+CWRC  +W  NRK+LA+C +GFG 
Sbjct  67    LAVDATESTNNTRRELIGRKTQEGSGKCIAYNPIDKCWRCDPNWEKNRKKLAECVLGFGR  126

Query  1272  KTKGGKSGKFYTVTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGD  1096
             KT GGK G  Y V D SDD   NPKPGTLRHAV +  PLWIIFA+ M IKL QEL++  +
Sbjct  127   KTTGGKDGPIYVVNDSSDDDLVNPKPGTLRHAVTRDGPLWIIFANSMVIKLQQELMITSN  186

Query  1095  KTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgd  916
             KTIDGRGA+V+I +G G+T+QFV NVII+ I++ HI  GNGGLIRD  +H G+RTKSDGD
Sbjct  187   KTIDGRGAKVYIMEGVGLTLQFVNNVIINNIYVKHIIPGNGGLIRDSEEHVGIRTKSDGD  246

Query  915   gisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDK  736
             GIS+FG++NVWIDHVSM  C DG+IDAIE STA+TISN HFTDH +VMLFGA D    DK
Sbjct  247   GISLFGATNVWIDHVSMTRCTDGMIDAIEGSTAVTISNSHFTDHQEVMLFGAKDEHVIDK  306

Query  735   IMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAP  556
              MQIT+AFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+ +PTII QGNRFIAP
Sbjct  307   NMQITVAFNHFGKRLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAP  366

Query  555   PDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN-FMDKHHKLYDGVMTF  379
             P+   KE+TKR   +  +WK+W W+S+GD ++ GA+FVQSG PN +  K           
Sbjct  367   PNEQAKEVTKREYTSYTDWKSWNWQSEGDYFLNGAYFVQSGRPNAWSPKPKNPVPSKFAI  426

Query  378   KAED---VTWLTRFAGALNCRVGSPC  310
             + +    V  LT  AGAL C  G  C
Sbjct  427   RPKPGTMVRELTMDAGALGCEAGKAC  452



>ref|XP_010463548.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   465 bits (1196),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 252/466 (54%), Positives = 317/466 (68%), Gaps = 28/466 (6%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASL--IHQVRRT  1453
              + V+ +A++IP    ++AE DE W  +A EA KH   AY P+P++I       H    T
Sbjct  9     LVCVICIASLIPTIRANVAETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYDNST  68

Query  1452  LSEAVAEDLT----------------TNTTGRHLLGSK-------KYRGPCNATNPIDRC  1342
               E   ED                  TN+T R L G +       K +GPC A+NPID+C
Sbjct  69    DVEGTEEDKAVDSAEDEDVIEMTSSPTNSTRRSLSGKRRGRGKWSKLKGPCTASNPIDKC  128

Query  1341  WRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTD-KSDDQSNPKPGTLRHAVIQKK  1165
             WRC  DWA  RKRL  C  GFGY+T GGK G+ Y VT  + DD  NP+PGTLRHAVIQK+
Sbjct  129   WRCQPDWARRRKRLVRCVRGFGYRTTGGKRGRIYVVTSPRDDDTVNPRPGTLRHAVIQKE  188

Query  1164  PLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIF  985
             PLWIIF HDM+I+L QEL++   KTID RGA VHI+ GAGIT+Q+VKN+IIHG+H+HHI 
Sbjct  189   PLWIIFKHDMSIRLSQELMIASHKTIDARGANVHIAYGAGITMQYVKNIIIHGLHVHHIV  248

Query  984   EGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITIS  805
               +GGLIRD +DHFG R ++DGDGISIFG++++W+DH+SM  C DGLIDAI  STAITIS
Sbjct  249   TSSGGLIRDSIDHFGQRGQADGDGISIFGATDIWLDHISMSKCQDGLIDAIMGSTAITIS  308

Query  804   NGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHW  625
             N HFT HNDVML GA D +  DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW
Sbjct  309   NSHFTHHNDVMLLGAQDHNQDDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHW  368

Query  624   NMYAIGGSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAF  448
              +YAIGGS  PTI+  GNRFIAPP   H +E+TKR      EWK W WRS+ D ++ GA+
Sbjct  369   ELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYAPEAEWKNWNWRSEKDYFLNGAY  428

Query  447   FVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             F QSG+P+F   H +    +       V+ LT++AGAL+CRVG  C
Sbjct  429   FRQSGNPHFKCSHSR-QQMIKPKHGVAVSKLTKYAGALDCRVGKAC  473



>ref|XP_006480843.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=436

 Score =   463 bits (1192),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 251/448 (56%), Positives = 316/448 (71%), Gaps = 14/448 (3%)
 Frame = -3

Query  1650  RFNKNNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLI  1471
                K   FFLF  S AA+IP    +I+E DEVWRRRA EA +  +Q Y+PNP  I++ L 
Sbjct  2     ELTKLRLFFLF--SFAALIPCLSANISEVDEVWRRRAEEAMQTTEQYYDPNPVAIASHLN  59

Query  1470  HQVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADC  1291
              +V         +DL+  T  R  L + +  G C ATNPID CWRC  +WA NR+ LA C
Sbjct  60    MKV---------QDLSKQTAARRGLLNAE-SGQCEATNPIDNCWRCKENWAENRQALAGC  109

Query  1290  AMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQE  1114
             A+GFG K  GGK GK Y VTD SD D  NPK GTLRHAVIQK+PLWIIFA DMNIKL QE
Sbjct  110   ALGFGIKATGGKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQE  169

Query  1113  LIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLR  934
             LI+QG KTIDGRGA VHI++GAG  +QFV+NVIIHGIHIH+I   +GG+IRD +DH G R
Sbjct  170   LIVQGKKTIDGRGANVHIANGAGFMLQFVQNVIIHGIHIHNISPRSGGMIRDSVDHVGKR  229

Query  933   TKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGAND  754
              +SDGD +SIFGSSN+W+DH+++   +DGLIDAI+ASTAITISN HF++H+  +L GA+D
Sbjct  230   GQSDGDAVSIFGSSNIWLDHLTLSQAHDGLIDAIQASTAITISNCHFSNHDKAILLGASD  289

Query  753   LSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQG  574
               T+DK MQ+T+AFN F K L+QRMP  R+G+ HVVNNDY  W MYAIGG   PTI+ QG
Sbjct  290   TFTEDKKMQVTVAFNRFDKGLVQRMPCVRFGFAHVVNNDYNQWEMYAIGGLKGPTILSQG  349

Query  573   NRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYD  394
             NRF A  + + KE+TKR+  +PEE K W WRS+GD+++ GA+F  SGDP      +++ D
Sbjct  350   NRFFASDNQNTKEVTKRMNCSPEEGKNWIWRSEGDVFLNGAYFNSSGDPK-KQIEYQMDD  408

Query  393   GVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              +      +V  +T+FAGAL C+ G  C
Sbjct  409   VIKPKPGTEVERITKFAGALVCKPGQKC  436



>ref|XP_010915114.1| PREDICTED: LOW QUALITY PROTEIN: pectate lyase-like [Elaeis guineensis]
Length=444

 Score =   464 bits (1193),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 258/430 (60%), Positives = 311/430 (72%), Gaps = 17/430 (4%)
 Frame = -3

Query  1581  GHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTGRH  1402
              +I E+D+ W+++A EA   ++ AY P+P  ++      V   LSEA       N+T R 
Sbjct  26    ANIVEFDDHWQKKAEEALARSRAAYNPDPEGVTHDFNKAVHLALSEA------RNSTRRT  79

Query  1401  L--LGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTD  1228
             L  +   K++GPC ATNPIDRCWRC  +W ++RK+LA CA GFG    GGK+G FY VTD
Sbjct  80    LRSVHRNKFKGPCVATNPIDRCWRCQKNWINHRKKLATCAKGFGRNAIGGKNGDFYVVTD  139

Query  1227  KSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDG  1051
              SDD   NPK GTLR  VIQ +PLWIIFA DM I+L +EL++  +KTIDGRGA VHI+ G
Sbjct  140   PSDDDLVNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELMINSNKTIDGRGANVHIAFG  199

Query  1050  AGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHV  871
             A ITIQFV +VIIHGIHIH I   NGG+IRD L HFG+RTKSDGDGISI+GSS++WIDH 
Sbjct  200   AQITIQFVHDVIIHGIHIHDIRPSNGGIIRDSLQHFGIRTKSDGDGISIYGSSDIWIDHC  259

Query  870   SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRL  691
             S+RNC DGLIDAIEASTAITISN HFT HNDV+LFGA+D +  D +MQ T+AFNHFGK L
Sbjct  260   SLRNCADGLIDAIEASTAITISNCHFTHHNDVLLFGASDSNEHDSMMQATVAFNHFGKGL  319

Query  690   IQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGT  511
             +QRMPRCR+G+ HVVNNDYT W MYAIGGS HPTII QGNRF+AP  +  KE+TKR   T
Sbjct  320   VQRMPRCRWGFFHVVNNDYTQWIMYAIGGSQHPTIISQGNRFVAPRMLFSKEVTKRDYAT  379

Query  510   PEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTW---LTRFAG  340
              + WK WTWRS+GD+   GAFF +SG+PN      + +D     KA+  TW   LTRFAG
Sbjct  380   EDVWKQWTWRSEGDLMQNGAFFRESGNPN-----ARKFDRKDFIKAKPGTWVRRLTRFAG  434

Query  339   ALNCRVGSPC  310
              L CR G PC
Sbjct  435   PLGCRAGRPC  444



>ref|XP_007157384.1| hypothetical protein PHAVU_002G065800g [Phaseolus vulgaris]
 gb|ESW29378.1| hypothetical protein PHAVU_002G065800g [Phaseolus vulgaris]
Length=448

 Score =   464 bits (1193),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 254/453 (56%), Positives = 304/453 (67%), Gaps = 21/453 (5%)
 Frame = -3

Query  1632  CFFLFVVSVAAIIPATVGHIAE-----------YDEVWRRRAAEAWKHAQQAYEPNPHNI  1486
             C    +  +   IP    ++ E           +D  W+ R   A K  Q+AY  +P++ 
Sbjct  5     CSIFLLTCLVVTIPTFYANVLEDEEFLDNQTKSFDGYWKGRKQVAEKQNQEAYITDPYSF  64

Query  1485  SASLIHQVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRK  1306
             + ++ + +        ++ +T    GR  L  K+ +  C ATNPIDRCWRC   W+ NRK
Sbjct  65    TINMTNNI--------SDLITGEEKGRRNLAGKQSQDSCLATNPIDRCWRCDPKWSENRK  116

Query  1305  RLADCAMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNI  1129
             +LADC  GFG  T GGK G FY VT   D D  NP PGTLRHAV +  PLWIIFAH MNI
Sbjct  117   KLADCVQGFGRDTIGGKKGPFYVVTSNLDNDMVNPVPGTLRHAVTRNGPLWIIFAHSMNI  176

Query  1128  KLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLD  949
             +L QELI+ GDKTIDGRGA ++I +GAG TIQFVKNVIIHGI I  I  G GGLIRD   
Sbjct  177   RLSQELIVAGDKTIDGRGADIYIVNGAGFTIQFVKNVIIHGIKIFDINAGQGGLIRDSES  236

Query  948   HFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVML  769
             H+GLRT+SDGDGISIFGSS +WIDHVSMRN  DGLIDAI+ STAITISN HFTDHN+VML
Sbjct  237   HYGLRTQSDGDGISIFGSSYIWIDHVSMRNARDGLIDAIQGSTAITISNSHFTDHNEVML  296

Query  768   FGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPT  589
             FGA+D   +DKIMQITL FNHFGKRL+QRMPRCR+G+IHVVNNDYTHW MYAIGGS HPT
Sbjct  297   FGASDSHEEDKIMQITLVFNHFGKRLVQRMPRCRFGFIHVVNNDYTHWEMYAIGGSKHPT  356

Query  588   IICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKH  409
             II +GNRF+AP     K+ITKR      EWK W WRS  D  + GAFF++SG P+  ++ 
Sbjct  357   IISEGNRFVAPDSKDAKQITKREYSLEPEWKKWQWRSIKDEVINGAFFIESG-PDLTNRP  415

Query  408   HKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
                 D + +     V  LTR AG+L C VG PC
Sbjct  416   FTRKDMISSRPGTYVGRLTRHAGSLRCIVGKPC  448



>ref|XP_006477525.1| PREDICTED: pectate lyase-like [Citrus sinensis]
Length=437

 Score =   463 bits (1192),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 246/445 (55%), Positives = 311/445 (70%), Gaps = 14/445 (3%)
 Frame = -3

Query  1638  NNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVR  1459
             N    L +  +A+I P    +I ++DEVW++RA  A +HA +AY PNP  + +S    V 
Sbjct  5     NAGILLTLFGLASISPILKANIHDFDEVWQKRAENARRHALEAYHPNPEEVVSSFNKHVH  64

Query  1458  RTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGF  1279
                          N+T R+L G + Y G C ATNPID+CWRC  +WA+NRKRLADCA GF
Sbjct  65    MMFENG-------NSTRRYLRG-RPYTGRCAATNPIDQCWRCDRNWANNRKRLADCAQGF  116

Query  1278  GYKTKGGKSGKFYTVTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQ  1102
             G  T GGK+G FY VT+ +DD   NPKPGTLRHAVIQ++PLWI FAHDM I+L +EL++ 
Sbjct  117   GRGTIGGKNGPFYVVTNPADDDLVNPKPGTLRHAVIQERPLWITFAHDMVIRLSEELLIT  176

Query  1101  GDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsd  922
              DKTID RG+ V I +GA IT+QFVKN+IIHG+HI     G GG+IRD + H+G R+ SD
Sbjct  177   SDKTIDARGSNVQIYNGAQITMQFVKNIIIHGLHIRKTKAGKGGMIRDSVSHYGFRSSSD  236

Query  921   gdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTK  742
             GDGIS+FG+S++WIDHVSM  C DGLIDA+  STAIT+SN HFT  + VML GA+D   +
Sbjct  237   GDGISMFGASHIWIDHVSMSGCQDGLIDAVMGSTAITVSNSHFTHQDHVMLLGASDGHPQ  296

Query  741   DKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFI  562
             D IMQ+T+AFNHFGK+L+QRMPR R+G+ HVVNNDYTHW MYAIGGS HPTI+ QGNRF+
Sbjct  297   DSIMQVTVAFNHFGKQLVQRMPRVRFGFAHVVNNDYTHWLMYAIGGSQHPTILSQGNRFL  356

Query  561   APPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSG-DPNFMDKHHKLYDGVM  385
             A    H KE+TKR       WKTW WRS+ D+ M GAFFV+SG D   +++     D + 
Sbjct  357   ASNSHHSKEVTKRDSSPQSVWKTWNWRSEMDLMMNGAFFVESGSDVRNVNRQ----DVIP  412

Query  384   TFKAEDVTWLTRFAGALNCRVGSPC  310
                 +  + +TRF+GALNC V  PC
Sbjct  413   AKPGKFASQMTRFSGALNCYVNKPC  437



>ref|NP_001057945.1| Os06g0583900 [Oryza sativa Japonica Group]
 dbj|BAD68734.1| putative pectate lyase [Oryza sativa Japonica Group]
 dbj|BAF19859.1| Os06g0583900 [Oryza sativa Japonica Group]
 dbj|BAG93046.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80871.1| hypothetical protein OsI_23497 [Oryza sativa Indica Group]
Length=448

 Score =   463 bits (1192),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 247/439 (56%), Positives = 310/439 (71%), Gaps = 13/439 (3%)
 Frame = -3

Query  1623  LFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSE  1444
               ++S AA   A +G   EYDE W++R   A   A+  Y+ +P  ++ S    V R+  E
Sbjct  22    FLLLSAAATSEANIG---EYDEYWQKRKLMADAAAEATYKRDPFEVTNSFNRAVHRSEEE  78

Query  1443  AVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTK  1264
             +   +L        +   KK+ GPC ATNPIDRCWRC ADW ++RKRLA CA GFG  T 
Sbjct  79    SGRRELA-------MTKRKKFAGPCKATNPIDRCWRCRADWVTDRKRLARCAQGFGRNTT  131

Query  1263  GGKSGKFYTVTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTI  1087
             GG +GKFY VTD +DD   NP+PGTLR  VIQ +PLWIIFA DM I L +E+++  DKTI
Sbjct  132   GGLAGKFYLVTDGTDDDVENPRPGTLRWGVIQDEPLWIIFAKDMIINLKEEMMINSDKTI  191

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             DGRGAQV I++GA +T+Q   NVIIH IHIH I +G GG+IRD  +HFG RT+SDGDGIS
Sbjct  192   DGRGAQVRITNGAQVTVQNSNNVIIHNIHIHDILQGKGGMIRDSPEHFGFRTQSDGDGIS  251

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             IFGS+NVW+DH+S+ NC DGLID I  ST +TISN H T+HNDVMLFG++D  ++D+IMQ
Sbjct  252   IFGSTNVWLDHLSLSNCQDGLIDVIAKSTGVTISNCHLTNHNDVMLFGSSDSFSEDQIMQ  311

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             IT+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS +PTII QGNR+IAPP++
Sbjct  312   ITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKNPTIISQGNRYIAPPNL  371

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED  367
               K ITK++  T EEWK W W S+ D++MEGA+F  SG P  + K     D +       
Sbjct  372   AAKRITKQLGATEEEWKNWVWHSEEDLFMEGAYFTTSGGP--IQKQFSNKDLIKPKPGSY  429

Query  366   VTWLTRFAGALNCRVGSPC  310
             VT LTRFAG++ C  G PC
Sbjct  430   VTRLTRFAGSIPCVAGKPC  448



>ref|XP_002270112.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32014.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   463 bits (1192),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 254/433 (59%), Positives = 308/433 (71%), Gaps = 16/433 (4%)
 Frame = -3

Query  1593  PATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNT  1414
             P    HIAEYD+ W+ R  EA   A  A++P+P +++      V +++          N 
Sbjct  22    PTIRAHIAEYDDYWKAREKEAKTVAIDAFDPSPEDVNDDFNKNVEKSI-------FGKNG  74

Query  1413  TGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTV  1234
             T R+L   K  +GPC ATNPIDRCWRC  +WA +R+RLADC +GFG +T GGK G+ Y V
Sbjct  75    TRRNL---KVNKGPCKATNPIDRCWRCRRNWAMDRRRLADCVLGFGRRTVGGKHGRLYIV  131

Query  1233  TDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHIS  1057
             TD SD D  NPKPGTLR+AVIQ +PLWI+F   M IKL QEL++  DKTIDGRG  VHI+
Sbjct  132   TDPSDNDMLNPKPGTLRYAVIQPQPLWIVFGRSMIIKLKQELMVTSDKTIDGRGVNVHIA  191

Query  1056  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  877
              GAGITIQF +NVIIHG+HIH I    GGLIRD + HFGLRT+SDGDGISIFGSS+VWID
Sbjct  192   YGAGITIQFARNVIIHGLHIHDIVSRPGGLIRDSVHHFGLRTRSDGDGISIFGSSHVWID  251

Query  876   HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGK  697
             H SM  C DGL+DAI+ STAITISN HFT HN+ ML GA+D  + D IMQ+T+AFNHFG+
Sbjct  252   HNSMSKCEDGLVDAIQGSTAITISNNHFTKHNETMLLGASDGYSGDIIMQVTVAFNHFGR  311

Query  696   RLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHK----KEIT  529
              LIQRMPRCR+G+ HVVNNDYTHWNMYA+GGS+HPTI+ QGNR++A P +      KE+T
Sbjct  312   GLIQRMPRCRWGFFHVVNNDYTHWNMYAVGGSAHPTIVSQGNRYVAAPLMDPKHDAKEVT  371

Query  528   KRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTR  349
             KR   T  EW  WTWRS+GD+ + GAFFVQSG P F  K    YD +     + V  LTR
Sbjct  372   KRDHATKAEWSKWTWRSEGDLMVNGAFFVQSGVP-FKKKPFSRYDMIKAKPGKFVPRLTR  430

Query  348   FAGALNCRVGSPC  310
             ++GAL C   SPC
Sbjct  431   YSGALTCWRTSPC  443



>emb|CAN69904.1| hypothetical protein VITISV_001006 [Vitis vinifera]
Length=443

 Score =   463 bits (1191),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 254/433 (59%), Positives = 308/433 (71%), Gaps = 16/433 (4%)
 Frame = -3

Query  1593  PATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNT  1414
             P    HIAEYD+ W+ R  EA   A  A++P+P +++      V +++          N 
Sbjct  22    PTIRAHIAEYDDYWKAREKEAKTVAIDAFDPSPEDVNDDFNKNVEKSI-------FGKNG  74

Query  1413  TGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTV  1234
             T R+L   K  +GPC ATNPIDRCWRC  +WA +R+RLADC +GFG +T GGK G+ Y V
Sbjct  75    TRRNL---KVNKGPCKATNPIDRCWRCRRNWAMDRRRLADCVLGFGRRTVGGKHGRLYIV  131

Query  1233  TDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHIS  1057
             TD SD D  NPKPGTLR+AVIQ +PLWI+F   M IKL QEL++  DKTIDGRG  VHI+
Sbjct  132   TDPSDNDMLNPKPGTLRYAVIQPQPLWIVFGRSMIIKLKQELMVTSDKTIDGRGVNVHIA  191

Query  1056  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  877
              GAGITIQF +NVIIHG+HIH I    GGLIRD + HFGLRT+SDGDGISIFGSS+VWID
Sbjct  192   YGAGITIQFARNVIIHGLHIHDIVSHPGGLIRDSVHHFGLRTRSDGDGISIFGSSHVWID  251

Query  876   HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGK  697
             H SM  C DGL+DAI+ STAITISN HFT HN+ ML GA+D  + D IMQ+T+AFNHFG+
Sbjct  252   HNSMSKCEDGLVDAIQGSTAITISNNHFTKHNETMLLGASDGYSGDIIMQVTVAFNHFGR  311

Query  696   RLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHK----KEIT  529
              LIQRMPRCR+G+ HVVNNDYTHWNMYA+GGS+HPTI+ QGNR++A P +      KE+T
Sbjct  312   GLIQRMPRCRWGFFHVVNNDYTHWNMYAVGGSAHPTIVSQGNRYVAAPLMDPKHDAKEVT  371

Query  528   KRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTR  349
             KR   T  EW  WTWRS+GD+ + GAFFVQSG P F  K    YD +     + V  LTR
Sbjct  372   KRDHATKAEWSKWTWRSEGDLMVNGAFFVQSGVP-FKKKPFSRYDMIKAKPGKFVPRLTR  430

Query  348   FAGALNCRVGSPC  310
             ++GAL C   SPC
Sbjct  431   YSGALTCWRTSPC  443



>gb|KEH19822.1| pectate lyase-like protein [Medicago truncatula]
Length=455

 Score =   463 bits (1192),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 261/459 (57%), Positives = 310/459 (68%), Gaps = 29/459 (6%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPAT-----------VGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNIS  1483
               LFV+ +A + P                  E+D  W+ RA  A +  + AY  +P+ IS
Sbjct  7     IILFVLCLAILTPTLNANKLENNEYWTEQRPEFDSYWQERAKVAKQENKAAYFKDPYAIS  66

Query  1482  ASLIHQVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKR  1303
              +         + +++E +     GR+L G  K  G C ATNPIDRCWRC  +WA+NR++
Sbjct  67    GNF--------TASISEIIAVKEKGRNL-GGLKDDGTCLATNPIDRCWRCDPNWANNRQK  117

Query  1302  LADCAMGFGYKTKGGKSGKFYTVTDKSDD-QSNPKPGTLRHAVIQKKPLWIIFAHDMNIK  1126
             LADC  GFG  T+GG+ G  Y VTD SDD   NPKPGTLR+AV +   LWI FA  M I 
Sbjct  118   LADCVQGFGRNTRGGQGGPIYVVTDPSDDDMMNPKPGTLRYAVTRNGSLWITFARSMAIT  177

Query  1125  LHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDH  946
             L QELIM GDKTIDGRG  V+IS+GAGITIQFVKNVIIHGI I+ I   +GG+IRD   H
Sbjct  178   LQQELIMSGDKTIDGRGVDVYISNGAGITIQFVKNVIIHGIKIYDIQVRDGGMIRDSEAH  237

Query  945   FGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLF  766
             +G RTKSDGDGISIFG+SNVWIDHVSMRNC DGLIDAI  STAITISN HFTDHN+VMLF
Sbjct  238   YGFRTKSDGDGISIFGASNVWIDHVSMRNCTDGLIDAIMGSTAITISNSHFTDHNEVMLF  297

Query  765   GANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTI  586
             GA++  ++DKIMQITLAFNHFGKRL+QRMPR R+G++H VNNDYTHW MYAIGGS +PTI
Sbjct  298   GASNDYSEDKIMQITLAFNHFGKRLVQRMPRARFGFVHCVNNDYTHWEMYAIGGSQNPTI  357

Query  585   ICQGNRFIAPPD-------IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDP  427
             I +GNRFI P +       I+ KEITKR      EWKTW WRS  D Y+ GAFFVQSG P
Sbjct  358   ISEGNRFIGPYNKMLGNDLINSKEITKREYTEESEWKTWQWRSINDEYINGAFFVQSG-P  416

Query  426   NFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
                D+     D +       V  LTR++G L CRVG PC
Sbjct  417   ELKDRPFSQKDMIKAKPGSFVGRLTRYSGNLRCRVGEPC  455



>ref|XP_010485518.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   464 bits (1193),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 252/466 (54%), Positives = 315/466 (68%), Gaps = 28/466 (6%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASL--IHQVRRT  1453
              + V+ +A++IP    ++AE DE W  +A EA KH   AY P+P++I       H    T
Sbjct  9     LVCVICIASLIPTIRANVAETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYDNST  68

Query  1452  LSEAVAEDLT----------------TNTTGRHLLGSK-------KYRGPCNATNPIDRC  1342
               E   ED                  TN+T R L G +       K +GPC A+NPID+C
Sbjct  69    DVEGTEEDTAVDSAEDEDVIEMTSSPTNSTRRSLSGKRRGRGKWSKLKGPCTASNPIDKC  128

Query  1341  WRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTD-KSDDQSNPKPGTLRHAVIQKK  1165
             WRC  DWA  RKRL  C  GFGY+T GGK G+ Y VT  + DD  NP+PGTLRHAVIQK+
Sbjct  129   WRCQPDWAKRRKRLVRCVRGFGYRTTGGKRGRIYVVTSPRDDDTVNPRPGTLRHAVIQKE  188

Query  1164  PLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIF  985
             PLWIIF HDM+I+L QEL++   KTID RGA VHI+ GAGIT+Q+V N+IIHG+H+HHI 
Sbjct  189   PLWIIFKHDMSIRLSQELMIASHKTIDARGANVHIAYGAGITMQYVHNIIIHGLHVHHIV  248

Query  984   EGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITIS  805
               +GGLIRD +DHFG R ++DGDGISIFG++N+W+DH+SM  C DGLIDAI  STAITIS
Sbjct  249   TSSGGLIRDSIDHFGQRGQADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTAITIS  308

Query  804   NGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHW  625
             N HFT HNDVML GA D +  DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW
Sbjct  309   NSHFTHHNDVMLLGAQDHNQDDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHW  368

Query  624   NMYAIGGSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAF  448
              +YAIGGS  PTI+  GNRFIAPP   H +E+TKR      EWK W WRS  D ++ GA+
Sbjct  369   ELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYAPEAEWKNWNWRSDKDYFLNGAY  428

Query  447   FVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             F QSG+P+F   H +    +       V+ LT++AGAL+CRVG  C
Sbjct  429   FRQSGNPHFKCSHSR-QQMIKPKHGVAVSKLTKYAGALDCRVGKAC  473



>ref|XP_006484673.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=436

 Score =   462 bits (1189),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 244/440 (55%), Positives = 317/440 (72%), Gaps = 12/440 (3%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
              +F+ S A ++P    HIAE +EVWRRRA EA +  +Q Y+PNP  ++  L  +V+    
Sbjct  8     LIFLFSFATLMPCLSAHIAEVNEVWRRRAEEAMQTTEQYYDPNPVAVANHLNMKVQDLSK  67

Query  1446  EAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKT  1267
             +A+A+        R LL ++   G C ATNPID+CWRC  +WA +R+ LA CA+GFG K 
Sbjct  68    QAIAK--------RGLLNAES--GQCEATNPIDKCWRCKENWAEDRQALAGCALGFGSKA  117

Query  1266  KGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKT  1090
              GGK GK Y VTD SD D  NPK GTLRHAVIQK+PLWIIFA DMNIKL QELI+QG KT
Sbjct  118   TGGKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQELIVQGSKT  177

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             IDGRGA+VHI++GAGI +QFVKNVIIHGIHIH+I   +GG+IRD +DH G R +SDGD +
Sbjct  178   IDGRGAKVHIANGAGIMLQFVKNVIIHGIHIHNISPCSGGMIRDSVDHVGKRGQSDGDAV  237

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             SIFGSSN+W+DH+++   +DGLIDAI+ASTAITISN H ++H+  +L GA+D  T+DK M
Sbjct  238   SIFGSSNIWLDHLTLSQAHDGLIDAIQASTAITISNCHLSNHDKAILLGASDTFTEDKKM  297

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             Q+T+AFN F K L+QRMP  R+G+ HVVNNDY  W MYAIGG   PTI+ QGNRF A  +
Sbjct  298   QVTVAFNRFDKGLVQRMPCVRFGFAHVVNNDYNQWEMYAIGGLQGPTILSQGNRFFASNN  357

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAE  370
              + KE+TKR+  +PEE K+W WRS+GD+++ GA+F  SGDP      +++ + +      
Sbjct  358   QNTKEVTKRMNCSPEEGKSWIWRSEGDVFLNGAYFNSSGDPK-KQIQYQMDNVIKPESGT  416

Query  369   DVTWLTRFAGALNCRVGSPC  310
             +V  +T+FAGAL C+ G  C
Sbjct  417   EVERITKFAGALVCKPGQEC  436



>gb|KDP45476.1| hypothetical protein JCGZ_09725 [Jatropha curcas]
Length=462

 Score =   463 bits (1191),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 261/456 (57%), Positives = 319/456 (70%), Gaps = 18/456 (4%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
             F+FV     I P  +  + +YD+VW+ R+ EA K+  +AY+P+P  ++A +  QV   + 
Sbjct  8     FMFVFWFGFITPNLMADMKKYDKVWQERSEEARKNMMEAYDPDPIAVTAEVNEQVNHQID  67

Query  1446  EAVAEDLT---------------TNTTGRHLLGSK-KYRGPCNATNPIDRCWRCHADWAS  1315
                  + T                N T R L   K KY GPC A NPID+CWRC  +W  
Sbjct  68    GNAKTNSTINHTKGTNNFETGAEANNTRRSLKQKKQKYNGPCQANNPIDKCWRCRKNWVK  127

Query  1314  NRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHD  1138
             +R+RLA CA+GFG +T GGK GK Y VTD SD D   PKPGTLRHAVIQK+PLWIIFA D
Sbjct  128   DRQRLASCALGFGRRTTGGKGGKIYVVTDNSDHDCVEPKPGTLRHAVIQKEPLWIIFACD  187

Query  1137  MNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRD  958
             MNIKL QELIM  +KTIDGRG  VHIS GAGITIQFV N+IIHG+ IHHI    GG+IRD
Sbjct  188   MNIKLSQELIMAHNKTIDGRGFNVHISHGAGITIQFVSNIIIHGLRIHHICSTCGGMIRD  247

Query  957   GLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHND  778
              +DH GLRT SDGDGISIFGS+NVWIDHVSM NC DGLIDAI+ STAITISN HF++HND
Sbjct  248   SVDHVGLRTASDGDGISIFGSTNVWIDHVSMSNCQDGLIDAIQGSTAITISNCHFSNHND  307

Query  777   VMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSS  598
              +L GA+D  + D+ MQIT+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW +YAIGGS 
Sbjct  308   AILLGASDSFSGDQFMQITVAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWLLYAIGGSM  367

Query  597   HPTIICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFM  418
             HPTI+ QGN+F+AP D + KE+TKR      EWK W WRS+GD+ + GAFFV+SG+P   
Sbjct  368   HPTIVSQGNQFVAPDDKYIKEVTKRDYAPMSEWKKWNWRSEGDLMVNGAFFVESGEPALH  427

Query  417   DKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              +  K +  +        T +TRFAGAL+C+ G  C
Sbjct  428   LRPSKKF-MIKAKHGRFATQMTRFAGALDCKYGKKC  462



>ref|XP_004236194.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=435

 Score =   462 bits (1188),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 255/429 (59%), Positives = 310/429 (72%), Gaps = 21/429 (5%)
 Frame = -3

Query  1581  GHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTL--SEAVAEDLTTNTTG  1408
              HI E+DEVW++RA +A K A+ AY PNP  ++  L +QV + +  S++   DL      
Sbjct  23    AHIKEFDEVWKKRAQQAKKAARHAYNPNPKIVADHLNYQVDKAVRGSKSRRRDL------  76

Query  1407  RHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTD  1228
                   ++Y G C ATNPID+CWRC  +WA NR +L DC +GFG KT GGK GK Y V D
Sbjct  77    ------QRYSGKCMATNPIDQCWRCDPNWARNRMKLTDCVLGFGRKTTGGKGGKIYVVMD  130

Query  1227  KSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDG  1051
              SD++  NPKPGTLRHAVIQ +PLWIIFA +M IKL+QELIM  +KTID RG QVHI+ G
Sbjct  131   NSDNELVNPKPGTLRHAVIQPEPLWIIFAKNMVIKLNQELIMTSNKTIDARGRQVHIAHG  190

Query  1050  AGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHV  871
              G+ +QF+ NVII  +HIH    G GGLIRD + H+G R+KSDGDGISIFGS+NVWIDH+
Sbjct  191   GGLMLQFIHNVIISNLHIHDTKAGAGGLIRDSVSHYGYRSKSDGDGISIFGSTNVWIDHI  250

Query  870   SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRL  691
             SM NC DGLIDA+E STAITISN HFT HNDVMLFGA+D ++ D +MQITLAFNHFG  L
Sbjct  251   SMSNCQDGLIDAVEGSTAITISNCHFTKHNDVMLFGASDTASGDSVMQITLAFNHFGHGL  310

Query  690   IQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGT  511
              QRMPR R+G++HVVNNDYTHW MYAIGGS HPTI+ QGNRFIAPP+ + KE+TKR    
Sbjct  311   TQRMPRVRWGFVHVVNNDYTHWLMYAIGGSMHPTILSQGNRFIAPPNPNAKEVTKRDYAP  370

Query  510   PEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLY--DGVMTFKAEDVTWLTRFAGA  337
                WK W W+SQGD+ M GAFFV+SGDP    KH  L   D + +     V+ LT+F+G+
Sbjct  371   ENVWKNWVWKSQGDLMMNGAFFVESGDP----KHAFLKGPDMITSKPGSSVSSLTQFSGS  426

Query  336   LNCRVGSPC  310
             L C  G PC
Sbjct  427   LKCIEGRPC  435



>gb|KDO49230.1| hypothetical protein CISIN_1g036607mg [Citrus sinensis]
Length=436

 Score =   462 bits (1188),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 245/440 (56%), Positives = 316/440 (72%), Gaps = 12/440 (3%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
              +F+ S A ++P    HIAE +EVWRRRA EA +  +Q Y+PNP  ++  L  +V+    
Sbjct  8     LIFLFSFATLMPCLSAHIAEVNEVWRRRAEEAMQTTEQYYDPNPVAVANHLNMKVQDLSK  67

Query  1446  EAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKT  1267
             +A+A+        R LL ++   G C ATNPID+CWRC  +WA +R+ LA CA+GFG K 
Sbjct  68    QAIAK--------RGLLNAES--GQCAATNPIDKCWRCKENWAEDRQALAGCALGFGSKA  117

Query  1266  KGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKT  1090
              GGK GK Y VTD SD D  NPK GTLRHAVIQK+PLWIIFA DMNIKL QELI+QG KT
Sbjct  118   TGGKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQELIVQGSKT  177

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             IDGRGA+VHI++GAGI +QFVKNVIIHGIHIH+I   +GG+IRD +DH G R +SDGD +
Sbjct  178   IDGRGAKVHIANGAGIMLQFVKNVIIHGIHIHNISPCSGGMIRDSVDHVGKRGQSDGDAV  237

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             SIFGSSN+W+DH+++   +DGLIDAI+ASTAITISN H ++H+  +L GA+D  T+DK M
Sbjct  238   SIFGSSNIWLDHLTLSQAHDGLIDAIQASTAITISNCHLSNHDKAILLGASDTFTEDKKM  297

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             Q+T+AFN F K L+QRMP  R+G+ HVVNNDY  W MYAIGG   PTI+ QGNRF A  +
Sbjct  298   QVTVAFNRFDKGLVQRMPCVRFGFAHVVNNDYNQWEMYAIGGLQGPTILSQGNRFFASNN  357

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAE  370
              + KE+TKR+  +PEE K+W WRS+GD+ + GA+F  SGDP      +++ D +      
Sbjct  358   QNAKEVTKRMNCSPEEGKSWIWRSEGDVLLNGAYFNSSGDPK-KQIQYQMDDVIKPESGT  416

Query  369   DVTWLTRFAGALNCRVGSPC  310
             +V  +T+FAGAL C+ G  C
Sbjct  417   EVERITKFAGALVCKPGQEC  436



>sp|Q9LFP5.1|PLY19_ARATH RecName: Full=Probable pectate lyase 19; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAC01830.1| pectate lyase-like protein [Arabidopsis thaliana]
Length=472

 Score =   462 bits (1190),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 251/465 (54%), Positives = 318/465 (68%), Gaps = 27/465 (6%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASL--IHQVRRT  1453
              +F   +A +IP   G+I+E DE W +RA EA +   QAY  +P+ I       H    T
Sbjct  9     LMFTFCIAVLIPTIRGNISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYDNST  68

Query  1452  LSEAVAED-----------------LTTNTTGRHLLGS-----KKYRGPCNATNPIDRCW  1339
                   ED                  +TN+T R L G       K +GPC A+NPID+CW
Sbjct  69    DVTTPEEDGDAKPEEEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDKCW  128

Query  1338  RCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKP  1162
             RC +DWA  RK+L  C  GFG++T GGK G+ Y VT   D D  NPKPGTLRHAVIQK+P
Sbjct  129   RCRSDWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEP  188

Query  1161  LWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFE  982
             LWIIF +DM+I+L+QEL++   KTID RGA VH++ GAGIT+QFVKNVIIHG+HIHHI E
Sbjct  189   LWIIFKNDMSIRLNQELLINSHKTIDARGANVHVAHGAGITMQFVKNVIIHGLHIHHISE  248

Query  981   GNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISN  802
              +GG+IRD +DHFG+RT++DGDG+SI+GSSN+W+DH+SM  C DGLIDAI  ST ITISN
Sbjct  249   SSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISMSKCQDGLIDAIVGSTGITISN  308

Query  801   GHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWN  622
              HFT HNDVML GA + +  DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW 
Sbjct  309   SHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWE  368

Query  621   MYAIGGSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFF  445
             +YAIGGS  PTI+  GNRFIAPP   H +E+TKR   + +EWK W WRS  D++M GA+F
Sbjct  369   LYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYASEDEWKHWNWRSDKDVFMNGAYF  428

Query  444   VQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              QSG+P +   H +    +       V+ LT++AGAL+CRVG  C
Sbjct  429   RQSGNPQYKCAHTR-QQMIKPKNGLAVSKLTKYAGALDCRVGRRC  472



>ref|XP_010420164.1| PREDICTED: probable pectate lyase 19 isoform X2 [Camelina sativa]
Length=472

 Score =   462 bits (1190),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 252/465 (54%), Positives = 318/465 (68%), Gaps = 27/465 (6%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASL--IHQVRRT  1453
              +F+  +A +IP   G+I+E DE W RRA EA +   QAY  +P+ I       H    T
Sbjct  9     LMFMFCIAGLIPTIRGNISELDEYWSRRADEAREFTLQAYHSDPYEIVDHFHERHYDNST  68

Query  1452  LSEAVAED-----------------LTTNTTGRHLLGS-----KKYRGPCNATNPIDRCW  1339
              +    ED                  +T +T R L G       K +GPC A+NPID+CW
Sbjct  69    DATETEEDGGAKPEEEEEEGIKMVGNSTKSTRRSLRGKGKGKWSKLKGPCTASNPIDKCW  128

Query  1338  RCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKP  1162
             RC  +WA  RK+L  C  GFG++T GGK G+ Y VT   D D  NPKPGTLRHAVIQK+P
Sbjct  129   RCRTNWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEP  188

Query  1161  LWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFE  982
             LWIIF +DM+I+L QEL++   KTID RGA VHI+ GAGIT+QFVKNVIIHG+HIHHI E
Sbjct  189   LWIIFKNDMSIRLSQELLINSHKTIDARGANVHIAHGAGITMQFVKNVIIHGLHIHHISE  248

Query  981   GNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISN  802
              +GG+IRD +DHFG+RT++DGDG+SI+GSSN+W+DH+SM  C DGLIDAI  ST ITISN
Sbjct  249   SSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISMSKCQDGLIDAIVGSTGITISN  308

Query  801   GHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWN  622
              HFT HNDVML GA + +  DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW 
Sbjct  309   SHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWE  368

Query  621   MYAIGGSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFF  445
             +YAIGGS  PTI+  GNRFIAPP   H +E+TKR     +EWK W WRS+ D++M GA+F
Sbjct  369   LYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYAPEDEWKHWIWRSEKDVFMNGAYF  428

Query  444   VQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              QSG+P+F   H +    +       V+ LT++AGAL+CRVG  C
Sbjct  429   RQSGNPHFKCAHTR-KQMIKPKNGMAVSKLTKYAGALDCRVGKRC  472



>ref|XP_004514773.1| PREDICTED: probable pectate lyase 3-like [Cicer arietinum]
Length=454

 Score =   461 bits (1187),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 252/459 (55%), Positives = 312/459 (68%), Gaps = 30/459 (7%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVG-----------HIAEYDEVWRRRAAEAWKHAQQAYEPNPHNIS  1483
               LF++ +A + P               H+ E+D  W+ RA  A +  Q AY  +P+ +S
Sbjct  7     IILFLLCLAVLTPTLNANPLEKNEYWEEHVPEFDSYWQERAKVAKEANQAAYFVDPYAVS  66

Query  1482  ASLIHQVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKR  1303
              +         +  V+E +   +  R L G+    G C ATNPIDRCWRC  +WA+NR++
Sbjct  67    GNF--------TATVSEIIAAKSARRSLRGNNN--GTCMATNPIDRCWRCDPNWANNRQK  116

Query  1302  LADCAMGFGYKTKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIK  1126
             LADC  GFG  T+GGK G FY VTD SD++  +PKPGTLRHAV +  PLWI FA  M I 
Sbjct  117   LADCVQGFGRNTRGGKGGPFYVVTDPSDNELLDPKPGTLRHAVTRNGPLWITFARSMVIT  176

