BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25646_g3_i3 len=948 path=[4574:0-178 4753:179-179 4754:180-227
4802:228-262 22435:263-275 4077:276-357 1549:358-517 21820:518-536
985:537-555 1004:556-604 1053:605-611 1060:612-947]

Length=948
                                                                      Score     E

ref|XP_010317101.1|  PREDICTED: probable pectate lyase P59              357   1e-117   
ref|XP_009599825.1|  PREDICTED: probable pectate lyase P59 isofor...    355   2e-116   
ref|XP_006357122.1|  PREDICTED: probable pectate lyase P59-like         355   2e-116   
ref|XP_009599826.1|  PREDICTED: probable pectate lyase P59 isofor...    355   3e-116   
ref|XP_009779191.1|  PREDICTED: probable pectate lyase P59              355   3e-116   
ref|XP_006361835.1|  PREDICTED: probable pectate lyase P59-like         355   4e-116   
ref|XP_009789921.1|  PREDICTED: probable pectate lyase P59              354   4e-116   
emb|CDP02198.1|  unnamed protein product                                354   1e-115   
ref|XP_009587689.1|  PREDICTED: probable pectate lyase P59              353   1e-115   
ref|XP_004234779.1|  PREDICTED: probable pectate lyase P59              352   3e-115   
sp|P15722.1|PLY59_SOLLC  RecName: Full=Probable pectate lyase P59...    348   1e-113   Solanum lycopersicum
ref|XP_009802165.1|  PREDICTED: probable pectate lyase P59              343   2e-111   
ref|XP_009617495.1|  PREDICTED: probable pectate lyase P59              340   3e-110   
ref|XP_006338480.1|  PREDICTED: probable pectate lyase P59-like         337   2e-109   
ref|XP_004232242.1|  PREDICTED: probable pectate lyase P59              334   3e-108   
gb|EPS66620.1|  hypothetical protein M569_08154                         325   1e-104   
gb|EYU34111.1|  hypothetical protein MIMGU_mgv1a006386mg                324   3e-104   
gb|EYU36839.1|  hypothetical protein MIMGU_mgv1a006379mg                323   8e-104   
ref|XP_011098575.1|  PREDICTED: probable pectate lyase P59              319   2e-102   
ref|XP_007153840.1|  hypothetical protein PHAVU_003G069100g             304   2e-96    
ref|XP_010678579.1|  PREDICTED: pectate lyase-like                      303   5e-96    
ref|XP_010033216.1|  PREDICTED: pectate lyase-like                      302   6e-96    
ref|XP_008341537.1|  PREDICTED: pectate lyase-like                      300   9e-95    
ref|XP_004302354.1|  PREDICTED: probable pectate lyase P59-like         300   1e-94    
ref|XP_009360393.1|  PREDICTED: probable pectate lyase 3                299   2e-94    
gb|KHN01171.1|  Putative pectate lyase 3                                298   3e-94    
ref|XP_009342871.1|  PREDICTED: pectate lyase-like                      298   4e-94    
ref|XP_010112093.1|  putative pectate lyase 7                           298   4e-94    
ref|XP_008239834.1|  PREDICTED: pectate lyase-like                      297   5e-94    
ref|XP_006573090.1|  PREDICTED: probable pectate lyase 3-like           298   6e-94    
ref|XP_008365507.1|  PREDICTED: pectate lyase-like                      296   6e-94    
ref|XP_008357758.1|  PREDICTED: pectate lyase-like                      298   8e-94    
emb|CAN79927.1|  hypothetical protein VITISV_042447                     296   1e-93    Vitis vinifera
ref|XP_002282500.3|  PREDICTED: pectate lyase                           296   1e-93    Vitis vinifera
ref|XP_007209148.1|  hypothetical protein PRUPE_ppa005859mg             296   1e-93    
ref|XP_008339935.1|  PREDICTED: probable pectate lyase 3                296   2e-93    
emb|CBI22159.3|  unnamed protein product                                296   2e-93    
ref|XP_007037229.1|  Pectate lyase family protein                       295   3e-93    
ref|XP_010256490.1|  PREDICTED: pectate lyase-like                      295   5e-93    
ref|XP_004147462.1|  PREDICTED: probable pectate lyase 7-like           295   6e-93    
ref|XP_010068708.1|  PREDICTED: pectate lyase-like                      295   7e-93    
gb|KGN59593.1|  hypothetical protein Csa_3G827350                       295   7e-93    
ref|XP_007046218.1|  Pectate lyase family protein, putative             295   8e-93    
ref|XP_002270089.1|  PREDICTED: pectate lyase                           294   9e-93    Vitis vinifera
ref|XP_008446067.1|  PREDICTED: pectate lyase-like                      292   1e-92    
ref|XP_009403112.1|  PREDICTED: pectate lyase-like                      294   1e-92    
ref|XP_009389712.1|  PREDICTED: pectate lyase-like                      294   1e-92    
ref|XP_007227702.1|  hypothetical protein PRUPE_ppa005744mg             294   2e-92    
ref|XP_008443432.1|  PREDICTED: probable pectate lyase 19               294   2e-92    
emb|CAN77957.1|  hypothetical protein VITISV_021245                     292   2e-92    Vitis vinifera
ref|XP_007224275.1|  hypothetical protein PRUPE_ppa019055mg             293   2e-92    
gb|KCW52797.1|  hypothetical protein EUGRSUZ_J02132                     293   3e-92    