Query  1125  LHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDH  946
             L QELIM  DKTIDGRG +V+I++GAGIT+QFVKN+IIHGI I++I    GG+IRD   H
Sbjct  177   LQQELIMSSDKTIDGRGVEVYIANGAGITVQFVKNIIIHGIKIYNIKVKEGGMIRDSESH  236

Query  945   FGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLF  766
             +G RTKSDGDGISIFG+SNVWIDHVSMRNC DGLIDAI  STAITISNGHFTDHN+VMLF
Sbjct  237   YGFRTKSDGDGISIFGASNVWIDHVSMRNCTDGLIDAIMGSTAITISNGHFTDHNEVMLF  296

Query  765   GANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTI  586
             GA+D  + DKIMQITLAFNHFGKRL+QRMPR R+G++HVVNNDYTHW MYA+GGS +PTI
Sbjct  297   GASDDYSDDKIMQITLAFNHFGKRLVQRMPRARFGFVHVVNNDYTHWEMYAMGGSQNPTI  356

Query  585   ICQGNRFIAPPDI-------HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDP  427
             I +GNRFI P ++       + KE+TKR       WK W WRS  D ++ GA+F+QSG P
Sbjct  357   ISEGNRFIGPDNVMVGGNQLNLKEVTKREYTDESVWKNWQWRSINDEFLNGAYFIQSG-P  415

Query  426   NFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
                ++     D +       V  LTR++G L CRVG PC
Sbjct  416   ELKNRPFSKKDMITAKPGSYVGRLTRYSGNLQCRVGKPC  454



>ref|XP_006344502.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=435

 Score =   460 bits (1184),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 254/427 (59%), Positives = 309/427 (72%), Gaps = 17/427 (4%)
 Frame = -3

Query  1581  GHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTGRH  1402
              HI E+DEVW++RA +A K A+ AY PNP  ++  L +QV + +         +N+  R 
Sbjct  23    AHIKEFDEVWKKRAQQAKKAARHAYNPNPKIVADHLNYQVDKAVR-------GSNSRRRD  75

Query  1401  LLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKS  1222
             L    +Y G C ATNPID+CWRC  +WA NR +L DC +GFG KT GGK GK Y V D S
Sbjct  76    L---HRYSGKCMATNPIDQCWRCDPNWARNRMKLTDCVLGFGRKTTGGKGGKIYVVMDNS  132

Query  1221  DDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAG  1045
             D++  NPKPGTLRHAVIQ +PLWIIFA +M I+L+QELIM  +KTID RG QVHI+ G G
Sbjct  133   DNELVNPKPGTLRHAVIQPEPLWIIFAKNMVIRLNQELIMTSNKTIDARGRQVHIAHGGG  192

Query  1044  ITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSM  865
             + +QFV NV+I  +HIH    G+GGLIRD + H+G R+KSDGDGISIFGS+NVWIDH+SM
Sbjct  193   LMLQFVHNVLISNLHIHDTKAGSGGLIRDSVSHYGYRSKSDGDGISIFGSTNVWIDHISM  252

Query  864   RNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQ  685
              NC DGLIDA+E STAITISN HFT HNDVMLFGA+D ++ D +MQITLAFNHFG  L Q
Sbjct  253   SNCQDGLIDAVEGSTAITISNCHFTKHNDVMLFGASDTASGDSVMQITLAFNHFGHGLTQ  312

Query  684   RMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPE  505
             RMPR R+G++H VNNDYTHW MYAIGGS HPTI+ QGNRFIAPP+ + KE+TKR      
Sbjct  313   RMPRIRWGFVHAVNNDYTHWLMYAIGGSMHPTILSQGNRFIAPPNPNAKEVTKRDYAPEN  372

Query  504   EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLY--DGVMTFKAEDVTWLTRFAGALN  331
              WK W W+SQGD+ M GAFFV+SGDP    KH  L   D + +     V+ LTRF+G+L 
Sbjct  373   VWKNWVWKSQGDLMMNGAFFVESGDP----KHAFLKGPDMITSKPGSFVSSLTRFSGSLK  428

Query  330   CRVGSPC  310
             C  G PC
Sbjct  429   CIEGRPC  435



>ref|XP_002892805.1| hypothetical protein ARALYDRAFT_471616 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69064.1| hypothetical protein ARALYDRAFT_471616 [Arabidopsis lyrata subsp. 
lyrata]
Length=459

 Score =   461 bits (1187),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 255/457 (56%), Positives = 313/457 (68%), Gaps = 14/457 (3%)
 Frame = -3

Query  1647  FNKNNCFFLFVVSVAAII-PATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLI  1471
              N     F+F  S  AI+ P    ++A +D  W +R ++A K    +Y+PNP N++    
Sbjct  6     LNLGGYVFVFFSSFLAIVAPQVRANVAVFDSYWTQRQSDALKQTMGSYDPNPINVTNHFN  65

Query  1470  HQVRRTL--SEA---VAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRK  1306
             + V   +  SE+      +LT   +GR    +KK+ G C A NPID+CWRC  +WA NRK
Sbjct  66    YHVNIAVDVSESNNDTRRELTQVRSGRK---TKKHSGKCLAYNPIDKCWRCDRNWAKNRK  122

Query  1305  RLADCAMGFGYKTKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNI  1129
             +LADC +GFG +T GGK G  Y V D SDD   NPKPGTLRHAV +  PLWIIFA  M I
Sbjct  123   KLADCVLGFGRRTTGGKDGPIYVVKDASDDDLINPKPGTLRHAVTRNGPLWIIFARSMII  182

Query  1128  KLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLD  949
             KL QEL++  DKTIDGRGA+V+I +GAG+T+Q+V NVIIH I++ HI  GNGGLIRD  D
Sbjct  183   KLQQELMITSDKTIDGRGARVYIMEGAGLTLQYVNNVIIHNIYVKHIVPGNGGLIRDSED  242

Query  948   HFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVML  769
             H GLRTKSDGDGIS+FG++N+WIDHVSM  C DG+IDAI+ STA+TISN HFTDH +VML
Sbjct  243   HIGLRTKSDGDGISLFGATNIWIDHVSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVML  302

Query  768   FGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPT  589
             FGA D    DK MQIT+AFNHFGKRL QRMPRCRYG IHVVNNDYTHW MYAIGG+ +PT
Sbjct  303   FGARDEHVIDKKMQITVAFNHFGKRLEQRMPRCRYGTIHVVNNDYTHWEMYAIGGNMNPT  362

Query  588   IICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN-FMDK  412
             II QGNRFIAPP+   K+ITKR      EWK+W W+S+GD ++ GA+FVQSG  N +  K
Sbjct  363   IISQGNRFIAPPNEQAKQITKREYTPYTEWKSWNWQSEGDYFLNGAYFVQSGKANAWSSK  422

Query  411   HHKLYDGVMTFKAEDVTW---LTRFAGALNCRVGSPC  310
                        + +  T    LT  AGAL C+ G  C
Sbjct  423   PKNPLPNKFAIRPKPGTMVRKLTMDAGALGCKQGKAC  459



>ref|XP_003552513.1| PREDICTED: pectate lyase-like [Glycine max]
Length=440

 Score =   461 bits (1185),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 247/442 (56%), Positives = 307/442 (69%), Gaps = 14/442 (3%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
             F+F+V+ A  IP     IAE+D+  + +A EA + A ++YEP+P N++A     V R L 
Sbjct  10    FIFLVAFAISIPCLEAGIAEFDDFLKAQADEAHEIALRSYEPDPINVTAEFNIHVHRALM  69

Query  1446  EAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKT  1267
             E       +N T R L   +KYRGPC ATNPIDRCWRC  DWA +R RLA C  GFG + 
Sbjct  70    E------ESNDTRREL--KQKYRGPCLATNPIDRCWRCRKDWAQDRYRLASCGKGFGRRA  121

Query  1266  KGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKT  1090
              GG  GK Y VTD SDD+  NP+PGTLR+ V+Q++PLWIIFA  M I L  EL++  DKT
Sbjct  122   VGGLHGKIYVVTDSSDDEPINPRPGTLRYGVLQREPLWIIFAQSMVITLKFELLISSDKT  181

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             IDGRGA V I  GAG+ +QFV N+IIHGI I+ I    G ++RD  +H G+RT+ DGD +
Sbjct  182   IDGRGANVVIKGGAGLAMQFVNNIIIHGIRINKIKSMEGTMLRDLWNHVGIRTRCDGDAV  241

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             SIFGSSN+W+DH+S+  C DGLID ++ ST ITISN H T HNDVMLFGA+D    DKIM
Sbjct  242   SIFGSSNIWLDHLSLSECEDGLIDIVQGSTGITISNCHMTKHNDVMLFGASDTYAGDKIM  301

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             Q+T+AFNHFG+ LIQRMPRCR+G++HV+NNDYTHW MYAIGGSS PTI+ QGNRFIAP +
Sbjct  302   QVTVAFNHFGQGLIQRMPRCRWGFVHVINNDYTHWLMYAIGGSSEPTILSQGNRFIAPNN  361

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMT--FK  376
                KEIT R    PEEW  W W+S+ D++M GA F+QSG P      +K   G+M     
Sbjct  362   NAAKEITHRDYAPPEEWSKWQWKSENDLFMNGATFLQSGSPLGKLPFNK---GLMMKPRP  418

Query  375   AEDVTWLTRFAGALNCRVGSPC  310
               +   LTRFAGALNC+VG PC
Sbjct  419   GAEANRLTRFAGALNCKVGKPC  440



>ref|NP_197015.4| putative pectate lyase 19 [Arabidopsis thaliana]
 gb|AED92118.1| putative pectate lyase 19 [Arabidopsis thaliana]
Length=472

 Score =   462 bits (1188),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 253/475 (53%), Positives = 322/475 (68%), Gaps = 31/475 (7%)
 Frame = -3

Query  1656  MERFNKNNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISAS  1477
             M R +K     +F   +A +IP   G+I+E DE W +RA EA +   QAY  +P+ I   
Sbjct  3     MVRLSK----LMFTFCIAVLIPTIRGNISELDEYWSQRADEAREFTLQAYHSDPYEIVDH  58

Query  1476  L--IHQVRRTLSEAVAED-----------------LTTNTTGRHLLGS-----KKYRGPC  1369
                 H    T      ED                  +TN+T R L G       K +GPC
Sbjct  59    FHERHYDNSTDVTTPEEDGDAKPEEEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPC  118

Query  1368  NATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGT  1192
              A+NPID+CWRC +DWA  RK+L  C  GFG++T GGK G+ Y VT   D D  NPKPGT
Sbjct  119   TASNPIDKCWRCRSDWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGT  178

Query  1191  LRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNVii  1012
             LRHAVIQK+PLWIIF +DM+I+L+QEL++   KTID RGA VH++ GAGIT+QFVKNV+I
Sbjct  179   LRHAVIQKEPLWIIFKNDMSIRLNQELLINSHKTIDARGANVHVAHGAGITMQFVKNVVI  238

Query  1011  hgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAI  832
             HG+HIHHI E +GG+IRD +DHFG+RT++DGDG+SI+GSSN+W+DH+SM  C DGLIDAI
Sbjct  239   HGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISMSKCQDGLIDAI  298

Query  831   EASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIH  652
               ST ITISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK L+QRMPR R+G++H
Sbjct  299   VGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWGFVH  358

Query  651   VVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQ  475
             VVNNDYTHW +YAIGGS  PTI+  GNRFIAPP   H +E+TKR   + +EWK W WRS 
Sbjct  359   VVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYASEDEWKHWNWRSD  418

Query  474   GDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              D++M GA+F QSG+P +   H +    +       V+ LT++AGAL+CRVG  C
Sbjct  419   KDVFMNGAYFRQSGNPQYKCAHTR-QQMIKPKNGLAVSKLTKYAGALDCRVGRRC  472



>emb|CAN77957.1| hypothetical protein VITISV_021245 [Vitis vinifera]
Length=407

 Score =   459 bits (1181),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 259/443 (58%), Positives = 310/443 (70%), Gaps = 41/443 (9%)
 Frame = -3

Query  1635  NCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRR  1456
             N   + ++    I+PA   +I ++DEVW+ RA EA K A QAY P+P  ++         
Sbjct  5     NMRLVILIPFLVIVPAVTANIGDFDEVWQTRAEEARKAALQAYNPHPEKVTD--------  56

Query  1455  TLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFG  1276
                                          N    + +CWRC +DWASNR +LADC +GFG
Sbjct  57    -----------------------------NFNKKVHKCWRCRSDWASNRMKLADCVLGFG  87

Query  1275  YKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQG  1099
              KT GGK GK Y VTD SD D  NPKPGTLRHA IQ++PLWIIFAH M I+L++ELIM  
Sbjct  88    QKTTGGKGGKIYVVTDPSDNDMVNPKPGTLRHAAIQEEPLWIIFAHSMAIRLNEELIMTS  147

Query  1098  DKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdg  919
             +KTID RGA VHI++GAG+T+QFV N+IIHG+HIH I  GNGGLIRD   H+G RT+SDG
Sbjct  148   NKTIDARGANVHIANGAGLTLQFVHNIIIHGLHIHDIKVGNGGLIRDSASHYGFRTRSDG  207

Query  918   dgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKD  739
             DGISIFG++N+WIDH+SM NC DGLIDAI ASTAITISN HFT HN+VMLFGA+D  + D
Sbjct  208   DGISIFGATNIWIDHISMSNCADGLIDAIMASTAITISNCHFTHHNEVMLFGASDGYSGD  267

Query  738   KIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIA  559
              IMQIT+ FNHFG+ L QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTI+ QGNRFIA
Sbjct  268   AIMQITITFNHFGQGLTQRMPRCRWGFFHVVNNDYTHWLMYAIGGSHHPTILSQGNRFIA  327

Query  558   PPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTF  379
             PPDI+ KE+TKR       WK+WTWRSQGD+ M GAFFV+SGDPNF D  +K    +   
Sbjct  328   PPDINCKEVTKRDYSPESVWKSWTWRSQGDLMMNGAFFVESGDPNF-DFSNKYV--IRAK  384

Query  378   KAEDVTWLTRFAGALNCRVGSPC  310
                 VT LTRF+GAL+CR G PC
Sbjct  385   PGAFVTRLTRFSGALSCREGMPC  407



>gb|ABK28696.1| unknown [Arabidopsis thaliana]
Length=473

 Score =   461 bits (1187),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 253/475 (53%), Positives = 322/475 (68%), Gaps = 31/475 (7%)
 Frame = -3

Query  1656  MERFNKNNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISAS  1477
             M R +K     +F   +A +IP   G+I+E DE W +RA EA +   QAY  +P+ I   
Sbjct  3     MVRLSK----LMFTFCIAVLIPTIRGNISELDEYWSQRADEAREFTLQAYHSDPYEIVDH  58

Query  1476  L--IHQVRRTLSEAVAED-----------------LTTNTTGRHLLGS-----KKYRGPC  1369
                 H    T      ED                  +TN+T R L G       K +GPC
Sbjct  59    FHERHYDNSTDVTTPEEDGDAKPEEEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPC  118

Query  1368  NATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGT  1192
              A+NPID+CWRC +DWA  RK+L  C  GFG++T GGK G+ Y VT   D D  NPKPGT
Sbjct  119   TASNPIDKCWRCRSDWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGT  178

Query  1191  LRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNVii  1012
             LRHAVIQK+PLWIIF +DM+I+L+QEL++   KTID RGA VH++ GAGIT+QFVKNV+I
Sbjct  179   LRHAVIQKEPLWIIFKNDMSIRLNQELLINSHKTIDARGANVHVAHGAGITMQFVKNVVI  238

Query  1011  hgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAI  832
             HG+HIHHI E +GG+IRD +DHFG+RT++DGDG+SI+GSSN+W+DH+SM  C DGLIDAI
Sbjct  239   HGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISMSKCQDGLIDAI  298

Query  831   EASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIH  652
               ST ITISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK L+QRMPR R+G++H
Sbjct  299   VGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWGFVH  358

Query  651   VVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQ  475
             VVNNDYTHW +YAIGGS  PTI+  GNRFIAPP   H +E+TKR   + +EWK W WRS 
Sbjct  359   VVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYASEDEWKHWNWRSD  418

Query  474   GDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              D++M GA+F QSG+P +   H +    +       V+ LT++AGAL+CRVG  C
Sbjct  419   KDVFMNGAYFRQSGNPQYKCAHTR-QQMIKPKNGLAVSKLTKYAGALDCRVGRRC  472



>gb|KHN13652.1| Pectate lyase [Glycine soja]
Length=440

 Score =   460 bits (1183),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 247/442 (56%), Positives = 307/442 (69%), Gaps = 14/442 (3%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
             F+F+V+ A  IP     IAE+D+  + +A EA + A ++YEP+P N++A     V R L 
Sbjct  10    FIFLVAFAISIPCLEAGIAEFDDFLKAQADEAHEIALRSYEPDPINVTAEFNIHVHRALM  69

Query  1446  EAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKT  1267
             E       +N T R L   +KYRGPC ATNPIDRCWRC  DWA +R RLA C  GFG + 
Sbjct  70    E------ESNDTRREL--KQKYRGPCLATNPIDRCWRCRKDWAQDRYRLASCGKGFGRRA  121

Query  1266  KGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKT  1090
              GG  GK Y VTD SDD+  NP+PGTLR+ V+Q++PLWIIFA  M I L  EL++  DKT
Sbjct  122   VGGLHGKIYVVTDSSDDEPINPRPGTLRYGVLQREPLWIIFAQSMVITLKFELLISSDKT  181

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             IDGRGA V I  GAG+ +QFV N+IIHGI I+ I    G ++RD  +H G+RT+ DGD +
Sbjct  182   IDGRGANVVIKGGAGLAMQFVNNIIIHGIRINKIKSMEGTMLRDLWNHVGIRTRCDGDAV  241

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             SIFGSSN+W+DH+S+  C DGLID ++ ST ITISN H T HNDVMLFGA+D    DKIM
Sbjct  242   SIFGSSNIWLDHLSLSECEDGLIDIVQGSTGITISNCHMTKHNDVMLFGASDTYAGDKIM  301

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             Q+T+AFNHFG+ LIQRMPRCR+G++HV+NNDYTHW MYAIGGSS PTI+ QGNRFIAP +
Sbjct  302   QVTVAFNHFGQGLIQRMPRCRWGFVHVINNDYTHWLMYAIGGSSEPTILSQGNRFIAPNN  361

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMT--FK  376
                KEIT R    PEEW  W W+S+ D++M GA F+QSG P      +K   G+M     
Sbjct  362   NAAKEITHRDYAPPEEWSKWQWKSENDLFMNGATFLQSGAPLGKLPFNK---GLMMKPRP  418

Query  375   AEDVTWLTRFAGALNCRVGSPC  310
               +   LTRFAGALNC+VG PC
Sbjct  419   GAEANRLTRFAGALNCKVGKPC  440



>emb|CDX70590.1| BnaC03g06740D [Brassica napus]
Length=475

 Score =   461 bits (1185),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 251/468 (54%), Positives = 321/468 (69%), Gaps = 30/468 (6%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNI-------------  1486
              + V  +A +IP     ++E DE W +RA EA +   QAY  +P+ I             
Sbjct  9     LMLVFCIAGLIPTIQADMSELDEYWSQRADEAREFTLQAYHSDPYEIIDHFHERHYDNST  68

Query  1485  --------SASLIHQVRRTLSEAVAE-DLTTNTTGRHLLGS-----KKYRGPCNATNPID  1348
                     S +   +V   + E V   D +TN+T R L G       K +GPC A+NPID
Sbjct  69    DITPTEEASNAKPEEVENEVIEMVGSGDNSTNSTRRSLRGKGKGKWSKLKGPCTASNPID  128

Query  1347  RCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQ  1171
             +CWRC  +WA  RK+L  C  GFG+ T GGK G+ Y VT   D D  NP+PGTLRHAVIQ
Sbjct  129   KCWRCRKNWAKRRKKLVKCVRGFGHMTVGGKHGRIYVVTSNLDEDVVNPEPGTLRHAVIQ  188

Query  1170  KKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihh  991
             ++PLWIIF +DM+I+L+QEL++   KTID RGA VHI+ GAG+T+QFV++VIIHG+HIHH
Sbjct  189   EEPLWIIFKNDMSIRLNQELMINSFKTIDARGANVHIAHGAGVTMQFVRHVIIHGLHIHH  248

Query  990   IFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAIT  811
             I E +GG+IRD  DHFG+RT++DGDG+SI+GSSN+W+DHVSM  C DGLIDAI  STAIT
Sbjct  249   ISESSGGMIRDSADHFGMRTRADGDGLSIYGSSNIWLDHVSMSQCQDGLIDAIVGSTAIT  308

Query  810   ISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYT  631
             ISN HFT HNDVML GA +    DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYT
Sbjct  309   ISNSHFTHHNDVMLLGAQNTYDLDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYT  368

Query  630   HWNMYAIGGSSHPTIICQGNRFIAPPDI-HKKEITKRVKGTPEEWKTWTWRSQGDIYMEG  454
             HW +YAIGGS  PTI+ QGNRFIAPP + H +E+TKR     EEWK W WRS+ DI+M G
Sbjct  369   HWELYAIGGSQSPTILSQGNRFIAPPHLPHYREVTKRDYAPEEEWKHWNWRSEKDIFMNG  428

Query  453   AFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             A+F QSG+PN+ +  H   + +       V+ LT++AGAL+CRVG  C
Sbjct  429   AYFRQSGNPNY-ETDHTRRNMIKPKNGYAVSKLTKYAGALDCRVGRRC  475



>ref|XP_006306515.1| hypothetical protein CARUB_v10012514mg [Capsella rubella]
 gb|EOA39413.1| hypothetical protein CARUB_v10012514mg [Capsella rubella]
Length=455

 Score =   460 bits (1183),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 251/447 (56%), Positives = 309/447 (69%), Gaps = 9/447 (2%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTL  1450
             FFL ++++ A  P    H+A +D  W +R ++A K    +Y+PNP N++  L + V   +
Sbjct  11    FFLSLLAIVA--PQVKAHVAVFDSYWTQRQSDALKRTMGSYDPNPLNVTNHLNYHVNLAV  68

Query  1449  SEAVAEDLTTNTTGRHLLGSKKYR--GPCNATNPIDRCWRCHADWASNRKRLADCAMGFG  1276
               A + + T     +   G +K +  G C A NPID+CWRC  +WA+NRK+LADC +GFG
Sbjct  69    DAAESFNDTRRELTQVRSGHRKLKRSGKCLAYNPIDKCWRCDRNWANNRKKLADCVLGFG  128

Query  1275  YKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQG  1099
              KT GGK G  Y V D SD D  NPKPGTLR+AV +  PLWIIFA  M IKL QEL++  
Sbjct  129   RKTTGGKDGPIYVVNDASDNDLVNPKPGTLRYAVTRDGPLWIIFARSMIIKLQQELMIAS  188

Query  1098  DKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdg  919
             DKTIDGRGA+V+I +GAG+T+Q+V NVIIH I++ HI  GNGGLIRD   H GLRTKSDG
Sbjct  189   DKTIDGRGAKVYIMEGAGLTMQYVNNVIIHSIYVKHIVPGNGGLIRDSEHHVGLRTKSDG  248

Query  918   dgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKD  739
             DGIS+FG++N+WIDHVSM  C DG+IDAI+ STA+TISN HFTDH +VMLFGA D    D
Sbjct  249   DGISLFGATNIWIDHVSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVID  308

Query  738   KIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIA  559
             K MQIT+AFNHFGKRL QRMPRCRYG IHVVNNDYTHW MYAIGG+ +PTII QGNRFIA
Sbjct  309   KKMQITVAFNHFGKRLEQRMPRCRYGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIA  368

Query  558   PPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN-FMDKHHKLYDGVMT  382
             PP    K+ITKR      EWK+W W+S+GD ++ GA+FVQSG  N +  K          
Sbjct  369   PPSEQAKQITKREYTPLAEWKSWNWQSEGDYFLNGAYFVQSGKANAWSPKPQNPIPNKFA  428

Query  381   FKAEDVTW---LTRFAGALNCRVGSPC  310
              + +  T    LT  AGAL CR G  C
Sbjct  429   IRPKPGTMVRKLTMEAGALGCRQGQAC  455



>ref|XP_010496063.1| PREDICTED: probable pectate lyase 3 [Camelina sativa]
Length=455

 Score =   459 bits (1181),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 252/445 (57%), Positives = 311/445 (70%), Gaps = 8/445 (2%)
 Frame = -3

Query  1620  FVVSVAAIIPATVG-HIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTL--  1450
             F +S+ AI+   VG H+A +D  W +R ++A K    +Y+PNP N++    + V   +  
Sbjct  11    FFLSLLAIVAPQVGAHVAVFDSYWMQRKSDALKQTFGSYDPNPLNVTNHFNYHVNLAVDA  70

Query  1449  SEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYK  1270
             +E++ +     T  R     +K+ G C A NPID+CWRC  +WA+NRK+LADCA+GFG K
Sbjct  71    TESINDTRRELTQVRSRRKLQKHGGKCVAYNPIDKCWRCDRNWANNRKKLADCALGFGRK  130

Query  1269  TKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDK  1093
             T GGK G  Y VTD SD D  NPKPGTLR+AV +  PLWIIFA  M IKL QEL++  DK
Sbjct  131   TTGGKDGPIYVVTDASDNDLINPKPGTLRYAVTRDGPLWIIFARSMIIKLQQELMITSDK  190

Query  1092  TIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdg  913
             TIDGRGA+V+I +GAG+T+QFV NVIIH I++ HI  GNGGLIRD   H GLRTKSDGDG
Sbjct  191   TIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKHIVTGNGGLIRDSEQHIGLRTKSDGDG  250

Query  912   isifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKI  733
             IS+FG++N+WIDHVSM  C DG+IDAI+ STA+TISN HFTDH +VMLFGA D    DK 
Sbjct  251   ISLFGATNIWIDHVSMTRCEDGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDKK  310

Query  732   MQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP  553
             MQIT+AFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+  PTII QGNRFIAPP
Sbjct  311   MQITVAFNHFGKRLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMDPTIISQGNRFIAPP  370

Query  552   DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN-FMDKHHKLYDGVMTFK  376
             +   K+ITKR      EWK+W W+S+GD ++ GA+FVQSG  N +  K H         +
Sbjct  371   NEQAKQITKREYTPFVEWKSWNWQSEGDYFLNGAYFVQSGKANAWSAKLHNPIPNKFAIR  430

Query  375   AED---VTWLTRFAGALNCRVGSPC  310
              +    V  LT  AG L C+ G  C
Sbjct  431   PKPGMMVRKLTMEAGVLGCKHGKAC  455



>ref|XP_006439649.1| hypothetical protein CICLE_v10020193mg [Citrus clementina]
 gb|ESR52889.1| hypothetical protein CICLE_v10020193mg [Citrus clementina]
Length=437

 Score =   458 bits (1178),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 244/445 (55%), Positives = 309/445 (69%), Gaps = 14/445 (3%)
 Frame = -3

Query  1638  NNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVR  1459
             N    L +  +A+I P    +  ++DEVW++RA  A +HA +AY PNP  + +S    V 
Sbjct  5     NAGILLTLFGLASISPILKANTHDFDEVWQKRAENARRHALEAYHPNPEEVVSSFNKHVH  64

Query  1458  RTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGF  1279
                          ++T R+L G + Y G C ATNPID+CWRC  +WA+NRKRLADCA GF
Sbjct  65    MMFENG-------SSTRRYLRG-RPYTGRCAATNPIDQCWRCDRNWANNRKRLADCAQGF  116

Query  1278  GYKTKGGKSGKFYTVTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQ  1102
             G  T GGK+G FY VT+ +DD   NPKPGTLRHAVIQ++PLWI FAHDM I+L +EL++ 
Sbjct  117   GRGTIGGKNGPFYVVTNPADDDLVNPKPGTLRHAVIQERPLWITFAHDMVIRLSEELLIT  176

Query  1101  GDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsd  922
              DKTID RG+ V I +GA IT+QFVKN+IIHG+HI     G GG+IRD + H G R+ SD
Sbjct  177   SDKTIDARGSNVQIYNGAQITMQFVKNIIIHGLHIRKTKAGKGGMIRDSVSHHGFRSSSD  236

Query  921   gdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTK  742
             GDGIS+FG+S++WIDHVSM  C DGLIDA+  STAIT+SN HFT  + VML GA+D   +
Sbjct  237   GDGISMFGASHIWIDHVSMSGCQDGLIDAVMGSTAITVSNSHFTHQDHVMLLGASDSHPQ  296

Query  741   DKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFI  562
             D IMQ+T+AFNHFGK+L+QRMPR R+G+ HVVNNDYTHW MYAIGGS HPTI+ QGNRF+
Sbjct  297   DSIMQVTVAFNHFGKQLVQRMPRVRFGFAHVVNNDYTHWLMYAIGGSQHPTILSQGNRFL  356

Query  561   APPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSG-DPNFMDKHHKLYDGVM  385
             A    H KE+TKR       WKTW WRS+ D+ M GAFFV+SG D   +++     D + 
Sbjct  357   ASNSHHSKEVTKRDSSPQSVWKTWNWRSEMDLMMNGAFFVESGSDVRNVNRQ----DVIP  412

Query  384   TFKAEDVTWLTRFAGALNCRVGSPC  310
                 +  + +TRF+GALNC V  PC
Sbjct  413   AKPGKFASQMTRFSGALNCYVNKPC  437



>ref|XP_010492335.1| PREDICTED: probable pectate lyase 19 [Camelina sativa]
Length=499

 Score =   460 bits (1184),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 253/492 (51%), Positives = 323/492 (66%), Gaps = 54/492 (11%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNI-------------  1486
              +F+  +A +IP   G+I+E DE W RRA EA +   QAY  +P+ I             
Sbjct  9     LMFMFCIAGLIPTIRGNISELDEYWSRRADEAREFTLQAYHSDPYEIVDHFHERHYDNST  68

Query  1485  -----SASLIHQVRRTLSEAVAEDL----------------------------TTNTTGR  1405
                  +   + Q+      A  E+                             +TN+T R
Sbjct  69    DDATETEDGVAQLEEEHGGAKPEEEHGGVQLEEEHGGAKPEEEEEEGIKMVGNSTNSTRR  128

Query  1404  HLLGS-----KKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFY  1240
              L G       K +GPC A+NPID+CWRC  +WA  RK+L  C  GFG++T GGK G+ Y
Sbjct  129   SLRGKGKGKWSKLKGPCTASNPIDKCWRCRTNWAKRRKKLTRCVRGFGHRTTGGKRGRIY  188

Query  1239  TVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVH  1063
              VT   D D  NPKPGTLRHAVIQK+PLWIIF +DM+I+L+QEL++   KTID RGA VH
Sbjct  189   VVTSNLDEDMVNPKPGTLRHAVIQKEPLWIIFKNDMSIRLNQELLINSHKTIDARGANVH  248

Query  1062  ISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVW  883
             I+ GAGIT+QFVKNVIIHG+HIHHI E +GG+IRD +DHFG+RT++DGDG+SI+GSSN+W
Sbjct  249   IAHGAGITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIW  308

Query  882   IDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHF  703
             +DH+SM  C DGLIDAI  ST ITISN HFT HNDVML GA + +  DK MQ+T+A+NHF
Sbjct  309   LDHISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHF  368

Query  702   GKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP-DIHKKEITK  526
             GK L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+  GNRFIAPP   H +E+TK
Sbjct  369   GKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTK  428

Query  525   RVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRF  346
             R     +EWK WTWRS+ D++M GA+F QSG+P+F   H +    +       V+ LT++
Sbjct  429   RDYAPEDEWKHWTWRSEKDVFMNGAYFRQSGNPHFKSAHTR-KQMIKPKNGMAVSKLTKY  487

Query  345   AGALNCRVGSPC  310
             AGAL+CRVG  C
Sbjct  488   AGALDCRVGKRC  499



>ref|XP_010527872.1| PREDICTED: probable pectate lyase 3 isoform X2 [Tarenaya hassleriana]
Length=461

 Score =   459 bits (1180),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 253/454 (56%), Positives = 307/454 (68%), Gaps = 18/454 (4%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
              LF +S  A   +  GH+A +DE W +R  +A +   + Y+PNP N++    + V   + 
Sbjct  11    ILFAISSWAS-SSVRGHVAVFDEYWTQRQDKALRQTLRFYDPNPFNVTDHFNYHVNLAVE  69

Query  1446  EAVAEDLTTNTTGRHLLGSKKYRG----------PCNATNPIDRCWRCHADWASNRKRLA  1297
             E +      N T R LL   + RG           C A NPIDRCWRC   W+ NRK+LA
Sbjct  70    ETMKTG--NNGTRRELLQVGQSRGQHPKRRNLGGKCVAYNPIDRCWRCDPGWSKNRKKLA  127

Query  1296  DCAMGFGYKTKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIKLH  1120
             DCA+GFG KT GGK+G +Y VTD SDD   NPK GTLRHAV +++PLWI+FA  M IKL 
Sbjct  128   DCALGFGRKTTGGKAGPYYVVTDASDDDLLNPKAGTLRHAVTREEPLWIVFAKSMVIKLQ  187

Query  1119  QELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFG  940
             QELIM  DKTIDGRG +VHI+ GAG T+QFV NVIIH I+I +I  GNGGLIRD   HFG
Sbjct  188   QELIMTSDKTIDGRGVRVHITGGAGFTLQFVNNVIIHNIYIKNIVPGNGGLIRDSETHFG  247

Query  939   LRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGA  760
             LRT+SDGDGI+IFG++NVWIDHVSM +C DG+IDAI+ ST ITISN H TDH +VMLFG 
Sbjct  248   LRTRSDGDGINIFGATNVWIDHVSMSHCSDGMIDAIQGSTGITISNCHLTDHQEVMLFGG  307

Query  759   NDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIIC  580
              D    DK MQIT+AFNHFGKRL+QRMPRCRYG IHVVNNDYTHW MYAIGG+ +PTII 
Sbjct  308   TDKDVIDKKMQITVAFNHFGKRLVQRMPRCRYGLIHVVNNDYTHWEMYAIGGNMNPTIIS  367

Query  579   QGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK-  403
             QGNRFIAPP+   K++TKR      EWK+W W+S+GD ++ GA+FVQSG  N +    K 
Sbjct  368   QGNRFIAPPNEEAKQVTKREYTPFTEWKSWNWQSEGDYFLNGAYFVQSGRANALSAAPKN  427

Query  402   ---LYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
                    +       V  LT  AG L+C+   PC
Sbjct  428   PVPSKFAIRPQPGTLVRKLTMDAGVLSCKKRKPC  461



>ref|XP_009131435.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
 emb|CDX78607.1| BnaA03g05190D [Brassica napus]
Length=475

 Score =   459 bits (1181),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 250/468 (53%), Positives = 320/468 (68%), Gaps = 30/468 (6%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNI-------------  1486
              + V+ +  +IP     ++E DE W  RA EA +   QAY  +P+ I             
Sbjct  9     LMLVLCIVGLIPTIRADMSELDEYWSGRADEAREFTLQAYHSDPYEIIDHFHERHYDNST  68

Query  1485  --------SASLIHQVRRTLSEAVAE-DLTTNTTGRHLLGS-----KKYRGPCNATNPID  1348
                     + +   +V   + E V   D +TN+T R L G       K +GPC A+NPID
Sbjct  69    DVTPTEEDNNTKPEEVENEVIEMVGSGDNSTNSTRRSLRGKGKGKWSKLKGPCTASNPID  128

Query  1347  RCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQ  1171
             +CWRC  +W+  RK+L  C  GFG+ T GGK G+ Y VT   D D  NP+PGTLRHAVIQ
Sbjct  129   KCWRCRKNWSKRRKKLVKCVRGFGHMTVGGKHGRIYVVTSNLDEDMVNPEPGTLRHAVIQ  188

Query  1170  KKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihh  991
             K+PLWIIF +DM+I+L+QEL++   KTID RGA VHI+ GAG+T+QFV++VIIHG+HIHH
Sbjct  189   KEPLWIIFKNDMSIRLNQELLINSFKTIDARGANVHIAHGAGVTMQFVRHVIIHGLHIHH  248

Query  990   IFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAIT  811
             I E +GG+IRD  DHFG+RT++DGDG+SI+GSSN+W+DHVSM  C DGLIDAI  STAIT
Sbjct  249   ISESSGGMIRDSADHFGMRTRADGDGLSIYGSSNIWLDHVSMSQCQDGLIDAIVGSTAIT  308

Query  810   ISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYT  631
             ISN HFT HNDVML GA +    DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYT
Sbjct  309   ISNSHFTHHNDVMLLGAQNTYDLDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYT  368

Query  630   HWNMYAIGGSSHPTIICQGNRFIAPPDI-HKKEITKRVKGTPEEWKTWTWRSQGDIYMEG  454
             HW +YAIGGS  PTI+ QGNRFIAPP + H +E+TKR     EEWK W WRS+ DI+M G
Sbjct  369   HWELYAIGGSQSPTILSQGNRFIAPPHLPHYREVTKRDYAPEEEWKHWNWRSEKDIFMNG  428

Query  453   AFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             A+F QSGDPN+ +  H   + +       V+ LT++AGAL+CRVG  C
Sbjct  429   AYFRQSGDPNY-ETDHTRRNMIKPKNGYAVSKLTKYAGALDCRVGRRC  475



>ref|XP_010453638.1| PREDICTED: probable pectate lyase 19 [Camelina sativa]
Length=490

 Score =   459 bits (1182),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 253/483 (52%), Positives = 321/483 (66%), Gaps = 45/483 (9%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASL--IHQVRRT  1453
              +F+  +A +IP   G+I+E DE W RRA EA +   QAY  +P+ I       H    T
Sbjct  9     LMFMFCIAGLIPTIRGNISELDEYWSRRADEAREFTLQAYHSDPYEIVDHFHERHYDNST  68

Query  1452  LSEAVAED-----------------------------------LTTNTTGRHLLGS----  1390
              +    ED                                    +TN+T R L G     
Sbjct  69    DATETEEDGAVQLEEEHVGAQVEEEHGGAKPEEEEEEGIKMVGNSTNSTRRSLRGKGKGK  128

Query  1389  -KKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD-D  1216
               K +GPC A+NPID+CWRC ++WA  RK+L  C  GFG++T GGK G+ Y VT   D D
Sbjct  129   WSKLKGPCTASNPIDKCWRCRSNWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDED  188

Query  1215  QSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITI  1036
               NPKPGTLRHAVIQK+PLWIIF +DM+I+L+QEL++   KTID RGA VHI+ GAGIT+
Sbjct  189   MVNPKPGTLRHAVIQKEPLWIIFKNDMSIRLNQELLINSHKTIDARGANVHIAHGAGITM  248

Query  1035  QFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNC  856
             QFVKNVIIHG+HIHHI E +GG+IRD +DHFG+RT++DGDG+SI+GSSN+W+DH+SM  C
Sbjct  249   QFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISMSKC  308

Query  855   YDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMP  676
              DGLIDAI  ST ITISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK L+QRMP
Sbjct  309   QDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQRMP  368

Query  675   RCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEW  499
             R R+G++HVVNNDYTHW +YAIGGS  PTI+  GNRFIAPP   H +E+TKR     +EW
Sbjct  369   RIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYAPEDEW  428

Query  498   KTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVG  319
             K W WRS+ D++M GA+F QSG+P+F   H +    +       V+ LT++AGAL+CRVG
Sbjct  429   KHWNWRSEKDVFMNGAYFRQSGNPHFKCTHTR-KQMIKHKNGMAVSKLTKYAGALDCRVG  487

Query  318   SPC  310
               C
Sbjct  488   KRC  490



>emb|CDY53552.1| BnaA09g57110D [Brassica napus]
Length=495

 Score =   459 bits (1182),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 248/441 (56%), Positives = 307/441 (70%), Gaps = 11/441 (2%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
             +  V  +A ++P    ++A +D  W +R  +A K    +Y+PNP N++  L + V    +
Sbjct  11    YALVFLLAILVPHVQANVAVFDNYWTQRQGDALKQTIASYDPNPLNVTDHLNYHV----A  66

Query  1446  EAVAEDLTTNTTGRHLLGSKKYRGP--CNATNPIDRCWRCHADWASNRKRLADCAMGFGY  1273
              AV    +TN T R L+G K   G   C A NPID+CWRC  +W  NRK+LA+C +GFG 
Sbjct  67    LAVDATESTNNTRRELIGRKTQEGSGKCIAHNPIDKCWRCDPNWEKNRKKLAECVLGFGR  126

Query  1272  KTKGGKSGKFYTVTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGD  1096
             KT GGK G  Y V D SDD   NPKPGTLRHAV +  PLWIIFA+ M IKL QEL++  +
Sbjct  127   KTTGGKDGPIYVVNDSSDDDLVNPKPGTLRHAVTRDGPLWIIFANSMVIKLQQELMITSN  186

Query  1095  KTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgd  916
             KTIDGRGA+V+I +G G+T+QFV NVII+ I++ HI  GNGGLIRD  +H GLRTKSDGD
Sbjct  187   KTIDGRGAKVYIMEGVGLTLQFVNNVIINNIYVKHIIPGNGGLIRDSEEHVGLRTKSDGD  246

Query  915   gisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDK  736
             GIS+FG++NVWIDHVSM  C DG+IDAIE STA+TISN HFTDH +VMLFGA D    DK
Sbjct  247   GISLFGATNVWIDHVSMTRCTDGMIDAIEGSTAVTISNSHFTDHQEVMLFGAKDEHVIDK  306

Query  735   IMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAP  556
              MQIT+AFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+ +PTII QGNRFIAP
Sbjct  307   NMQITVAFNHFGKRLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAP  366

Query  555   PDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN-FMDKHHKLYDGVMTF  379
             P+   KE+TKR   +  +WK+W W+S+GD ++ GA+FVQSG PN +  K           
Sbjct  367   PNEQAKEVTKREYTSYTDWKSWNWQSEGDYFLNGAYFVQSGRPNAWSPKPKNPVPSKFAI  426

Query  378   KAED---VTWLTRFAGALNCR  325
             + +    V  LT  AGAL C 
Sbjct  427   RPKPGTMVRELTMDAGALGCE  447



>gb|KDO76053.1| hypothetical protein CISIN_1g013757mg [Citrus sinensis]
Length=437

 Score =   457 bits (1176),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 244/445 (55%), Positives = 309/445 (69%), Gaps = 14/445 (3%)
 Frame = -3

Query  1638  NNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVR  1459
             N    L +  +A+I P    +  ++DEVW++RA  A +HA +AY PNP  + +S    V 
Sbjct  5     NAGILLTLFGLASISPILKANTHDFDEVWQKRAENARRHALEAYHPNPEEVVSSFNKHVH  64

Query  1458  RTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGF  1279
                          ++T R+L G + Y G C ATNPID+CWRC  +WA+NRKRLADCA GF
Sbjct  65    MMFENG-------SSTRRYLRG-RPYTGRCAATNPIDQCWRCDRNWANNRKRLADCAQGF  116

Query  1278  GYKTKGGKSGKFYTVTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQ  1102
             G  T GGK+G FY VT+ +DD   NPKPGTLRHAVIQ++PLWI FAHDM I+L +EL++ 
Sbjct  117   GRGTIGGKNGPFYVVTNPADDDLVNPKPGTLRHAVIQERPLWITFAHDMVIRLSEELLIT  176

Query  1101  GDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsd  922
              DKTID RG+ V I +GA IT+QFVKN+IIHG+HI     G GG+IRD + H G R+ SD
Sbjct  177   SDKTIDARGSNVQIYNGAQITMQFVKNIIIHGLHIRKTKAGKGGMIRDSVSHHGFRSSSD  236

Query  921   gdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTK  742
             GDGIS+FG+S++WIDHVSM  C DGLIDA+  STAIT+SN HFT  + VML GA+D   +
Sbjct  237   GDGISMFGASHIWIDHVSMSGCQDGLIDAVMGSTAITVSNSHFTHQDHVMLLGASDGHPQ  296

Query  741   DKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFI  562
             D IMQ+T+AFNHFGK+L+QRMPR R+G+ HVVNNDYTHW MYAIGGS HPTI+ QGNRF+
Sbjct  297   DSIMQVTVAFNHFGKQLVQRMPRVRFGFAHVVNNDYTHWLMYAIGGSQHPTILSQGNRFL  356

Query  561   APPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSG-DPNFMDKHHKLYDGVM  385
             A    H KE+TKR       WKTW WRS+ D+ M GAFFV+SG D   +++     D + 
Sbjct  357   ASNSHHSKEVTKRDSSPQSVWKTWNWRSEMDLMMNGAFFVESGSDVRNVNRQ----DVIP  412

Query  384   TFKAEDVTWLTRFAGALNCRVGSPC  310
                 +  + +TRF+GALNC V  PC
Sbjct  413   AKPGKFASQMTRFSGALNCYVNKPC  437



>ref|XP_010476496.1| PREDICTED: probable pectate lyase 3 [Camelina sativa]
Length=455

 Score =   458 bits (1178),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 250/445 (56%), Positives = 309/445 (69%), Gaps = 8/445 (2%)
 Frame = -3

Query  1620  FVVSVAAIIPATVG-HIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTL--  1450
             F +S+ AI+   VG H+A +D  W +R  +A K    +Y+PNP N++    + V   +  
Sbjct  11    FFLSLLAIVAPQVGAHVAVFDSYWMQRKTDALKQTFGSYDPNPLNVTNHFNYHVNLAVDA  70

Query  1449  SEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYK  1270
             +E++ +     T  R     +K+ G C A NPID+CWRC  +WA+NRK+LA+CA+GFG K
Sbjct  71    TESINDTRRELTQVRSRRKLQKHGGKCVAYNPIDKCWRCDRNWANNRKKLAECALGFGRK  130

Query  1269  TKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDK  1093
             T GGK G  Y VTD SD D  NPKPGTLR+AV +  PLWIIFA  M IKL QEL++  DK
Sbjct  131   TTGGKDGPIYVVTDASDNDLINPKPGTLRYAVTRDGPLWIIFARSMIIKLQQELMITSDK  190

Query  1092  TIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdg  913
             TIDGRGA+V+I +GAG+T+QFV NVIIH I++  I  GNGGLIRD   H GLRTKSDGDG
Sbjct  191   TIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKQIVTGNGGLIRDSEQHIGLRTKSDGDG  250

Query  912   isifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKI  733
             IS+FG++N+WIDHVSM  C DG+IDAI+ STA+TISN HFTDH +VMLFGA D    DK 
Sbjct  251   ISLFGATNIWIDHVSMTRCEDGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDKK  310

Query  732   MQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP  553
             MQIT+AFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+  PTII QGNRFIAPP
Sbjct  311   MQITVAFNHFGKRLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMDPTIISQGNRFIAPP  370

Query  552   DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN-FMDKHHKLYDGVMTFK  376
             +   K+ITKR      EWK+W W+S+GD ++ GA+FVQSG  N +  K H         +
Sbjct  371   NEQAKQITKREYTPFVEWKSWNWQSEGDYFLNGAYFVQSGKANAWSAKLHNPIPSKFAIR  430

Query  375   AEDVTW---LTRFAGALNCRVGSPC  310
              +  T    LT  AG L C+ G  C
Sbjct  431   PKPGTMVRKLTMEAGVLGCKHGKEC  455



>ref|XP_010523445.1| PREDICTED: probable pectate lyase 3 [Tarenaya hassleriana]
Length=464

 Score =   458 bits (1178),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 247/451 (55%), Positives = 307/451 (68%), Gaps = 15/451 (3%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
             FLF  S++ +      H+A +DE W +R A A +   + Y+PNP N++    H V   + 
Sbjct  17    FLFS-SISDVAQPVKAHVAVFDEYWTQRQAHALRQTLRFYDPNPFNVTDHFNHHVNLAVE  75

Query  1446  EAVA-------EDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCA  1288
             EA         E     + G+HL   ++  G C A NPIDRCWRC  +WA +RK+LADC 
Sbjct  76    EATEASNGTRRELWQVGSGGKHL--KRRNTGKCVAYNPIDRCWRCQPNWAKDRKKLADCV  133

Query  1287  MGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQEL  1111
             +GFG +T GGK+G++Y VTD SD D  NP+PGTLRHAV + +PLWI+F   M I+L QEL
Sbjct  134   LGFGRRTTGGKAGRYYVVTDASDTDLINPRPGTLRHAVTRDEPLWIVFERSMVIRLAQEL  193

Query  1110  IMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRT  931
             I+  +KTIDGRG +VHI+ GAG+T+QFV NVIIH I+I  I  GNGGLIRD   HFGLRT
Sbjct  194   IITSNKTIDGRGVRVHITGGAGLTVQFVNNVIIHNIYIKDIVPGNGGLIRDSETHFGLRT  253

Query  930   KsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDL  751
             +SDGDGI+IFG++NVWIDHVSM +C DG+IDAI+ ST ITISN H TDH +VMLFGA D 
Sbjct  254   RSDGDGINIFGATNVWIDHVSMAHCSDGMIDAIQGSTGITISNCHLTDHGEVMLFGATDK  313

Query  750   STKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGN  571
                D  MQIT+AFNHFGKRL+QRMPRCRYG IHVVNNDYTHW MYAIGG+ +PTII QGN
Sbjct  314   DEIDTKMQITVAFNHFGKRLVQRMPRCRYGLIHVVNNDYTHWEMYAIGGNMNPTIISQGN  373

Query  570   RFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK----  403
             RFIAPP+   K++TKR      EWK+W W+S+GD ++ GA+FVQSG  N      K    
Sbjct  374   RFIAPPNEQAKQVTKREYTPYPEWKSWNWQSEGDYFLNGAYFVQSGRANAWSVAPKNPVP  433

Query  402   LYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
                 +       V  LT  +G L C+ G PC
Sbjct  434   SKFAIRPQPGTLVRKLTMNSGVLGCKKGKPC  464



>gb|KHG23093.1| hypothetical protein F383_29772 [Gossypium arboreum]
Length=385

 Score =   455 bits (1170),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 245/377 (65%), Positives = 285/377 (76%), Gaps = 2/377 (1%)
 Frame = -3

Query  1434  EDLTTNTTGRHLLGS-KKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGG  1258
             +D+ TN+T R L G  KKY GPC A NPIDRCWRC  +WA NRKRLA C +GFG+KT+GG
Sbjct  9     KDVITNSTRRDLRGKHKKYTGPCMAINPIDRCWRCRKNWAKNRKRLAKCVLGFGHKTRGG  68

Query  1257  KSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDG  1081
             K G++Y VTD SDD   NPKPGTLRHAVIQK+PLWIIFAHDMNIKL QEL++Q  KTIDG
Sbjct  69    KKGEYYLVTDNSDDDVVNPKPGTLRHAVIQKRPLWIIFAHDMNIKLSQELMVQSHKTIDG  128

Query  1080  RGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisif  901
             RGA VHI+ G GIT+QFV NVIIH IHIH +   +GGLIRD  DH+G RT  DGDGISIF
Sbjct  129   RGANVHIAYGCGITLQFVHNVIIHNIHIHRVVRSSGGLIRDSEDHYGFRTVGDGDGISIF  188

Query  900   gsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQIT  721
             GSS +W+DH+SM  C DGLIDAI+ STAITISN HFT H+ V+L GA+D  ++D+ MQ+T
Sbjct  189   GSSKIWLDHISMSECQDGLIDAIQGSTAITISNCHFTHHDHVILLGASDTYSRDQFMQVT  248

Query  720   LAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHK  541
             LAFNHFGK LIQRMPRCR+GY HVVNNDYTHW +YAIGGS+HPTII QGNRFIAP D   
Sbjct  249   LAFNHFGKELIQRMPRCRWGYFHVVNNDYTHWKLYAIGGSTHPTIISQGNRFIAPDDPLT  308

Query  540   KEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVT  361
             KEIT R   +  EW+ W WRS+GD +M GAFFV SG  +      K  D +    A  V 
Sbjct  309   KEITNRNYASESEWRHWVWRSEGDRFMNGAFFVTSGPHSPPRLKFKKKDIIKPKPAIFVG  368

Query  360   WLTRFAGALNCRVGSPC  310
              LT+F+G L C+ G  C
Sbjct  369   RLTKFSGTLKCKEGVKC  385



>gb|KHG05193.1| hypothetical protein F383_30875 [Gossypium arboreum]
Length=385

 Score =   455 bits (1170),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 245/377 (65%), Positives = 284/377 (75%), Gaps = 2/377 (1%)
 Frame = -3

Query  1434  EDLTTNTTGRHLLGS-KKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGG  1258
             +D+ TN+T R L G  KKY GPC A NPIDRCWRC  +WA NRKRLA C +GFG+KT+GG
Sbjct  9     KDVITNSTRRSLRGKHKKYTGPCMAINPIDRCWRCKKNWAKNRKRLAKCVLGFGHKTRGG  68

Query  1257  KSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDG  1081
             K G++Y VTD SDD   NPKPGTLRHAVIQK+PLWIIFAHDMNIKL +EL++Q  KTIDG
Sbjct  69    KKGEYYLVTDNSDDDVVNPKPGTLRHAVIQKRPLWIIFAHDMNIKLSKELMVQSHKTIDG  128

Query  1080  RGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisif  901
             RG  VHI+ G GIT+QFV NVIIH IHIH +   +GGLIRD  DH+G RT  DGDGISIF
Sbjct  129   RGVNVHIAYGCGITLQFVHNVIIHNIHIHRVVRSSGGLIRDSEDHYGYRTVGDGDGISIF  188

Query  900   gsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQIT  721
             GSS +W+DH+SM  C DGLIDAI+ STAITISN HFT H+ V+L GA+D  +KD+ MQ+T
Sbjct  189   GSSKIWLDHISMSECQDGLIDAIQGSTAITISNCHFTHHDHVILLGASDTYSKDQYMQVT  248

Query  720   LAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHK  541
             LAFNHFGK LIQRMPRCR+GY HVVNNDYTHW +YAIGGS+HPTII QGNRFIAP D   
Sbjct  249   LAFNHFGKELIQRMPRCRWGYFHVVNNDYTHWKLYAIGGSTHPTIISQGNRFIAPDDPLT  308

Query  540   KEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVT  361
             KEIT R      EW+ W WRS+GD +M GAFFV SG P+      K  D +    A  V 
Sbjct  309   KEITHRNYAPESEWRNWIWRSEGDRFMNGAFFVTSGPPSPPHLKLKKKDIIKAKPAIFVG  368

Query  360   WLTRFAGALNCRVGSPC  310
              LT+F+G L C+ G  C
Sbjct  369   RLTKFSGTLKCKEGVKC  385



>ref|XP_010670318.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=450

 Score =   456 bits (1174),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 250/448 (56%), Positives = 307/448 (69%), Gaps = 20/448 (4%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVGHIA-------EYDEVWRRRAAEAWKHAQQAYEPNPHNISASLI  1471
             F    V++  I   T+GH+        E+DE ++R+ AEA+  +  AY  +P  +     
Sbjct  15    FATIFVAIPTIQANTIGHVGNHTTKDTEHDEWFQRKLAEAYNASLLAYHHDPIEVMNHFN  74

Query  1470  HQVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADC  1291
             + V R L         TN+T R   G  KY+G C A NPIDRCWRC ADWA +RK+LADC
Sbjct  75    YHVHRALE-------GTNSTRR---GLNKYQGECKAQNPIDRCWRCKADWAVDRKKLADC  124

Query  1290  AMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQE  1114
               GFG +T GGK G +YTVTD SD D  NPKPGTLR AV+Q +PLWIIFA DM IKL  E
Sbjct  125   VKGFGRQTTGGKKGAYYTVTDPSDNDVVNPKPGTLRFAVLQPQPLWIIFAKDMTIKLKAE  184

Query  1113  LIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLR  934
             L++  DKTIDGRGAQV I+DGAGITIQF  NVIIH I IH I    GG+IRD  +H G+R
Sbjct  185   LMITSDKTIDGRGAQVQIADGAGITIQFANNVIIHNIKIHDIVPSTGGMIRDTNNHVGIR  244

Query  933   TKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGAND  754
                DGDGI++F SSN+W+DH+SM NC DGLID ++ASTAIT+SN HFT H+ V+LFGA+D
Sbjct  245   GADDGDGINVFASSNIWLDHLSMWNCKDGLIDIVKASTAITLSNNHFTRHDHVLLFGADD  304

Query  753   LSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQG  574
                 D+IMQI+LAFNHFGK L+QRMPRCR+G+ HV+NNDYTHW MYAIGG+SHPTII QG
Sbjct  305   KDPADEIMQISLAFNHFGKGLVQRMPRCRFGFFHVLNNDYTHWIMYAIGGTSHPTIISQG  364

Query  573   NRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYD  394
             NRFIAPP+   K IT R     ++WK W WRS+ D ++ GA+FV+SG P  +D+     D
Sbjct  365   NRFIAPPNPTAKMITNRNNVVGDDWKKWIWRSENDQFVNGAYFVESGHP--LDETRFKKD  422

Query  393   GVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              +       V  LTRF+G L CRVG  C
Sbjct  423   FIKAKPGTYVRRLTRFSGQLRCRVGQSC  450



>ref|XP_003613595.1| Pectate lyase [Medicago truncatula]
 gb|AES96553.1| pectate lyase P59-like protein [Medicago truncatula]
Length=449

 Score =   456 bits (1173),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 260/447 (58%), Positives = 309/447 (69%), Gaps = 20/447 (4%)
 Frame = -3

Query  1620  FVVSVAAIIPATVGHIAEY-DEV--------WRRRAAEAWKHAQQAYEPNPHNISASLIH  1468
              VV+++ ++ A V     Y D +        W+++A+ A     +AY P+P+ +S +L H
Sbjct  13    LVVTISTLVHANVKEDKAYWDRIAPVLNTTYWQQKASAAAMKNDKAYTPDPYAVSGNLSH  72

Query  1467  QVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCA  1288
              V          ++     GR  L   K RGPC ATNPIDRCWRC  +WA+NR++LADC 
Sbjct  73    SV---------SEMIIGNQGRRNLAGGKARGPCMATNPIDRCWRCDPNWANNRQKLADCV  123

Query  1287  MGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQEL  1111
              GFG KT GGK G  Y VTD SD D  NP+PGTLR  V +  PLWI FA  M I+L+QEL
Sbjct  124   KGFGRKTTGGKGGPIYVVTDPSDSDMVNPRPGTLRFGVTRNGPLWITFARSMTIRLNQEL  183

Query  1110  IMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRT  931
             IM   KTIDGRGA V I+ GAGITIQF++NVIIHGI I  I  G+GGLIRDG DHFG RT
Sbjct  184   IMTSHKTIDGRGADVTIASGAGITIQFIENVIIHGIKIFDIVVGSGGLIRDGQDHFGQRT  243

Query  930   KsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDL  751
              SDGDGISIFGSSN+WIDHVSMRNC DGL+DAI  STAITISN HFTDHN+VMLFGA+D 
Sbjct  244   MSDGDGISIFGSSNIWIDHVSMRNCRDGLVDAIMGSTAITISNSHFTDHNEVMLFGASDG  303

Query  750   STKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGN  571
                D+ MQIT+AFNHFGKRLIQRMPRCR+G+IHV+NNDYTHW MYAIGGS HPTII +GN
Sbjct  304   YGGDEKMQITVAFNHFGKRLIQRMPRCRFGFIHVLNNDYTHWEMYAIGGSMHPTIISEGN  363

Query  570   RFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDG  391
             RFIAP + H KEITKR       WK+W WRS  D+Y+ GAFF Q G P   D+     D 
Sbjct  364   RFIAPNNGHAKEITKREYVDESVWKSWQWRSINDVYLNGAFFRQGG-PELKDRPFSRKDM  422

Query  390   VMTFKAEDVTWLTRFAGALNCRVGSPC  310
             + +     V  LTR++G+L C VG PC
Sbjct  423   IKSRPGTYVGRLTRYSGSLRCIVGKPC  449



>ref|XP_006437462.1| hypothetical protein CICLE_v10031653mg [Citrus clementina]
 gb|ESR50702.1| hypothetical protein CICLE_v10031653mg [Citrus clementina]
Length=419

 Score =   455 bits (1170),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 242/430 (56%), Positives = 310/430 (72%), Gaps = 12/430 (3%)
 Frame = -3

Query  1596  IPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTN  1417
             +P    HIAE DEVWRRRA EA +  +Q Y+PNP  ++  L  +V+    +A+A+     
Sbjct  1     MPCLSAHIAEVDEVWRRRAEEAMQTTEQYYDPNPVAVANHLNMKVQDLSKQAIAK-----  55

Query  1416  TTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYT  1237
                R LL ++   G C ATNPID+CWRC  +WA +R+ LA CA+GFG K  GGK GK Y 
Sbjct  56    ---RGLLNAES--GQCEATNPIDKCWRCKENWAEDRQALAGCALGFGSKATGGKGGKIYE  110

Query  1236  VTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHI  1060
             VTD SD D  NPK GTLRHAVIQK+PLWIIFA DMNIKL QELI+QG KTIDGRGA+VHI
Sbjct  111   VTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQELIVQGSKTIDGRGAKVHI  170

Query  1059  SDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWI  880
             ++GAGI +QFVKNVIIHGIHIH+I   +GG+IRD +DH G R +SDGD +SIFGSSN+W+
Sbjct  171   ANGAGIMLQFVKNVIIHGIHIHNISPCSGGMIRDSVDHVGKRGQSDGDAVSIFGSSNIWL  230

Query  879   DHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFG  700
             DH+++   +DGLIDAI+ASTAITISN H ++H+  +L GA+D  T+DK MQ+T+AFN F 
Sbjct  231   DHLTLSQAHDGLIDAIQASTAITISNCHLSNHDKAILLGASDTFTEDKKMQVTVAFNRFD  290

Query  699   KRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRV  520
             K L+QRMP  R+G+ HVVNNDY  W MYAIGG   PTI+ QGNRF A  + + KE+TKR+
Sbjct  291   KGLVQRMPCVRFGFAHVVNNDYNQWEMYAIGGLQGPTILSQGNRFFASNNQNAKEVTKRM  350

Query  519   KGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAG  340
               +PEE K+W WRS+GD+ + GA+F  SGDP      +++ + +      +V  +T+FAG
Sbjct  351   NCSPEEGKSWIWRSEGDVLLNGAYFNSSGDPK-KQIQYQMDNVIKPESGTEVERITKFAG  409

Query  339   ALNCRVGSPC  310
             AL C+ G  C
Sbjct  410   ALVCKPGQEC  419



>ref|NP_186776.1| putative pectate lyase 7 [Arabidopsis thaliana]
 sp|Q9SRH4.1|PLY7_ARATH RecName: Full=Probable pectate lyase 7; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF03499.1|AC010676_9 putative pectate lyase [Arabidopsis thaliana]
 gb|AAF26147.1|AC008261_4 putative pectate lyase [Arabidopsis thaliana]
 gb|ABI93918.1| At3g01270 [Arabidopsis thaliana]
 gb|AEE73631.1| putative pectate lyase 7 [Arabidopsis thaliana]
Length=475

 Score =   456 bits (1174),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 252/468 (54%), Positives = 321/468 (69%), Gaps = 30/468 (6%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIA-EYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQ-----  1465
              + V+ +A++IP    ++A E DE W  +A EA KH   AY P+P+ I      +     
Sbjct  9     LVCVICIASLIPTIRANVADETDEYWVNKANEARKHTLMAYHPDPYEIVDHFHERHYDNS  68

Query  1464  --VRRTLSE-AVA---EDLT------TNTTGRHLLGS---------KKYRGPCNATNPID  1348
               V  T  E AVA   ED+       TN+T R L G           K  GPC A+NPID
Sbjct  69    TDVEGTEEEKAVASEEEDVIEMISSPTNSTRRSLTGRGKGKGKGKWSKLTGPCTASNPID  128

Query  1347  RCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTD-KSDDQSNPKPGTLRHAVIQ  1171
             +CWRC  DWA  RK+L  C  GFGY+T GGK G+ Y VT  + DD  NP+PGTLRHAVIQ
Sbjct  129   KCWRCQPDWARRRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDMVNPRPGTLRHAVIQ  188

Query  1170  KKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihh  991
             K+PLWI+F HDM+I+L QEL++  DKTID RGA VHI+ GAGIT+Q+V N+IIHG+H+HH
Sbjct  189   KEPLWIVFKHDMSIRLSQELMITSDKTIDARGANVHIAYGAGITMQYVHNIIIHGLHVHH  248

Query  990   IFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAIT  811
             I + +GGLIRD ++HFG R ++DGDGISIFG++N+W+DH+SM  C DGLIDAI  STAIT
Sbjct  249   IVKSSGGLIRDSINHFGHRGEADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTAIT  308

Query  810   ISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYT  631
             ISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYT
Sbjct  309   ISNSHFTHHNDVMLLGAQNNNMDDKKMQVTVAYNHFGKGLVQRMPRVRWGFVHVVNNDYT  368

Query  630   HWNMYAIGGSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEG  454
             HW +YAIGGS  PTI+  GNRFIAPP   H +E+TKR   +  EWK W WRS+ D++M  
Sbjct  369   HWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYASESEWKNWNWRSEKDVFMNN  428

Query  453   AFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             A+F QSG+P+F   H +    +       V+ LT++AGAL+CRVG  C
Sbjct  429   AYFRQSGNPHFKCSHSR-QQMIKPKNGMAVSKLTKYAGALDCRVGKAC  475



>gb|AAM60924.1| putative pectate lyase [Arabidopsis thaliana]
Length=475

 Score =   456 bits (1173),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 247/468 (53%), Positives = 319/468 (68%), Gaps = 30/468 (6%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAE-YDEVWRRRAAEAWKHAQQAYEPNPHNI------------  1486
              + V+ +A++IP    ++AE  DE W  +A EA KH   AY P+P+ I            
Sbjct  9     LVCVICIASLIPTIRANVAEETDEYWVNKANEARKHTLMAYHPDPYEIVDHFHERHYDNS  68

Query  1485  ---SASLIHQVRRTLSEAVAEDLT--TNTTGRHLLGS---------KKYRGPCNATNPID  1348
                  +   +   +  E V E ++  TN+T R L G           K  GPC A+NPID
Sbjct  69    TDVEGTEEEKAIASEEEDVIEMISSPTNSTRRSLTGRGKGKGKGKWSKLTGPCTASNPID  128

Query  1347  RCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTD-KSDDQSNPKPGTLRHAVIQ  1171
             +CWRC  DWA  RK+L  C  GFGY+T GGK G+ Y VT  + DD  NP+PGTLRHAVIQ
Sbjct  129   KCWRCQPDWARRRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDMVNPRPGTLRHAVIQ  188

Query  1170  KKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihh  991
             K+PLWI+F HDM+I+L QEL++  DKTID RGA VHI+ GAGIT+Q+V N+IIHG+H+HH
Sbjct  189   KEPLWIVFKHDMSIRLSQELMITSDKTIDARGANVHIAYGAGITMQYVHNIIIHGLHVHH  248

Query  990   IFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAIT  811
             I + +GGLIRD ++HFG R ++DGDGISIFG++N+W+DH+SM  C DGLIDAI  STAIT
Sbjct  249   IVKSSGGLIRDSINHFGHRGEADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTAIT  308

Query  810   ISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYT  631
             ISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYT
Sbjct  309   ISNSHFTHHNDVMLLGAQNNNMDDKKMQVTVAYNHFGKGLVQRMPRVRWGFVHVVNNDYT  368

Query  630   HWNMYAIGGSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEG  454
             HW +YAIGGS  PTI+  GNRFIAPP   H +E+TKR   +  EWK W WRS+ D++M  
Sbjct  369   HWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYASESEWKNWNWRSEKDVFMNN  428

Query  453   AFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             A+F QSG+P+F   H +    +       V+ LT++AGAL+CRVG  C
Sbjct  429   AYFRQSGNPHFKCSHSR-QQMIKPKNGMAVSKLTKYAGALDCRVGKAC  475



>ref|XP_003613596.1| Pectate lyase [Medicago truncatula]
 gb|AES96554.1| pectate lyase P59-like protein [Medicago truncatula]
Length=449

 Score =   455 bits (1171),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 255/448 (57%), Positives = 313/448 (70%), Gaps = 22/448 (5%)
 Frame = -3

Query  1620  FVVSVAAIIPATVGHIAEY-DEV--------WRRRAAEAWKHAQQAYEPNPHNISASLIH  1468
              VV+++ ++ A V     Y D +        W+++A+ A K   +AY P+P+ +S +L  
Sbjct  13    LVVTISTLVHANVKEDKAYWDRILPTLNTTYWQKKASIAAKANDKAYTPDPYAVSGNL--  70

Query  1467  QVRRTLSEAVAEDLTTNTTGR-HLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADC  1291
                   S  V+E +     GR +L+G       C ATNPIDRCWRC  +WA+NRK+LADC
Sbjct  71    ------SSTVSEMIIGGINGRRNLVGLGN--SSCMATNPIDRCWRCDPNWANNRKKLADC  122

Query  1290  AMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQE  1114
               GFG KT GGK G  Y VTD SD D  NP+PGTLRHAV +  PLWIIFA  M I+L+QE
Sbjct  123   VQGFGRKTTGGKDGPIYVVTDPSDSDLVNPRPGTLRHAVTRNGPLWIIFARSMKIRLNQE  182

Query  1113  LIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLR  934
             LIM G+KTIDGRGA V I++GAGITIQF++NVIIHGI I+ I  G+GGL+RD  DH+GLR
Sbjct  183   LIMAGNKTIDGRGADVTIANGAGITIQFIENVIIHGIKIYDIMVGSGGLVRDSEDHYGLR  242

Query  933   TKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGAND  754
             T SDGDGISIFGSS++WIDHVSMRNC DGLIDAI  STAITISN HFTDHN+VMLFGA+D
Sbjct  243   TISDGDGISIFGSSHIWIDHVSMRNCRDGLIDAIMGSTAITISNSHFTDHNEVMLFGASD  302

Query  753   LSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQG  574
                 D+ MQIT+ FN FGK+LIQRMPRCR+G+IHV+NN Y  W MYAIGG+ HPTII +G
Sbjct  303   TYDGDQKMQITVVFNRFGKKLIQRMPRCRFGFIHVLNNFYNRWEMYAIGGTMHPTIISEG  362

Query  573   NRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYD  394
             N+FIAP + H KEITKR      EWKTW WRS  D+Y+ GAFF QSG    +++     D
Sbjct  363   NKFIAPNNGHAKEITKRTLVPEAEWKTWQWRSINDLYLNGAFFRQSG-AELINRPFSNKD  421

Query  393   GVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              +       V  LTR++ +L CRVG PC
Sbjct  422   MIKAKPGSYVGRLTRYSRSLRCRVGKPC  449



>ref|XP_008786760.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=467

 Score =   456 bits (1172),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 254/431 (59%), Positives = 308/431 (71%), Gaps = 18/431 (4%)
 Frame = -3

Query  1581  GHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTGRH  1402
              ++AE D+ W+++A EA+  ++ AY P+P  ++      V   L++A       N+T R 
Sbjct  48    ANVAELDDHWQKKAEEAFARSRAAYHPDPEGVTNHFNQAVHLALAQA------RNSTRRG  101

Query  1401  L--LGSKKYR-GPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVT  1231
             L  + + K+R G C A+NPIDRCWRC  DW  +RK+LA C  GFG    GG+ G FY VT
Sbjct  102   LKAVRADKFRQGQCVASNPIDRCWRCQKDWIKDRKKLASCGKGFGRNAVGGRDGDFYVVT  161

Query  1230  DKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISD  1054
             D SD D  NPK GTLR  VIQ +PLWIIFA DM I+L +ELI+  +KTID RGA VHI+ 
Sbjct  162   DPSDNDLVNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELIINSNKTIDARGANVHIAF  221

Query  1053  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  874
             GA I+IQFV+NVIIHG+HIH I  GNGG+IRD L H+G RTKSDGDGISI+GSS++WIDH
Sbjct  222   GAQISIQFVQNVIIHGLHIHDIKPGNGGMIRDSLRHYGFRTKSDGDGISIYGSSDIWIDH  281

Query  873   VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKR  694
              SMRNC DGLIDAIEASTAITISN HF  HNDV+LFGA+D + +D IMQ+T+AFNHFGK 
Sbjct  282   CSMRNCADGLIDAIEASTAITISNCHFARHNDVLLFGASDSNERDSIMQVTVAFNHFGKG  341

Query  693   LIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKG  514
             L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII QGNRF+APP    KEITKR   
Sbjct  342   LVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSQHPTIISQGNRFLAPPMRFAKEITKRDYA  401

Query  513   TPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTW---LTRFA  343
             T + WK WTWRS+GD+   GAFF +SG P   +     +D     KA+  TW   LTR+A
Sbjct  402   TEDVWKHWTWRSEGDLMQNGAFFRESGAPAKNN-----FDKKDFIKAKPGTWVKRLTRYA  456

Query  342   GALNCRVGSPC  310
             G L CR G  C
Sbjct  457   GPLGCRAGRAC  467



>ref|NP_172894.1| putative pectate lyase 3 [Arabidopsis thaliana]
 sp|Q9M9S2.1|PLY3_ARATH RecName: Full=Probable pectate lyase 3; AltName: Full=Pectate 
lyase A2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF43942.1|AC012188_19 Strong similarity to Pectate Lyase Precursor from Lilium longiflorum 
gi|730290 and contains a Pectate lyase PF|00544 domain. 
EST gb|AW004514 comes from this gene [Arabidopsis thaliana]
 gb|AAQ62871.1| At1g14420 [Arabidopsis thaliana]
 dbj|BAD43564.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43610.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43654.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43743.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43876.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43899.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29161.1| putative pectate lyase 3 [Arabidopsis thaliana]
Length=459

 Score =   455 bits (1171),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 252/457 (55%), Positives = 311/457 (68%), Gaps = 14/457 (3%)
 Frame = -3

Query  1647  FNKNNCFFLFVVSVAAII-PATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLI  1471
              N     F+F  S  AI+ P   G++A +D  W +R ++A K    +Y+P+P N++    
Sbjct  6     LNLGGYVFVFFSSFLAIVAPQVRGNVAVFDSYWTQRQSDALKQTIGSYDPHPLNVTNHFN  65

Query  1470  HQVRRTLSEAVAE-----DLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRK  1306
             + V   +  + +      +LT   +GR    + K  G C A NPID CWRC  +WA+NRK
Sbjct  66    YHVNIAVDASESRNDTRRELTQVRSGRK---THKSSGKCLAYNPIDNCWRCDRNWANNRK  122

Query  1305  RLADCAMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNI  1129
             +LADC +GFG +T GGK G  Y V D SD D  NPKPGTLRHAV +  PLWIIFA  M I
Sbjct  123   KLADCVLGFGRRTTGGKDGPIYVVKDASDNDLINPKPGTLRHAVTRDGPLWIIFARSMII  182

Query  1128  KLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLD  949
             KL QEL++  DKTIDGRGA+V+I +GAG+T+QFV NVIIH I++ HI  GNGGLIRD   
Sbjct  183   KLQQELMITSDKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKHIVPGNGGLIRDSEA  242

Query  948   HFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVML  769
             H GLRTKSDGDGIS+FG++N+WIDHVSM  C DG+IDAI+ STA+TISN HFTDH +VML
Sbjct  243   HIGLRTKSDGDGISLFGATNIWIDHVSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVML  302

Query  768   FGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPT  589
             FGA D    DK MQIT+AFNHFGKRL QRMPRCRYG IHVVNNDYTHW MYAIGG+ +PT
Sbjct  303   FGARDEHVIDKKMQITVAFNHFGKRLEQRMPRCRYGTIHVVNNDYTHWEMYAIGGNMNPT  362

Query  588   IICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN-FMDK  412
             II QGNRFIAPP+   K+ITKR      EWK+W W+S+GD ++ GA+FVQSG  N +  K
Sbjct  363   IISQGNRFIAPPNEEAKQITKREYTPYGEWKSWNWQSEGDYFLNGAYFVQSGKANAWSSK  422

Query  411   HHKLYDGVMTFKAEDVTW---LTRFAGALNCRVGSPC  310
                      T + +  T    LT  AG L C++G  C
Sbjct  423   PKTPLPNKFTIRPKPGTMVRKLTMDAGVLGCKLGEAC  459



>gb|AAB69759.1| putative pectate lyase [Arabidopsis thaliana]
Length=459

 Score =   455 bits (1171),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 251/457 (55%), Positives = 310/457 (68%), Gaps = 14/457 (3%)
 Frame = -3

Query  1647  FNKNNCFFLFVVSVAAII-PATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLI  1471
              N     F+F  S  AI+ P   G++A +D  W +R ++A K    +Y+P+P N++    
Sbjct  6     LNLGGYVFVFFSSFLAIVAPQVRGNVAVFDSYWTQRQSDALKQTIGSYDPHPLNVTNHFN  65

Query  1470  HQVRRTLSEAVAE-----DLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRK  1306
             + V   +  + +      +LT   +GR    + K  G C A NPID CWRC  +WA+NRK
Sbjct  66    YHVNIAVDASESRNDTRRELTQVRSGRK---THKSSGKCLAYNPIDNCWRCDRNWANNRK  122

Query  1305  RLADCAMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNI  1129
             +LADC +GFG +T GGK G  Y V D SD D  NPKPGTLRHAV +  PLWIIFA  M I
Sbjct  123   KLADCVLGFGRRTTGGKDGPIYVVKDASDNDLINPKPGTLRHAVTRDGPLWIIFARSMII  182

Query  1128  KLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLD  949
             KL QEL++  DKTIDGRGA+V+I +GAG+T+QFV NVIIH I++ HI  GNGGLIRD   
Sbjct  183   KLQQELMITSDKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKHIVPGNGGLIRDSEA  242

Query  948   HFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVML  769
             H GLRTKSDGDGIS+ G++N+WIDHVSM  C DG+IDAI+ STA+TISN HFTDH +VML
Sbjct  243   HIGLRTKSDGDGISLIGATNIWIDHVSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVML  302

Query  768   FGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPT  589
             FGA D    DK MQIT+AFNHFGKRL QRMPRCRYG IHVVNNDYTHW MYAIGG+ +PT
Sbjct  303   FGARDEHVIDKKMQITVAFNHFGKRLEQRMPRCRYGTIHVVNNDYTHWEMYAIGGNMNPT  362

Query  588   IICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN-FMDK  412
             II QGNRFIAPP+   K+ITKR      EWK+W W+S+GD ++ GA+FVQSG  N +  K
Sbjct  363   IISQGNRFIAPPNEEAKQITKREYTPYGEWKSWNWQSEGDYFLNGAYFVQSGKANAWSSK  422

Query  411   HHKLYDGVMTFKAEDVTW---LTRFAGALNCRVGSPC  310
                      T + +  T    LT  AG L C++G  C
Sbjct  423   PKTPLPNKFTIRPKPGTMVRKLTMDAGVLGCKLGEAC  459



>gb|AAQ62996.1| oil palm polygalacturonase allergen PEST361 [Elaeis guineensis]
Length=447

 Score =   454 bits (1169),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 259/440 (59%), Positives = 312/440 (71%), Gaps = 28/440 (6%)
 Frame = -3

Query  1581  GHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTGRH  1402
              +I E+D+ W+++A EA   ++ AY P+P  ++      V   LSEA       N+T R 
Sbjct  26    ANIVEFDDHWQKKAEEALARSRAAYNPDPEAVTHDFNKAVHLALSEA------RNSTRRT  79

Query  1401  L--LGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTD  1228
             L  +   K++GPC ATNPIDRCWRC  +W ++RK+LA CA GFG    GGK+G FY VTD
Sbjct  80    LRSVHRNKFKGPCVATNPIDRCWRCQKNWINHRKKLATCAKGFGRNAIGGKNGDFYVVTD  139

Query  1227  KSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDG  1051
              SDD   NPK GTLR  VIQ +PLWIIFA DM I+L +EL++  +KTIDGRGA VHI+ G
Sbjct  140   PSDDDLVNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELMINSNKTIDGRGANVHIAFG  199

Query  1050  AGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHV  871
             A ITIQFV +VIIHGIHIH I   NGG+IRD L HFG+RTKSDGDGISI+GSS++WIDH 
Sbjct  200   AQITIQFVHDVIIHGIHIHDIRPSNGGIIRDSLQHFGIRTKSDGDGISIYGSSDIWIDHC  259

Query  870   SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRL  691
             S+RNC DGLIDAIEASTAITISN HFT HNDV+LFGA+D +  D +MQ T+AFNHFGK L
Sbjct  260   SLRNCADGLIDAIEASTAITISNCHFTHHNDVLLFGASDSNEHDSMMQATVAFNHFGKGL  319

Query  690   IQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGT  511
             +QRMPRCR+G+ HVVNNDYT W MYAIGGS HPTII QGNRF+AP  +  KE+TKR   T
Sbjct  320   VQRMPRCRWGFFHVVNNDYTQWIMYAIGGSQHPTIISQGNRFVAPRMLFSKEVTKRDYAT  379

Query  510   PEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTW---LTRFAG  340
              + WK WTWRS+GD+   GAFF +SG+PN      + +D     KA+  TW   LTRFAG
Sbjct  380   EDVWKQWTWRSEGDLMQNGAFFRESGNPN-----ARKFDRKDFIKAKPGTWVRRLTRFAG  434

Query  339   ALNCRVGSPC*IALLHSRPA  280
              L            LHSRPA
Sbjct  435   PLG-----------LHSRPA  443



>gb|AAQ62997.1| oil palm polygalacturonase allergen PEST411 [Elaeis guineensis]
Length=447

 Score =   454 bits (1169),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 263/459 (57%), Positives = 310/459 (68%), Gaps = 22/459 (5%)
 Frame = -3

Query  1656  MERFNKNNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISAS  1477
             ME       FFL  +   A    +   I E D+ W+++A EA   ++ AY P+P  ++  
Sbjct  1     MEGVRTKPSFFLCSLIFLASAALSGADIPELDDHWQKKAEEALARSRAAYHPDPEAVTNH  60

Query  1476  LIHQVRRTLSEAVAEDLTTNTTGRHL--LGSKKYRGPCNATNPIDRCWRCHADWASNRKR  1303
                 V   L+EA       N+T R L  +G KK++G C ATNPIDRCWRC  +W  +RK+
Sbjct  61    FNKAVHLALAEA------RNSTRRSLRAVGVKKFKGKCVATNPIDRCWRCQKNWIKHRKK  114

Query  1302  LADCAMGFGYKTKGGKSGKFYTVTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIK  1126
             LA C  GFG    GGK+G FY VTD SDD   NPK GTLR  VIQ +PLWI+FA DM I+
Sbjct  115   LATCGKGFGRHATGGKAGDFYVVTDPSDDDLVNPKFGTLRWGVIQDRPLWIVFARDMIIR  174

Query  1125  LHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDH  946
             L +EL++  +KTID RGA VHI+ GA ITIQFV NVIIHG+HIH I   NGG+IRD L H
Sbjct  175   LSEELMINSNKTIDARGANVHIAYGAQITIQFVNNVIIHGLHIHDIKPSNGGMIRDSLHH  234

Query  945   FGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLF  766
             FGLRTKSDGDGISI+GSS+VWIDH SMRNC DGLIDAIE STAITISN HFT HNDV+LF
Sbjct  235   FGLRTKSDGDGISIYGSSDVWIDHCSMRNCADGLIDAIEGSTAITISNCHFTHHNDVLLF  294

Query  765   GANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTI  586
             GA+D +  D IMQ T+AFNHFGK L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTI
Sbjct  295   GASDSNENDSIMQATVAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSKHPTI  354

Query  585   ICQGNRFIAPPDIHKKEITKRVK----GTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFM  418
             I QGNRFIAPP    KE+TK V      T + WK WTWRS+GD+   GAFF  S      
Sbjct  355   ISQGNRFIAPPLRFAKEVTKEVTKRDYATEDVWKQWTWRSEGDLMQNGAFFA-SLVLKHK  413

Query  417   DKHHKLYDGVMTFKAEDVTW---LTRFAGALNCRVGSPC  310
             D H K +      +A+  TW   LTRFAG L C+ G  C
Sbjct  414   DVHRKDF-----IRAKPGTWVRRLTRFAGPLGCKAGRAC  447



>ref|XP_009121613.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
 emb|CDX69550.1| BnaA10g18990D [Brassica napus]
Length=499

 Score =   456 bits (1173),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 259/502 (52%), Positives = 329/502 (66%), Gaps = 58/502 (12%)
 Frame = -3

Query  1656  MERFNKNNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNI---  1486
             M R  K  C F     +A +IP    +I+E DE W +RA EA +   QAY  +P+ I   
Sbjct  3     MARLLKLMCVFC----IAGLIPTIKANISELDEYWSQRADEAREFTLQAYHSDPYEIVDH  58

Query  1485  ------------SASLIHQVRRTLSEAVAEDLTTNTTGR------------------HLL  1396
                         + +  H    T   A  ED + +T                      ++
Sbjct  59    FHERHYDNSTDDTTTEEHSSNSTDVTATEEDNSNSTDVTATEEDSSTKPEEEGTEVIEMV  118

Query  1395  GSKK-----------------YRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKT  1267
             G+ K                  +GPC A+NPID+CWRC ++WA+ RK+LA C  GFG+ T
Sbjct  119   GNSKNSTRRSLKGKGKGKWSKLKGPCTASNPIDKCWRCRSNWANRRKKLAKCVRGFGHGT  178