ref|XP_002272638.2|  PREDICTED: pectate lyase-like                      293   3e-92    Vitis vinifera
ref|XP_008221660.1|  PREDICTED: probable pectate lyase 3                293   4e-92    
ref|XP_003613595.1|  Pectate lyase                                      293   4e-92    
ref|XP_004155392.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    292   5e-92    
ref|XP_004135462.1|  PREDICTED: probable pectate lyase P59-like         292   5e-92    
ref|XP_004490004.1|  PREDICTED: probable pectate lyase 3-like iso...    290   7e-92    
ref|XP_008221658.1|  PREDICTED: pectate lyase-like                      292   7e-92    
ref|XP_009408830.1|  PREDICTED: pectate lyase-like                      291   1e-91    
ref|XP_008366366.1|  PREDICTED: pectate lyase-like                      292   1e-91    
ref|XP_009761969.1|  PREDICTED: probable pectate lyase P59              291   1e-91    
ref|XP_010066949.1|  PREDICTED: pectate lyase                           291   2e-91    
ref|XP_008339934.1|  PREDICTED: probable pectate lyase 3                291   2e-91    
ref|XP_004490003.1|  PREDICTED: probable pectate lyase 3-like iso...    291   2e-91    
ref|XP_008793504.1|  PREDICTED: pectate lyase-like                      291   2e-91    
ref|XP_008446316.1|  PREDICTED: probable pectate lyase P59              290   3e-91    
ref|XP_010528323.1|  PREDICTED: probable pectate lyase 19               291   4e-91    
ref|XP_004165454.1|  PREDICTED: pectate lyase-like                      290   4e-91    
gb|KHN13490.1|  Putative pectate lyase 3                                287   6e-91    
gb|KHN13240.1|  Putative pectate lyase 3                                290   7e-91    
ref|XP_002520133.1|  Pectate lyase precursor, putative                  289   8e-91    Ricinus communis
ref|XP_008389523.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    290   8e-91    
ref|XP_002311599.2|  pectate lyase family protein                       289   1e-90    Populus trichocarpa [western balsam poplar]
ref|XP_011025954.1|  PREDICTED: probable pectate lyase P59              289   1e-90    
ref|XP_007157384.1|  hypothetical protein PHAVU_002G065800g             289   1e-90    
ref|XP_003530685.1|  PREDICTED: probable pectate lyase 3-like           289   2e-90    
ref|XP_010915114.1|  PREDICTED: LOW QUALITY PROTEIN: pectate lyas...    288   2e-90    
gb|KHN08706.1|  Putative pectate lyase 3                                288   2e-90    
ref|XP_009369346.1|  PREDICTED: pectate lyase-like                      288   2e-90    
ref|XP_003519771.2|  PREDICTED: probable pectate lyase 3-like           288   3e-90    
ref|XP_010925369.1|  PREDICTED: pectate lyase                           288   3e-90    
ref|XP_009121613.1|  PREDICTED: probable pectate lyase 19               290   4e-90    
ref|XP_003543726.1|  PREDICTED: pectate lyase                           288   4e-90    
gb|ACU23277.1|  unknown                                                 288   4e-90    Glycine max [soybeans]
ref|XP_009615547.1|  PREDICTED: probable pectate lyase P59              287   5e-90    
ref|XP_008374522.1|  PREDICTED: pectate lyase-like                      287   6e-90    
emb|CDY66593.1|  BnaCnng51570D                                          289   6e-90    
gb|KEH19822.1|  pectate lyase-like protein                              287   7e-90    
ref|XP_007032453.1|  Pectate lyase family protein                       287   8e-90    
ref|XP_008786760.1|  PREDICTED: pectate lyase-like                      287   1e-89    
ref|XP_009381244.1|  PREDICTED: pectate lyase-like                      285   2e-89    
gb|KEH24975.1|  pectate lyase P59-like protein                          286   2e-89    
gb|AAB69766.1|  putative pectate lyase Nt59                             276   3e-89    Nicotiana tabacum [American tobacco]
ref|XP_010242445.1|  PREDICTED: pectate lyase                           285   5e-89    
ref|XP_009131435.1|  PREDICTED: probable pectate lyase 19               286   5e-89    
ref|XP_010492335.1|  PREDICTED: probable pectate lyase 19               286   5e-89    
emb|CDP14850.1|  unnamed protein product                                285   5e-89    
gb|EYU24412.1|  hypothetical protein MIMGU_mgv1a011674mg                278   8e-89    
ref|XP_004514773.1|  PREDICTED: probable pectate lyase 3-like           284   1e-88    
ref|XP_009598230.1|  PREDICTED: pectate lyase-like                      283   1e-88    
ref|XP_006286712.1|  hypothetical protein CARUB_v10002862mg             286   1e-88    
ref|XP_002323835.1|  hypothetical protein POPTR_0017s11450g             284   1e-88    Populus trichocarpa [western balsam poplar]
ref|XP_007215366.1|  hypothetical protein PRUPE_ppa005602mg             283   2e-88    
ref|XP_009788285.1|  PREDICTED: pectate lyase-like                      283   2e-88    
emb|CDX70590.1|  BnaC03g06740D                                          284   2e-88    
ref|XP_003554335.1|  PREDICTED: pectate lyase-like                      283   2e-88    
ref|XP_010550068.1|  PREDICTED: probable pectate lyase 19               284   3e-88    