Query  1266  KGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKT  1090
              GGK G+ Y VT   D D  NP PGTLRHAVIQK+PLWIIF +DM+I+L QEL++  DKT
Sbjct  179   TGGKRGRIYVVTSNLDEDMVNPIPGTLRHAVIQKEPLWIIFKNDMSIRLSQELLVNSDKT  238

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             ID RGA VHI+ GAGIT+QFV+NVIIHG+HIHHI E NGG+IRD +DHFG+RT++DGDG+
Sbjct  239   IDARGADVHIAHGAGITMQFVRNVIIHGLHIHHISESNGGMIRDSVDHFGMRTRADGDGL  298

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGA-NDLSTKDKI  733
             SI+GSSN+WIDHVSM  C DGLIDAI  STAITISN HFT HNDVML GA N+++  D+ 
Sbjct  299   SIYGSSNIWIDHVSMSKCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNNMNEADQK  358

Query  732   MQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP  553
             MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+  GNRFIAPP
Sbjct  359   MQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPP  418

Query  552   DI-HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFK  376
              + + KE+TKR   + +EWK WTWRS+ DI+M GAFF QSGDP++   H +    +    
Sbjct  419   HLPYYKEVTKRDYASEDEWKHWTWRSEKDIFMNGAFFRQSGDPHYKSAHTR-KQMIKPKN  477

Query  375   AEDVTWLTRFAGALNCRVGSPC  310
                V+ LT++AGAL+CRVG  C
Sbjct  478   GYAVSKLTKYAGALDCRVGRRC  499



>emb|CDX74293.1| BnaA03g27540D [Brassica napus]
Length=471

 Score =   455 bits (1170),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 248/465 (53%), Positives = 315/465 (68%), Gaps = 28/465 (6%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
              + V+ +A++IP    ++AE D+ W + A EA K    AY P+P+ I     H+     S
Sbjct  9     LVCVICIASLIPTLRANVAETDDYWVKMANEARKRTLMAYHPDPYQI-VDHFHERHYDNS  67

Query  1446  EAVA----------EDLT-----TNTTGRHLLGS---------KKYRGPCNATNPIDRCW  1339
               V           +D+      TN+T R L G           K +GPC A+NPID+CW
Sbjct  68    TDVEETEEHASEEEDDIEMSSSLTNSTRRSLRGRGKGKGRGKWSKLKGPCTASNPIDKCW  127

Query  1338  RCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVT-DKSDDQSNPKPGTLRHAVIQKKP  1162
             RC  DWA  RK+L  C  GFGY+T GGK G+ Y VT ++ DD  NP+PGTLRHAVIQ +P
Sbjct  128   RCQPDWARRRKKLVKCVRGFGYRTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQNEP  187

Query  1161  LWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFE  982
             LWIIF HDM+I+L QEL++   KTID RG  VHI+ GAGIT+Q+V+N+IIHG+H+HHI  
Sbjct  188   LWIIFKHDMSIRLSQELMINSHKTIDARGTNVHIAYGAGITMQYVRNIIIHGLHVHHIVP  247

Query  981   GNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISN  802
             G+GG+IR+  DHFG R ++DGDGISIFG++N+W+DH+SM  C DGLIDAI  ST ITISN
Sbjct  248   GSGGMIRNSNDHFGFRGQADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTGITISN  307

Query  801   GHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWN  622
              HFT HNDVML GA + +  DK MQ+T+AFNHFGK L+QRMPR R+G++HVVNNDYTHW 
Sbjct  308   SHFTHHNDVMLLGAQNDNHADKKMQVTVAFNHFGKGLVQRMPRIRWGFVHVVNNDYTHWE  367

Query  621   MYAIGGSSHPTIICQGNRFIAPPDI-HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFF  445
             +YAIGGS  PTI+  GNRFIAPP I H +E+TKR      EWK W WRS  DI+M  A+F
Sbjct  368   LYAIGGSQSPTILSHGNRFIAPPHIQHYREVTKRDYAPESEWKNWNWRSDKDIFMNNAYF  427

Query  444   VQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              QSG+P FM  H +    +       V+ LT++AGAL+CRVG PC
Sbjct  428   RQSGNPKFMCSHSR-QQMIKPKHGSAVSKLTKYAGALDCRVGKPC  471



>ref|XP_006299938.1| hypothetical protein CARUB_v10016149mg [Capsella rubella]
 gb|EOA32836.1| hypothetical protein CARUB_v10016149mg [Capsella rubella]
Length=472

 Score =   455 bits (1171),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 248/465 (53%), Positives = 320/465 (69%), Gaps = 27/465 (6%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNI----------SAS  1477
              + V+ +A+ IP    ++ E DE W  +A EA KH   AY P+P++I          +++
Sbjct  9     LVCVICIASFIPTIRANVPETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYDNST  68

Query  1476  LIHQVR--RTLSEAVAEDLT-----TNTTGRHLLGSK-------KYRGPCNATNPIDRCW  1339
              + +    + +  A  ED+      TN+T R L G +       K RGPC A+NPID+CW
Sbjct  69    DVEETEEDKAVDSAEEEDIEMISSPTNSTRRSLSGKRRGRGKWSKLRGPCTASNPIDKCW  128

Query  1338  RCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTD-KSDDQSNPKPGTLRHAVIQKKP  1162
             RC  DWA  RK+L  C  GFGYK  GGK G+ Y VT  + DD  NP+PGTLRHAVIQK+P
Sbjct  129   RCQPDWAKRRKKLVHCVRGFGYKVTGGKRGRIYVVTSPRDDDTVNPRPGTLRHAVIQKEP  188

Query  1161  LWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFE  982
             LWIIF HDM+I+L QEL++   KTID RG+ VHI+ GAGITIQ+V N+IIHG+HIHHI +
Sbjct  189   LWIIFKHDMSIRLSQELMIASHKTIDARGSNVHIAYGAGITIQYVHNIIIHGLHIHHIVK  248

Query  981   GNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISN  802
              +GGLIRD ++HFG R ++DGDGISIFG++N+W+DH+SM  C DGLIDAI  STAITISN
Sbjct  249   SSGGLIRDSINHFGQRGQADGDGISIFGATNIWLDHISMSRCQDGLIDAIMGSTAITISN  308

Query  801   GHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWN  622
              HFT HNDVML GA D +  DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW 
Sbjct  309   SHFTHHNDVMLLGAQDNNQDDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWE  368

Query  621   MYAIGGSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFF  445
             +YAIGGS  PTI+  GNRFIAPP   H +E+TKR   +  EWK W WRS+ D ++ GA F
Sbjct  369   LYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYASEGEWKHWNWRSEKDYFLNGAHF  428

Query  444   VQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              +SG+P+F   H +    +       V+ LT++AGAL+CRVG  C
Sbjct  429   RESGNPHFKCSHSR-QQMIKPKHGVAVSKLTKYAGALDCRVGKAC  472



>emb|CDX91953.1| BnaC03g32550D [Brassica napus]
Length=471

 Score =   455 bits (1170),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 248/465 (53%), Positives = 315/465 (68%), Gaps = 28/465 (6%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
              + V+ +A++IP    ++AE D+ W + A EA K    AY P+P+ I     H+     S
Sbjct  9     LVCVICIASLIPTLRANVAETDDYWVKMANEARKRTLMAYHPDPYQI-VDHFHERHYDNS  67

Query  1446  EAVA----------EDLT-----TNTTGRHLLGS---------KKYRGPCNATNPIDRCW  1339
               V           +D+      TN+T R L G           K +GPC A+NPID+CW
Sbjct  68    TDVEETEEHASEEEDDIEMSSSPTNSTRRSLRGRGKGKGRGKWSKLKGPCTASNPIDKCW  127

Query  1338  RCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVT-DKSDDQSNPKPGTLRHAVIQKKP  1162
             RC  DWA  RK+L  C  GFGY+T GGK G+ Y VT ++ DD  NP+PGTLRHAVIQ +P
Sbjct  128   RCQPDWARRRKKLVKCVRGFGYRTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQNEP  187

Query  1161  LWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFE  982
             LWIIF HDM+I+L QEL++   KTID RG  VHI+ GAGIT+Q+V+N+IIHG+H+HHI  
Sbjct  188   LWIIFKHDMSIRLSQELMINSHKTIDARGTNVHIAYGAGITMQYVRNIIIHGLHVHHIVP  247

Query  981   GNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISN  802
             G+GG+IR+  DHFG R ++DGDGISIFG++N+W+DH+SM  C DGLIDAI  ST ITISN
Sbjct  248   GSGGMIRNSNDHFGFRGQADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTGITISN  307

Query  801   GHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWN  622
              HFT HNDVML GA + +  DK MQ+T+AFNHFGK L+QRMPR R+G++HVVNNDYTHW 
Sbjct  308   SHFTHHNDVMLLGAQNDNHADKKMQVTVAFNHFGKGLVQRMPRIRWGFVHVVNNDYTHWE  367

Query  621   MYAIGGSSHPTIICQGNRFIAPPDI-HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFF  445
             +YAIGGS  PTI+  GNRFIAPP I H +E+TKR      EWK W WRS  DI+M  A+F
Sbjct  368   LYAIGGSQSPTILSHGNRFIAPPHIQHYREVTKRDYAPESEWKNWNWRSDKDIFMNNAYF  427

Query  444   VQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              QSG+P FM  H +    +       V+ LT++AGAL+CRVG PC
Sbjct  428   RQSGNPKFMCSHSR-QQMIKPKHGSAVSKLTKYAGALDCRVGKPC  471



>emb|CDX81636.1| BnaC08g39650D [Brassica napus]
Length=484

 Score =   455 bits (1171),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 237/404 (59%), Positives = 295/404 (73%), Gaps = 7/404 (2%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
             +  V     ++P    ++A +D  W++R  +A K    +Y+PNP N++  L + V    +
Sbjct  11    YTLVFLSVILVPHVQANVAIFDNYWKQRQGDALKQTIASYDPNPLNVTDHLNYHV----A  66

Query  1446  EAVAEDLTTNTTGRHLLG--SKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGY  1273
              AV    +TN T R L+G  +++  G C A NPID+CWRC  +W  NRK+L +C +GFG 
Sbjct  67    LAVDATESTNNTRRELIGRETQEGSGKCIAYNPIDKCWRCDPNWEKNRKKLVECVLGFGR  126

Query  1272  KTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGD  1096
             KT GGK G  Y V D SD D  NPKPGTLRHAV +  PLWIIFA+ M IKL QEL++  +
Sbjct  127   KTTGGKDGPIYVVNDSSDEDLVNPKPGTLRHAVTRDGPLWIIFANSMVIKLQQELMITSN  186

Query  1095  KTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgd  916
             KTIDGRGA+V+I +GAG+T QFV NVII+ I++ HI  GNGGLIRD  +H GLRTKSDGD
Sbjct  187   KTIDGRGARVYIMEGAGLTQQFVNNVIINNIYVKHIIPGNGGLIRDSEEHVGLRTKSDGD  246

Query  915   gisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDK  736
             GIS+FG++NVWIDHVSM  C DG+IDAIE STA+TISN HFTDH +VMLFGA D    DK
Sbjct  247   GISLFGATNVWIDHVSMTRCTDGMIDAIEGSTAVTISNSHFTDHQEVMLFGAKDEHVIDK  306

Query  735   IMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAP  556
              MQIT+AFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+ +PTII QGNRFIAP
Sbjct  307   NMQITVAFNHFGKRLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAP  366

Query  555   PDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN  424
             P+   KE+TKR   +  +WK+W W+S+GD ++ GA+FVQSG PN
Sbjct  367   PNEQAKEVTKREYTSYTDWKSWNWQSEGDYFLNGAYFVQSGRPN  410



>gb|ACU23277.1| unknown [Glycine max]
Length=443

 Score =   454 bits (1167),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 250/443 (56%), Positives = 299/443 (67%), Gaps = 17/443 (4%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
             F  + + A +IP     IAE+D+  + +A EA K A  +Y P PH+++  L   V   L 
Sbjct  14    FTLLATFAIVIPCLEAGIAEFDDFLKAQADEAHKIALDSYVPEPHDVAHELNFHVHMALE  73

Query  1446  EAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKT  1267
              +   +L      R L G     G C A+NPID CWRC+ DWA++R RLA C  GFG + 
Sbjct  74    NSTRRELRQ----RKLRGG----GKCQASNPIDACWRCNKDWANDRFRLAKCGKGFGRRA  125

Query  1266  KGGKSGKFYTVTDKSDD-QSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKT  1090
              GG  G  Y VTD SDD   NPKPGT+RHAV QK PLWIIF H M I L QEL++  DKT
Sbjct  126   TGGLGGPIYAVTDNSDDDMVNPKPGTIRHAVTQKGPLWIIFGHSMIISLRQELMISSDKT  185

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             IDGRGA V    GAG+TIQFV NVIIHG+ I  I   +GG+IRD  DH+GLRT+SDGD I
Sbjct  186   IDGRGANVQFRGGAGLTIQFVNNVIIHGVRIKDIVPKDGGMIRDSADHYGLRTRSDGDAI  245

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             SIFGS+N+WIDHVS+ NC DGLID I+ STAITISN H T HNDV LFGA+D    DKIM
Sbjct  246   SIFGSTNIWIDHVSLSNCADGLIDIIQGSTAITISNCHMTKHNDVFLFGASDSYNGDKIM  305

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             QIT+AFNHFG+ L+QRMPRCR+G++HV+NNDYTHW MYAIGGSS PTI+ QGNRFIAP +
Sbjct  306   QITVAFNHFGQGLVQRMPRCRWGFVHVLNNDYTHWLMYAIGGSSGPTILSQGNRFIAPNN  365

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAE  370
              + KEIT R    P+ WK W W+S+ D++M GA FV SG P  M      Y   +  K  
Sbjct  366   DNAKEITHRDYAGPDVWKNWQWQSEMDLFMNGAKFVTSGSPIKM-----TYKKGLIMKPR  420

Query  369   D---VTWLTRFAGALNCRVGSPC  310
             D   V+ LTR AGALNC VG PC
Sbjct  421   DGTHVSRLTRHAGALNCFVGKPC  443



>ref|XP_003543726.1| PREDICTED: pectate lyase [Glycine max]
Length=443

 Score =   454 bits (1167),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 250/443 (56%), Positives = 299/443 (67%), Gaps = 17/443 (4%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
             F  + + A +IP     IAE+D+  + +A EA K A  +Y P PH+++  L   V   L 
Sbjct  14    FTLLATFAIVIPCLEAGIAEFDDFLKAQADEAHKIALDSYVPEPHDVAHELNFHVHMALE  73

Query  1446  EAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKT  1267
              +   +L      R L G     G C A+NPID CWRC+ DWA++R RLA C  GFG + 
Sbjct  74    NSTRRELRQ----RKLRGG----GKCQASNPIDACWRCNKDWANDRFRLAKCGKGFGRRA  125

Query  1266  KGGKSGKFYTVTDKSDD-QSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKT  1090
              GG  G  Y VTD SDD   NPKPGT+RHAV QK PLWIIF H M I L QEL++  DKT
Sbjct  126   TGGLGGPIYVVTDNSDDDMVNPKPGTIRHAVTQKGPLWIIFGHSMIISLRQELMISSDKT  185

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             IDGRGA V    GAG+TIQFV NVIIHG+ I  I   +GG+IRD  DH+GLRT+SDGD I
Sbjct  186   IDGRGANVQFRGGAGLTIQFVNNVIIHGVRIKDIVPKDGGMIRDSADHYGLRTRSDGDAI  245

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             SIFGS+N+WIDHVS+ NC DGLID I+ STAITISN H T HNDV LFGA+D    DKIM
Sbjct  246   SIFGSTNIWIDHVSLSNCADGLIDIIQGSTAITISNCHMTKHNDVFLFGASDSYNGDKIM  305

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             QIT+AFNHFG+ L+QRMPRCR+G++HV+NNDYTHW MYAIGGSS PTI+ QGNRFIAP +
Sbjct  306   QITVAFNHFGQGLVQRMPRCRWGFVHVLNNDYTHWLMYAIGGSSGPTILSQGNRFIAPNN  365

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAE  370
              + KEIT R    P+ WK W W+S+ D++M GA FV SG P  M      Y   +  K  
Sbjct  366   DNAKEITHRDYAGPDVWKNWQWQSEMDLFMNGAKFVTSGSPIKM-----TYKKGLIMKPR  420

Query  369   D---VTWLTRFAGALNCRVGSPC  310
             D   V+ LTR AGALNC VG PC
Sbjct  421   DGTHVSRLTRHAGALNCFVGKPC  443



>ref|XP_010683249.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=444

 Score =   453 bits (1165),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 262/425 (62%), Positives = 307/425 (72%), Gaps = 8/425 (2%)
 Frame = -3

Query  1581  GHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTGRH  1402
              +IAE+DE W +R  EA K+ ++AY P P+N++    HQV   L     + L  N+T R 
Sbjct  27    ANIAEFDEYWHKRRLEAVKYFEEAYHPEPYNVTNHFNHQVH--LHARNMKKL--NSTRRG  82

Query  1401  LLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKS  1222
             LLG K + GPC ATNPID CWRC  +WA NRKRLADCA+GFG  T GGK G+ Y VTD S
Sbjct  83    LLG-KGHIGPCVATNPIDACWRCQPNWAENRKRLADCAIGFGKGTTGGKDGRIYVVTDSS  141

Query  1221  D-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAG  1045
             D D  NPKPGTLRHAVIQ +PLWIIFA  MNI+L QELIM GDKTID RGA VHI+ GAG
Sbjct  142   DNDMQNPKPGTLRHAVIQTEPLWIIFARSMNIRLTQELIMTGDKTIDARGANVHIAHGAG  201

Query  1044  ITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSM  865
             ITIQF+KNVIIHG+HIH I+ G+GGLIRD  +HFGLRT+SDGD ISIFG+SN+WIDHVSM
Sbjct  202   ITIQFIKNVIIHGLHIHQIYPGDGGLIRDSANHFGLRTRSDGDAISIFGASNIWIDHVSM  261

Query  864   RNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQ  685
                 DGLID I+ STAITISN H TDHN+V LFGA +  T D+ MQ+T+AFNHFGK L+Q
Sbjct  262   ARGTDGLIDIIQGSTAITISNCHMTDHNEVFLFGATNDYTDDQKMQVTVAFNHFGKGLVQ  321

Query  684   RMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPE  505
             RMPR R+G+IHVVNNDYTHW MYAIGGS HPTII QGNRF+AP +   KE+TKR +    
Sbjct  322   RMPRARFGFIHVVNNDYTHWQMYAIGGSQHPTIISQGNRFVAPFNPFAKEVTKR-EAPES  380

Query  504   EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCR  325
             EWK+WTW S  D ++ GAFF  SG  N +D  +K            V  LTR +G   C 
Sbjct  381   EWKSWTWLSDKDWFLNGAFFRDSGRGNAIDSKNKA-QMFSAMAGTKVGELTRCSGPRKCT  439

Query  324   VGSPC  310
              G PC
Sbjct  440   PGKPC  444



>ref|XP_007139601.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
 gb|ESW11595.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
Length=444

 Score =   452 bits (1164),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 248/441 (56%), Positives = 305/441 (69%), Gaps = 8/441 (2%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
              + +V+ A  IP   G I E+D+  + +A EA + A ++Y P+P N++  L   V   L+
Sbjct  10    IIILVAFAITIPCLEGGIGEFDDFLKGQALEAHEIALESYVPDPVNMTDDLNINVHGALT  69

Query  1446  EAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKT  1267
             E   E+  +N T R L   +KY GPC A NPIDRCWRC   WA NR +LA CA GFG K 
Sbjct  70    EVFKEE--SNHTRREL--KQKYGGPCLALNPIDRCWRCKKGWAKNRFKLAHCAKGFGRKA  125

Query  1266  KGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKT  1090
              GG  GK Y V D SDD   NPKPGTLR  V+QK+PLWIIFA  M IKL+ EL++  DKT
Sbjct  126   TGGLEGKMYIVNDPSDDDPINPKPGTLRFGVLQKEPLWIIFARSMIIKLNYELLISSDKT  185

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             IDGRGA V I DG+G+T+QFV NVIIHG+ + +I    GG IRD  +H G+RTK+DGD I
Sbjct  186   IDGRGANVMIKDGSGLTMQFVNNVIIHGLRLQNIKSTPGGTIRDSWNHVGIRTKADGDAI  245

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             SIFGSSN+WIDH+S+ +C DGL+D I+ ST ITISN H T HNDVMLFGA+D  T DKIM
Sbjct  246   SIFGSSNIWIDHLSLSDCEDGLVDIIQGSTGITISNCHMTKHNDVMLFGASDTFTGDKIM  305

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             Q+T+AFNHFG+ LIQRMPRCR+G+ HV+NNDYTHW MYAIGGSS PTI+ QGNRFIAP +
Sbjct  306   QVTVAFNHFGQGLIQRMPRCRWGFFHVLNNDYTHWLMYAIGGSSAPTILSQGNRFIAPNN  365

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFK-A  373
                KE+T R    P  W+ W WRS+ D++M GA FVQSG P      +K +  +M  +  
Sbjct  366   NAAKEVTHRDYAEPSVWEKWQWRSENDVFMNGANFVQSGPPLGKLPFNKGF--LMKPRHG  423

Query  372   EDVTWLTRFAGALNCRVGSPC  310
                  LTRFAGALNC+  SPC
Sbjct  424   SQANRLTRFAGALNCKANSPC  444



>emb|CDY66593.1| BnaCnng51570D [Brassica napus]
Length=499

 Score =   454 bits (1169),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 255/492 (52%), Positives = 325/492 (66%), Gaps = 54/492 (11%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNI-------------  1486
              + V  +A +IP    +I+E DE W +RA EA +   QAY  +P+ I             
Sbjct  9     LMCVFCIAGLIPTIRANISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYDNST  68

Query  1485  --SASLIHQVRRTLSEAVAEDLTTNTTGR------------------HLLGSKK------  1384
               + +  H        A AED + +T                      ++G+ K      
Sbjct  69    DDTTTEEHSSNSADVTATAEDSSNSTDVTATEEDSSTKPEEERTEVIEMVGNSKNSTRRS  128

Query  1383  -----------YRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYT  1237
                         +GPC A+NPID+CWRC ++WA+ RK+LA C  GFG+ T GGK G+ Y 
Sbjct  129   LKGKGKGKWSKLKGPCTASNPIDKCWRCRSNWANRRKKLAKCVRGFGHGTTGGKRGRIYV  188

Query  1236  VTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHI  1060
             VT   D D  NP PGTLRHAVIQK+PLWIIF +DM+I+L QEL++  DKTID RGA VHI
Sbjct  189   VTSNLDEDMVNPIPGTLRHAVIQKEPLWIIFKNDMSIRLSQELLVNSDKTIDARGADVHI  248

Query  1059  SDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWI  880
             + GAGIT+QFV+NVIIHG+HIHHI E NGG+IRD +DHFG+RT++DGDG+SI+GSSN+WI
Sbjct  249   AHGAGITMQFVRNVIIHGLHIHHISESNGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWI  308

Query  879   DHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGA-NDLSTKDKIMQITLAFNHF  703
             DHVSM  C DGLIDAI  STAITISN HFT HNDVML GA N+++  D+ MQ+T+A+NHF
Sbjct  309   DHVSMSKCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNNMNEADQKMQVTVAYNHF  368

Query  702   GKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI-HKKEITK  526
             GK L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+  GNRFIAPP + + KE+TK
Sbjct  369   GKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHLPYYKEVTK  428

Query  525   RVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRF  346
             R     +EWK WTWRS+ DI+M GAFF QSGDP++   H +    +       V+ LT++
Sbjct  429   RDYALEDEWKHWTWRSEKDIFMNGAFFRQSGDPHYKSAHTR-KQMIKPKNGYAVSKLTKY  487

Query  345   AGALNCRVGSPC  310
             AGAL+CRVG  C
Sbjct  488   AGALDCRVGKRC  499



>ref|XP_009110541.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=458

 Score =   453 bits (1165),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 253/458 (55%), Positives = 309/458 (67%), Gaps = 17/458 (4%)
 Frame = -3

Query  1647  FNKNNCFFLFVVSVAAIIPATVG-HIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLI  1471
              N     F+F +S+ A +   VG ++A +D  W +R  +A K    +++PNP N++  L 
Sbjct  6     LNIGGYLFVFCLSLLATLTPHVGANVAVFDNYWLQRQGDALKQTIASFDPNPLNVTDHLN  65

Query  1470  HQVRRTLSEAVAEDLTTNTTGRHLLGSKKYR-----GPCNATNPIDRCWRCHADWASNRK  1306
             + V    + AV    +TN+T R L   +  R     G C A NPIDRCWRC+ DW  NRK
Sbjct  66    YHV----ALAVDATESTNSTRRELSQVRNGRKLKRSGKCVAYNPIDRCWRCNGDWEKNRK  121

Query  1305  RLADCAMGFGYKTKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNI  1129
             +LADC +GFG +T GGK G  Y V D SDD   NPKPGTLRHAV +  PLWIIF   M I
Sbjct  122   KLADCVLGFGRRTTGGKDGPIYVVNDASDDDLINPKPGTLRHAVTRDGPLWIIFGSSMII  181

Query  1128  KLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLD  949
              L QELI+  DKTIDGRGA+V+I +GAG+T+QFV NVIIH I++ H+   +GGLIRD   
Sbjct  182   NLQQELIITSDKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKHVVPKSGGLIRDSEQ  241

Query  948   HFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVML  769
             H GLRT SDGDGIS+FG++NVWIDHVSM  C DG+IDAI  STAITISN HFTDH +VML
Sbjct  242   HIGLRTVSDGDGISLFGATNVWIDHVSMTRCSDGMIDAILGSTAITISNSHFTDHEEVML  301

Query  768   FGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPT  589
             FGAND    DK MQIT+AFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+ +PT
Sbjct  302   FGANDKHVIDKKMQITVAFNHFGKRLDQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPT  361

Query  588   IICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSG-----DPN  424
             II QGNRFIAPP+   K+ITKR       WK W W+S+GD ++ GA+FVQSG      P 
Sbjct  362   IISQGNRFIAPPNEQAKQITKREYTPYVNWKMWNWQSEGDYFLNGAYFVQSGKQNAWSPK  421

Query  423   FMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              ++   K +  +       V  LT  AGAL C+ G+PC
Sbjct  422   PINPVPKKF-AIRPQPGTMVRKLTMDAGALGCKPGTPC  458



>ref|XP_009129128.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=457

 Score =   452 bits (1164),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 249/452 (55%), Positives = 306/452 (68%), Gaps = 6/452 (1%)
 Frame = -3

Query  1647  FNKNNCFFLFV-VSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLI  1471
              N  +   +FV +S+A + P+   HIA +D+ W +R A A +   ++YEPNP N++    
Sbjct  6     LNLGSYVIVFVSLSIAIVAPSVQAHIAVFDDYWTQRQANALRQTMESYEPNPLNVTNHFN  65

Query  1470  HQVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADC  1291
             +     +    A++ T    G+   G K   G   + N IDRCWR   +WA NRK+LADC
Sbjct  66    YHAALAMETTGADNGTRRELGQVKAGQKARGGRFKSLNAIDRCWRGDKNWAKNRKKLADC  125

Query  1290  AMGFGYKTKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQE  1114
              +GFG KT GGK+G  Y VTD SDD   +PKPGTLRHAV + +PLWIIFA  M IKL QE
Sbjct  126   VLGFGLKTTGGKNGPIYVVTDASDDDLLSPKPGTLRHAVTRDRPLWIIFARTMVIKLQQE  185

Query  1113  LIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLR  934
             L++  DKTIDGRG  V+I+ GAG T+QFVKNVIIH IH+  I  G GGLIRD  +HFGLR
Sbjct  186   LMITNDKTIDGRGVSVYITGGAGFTLQFVKNVIIHNIHMKFIKRGFGGLIRDSEEHFGLR  245

Query  933   TKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGAND  754
             T SDGDGI+IFG++N+WIDHVSMRNC DG+IDAI  STAITISN HFTDH +VMLFGA +
Sbjct  246   TISDGDGINIFGATNIWIDHVSMRNCSDGMIDAIMGSTAITISNSHFTDHKEVMLFGAKN  305

Query  753   LSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQG  574
                 DK MQIT+AFNHFGKRL QRMPR RYG +HVVNNDYTHW MYAIGG+ +PTII QG
Sbjct  306   GDEFDKKMQITVAFNHFGKRLNQRMPRVRYGMVHVVNNDYTHWEMYAIGGNMNPTIISQG  365

Query  573   NRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK-LY  397
             NRFIAPP    K++TKR      EWK+W W+S+ D ++ GA+FVQSG  N      K   
Sbjct  366   NRFIAPPKEDCKQVTKREYTAYPEWKSWNWQSERDYFLNGAYFVQSGKSNAWSAAPKNPI  425

Query  396   DGVMTFKAE---DVTWLTRFAGALNCRVGSPC  310
                 T + +    V  LT+ AG L+CR G  C
Sbjct  426   PKEFTIRPQPGTKVRSLTKDAGTLDCRPGKSC  457



>emb|CDY09356.1| BnaA02g26540D [Brassica napus]
Length=457

 Score =   452 bits (1164),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 249/452 (55%), Positives = 306/452 (68%), Gaps = 6/452 (1%)
 Frame = -3

Query  1647  FNKNNCFFLFV-VSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLI  1471
              N  +   +FV +S+A + P+   HIA +D+ W +R A A +   ++YEPNP N++    
Sbjct  6     LNLGSYVIVFVSLSIAIVAPSVQAHIAVFDDYWTQRQANALRQTMESYEPNPLNVTNHFN  65

Query  1470  HQVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADC  1291
             +     +    A++ T    G+   G K   G   + N IDRCWR   +WA NRK+LADC
Sbjct  66    YHAALAMETTGADNGTRRELGQVKAGQKARGGRFKSLNAIDRCWRGDKNWAKNRKKLADC  125

Query  1290  AMGFGYKTKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQE  1114
              +GFG KT GGK+G  Y VTD SDD   +PKPGTLRHAV + +PLWIIFA  M IKL QE
Sbjct  126   VLGFGLKTTGGKNGPIYVVTDASDDDLLSPKPGTLRHAVTRDRPLWIIFARTMVIKLQQE  185

Query  1113  LIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLR  934
             L++  DKTIDGRG  V+I+ GAG T+QFVKNVIIH IH+  I  G GGLIRD  +HFGLR
Sbjct  186   LMITNDKTIDGRGVSVYITGGAGFTLQFVKNVIIHNIHMKFIKRGFGGLIRDSEEHFGLR  245

Query  933   TKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGAND  754
             T SDGDGI+IFG++N+WIDHVSMRNC DG+IDAI  STAITISN HFTDH +VMLFGA +
Sbjct  246   TISDGDGINIFGATNIWIDHVSMRNCSDGMIDAIMGSTAITISNSHFTDHKEVMLFGAKN  305

Query  753   LSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQG  574
                 DK MQIT+AFNHFGKRL QRMPR RYG +HVVNNDYTHW MYAIGG+ +PTII QG
Sbjct  306   GDEFDKKMQITVAFNHFGKRLNQRMPRVRYGMVHVVNNDYTHWEMYAIGGNMNPTIISQG  365

Query  573   NRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK-LY  397
             NRFIAPP    K++TKR      EWK+W W+S+ D ++ GA+FVQSG  N      K   
Sbjct  366   NRFIAPPKEDCKQVTKREYTAYPEWKSWNWQSERDYFLNGAYFVQSGKSNAWSAAPKNPI  425

Query  396   DGVMTFKAE---DVTWLTRFAGALNCRVGSPC  310
                 T + +    V  LT+ AG L+CR G  C
Sbjct  426   PKEFTIRPQPGTKVRSLTKDAGTLDCRPGKSC  457



>ref|XP_009125036.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 7 [Brassica 
rapa]
Length=470

 Score =   452 bits (1164),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 249/467 (53%), Positives = 313/467 (67%), Gaps = 29/467 (6%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTL  1450
               + V+ +A++IP    ++AE DE W  +A EA +    AY P+P+ I     H+     
Sbjct  6     LLVCVICIASLIPTLRANVAETDEYWVTKANEARRRTLMAYHPDPYQI-VDHFHERHYDN  64

Query  1449  SEAVA----------EDL-----TTNTTGRHLLGS----------KKYRGPCNATNPIDR  1345
             S  V           +D+      TN+T R  L             K +GPC A+NPID+
Sbjct  65    STDVEEMEENASEEEDDIEMISSATNSTRRSYLRGRGKGKGRGKWSKLKGPCTASNPIDK  124

Query  1344  CWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVT-DKSDDQSNPKPGTLRHAVIQK  1168
             CWRC  DWA  RK+L  C  GFGYKT GGK G+ Y VT ++ DD  NP+PGTLRHAVIQ 
Sbjct  125   CWRCQPDWARRRKKLVKCVRGFGYKTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQN  184

Query  1167  KPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhI  988
             +PLWIIF HDM+I+L QEL++   KTID RG  VHI+ GAGIT+Q+V N+IIHG+HIHHI
Sbjct  185   EPLWIIFKHDMSIRLCQELMINSHKTIDARGTNVHIAYGAGITMQYVHNIIIHGLHIHHI  244

Query  987   FEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITI  808
              +G GG+IR+  DHFG R  +DGDGISIFG++N+W+DH+SM  C DGLIDAI  ST ITI
Sbjct  245   VQGRGGMIRNSNDHFGFRGVADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTGITI  304

Query  807   SNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTH  628
             SN HFT HNDVML GA + +  DK MQ+T+AFNHFGK L+QRMPR R+G++HVVNNDYTH
Sbjct  305   SNSHFTHHNDVMLLGAQNDNHADKKMQVTVAFNHFGKGLVQRMPRIRWGFVHVVNNDYTH  364

Query  627   WNMYAIGGSSHPTIICQGNRFIAPPDI-HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGA  451
             W +YAIGGS  PTI+  GNRFIAPP I H +E+TKR      EWK W WRS+ DI+M  A
Sbjct  365   WELYAIGGSQSPTILSHGNRFIAPPHIQHYREVTKRDSAPESEWKNWNWRSEKDIFMNNA  424

Query  450   FFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             +F QSG+P FM  H +    +       V+ LT++AGAL+CRVG PC
Sbjct  425   YFRQSGNPKFMCSHSR-QQMIKPKHGVAVSKLTKYAGALDCRVGKPC  470



>emb|CDY68729.1| BnaCnng60280D [Brassica napus]
Length=458

 Score =   452 bits (1163),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 252/453 (56%), Positives = 307/453 (68%), Gaps = 19/453 (4%)
 Frame = -3

Query  1626  FLFVVSV---AAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRR  1456
             +LFV S+   A + P    ++A +D  W +R  +A K    +++PNP N++  L + V  
Sbjct  11    YLFVFSLLLLATLTPHVGANVAVFDNYWLQRQGDALKQTIASFDPNPLNVTDHLNYHV--  68

Query  1455  TLSEAVAEDLTTNTTGRHLLGSKKYR-----GPCNATNPIDRCWRCHADWASNRKRLADC  1291
               + AV    + N+T R L   +  R     G C A NPIDRCWRCH DW  NRK+LADC
Sbjct  69    --ALAVGATESINSTRRELSQVRNGRKLKRSGKCVAYNPIDRCWRCHGDWEKNRKKLADC  126

Query  1290  AMGFGYKTKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQE  1114
              +GFG +T GGK G  Y V D SDD   NPKPGTLRHAV +  PLWIIF   M I L QE
Sbjct  127   VLGFGRRTTGGKDGPIYVVNDASDDDLINPKPGTLRHAVTRDGPLWIIFGSSMIINLQQE  186

Query  1113  LIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLR  934
             LI+  DKTIDGRGA+V+I +GAG+T+QFV NVIIH I+I H+   +GGLIRD   H GLR
Sbjct  187   LIITSDKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYIKHVVPKSGGLIRDSEQHIGLR  246

Query  933   TKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGAND  754
             T SDGDGIS+FG++NVWIDHVSM  C DG+IDAI  STAITISN HFTDH +VMLFGAND
Sbjct  247   TVSDGDGISLFGATNVWIDHVSMTRCSDGMIDAILGSTAITISNSHFTDHEEVMLFGAND  306

Query  753   LSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQG  574
                 DK MQIT+AFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+ +PTII QG
Sbjct  307   KHVIDKKMQITVAFNHFGKRLDQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQG  366

Query  573   NRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSG-----DPNFMDKH  409
             NRFIAPP+   K+ITKR      +WK W W+S+GD ++ GA+FVQSG      P  ++  
Sbjct  367   NRFIAPPNEQAKQITKREYTPYVDWKMWNWQSEGDYFLNGAYFVQSGKQNAWSPKPVNPV  426

Query  408   HKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              + +  +       V  LT  AGAL C+ G+PC
Sbjct  427   PRKF-AIRPQPGTMVRKLTMDAGALGCKPGTPC  458



>emb|CDX85564.1| BnaA02g02490D [Brassica napus]
Length=473

 Score =   452 bits (1163),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 250/466 (54%), Positives = 315/466 (68%), Gaps = 28/466 (6%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQ------  1465
              +F   +A +IP    +++E DE W +RA EA +   QAY  NP+ +      +      
Sbjct  9     LMFTFYIAGLIPTIRANLSELDEYWSKRAGEAREFTLQAYHSNPYEVVDHFHERHYDNST  68

Query  1464  -VRRTLS-------EAVAEDLT------TNTTGRHLLGSKK-----YRGPCNATNPIDRC  1342
              V+ T         E V +D+        N+T R L G +K      +GPC A+NPID+C
Sbjct  69    DVKETEEDSDDEKPEEVEDDVIEMVGNEMNSTRRILRGKRKGKWSKLKGPCTASNPIDKC  128

Query  1341  WRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKK  1165
             WRC ++WA  RK L  C  GFG+ T GGK G+ Y VT   D D  NPKPGTLRHAVIQK+
Sbjct  129   WRCRSNWAKRRKNLVKCVRGFGHSTIGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKE  188

Query  1164  PLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIF  985
             PLWIIF +DM+I+L QEL++   KTID RG  VHI+ GAGITIQFV++VIIHG+ IHHI 
Sbjct  189   PLWIIFKNDMHIRLSQELMICSFKTIDARGTDVHIAHGAGITIQFVRHVIIHGLRIHHIC  248

Query  984   EGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITIS  805
             + NGG+IRD  DHFG+RTK+DGDGISI+GSS +W+DH+SM  C DGLIDAI  STAITIS
Sbjct  249   QSNGGMIRDSTDHFGMRTKADGDGISIYGSSMIWLDHISMSKCQDGLIDAIVGSTAITIS  308

Query  804   NGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHW  625
             N HFT HNDVML GA + +  DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW
Sbjct  309   NSHFTHHNDVMLLGAQNDNQGDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHW  368

Query  624   NMYAIGGSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAF  448
              +YAIGGS  PTI+  GNRFIAPP   H +E+TKR   +  EWK W WRS  D++M GA+
Sbjct  369   ELYAIGGSQAPTILSHGNRFIAPPHKPHYREVTKRDYASEHEWKHWNWRSDKDMFMNGAY  428

Query  447   FVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             F QSG+P+F   HH     +       V+ LT++AGAL+CRVG  C
Sbjct  429   FRQSGNPHF-KCHHTRKQMIKPKHGIAVSMLTKYAGALDCRVGKRC  473



>ref|XP_010551866.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=475

 Score =   452 bits (1163),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 248/472 (53%), Positives = 316/472 (67%), Gaps = 35/472 (7%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
              L ++ +  I     G++AE+DE W++R+ EA  H+ +AY  +P  I     H+     S
Sbjct  6     LLHLICMFCIAALIRGNVAEFDEYWQKRSEEAHNHSLEAYHSDPFEI-VDHFHERHYDNS  64

Query  1446  EAVAED-------------------LTTNTTGRHLLGS------------KKYRGPCNAT  1360
               +  +                   + T TT                    K +GPC A+
Sbjct  65    TDIEAEREEEDDHEEEEEEEEYSIAMLTGTTNSTRRSLRGRSRRGRRGKWSKLKGPCTAS  124

Query  1359  NPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRH  1183
             NPID+CWRC ADWA+ RK+LADC  GFG+KT GGK G+ Y VT   D D  NP+PGTLRH
Sbjct  125   NPIDKCWRCRADWANRRKKLADCVRGFGFKTTGGKLGRIYVVTSNLDSDVVNPRPGTLRH  184

Query  1182  AVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgi  1003
             AVIQK PLWIIF  DM+I+L QEL++   KTID RGA VHI+ GAGIT+QFV N+IIHG+
Sbjct  185   AVIQKVPLWIIFKKDMHIRLQQELLINSHKTIDARGANVHIAYGAGITMQFVTNIIIHGL  244

Query  1002  hihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEAS  823
             HIHHI   NGG+IRD +DH+G RT++DGDG+SIFG+SN+WIDHVSM  C DGLIDAI+ S
Sbjct  245   HIHHIVSSNGGMIRDSVDHYGFRTRADGDGLSIFGASNIWIDHVSMSRCQDGLIDAIDGS  304

Query  822   TAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVN  643
             T ITISN HFT HNDVML GA+++  KDK MQ+T+A+NHFGK L+QRMPR R+G++HVVN
Sbjct  305   TGITISNSHFTHHNDVMLLGAHNVIDKDKRMQVTVAYNHFGKGLVQRMPRVRWGFVHVVN  364

Query  642   NDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHK-KEITKRVKGTPEEWKTWTWRSQGDI  466
             NDYTHW +YAIGGS  PTI+  GNRFIAPP I + KE+TKR      EW+ W WRS+ D+
Sbjct  365   NDYTHWQLYAIGGSQGPTILSHGNRFIAPPHIPQYKEVTKRDYAPESEWRKWNWRSEKDV  424

Query  465   YMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             +M GAFF QSG+P F   H +    +       V+ LT++AG+L+C+VG PC
Sbjct  425   FMNGAFFRQSGNPKFRCTHTR-QQMIRPKHGMAVSMLTKYAGSLDCKVGRPC  475



>emb|CDX96854.1| BnaA08g23970D [Brassica napus]
Length=458

 Score =   451 bits (1161),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 252/458 (55%), Positives = 309/458 (67%), Gaps = 17/458 (4%)
 Frame = -3

Query  1647  FNKNNCFFLFVVSVAAIIPATVG-HIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLI  1471
              N     F+F +S+ A +   VG ++A +D  W +R  +A K    +++PNP N++  L 
Sbjct  6     LNIGGYLFVFCLSLLATLTPHVGANVAVFDNYWLQRQGDALKQTIASFDPNPLNVTDHLN  65

Query  1470  HQVRRTLSEAVAEDLTTNTTGRHLLGSKKYR-----GPCNATNPIDRCWRCHADWASNRK  1306
             + V    + AV    + N+T R L   +  R     G C A NPIDRCWRC+ DW  NRK
Sbjct  66    YHV----ALAVDATESINSTRRELSQVRNGRKLKRSGKCVAYNPIDRCWRCNGDWEKNRK  121

Query  1305  RLADCAMGFGYKTKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNI  1129
             +LADC +GFG +T GGK G  Y V D SDD   NPKPGTLRHAV +  PLWIIF   M I
Sbjct  122   KLADCVLGFGRRTTGGKDGPIYVVNDASDDDLINPKPGTLRHAVTRDGPLWIIFGSSMII  181

Query  1128  KLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLD  949
              L QELI+  DKTIDGRGA+V+I +GAG+T+QFV NVIIH I++ H+   +GGLIRD   
Sbjct  182   NLQQELIITSDKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKHVVPKSGGLIRDSEQ  241

Query  948   HFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVML  769
             H GLRT SDGDGIS+FG++NVWIDHVSM  C DG+IDAI  STAITISN HFTDH +VML
Sbjct  242   HIGLRTVSDGDGISLFGATNVWIDHVSMTRCSDGMIDAILGSTAITISNSHFTDHEEVML  301

Query  768   FGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPT  589
             FGAND    DK MQIT+AFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+ +PT
Sbjct  302   FGANDKHVIDKKMQITVAFNHFGKRLDQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPT  361

Query  588   IICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSG-----DPN  424
             II QGNRFIAPP+   K+ITKR      +WK W W+S+GD ++ GA+FVQSG      P 
Sbjct  362   IISQGNRFIAPPNEQAKQITKREYTPYVDWKMWNWQSEGDYFLNGAYFVQSGKQNAWSPK  421

Query  423   FMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              ++   K +  +       V  LT  AGAL C+ G+PC
Sbjct  422   PVNPVPKKF-AIRPQPGTMVRKLTMDAGALGCKPGTPC  458



>emb|CDY28691.1| BnaCnng05770D [Brassica napus]
Length=469

 Score =   451 bits (1161),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 249/466 (53%), Positives = 314/466 (67%), Gaps = 28/466 (6%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTL  1450
               + V+ +A++IP    ++AE DE W  +A EA +    AY P+P+ I     H+     
Sbjct  6     LLVCVICIASLIPTLRANVAETDEYWVTKANEARRRTLMAYHPDPYQI-VDHFHERHYDN  64

Query  1449  SEAVA----------EDL-----TTNTTGRHLLGS---------KKYRGPCNATNPIDRC  1342
             S  V           +D+      TN+T R L G           K +GPC A+NPID+C
Sbjct  65    STDVEEMEENASEEEDDIEMISSATNSTRRSLRGRGKGKGRGKWSKLKGPCTASNPIDKC  124

Query  1341  WRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVT-DKSDDQSNPKPGTLRHAVIQKK  1165
             WRC  DWA  RK+L  C  GFGYKT GGK G+ Y VT ++ DD  NP+PGTLRHAVIQ +
Sbjct  125   WRCQPDWARRRKKLVKCVRGFGYKTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQNE  184

Query  1164  PLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIF  985
             PLWIIF HDM+I+L QEL++   KTID RG  VHI+ GAGIT+Q+V N+IIHG+HIHHI 
Sbjct  185   PLWIIFKHDMSIRLCQELMINSHKTIDARGTNVHIAYGAGITMQYVHNIIIHGLHIHHIV  244

Query  984   EGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITIS  805
             +G GG+IR+  DHFG R  +DGDGISIFG++N+W+DH+SM  C DGLIDAI  ST ITIS
Sbjct  245   QGRGGMIRNSNDHFGFRGVADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTGITIS  304

Query  804   NGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHW  625
             N HFT HNDVML GA + +  DK MQ+T+AFNHFGK L+QRMPR R+G++HVVNNDYTHW
Sbjct  305   NSHFTHHNDVMLLGAQNDNHADKKMQVTVAFNHFGKGLVQRMPRIRWGFVHVVNNDYTHW  364

Query  624   NMYAIGGSSHPTIICQGNRFIAPPDI-HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAF  448
              +YAIGGS  PTI+  GNRFIAPP + H +E+TKR      EWK W WRS+ DI+M  A+
Sbjct  365   ELYAIGGSQSPTILSHGNRFIAPPHLQHYREVTKRDSAPESEWKNWNWRSEKDIFMNNAY  424

Query  447   FVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             F QSG+P FM  H +    +       V+ LT++AGAL+CRVG PC
Sbjct  425   FRQSGNPKFMCSHSR-QQMIKPKHGVAVSKLTKYAGALDCRVGKPC  469



>ref|XP_004966014.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=486

 Score =   452 bits (1163),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 244/452 (54%), Positives = 314/452 (69%), Gaps = 13/452 (3%)
 Frame = -3

Query  1650  RFNKNNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLI  1471
             R+++   F L+ V +      +  +I E+D+ WR+R   A   A+  Y+ +P  +   L 
Sbjct  43    RWSRPGSFVLYAVVLLLSAAVSEANIGEFDDYWRQRKLMADAAAEATYQHDPIEVPNQLN  102

Query  1470  HQVRRTLSEAVAEDLTTNTTGRHLLGSKKYR--GPCNATNPIDRCWRCHADWASNRKRLA  1297
               V R++ +   ED++T    R +LG KK +  GPC ATNPIDRCWRC  DWA++RKRLA
Sbjct  103   RAVHRSIKK---EDISTR---REMLGQKKGKMNGPCKATNPIDRCWRCRKDWATDRKRLA  156

Query  1296  DCAMGFGYKTKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIKLH  1120
              CA GFG  T GG +GKFY VTD +DD   NP+PGTLR AVIQ +PLWI FA  M I L 
Sbjct  157   RCAQGFGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWAVIQIEPLWITFAKTMIITLK  216

Query  1119  QELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGN--GGLIRDGLDH  946
             +ELI++GDKTIDGRG QV I++GA +T+QF  NVIIH IHI+ I   N  GG IRD  DH
Sbjct  217   EELIIRGDKTIDGRGVQVRIANGAQLTVQFANNVIIHNIHINDIISSNKNGGNIRDSPDH  276

Query  945   FGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLF  766
             FG RT SDGDGI++FGS+NVW+DH+S+ NC DGLID I  ST +TISN H T+HNDVMLF
Sbjct  277   FGWRTVSDGDGITVFGSTNVWLDHLSLSNCQDGLIDVIAKSTGVTISNCHMTNHNDVMLF  336

Query  765   GANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTI  586
              ++D   +D+IMQIT+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTI
Sbjct  337   SSSDKHPEDQIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKAPTI  396

Query  585   ICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHH  406
             I QGNR+IAPP++  K++TK+      EWK W W S+ D++MEGA+F  +G    +++  
Sbjct  397   ISQGNRYIAPPNLAAKQVTKQHDAPESEWKNWVWHSEDDLFMEGAYFTVTGGQ--INRQF  454

Query  405   KLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
                D +       VT LTRFAG+L+C+ G PC
Sbjct  455   NKKDLIKPKPGSYVTRLTRFAGSLDCKPGKPC  486



>ref|XP_006826355.1| hypothetical protein AMTR_s00004p00123190 [Amborella trichopoda]
 gb|ERM93592.1| hypothetical protein AMTR_s00004p00123190 [Amborella trichopoda]
Length=479

 Score =   452 bits (1162),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 243/422 (58%), Positives = 306/422 (73%), Gaps = 21/422 (5%)
 Frame = -3

Query  1563  DEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTGRHLLGSKK  1384
             D V   RA ++W  AQ AYEP+P  +S        R L+  V  +L +    R  LG ++
Sbjct  75    DSVLEARAHQSWLEAQAAYEPDPEAVS--------RNLTHLVHMELPSGNHMRRQLG-RR  125

Query  1383  YRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD-DQSN  1207
             + GPC ATNPIDRCWRC   W +NRK+LADCAMGFG +  GGK G++Y VTD SD D  N
Sbjct  126   WHGPCVATNPIDRCWRCDQKWHTNRKKLADCAMGFGQQALGGKYGRYYVVTDPSDNDLLN  185

Query  1206  PKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFV  1027
             PKPGTLRHAVIQ +PLWIIF  DM IKL +EL++   KT+DGRGA VHI+ GA ITIQ+V
Sbjct  186   PKPGTLRHAVIQNEPLWIIFQRDMVIKLTEELMVNSFKTVDGRGANVHIAYGACITIQYV  245

Query  1026  KNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDG  847
             KNVIIHG+HIH    GNGG+IRD  DHFG+RT+SDGDGISI+GS+NVW+DH ++  C DG
Sbjct  246   KNVIIHGLHIHDCKAGNGGMIRDSEDHFGIRTRSDGDGISIYGSTNVWVDHNTLSKCQDG  305

Query  846   LIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCR  667
             L+DAI  STAITISN HF+ H++V+L G +DL   DK+MQ+T+AFNHFGK L QRMPRCR
Sbjct  306   LVDAIMGSTAITISNNHFSKHDEVLLLGGSDLYPMDKVMQVTVAFNHFGKGLSQRMPRCR  365

Query  666   YGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWT  487
             +GY HVVNNDYTHW  YAIGGS +PTI+ QGNRF+AP D + KEITKR  G   +W +W 
Sbjct  366   FGYFHVVNNDYTHWGKYAIGGSMNPTILSQGNRFVAPLDPYFKEITKRF-GPDLDWGSWN  424

Query  486   WRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTW---LTRFAGALNCRVGS  316
             W+S+GD++  GA F QSG+        + Y+  ++ +A+  ++   LTRF+GAL C+ G+
Sbjct  425   WKSEGDLFKNGAIFTQSGNG-------RKYERKISIRAKPGSYVGILTRFSGALKCKTGT  477

Query  315   PC  310
             PC
Sbjct  478   PC  479



>ref|XP_009134622.1| PREDICTED: probable pectate lyase 7 [Brassica rapa]
Length=471

 Score =   451 bits (1160),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 244/465 (52%), Positives = 314/465 (68%), Gaps = 28/465 (6%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
              + V+ +A++IP    ++AE D+ W + A EA K    AY P+P+ I     H+     S
Sbjct  9     LVCVICIASLIPTLRANVAETDDYWVKMANEARKRTLMAYHPDPYQI-VDHFHERHYDNS  67

Query  1446  EAVA----------EDLT-----TNTTGRHLLGS---------KKYRGPCNATNPIDRCW  1339
               V           +D+      TN+T R L G           K +GPC A+NPID+CW
Sbjct  68    TDVEETEEHASEEEDDIEMSSSLTNSTRRSLRGRGKGKGRGKWSKLKGPCTASNPIDKCW  127

Query  1338  RCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVT-DKSDDQSNPKPGTLRHAVIQKKP  1162
             RC  DWA  RK+L  C  GFGY+T GGK G+ Y VT ++ DD  NP+PGTLRHAVIQ +P
Sbjct  128   RCQPDWARRRKKLVKCVRGFGYRTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQNEP  187

Query  1161  LWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFE  982
             LWIIF HDM+I+L QEL++   KTID RG  VHI+ GAGIT+Q+V+N+IIHG+H+HHI  
Sbjct  188   LWIIFKHDMSIRLSQELMINSHKTIDARGTNVHIAYGAGITMQYVRNIIIHGLHVHHIVP  247

Query  981   GNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISN  802
             G+GG+IR+  DHFG R ++DGDGIS+FG++N+W+DH+SM  C DGLIDAI  S  IT+SN
Sbjct  248   GSGGMIRNSNDHFGFRGQADGDGISLFGATNIWLDHISMSKCQDGLIDAIMGSPGITLSN  307

Query  801   GHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWN  622
              HFT HNDVML GA + +  DK MQ+T+AFNHFGK L+QRMPR R+G++HVVNNDYTHW 
Sbjct  308   SHFTHHNDVMLLGAQNDNHADKKMQVTVAFNHFGKGLVQRMPRIRWGFVHVVNNDYTHWE  367

Query  621   MYAIGGSSHPTIICQGNRFIAPPDI-HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFF  445
             +YAIGGS  PTI+  GNRFIAPP + H +E+TKR      EWK W WRS  DI+M  A+F
Sbjct  368   LYAIGGSQSPTILSHGNRFIAPPHLQHYREVTKRDYAPESEWKNWNWRSDKDIFMNNAYF  427

Query  444   VQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              QSG+P FM  H +    +       V+ LT++AGAL+CRVG PC
Sbjct  428   RQSGNPKFMCSHSR-QQMIKPKHGSAVSTLTKYAGALDCRVGKPC  471



>ref|XP_006656188.1| PREDICTED: pectate lyase-like [Oryza brachyantha]
Length=446

 Score =   450 bits (1157),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 241/441 (55%), Positives = 308/441 (70%), Gaps = 12/441 (3%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTL  1450
             + +F++S AA   A +G   +YDE W++R   A   A+  Y+ +P  ++      V R+ 
Sbjct  17    YAVFLLSAAATSEANIG---DYDEHWQKRKLMADAAAEATYKRDPFEVTNDFNRAVHRS-  72

Query  1449  SEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYK  1270
                  E+  T      L   KK+ GPC ATNPIDRCWRC  DWA++RKRLA CA GFG  
Sbjct  73    -----EEKETARRSLMLSKRKKFAGPCKATNPIDRCWRCRDDWATDRKRLARCAQGFGRN  127

Query  1269  TKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDK  1093
             T GG +GKFY VTD +DD   NP+PGTLR  VIQ +PLWIIF  +M I L +EL++  DK
Sbjct  128   TTGGLAGKFYVVTDGTDDDVVNPRPGTLRWGVIQDEPLWIIFGKNMIINLKEELMIGNDK  187

Query  1092  TIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdg  913
             T+DGRGAQV I++GA +T+Q   NVIIH IH+H I  G GG+IRD  +HFG RT+SDGDG
Sbjct  188   TVDGRGAQVRITNGAQVTVQNSNNVIIHNIHVHDIVLGKGGMIRDSPEHFGFRTQSDGDG  247

Query  912   isifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKI  733
             I+IFGS+NVW+DH+S+ NC DGLID I  ST +TISN H T+HNDVMLFG++D  ++D+I
Sbjct  248   ITIFGSTNVWLDHLSLSNCQDGLIDVIAKSTGVTISNCHLTNHNDVMLFGSSDSFSEDQI  307

Query  732   MQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP  553
             MQIT+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS +PTII QGNR+IAPP
Sbjct  308   MQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKNPTIISQGNRYIAPP  367

Query  552   DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKA  373
             ++  K+ITK++     EWK W W S+ D++MEGA+F  SG       + K  D +     
Sbjct  368   NLAAKQITKQLGAEESEWKNWVWHSEEDLFMEGAYFTTSGGAIRTSINKK--DLIKPKPG  425

Query  372   EDVTWLTRFAGALNCRVGSPC  310
               VT LTRFAG++ CR G PC
Sbjct  426   SYVTRLTRFAGSIPCRPGKPC  446



>gb|EYU22437.1| hypothetical protein MIMGU_mgv1a006496mg [Erythranthe guttata]
Length=442

 Score =   449 bits (1156),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 246/443 (56%), Positives = 300/443 (68%), Gaps = 15/443 (3%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTL  1450
             FF   +++A  +P      A  DE  +++A EA++ + QAY P+P  ++      V  TL
Sbjct  12    FFCIALALAVTLPRAHAQNATMDEYLQKKAEEAYQESLQAYNPHPEELTEEFNELVGETL  71

Query  1449  SEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYK  1270
                    +  N T R L    K  G C ATNPIDRCWRC  +WA NRK+LADCA GFG++
Sbjct  72    -------IGQNATRRQL----KQTGECMATNPIDRCWRCDRNWAKNRKKLADCARGFGHQ  120

Query  1269  TKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDK  1093
             T GGK G++Y VTD SD D  +PKPGTLRHAVIQ +PLWIIFAH M I+L QELI   DK
Sbjct  121   TTGGKKGRYYLVTDPSDNDMDHPKPGTLRHAVIQTEPLWIIFAHSMVIRLKQELIFTSDK  180

Query  1092  TIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdg  913
             T+DGRG QVHI+ GAG+T+QFV NVIIH I IH+I   NGGLIRD ++H G RT+SDGD 
Sbjct  181   TVDGRGVQVHIAYGAGLTLQFVHNVIIHNIWIHNIIPRNGGLIRDAINHLGFRTQSDGDA  240

Query  912   isifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKI  733
             ISI+ S+ +WIDHVS+    DGLID IE STAITISN     HNDVML GA+D  ++D I
Sbjct  241   ISIYSSNRIWIDHVSLSRATDGLIDIIEGSTAITISNCKLNHHNDVMLLGAHDAQSRDAI  300

Query  732   MQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP  553
             MQ+T+AFN FG  LIQRMPRCR+G+ HVVNNDY HW +YAIGGS+HPTII QGNRF A  
Sbjct  301   MQVTVAFNRFGIGLIQRMPRCRWGFFHVVNNDYQHWELYAIGGSAHPTIISQGNRFRAAD  360

Query  552   DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYD-GVMTFK  376
               + KE+TKR   T +EW  W WRS+GD++M GAFF +SG P        L    ++ FK
Sbjct  361   YQYTKEVTKRDYATKDEWMKWQWRSEGDLFMNGAFFTESG-PAIKHVRSPLNGRNMIKFK  419

Query  375   -AEDVTWLTRFAGALNCRVGSPC  310
                 V  LTR AGA+ CR G  C
Sbjct  420   HGSFVGRLTRSAGAIKCRPGKLC  442



>gb|KEH24975.1| pectate lyase P59-like protein [Medicago truncatula]
Length=453

 Score =   449 bits (1156),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 254/444 (57%), Positives = 301/444 (68%), Gaps = 11/444 (2%)
 Frame = -3

Query  1626  FLFVVSVAAIIP----ATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVR  1459
             F+ +V+ A  IP    A V   AE D+  + RA EA K A + Y P P  ++  L   V 
Sbjct  16    FILLVTFAITIPCLEAAHVLSPAEIDDFVKARAEEAHKVAVETYVPIPEGVAHDLNVAVH  75

Query  1458  RTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGF  1279
              ++    AE+  T    R     KK+ GPC ATNPID CWRC ADWA+NR +LA C+ GF
Sbjct  76    MSME---AEENNTRREMRQ--KGKKHDGPCEATNPIDSCWRCKADWAANRFQLAKCSKGF  130

Query  1278  GYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQ  1102
             G KT GG  G  Y VTD+SD D  NPKPGTLR   +QK PLWI FA  M I+L+QEL++ 
Sbjct  131   GRKTTGGLGGPIYVVTDESDNDMVNPKPGTLRFGAVQKGPLWITFARSMVIRLNQELMVS  190

Query  1101  GDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsd  922
              DKTIDGRGA V I DGAGIT+QFV NVIIHG+HI +I    GGLIRD  DH G RT+SD
Sbjct  191   SDKTIDGRGANVQIRDGAGITMQFVNNVIIHGLHIQNIKAKPGGLIRDSFDHTGQRTRSD  250

Query  921   gdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTK  742
             GD ISI+GSSN+WIDH+S+  C DGL+D I+ ST ITISN H T HNDVMLFGA+D  T 
Sbjct  251   GDAISIYGSSNIWIDHLSLSECEDGLVDIIQGSTGITISNCHMTKHNDVMLFGASDSYTG  310

Query  741   DKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFI  562
             DK+MQIT+AFNHFG+ LIQRMPRCRYG++HV+NNDYTHW MYAIGGSS PTI+ QGNRFI
Sbjct  311   DKLMQITVAFNHFGQGLIQRMPRCRYGFVHVLNNDYTHWIMYAIGGSSSPTILSQGNRFI  370

Query  561   APPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMT  382
             AP +   KE+T R    P+ WK W W S+ D++M GA FV SG P       K Y  +  
Sbjct  371   APDNGAAKEVTHRDYAPPDVWKNWQWSSELDVFMNGAKFVPSGAPINRKPFKKAY-MMQP  429

Query  381   FKAEDVTWLTRFAGALNCRVGSPC  310
                  V+ LTR AGALNC VG PC
Sbjct  430   RDGSHVSRLTRNAGALNCVVGKPC  453



>ref|XP_009148818.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=458

 Score =   449 bits (1156),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 247/452 (55%), Positives = 307/452 (68%), Gaps = 18/452 (4%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTL  1450
             F   + S+A + P    +IA +D+ W +R  +A K    +++P P N++  L + V    
Sbjct  13    FVFLLSSLATLAPQVQANIAVFDDYWTQRQGDALKQTLASFDPYPLNVTNHLNYHV----  68

Query  1449  SEAVAEDLT--TNTTGRHLLGSKK-----YRGPCNATNPIDRCWRCHADWASNRKRLADC  1291
               A+A D T  TN+T R L  +++      RG C A NPID+CWRC  DW  NRK+LA C
Sbjct  69    --ALALDTTESTNSTRRELSQARRGRKMQNRGKCVAHNPIDKCWRCDRDWEKNRKKLAVC  126

Query  1290  AMGFGYKTKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQE  1114
             A+GFG +T GGK G  Y VTD SDD+  +P+PGTLRHAV +  PLWIIFA  M IKL QE
Sbjct  127   ALGFGRRTTGGKDGPIYVVTDASDDELISPRPGTLRHAVTRDGPLWIIFARSMVIKLQQE  186

Query  1113  LIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLR  934
             L+M  DKTIDGRGA+V+I  G+G+T+QFV NVIIH I+I  I   NGGLIRD   H GLR
Sbjct  187   LMMTSDKTIDGRGARVYIMGGSGLTLQFVNNVIIHNIYIKQIVPANGGLIRDSEQHIGLR  246

Query  933   TKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGAND  754
             T+SDGDGI++FG++NVWIDHVSM  C DG+IDAI  STA+T+SN HFTDH +VMLFGAND
Sbjct  247   TRSDGDGINLFGATNVWIDHVSMTRCSDGMIDAILGSTAVTVSNSHFTDHQEVMLFGAND  306

Query  753   LSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQG  574
                 DK MQIT+AFNHFGKRL QRMPR R+G IHVVNNDYTHW MYAIGG+ +PTII  G
Sbjct  307   KHEIDKKMQITVAFNHFGKRLEQRMPRVRFGTIHVVNNDYTHWEMYAIGGNMNPTIISHG  366

Query  573   NRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN-FMDKHHKLY  397
             NRFIAPP+   K+ITKR   +  +WK W W+S+GD ++ GA+FVQSG PN +  K     
Sbjct  367   NRFIAPPNEQAKQITKREYTSYVDWKLWNWQSEGDYFLNGAYFVQSGKPNAWSPKPKNPI  426

Query  396   DGVMTFKAEDVTW---LTRFAGALNCRVGSPC  310
                   + +  T    LT  AG L C+ G  C
Sbjct  427   PNKFAIRPKPGTMVRKLTMDAGVLGCKQGQAC  458



>emb|CDY39314.1| BnaC05g10650D [Brassica napus]
Length=459

 Score =   449 bits (1156),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 246/454 (54%), Positives = 307/454 (68%), Gaps = 19/454 (4%)
 Frame = -3

Query  1632  CFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRT  1453
              F  F+ S+A + P    +IA +D+ W +R  +A K    +++P P N++  L + V   
Sbjct  12    VFVFFLSSLATLAPQVQANIAVFDDYWTQRQGDALKQTLASFDPYPLNVTNHLNYHV---  68

Query  1452  LSEAVAEDLT--TNTTGRHLLGSKK------YRGPCNATNPIDRCWRCHADWASNRKRLA  1297
                A+A D T   N+T R L  +++       RG C A NPID+CWRC  DW  NRK+LA
Sbjct  69    ---ALALDTTGSINSTRRELSQARRGRKMQNRRGKCVAHNPIDKCWRCDRDWEKNRKKLA  125

Query  1296  DCAMGFGYKTKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIKLH  1120
              CA+GFG +T GGK G  Y VTD SDD+  +P+PGTLRHAV +  PLWIIFA  M IKL 
Sbjct  126   VCALGFGRRTSGGKDGPIYVVTDASDDELISPRPGTLRHAVTRDGPLWIIFARSMVIKLQ  185

Query  1119  QELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFG  940
             QEL+M  DKTIDGRGA+V+I  G+G+T+QFV NVI+H I+I  I   NGGLIRD   H G
Sbjct  186   QELMMTSDKTIDGRGARVYIMGGSGLTLQFVNNVIVHNIYIKQIVPANGGLIRDSEQHIG  245

Query  939   LRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGA  760
             LRT+SDGDGI++FG++NVWIDHVSM  C DG+IDAI  STA+T+SN HFTDH +VMLFGA
Sbjct  246   LRTRSDGDGINLFGATNVWIDHVSMTRCSDGMIDAILGSTAVTVSNSHFTDHQEVMLFGA  305

Query  759   NDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIIC  580
             ND    DK MQIT+AFNHFGKRL QRMPR R+G IHVVNNDYTHW MYAIGG+ +PTII 
Sbjct  306   NDKHEIDKKMQITVAFNHFGKRLEQRMPRVRFGTIHVVNNDYTHWEMYAIGGNMNPTIIS  365

Query  579   QGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN-FMDKHHK  403
              GNRFIAPP+   K+ITKR   +  +WK W W+S+GD ++ GA+FVQSG PN +  K   
Sbjct  366   HGNRFIAPPNEQAKQITKREYTSYVDWKLWNWQSEGDYFLNGAYFVQSGKPNAWSPKPKN  425

Query  402   LYDGVMTFKAEDVTW---LTRFAGALNCRVGSPC  310
                     + +  T    LT  AG L C+ G  C
Sbjct  426   PIPNKFAIRPKPGTMVRKLTMDAGVLGCKQGQAC  459



>ref|XP_006431087.1| hypothetical protein CICLE_v10011762mg [Citrus clementina]
 ref|XP_006431088.1| hypothetical protein CICLE_v10011763mg [Citrus clementina]
 gb|ESR44327.1| hypothetical protein CICLE_v10011762mg [Citrus clementina]
 gb|ESR44328.1| hypothetical protein CICLE_v10011763mg [Citrus clementina]
Length=435

 Score =   449 bits (1154),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 239/440 (54%), Positives = 310/440 (70%), Gaps = 13/440 (3%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
              +F+ S   +IP  +  IAE DEVWRRRA EA +  +Q Y+P+P  ++++L  +V     
Sbjct  8     LIFLFSFIILIPC-LSAIAEADEVWRRRAEEAMQTTEQYYDPDPVAVASNLNMKV-----  61

Query  1446  EAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKT  1267
                 +DL+  T  R  L + +  G C ATNPID+CWRC  +WA +R+ LA CA+GFG K 
Sbjct  62    ----QDLSKQTAARRGLLNAE-SGQCEATNPIDKCWRCKENWAEDRQALAGCALGFGSKA  116

Query  1266  KGGKSGKFYTVTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKT  1090
              GGK GK Y VTD SD+   NPK GTLRHAVIQK+PLWIIFA DMNIKL QEL++QG+KT
Sbjct  117   TGGKGGKIYEVTDSSDNNMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQELVVQGNKT  176

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             IDGRGA VHI++GAGI +QFV+NVIIHGIHIH+I   +GG+IRD +DH G R  SDGD +
Sbjct  177   IDGRGANVHIANGAGIRLQFVQNVIIHGIHIHNISPASGGMIRDSVDHVGNRGPSDGDAV  236

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             S+F SSN+W+DH+++    DGLIDAI+ STAITISN H ++H+  +L GA D  T+DK M
Sbjct  237   SVFSSSNIWLDHLTLSKAQDGLIDAIQGSTAITISNCHLSNHDKAILLGATDTFTEDKKM  296

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             Q+T+AFN F K L+QRMP  R+G+ HVVNNDY  W MYAIGG   PTI+ QGNRF A  +
Sbjct  297   QVTVAFNRFDKGLVQRMPCIRFGFAHVVNNDYNQWEMYAIGGLKGPTILSQGNRFFASDN  356

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAE  370
              + KE+TKR+  +PEE   W WRS+GD+++ GA+F  SGDP    K ++L D +      
Sbjct  357   KNAKEVTKRMDCSPEEGNGWIWRSEGDVFLNGAYFNASGDPKKQIK-YELNDVIKPAPGT  415

Query  369   DVTWLTRFAGALNCRVGSPC  310
             +V  +T+FAGAL C+ G  C
Sbjct  416   EVQRITKFAGALVCKPGQQC  435



>dbj|BAK06965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   449 bits (1154),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 244/453 (54%), Positives = 306/453 (68%), Gaps = 13/453 (3%)
 Frame = -3

Query  1656  MERFNKNNCFFLFVVSVAAIIPATV--GHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNIS  1483
             ME F  +    L + +V  +  A V   +I E+DE W+RR  EA   A+  Y PNP  ++
Sbjct  1     MEGFQWSRPVSLLLYAVLFLSAAAVSEANIGEFDEHWQRRKLEARARAEATYHPNPIEVA  60

Query  1482  ASLIHQVRRTLSEAVAEDLTTNTTGRHLLG-SKKYRGPCNATNPIDRCWRCHADWASNRK  1306
              SL   V R+L +        + + R LLG  KK+ GPC ATNPIDRCWRC  DWA++R 
Sbjct  61    NSLNRAVHRSLRD-------ESGSRRKLLGLHKKFAGPCTATNPIDRCWRCRKDWATDRM  113

Query  1305  RLADCAMGFGYKTKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNI  1129
             RLA CA GFG    GG  GK Y VTD +DD    P+PGTLR  VIQ +PLWIIFA  M I
Sbjct  114   RLARCAQGFGRNATGGLGGKIYIVTDGTDDDVLEPRPGTLRWGVIQNEPLWIIFARPMLI  173

Query  1128  KLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLD  949
             KL +EL++  DKTIDGRGAQV I+DGA +T+Q+  NVIIH IH++ +  G GG IRD   
Sbjct  174   KLKEELLVGSDKTIDGRGAQVRIADGAQVTVQYSHNVIIHNIHVNDLIVGKGGRIRDSPQ  233

Query  948   HFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVML  769
             H G RT+SDGDG+S+FGS+NVW+DH+S+  C DGLID I  +T +TISN H T+HNDVML
Sbjct  234   HAGFRTQSDGDGVSVFGSTNVWLDHLSLATCQDGLIDVIAEATGVTISNCHLTNHNDVML  293

Query  768   FGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPT  589
             FG++D + KD+IMQ+T+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS +PT
Sbjct  294   FGSSDSNPKDQIMQVTVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKNPT  353

Query  588   IICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKH  409
             II QGNR+IAPP++  K ITKR+  +  EWK W W SQ D+ +  A F  SG  N  ++ 
Sbjct  354   IISQGNRYIAPPNLAAKLITKRLGASEAEWKNWVWHSQDDLLLNDAVFADSGGAN--ERK  411

Query  408   HKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
                 D +       VT LTRFAG L C+ G PC
Sbjct  412   FDKDDLITPKPGSYVTRLTRFAGCLPCKPGKPC  444



>gb|KFK43687.1| hypothetical protein AALP_AA1G160000 [Arabis alpina]
Length=460

 Score =   449 bits (1155),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 248/453 (55%), Positives = 303/453 (67%), Gaps = 16/453 (4%)
 Frame = -3

Query  1632  CFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRT  1453
              F  F+  +A   P +  H+A +D  W +R  +A +    +Y+PNP N++    H V   
Sbjct  12    VFVFFLSFIATFPPESRAHVAVFDNYWTQRQTDALRQTMNSYDPNPLNVTDHFNHHV---  68

Query  1452  LSEAVAEDLTTNTTGRHLLGSKKY-------RGPCNATNPIDRCWRCHADWASNRKRLAD  1294
              S A+    + N T R L   +K         G C A N ID+CWRC  +WA NRK+L D
Sbjct  69    -SLAMDATESNNGTRRELTQVRKSGRKIHKSSGKCLAYNAIDKCWRCDRNWAKNRKKLTD  127

Query  1293  CAMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQ  1117
             C +GFG KT GGK G  Y V D SD D  NPKPGTLR+AV +  PLWIIFA  M IKL Q
Sbjct  128   CVLGFGRKTTGGKDGPIYVVNDASDNDLVNPKPGTLRYAVTRDGPLWIIFARSMIIKLQQ  187

Query  1116  ELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGL  937
             EL++  DKTIDGRGA+++I +GAG+T+Q+V NVIIH I++ HI  GNGGLIRD   H GL
Sbjct  188   ELMITSDKTIDGRGARIYIMEGAGLTLQYVNNVIIHNIYVKHIVPGNGGLIRDSEHHLGL  247

Query  936   RTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGAN  757
             RTKSDGDGIS+FG++NVWIDHVSM  C DG+IDAI+ STA+TISN HFTDH +VMLFGA 
Sbjct  248   RTKSDGDGISLFGATNVWIDHVSMTRCADGMIDAIQGSTAVTISNSHFTDHQEVMLFGAR  307

Query  756   DLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQ  577
             D    DK MQIT+AFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+ +PTII Q
Sbjct  308   DEDVIDKKMQITVAFNHFGKRLEQRMPRCRFGLIHVVNNDYTHWEMYAIGGNMNPTIISQ  367

Query  576   GNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN-FMDKHHKL  400
             GNRFIAPP+   K+ITKR      EWK+W W+S+GD ++ GA+FVQSG  N +  K    
Sbjct  368   GNRFIAPPNEQAKQITKREYTPFIEWKSWNWQSEGDYFLNGAYFVQSGKANAWSPKPVNP  427

Query  399   YDGVMTFKAEDVTW---LTRFAGALNCRVGSPC  310
                    + +  T    LT  AGAL C+ G  C
Sbjct  428   LPNKFRIRPKPGTMVRKLTMDAGALGCKHGKAC  460



>ref|XP_006482544.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=435

 Score =   448 bits (1152),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 240/440 (55%), Positives = 311/440 (71%), Gaps = 13/440 (3%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
              +F+ S   +IP  +  IAE DEVWRRRA EA +  +Q Y+P+P  ++++L  +V     
Sbjct  8     LIFLFSFIILIPC-LSAIAEADEVWRRRAEEAMQTTEQYYDPDPVAVASNLNMKV-----  61

Query  1446  EAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKT  1267
                 +DL+  T  R  L + +  G C ATNPID+CWRC  +WA +R+ LA CA+GFG K 
Sbjct  62    ----QDLSKQTAARRGLLNAE-SGQCEATNPIDKCWRCKENWAEDRQALAGCALGFGSKA  116

Query  1266  KGGKSGKFYTVTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKT  1090
              GGK GK Y VTD SD+   NPK GTLRHAVIQK+PLWIIFA DMNIKL QEL++QG+KT
Sbjct  117   TGGKGGKIYEVTDSSDNNMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQELVVQGNKT  176

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             IDGRGA VHI++GAGI +QFV+NVIIHGIHIH+I   +GG+IRD +DH G R  SDGD +
Sbjct  177   IDGRGANVHIANGAGIRLQFVQNVIIHGIHIHNISPASGGMIRDSVDHVGNRGPSDGDAV  236

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             S+FGSSN+W+DH+++    DGLIDAI+ STAITISN H ++H+  +L GA D  T+DK M
Sbjct  237   SVFGSSNIWLDHLTLSKAQDGLIDAIQGSTAITISNCHLSNHDKAILLGATDTFTEDKKM  296

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             Q+T+AFN F K L+QRMP  R+G+ HVVNNDY  W MYAIGG   PTI+ QGNRF A  +
Sbjct  297   QVTVAFNRFDKGLVQRMPCIRFGFAHVVNNDYNQWEMYAIGGLKGPTILSQGNRFFASDN  356

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAE  370
              + KE+TKR+  +PEE   W WRS+GD+++ GA+F  SGDP    K ++L D +      
Sbjct  357   KNAKEVTKRMDCSPEEGNGWIWRSEGDVFLNGAYFNASGDPKKQIK-YELNDVIKPAPGT  415

Query  369   DVTWLTRFAGALNCRVGSPC  310
             +V  +T+FAGAL C+ G  C
Sbjct  416   EVQRITKFAGALVCKPGQQC  435



>emb|CDY41679.1| BnaC02g34750D [Brassica napus]
Length=457

 Score =   449 bits (1154),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 248/452 (55%), Positives = 305/452 (67%), Gaps = 6/452 (1%)
 Frame = -3

Query  1647  FNKNNCFFLFV-VSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLI  1471
              N  +   +FV +S+A + P+   HIA +D+ W +R A A +   ++YEPNP N++    
Sbjct  6     LNLGSYVIVFVSLSIAIVAPSVQAHIAVFDDYWTQRQANALRQTMESYEPNPLNVTNHFN  65

Query  1470  HQVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADC  1291
             +     +    A++      G+   G K   G   + N IDRCWR   +WA NRK+LADC
Sbjct  66    YHAALAMETTGADNGPRRELGQVKAGQKTRGGRFRSLNAIDRCWRGDKNWAKNRKKLADC  125

Query  1290  AMGFGYKTKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQE  1114
              +GFG KT GGK+G  Y VTD SDD   +PKPGTLRHAV + +PLWIIFA  M IKL QE
Sbjct  126   VLGFGLKTIGGKNGPIYVVTDASDDDLLSPKPGTLRHAVTRDRPLWIIFARTMVIKLQQE  185

Query  1113  LIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLR  934
             L++  DKTIDGRG  V+I+ GAG T+QFVKNVIIH IH+  I  G GGLIRD  +HFGLR
Sbjct  186   LMITNDKTIDGRGVSVYITGGAGFTLQFVKNVIIHNIHMKFIKRGFGGLIRDSEEHFGLR  245

Query  933   TKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGAND  754
             T SDGDGI+IFG++N+WIDHVSMRNC DG+IDAI  STAITISN HFTDH +VMLFGA +
Sbjct  246   TISDGDGINIFGATNIWIDHVSMRNCSDGMIDAIMGSTAITISNSHFTDHKEVMLFGAKN  305

Query  753   LSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQG  574
                 DK MQIT+AFNHFGKRL QRMPR RYG +HVVNNDYTHW MYAIGG+ +PTII QG
Sbjct  306   GDEFDKKMQITVAFNHFGKRLNQRMPRVRYGMVHVVNNDYTHWEMYAIGGNMNPTIISQG  365

Query  573   NRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK-LY  397
             NRFIAPP    K++TKR      EWK+W W+S+ D ++ GA+FVQSG  N      K   
Sbjct  366   NRFIAPPKEDCKQVTKREYTPYPEWKSWNWQSERDYFLNGAYFVQSGKSNAWSAAPKNPI  425

Query  396   DGVMTFKAE---DVTWLTRFAGALNCRVGSPC  310
                 T + +    V  LT+ AG L+CR G  C
Sbjct  426   PKEFTIRPQPGTKVRSLTKDAGTLDCRPGKSC  457



>ref|XP_003563707.1| PREDICTED: pectate lyase-like [Brachypodium distachyon]
Length=448

 Score =   448 bits (1153),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 247/456 (54%), Positives = 313/456 (69%), Gaps = 15/456 (3%)
 Frame = -3

Query  1656  MERFN---KNNCFFLFVVS--VAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPH  1492
             ME F    +   F L+VV   ++A  P +  +I ++DE W++R A A   A+  Y+ +P 
Sbjct  1     MEGFQWGRRAGSFVLYVVFFFLSASAPVSQANIGDFDEHWQQRKAAARAAAEAIYQSDPL  60

Query  1491  NISASLIHQVRRTLSEAVAEDLTTNTTGRHLLGS-KKYRGPCNATNPIDRCWRCHADWAS  1315
              ++ SL   V R   E  A       T R +LG  KK+ GPC ATNPIDRCWRC  DWA+
Sbjct  61    EVANSLNRAVHRATKEDDA------GTRRSMLGKHKKFAGPCRATNPIDRCWRCRKDWAT  114

Query  1314  NRKRLADCAMGFGYKTKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHD  1138
             +RKRLA CA GFG    GG +GKFY VTD SDD    P+PGTLR AVIQ +PLWIIFA  
Sbjct  115   DRKRLARCAQGFGRNATGGLAGKFYIVTDGSDDDVLAPRPGTLRWAVIQAEPLWIIFARS  174

Query  1137  MNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRD  958
             M IKL +EL++  DKTIDGRGAQV I+DGA +T+Q+  NVIIH IHI+ +  G GG+IRD
Sbjct  175   MLIKLKEELLIGSDKTIDGRGAQVRIADGAQVTVQYAHNVIIHNIHINDLIVGKGGMIRD  234

Query  957   GLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHND  778
                HFG RT+SDGDG+++FGS++VW+DH+S+  C DGLID I  ST +TISN H T+HND
Sbjct  235   SPAHFGFRTQSDGDGVNVFGSTSVWLDHLSLATCQDGLIDVIAESTGVTISNCHLTNHND  294

Query  777   VMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSS  598
             VMLFG++D + KD IMQIT+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS 
Sbjct  295   VMLFGSSDSNPKDVIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSK  354

Query  597   HPTIICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFM  418
              PTI+ QGNR+IAPP++  K+ITK++     EWK W W SQ D+ M GAFF ++G    +
Sbjct  355   DPTILSQGNRYIAPPNLAAKQITKQIGAAEPEWKNWVWHSQEDLLMNGAFFTETGGD--I  412

Query  417   DKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              +     D +       VT LTR+AG + CR G PC
Sbjct  413   KRKFDKDDLIKPKPGTYVTRLTRYAGCIPCRPGKPC  448



>gb|KFK33456.1| hypothetical protein AALP_AA5G015800 [Arabis alpina]
Length=460

 Score =   449 bits (1154),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 255/457 (56%), Positives = 309/457 (68%), Gaps = 13/457 (3%)
 Frame = -3

Query  1647  FNKNNCFFLFV-VSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLI  1471
              N       FV +++A I P+   HIA YDE W +R  EA +   ++YEP+P N++    
Sbjct  6     LNLGTYVLAFVSLALAIIAPSVQAHIAVYDEYWTQRQTEALRRTLESYEPDPLNVTDHFN  65

Query  1470  HQVRRTL--SEAV---AEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRK  1306
             +     +  +EAV     +L     GR  +  KK  G   + N ID+CWR   +WA NRK
Sbjct  66    YHSALAMETTEAVNGTRRELRVVGGGRKTI--KKRGGRFQSLNAIDKCWRGDKNWAKNRK  123

Query  1305  RLADCAMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNI  1129
             +LADC +GFG KT GGK+G  Y VTD SD D  NP+PGTLRHAV + +PLWIIFA  M I
Sbjct  124   KLADCVLGFGRKTTGGKAGPIYEVTDASDNDVMNPRPGTLRHAVTRDRPLWIIFAKSMVI  183

Query  1128  KLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLD  949
             KL QELI+  DKTIDGRG  VHI+ GAG+TIQFVKNVIIH IH+  I    GG+IRD  +
Sbjct  184   KLQQELIITNDKTIDGRGVSVHITGGAGLTIQFVKNVIIHNIHMKFIERRAGGMIRDSEN  243

Query  948   HFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVML  769
             HFGLRT+SDGDGI+IFG++NVWIDHVSMRNC DG+IDAI  STAITISN HFTDH +VML
Sbjct  244   HFGLRTESDGDGINIFGATNVWIDHVSMRNCSDGMIDAIMGSTAITISNCHFTDHEEVML  303

Query  768   FGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPT  589
             FGA +    DK MQIT+AFNHFGKRL QRMPR RYG +HVVNNDYTHW MYAIGG+ +PT
Sbjct  304   FGAKNGDVIDKKMQITVAFNHFGKRLDQRMPRVRYGMVHVVNNDYTHWQMYAIGGNMNPT  363

Query  588   IICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKH  409
             II QGNRFIAPP+  KK+ITKR      EWK+W W+S+ D ++ GA+FVQSG  N     
Sbjct  364   IISQGNRFIAPPEEDKKQITKREYTPYPEWKSWNWQSERDYFLNGAYFVQSGKSNAWSST  423

Query  408   HK-LYDGVMTFKAE---DVTWLTRFAGALNCRVGSPC  310
              K       T + +    V  LT+ AG L C+ G  C
Sbjct  424   PKNPIPRKFTIRPQPGTKVRRLTKDAGTLGCKPGKSC  460



>ref|XP_002437204.1| hypothetical protein SORBIDRAFT_10g022830 [Sorghum bicolor]
 gb|EER88571.1| hypothetical protein SORBIDRAFT_10g022830 [Sorghum bicolor]
Length=454

 Score =   448 bits (1153),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 248/454 (55%), Positives = 313/454 (69%), Gaps = 13/454 (3%)
 Frame = -3

Query  1650  RFNKNNCFFLF-VVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASL  1474
             R+++   F LF +V   +   ++  +I ++D+ WR+R   A   A+  Y+ +P  ++  L
Sbjct  7     RWSRAGSFVLFYLVLFLSAAVSSEANIGDFDDYWRQRKLMADAAAEATYKHDPLEVTNQL  66

Query  1473  IHQVRRTLSEAVAEDLTTNTTGRHLLGSKKYR---GPCNATNPIDRCWRCHADWASNRKR  1303
                V R++ +   ED++T    R ++G KK +   GPC ATNPIDRCWRC  DWA++RKR
Sbjct  67    NRAVHRSVEK---EDMSTRR--RAMMGHKKGKLNNGPCEATNPIDRCWRCRQDWATDRKR  121

Query  1302  LADCAMGFGYKTKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIK  1126
             LA CA GFG  T GG +GKFY VTD +DD   NP+PGTLR AVIQ +PLWI FA  M I 
Sbjct  122   LARCAQGFGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWAVIQIEPLWITFARTMIIT  181

Query  1125  LHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGN--GGLIRDGL  952
             L +ELI+QGDKTIDGRGAQV I++GA +T+QF  NVIIH +HI+ I   N  GG IRD  
Sbjct  182   LKEELIIQGDKTIDGRGAQVRIANGAQLTVQFANNVIIHNVHINDIMSSNKNGGNIRDSP  241

Query  951   DHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVM  772
             DHFG RT SDGDGI++FGS+NVW+DH+S+ NC DGLID I  ST +TISN H T+HNDVM
Sbjct  242   DHFGWRTVSDGDGITLFGSTNVWLDHLSLSNCQDGLIDVIVKSTGVTISNCHMTNHNDVM  301

Query  771   LFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHP  592
             LF ++D   +D+IMQIT+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  P
Sbjct  302   LFSSSDKHPEDQIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKAP  361

Query  591   TIICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDK  412
             TII QGNR+IAPP++  K +TK       EWK W W S+ D++MEGA F  SG       
Sbjct  362   TIISQGNRYIAPPNLAAKLVTKHHDAPESEWKNWVWHSENDLFMEGANFTVSGGQKINRN  421

Query  411   HHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              HK  D +       VT LTR+AGAL CR G PC
Sbjct  422   FHK-KDLIKPKNGSYVTRLTRYAGALACRPGKPC  454



>gb|KHN13240.1| Putative pectate lyase 3 [Glycine soja]
Length=446

 Score =   447 bits (1151),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 251/450 (56%), Positives = 300/450 (67%), Gaps = 24/450 (5%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
             F  + + A +IP     IAE+D+  + +A EA K A  +Y P PH+++  L   V   L 
Sbjct  10    FTLLATFAIVIPCLEAGIAEFDDFLKAQADEAHKIALDSYVPEPHDVAHELNFHVHMALE  69

Query  1446  EAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKT  1267
              +   +L      R L G     G C A+NPID CWRC+ DWA++R RLA C  GFG + 
Sbjct  70    NSTRRELRQ----RKLRGG----GKCQASNPIDACWRCNKDWANDRFRLAKCGKGFGRRA  121

Query  1266  KGGKSGKFYTVTDKSDD-QSNPKPGTLRHA-------VIQKKPLWIIFAHDMNIKLHQEL  1111
              GG  G  Y VTD SDD   NPKPGT+RHA       V QK PLWIIF H M I L QEL
Sbjct  122   TGGLGGPIYVVTDNSDDDMVNPKPGTIRHAPGTIRHAVTQKGPLWIIFGHSMIISLRQEL  181

Query  1110  IMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRT  931
             ++  DKTIDGRGA V   DGAG+TIQFV NVIIHG+ I  I   +GG+IRD  DH+GLRT
Sbjct  182   MISSDKTIDGRGANVVFRDGAGLTIQFVNNVIIHGVRIKDIVPKDGGMIRDSADHYGLRT  241

Query  930   KsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDL  751
             +SDGD ISIFGS+N+WIDHVS+ NC DGLID I+ STAITISN H T HNDV LFGA+D 
Sbjct  242   RSDGDAISIFGSTNIWIDHVSLSNCADGLIDIIQGSTAITISNCHMTKHNDVFLFGASDS  301

Query  750   STKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGN  571
                DKIMQIT+AFNHFG+ L+QRMPRCR+G++HV+NNDYTHW MYAIGGSS PTI+ QGN
Sbjct  302   YNGDKIMQITVAFNHFGQGLVQRMPRCRWGFVHVLNNDYTHWLMYAIGGSSGPTILSQGN  361

Query  570   RFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDG  391
             RFIAP + + KEIT R    P+ WK W W+S+ D++M GA FV SG P  M      Y  
Sbjct  362   RFIAPNNDNAKEITHRDYAGPDVWKNWQWQSEMDLFMNGAKFVTSGSPIKM-----TYKK  416

Query  390   VMTFKAED---VTWLTRFAGALNCRVGSPC  310
              +  K  D   V+ LTR AGALNC VG PC
Sbjct  417   GLIMKPRDGTHVSRLTRHAGALNCFVGKPC  446



>ref|XP_006292606.1| hypothetical protein CARUB_v10018855mg [Capsella rubella]
 gb|EOA25504.1| hypothetical protein CARUB_v10018855mg [Capsella rubella]
Length=455

 Score =   447 bits (1150),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 253/457 (55%), Positives = 308/457 (67%), Gaps = 16/457 (4%)
 Frame = -3

Query  1644  NKNNCFFLFV-VSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIH  1468
             N  +  F+FV +S+A ++P+   HIA +DE W +R  EA +   +AY+P P N++    H
Sbjct  3     NLGSYVFVFVSLSLAVVVPSVQAHIAVHDEYWTQRQTEALQQTLEAYDPEPLNVTDHFNH  62

Query  1467  QVRRTLSEAVAEDLTTNTTGRHLL----GSKKYRGP--CNATNPIDRCWRCHADWASNRK  1306
             Q     + A+      N T R L     G+KK R      + N ID+CWR   +W  NRK
Sbjct  63    QA----ALAMVPTGIVNETRRELRQVGRGNKKPRRGRRYESLNAIDKCWRGDKNWDKNRK  118

Query  1305  RLADCAMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNI  1129
             +LADC +GFG KT GGK+G FY VTD SD D  NPKPGTLR+AV + +PLWIIFA  M I
Sbjct  119   KLADCVLGFGRKTTGGKNGPFYVVTDPSDTDLMNPKPGTLRYAVTRDRPLWIIFARSMII  178

Query  1128  KLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLD  949
             KL QELI+  DKTIDGRGA VHI+ GAG+T+QFV+NVIIH I+I  I +G GGLIRD   
Sbjct  179   KLQQELIITNDKTIDGRGANVHITGGAGLTLQFVRNVIIHNIYIKQIKKGAGGLIRDSEH  238

Query  948   HFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVML  769
             HFGLRT SDGDGI+IFG++NVWIDHVSM +C DG+IDAI  STAITISN HFTDH++VML
Sbjct  239   HFGLRTVSDGDGINIFGATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVML  298

Query  768   FGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPT  589
             FG  +    DK MQIT+AFNHFGKRL QRMPR RYG +HVVNNDYTHW MYAIGG+ +PT
Sbjct  299   FGGTNKDVIDKKMQITVAFNHFGKRLKQRMPRVRYGLVHVVNNDYTHWEMYAIGGNMNPT  358

Query  588   IICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKH  409
             II QGNRFIAPP    K++TKR      EWKTW W+S+ D ++ GA+FVQSG  N     
Sbjct  359   IISQGNRFIAPPIEDSKQVTKREYTPYPEWKTWNWQSEKDYFLNGAYFVQSGKANAWSTA  418

Query  408   HK----LYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              K        +       V  LT+ AG L C+ G  C
Sbjct  419   PKNPIPRKFAIRPQPGTKVRRLTKDAGTLGCKPGKSC  455



>gb|KFK37588.1| hypothetical protein AALP_AA3G002600 [Arabis alpina]
Length=472

 Score =   447 bits (1151),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 245/467 (52%), Positives = 319/467 (68%), Gaps = 31/467 (7%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNI----------SAS  1477
              + VV +A++IP    ++AE D+ W  +A EA K     Y P+P+ I          +++
Sbjct  9     LVCVVCIASLIPTLRANVAETDDYWVNKANEARKRTLSVYHPDPYAIVDHFHERHYDNST  68

Query  1476  LIHQVRRTLSEAVAEDLTTN-------TTGRHLLGSK-------KYRGPCNATNPIDRCW  1339
              + +     + A AE+  T        +T R L G++       K +GPC A+NPID+CW
Sbjct  69    DVEEREEHEATAFAEEDDTEMISSSTNSTRRSLSGNRGKRGKWSKLKGPCTASNPIDKCW  128

Query  1338  RCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTD-KSDDQSNPKPGTLRHAVIQKKP  1162
             RC ADWA  RK+L  C  GFGY+T GGK G+ Y VT  + DD  NPKPGTLRHAVIQK+P
Sbjct  129   RCQADWAKRRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDVVNPKPGTLRHAVIQKEP  188

Query  1161  LWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFE  982
             LWIIF HDM+I+L QEL++   KTID RGA VH++ GAGIT+Q+V N+IIHG+H+HHI E
Sbjct  189   LWIIFKHDMSIRLKQELMINSHKTIDARGANVHVAYGAGITMQYVHNIIIHGLHVHHIIE  248

Query  981   GNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISN  802
             G+GG++R+ +DHFG R K+DGDGISIFG++N+W+DH+SM  C DGLIDAI  ST ITISN
Sbjct  249   GSGGMVRNSVDHFGFRGKADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTGITISN  308

Query  801   GHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWN  622
              HFT HNDVML GA+D +  DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW 
Sbjct  309   SHFTHHNDVMLLGAHDSNKDDKKMQVTVAYNHFGKGLVQRMPRVRWGFVHVVNNDYTHWE  368

Query  621   MYAIGGSSHPTIICQGNRFIAPPDIHK---KEITKRVKGTPEEWKTWTWRSQGDIYMEGA  451
             +YAIGGS  PTI+  GNRFIA   +HK    E+TKR   +  EWK W WRS  D++M  A
Sbjct  369   LYAIGGSQGPTILSHGNRFIA--SLHKPQYNEVTKRDYASESEWKNWNWRSDRDVFMNRA  426

Query  450   FFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             +F QSG+P F   H +    +        + LT++AGAL+CRVG PC
Sbjct  427   YFRQSGNPKFKCTHTR-QQMIKPKHGVAASMLTKYAGALDCRVGKPC  472



>emb|CDP00293.1| unnamed protein product [Coffea canephora]
Length=445

 Score =   446 bits (1148),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 244/425 (57%), Positives = 299/425 (70%), Gaps = 16/425 (4%)
 Frame = -3

Query  1578  HIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTGRHL  1399
             HI E+D+  R+RA +A + + +AY P+P  ++ +   QV + L          N T R L
Sbjct  35    HIGEFDDFLRKRAEDALQASLRAYNPDPEAVTDNFTRQVGKMLEGG-------NETRRQL  87

Query  1398  LGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD  1219
                    G C ATNPIDRCWRC  +WA NRKRLA CA GFG +TKGG  GK+Y V D SD
Sbjct  88    KA-----GGCVATNPIDRCWRCDPNWAKNRKRLAKCARGFGRQTKGGMHGKYYVVVDPSD  142

Query  1218  DQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGI  1042
             D   +P+PGTLRHAVIQ++PLWIIF   M IKL+QEL++  DKTIDGRG +VHI+ GAG+
Sbjct  143   DNVQDPEPGTLRHAVIQQEPLWIIFDTSMVIKLNQELLINSDKTIDGRGVEVHIAYGAGL  202

Query  1041  TIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMR  862
             +IQFV+NVIIH I IHHI   NGGL+RD   H GLRT+SDGDGISIFGS++VWIDHVS+ 
Sbjct  203   SIQFVQNVIIHNIKIHHIVPKNGGLVRDSTSHIGLRTRSDGDGISIFGSNHVWIDHVSLS  262

Query  861   NCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQR  682
              C DGLIDAI ASTAITISN  F +HNDV+L GA+D  ++D IMQ+T+AFN FGK L+QR
Sbjct  263   KCSDGLIDAIMASTAITISNCKFNNHNDVILLGASDEHSEDAIMQVTVAFNRFGKGLVQR  322

Query  681   MPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEE  502
             MPRCR+G+ H+VNNDY+ W MYAIGGS+HPTII QGNRF A  +   KE+TKR      +
Sbjct  323   MPRCRWGFFHIVNNDYSQWQMYAIGGSAHPTIISQGNRFKASKNQFTKEVTKRDYAEKSQ  382

Query  501   WKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTW-LTRFAGALNCR  325
             W  W WRS+GD ++ GAFFV+SG P  + K        + FK       LTR+AGAL CR
Sbjct  383   WMGWQWRSEGDKFLNGAFFVESGPP--LKKSPFTGKNKLQFKPGSYAGRLTRYAGALKCR  440

Query  324   VGSPC  310
              G PC
Sbjct  441   EGKPC  445



>ref|XP_009114192.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=459

 Score =   447 bits (1149),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 243/450 (54%), Positives = 303/450 (67%), Gaps = 7/450 (2%)
 Frame = -3

Query  1638  NNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVR  1459
             ++ F    + +A + P+   H+A +DE W +R A A +   ++Y+PNP N++  L +   
Sbjct  10    SHVFAFLSLCLAVVAPSIQAHVAVFDEYWTQRQAAALRQTIESYDPNPFNVTDHLNYHAA  69

Query  1458  RTLSEAVAEDLTTNTTGRHLLGSKKYR--GPCNATNPIDRCWRCHADWASNRKRLADCAM  1285
               +    A++ T    G+   G K  R  G  ++ N ID+CWR H +W  NRK+LADC +
Sbjct  70    LAMETTGADNGTRRELGQVGGGRKTKRRGGRYHSLNAIDKCWRGHRNWHKNRKKLADCVL  129

Query  1284  GFGYKTKGGKSGKFYTVTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELI  1108
             GFG KT GGK G  Y VTD SDD   NPKPGTLR+AV + +PLWIIF   M IKL QELI
Sbjct  130   GFGRKTTGGKKGPMYVVTDASDDDLMNPKPGTLRYAVTRDRPLWIIFGRSMIIKLQQELI  189

Query  1107  MQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTK  928
             +  DKTIDGRGA +HI+ GAG+T+QFVKNVIIH IHI  I  GNGG+IRD   HFG RT 
Sbjct  190   INSDKTIDGRGANIHITGGAGLTLQFVKNVIIHNIHIKTIVPGNGGMIRDSEHHFGHRTT  249

Query  927   sdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLS  748
             SDGDGI+IFGS+NVWIDHVSM NC DG+ID I  STAITISN H TDHN+VMLFGA +  
Sbjct  250   SDGDGINIFGSTNVWIDHVSMTNCTDGMIDVIMGSTAITISNCHLTDHNEVMLFGAREED  309

Query  747   TKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNR  568
               DK MQIT+AFNHFGKRL+QRMPR R+G +HVVNNDYTHW MYAIGG+ +PTII QGNR
Sbjct  310   VVDKKMQITVAFNHFGKRLVQRMPRARFGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNR  369

Query  567   FIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK----L  400
             FIAPP  + K++TKR      EWK+W W+S+ D ++ GA+FV+SG  N      +     
Sbjct  370   FIAPPKENSKQVTKREYAKYSEWKSWNWQSERDYFLNGAYFVKSGRANAWSPAPENPIPR  429

Query  399   YDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             +  +       V  LT+ AG L CR G  C
Sbjct  430   HFAIQPQPGTGVRRLTKDAGTLGCRPGKSC  459



>ref|XP_009126031.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
Length=481

 Score =   447 bits (1151),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 251/474 (53%), Positives = 315/474 (66%), Gaps = 36/474 (8%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQ------  1465
              +F   +A +IP    +++E DE W +RA EA +   QAY  NP+ +      +      
Sbjct  9     LMFTFYIAGLIPTIRANLSELDEYWSKRAGEAREFTLQAYHSNPYEVVDHFHERHYDNST  68

Query  1464  -VRRTLS-------EAVAEDLT------TNTTGRHLLGS-------------KKYRGPCN  1366
              V+ T         E V +D+        N+T R L G               K +GPC 
Sbjct  69    DVKETEEDSDDEKPEEVEDDVIEMVGNEMNSTRRILRGKPKGKGKGKRKGKWSKLKGPCT  128

Query  1365  ATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTL  1189
             A+NPID+CWRC ++WA  RK L  C  GFG+ T GGK G+ Y VT   D D  NPKPGTL
Sbjct  129   ASNPIDKCWRCRSNWAKRRKNLVKCVRGFGHSTIGGKRGRIYVVTSNLDEDMVNPKPGTL  188

Query  1188  RHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViih  1009
             RHAVIQK+PLWIIF +DM+I+L QEL++   KTID RGA VHI+ GAGITIQFV++VIIH
Sbjct  189   RHAVIQKEPLWIIFKNDMHIRLSQELMICSFKTIDARGADVHIAHGAGITIQFVRHVIIH  248

Query  1008  gihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIE  829
             G+ IHHI + NGG+IRD  DHFG+RTK+DGDGISI+GSS +W+DH+SM  C DGLIDAI 
Sbjct  249   GLRIHHICQSNGGMIRDSTDHFGMRTKADGDGISIYGSSMIWLDHISMSKCQDGLIDAIV  308

Query  828   ASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHV  649
              STAITISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK L+QRMPR R+G++HV
Sbjct  309   GSTAITISNSHFTHHNDVMLLGAQNDNQGDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHV  368

Query  648   VNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQG  472
             VNNDYTHW +YAIGGS  PTI+  GNRFIAPP   H +E+TKR   +  EWK W WRS  
Sbjct  369   VNNDYTHWELYAIGGSQAPTILSHGNRFIAPPHKPHYREVTKRDYASEHEWKHWNWRSDK  428

Query  471   DIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             D++M GA+F QSG+P+F   HH     +       V+ LT++AGAL+CRVG  C
Sbjct  429   DMFMNGAYFRQSGNPHF-KCHHTRKQMIKPKHGIAVSMLTKYAGALDCRVGKRC  481



>emb|CDY45254.1| BnaA06g09240D [Brassica napus]
Length=458

 Score =   446 bits (1148),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 246/452 (54%), Positives = 305/452 (67%), Gaps = 18/452 (4%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTL  1450
             F   + S A + P    +IA +D+ W +R  +A K    +++P P N++  L + V    
Sbjct  13    FVFLLSSFATLAPQVQANIAVFDDYWTQRQGDALKQTLASFDPYPLNVTNHLNYHV----  68

Query  1449  SEAVAEDLT--TNTTGRHLLGSKK-----YRGPCNATNPIDRCWRCHADWASNRKRLADC  1291
               A+A D T   N+T R L  +++      RG C A NPID+CWRC  DW  NRK+LA C
Sbjct  69    --ALALDTTESINSTRRELSQARRGRKMQNRGKCVAHNPIDKCWRCDRDWEKNRKKLAVC  126

Query  1290  AMGFGYKTKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQE  1114
             A+GFG +T GGK G  Y VTD SDD+  +P+PGTLRHAV +  PLWIIFA  M IKL QE
Sbjct  127   ALGFGRRTTGGKDGPIYVVTDASDDELISPRPGTLRHAVTRDGPLWIIFARSMVIKLQQE  186

Query  1113  LIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLR  934
             L+M  DKTIDGRGA+V+I  G+G+T+QFV NVIIH I+I  I   NGGLIRD   H GLR
Sbjct  187   LMMTSDKTIDGRGARVYIMGGSGLTLQFVNNVIIHNIYIKQIVPANGGLIRDSEQHIGLR  246

Query  933   TKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGAND  754
             T+SDGDGI++FG++NVWIDHVSM  C DG+IDAI  STA+T+SN HFTDH +VMLFGAND
Sbjct  247   TRSDGDGINLFGATNVWIDHVSMTRCSDGMIDAILGSTAVTVSNSHFTDHQEVMLFGAND  306

Query  753   LSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQG  574
                 DK MQIT+AFNHFGKRL QRMPR R+G IHVVNNDYTHW MYAIGG+ +PTII  G
Sbjct  307   KHEIDKKMQITVAFNHFGKRLEQRMPRVRFGTIHVVNNDYTHWEMYAIGGNMNPTIISHG  366

Query  573   NRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN-FMDKHHKLY  397
             NRFIAPP+   K+ITKR   +  +WK W W+S+GD ++ GA+FVQSG PN +  K     
Sbjct  367   NRFIAPPNEQAKQITKREYTSYVDWKLWNWQSEGDYFLNGAYFVQSGKPNAWSPKPKNPI  426

Query  396   DGVMTFKAEDVTW---LTRFAGALNCRVGSPC  310
                   + +  T    LT  AG L C+ G  C
Sbjct  427   PNKFAIRPKPGTMVRKLTMDAGVLGCKQGQAC  458



>emb|CDY04133.1| BnaA09g19110D [Brassica napus]
 gb|AIS67292.1| pectate lyase-like protein 9 [Brassica rapa subsp. chinensis]
Length=459

 Score =   447 bits (1149),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 243/450 (54%), Positives = 303/450 (67%), Gaps = 7/450 (2%)
 Frame = -3

Query  1638  NNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVR  1459
             ++ F    + +A + P+   H+A +DE W +R A A +   ++Y+PNP N++  L +   
Sbjct  10    SHVFAFLSLCLAVVAPSIQAHVAVFDEYWTQRQAAALRQTIESYDPNPFNVTDHLNYHAA  69

Query  1458  RTLSEAVAEDLTTNTTGRHLLGSKKYR--GPCNATNPIDRCWRCHADWASNRKRLADCAM  1285
               +    A++ T    G+   G K  R  G  ++ N ID+CWR H +W  NRK+LADC +
Sbjct  70    LAMETTGADNGTRRELGQVGGGRKTKRRGGRYHSLNAIDKCWRGHRNWHKNRKKLADCVL  129

Query  1284  GFGYKTKGGKSGKFYTVTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELI  1108
             GFG KT GGK G  Y VTD SDD   NPKPGTLR+AV + +PLWIIF   M IKL QELI
Sbjct  130   GFGRKTTGGKKGPMYVVTDASDDDLMNPKPGTLRYAVTRDRPLWIIFGRSMIIKLQQELI  189

Query  1107  MQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTK  928
             +  DKTIDGRGA +HI+ GAG+T+QFVKNVIIH IHI  I  GNGG+IRD   HFG RT 
Sbjct  190   INSDKTIDGRGANIHITGGAGLTLQFVKNVIIHNIHIKTIVPGNGGMIRDSEHHFGHRTT  249

Query  927   sdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLS  748
             SDGDGI+IFGS+NVWIDHVSM NC DG+ID I  STAITISN H TDHN+VMLFGA +  
Sbjct  250   SDGDGINIFGSTNVWIDHVSMTNCTDGMIDVIMGSTAITISNCHLTDHNEVMLFGAREED  309

Query  747   TKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNR  568
               DK MQIT+AFNHFGKRL+QRMPR R+G +HVVNNDYTHW MYAIGG+ +PTII QGNR
Sbjct  310   VIDKKMQITVAFNHFGKRLVQRMPRARFGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNR  369

Query  567   FIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK----L  400
             FIAPP  + K++TKR      EWK+W W+S+ D ++ GA+FV+SG  N      +     
Sbjct  370   FIAPPKENSKQVTKREYAKYSEWKSWNWQSERDYFLNGAYFVKSGRANAWSPAPENPIPR  429

Query  399   YDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             +  +       V  LT+ AG L CR G  C
Sbjct  430   HFAIQPQPGTGVRRLTKDAGTLGCRPGKSC  459



>gb|KHN13490.1| Putative pectate lyase 3, partial [Glycine soja]
Length=364

 Score =   442 bits (1138),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 240/363 (66%), Positives = 269/363 (74%), Gaps = 5/363 (1%)
 Frame = -3

Query  1386  KYRG--PCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSDD-  1216
             KYRG  PC ATNPIDRCWRC  +WA+NR++LADC  GFG  T GGK G FY VTD SDD 
Sbjct  3     KYRGDGPCIATNPIDRCWRCDPNWANNRQKLADCVQGFGRNTVGGKGGPFYVVTDPSDDD  62

Query  1215  QSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITI  1036
               NPKPGTLRHAV +  PLWIIFA  M I L QELIM  +KTIDGRG  V+I+ GAGIT+
Sbjct  63    MVNPKPGTLRHAVTRDGPLWIIFARSMFITLQQELIMNSNKTIDGRGVDVYIAKGAGITV  122

Query  1035  QFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNC  856
             QFVKN+IIHGI +  I    GG+IRD   H+G RTKSDGDGISIFGSSN+WIDHVSMRNC
Sbjct  123   QFVKNIIIHGIKVFDIVIREGGMIRDSETHYGFRTKSDGDGISIFGSSNIWIDHVSMRNC  182

Query  855   YDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMP  676
              DGLIDAI  STAITISN HFTDHN+VMLFGA+D  + DKIMQITLAFNHFGKRL+QRMP
Sbjct  183   SDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDSYSDDKIMQITLAFNHFGKRLVQRMP  242

Query  675   RCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEEWK  496
             R RYG++H VNNDYTHW MYAIGGS +PTII +GNRFIAP +   K+ITKR       W 
Sbjct  243   RVRYGFVHSVNNDYTHWEMYAIGGSKNPTIISEGNRFIAPDNQFAKQITKREYAPENVWA  302

Query  495   TWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAG-ALNCRVG  319
              W WRS  D+YM GAFFVQSG P    +     D +       V  LTR++G  L CRVG
Sbjct  303   NWQWRSINDVYMNGAFFVQSG-PELASRPFSREDMITAKVGNYVGRLTRYSGNLLKCRVG  361

Query  318   SPC  310
              PC
Sbjct  362   RPC  364



>ref|XP_004489168.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=444

 Score =   445 bits (1144),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 247/442 (56%), Positives = 307/442 (69%), Gaps = 12/442 (3%)
 Frame = -3

Query  1620  FVVSVAAI-IPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSE  1444
             F+V + AI IP     IAE+D+  + +A  A + A ++Y PNP NI+  L   V   + E
Sbjct  10    FIVLILAITIPCLEAGIAEFDDYLKEQADLARQIALKSYVPNPENITTELNLHVNMAMEE  69

Query  1443  AVAEDLTTNTTGRHLLGSKKYRGP--CNATNPIDRCWRCHADWASNRKRLADCAMGFGYK  1270
             A      +N+T R L   +K+ G   C ++NPID CWRC  DWA NR++LA C  GFG K
Sbjct  70    AY-----SNSTRRELRQRQKHGGSSACMSSNPIDNCWRCKKDWAQNRQQLAQCGKGFGRK  124

Query  1269  TKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDK  1093
               GG  GKFY VTD+SD D   PK GTLR+  +QK PLWIIFA  M I+L+QEL++  DK
Sbjct  125   AVGGLGGKFYVVTDESDNDLVTPKFGTLRYGAVQKGPLWIIFARSMIIRLNQELLVSSDK  184

Query  1092  TIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdg  913
             TIDGRGA VHI DGAGIT+QFV NVIIHG+HI +I   +GG+IRD  +H GLRT+SDGD 
Sbjct  185   TIDGRGANVHIRDGAGITMQFVNNVIIHGLHIRNIKARSGGMIRDSYNHVGLRTRSDGDA  244

Query  912   isifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKI  733
             +S+FGSSN+WIDH+S+    DGLID I+ STAITISN H T HNDVMLFGA+D  + DKI
Sbjct  245   LSVFGSSNIWIDHISLSESEDGLIDVIQGSTAITISNCHMTKHNDVMLFGASDSYSDDKI  304

Query  732   MQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP  553
             MQIT+AFNHFG+ LIQRMPRCR+G+ HV+NNDYTHW MYAIGGSS PTI+ QGNRFIAP 
Sbjct  305   MQITVAFNHFGQGLIQRMPRCRWGFFHVLNNDYTHWLMYAIGGSSGPTILSQGNRFIAPN  364

Query  552   DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFK-  376
             +   K IT R   + + W  W WRS+ D++M GA F++SG P       K Y  +M  + 
Sbjct  365   NNAAKTITHRDYASQDVWSKWQWRSENDLFMNGATFIESGAPIKNLPFKKGY--LMKPRP  422

Query  375   AEDVTWLTRFAGALNCRVGSPC  310
                   LTR+AGALNC++G PC
Sbjct  423   GTQANRLTRYAGALNCQIGRPC  444



>ref|XP_010514040.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   444 bits (1143),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 243/451 (54%), Positives = 301/451 (67%), Gaps = 6/451 (1%)
 Frame = -3

Query  1644  NKNNCFFLFV-VSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIH  1468
             N  +   +FV +S+A ++P    H+AEYDE W +R  EA     ++Y+P P N++    +
Sbjct  3     NLGSYVIVFVSLSLAVVVPTVHAHVAEYDEYWTQRQTEALHQTLESYDPEPLNVTDHFNY  62

Query  1467  QVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCA  1288
                  +      + T     +   G K+  G   + N ID+CWR   +W  NRK+LADC 
Sbjct  63    HAALAMETTGIANETRRDLRQVKSGKKRRGGRYESLNAIDKCWRGDKNWDKNRKKLADCV  122

Query  1287  MGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQEL  1111
             +GFG KT GGK+G  Y VTD SD D  NPKPGTLRHAV + +PLWIIFA  M IKL QEL
Sbjct  123   LGFGRKTTGGKNGPIYVVTDPSDNDLLNPKPGTLRHAVTRDRPLWIIFARHMIIKLQQEL  182

Query  1110  IMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRT  931
             I+  DKTIDGRG  V+I+ GAG+T+Q+V+NVIIH I+I  I +G GGLIRD   HFGLRT
Sbjct  183   IITNDKTIDGRGVSVYITGGAGLTLQYVRNVIIHNIYIKQIKKGPGGLIRDSEHHFGLRT  242

Query  930   KsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDL  751
              SDGDGISIFG++N+WIDHVSM +C DG+IDAI  STAITISN HFTDH++VMLFG  + 
Sbjct  243   MSDGDGISIFGATNIWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGKNT  302

Query  750   STKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGN  571
                DK MQIT+AFNHFGKRL QRMPR RYG +HVVNNDYTHW MYAIGG+ +PTII QGN
Sbjct  303   DVIDKKMQITVAFNHFGKRLKQRMPRARYGLVHVVNNDYTHWEMYAIGGNMNPTIISQGN  362

Query  570   RFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK----  403
             RFIAPP+   K++TKR      EWKTW W+S+ D ++ GA+FVQSG  N      K    
Sbjct  363   RFIAPPNEDSKQVTKREYTPYPEWKTWNWQSEKDYFLNGAYFVQSGKANAWSTAPKNPIP  422

Query  402   LYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
                 +       V  LT+ AGAL C+ G  C
Sbjct  423   RKFAIRPQPGTKVRRLTKDAGALGCKAGKSC  453



>sp|P40973.1|PLY_LILLO RecName: Full=Pectate lyase; Flags: Precursor [Lilium longiflorum]
 emb|CAA78976.1| pectate lyase [Lilium longiflorum]
 gb|AAA33398.1| pectate lyase [Lilium longiflorum]
Length=434

 Score =   443 bits (1140),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 250/441 (57%), Positives = 309/441 (70%), Gaps = 13/441 (3%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTL  1450
             FFL+ +   A    +  +IAE+DE W++++  A   A++AY P+P         +V    
Sbjct  6     FFLYSLLFFASAALSSANIAEFDEYWQKKSKVAQAKAKKAYTPHPE--------EVTNHF  57

Query  1449  SEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYK  1270
             ++AV      N+T R+L  +K   G C ATNPIDRCWRC  +W++NRK L  C  GFG K
Sbjct  58    NKAVHSSFEGNSTRRNLRTNK--LGQCLATNPIDRCWRCKKNWSANRKDLVKCVKGFGRK  115

Query  1269  TKGGKSGKFYTVTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDK  1093
             T GG +G+ Y VTD SDD  ++PK GTLR  VIQ +PLWIIF   M I+L QELI+  DK
Sbjct  116   TTGGAAGEIYVVTDPSDDSLTDPKFGTLRWGVIQDRPLWIIFGKSMVIRLKQELIINNDK  175

Query  1092  TIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdg  913
             TIDGRGA V I+ GA +T+QFV NVIIHGIHIH I  G GGLIRD   H G+RT+SDGDG
Sbjct  176   TIDGRGANVQIAGGAQLTVQFVHNVIIHGIHIHDIKPGEGGLIRDSEKHSGIRTRSDGDG  235

Query  912   isifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKI  733
             ISI GSSN+WIDHVS+  C DGLID I  STAITISN H T+H+DVML GA+D  T+D+I
Sbjct  236   ISIIGSSNIWIDHVSLARCSDGLIDVILGSTAITISNCHLTEHDDVMLLGASDTYTQDEI  295

Query  732   MQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP  553
             MQ+T+AFNHFG+ L+QRMPRCRYG++HVVNNDYTHW MYA+GGS HPTII QGNR+IAP 
Sbjct  296   MQVTVAFNHFGRGLVQRMPRCRYGFVHVVNNDYTHWIMYAVGGSQHPTIISQGNRYIAPH  355

Query  552   DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKA  373
                 KE+TKR    P EW  WTW+SQGD+++ GAFFV+SG P F +K+ K  D +     
Sbjct  356   IEAAKEVTKRDYAEPAEWSKWTWKSQGDLFVSGAFFVESGGP-FENKYSK-KDLIKAKPG  413

Query  372   EDVTWLTRFAGALNCRVGSPC  310
               V  LTRF+GALNC+    C
Sbjct  414   TFVQRLTRFSGALNCKENMEC  434



>ref|XP_002882189.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58448.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=475

 Score =   444 bits (1143),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 253/468 (54%), Positives = 321/468 (69%), Gaps = 30/468 (6%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIA-EYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQ-----  1465
              + V  +A++IP    ++A E D+ W  +A EA KH   AY P+P+ I      +     
Sbjct  9     LVCVFCIASLIPTIRANVADETDDYWVNKANEARKHTLMAYHPDPYEIVDHFHERHYDNS  68

Query  1464  --VRRTLSE-AVA---EDLT------TNTTGRHLLGSKKYRG---------PCNATNPID  1348
               V  T  E AVA   ED+       TN+T R L G  K +G         PC A+NPID
Sbjct  69    TDVEGTEEEKAVASEEEDVIEMISSPTNSTRRSLTGRGKGKGKGKWSKLKGPCTASNPID  128

Query  1347  RCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTD-KSDDQSNPKPGTLRHAVIQ  1171
             +CWRC  DWA  RK+L  C  GFGY+T GGK G+ Y VT  + DD  NP+PGTLRHAVIQ
Sbjct  129   KCWRCQPDWARRRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDMVNPRPGTLRHAVIQ  188

Query  1170  KKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihh  991
             K+PLWIIF HDM+I+L+QEL++   KTID RGA VHI+ GAGIT+Q+V N+IIHG+HIHH
Sbjct  189   KEPLWIIFKHDMSIRLNQELMIASHKTIDARGANVHIAYGAGITMQYVHNIIIHGLHIHH  248

Query  990   IFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAIT  811
             I + +GG+IRD +DHFG R ++DGDGISIFG++N+W+DH+SM  C DGLIDAI  STAIT
Sbjct  249   IVQSSGGMIRDSIDHFGQRGRADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTAIT  308

Query  810   ISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYT  631
             ISN HFT HNDVML GA D +  DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYT
Sbjct  309   ISNSHFTHHNDVMLLGAQDNNMDDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYT  368

Query  630   HWNMYAIGGSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEG  454
             HW +YAIGGS  PTI+  GNRFIAPP   H +E+TKR   +  EWK W WRS+ D++M  
Sbjct  369   HWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYASESEWKNWNWRSEKDVFMNN  428

Query  453   AFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             A+F QSG+P+F   H +    +       V+ LT++AGAL+CRVG  C
Sbjct  429   AYFRQSGNPHFKCSHSR-QQMIKPKHGVAVSKLTKYAGALDCRVGKAC  475



>ref|XP_003554335.1| PREDICTED: pectate lyase-like [Glycine max]
Length=443

 Score =   443 bits (1139),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 248/444 (56%), Positives = 300/444 (68%), Gaps = 19/444 (4%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
             F  +V+ A +IP     IAE+D+  + +A EA K A +AY P P +++  L   V  +L 
Sbjct  14    FNLLVTFAIVIPCLEAGIAEFDDFLKAQADEAQKIALEAYVPVPEDVTDELNFHVHLSLE  73

Query  1446  EAVAEDLTTNTTGRHLLGSKKYRGP-CNATNPIDRCWRCHADWASNRKRLADCAMGFGYK  1270
                      N+T R L   K   G  C A+NPID CWRC+ +WA++R RLA C  GFG +
Sbjct  74    ---------NSTRRELRQRKGRSGKKCVASNPIDTCWRCNKNWANDRYRLAKCGKGFGRR  124

Query  1269  TKGGKSGKFYTVTDKSDD-QSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDK  1093
               GG  G  Y VTD SDD   NPKPGT+RHAV Q+ PLWIIF   M IKL+QEL++  DK
Sbjct  125   ATGGLGGPIYVVTDNSDDDMVNPKPGTIRHAVTQRGPLWIIFQRSMMIKLNQELMISSDK  184

Query  1092  TIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdg  913
             TIDGRGA V   DGAG+TIQFV NVIIHG+ I +I    GG+IRD  +H GLRTKSDGD 
Sbjct  185   TIDGRGANVVFRDGAGLTIQFVNNVIIHGVRIKNIVPKEGGMIRDSYNHVGLRTKSDGDA  244

Query  912   isifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKI  733
             ISIFG+SNVWIDHVS+ NC DGLID I+ STAITISN H T HNDVMLFGA+D  + DKI
Sbjct  245   ISIFGASNVWIDHVSLSNCADGLIDVIQGSTAITISNCHMTKHNDVMLFGASDSYSGDKI  304

Query  732   MQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP  553
             MQIT+AFNHFG+ L+QRMPRCR+G++HV+NNDYTHW MYAIGGSS PTI+ QGNRFIAP 
Sbjct  305   MQITVAFNHFGQGLVQRMPRCRWGFVHVLNNDYTHWMMYAIGGSSGPTILSQGNRFIAPN  364

Query  552   DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKA  373
             +   K IT R    P+ WK W W+S+ D+++ GA F+ SG P         Y   +  K 
Sbjct  365   NNAAKLITHRDYAEPQVWKNWQWQSEMDLFINGAQFIPSGSP-----IKTTYKKGLLMKP  419

Query  372   EDVT---WLTRFAGALNCRVGSPC  310
              D T    LTR +GALNC VG PC
Sbjct  420   RDGTHASRLTRNSGALNCIVGRPC  443



>ref|XP_004228388.1| PREDICTED: pectate lyase [Solanum lycopersicum]
Length=439

 Score =   442 bits (1138),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 246/455 (54%), Positives = 306/455 (67%), Gaps = 22/455 (5%)
 Frame = -3

Query  1656  MERFNKNNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISAS  1477
             M   + N+   +  + +A+++P     IAE+D    ++A EA   + +AY  NP  I+ +
Sbjct  1     MAFISGNSILLVLFIWLASLVPHLHARIAEFDPYLEKQALEALNSSLEAYTNNPEEITNA  60

Query  1476  LIHQVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLA  1297
                +V   L       L   +  RHL    K +  C ATNPIDRCWRC  +WA NR  L 
Sbjct  61    FNKEVGNAL-------LKYKSLRRHL----KEKDKCMATNPIDRCWRCDKNWAENRMDLE  109

Query  1296  DCAMGFGYKTKGGKSGKFYTVTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLH  1120
             +CA GFG+KT GGK+GK+Y VTD+SDD    PKPGTLRHAVIQ++PLWIIF   M IKL 
Sbjct  110   ECARGFGHKTTGGKNGKYYVVTDESDDNVQEPKPGTLRHAVIQEEPLWIIFEKSMVIKLR  169

Query  1119  QELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFG  940
             QEL++  DKTIDGRG  VHI+ GAG+ IQFV NVIIH I I +I   NGG+IRD ++H G
Sbjct  170   QELMITSDKTIDGRGVAVHIAYGAGLMIQFVHNVIIHNIRIQNIISTNGGMIRDSINHIG  229

Query  939   LRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGA  760
             LRT SDGDGISIFGS+++WIDH ++  C DGLIDAI ASTAITISN  F  HNDVML GA
Sbjct  230   LRTVSDGDGISIFGSNHIWIDHCTLSECTDGLIDAIMASTAITISNCKFNYHNDVMLLGA  289

Query  759   NDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIIC  580
              D   +D IMQ+T+AFN FG+ LIQRMPRCR+G+ HVVNNDYTHW MYAIGGS+HPTII 
Sbjct  290   TDAFPQDAIMQVTVAFNRFGEGLIQRMPRCRWGFFHVVNNDYTHWQMYAIGGSAHPTIIS  349

Query  579   QGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN----FMDK  412
             QGNRF A  + + K++TKR   T  EWK W W S+GD ++ GA+FV+SG  +     + K
Sbjct  350   QGNRFKASDNPNTKQVTKRDYATESEWKKWQWVSEGDSFLNGAYFVESGPQDKKKTALTK  409

Query  411   HHKLYDGVMTFK-AEDVTWLTRFAGALNCRVGSPC  310
             +HK+      FK       LTRFAG L C+ G PC
Sbjct  410   NHKI-----KFKPGSHAGRLTRFAGVLKCKPGIPC  439



>ref|XP_010425041.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   442 bits (1138),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 242/451 (54%), Positives = 303/451 (67%), Gaps = 6/451 (1%)
 Frame = -3