ref|XP_008456459.1|  PREDICTED: pectate lyase-like                      283   3e-88    
ref|XP_010105747.1|  putative pectate lyase P59                         282   4e-88    
ref|XP_007137422.1|  hypothetical protein PHAVU_009G125800g             282   5e-88    
ref|XP_006842121.1|  hypothetical protein AMTR_s00078p00106380          282   5e-88    
ref|XP_003621115.1|  Pectate lyase                                      282   5e-88    
ref|XP_002871648.1|  pectate lyase family protein                       283   6e-88    
gb|AAA86241.1|  pectate lyase homolog                                   282   7e-88    Medicago sativa [alfalfa]
ref|XP_011005067.1|  PREDICTED: probable pectate lyase P59              282   8e-88    
ref|XP_010420163.1|  PREDICTED: probable pectate lyase 19 isoform X1    283   9e-88    
ref|XP_010420164.1|  PREDICTED: probable pectate lyase 19 isoform X2    282   9e-88    
ref|XP_004489374.1|  PREDICTED: pectate lyase-like                      281   1e-87    
ref|XP_010420165.1|  PREDICTED: probable pectate lyase 19 isoform X3    283   1e-87    
ref|XP_006374492.1|  hypothetical protein POPTR_0015s07590g             281   1e-87    
ref|XP_008230729.1|  PREDICTED: pectate lyase                           281   1e-87    
ref|XP_010453638.1|  PREDICTED: probable pectate lyase 19               283   1e-87    
ref|XP_007139601.1|  hypothetical protein PHAVU_008G043600g             280   2e-87    
ref|XP_011013803.1|  PREDICTED: pectate lyase-like                      280   2e-87    
ref|XP_004162547.1|  PREDICTED: probable pectate lyase P59-like         280   3e-87    
ref|XP_004146792.1|  PREDICTED: probable pectate lyase P59-like         280   3e-87    
sp|Q9LFP5.1|PLY19_ARATH  RecName: Full=Probable pectate lyase 19;...    281   3e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011009454.1|  PREDICTED: pectate lyase-like                      281   4e-87    
ref|XP_010551866.1|  PREDICTED: probable pectate lyase 19               281   5e-87    
ref|XP_010476496.1|  PREDICTED: probable pectate lyase 3                280   5e-87    
ref|XP_009117903.1|  PREDICTED: probable pectate lyase 3                279   8e-87    
ref|XP_006344502.1|  PREDICTED: probable pectate lyase P59-like         279   8e-87    
ref|NP_197015.4|  putative pectate lyase 19                             280   8e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011085780.1|  PREDICTED: probable pectate lyase P59              279   9e-87    
gb|KHG16093.1|  hypothetical protein F383_07683                         279   9e-87    
ref|XP_002892805.1|  hypothetical protein ARALYDRAFT_471616             280   9e-87    
ref|XP_010496063.1|  PREDICTED: probable pectate lyase 3                279   9e-87    
gb|ABK28696.1|  unknown                                                 280   1e-86    Arabidopsis thaliana [mouse-ear cress]
gb|KFK25747.1|  hypothetical protein AALP_AA8G154300                    281   1e-86    
ref|XP_002306040.1|  hypothetical protein POPTR_0004s12300g             278   1e-86    Populus trichocarpa [western balsam poplar]
ref|XP_007151201.1|  hypothetical protein PHAVU_004G026400g             278   1e-86    
ref|XP_004236194.1|  PREDICTED: probable pectate lyase P59              278   1e-86    
gb|KDP45476.1|  hypothetical protein JCGZ_09725                         278   3e-86    
gb|KHG08055.1|  putative pectate lyase P59                              278   3e-86    
ref|XP_003552513.1|  PREDICTED: pectate lyase-like                      277   3e-86    
ref|XP_004489168.1|  PREDICTED: pectate lyase-like                      278   3e-86    
ref|XP_006306515.1|  hypothetical protein CARUB_v10012514mg             278   4e-86    
ref|XP_003613596.1|  Pectate lyase                                      277   4e-86    
emb|CDX74293.1|  BnaA03g27540D                                          278   5e-86    
emb|CDX91953.1|  BnaC03g32550D                                          278   5e-86    
gb|KHN13652.1|  Pectate lyase                                           277   6e-86    
emb|CDX85564.1|  BnaA02g02490D                                          278   6e-86    
gb|AAQ62997.1|  oil palm polygalacturonase allergen PEST411             276   1e-85    Elaeis guineensis
ref|XP_009126031.1|  PREDICTED: probable pectate lyase 19               277   1e-85    
ref|XP_006354795.1|  PREDICTED: pectate lyase-like                      276   1e-85    
sp|P40973.1|PLY_LILLO  RecName: Full=Pectate lyase; Flags: Precursor    275   1e-85    Lilium longiflorum [Easter lily]
gb|KFK43687.1|  hypothetical protein AALP_AA1G160000                    276   2e-85    
gb|AAQ62996.1|  oil palm polygalacturonase allergen PEST361             275   2e-85    Elaeis guineensis
ref|NP_001057945.1|  Os06g0583900                                       275   2e-85    Oryza sativa Japonica Group [Japonica rice]
gb|KHN08855.1|  Putative pectate lyase P59                              275   2e-85    