Query  1644  NKNNCFFLFV-VSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIH  1468
             N  +   +FV +S+A ++P+   H+AEYDE W +R  EA     ++Y+P P N++    +
Sbjct  3     NLGSYVIVFVSLSLAVVVPSVHAHVAEYDEYWTQRQTEALHQTLESYDPEPLNVTDHFNY  62

Query  1467  QVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCA  1288
                  +      + T     +   G K+  G   + N ID+CWR + +W  NRK+LADC 
Sbjct  63    HAALAMETTGISNETRRDLRQVKSGKKRRGGRYESLNAIDKCWRGNKNWDKNRKKLADCV  122

Query  1287  MGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQEL  1111
             +GFG KT GGK+G  Y VTD SD D  NPKPGTLR+AV + +PLWIIFA  M IKL QEL
Sbjct  123   LGFGRKTTGGKNGPIYVVTDPSDNDLLNPKPGTLRYAVTRDRPLWIIFARHMIIKLQQEL  182

Query  1110  IMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRT  931
             I+  DKTIDGRG  V+I+ GAG+T+Q+V+NVIIH I+I  I +G GGLIRD   HFGLRT
Sbjct  183   IITNDKTIDGRGVSVYITGGAGLTLQYVRNVIIHNIYIKQIKKGPGGLIRDSEHHFGLRT  242

Query  930   KsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDL  751
              SDGDGISIFG++NVWIDHVSM +C DG+IDAI  STAITISN HFTDH++VMLFG  + 
Sbjct  243   MSDGDGISIFGATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGKNT  302

Query  750   STKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGN  571
                DK MQIT+AFNHFGKRL QRMPR RYG +HVVNNDYTHW MYAIGG+ +PTII QGN
Sbjct  303   DVIDKKMQITVAFNHFGKRLKQRMPRARYGLVHVVNNDYTHWEMYAIGGNMNPTIISQGN  362

Query  570   RFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK----  403
             RFIAPP+   K++TKR      EWK+W W+S+ D ++ GA+FVQSG  N      K    
Sbjct  363   RFIAPPNEDSKQVTKREYTPYPEWKSWNWQSEKDYFLNGAYFVQSGKANAWSTAPKNPIP  422

Query  402   LYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
                 +       V  LT+ AGAL C+ G  C
Sbjct  423   RKFAIRPQPGTKVRRLTKDAGALGCKPGKSC  453



>emb|CDY17432.1| BnaC09g21050D [Brassica napus]
Length=459

 Score =   442 bits (1137),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 241/450 (54%), Positives = 303/450 (67%), Gaps = 7/450 (2%)
 Frame = -3

Query  1638  NNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVR  1459
             ++ F    + +A + P+   H+A +DE W +R ++A +   ++Y+PNP N++  L +   
Sbjct  10    SHVFAFLSLCLAVVAPSVQAHVAVFDEYWTQRQSDALRQTIESYDPNPFNVTDHLNYHAA  69

Query  1458  RTLSEAVAEDLTTNTTGRHLLGSKKYR--GPCNATNPIDRCWRCHADWASNRKRLADCAM  1285
               +    A++ T    G+   G K  R  G  ++ N ID+CWR H +W  NRK+LADC +
Sbjct  70    LAMETTGADNGTRRKLGQVGDGRKTKRRGGRYHSLNAIDKCWRGHRNWHKNRKKLADCVL  129

Query  1284  GFGYKTKGGKSGKFYTVTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELI  1108
             GFG KT GGK G  Y VTD +DD   NPKPGTLR+AV + +PLWIIF   M IKL QELI
Sbjct  130   GFGRKTTGGKKGPIYVVTDAADDDLMNPKPGTLRYAVTRDRPLWIIFGRSMIIKLQQELI  189

Query  1107  MQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTK  928
             +  DKTIDGRGA VHI+ GAG+T+QFVKNVIIH IHI  I  GNGG+IRD   HFG RT 
Sbjct  190   INSDKTIDGRGANVHITGGAGLTLQFVKNVIIHNIHIKTIIPGNGGMIRDSEHHFGHRTT  249

Query  927   sdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLS  748
             SDGDGI+IFGS+NVWIDHVSM NC DG+ID I  STAITISN H TDHN+VMLFGA +  
Sbjct  250   SDGDGINIFGSTNVWIDHVSMTNCTDGMIDVIMGSTAITISNCHLTDHNEVMLFGAREED  309

Query  747   TKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNR  568
               DK MQIT+AFNHFGKRL+QRMPR R+G +HVVNNDYTHW MYAIGG+ +PTII QGNR
Sbjct  310   VIDKKMQITVAFNHFGKRLVQRMPRARFGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNR  369

Query  567   FIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK----L  400
             F APP  + K++TKR      EWK+W W+S+ D ++ GA+FV+SG  N      +     
Sbjct  370   FTAPPKENCKQVTKREYAKYSEWKSWNWQSERDYFLNGAYFVKSGRANAWSPAPENPIPR  429

Query  399   YDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             +  +       V  LT+ AG L CR G  C
Sbjct  430   HFAIQPQPGTGVRRLTKDAGTLGCRPGKSC  459



>ref|XP_010502279.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   442 bits (1136),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 247/455 (54%), Positives = 304/455 (67%), Gaps = 14/455 (3%)
 Frame = -3

Query  1644  NKNNCFFLFV-VSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIH  1468
             N  +   +FV +S+A  +P+   H+AEYDE W +R  EA     ++Y+P P N++    +
Sbjct  3     NLGSYVIVFVSLSLAVAVPSVHAHVAEYDEYWTQRQTEALHQTLESYDPEPLNVTDHFNY  62

Query  1467  QVRRTLSEAVAEDLTTNTTGRHLL----GSKKYRGPCNATNPIDRCWRCHADWASNRKRL  1300
                   + A+    T N T R L     G K+  G   + N ID+CWR   +W  NRK+L
Sbjct  63    HA----ALAMETTGTANETRRDLRQVKSGKKRRGGRYESLNAIDKCWRGDKNWDKNRKKL  118

Query  1299  ADCAMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKL  1123
             ADC +GFG KT GGK+G  Y VTD SD D  +PKPGTLRHAV + +PLWIIFA  M IKL
Sbjct  119   ADCVLGFGRKTTGGKNGPIYVVTDPSDNDLLDPKPGTLRHAVTRDRPLWIIFARHMIIKL  178

Query  1122  HQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHF  943
              QELI+  DKTIDGRG  V+I+ GAG+T+Q+V+NVIIH I+I  I  G GGLIRD   HF
Sbjct  179   QQELIITNDKTIDGRGVSVYITGGAGLTLQYVRNVIIHNIYIKQIKRGPGGLIRDSEHHF  238

Query  942   GLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFG  763
             GLRT SDGDGI+IFG++NVWIDHVSM +C DG+IDAI  STAITISN HFTDH++VMLFG
Sbjct  239   GLRTMSDGDGINIFGATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFG  298

Query  762   ANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTII  583
               +    DK MQIT+AFNHFGKRL QRMPR RYG +HVVNNDYTHW MYAIGG+ +PTII
Sbjct  299   GKNTDVIDKKMQITVAFNHFGKRLKQRMPRARYGLVHVVNNDYTHWEMYAIGGNMNPTII  358

Query  582   CQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK  403
              QGNRFIAPP+   K++TKR      EWKTW W+S+ D ++ GA+FVQSG  N      K
Sbjct  359   SQGNRFIAPPNEDSKQVTKREYTPYPEWKTWNWQSEKDYFLNGAYFVQSGKANAWSTAPK  418

Query  402   ----LYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
                     +       V  LT+ AGAL C+ G  C
Sbjct  419   NPIPRKFAIRPQPGTKVRRLTKDAGALGCKPGKSC  453



>gb|EYU28712.1| hypothetical protein MIMGU_mgv1a006498mg [Erythranthe guttata]
Length=442

 Score =   441 bits (1134),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 243/443 (55%), Positives = 307/443 (69%), Gaps = 16/443 (4%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTL  1450
               L ++    +IP +   IA+YD+  R++A E++  + +A++PNP  ++  L  QV  TL
Sbjct  13    LLLSMIYFVTLIPKSHAAIAKYDDYLRKKANESFAESLKAFDPNPEKVADELNEQVGETL  72

Query  1449  SEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYK  1270
                V E+L+     RHL    K    C ATNPIDRCWRC  DW+ NRK+LA+C  GFG++
Sbjct  73    ---VHENLSR----RHL----KEENDCKATNPIDRCWRCDGDWSKNRKKLAECVRGFGHR  121

Query  1269  TKGGKSGKFYTVTDKSDDQSN-PKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDK  1093
             T GGK G++Y VTD SDD  + PK GTLRHAVIQ +PLWIIFA  M I+L QELI   DK
Sbjct  122   TTGGKDGRYYLVTDPSDDDMDKPKNGTLRHAVIQSEPLWIIFARSMVIRLKQELIFASDK  181

Query  1092  TIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdg  913
             T+DGRG +V I+ GAG+T+QFV NVIIH I IH+I    GG+IRD +DH GLRT SDGDG
Sbjct  182   TVDGRGVRVRIAYGAGLTLQFVHNVIIHNIRIHNIVSTPGGMIRDAVDHIGLRTVSDGDG  241

Query  912   isifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKI  733
             I++F S+N+WIDHVS+    DGLID IE STAITISN  F +HN VML GA+D STKD I
Sbjct  242   INVFSSNNIWIDHVSLSKGTDGLIDVIEGSTAITISNCKFNNHNTVMLLGAHDNSTKDTI  301

Query  732   MQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP  553
             MQ+T+AFN FGK L+QRMPRCR+G+ HV+NNDY+ W MYAIGGSS+PTII QGNRF A  
Sbjct  302   MQVTVAFNRFGKGLVQRMPRCRWGFFHVINNDYSKWLMYAIGGSSNPTIISQGNRFKASD  361

Query  552   DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYD-GVMTFK  376
             +   K++TKR + T  EWK W WRS+GD ++ GA+F +SG P        L +  ++ FK
Sbjct  362   NPFTKQVTKR-ESTESEWKKWQWRSEGDKFVNGAYFRESG-PKVKHTISPLKEKNLIKFK  419

Query  375   AEDVTW-LTRFAGALNCRVGSPC  310
                    LTR+AGALNC  G  C
Sbjct  420   PGSYAGRLTRYAGALNCVAGKSC  442



>ref|XP_006286712.1| hypothetical protein CARUB_v10002862mg [Capsella rubella]
 gb|EOA19610.1| hypothetical protein CARUB_v10002862mg [Capsella rubella]
Length=512

 Score =   444 bits (1141),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 232/379 (61%), Positives = 287/379 (76%), Gaps = 8/379 (2%)
 Frame = -3

Query  1425  TTNTTGRHLLGS-----KKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKG  1261
             +TN+T R L G       K RGPC A+NPID+CWRC +DWA  RK+L  C  GFG++T G
Sbjct  135   STNSTRRSLRGKGKGKWSKLRGPCTASNPIDKCWRCRSDWAKRRKKLTRCVRGFGHRTTG  194

Query  1260  GKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTID  1084
             GK G+ Y VT   D D  NPKPGTLRHAVIQK+PLWIIF +DM+I+L QEL++   KTID
Sbjct  195   GKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEPLWIIFKNDMHIRLSQELLINSHKTID  254

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
              RGA VHI+ GAGIT+QFV+NVIIHG+HIHHIFE +GG+IRD +DHFG+RT++DGDGISI
Sbjct  255   ARGADVHIAHGAGITMQFVRNVIIHGLHIHHIFESSGGMIRDSVDHFGMRTRADGDGISI  314

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             +GSS +W+DH+SM  C DGLIDAI  STAITISN HFT HNDVML GA + +  DK MQ+
Sbjct  315   YGSSKIWLDHISMSKCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNTNEADKHMQV  374

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP-DI  547
             T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+  GNRFIAPP   
Sbjct  375   TVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKP  434

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED  367
             H +E+TKR   + +EWK W WRS+ D++M GA+F QSGDP +   H +    +       
Sbjct  435   HYREVTKRDYASEDEWKHWNWRSEKDVFMNGAYFRQSGDPKYKCAHTR-QQMIKPKHGLA  493

Query  366   VTWLTRFAGALNCRVGSPC  310
             V+ LT++AGAL+CRVG  C
Sbjct  494   VSKLTKYAGALDCRVGKRC  512



>gb|EAY99626.1| hypothetical protein OsI_21605 [Oryza sativa Indica Group]
Length=441

 Score =   440 bits (1132),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 242/419 (58%), Positives = 300/419 (72%), Gaps = 19/419 (5%)
 Frame = -3

Query  1563  DEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTGRHLLGSKK  1384
             +E W +RA EA    + AY  +P             TL+   A D+   TT R L    +
Sbjct  41    EEYWEKRAEEARSFNRAAYVSDP-----------VATLNRFNA-DVLRATTRRSL---AR  85

Query  1383  YRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSDDQSN-  1207
             Y GPC ATNPIDRCWRC  DWA++RKRLA C  GFG++T GG +GK Y VTD SDD+   
Sbjct  86    YTGPCMATNPIDRCWRCRDDWATDRKRLARCVRGFGHRTVGGAAGKIYVVTDASDDEMVI  145

Query  1206  PKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFV  1027
             P+ GTLR+ VIQ +P+WI+FA DM I+L QELI+  +KTIDGRGAQVHI+ GA IT+Q V
Sbjct  146   PRKGTLRYGVIQDRPMWIVFARDMIIQLRQELIVNHNKTIDGRGAQVHIT-GAQITLQGV  204

Query  1026  KNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDG  847
             ++VIIH +HIHH     GG+IRD   H+GLRT+SDGDGISI  SSN+WIDHVSM NC DG
Sbjct  205   QHVIIHNVHIHHSVPHGGGMIRDSKRHYGLRTRSDGDGISIMSSSNIWIDHVSMSNCSDG  264

Query  846   LIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCR  667
             LIDA+  STAITISNGHFT H+ VMLFGA++   +D++MQIT+AFNHFGK L+QR+PRCR
Sbjct  265   LIDAVSGSTAITISNGHFTKHDHVMLFGASNSDAQDEVMQITVAFNHFGKGLVQRLPRCR  324

Query  666   YGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWT  487
             +G+ HVVNNDY HW MYAIGG+ +PTII QGNRFIAP D++ KE+TKR     +E+K W 
Sbjct  325   FGFFHVVNNDYMHWLMYAIGGNMNPTIISQGNRFIAPDDVNAKEVTKREYTPYDEYKEWV  384

Query  486   WRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             W+SQGD+ M GAFF +SG  N  ++ +   D +     + V  LT+FAGALNC VG PC
Sbjct  385   WKSQGDVMMNGAFFNESGGQN--ERSYDQLDFIPAKHGKYVGQLTKFAGALNCHVGMPC  441



>emb|CDY63769.1| BnaCnng42620D [Brassica napus]
Length=479

 Score =   442 bits (1136),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 243/472 (51%), Positives = 314/472 (67%), Gaps = 34/472 (7%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQ------  1465
              +F+  +A +IP    + +E DE W +RA EA +   QAY  NP+ +      +      
Sbjct  9     LMFMFYIAGLIPTIRANFSELDEYWSKRAGEAREFTLQAYHSNPYEVVDHFHERHYDNST  68

Query  1464  -VRRTLSEA------VAEDLTTNTTGRHLLGSKK------------------YRGPCNAT  1360
              V+ T  ++        ED      G  +  +++                   +GPC A+
Sbjct  69    DVKETEEDSDDEKPEEVEDDVIEMVGNEMNSTRRILRGKSKGKGKRKGKWSKLKGPCTAS  128

Query  1359  NPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVT-DKSDDQSNPKPGTLRH  1183
             NPID+CWRC ++WA  RK L  C  GFG+ T GGK G+ Y VT ++ DD  NPKPGTLRH
Sbjct  129   NPIDKCWRCRSNWAKRRKNLVKCVRGFGHSTIGGKRGRIYVVTSNRDDDMVNPKPGTLRH  188

Query  1182  AVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgi  1003
             AVIQK+PLWIIF +DM+I+L QEL++   KTID RGA VHI+ GAGITIQFV++VIIHG+
Sbjct  189   AVIQKEPLWIIFKNDMHIRLSQELMICSFKTIDARGANVHIAHGAGITIQFVRHVIIHGL  248

Query  1002  hihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEAS  823
             HIHHI + NGG+IRD   HFG+RT++DGDGISI+GSS +W+DH+SM  C DGLIDAI  S
Sbjct  249   HIHHICQSNGGMIRDSEGHFGMRTRADGDGISIYGSSMIWLDHISMSKCQDGLIDAIVGS  308

Query  822   TAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVN  643
             TAITISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK L+QRMPR R+G++HVVN
Sbjct  309   TAITISNSHFTHHNDVMLLGAQNDNQGDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVN  368

Query  642   NDYTHWNMYAIGGSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQGDI  466
             NDYTHW +YAIGGS  PTI+  GNRF+APP   H +E+TKR   +  EWK W WRS  D+
Sbjct  369   NDYTHWELYAIGGSQAPTILSHGNRFVAPPHKPHYREVTKRDYASEHEWKHWNWRSDKDM  428

Query  465   YMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             +M GA+F QSG+P+F   HH     +       V+ LT++AGAL+CRVG  C
Sbjct  429   FMNGAYFRQSGNPHF-KCHHTRKQMIKPKHGIAVSMLTKYAGALDCRVGKRC  479



>ref|XP_007151201.1| hypothetical protein PHAVU_004G026400g [Phaseolus vulgaris]
 gb|ESW23195.1| hypothetical protein PHAVU_004G026400g [Phaseolus vulgaris]
Length=441

 Score =   440 bits (1131),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 248/444 (56%), Positives = 293/444 (66%), Gaps = 19/444 (4%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
             F  + ++A  IP     IAE+DE  R ++ +A + A Q+Y P P  ++  L + V  ++ 
Sbjct  12    FSLLATLAITIPCLEAGIAEFDEFLRAQSEKAHEIALQSYVPTPEFVTNDLNYHVHLSMQ  71

Query  1446  EAVAEDLTTNTTGRHLL-GSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYK  1270
                      N T R L  G+     PC ++NPID CWRC+ DWA +R RLA C  GFG +
Sbjct  72    ---------NVTRRGLKEGNNAIGKPCESSNPIDNCWRCNKDWAKDRYRLAKCGKGFGRR  122

Query  1269  TKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDK  1093
               GG  G  Y VTD SD D  NPKPGTLR+AV QK PLWI F   M I L QEL++  DK
Sbjct  123   AVGGLGGPIYVVTDNSDEDMINPKPGTLRYAVTQKGPLWITFERSMIISLQQELMISSDK  182

Query  1092  TIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdg  913
             TIDGRGA V I DG G+T+QFV NVIIHGI +  I    GGLIRD  +H G RT+SDGD 
Sbjct  183   TIDGRGANVQIRDGGGLTMQFVNNVIIHGIRVKDIVPKEGGLIRDSYNHIGQRTRSDGDA  242

Query  912   isifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKI  733
             IS+FG+SN+WIDHVS+ N  DGLID I+ STAITISN H T HNDVMLFGA D  T DKI
Sbjct  243   ISVFGASNIWIDHVSLSNSADGLIDVIQGSTAITISNCHMTRHNDVMLFGAADSYTGDKI  302

Query  732   MQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP  553
             MQIT+AFNHFG+ LIQRMPRCR G+ HV+NNDYTHW MYAIGGS+ PTI+ QGNRFIAP 
Sbjct  303   MQITVAFNHFGQGLIQRMPRCRMGFFHVLNNDYTHWMMYAIGGSAGPTILSQGNRFIAPN  362

Query  552   DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKA  373
             +   KEIT R   TPEEWK W W+S  D+ M GA F  SG P  M KH K +      K 
Sbjct  363   NDAAKEITHRDYATPEEWKNWQWQSDMDLLMNGATFNSSGSPIAM-KHKKGF----IMKP  417

Query  372   ED---VTWLTRFAGALNCRVGSPC  310
              D   V+ LTR +GALNC VG PC
Sbjct  418   RDGTHVSRLTRHSGALNCFVGLPC  441



>ref|XP_006363934.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=439

 Score =   439 bits (1130),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 242/455 (53%), Positives = 306/455 (67%), Gaps = 22/455 (5%)
 Frame = -3

Query  1656  MERFNKNNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISAS  1477
             M   + N+   +  + +A+++P     IAE+D    ++A E    + +AY  NP  ++ +
Sbjct  1     MAFISGNSILLILFIWLASLVPHIHARIAEFDAYLEKQALEDLNSSLEAYTHNPEEVTNA  60

Query  1476  LIHQVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLA  1297
                +V   L       L   +  R+L    K +  C ATNPIDRCWRC  +WA NR  L 
Sbjct  61    FNKEVGNAL-------LKYKSLRRNL----KEKNKCMATNPIDRCWRCDKNWAENRMDLE  109

Query  1296  DCAMGFGYKTKGGKSGKFYTVTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDMNIKLH  1120
             +CA GFG+KT GGK+GK+Y VTD+SDD    PKPGTLRHAVIQ++PLWIIF   M IKL 
Sbjct  110   ECARGFGHKTTGGKNGKYYVVTDESDDNVQEPKPGTLRHAVIQEEPLWIIFEKSMVIKLQ  169

Query  1119  QELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFG  940
             QEL++  DKTIDGRG  VHI++GAG+TIQFV NVIIH I I +I   NGG+IRD ++H G
Sbjct  170   QELMITSDKTIDGRGVAVHIANGAGLTIQFVHNVIIHNIRIQNIISTNGGMIRDSVNHIG  229

Query  939   LRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGA  760
             LRT SDGDGISIFGS+++WIDH ++  C DGL+DAI ASTAITISN  F  HNDVML GA
Sbjct  230   LRTVSDGDGISIFGSNHIWIDHCTLSECTDGLVDAIMASTAITISNCKFNHHNDVMLLGA  289

Query  759   NDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIIC  580
              D   +D IMQ+T+AFN FG+ LIQRMPRCR+G+ HVVNNDYTHW MYAIGGS+HPTII 
Sbjct  290   TDAFPQDSIMQVTVAFNRFGEGLIQRMPRCRWGFFHVVNNDYTHWQMYAIGGSAHPTIIS  349

Query  579   QGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN----FMDK  412
             QGNRF A  + + K++TKR      EWK W W S+GD ++ GA+FV+SG  +     + K
Sbjct  350   QGNRFKAADNPNTKQVTKRDYAPESEWKKWQWVSEGDSFLNGAYFVESGPQDKKKTALTK  409

Query  411   HHKLYDGVMTFK-AEDVTWLTRFAGALNCRVGSPC  310
             +HK+      FK       LTRFAG L C+ G PC
Sbjct  410   NHKI-----KFKPGSHAGRLTRFAGVLKCKPGIPC  439



>gb|EPS73633.1| hypothetical protein M569_01123, partial [Genlisea aurea]
Length=455

 Score =   440 bits (1131),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 253/465 (54%), Positives = 305/465 (66%), Gaps = 39/465 (8%)
 Frame = -3

Query  1629  FFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTL  1450
              FLF+V  +A       + A+ DE  + RA EA + + +AY+ NP +++      V  +L
Sbjct  5     LFLFIVGSSA----GDEYGAQLDEYMKSRAEEARRESLKAYKDNPEDVAEQFNQLVSDSL  60

Query  1449  SEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYK  1270
                    +  N+T R L G     G C ATNPIDRCWRC  DWA NRK+LADC  GFG+ 
Sbjct  61    -------IGANSTRRDLRGVG---GGCRATNPIDRCWRCDNDWAKNRKKLADCVRGFGHD  110

Query  1269  TKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDK  1093
             T GGK+G++Y VTD SD D +NPKPGTLRHAVIQK+PLWIIFAH M I+L+QELI    K
Sbjct  111   TTGGKNGRYYLVTDPSDNDMANPKPGTLRHAVIQKEPLWIIFAHSMIIRLNQELIFTSHK  170

Query  1092  TIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdg  913
             TIDGRG QVHI++GAG+TIQFV NVIIH I IH+I    GG+IRD +DH GLRT SDGD 
Sbjct  171   TIDGRGVQVHIANGAGLTIQFVTNVIIHNIWIHNIAPAGGGMIRDSIDHIGLRTMSDGDA  230

Query  912   isifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKI  733
             ISI+GSS VWIDHVS+   YDGLIDAI+ STAITISN  F  HNDVML GA+D +  D I
Sbjct  231   ISIYGSSRVWIDHVSLSKAYDGLIDAIQGSTAITISNCKFNHHNDVMLLGAHDDNPGDAI  290

Query  732   MQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIA--  559
             MQ+T+AFN FG   IQRMPR R+G++HVVNNDY HW +YAIGGS+HPTII QGNR+ A  
Sbjct  291   MQVTVAFNRFGIGCIQRMPRVRWGFVHVVNNDYQHWELYAIGGSAHPTIISQGNRYRASD  350

Query  558   -----------------PPDIHKK----EITKRVKGTPEEWKTWTWRSQGDIYMEGAFFV  442
                              PP  H+K    ++TKR      EW  W WRS+GD +M GAFF 
Sbjct  351   YRYTKEVRNPNYSLSPLPPKSHRKTQNLQVTKRDYAPKSEWSKWKWRSEGDFFMNGAFFT  410

Query  441   QSGDPNFMDKHHKLYDGVMTFKAED-VTWLTRFAGALNCRVGSPC  310
             QSG P  +         V+ +K    V  LTR AGA+ CR GS C
Sbjct  411   QSGSPFSVGTKPLTKRNVIKYKPGTYVGRLTRNAGAMKCRKGSYC  455



>gb|AFW87059.1| pectate lyase [Zea mays]
Length=451

 Score =   439 bits (1130),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 241/455 (53%), Positives = 313/455 (69%), Gaps = 17/455 (4%)
 Frame = -3

Query  1650  RFNKNNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLI  1471
             R+ +   F L++V        +  +I ++DE W++R   A   A+  Y+ +P  ++  L 
Sbjct  6     RWIRPGSFVLYLVFFFLSAALSEANIGDFDEYWQQRKLMADAAAEATYKHDPVEVANQLN  65

Query  1470  HQVRRTLSEAVAEDLTTNTTGRHLLGS----KKYRGPCNATNPIDRCWRCHADWASNRKR  1303
               V R++ +   ED+ T    R ++G+     K+ GPC ATNPIDRCWRC  DWA++RKR
Sbjct  66    RAVHRSVEK---EDIGTR---REMMGTTTRKSKFSGPCRATNPIDRCWRCRQDWATDRKR  119

Query  1302  LADCAMGFGYKTKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIK  1126
             LA CA GFG  T GG +GKFY VTD +DD   NP+PGTLR  VIQ +PLWI FA  M I 
Sbjct  120   LARCAKGFGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWGVIQIEPLWITFAKTMIIT  179

Query  1125  LHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGN--GGLIRDGL  952
             L +ELI++GDKTIDGRG QV I++GA +T+QFV NVIIH IHI+ I   N  GG +RD  
Sbjct  180   LKEELIIRGDKTIDGRGVQVRITNGAQLTLQFVNNVIIHNIHINDIVSSNKDGGYVRDSP  239

Query  951   DHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVM  772
             DHFG RT SDGDGI++FGS+NVW+DH+S+ NC DGLID I  ST +TISN H T+HNDVM
Sbjct  240   DHFGWRTVSDGDGITVFGSTNVWLDHLSLSNCQDGLIDVIAKSTGVTISNCHLTNHNDVM  299

Query  771   LFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHP  592
             LF ++D   +D+IMQIT+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  P
Sbjct  300   LFSSSDKHPEDQIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKAP  359

Query  591   TIICQGNRFIAPPDIHKKEITKRVKGTPEE-WKTWTWRSQGDIYMEGAFFVQSGDPNFMD  415
             TII QGNR+IAPP++  K++TK+   TPE  WK W W S+ D++MEGA+F  +G    ++
Sbjct  360   TIISQGNRYIAPPNLAAKQVTKQ-HDTPESVWKNWVWHSENDLFMEGAYFTVTGGQ--IN  416

Query  414   KHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             +     D +       VT LTR+AG+L C  G PC
Sbjct  417   RQFNKKDLIKPRNGSYVTRLTRYAGSLACTPGKPC  451



>ref|XP_007137422.1| hypothetical protein PHAVU_009G125800g [Phaseolus vulgaris]
 gb|ESW09416.1| hypothetical protein PHAVU_009G125800g [Phaseolus vulgaris]
Length=439

 Score =   439 bits (1128),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 243/444 (55%), Positives = 296/444 (67%), Gaps = 19/444 (4%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
             F  +V++A  IP     IAE+D+  + ++ +A K A ++Y P P  +++ L + V  ++ 
Sbjct  10    FSLLVTLAITIPCLEAGIAEFDDFLKAQSEKAHKIALESYVPTPEFVASELNYHVHLSM-  68

Query  1446  EAVAEDLTTNTTGRHL-LGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYK  1270
                      N+T R L  G+     PC+++NPID CWRC+ DWA++R RLA C  GFG +
Sbjct  69    --------LNSTRRGLKAGNNDAGAPCDSSNPIDNCWRCNKDWANDRYRLAKCGKGFGRR  120

Query  1269  TKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDK  1093
               GG  G  Y VTD SD D  NPK GTLR+ V QK PLWI FA  M I L QEL++  DK
Sbjct  121   AVGGLGGPIYVVTDNSDEDMVNPKEGTLRYGVTQKGPLWITFARSMIITLQQELLISSDK  180

Query  1092  TIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdg  913
             TIDGRGA V I DGAG+T+QFV NVIIHGI + +I    GG+IRD  +H GLRT+SDGD 
Sbjct  181   TIDGRGANVQIRDGAGLTMQFVNNVIIHGIRVKNIVSKEGGMIRDSYNHVGLRTRSDGDA  240

Query  912   isifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKI  733
             IS+FG+SN+WIDHVS+ N  DGLID I+ STAITISN H T HNDVMLFGA D  + DKI
Sbjct  241   ISVFGASNIWIDHVSLSNSDDGLIDVIQGSTAITISNCHMTRHNDVMLFGATDTYSGDKI  300

Query  732   MQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP  553
             MQIT+AFNHFG+ LIQRMPRCR G+ HV+NNDYTHW MYAIGGS+ PTI+ QGNRFIAP 
Sbjct  301   MQITVAFNHFGQGLIQRMPRCRMGFFHVLNNDYTHWMMYAIGGSAAPTILSQGNRFIAPN  360

Query  552   DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKA  373
             +   KEIT RV   PE WK W W+S  D+ M GA F  SG P         Y   +  K 
Sbjct  361   NDAAKEITHRVDAEPEVWKNWQWQSDMDLLMNGATFNTSGSPITTQ-----YKKGLLMKP  415

Query  372   ED---VTWLTRFAGALNCRVGSPC  310
              D   V+ LTR AGALNC VG PC
Sbjct  416   RDGTHVSRLTRHAGALNCFVGLPC  439



>ref|XP_011086389.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=442

 Score =   438 bits (1126),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 238/444 (54%), Positives = 306/444 (69%), Gaps = 21/444 (5%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
              + ++S   ++P +   IA+YDE  ++RA  + + +++A+ PNP  ++  L        +
Sbjct  15    LIIILSFVLLLPKSGAAIAKYDEYLKKRAQASLEESRKAFNPNPEELADDL--------N  66

Query  1446  EAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKT  1267
             + V+E LT     R+L      +G C ATNPIDRCWRC  +W  NRK+LA+CA GFG++ 
Sbjct  67    DQVSETLTREGGKRNL-----RQGGCKATNPIDRCWRCDPNWDKNRKQLAECARGFGHRA  121

Query  1266  KGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKT  1090
              GGKSG++Y VTD SD D   PKPGTLRHAVIQ +PLWIIF  +M I L +ELI   DKT
Sbjct  122   TGGKSGRYYVVTDPSDNDMDKPKPGTLRHAVIQPQPLWIIFGRNMVITLKEELIFASDKT  181

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             +DGRGA+VHI+ GAGIT+QFV NVIIH I IH I    GG+IRD +DH GLRT+SDGDGI
Sbjct  182   VDGRGAEVHIAYGAGITLQFVHNVIIHNIWIHDIVPEPGGMIRDAVDHIGLRTQSDGDGI  241

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             S+FGS+N+WIDHVS+    DGLID IE STA+TISN  F +HNDVML GA+D S KD IM
Sbjct  242   SVFGSNNIWIDHVSLSKGTDGLIDVIEGSTAVTISNCKFNNHNDVMLLGAHDGSNKDSIM  301

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             Q+T+AFN FG+ LIQRMPRCR G++HV+NNDY  W +YAIGGS+H TII QGNRF A  +
Sbjct  302   QVTVAFNQFGEGLIQRMPRCRLGFVHVINNDYDSWGLYAIGGSAHSTIISQGNRFKASNN  361

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKL---YDGVMTF  379
                K++T+R   +  EWK W WRS+GD+++ GA+FV+SG P    KH KL       + F
Sbjct  362   PDTKQVTRRAYASESEWKKWQWRSEGDMFLNGAYFVESGPP---IKHTKLPLRKKNSIKF  418

Query  378   KAEDVTW-LTRFAGALNCRVGSPC  310
             +       LTR+AGA  C  G  C
Sbjct  419   RPGSFAGRLTRYAGARMCFPGKLC  442



>ref|XP_004489374.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=447

 Score =   438 bits (1126),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 244/443 (55%), Positives = 292/443 (66%), Gaps = 15/443 (3%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLS  1447
              + +V+    IP     IAE+D+  R +A EA K A  +Y P P +++  L   V   L 
Sbjct  16    LILLVTFTITIPCLEAGIAEFDDFLRAQAEEAHKLALASYVPIPGDVAHDLNFHVHLALE  75

Query  1446  EAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKT  1267
              A       N T R L         C ATNPID CWRC  DWA++R +LA C+ GFG + 
Sbjct  76    GA-------NDTRRELKQKHAAGEACEATNPIDSCWRCQKDWANDRFKLAKCSKGFGRRA  128

Query  1266  KGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKT  1090
              GG  G  Y VTD+SD D  NPKPGTLR+  +QK PLWI F   M I+L+QEL++  DKT
Sbjct  129   TGGLGGPIYVVTDESDNDMQNPKPGTLRYGAVQKGPLWITFQRSMIIRLNQELLVSSDKT  188

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             IDGRGA V I DG GIT+QFV NVIIHG+HI +I    G +IRD  +H G RT+SDGD +
Sbjct  189   IDGRGANVQIRDGGGITMQFVNNVIIHGLHISNIKSKPGAMIRDSYNHVGQRTRSDGDAL  248

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             SIFGSSN+WIDHVS+  C DGLID I+ STAITISN H T HNDVMLFGA+D    DK+M
Sbjct  249   SIFGSSNIWIDHVSLSQCEDGLIDVIQGSTAITISNCHMTKHNDVMLFGASDTYNGDKLM  308

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             QIT+AFNHFG+ LIQRMPRCR+G++HVVNNDYTHW MYAIGGSS PTI+ QGNRFIAP +
Sbjct  309   QITVAFNHFGQGLIQRMPRCRFGFVHVVNNDYTHWQMYAIGGSSGPTILSQGNRFIAPDN  368

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAE  370
                KEIT R    PE WK W W+S+ D++M GA FV SG P       K +      K  
Sbjct  369   DAAKEITHRDYAEPEVWKNWQWQSEMDLFMNGAKFVTSGSPINKAPFKKGF----IMKPR  424

Query  369   D---VTWLTRFAGALNCRVGSPC  310
             D   V+ LTR +GALNC VG PC
Sbjct  425   DGSHVSRLTRHSGALNCVVGKPC  447



>ref|NP_001150723.1| pectate lyase precursor [Zea mays]
 gb|ACG40127.1| pectate lyase precursor [Zea mays]
Length=451

 Score =   438 bits (1126),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 240/455 (53%), Positives = 313/455 (69%), Gaps = 17/455 (4%)
 Frame = -3

Query  1650  RFNKNNCFFLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLI  1471
             R+ +   F L++V        +  +I ++DE W++R   A   A+  Y+ +P  ++  L 
Sbjct  6     RWIRPGSFVLYLVFFFLSAALSEANIGDFDEYWQQRKLMADAAAEATYKHDPVEVANQLN  65

Query  1470  HQVRRTLSEAVAEDLTTNTTGRHLLGS----KKYRGPCNATNPIDRCWRCHADWASNRKR  1303
               V R++ +   +D+ T    R ++G+     K+ GPC ATNPIDRCWRC  DWA++RKR
Sbjct  66    RAVHRSVEK---DDIGTR---REMMGTTTRKSKFSGPCRATNPIDRCWRCRQDWATDRKR  119

Query  1302  LADCAMGFGYKTKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIK  1126
             LA CA GFG  T GG +GKFY VTD +DD   NP+PGTLR  VIQ +PLWI FA  M I 
Sbjct  120   LARCAKGFGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWGVIQIEPLWITFAKTMIIT  179

Query  1125  LHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGN--GGLIRDGL  952
             L +ELI++GDKTIDGRG QV I++GA +T+QFV NVIIH IHI+ I   N  GG +RD  
Sbjct  180   LKEELIIRGDKTIDGRGVQVRITNGAQLTLQFVNNVIIHNIHINDIVSSNKDGGYVRDSP  239

Query  951   DHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVM  772
             DHFG RT SDGDGI++FGS+NVW+DH+S+ NC DGLID I  ST +TISN H T+HNDVM
Sbjct  240   DHFGWRTVSDGDGITVFGSTNVWLDHLSLSNCQDGLIDVIAKSTGVTISNCHLTNHNDVM  299

Query  771   LFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHP  592
             LF ++D   +D+IMQIT+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  P
Sbjct  300   LFSSSDKHPEDQIMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKAP  359

Query  591   TIICQGNRFIAPPDIHKKEITKRVKGTPEE-WKTWTWRSQGDIYMEGAFFVQSGDPNFMD  415
             TII QGNR+IAPP++  K++TK+   TPE  WK W W S+ D++MEGA+F  +G    ++
Sbjct  360   TIISQGNRYIAPPNLAAKQVTKQ-HDTPESVWKNWVWHSENDLFMEGAYFTVTGGQ--IN  416

Query  414   KHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             +     D +       VT LTR+AG+L C  G PC
Sbjct  417   RQFNKKDLIKPRNGSYVTRLTRYAGSLACTPGKPC  451



>ref|NP_178375.1| putative pectate lyase 6 [Arabidopsis thaliana]
 sp|O64510.1|PLY6_ARATH RecName: Full=Probable pectate lyase 6; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC05350.1| putative pectate lyase [Arabidopsis thaliana]
 gb|AAO64162.1| putative pectate lyase [Arabidopsis thaliana]
 gb|AAV34776.1| At2g02720 [Arabidopsis thaliana]
 gb|AEC05615.1| putative pectate lyase 6 [Arabidopsis thaliana]
Length=455

 Score =   437 bits (1123),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 243/464 (52%), Positives = 303/464 (65%), Gaps = 30/464 (6%)
 Frame = -3

Query  1644  NKNNCFFLFV-VSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNIS-----  1483
             N  +  F+FV +S+  ++P+   HIAEYDE W +R   A +   ++Y+PNP N++     
Sbjct  3     NLGSYVFVFVALSLTVVVPSVQAHIAEYDEYWTQRQTNALRETLESYDPNPENVTDHFNY  62

Query  1482  --------ASLIHQVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHA  1327
                       ++++ RR L +      TT   GR             + N ID+CWR   
Sbjct  63    HAALAMETTGIVNETRRDLRQVGRGKKTTRRGGRF-----------ESLNAIDKCWRGDK  111

Query  1326  DWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWII  1150
             +W  NRK+LADC +GFG KT GGK+G  Y VTD SD D   PKPGT+RHAV + +PLWII
Sbjct  112   NWDKNRKKLADCVLGFGRKTTGGKNGPIYVVTDPSDNDLLKPKPGTIRHAVTRDRPLWII  171

Query  1149  FAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGG  970
             FA  M IKL QELI+  DKTIDGRGA+++I+ GAG+T+QFV+NVIIH IHI  I  G GG
Sbjct  172   FARSMIIKLQQELIITNDKTIDGRGAKIYITGGAGLTLQFVRNVIIHNIHIKQIKRGAGG  231

Query  969   LIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFT  790
             LI D   HFGLRT SDGDGI+IFG++NVWIDHVSM +C DG+IDAI  STAITISN HFT
Sbjct  232   LIIDSEQHFGLRTVSDGDGINIFGATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFT  291

Query  789   DHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAI  610
             DH++VMLFG  +    DK MQIT+AFNHFGKRL QRMPR R+G +HVVNNDYTHW MYAI
Sbjct  292   DHDEVMLFGGTNKDVIDKKMQITVAFNHFGKRLKQRMPRVRFGLVHVVNNDYTHWEMYAI  351

Query  609   GGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGD  430
             GG+ +PTII QGNRFIAPP    K++TKR      EWK+W W+S+ D ++ GA+FVQSG 
Sbjct  352   GGNMNPTIISQGNRFIAPPIEDSKQVTKREYTPYPEWKSWNWQSEKDYFLNGAYFVQSGK  411

Query  429   PNFMDKHHK----LYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              N      K        +       V  LT+ AG L C+ G  C
Sbjct  412   ANAWSATPKNPIPRKFAIRPQPGTKVRRLTKDAGTLGCKPGKSC  455



>ref|NP_001046281.1| Os02g0214400 [Oryza sativa Japonica Group]
 dbj|BAD25039.1| putative pectate lyase precursor [Oryza sativa Japonica Group]
 dbj|BAF08195.1| Os02g0214400 [Oryza sativa Japonica Group]
 dbj|BAG94880.1| unnamed protein product [Oryza sativa Japonica Group]
Length=446

 Score =   436 bits (1122),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 243/445 (55%), Positives = 301/445 (68%), Gaps = 18/445 (4%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGH--IAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRT  1453
             FL V  V     A V +  I E+DE W +R A A   A++ Y+P+P N++    H V R+
Sbjct  14    FLLVAGVFLAAAAAVSNAGIGEFDEHWEKRRAAAEAAAEEVYKPDPFNVTNEFNHAVIRS  73

Query  1452  LSEAVAEDLTTNTTGRHLLG-SKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFG  1276
                 V          R L G + KY+GPC ATNPIDRCWRC  DWA++RKRLA CAMGFG
Sbjct  74    TERGVLR--------RELSGKNSKYKGPCLATNPIDRCWRCRKDWATDRKRLARCAMGFG  125

Query  1275  YKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQG  1099
                 GG  GK Y VTD  D D +NP+ GTLR   +Q  PLWI FA  M I+L QEL++  
Sbjct  126   RGATGGVRGKIYVVTDPGDGDAANPRYGTLRWGAMQAAPLWITFAKSMVIRLTQELLVAS  185