gb|EAY99626.1|  hypothetical protein OsI_21605                          275   3e-85    Oryza sativa Indica Group [Indian rice]
gb|KHG05193.1|  hypothetical protein F383_30875                         273   3e-85    
ref|XP_006655782.1|  PREDICTED: pectate lyase-like                      272   3e-85    
ref|XP_011085777.1|  PREDICTED: probable pectate lyase P59              275   4e-85    
ref|XP_004301165.1|  PREDICTED: probable pectate lyase P59-like         275   5e-85    
emb|CAN69904.1|  hypothetical protein VITISV_001006                     274   5e-85    Vitis vinifera
ref|XP_002270112.1|  PREDICTED: pectate lyase                           274   6e-85    Vitis vinifera
ref|XP_009125036.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    275   6e-85    
emb|CDY53552.1|  BnaA09g57110D                                          276   7e-85    
gb|AAB69759.1|  putative pectate lyase                                  274   9e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009134622.1|  PREDICTED: probable pectate lyase 7                275   1e-84    
ref|NP_172894.1|  putative pectate lyase 3                              274   1e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004152537.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    273   1e-84    
emb|CDY28691.1|  BnaCnng05770D                                          274   1e-84    
ref|XP_011087217.1|  PREDICTED: pectate lyase-like                      273   1e-84    
ref|XP_009110541.1|  PREDICTED: probable pectate lyase 3                273   2e-84    
ref|XP_003563707.1|  PREDICTED: pectate lyase-like                      273   2e-84    
emb|CDX96854.1|  BnaA08g23970D                                          273   2e-84    
emb|CDX81636.1|  BnaC08g39650D                                          274   3e-84    
ref|XP_004298448.1|  PREDICTED: probable pectate lyase 3-like           272   3e-84    
dbj|BAH20311.1|  AT3G01270                                              270   4e-84    Arabidopsis thaliana [mouse-ear cress]
emb|CDY68729.1|  BnaCnng60280D                                          273   4e-84    
gb|AES91206.2|  pectate lyase P59-like protein                          272   4e-84    
ref|XP_006656188.1|  PREDICTED: pectate lyase-like                      272   5e-84    
ref|XP_010463548.1|  PREDICTED: probable pectate lyase 7                273   5e-84    
ref|XP_007138209.1|  hypothetical protein PHAVU_009G189800g             271   5e-84    
emb|CDP02199.1|  unnamed protein product                                269   6e-84    
ref|XP_010523445.1|  PREDICTED: probable pectate lyase 3                272   7e-84    
ref|XP_010513594.1|  PREDICTED: probable pectate lyase 7                272   8e-84    
ref|XP_010527872.1|  PREDICTED: probable pectate lyase 3 isoform X2     271   1e-83    
gb|KHG08946.1|  Pectate lyase                                           270   1e-83    
gb|KHG07401.1|  putative pectate lyase P59                              271   1e-83    
ref|XP_009114192.1|  PREDICTED: probable pectate lyase 6                271   1e-83    
emb|CDY04133.1|  BnaA09g19110D                                          271   2e-83    
gb|AAM60924.1|  putative pectate lyase                                  271   2e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882189.1|  pectate lyase family protein                       271   2e-83    
ref|NP_186776.1|  putative pectate lyase 7                              271   3e-83    Arabidopsis thaliana [mouse-ear cress]
emb|CDY63769.1|  BnaCnng42620D                                          271   3e-83    
ref|XP_010485518.1|  PREDICTED: probable pectate lyase 7                270   4e-83    
gb|KHG23093.1|  hypothetical protein F383_29772                         267   5e-83    
gb|KFK37588.1|  hypothetical protein AALP_AA3G002600                    270   8e-83    
ref|XP_009380431.1|  PREDICTED: pectate lyase-like                      268   9e-83    
emb|CDY39314.1|  BnaC05g10650D                                          269   1e-82    
gb|EAY99621.1|  hypothetical protein OsI_21600                          268   1e-82    Oryza sativa Indica Group [Indian rice]
ref|XP_009148818.1|  PREDICTED: probable pectate lyase 3                269   1e-82    
ref|NP_001056784.1|  Os06g0144900                                       268   1e-82    Oryza sativa Japonica Group [Japonica rice]
emb|CDY45254.1|  BnaA06g09240D                                          268   1e-82    
gb|EPS62426.1|  hypothetical protein M569_12361                         267   2e-82    
gb|KFK33456.1|  hypothetical protein AALP_AA5G015800                    268   2e-82    
gb|AAA16476.1|  pectate lyase homolog                                   267   2e-82    Zea mays [maize]
emb|CDY17432.1|  BnaC09g21050D                                          268   2e-82    
ref|XP_006826355.1|  hypothetical protein AMTR_s00004p00123190          268   3e-82    
ref|XP_004964534.1|  PREDICTED: pectate lyase-like                      267   4e-82    
gb|AGT16685.1|  pectate lyase precursor                                 263   4e-82    
emb|CDY09356.1|  BnaA02g26540D                                          267   5e-82    
gb|EMS65801.1|  hypothetical protein TRIUR3_32637                       261   5e-82    
ref|XP_009129128.1|  PREDICTED: probable pectate lyase 6                267   6e-82    
dbj|BAK05605.1|  predicted protein                                      266   6e-82    
ref|XP_010670318.1|  PREDICTED: pectate lyase-like                      266   6e-82    
ref|NP_001056786.1|  Os06g0145100                                       263   6e-82    Oryza sativa Japonica Group [Japonica rice]
gb|EEE56553.1|  hypothetical protein OsJ_05879                          265   6e-82    Oryza sativa Japonica Group [Japonica rice]
gb|EAY85003.1|  hypothetical protein OsI_06363                          266   1e-81    Oryza sativa Indica Group [Indian rice]
emb|CDP00293.1|  unnamed protein product                                266   1e-81    
ref|XP_010527871.1|  PREDICTED: probable pectate lyase 3 isoform X1     273   1e-81    
ref|NP_001046281.1|  Os02g0214400                                       266   1e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006299938.1|  hypothetical protein CARUB_v10016149mg             266   2e-81    
ref|XP_004508770.1|  PREDICTED: probable pectate lyase P59-like         265   2e-81    
ref|XP_002437815.1|  hypothetical protein SORBIDRAFT_10g003090          265   2e-81    Sorghum bicolor [broomcorn]
emb|CDY41679.1|  BnaC02g34750D                                          265   2e-81    
ref|XP_002511525.1|  Pectate lyase precursor, putative                  265   3e-81    Ricinus communis
ref|XP_011098576.1|  PREDICTED: probable pectate lyase P56              265   3e-81    
ref|XP_010425041.1|  PREDICTED: probable pectate lyase 6                265   3e-81    
dbj|BAD68402.1|  putative pectate lyase homolog                         264   4e-81    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056781.1|  Os06g0144200                                       265   4e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010514040.1|  PREDICTED: probable pectate lyase 6                265   4e-81    
ref|XP_006363934.1|  PREDICTED: pectate lyase-like                      264   6e-81    
ref|XP_011087066.1|  PREDICTED: pectate lyase                           263   9e-81    
ref|XP_010502279.1|  PREDICTED: probable pectate lyase 6                264   1e-80    
ref|XP_003609009.1|  Pectate lyase                                      263   1e-80    
ref|XP_006477525.1|  PREDICTED: pectate lyase-like                      262   2e-80    
ref|XP_010683249.1|  PREDICTED: pectate lyase-like                      262   3e-80    
dbj|BAJ99909.1|  predicted protein                                      258   3e-80    
ref|XP_002436463.1|  hypothetical protein SORBIDRAFT_10g003080          262   5e-80    Sorghum bicolor [broomcorn]
ref|XP_006439649.1|  hypothetical protein CICLE_v10020193mg             261   6e-80    
dbj|BAK06965.1|  predicted protein                                      261   7e-80    
ref|XP_004228388.1|  PREDICTED: pectate lyase                           261   8e-80    
emb|CBI15265.3|  unnamed protein product                                259   9e-80    
gb|KDO76053.1|  hypothetical protein CISIN_1g013757mg                   260   1e-79    
ref|XP_006292606.1|  hypothetical protein CARUB_v10018855mg             261   1e-79    
gb|AGT16687.1|  pectate lyase                                           260   2e-79    
ref|XP_009789922.1|  PREDICTED: pectate lyase-like                      258   3e-79    
ref|XP_004966014.1|  PREDICTED: pectate lyase-like                      261   3e-79    
ref|XP_009587688.1|  PREDICTED: pectate lyase-like                      258   3e-79    
ref|XP_009797403.1|  PREDICTED: pectate lyase-like                      259   5e-79    
ref|NP_178375.1|  putative pectate lyase 6                              259   6e-79    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001150425.1|  LOC100284055 precursor                             259   6e-79    Zea mays [maize]
ref|XP_002453531.1|  hypothetical protein SORBIDRAFT_04g007450          258   8e-79    Sorghum bicolor [broomcorn]
ref|XP_006579282.1|  PREDICTED: probable pectate lyase P59-like         257   1e-78    
ref|XP_009758350.1|  PREDICTED: pectate lyase-like                      257   3e-78    
ref|XP_009599232.1|  PREDICTED: pectate lyase-like                      257   3e-78    
gb|ACF87417.1|  unknown                                                 256   4e-78    Zea mays [maize]
ref|XP_008679844.1|  PREDICTED: pectate lyase                           256   4e-78    
ref|XP_002437204.1|  hypothetical protein SORBIDRAFT_10g022830          256   5e-78    Sorghum bicolor [broomcorn]
gb|AFW87059.1|  pectate lyase                                           256   5e-78    
ref|NP_001150723.1|  pectate lyase precursor                            256   5e-78    Zea mays [maize]