Query  1098  DKTIDGRGAQVHIS-DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsd  922
             DKTIDGRGAQVHI+  GAGIT+QF +NVII  +H+H +   +GG +RD   H G RT++D
Sbjct  186   DKTIDGRGAQVHIARGGAGITVQFARNVIITSLHVHDVKHSDGGAVRDSPTHIGPRTRAD  245

Query  921   gdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTK  742
             GDGIS+F +++VW+DHVSM  C DGLID ++ ST +TISN HFT+HNDVMLFGA+D   +
Sbjct  246   GDGISLFAATDVWVDHVSMSMCEDGLIDVVQGSTGVTISNSHFTNHNDVMLFGASDSYPQ  305

Query  741   DKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFI  562
             DK+MQIT+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGG   PTI+ QGNR+I
Sbjct  306   DKVMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGGMSPTILSQGNRYI  365

Query  561   APPDIHKKEITKRVKGTPE-EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVM  385
             APP+I  K IT+     PE EWK W WRS GD++M GA+F  S     +++  K  D V 
Sbjct  366   APPNIAAKLITRHY--APEWEWKNWAWRSDGDLFMNGAYFQASN--GAINRKVKGSDMVK  421

Query  384   TFKAEDVTWLTRFAGALNCRVGSPC  310
                   V  LTRFAGAL+CR G PC
Sbjct  422   PKPGSYVRRLTRFAGALSCRPGEPC  446



>ref|XP_011087066.1| PREDICTED: pectate lyase [Sesamum indicum]
Length=431

 Score =   434 bits (1117),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 238/431 (55%), Positives = 297/431 (69%), Gaps = 28/431 (6%)
 Frame = -3

Query  1593  PATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNT  1414
             P +   IA+YDE  +++A  A + A +A++PNP  ++  L +QV  T  +          
Sbjct  26    PESRAAIAKYDEYLQKKAEVASEEALKAFDPNPEKLADDLNYQVSETEDD----------  75

Query  1413  TGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTV  1234
                             ATNPIDRCWRC  +WA NR++LADCA GFG++  GGK G++Y V
Sbjct  76    --------------FKATNPIDRCWRCDRNWAQNRQKLADCARGFGHRATGGKGGRYYVV  121

Query  1233  TDKSDDQSN-PKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHIS  1057
             TD SDD  + PKPGTLRHA IQK+PLWIIFA+ M IKL +EL+   +KT+DGRGA+VHI+
Sbjct  122   TDPSDDDMDKPKPGTLRHAAIQKEPLWIIFANHMVIKLKEELLFASNKTLDGRGAKVHIA  181

Query  1056  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  877
              GAGIT+QFV NVIIH I IH I    GG+IRD +DH GLRT+SDGDGIS+F S+N+WID
Sbjct  182   YGAGITLQFVHNVIIHNIRIHDIHPAPGGMIRDAVDHIGLRTRSDGDGISVFNSNNIWID  241

Query  876   HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGK  697
             HVS+    DGLID IE STAITISN  F  HNDVML GA+D + KD IMQIT+AFN FGK
Sbjct  242   HVSLSKGTDGLIDVIEGSTAITISNCKFNHHNDVMLLGAHDSTAKDSIMQITVAFNRFGK  301

Query  696   RLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVK  517
              LIQRMPR R+G++HV+NNDY+HW MYAIGGS+HPTII QGNRF A  + H KE+TKR+ 
Sbjct  302   GLIQRMPRIRWGFVHVINNDYSHWEMYAIGGSAHPTIISQGNRFKAANNQHTKEVTKRMF  361

Query  516   GTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYD-GVMTFKAEDVTW-LTRFA  343
                 EW+ W WRS+GD +  GA+FV+SG P     +  L +  ++ FK       LTR+A
Sbjct  362   AEKSEWEKWQWRSEGDKFTNGAYFVESG-PAIRRTNLPLTEKSLIKFKPGSFAGRLTRYA  420

Query  342   GALNCRVGSPC  310
             GAL CR G  C
Sbjct  421   GALKCREGKLC  431



>ref|XP_004964534.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=438

 Score =   434 bits (1116),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 238/419 (57%), Positives = 296/419 (71%), Gaps = 19/419 (5%)
 Frame = -3

Query  1563  DEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTGRHLLGSKK  1384
             +E W  RA EA  + + AY  +P       I  + R  +E +       TT R L   ++
Sbjct  38    EEYWAERAEEARANNRAAYVSDP-------IAAMNRFNTETLRA-----TTRRSL---RR  82

Query  1383  YRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSDDQSN-  1207
             Y+GPC ATNPID CWRC ADWA++R+RLA CA GFG+KT GG  GK Y VTD SDD+   
Sbjct  83    YQGPCAATNPIDSCWRCRADWATDRQRLALCARGFGHKTTGGAGGKIYIVTDASDDEMII  142

Query  1206  PKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFV  1027
             P+ GTLR+ VIQ +PLWI+FA DM ++L QELI+  +KTIDGRGAQVHI+ GA IT+Q V
Sbjct  143   PRKGTLRYGVIQGRPLWIVFARDMVVRLRQELIVSDNKTIDGRGAQVHIT-GAQITLQSV  201

Query  1026  KNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDG  847
              +VIIH +HIHH    +GG+IRD   H+GLRT+SDGDGIS+  SSNVWIDHVSM  C DG
Sbjct  202   SHVIIHNVHIHHSAPHSGGIIRDSKRHYGLRTRSDGDGISVLSSSNVWIDHVSMYRCSDG  261

Query  846   LIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCR  667
             LID +  ST IT+SN HFT H+ VMLFGA++ + +D++MQ+T+AFNHFGK L+QRMPRCR
Sbjct  262   LIDVVNGSTGITVSNSHFTKHDHVMLFGASNDNPQDRMMQVTVAFNHFGKGLVQRMPRCR  321

Query  666   YGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWT  487
             YG+ HVVNNDYTHW MYAIGG+ +PTII QGNRFIAP D + KE+TKR      E+K W 
Sbjct  322   YGFFHVVNNDYTHWQMYAIGGNKNPTIISQGNRFIAPDDPNAKEVTKREYTPYSEYKDWV  381

Query  486   WRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             W+SQGD+ M GAFF +SG  N  ++ +   D +       V  LT+FAG LNCR G PC
Sbjct  382   WKSQGDVMMNGAFFNESGGQN--ERKYDQLDFIPARHGSYVGELTKFAGTLNCRAGKPC  438



>gb|KFK25747.1| hypothetical protein AALP_AA8G154300 [Arabis alpina]
Length=504

 Score =   436 bits (1122),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 231/386 (60%), Positives = 288/386 (75%), Gaps = 10/386 (3%)
 Frame = -3

Query  1446  EAVAEDLTTNTTGRHLLGS-----KKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMG  1282
             E V E  +TN+T R L G       K +GPC A+NPID+CWRC  DWA  RKRL  C  G
Sbjct  122   EMVGE--STNSTRRSLRGKGRGKWSKLKGPCTASNPIDKCWRCRPDWARRRKRLVKCVRG  179

Query  1281  FGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIM  1105
             FG++T GGK G+ Y VT   D D  NP PGTLRHAVIQK+PLWIIF +DM+I+L+QEL++
Sbjct  180   FGHRTTGGKRGRIYVVTSNLDEDMVNPVPGTLRHAVIQKEPLWIIFKNDMSIRLNQELLI  239

Query  1104  QGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKs  925
                KTID RGA VHI+ GAGIT+QFV+NVIIHG+HIHHI E +GG+IRD +DH+G+RT++
Sbjct  240   NSHKTIDARGADVHIAHGAGITMQFVRNVIIHGLHIHHISESSGGMIRDSVDHYGMRTRA  299

Query  924   dgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLST  745
             DGDG+SI+GSSN+W+DH+SM  C DGLIDAI  ST ITISN HFT HNDVML GA + + 
Sbjct  300   DGDGLSIYGSSNIWLDHISMSKCQDGLIDAICGSTGITISNSHFTHHNDVMLLGAQNTNE  359

Query  744   KDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRF  565
             +DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+  GNRF
Sbjct  360   EDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRF  419

Query  564   IAPP-DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGV  388
             IAPP   H +E+TKR   + +EWK W WRS+ DI+M GA+F QSG P +   H +    +
Sbjct  420   IAPPHKPHYREVTKRDYASEDEWKHWNWRSEKDIFMNGAYFRQSGTPGYKCAHTR-KQMI  478

Query  387   MTFKAEDVTWLTRFAGALNCRVGSPC  310
                    V+ LT++AGAL+CRVG  C
Sbjct  479   KPKNGMAVSKLTKYAGALDCRVGKRC  504



>ref|XP_010420163.1| PREDICTED: probable pectate lyase 19 isoform X1 [Camelina sativa]
Length=499

 Score =   436 bits (1122),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 228/379 (60%), Positives = 284/379 (75%), Gaps = 8/379 (2%)
 Frame = -3

Query  1425  TTNTTGRHLLGS-----KKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKG  1261
             +T +T R L G       K +GPC A+NPID+CWRC  +WA  RK+L  C  GFG++T G
Sbjct  122   STKSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWRCRTNWAKRRKKLTRCVRGFGHRTTG  181

Query  1260  GKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTID  1084
             GK G+ Y VT   D D  NPKPGTLRHAVIQK+PLWIIF +DM+I+L QEL++   KTID
Sbjct  182   GKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEPLWIIFKNDMSIRLSQELLINSHKTID  241

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
              RGA VHI+ GAGIT+QFVKNVIIHG+HIHHI E +GG+IRD +DHFG+RT++DGDG+SI
Sbjct  242   ARGANVHIAHGAGITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSI  301

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             +GSSN+W+DH+SM  C DGLIDAI  ST ITISN HFT HNDVML GA + +  DK MQ+
Sbjct  302   YGSSNIWLDHISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQV  361

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP-DI  547
             T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+  GNRFIAPP   
Sbjct  362   TVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKP  421

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED  367
             H +E+TKR     +EWK W WRS+ D++M GA+F QSG+P+F   H +    +       
Sbjct  422   HYREVTKRDYAPEDEWKHWIWRSEKDVFMNGAYFRQSGNPHFKCAHTR-KQMIKPKNGMA  480

Query  366   VTWLTRFAGALNCRVGSPC  310
             V+ LT++AGAL+CRVG  C
Sbjct  481   VSKLTKYAGALDCRVGKRC  499



>ref|XP_008679844.1| PREDICTED: pectate lyase [Zea mays]
 gb|AFW66064.1| pectate lyase-like protein [Zea mays]
Length=444

 Score =   434 bits (1115),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 236/427 (55%), Positives = 298/427 (70%), Gaps = 18/427 (4%)
 Frame = -3

Query  1578  HIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTGRHL  1399
             ++ ++D+  ++R   A   A++AY P+P+N++ S    V R +S +  E        R  
Sbjct  32    NVGQFDDHLQKRKELAEASAREAYRPDPYNVTNSFNAAVHRAVSSSRRE-------MRER  84

Query  1398  LGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD  1219
                 K RGPC ATNPID+CWRC  DWA++R+RLA CA GFG+ T GG  GK Y VTD +D
Sbjct  85    PRKHKKRGPCRATNPIDKCWRCRRDWATDRQRLARCARGFGHATTGGLGGKIYVVTDPTD  144

Query  1218  -DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGI  1042
              D  NP+PGTLR  VIQ  PLWIIFA  M I+L QEL+M  DKTIDGRGAQVHI++GAGI
Sbjct  145   LDVVNPRPGTLRWGVIQPGPLWIIFARSMIIQLSQELLMSSDKTIDGRGAQVHIANGAGI  204

Query  1041  TIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMR  862
             T+Q  +NVIIH +H+H +    GGL+RD   H G RT++DGDGIS+F ++NVWIDH+SM 
Sbjct  205   TVQLAQNVIIHNLHVHDVKHTMGGLMRDSPTHIGSRTRADGDGISLFSATNVWIDHISMS  264

Query  861   NCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQR  682
             NC DGLID +++ST ITISN HFT+HNDVMLFGA+D   +D+IMQIT+AFNHFG+ L+QR
Sbjct  265   NCEDGLIDVVQSSTGITISNCHFTNHNDVMLFGASDSWPQDQIMQITVAFNHFGRGLVQR  324

Query  681   MPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEE  502
             MPRCR+G+ HVVNNDYTHW MYAIGG   PTII QGNR+IAPP+I  K ITK      EE
Sbjct  325   MPRCRWGFFHVVNNDYTHWLMYAIGGGDAPTIISQGNRYIAPPNIAAKVITKHYA---EE  381

Query  501   --WKTWTWRSQGDIYMEGAFFVQSGD-PNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALN  331
               WK W W ++ D++M GA F  SG  P  +D +  +     T+    VT LTRF+G L+
Sbjct  382   GVWKNWVWHTEDDLFMNGAIFNPSGGAPKQVDTNEWVKPKPGTY----VTRLTRFSGTLS  437

Query  330   CRVGSPC  310
             C  G PC
Sbjct  438   CCTGKPC  444



>gb|AAA16476.1| pectate lyase homolog [Zea mays]
 gb|AFW85884.1| hypothetical protein ZEAMMB73_308319 [Zea mays]
Length=438

 Score =   434 bits (1115),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 237/424 (56%), Positives = 296/424 (70%), Gaps = 19/424 (4%)
 Frame = -3

Query  1578  HIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTGRHL  1399
             ++   +E W  RA  A      AY  +P  ++A+               D+   TT R L
Sbjct  33    NVTSDEEYWAERAEVARSRNLAAYVSDP--VAAT----------NRFNADVLRATTRRAL  80

Query  1398  LGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD  1219
                 +Y GPC ATNPIDRCWRC ADWA++RKRLA CA GFG++T GG +GK Y V D SD
Sbjct  81    ---ARYDGPCMATNPIDRCWRCRADWATDRKRLAQCARGFGHRTVGGAAGKLYVVRDPSD  137

Query  1218  DQSN-PKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGI  1042
             D+   P+ GTLRHAVIQ +PLWI+FA DM I+L QELI+  +KTIDGRGAQVHI   A I
Sbjct  138   DEMIIPRKGTLRHAVIQDRPLWIVFARDMVIELRQELIVNHNKTIDGRGAQVHIM-FAQI  196

Query  1041  TIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMR  862
             T+Q V+NVI+H +HIH     +GG+IRD   H+GLRT+SDGDG+S+  SSNVWIDHVSM 
Sbjct  197   TLQNVQNVILHNLHIHDSKAHSGGMIRDSKRHYGLRTRSDGDGVSVLSSSNVWIDHVSMS  256

Query  861   NCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQR  682
             +C DGLID +  STAIT+SN HFTDH+ VMLFGA++ S +D +MQ+T+AFNHFG+ L+QR
Sbjct  257   SCSDGLIDVVNGSTAITVSNSHFTDHDHVMLFGASNDSPQDAVMQVTVAFNHFGRGLVQR  316

Query  681   MPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEE  502
             MPRCRYG+ HVVNNDYTHW MYAIGG+ +PTII QGNRFIAP D + KE+TKR     ++
Sbjct  317   MPRCRYGFFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIAPDDPNAKEVTKREYTPYKD  376

Query  501   WKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRV  322
             +K W W+SQGD+ M GAFF +SG  N  ++ +  +D +       V  LTRFAG L C V
Sbjct  377   YKEWVWKSQGDVMMNGAFFNESGGQN--ERKYDRFDFIPAKHGRYVGQLTRFAGPLKCIV  434

Query  321   GSPC  310
             G PC
Sbjct  435   GQPC  438



>ref|XP_004298448.1| PREDICTED: probable pectate lyase 3-like [Fragaria vesca subsp. 
vesca]
Length=443

 Score =   434 bits (1115),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 242/420 (58%), Positives = 293/420 (70%), Gaps = 12/420 (3%)
 Frame = -3

Query  1563  DEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTGRHLLGSKK  1384
             DE W++RAA+A + A  +  P+P N++     +V   +       +  N T R L G K+
Sbjct  34    DEYWKQRAADAMRIANASVHPDPENVTEEFNAKVHEHI-------MGQNRTRRTLRGFKR  86

Query  1383  YRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSDDQ-SN  1207
             Y GPC ATNPID CWRC  +WA NR++L DC+MGFG KT GGK G  Y VTD SDD   N
Sbjct  87    YEGPCRATNPIDACWRCDPEWADNRQKLVDCSMGFGKKTTGGKGGPIYVVTDGSDDDIVN  146

Query  1206  PKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFV  1027
             PK GTLR+AV +K+PLWIIFAH M I+L QEL++  DKTIDGRGA + I+ G GIT+Q+V
Sbjct  147   PKEGTLRYAVTRKRPLWIIFAHSMVIRLQQELMVTCDKTIDGRGANIVIAYGGGITLQYV  206

Query  1026  KNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDG  847
              NVII  I +  I    GG++RD  DH GLRT+SDGDGIS+F +SN+WIDHVSM    DG
Sbjct  207   NNVIITNIKVKDIQSLPGGMLRDAEDHVGLRTRSDGDGISLFSASNIWIDHVSMARTADG  266

Query  846   LIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCR  667
             LID I  STA+TISNGHFTDHN+ MLFGA +  T+DK MQITLAFNHFG+ L+QRMPRCR
Sbjct  267   LIDCIMGSTAVTISNGHFTDHNEAMLFGAKNTHTQDKNMQITLAFNHFGQGLVQRMPRCR  326

Query  666   YGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWT  487
             +G+ HVVNNDYT W MYAIGG+ +PTII QGNRFIAP     KE+TKR      EWK W 
Sbjct  327   FGFFHVVNNDYTQWIMYAIGGNMNPTIISQGNRFIAPESHVAKEVTKREYTDESEWKNWN  386

Query  486   WRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVT-WLTRFAGALNCRVGSPC  310
             WRS+GD+   GAFFV+SG+PN     +     +M FK   +   LT FAGAL C VG PC
Sbjct  387   WRSEGDVMENGAFFVESGNPNCAKSTNI---EMMPFKPGKLAPQLTSFAGALECFVGRPC  443



>ref|XP_002875142.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51401.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=455

 Score =   434 bits (1115),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 239/454 (53%), Positives = 302/454 (67%), Gaps = 8/454 (2%)
 Frame = -3

Query  1647  FNKNNCFFLFV-VSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLI  1471
              N  +  F+FV +S+  ++P+   HIA YD+ W +R   A +   ++Y+PNP N++    
Sbjct  2     LNLGSYVFVFVSLSLTVVVPSVQAHIAVYDDYWTQRQTIALRQTLESYDPNPDNVTDHFN  61

Query  1470  HQVRRTLSEAVAEDLTTNTTGRHLLGSKKYR--GPCNATNPIDRCWRCHADWASNRKRLA  1297
             +     +      + T     +   G KK R  G   + N ID+CWR   +W  NRK+LA
Sbjct  62    YHAALAMETTGIVNETRRDLRQVRSGKKKPRRGGRFESLNAIDKCWRGDKNWDKNRKKLA  121

Query  1296  DCAMGFGYKTKGGKSGKFYTVTDKSD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLH  1120
             DC +GFG KT GGK+G  Y VTD SD D  NPKPGT+RHAV + +PLWI+FA  M IKL 
Sbjct  122   DCVLGFGRKTTGGKNGPIYVVTDPSDNDLLNPKPGTIRHAVTRDRPLWIVFARSMIIKLQ  181

Query  1119  QELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFG  940
             QELI+  DKTIDGRGA+++I+ GAG+T+QFV+NVIIH +HI  I +G GG+IRD   H+G
Sbjct  182   QELIITNDKTIDGRGARIYITGGAGLTLQFVRNVIIHNVHIKLIKKGVGGVIRDSEHHYG  241

Query  939   LRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGA  760
              RT SDGDGI+IFG++NVWIDHVSM +C DG+IDAI  STAITISN HFTDH++VMLFG 
Sbjct  242   HRTMSDGDGINIFGATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGG  301

Query  759   NDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIIC  580
              +    DK MQIT+AFNHFGKRL QRMPR RYG +HVVNNDYTHW MYAIGG+ +PTII 
Sbjct  302   TNKDVIDKKMQITVAFNHFGKRLKQRMPRVRYGLVHVVNNDYTHWEMYAIGGNMNPTIIS  361

Query  579   QGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK-  403
             QGNRFIAPP    K++TKR      EWKTW W+S+ D ++ GA+FVQSG  N      K 
Sbjct  362   QGNRFIAPPIEDSKQVTKREYTPYPEWKTWNWQSEKDYFLNGAYFVQSGKANAWSSTPKN  421

Query  402   ---LYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
                    +       V  LT+ AG L C+ G  C
Sbjct  422   PIPRKFAIRPQPGTKVRRLTKDAGTLGCKPGKSC  455



>ref|XP_002453531.1| hypothetical protein SORBIDRAFT_04g007450 [Sorghum bicolor]
 gb|EES06507.1| hypothetical protein SORBIDRAFT_04g007450 [Sorghum bicolor]
Length=445

 Score =   432 bits (1112),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 232/426 (54%), Positives = 290/426 (68%), Gaps = 12/426 (3%)
 Frame = -3

Query  1584  VGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTGR  1405
               +IA++DE W++R   A    ++ Y P+P+N++ S    V R  S           T R
Sbjct  31    TANIADFDEHWQKRKELAEASVRETYRPDPYNVTNSFNVAVHRATS--------LRRTMR  82

Query  1404  HLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDK  1225
              +    K +GPC ATNPID+CWRC  DWA++R RLA CA GFG  T GG  G  Y VTD 
Sbjct  83    EMPRKHKKKGPCRATNPIDKCWRCKNDWATDRFRLARCARGFGQATTGGLGGPIYIVTDP  142

Query  1224  SD-DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGA  1048
             SD D  NP+PGTLR  VIQ  PLWIIFA  M I+L QEL++  DKTIDGRGAQVHI++GA
Sbjct  143   SDGDVVNPRPGTLRWGVIQPGPLWIIFAKSMIIQLSQELLVSSDKTIDGRGAQVHIANGA  202

Query  1047  GITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVS  868
             GIT+Q  +NVIIH +H+H +    GGL+RD   H G RTK+DGDGIS+F ++NVWIDH+S
Sbjct  203   GITVQLARNVIIHNLHVHDVLHSMGGLMRDSPTHVGSRTKADGDGISLFQATNVWIDHIS  262

Query  867   MRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLI  688
             M NC DGLID +++ST ITISN HFT+HNDVMLFGA+D   +D++MQIT+AFNHFG+ L+
Sbjct  263   MSNCEDGLIDVVQSSTGITISNCHFTNHNDVMLFGASDSYPQDQMMQITVAFNHFGRGLV  322

Query  687   QRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTP  508
             QRMPRCR+G+ HVVNNDYTHW MYAIGG   PTII QGNR+IAPP+I  K ITK      
Sbjct  323   QRMPRCRWGFFHVVNNDYTHWLMYAIGGGKAPTIISQGNRYIAPPNIAAKVITKHY-AEE  381

Query  507   EEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNC  328
              EWK W W ++ D++M GA F  SG    + +     + V       VT LTRF+G L+C
Sbjct  382   GEWKNWVWHTEDDLFMNGAIFEPSG--GAVQRQINSNEWVKPKPGTYVTRLTRFSGTLSC  439

Query  327   RVGSPC  310
              +  PC
Sbjct  440   CMSKPC  445



>ref|XP_009758350.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=445

 Score =   432 bits (1111),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 242/456 (53%), Positives = 306/456 (67%), Gaps = 18/456 (4%)
 Frame = -3

Query  1656  MERFNKNNCFFLF-VVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISA  1480
             M  F+ N+  FL+ ++ +A++IP    +IAE+D    ++A EA K +  AY  NP  ++ 
Sbjct  1     MASFSCNSVIFLYSLLCIASLIPNLHANIAEFDPYLEKKAEEALKSSLAAYNENPEELTD  60

Query  1479  SLIHQVRRTLSEAVAEDLTTNTTGRHLLGSKKYRGP----CNATNPIDRCWRCHADWASN  1312
             +   +V  T+          N T RHL    K        C A NPID+CWRC  +WA+N
Sbjct  61    TFNKEVGETI---------FNGTRRHLKEEDKDDKDDNDGCKAYNPIDKCWRCDKNWANN  111

Query  1311  RKRLADCAMGFGYKTKGGKSGKFYTVTDKSDDQ-SNPKPGTLRHAVIQKKPLWIIFAHDM  1135
             RK LADCA GFG+ T GGK GKFY VTD SDD    PKPGTLRHAVIQ++PLWIIF   M
Sbjct  112   RKALADCARGFGHGTTGGKDGKFYVVTDPSDDNVEEPKPGTLRHAVIQEEPLWIIFEKSM  171

Query  1134  NIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDG  955
              IKL QEL++  DKTIDGRG  VH++ GAG+TIQFV NVI+H I +HHI   +GG+IRD 
Sbjct  172   IIKLQQELMINNDKTIDGRGVSVHVAYGAGLTIQFVHNVIVHNIRVHHILSTSGGMIRDS  231

Query  954   LDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDV  775
             +DH GLRT SDGD ISIFG++ +WIDH ++    DGLIDAI ASTAITISN  F  HNDV
Sbjct  232   IDHIGLRTVSDGDAISIFGANRIWIDHCTLTKGADGLIDAIMASTAITISNCKFNHHNDV  291

Query  774   MLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSH  595
             ML GAND   +DKIMQ+T+AFN FGK  IQRMPRCR+G+ HVVNNDY  W MYAIGG+++
Sbjct  292   MLLGANDAFPQDKIMQVTVAFNRFGKGCIQRMPRCRWGFFHVVNNDYAKWEMYAIGGTAN  351

Query  594   PTIICQGNRFIAPPDIHKKEITKRVKGTPEE-WKTWTWRSQGDIYMEGAFFVQSGDPNFM  418
             PTII QGNRF A  + + KE+T R  G PE  W+ W WRS+GD+++ GA+F +SG P+  
Sbjct  352   PTIISQGNRFKASNNPNTKEVTNR-NGAPESLWRNWQWRSEGDLFLNGAYFRESG-PDIK  409

Query  417   DKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
                   +  +    A+ V  LTR AG + C++G  C
Sbjct  410   HTPFTEHTSIKFEPAKFVGRLTRKAGVIKCKIGKAC  445



>ref|XP_009380431.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=436

 Score =   431 bits (1109),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 243/444 (55%), Positives = 298/444 (67%), Gaps = 24/444 (5%)
 Frame = -3

Query  1626  FLFVVSVAAIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASL----IHQVR  1459
              LF+ S A+    +  +I +YDE W +R AEA  +  QAY   P ++        I QV 
Sbjct  12    LLFLASAAS----SNTNITDYDEYWVKREAEALSNIMQAYVSEPESVVNHFNTPDIFQV-  66

Query  1458  RTLSEAVAEDLTTNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGF  1279
                          N+T R L   K     C ATNPIDRCWRC +DWASNRK LA CA GF
Sbjct  67    ------------FNSTRRSLRHGKGKGRKCVATNPIDRCWRCRSDWASNRKLLAKCAKGF  114

Query  1278  GYKTKGGKSGKFYTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQ  1102
             G   +GG SG  Y VT+ SDD   +P+PGTLR+ V + +PLWIIFA DM IKL QEL++ 
Sbjct  115   GRHAEGGLSGSIYVVTNPSDDNLLDPRPGTLRYGVTRDRPLWIIFARDMVIKLQQELMIN  174

Query  1101  GDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsd  922
               KTIDGRGA VHI+ GAG+TIQFVK+VI+H +HIH I  G GG IRD   H+G+RT+SD
Sbjct  175   NYKTIDGRGANVHIAYGAGLTIQFVKHVIVHNLHIHDIKPGAGGNIRDSEGHWGIRTRSD  234

Query  921   gdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTK  742
             GDG+SIFG+S+VW+DH+SM NC DGLIDA++ASTAITISN H T HNDV+L GA+D S +
Sbjct  235   GDGVSIFGASHVWVDHLSMSNCADGLIDAVKASTAITISNCHLTRHNDVILLGASDKSQE  294

Query  741   DKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFI  562
             D +MQ+T+A+NHFGK L+QRMPRCR+G+ HVVNNDYTHW MYA+GGS HPTII QGNRF+
Sbjct  295   DAVMQVTVAYNHFGKGLVQRMPRCRWGFFHVVNNDYTHWMMYAVGGSQHPTIISQGNRFV  354

Query  561   APPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMT  382
              PP    KE+T R      EWK W W S+ D +  GAFF+QSG   +  KH + YD +  
Sbjct  355   GPPIQFAKEVTHREYAPESEWKNWIWTSEDDEFKSGAFFIQSGH-KYQGKHSR-YDVIKA  412

Query  381   FKAEDVTWLTRFAGALNCRVGSPC  310
                     LTRF+GAL C    PC
Sbjct  413   KPGSIAGRLTRFSGALQCSPNRPC  436



>gb|ACF87417.1| unknown [Zea mays]
Length=444

 Score =   432 bits (1110),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 236/427 (55%), Positives = 299/427 (70%), Gaps = 18/427 (4%)
 Frame = -3

Query  1578  HIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTGRHL  1399
             ++ ++D+  ++R   A   A++AY P+P+N++ S    V R +S +  E        +H 
Sbjct  32    NVGQFDDHLQKRKELAEASAREAYRPDPYNVTNSFNAAVHRAVSSSRRE--MWERPRKH-  88

Query  1398  LGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD  1219
                 K RGPC ATNPID+CWRC  DWA++R+RLA CA GFG+ T GG  GK Y VTD +D
Sbjct  89    ----KKRGPCRATNPIDKCWRCRRDWATDRQRLARCARGFGHATTGGLGGKIYVVTDPTD  144

Query  1218  -DQSNPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGI  1042
              D  NP+PGTLR  VIQ  PLWIIFA  M I+L QEL+M  DKTIDGRGAQVHI++GAGI
Sbjct  145   LDVVNPRPGTLRWGVIQPGPLWIIFARSMIIQLSQELLMSSDKTIDGRGAQVHIANGAGI  204

Query  1041  TIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMR  862
             T+Q  +NVIIH +H+H +    GGL+RD   H G RT++DGDGIS+F ++NVWIDH+SM 
Sbjct  205   TVQLAQNVIIHNLHVHDVKHTMGGLMRDSPTHIGSRTRADGDGISLFSATNVWIDHISMS  264

Query  861   NCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQR  682
             NC DGLID +++ST ITISN HFT+HNDVMLFGA+D   +D+IMQIT+AFNHFG+ L+QR
Sbjct  265   NCEDGLIDVVQSSTGITISNCHFTNHNDVMLFGASDSWPQDQIMQITVAFNHFGRGLVQR  324

Query  681   MPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEE  502
             MPRCR+G+ HVVNNDYTHW MYAIGG   PTII QGNR+IAPP+I  K ITK      EE
Sbjct  325   MPRCRWGFFHVVNNDYTHWLMYAIGGGDAPTIISQGNRYIAPPNIAAKVITKHYA---EE  381

Query  501   --WKTWTWRSQGDIYMEGAFFVQSGD-PNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALN  331
               WK W W ++ D++M GA F  SG  P  +D +  +     T+    VT LTRF+G L+
Sbjct  382   GVWKNWVWHTEDDLFMNGAIFNPSGGAPKQVDTNEWVKPKPGTY----VTRLTRFSGTLS  437

Query  330   CRVGSPC  310
             C  G PC
Sbjct  438   CCTGKPC  444



>ref|XP_002437815.1| hypothetical protein SORBIDRAFT_10g003090 [Sorghum bicolor]
 gb|EER89182.1| hypothetical protein SORBIDRAFT_10g003090 [Sorghum bicolor]
Length=444

 Score =   431 bits (1109),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 237/420 (56%), Positives = 293/420 (70%), Gaps = 20/420 (5%)
 Frame = -3

Query  1563  DEV-WRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTTGRHLLGSK  1387
             DEV W  RA  A    + AY  +P       +  + R        D+   TT R L    
Sbjct  43    DEVYWAERAEAARSRNRAAYVSDP-------VAAMNR-----FNADVLRATTRRAL---A  87

Query  1386  KYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSDDQS-  1210
             +Y GPC ATNPIDRCWRC +DWA++RKRLA CA GFG++T GG +GK Y VTD SDD+  
Sbjct  88    RYSGPCMATNPIDRCWRCRSDWAADRKRLARCARGFGHRTTGGAAGKLYVVTDPSDDEMI  147

Query  1209  NPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQF  1030
              P+ GTLRHAVIQ +PLWI+FA DM I+L QELI+  DKTIDGRGAQVH+  GA +T+Q 
Sbjct  148   VPRKGTLRHAVIQDRPLWIVFARDMVIRLRQELIVTSDKTIDGRGAQVHVV-GAQVTLQS  206

Query  1029  VKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYD  850
             V +VI+H +HIH     +GG+IRD   H G+RT+SDGDGIS+  SSNVWIDHVSM  C D
Sbjct  207   VHDVILHNLHIHDAVAHSGGMIRDSKRHTGMRTRSDGDGISVLSSSNVWIDHVSMSRCAD  266

Query  849   GLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRC  670
             GLID +  STAIT+SN HFT H+ VMLFGA++ + +D++MQIT+AFNHFG+ L+QRMPRC
Sbjct  267   GLIDVVNGSTAITVSNSHFTHHDHVMLFGASNDNPQDEVMQITVAFNHFGRGLVQRMPRC  326

Query  669   RYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEEWKTW  490
             RYG+ HVVNNDYTHW MYAIGG+ +PTII QGNRFIAP D + KE+TKR     +++K W
Sbjct  327   RYGFFHVVNNDYTHWIMYAIGGNKNPTIISQGNRFIAPDDPNAKEVTKREYTAYKDYKEW  386

Query  489   TWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              W+SQGD+ M GAFF +SG  N  ++ +   D +       V  LTRFAG L C VG PC
Sbjct  387   VWKSQGDVMMNGAFFNESGGQN--ERKYDELDFIPAKHGRYVGQLTRFAGPLKCIVGQPC  444



>ref|XP_002436463.1| hypothetical protein SORBIDRAFT_10g003080 [Sorghum bicolor]
 gb|EER87830.1| hypothetical protein SORBIDRAFT_10g003080 [Sorghum bicolor]
Length=465

 Score =   432 bits (1111),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 235/430 (55%), Positives = 294/430 (68%), Gaps = 11/430 (3%)
 Frame = -3

Query  1590  ATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLTTNTT  1411
             A + ++    E W  RA  A  + + AYE +P  +       VRR +     E  T   +
Sbjct  44    AQLVNVTANQEYWAERAEVAHAYNRAAYESDPVGVMDRFNDGVRRAM-----ETSTPTRS  98

Query  1410  GRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVT  1231
                 L  K   GPC ATNPID+CWRC  DWA NRKRLA C MGFG++T GG +G+ Y VT
Sbjct  99    RSRSLAHKARGGPCTATNPIDQCWRCRGDWARNRKRLARCGMGFGHRTTGGLAGRIYVVT  158

Query  1230  DKSDDQSN---PKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHI  1060
             D SD+ +N   P+ GTLR+AVIQ +PLWI FA DM I L +EL++  DKTIDGRGAQVH+
Sbjct  159   DPSDEPANLVVPRKGTLRYAVIQDRPLWITFARDMVINLCRELLVTSDKTIDGRGAQVHV  218

Query  1059  SDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWI  880
               GA IT+Q V+NVI+H +HIH      GG+IRD   H+GLR +SDGDG+S+ GSS++WI
Sbjct  219   V-GAQITLQNVRNVILHNLHIHDAAPRGGGVIRDSKHHWGLRGESDGDGVSVMGSSDIWI  277

Query  879   DHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFG  700
             DHVSMR+C DGL+D ++ STA+TISNGHFT H+ VMLFGA+D + KDK MQ+T+AFNHFG
Sbjct  278   DHVSMRSCADGLVDVVDGSTAVTISNGHFTRHDHVMLFGASDAAVKDKAMQVTVAFNHFG  337

Query  699   KRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRV  520
             K L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS +PTII QGNRF A  D   KE+TKR 
Sbjct  338   KGLVQRMPRCRHGFFHVVNNDYTHWLMYAIGGSQNPTIISQGNRFRAVDDGRFKEVTKRE  397

Query  519   KGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAG  340
                  E+K W W+SQ D+++ GAFF QSG  N  ++     D +     +    LTR+AG
Sbjct  398   YTPYSEYKDWVWKSQDDLFLNGAFFNQSGGEN--ERRFDRLDLIQAKGGQYAELLTRYAG  455

Query  339   ALNCRVGSPC  310
             ALNCRVG  C
Sbjct  456   ALNCRVGKKC  465



>dbj|BAH20311.1| AT3G01270 [Arabidopsis thaliana]
Length=365

 Score =   428 bits (1100),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 219/361 (61%), Positives = 275/361 (76%), Gaps = 3/361 (1%)
 Frame = -3

Query  1386  KYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTD-KSDDQS  1210
             K  GPC A+NPID+CWRC  DWA  RK+L  C  GFGY+T GGK G+ Y VT  + DD  
Sbjct  6     KLTGPCTASNPIDKCWRCQPDWARRRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDMV  65

Query  1209  NPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQF  1030
             NP+PGTLRHAVIQK+PLWI+F HDM+I+L QEL++  DKTID RGA VHI+ GAGIT+Q+
Sbjct  66    NPRPGTLRHAVIQKEPLWIVFKHDMSIRLSQELMITSDKTIDARGANVHIAYGAGITMQY  125

Query  1029  VKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYD  850
             V N+IIHG+H+HHI + +GGLIRD ++HFG R ++DGDGISIFG++N+W+DH+SM  C D
Sbjct  126   VHNIIIHGLHVHHIVKSSGGLIRDSINHFGHRGEADGDGISIFGATNIWLDHISMSKCQD  185

Query  849   GLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRC  670
             GLIDAI  STAITISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK L+QRMPR 
Sbjct  186   GLIDAIMGSTAITISNSHFTHHNDVMLLGAQNNNMDDKKMQVTVAYNHFGKGLVQRMPRV  245

Query  669   RYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKT  493
             R+G++HVVNNDYTHW +YAIGGS  PTI+  GNRFIAPP   H +E+TKR   +  EWK 
Sbjct  246   RWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYASESEWKN  305

Query  492   WTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSP  313
             W WRS+ D++M  A+F QSG+P+F   H +    +       V+ LT++AGAL+CRVG  
Sbjct  306   WNWRSEKDVFMNNAYFRQSGNPHFKCSHSR-QQMIKPKNGMAVSKLTKYAGALDCRVGKA  364

Query  312   C  310
             C
Sbjct  365   C  365



>ref|XP_011071024.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=441

 Score =   431 bits (1107),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 240/433 (55%), Positives = 297/433 (69%), Gaps = 14/433 (3%)
 Frame = -3

Query  1602  AIIPATVGHIAEYDEVWRRRAAEAWKHAQQAYEPNPHNISASLIHQVRRTLSEAVAEDLT  1423
             A +P     IA +DE  ++RAAE+++ + Q Y PNP +++      V +TL       + 
Sbjct  21    ATLPKACAKIATFDEDLQKRAAESYQESLQEYNPNPQDLTDEFNELVGKTL-------MN  73

Query  1422  TNTTGRHLLGSKKYRGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKF  1243
              N T R+L         C ATNPIDRCWRC  DWA +RKRLADC  GFG+ T GGK+G++
Sbjct  74    ENVTRRNL-----GEDDCKATNPIDRCWRCDRDWAKHRKRLADCVRGFGHLTTGGKAGRY  128

Query  1242  YTVTDKSDDQS-NPKPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQV  1066
             Y V D SDD   +PKPGTLRHA++Q +PLWIIF H M IKL  ELIM  DKTIDGRG  V
Sbjct  129   YLVDDPSDDDMDHPKPGTLRHAILQTEPLWIIFKHSMVIKLKNELIMTSDKTIDGRGVLV  188

Query  1065  HISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNV  886
             HI+ GAGITIQFV N+IIH I IH+I   +GG+IRD L H GLRTKSDGD I+I+ S+ +
Sbjct  189   HIAYGAGITIQFVHNIIIHNIWIHNIVPTSGGMIRDTLSHIGLRTKSDGDAINIYSSNRI  248

Query  885   WIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNH  706
             WIDHVS+   YDGLID IE STAITISN  F  HNDVML GA+D  + D IMQ+T+AFN 
Sbjct  249   WIDHVSLSKGYDGLIDVIEGSTAITISNCKFNHHNDVMLLGAHDSHSIDAIMQVTVAFNR  308

Query  705   FGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITK  526
             FGK LIQRMPR R+G+ HVVNNDY+HW +YAIGGS+HPTII QGNRF A    + KE+TK
Sbjct  309   FGKGLIQRMPRVRWGFAHVVNNDYSHWELYAIGGSAHPTIISQGNRFRASNYRYTKEVTK  368

Query  525   RVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED-VTWLTR  349
             R   T ++W  W WRS+GD++  GAFF +SG P    K   +   ++ ++    V  LT+
Sbjct  369   RDYATKDQWMKWQWRSEGDLFKNGAFFTESGQPLEHSKSPLVGMNLIRYRPGSFVGTLTK  428

Query  348   FAGALNCRVGSPC  310
             +AGAL CR G  C
Sbjct  429   YAGALKCRKGKLC  441



>ref|XP_010420165.1| PREDICTED: probable pectate lyase 19 isoform X3 [Camelina sativa]
Length=506

 Score =   433 bits (1113),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 222/359 (62%), Positives = 276/359 (77%), Gaps = 3/359 (1%)
 Frame = -3

Query  1380  RGPCNATNPIDRCWRCHADWASNRKRLADCAMGFGYKTKGGKSGKFYTVTDKSD-DQSNP  1204
             +GPC A+NPID+CWRC  +WA  RK+L  C  GFG++T GGK G+ Y VT   D D  NP
Sbjct  149   KGPCTASNPIDKCWRCRTNWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNP  208

Query  1203  KPGTLRHAVIQKKPLWIIFAHDMNIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVK  1024
             KPGTLRHAVIQK+PLWIIF +DM+I+L QEL++   KTID RGA VHI+ GAGIT+QFVK
Sbjct  209   KPGTLRHAVIQKEPLWIIFKNDMSIRLSQELLINSHKTIDARGANVHIAHGAGITMQFVK  268

Query  1023  NViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGL  844
             NVIIHG+HIHHI E +GG+IRD +DHFG+RT++DGDG+SI+GSSN+W+DH+SM  C DGL
Sbjct  269   NVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISMSKCQDGL  328

Query  843   IDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRY  664
             IDAI  ST ITISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK L+QRMPR R+
Sbjct  329   IDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQRMPRIRW  388

Query  663   GYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWT  487
             G++HVVNNDYTHW +YAIGGS  PTI+  GNRFIAPP   H +E+TKR     +EWK W 
Sbjct  389   GFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYAPEDEWKHWI  448

Query  486   WRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             WRS+ D++M GA+F QSG+P+F   H +    +       V+ LT++AGAL+CRVG  C
Sbjct  449   WRSEKDVFMNGAYFRQSGNPHFKCAHTR-KQMIKPKNGMAVSKLTKYAGALDCRVGKRC  506



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5250800251364