dbj|BAC42832.1|  putative pectate lyase                                 250   1e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006357121.1|  PREDICTED: pectate lyase-like                      253   2e-77    
ref|XP_002875142.1|  pectate lyase family protein                       255   3e-77    
emb|CDY03043.1|  BnaC07g21840D                                          254   3e-77    
ref|XP_011086389.1|  PREDICTED: pectate lyase-like                      254   4e-77    
ref|XP_003571658.1|  PREDICTED: pectate lyase-like                      254   4e-77    
ref|XP_011097774.1|  PREDICTED: pectate lyase-like                      253   5e-77    
ref|XP_009107745.1|  PREDICTED: probable pectate lyase 15               254   5e-77    
gb|EYU28712.1|  hypothetical protein MIMGU_mgv1a006498mg                254   5e-77    
gb|ACF84425.1|  unknown                                                 248   7e-77    Zea mays [maize]
ref|XP_004951474.1|  PREDICTED: pectate lyase-like                      253   8e-77    
ref|XP_011071024.1|  PREDICTED: pectate lyase-like                      253   8e-77    
emb|CDY45202.1|  BnaA06g34060D                                          253   1e-76    
ref|XP_006357289.1|  PREDICTED: probable pectate lyase 3-like           253   1e-76    
ref|XP_010450167.1|  PREDICTED: probable pectate lyase 15 isoform X1    253   1e-76    
ref|XP_010450168.1|  PREDICTED: probable pectate lyase 15 isoform X2    253   2e-76    
ref|XP_009627245.1|  PREDICTED: pectate lyase-like                      252   2e-76    
gb|KHG12411.1|  hypothetical protein F383_06737                         250   2e-76    
emb|CDY18738.1|  BnaC08g08780D                                          253   2e-76    
ref|XP_010435229.1|  PREDICTED: probable pectate lyase 15               253   2e-76    
ref|XP_009101245.1|  PREDICTED: probable pectate lyase 6                253   2e-76    
ref|XP_010440536.1|  PREDICTED: probable pectate lyase 15 isoform X2    253   2e-76    
gb|KHG22755.1|  hypothetical protein F383_29653                         251   3e-76    
ref|XP_010440534.1|  PREDICTED: probable pectate lyase 15 isoform X1    252   3e-76    
emb|CDY53564.1|  BnaC04g55760D                                          251   4e-76    
emb|CAB36835.1|  putative pectate lyase A11 (fragment)                  249   5e-76    
gb|KDO49831.1|  hypothetical protein CISIN_1g044170mg                   249   5e-76    
ref|XP_010532870.1|  PREDICTED: putative pectate lyase 14               251   6e-76    
ref|XP_008460728.1|  PREDICTED: probable pectate lyase 1 isoform X3     249   6e-76    
gb|EYU22437.1|  hypothetical protein MIMGU_mgv1a006496mg                251   6e-76    
gb|KDO49230.1|  hypothetical protein CISIN_1g036607mg                   251   7e-76    
gb|ACN35280.1|  unknown                                                 245   8e-76    
ref|XP_004234780.1|  PREDICTED: probable pectate lyase P56              249   9e-76    
ref|NP_567409.1|  probable pectate lyase 15                             251   1e-75    
dbj|BAF43573.1|  pectate lyase                                          250   1e-75    
ref|NP_001190720.1|  probable pectate lyase 15                          251   1e-75    
ref|XP_008460726.1|  PREDICTED: probable pectate lyase 8 isoform X1     250   1e-75    
emb|CDY66697.1|  BnaAnng22760D                                          250   1e-75    
ref|XP_006484673.1|  PREDICTED: probable pectate lyase 19-like          250   1e-75    
ref|XP_004171543.1|  PREDICTED: probable pectate lyase 15-like          250   1e-75    
ref|XP_002870357.1|  pectate lyase family protein                       251   1e-75    
ref|XP_004138973.1|  PREDICTED: probable pectate lyase 15-like          250   1e-75    
ref|XP_008460727.1|  PREDICTED: probable pectate lyase 1 isoform X2     249   1e-75    
ref|XP_007222160.1|  hypothetical protein PRUPE_ppa005761mg             250   2e-75    
ref|XP_009397895.1|  PREDICTED: probable pectate lyase 8                250   2e-75    
ref|XP_006437462.1|  hypothetical protein CICLE_v10031653mg             249   2e-75    
ref|XP_006480843.1|  PREDICTED: probable pectate lyase 19-like          249   2e-75    
ref|XP_006282594.1|  hypothetical protein CARUB_v10004736mg             250   2e-75    
ref|XP_011086987.1|  PREDICTED: probable pectate lyase 22               248   2e-75    
ref|XP_006428983.1|  hypothetical protein CICLE_v10013750mg             249   2e-75    
ref|XP_009102560.1|  PREDICTED: probable pectate lyase 9                249   3e-75    
emb|CDX77470.1|  BnaA07g06080D                                          249   4e-75    
gb|AAX88800.1|  ripening-related pectate lyase                          249   4e-75    
ref|XP_002526952.1|  Pectate lyase precursor, putative                  247   4e-75    
ref|XP_009599824.1|  PREDICTED: pectate lyase                           247   4e-75    
ref|NP_189110.1|  probable pectate lyase 10                             249   4e-75    
ref|XP_009757256.1|  PREDICTED: pectate lyase                           247   5e-75    
ref|XP_009586995.1|  PREDICTED: probable pectate lyase 5                247   5e-75    
gb|AAK66161.1|  pectate lyase                                           246   7e-75    
ref|XP_006361836.1|  PREDICTED: probable pectate lyase P56-like         247   7e-75    
ref|XP_006431087.1|  hypothetical protein CICLE_v10011762mg             248   9e-75    
dbj|BAF01663.1|  pectate lyase like protein                             243   9e-75    
ref|XP_004233352.1|  PREDICTED: pectate lyase-like                      246   9e-75    
ref|XP_010239620.1|  PREDICTED: probable pectate lyase 8 isoform X2     247   1e-74    
emb|CDY01151.1|  BnaA04g06680D                                          248   1e-74    
dbj|BAK06362.1|  predicted protein                                      248   1e-74    
gb|EEE60442.1|  hypothetical protein OsJ_13660                          248   1e-74    
ref|XP_009139602.1|  PREDICTED: probable pectate lyase 15               248   1e-74    
ref|XP_008438392.1|  PREDICTED: probable pectate lyase 8                248   1e-74    
ref|XP_008223974.1|  PREDICTED: probable pectate lyase 8                247   1e-74    
ref|XP_006482544.1|  PREDICTED: probable pectate lyase 19-like          247   1e-74    
ref|XP_006280540.1|  hypothetical protein CARUB_v10026482mg             246   2e-74    
ref|XP_009411363.1|  PREDICTED: probable pectate lyase 8                248   2e-74    
ref|XP_010239619.1|  PREDICTED: probable pectate lyase 8 isoform X1     247   2e-74    
ref|XP_002885665.1|  pectate lyase family protein                       247   2e-74    
ref|XP_004289729.1|  PREDICTED: probable pectate lyase 15-like          247   2e-74    
emb|CAE02420.2|  OSJNBa0095E20.8                                        248   2e-74    
gb|EMT28700.1|  hypothetical protein F775_17439                         245   2e-74    
gb|EAZ35814.1|  hypothetical protein OsJ_20107                          238   3e-74    
ref|XP_002285340.1|  PREDICTED: probable pectate lyase 5                246   3e-74    
emb|CAN76500.1|  hypothetical protein VITISV_004734                     245   3e-74    
gb|EMT27253.1|  hypothetical protein F775_20306                         244   3e-74    
ref|XP_009804979.1|  PREDICTED: probable pectate lyase 5                245   3e-74    
ref|XP_010663062.1|  PREDICTED: probable pectate lyase 5                245   3e-74    
ref|XP_010243989.1|  PREDICTED: probable pectate lyase 8                246   3e-74    
ref|XP_010109687.1|  hypothetical protein L484_015172                   246   3e-74    
ref|XP_009111860.1|  PREDICTED: probable pectate lyase 20               246   3e-74    
gb|KDO82123.1|  hypothetical protein CISIN_1g015702mg                   241   3e-74    
gb|EEC76710.1|  hypothetical protein OsI_14719                          247   3e-74    
gb|ABM68553.1|  pectate lyase                                           240   3e-74    
ref|XP_004501839.1|  PREDICTED: probable pectate lyase 5-like           245   3e-74    
emb|CDY46471.1|  BnaC07g03950D                                          246   4e-74    
ref|XP_009102476.1|  PREDICTED: probable pectate lyase 10               246   5e-74    
ref|XP_007037816.1|  Pectin lyase-like superfamily protein isoform 2    243   5e-74    
ref|XP_011072008.1|  PREDICTED: probable pectate lyase 18               244   6e-74    
dbj|BAB01216.1|  pectate lyase                                          246   6e-74    
ref|XP_008804450.1|  PREDICTED: probable pectate lyase 8 isoform X2     245   7e-74    
ref|XP_010264036.1|  PREDICTED: probable pectate lyase 8                245   7e-74    
ref|XP_006852264.1|  hypothetical protein AMTR_s00049p00173370          244   7e-74    
ref|XP_009362042.1|  PREDICTED: probable pectate lyase 8                246   8e-74    
ref|XP_008360481.1|  PREDICTED: probable pectate lyase 8                245   8e-74    
gb|EPS73633.1|  hypothetical protein M569_01123                         246   8e-74    
gb|EYU22243.1|  hypothetical protein MIMGU_mgv1a007460mg                244   8e-74    
ref|XP_008391438.1|  PREDICTED: probable pectate lyase 8                245   9e-74    
ref|XP_010527219.1|  PREDICTED: probable pectate lyase 10               244   9e-74    
emb|CDY56668.1|  BnaCnng30870D                                          244   1e-73    
ref|XP_007034463.1|  Pectin lyase-like superfamily protein              245   1e-73    
ref|XP_008804449.1|  PREDICTED: probable pectate lyase 8 isoform X1     245   1e-73    
ref|XP_008667903.1|  PREDICTED: pectate lyase 8 isoform X1              246   1e-73    
ref|XP_002884619.1|  pectate lyase family protein                       244   1e-73    
ref|XP_010320956.1|  PREDICTED: probable pectate lyase 5                244   1e-73    
ref|XP_006341783.1|  PREDICTED: probable pectate lyase 5-like           244   1e-73    
ref|XP_002863927.1|  pectate lyase family protein                       244   1e-73    
ref|XP_003535958.1|  PREDICTED: probable pectate lyase 1-like           245   2e-73    
ref|XP_010100325.1|  hypothetical protein L484_027633                   244   2e-73    
ref|XP_010918897.1|  PREDICTED: probable pectate lyase 8 isoform X2     244   2e-73    
ref|NP_568705.1|  putative pectate lyase 20                             244   2e-73    
emb|CDY19932.1|  BnaA09g03190D                                          244   2e-73    
gb|KHG06252.1|  hypothetical protein F383_10745                         244   2e-73    
gb|AAM63307.1|  pectate lyase                                           244   2e-73    
ref|XP_010250930.1|  PREDICTED: probable pectate lyase 5                243   2e-73    
ref|XP_010918895.1|  PREDICTED: probable pectate lyase 8 isoform X1     244   2e-73    
ref|XP_006297684.1|  hypothetical protein CARUB_v10013715mg             244   2e-73    
ref|XP_003638513.1|  Pectate lyase                                      243   2e-73    
gb|KFK31278.1|  hypothetical protein AALP_AA6G091900                    243   2e-73    
ref|XP_004134015.1|  PREDICTED: probable pectate lyase 15-like          244   3e-73    
ref|XP_007137977.1|  hypothetical protein PHAVU_009G170500g             243   3e-73    
ref|XP_010935686.1|  PREDICTED: probable pectate lyase 8 isoform X2     243   3e-73    
ref|XP_010106682.1|  hypothetical protein L484_004616                   242   4e-73    
ref|XP_010935685.1|  PREDICTED: probable pectate lyase 8 isoform X1     244   4e-73    
gb|KHG30349.1|  hypothetical protein F383_15991                         245   4e-73    
gb|ABK92535.1|  unknown                                                 238   4e-73    
gb|EAY99627.1|  hypothetical protein OsI_21606                          242   4e-73    
gb|EYU30593.1|  hypothetical protein MIMGU_mgv1a007569mg                242   5e-73    
ref|XP_007037815.1|  Pectin lyase-like superfamily protein isoform 1    242   5e-73    
ref|XP_011073763.1|  PREDICTED: probable pectate lyase 8                243   5e-73    
ref|XP_004975048.1|  PREDICTED: probable pectate lyase 15-like is...    243   5e-73    
ref|XP_010023767.1|  PREDICTED: probable pectate lyase 8 isoform X1     243   6e-73    
ref|XP_003638493.1|  Pectate lyase                                      236   6e-73    
ref|XP_009385867.1|  PREDICTED: probable pectate lyase 8 isoform X2     243   6e-73    
gb|AAF19196.1|AF206320_1  pectate lyase 2                               243   6e-73    
ref|XP_011086701.1|  PREDICTED: probable pectate lyase 5                242   7e-73    
ref|XP_010464311.1|  PREDICTED: probable pectate lyase 8                242   7e-73    
ref|XP_008339288.1|  PREDICTED: probable pectate lyase 8                243   7e-73    
ref|XP_010023768.1|  PREDICTED: probable pectate lyase 1 isoform X2     243   7e-73    
gb|KDP33375.1|  hypothetical protein JCGZ_12924                         243   8e-73    
ref|XP_003523121.1|  PREDICTED: probable pectate lyase 18-like          242   8e-73    
ref|XP_010442341.1|  PREDICTED: probable pectate lyase 20               242   8e-73    
ref|XP_010486231.1|  PREDICTED: probable pectate lyase 8                242   8e-73    
ref|XP_010545988.1|  PREDICTED: probable pectate lyase 22               242   8e-73    
gb|KHN34377.1|  Putative pectate lyase 22                               242   8e-73    
ref|XP_007145412.1|  hypothetical protein PHAVU_007G236800g             243   8e-73    
gb|KHN05801.1|  Putative pectate lyase 22                               242   9e-73    
ref|XP_007201029.1|  hypothetical protein PRUPE_ppa006229mg             242   9e-73    
ref|XP_010439830.1|  PREDICTED: probable pectate lyase 20               242   9e-73    
emb|CDX77400.1|  BnaA07g05380D                                          244   9e-73    
ref|XP_003555714.2|  PREDICTED: probable pectate lyase 1-like           244   9e-73    
gb|EMS45831.1|  Pectate lyase                                           245   9e-73    
ref|XP_010447044.1|  PREDICTED: probable pectate lyase 8                242   1e-72    
ref|XP_004497757.1|  PREDICTED: probable pectate lyase 15-like          243   1e-72    
dbj|BAB10560.1|  pectate lyase                                          241   1e-72    
ref|NP_001141589.1|  uncharacterized protein LOC100273705               243   1e-72    
ref|XP_008235520.1|  PREDICTED: probable pectate lyase 8                243   1e-72    
ref|XP_010532807.1|  PREDICTED: probable pectate lyase 15               243   1e-72    
ref|NP_001289258.1|  probable pectate lyase 18 precursor                241   1e-72    
ref|XP_006484000.1|  PREDICTED: probable pectate lyase 5-like           241   1e-72    
ref|XP_009385866.1|  PREDICTED: probable pectate lyase 8 isoform X1     244   1e-72    
dbj|BAB10313.1|  pectate lyase                                          241   1e-72    
ref|NP_568967.1|  putative pectate lyase 22                             242   1e-72    
ref|XP_009349844.1|  PREDICTED: probable pectate lyase 8                243   1e-72    
gb|AEN70985.1|  pectate lyase                                           241   1e-72    
ref|XP_007155507.1|  hypothetical protein PHAVU_003G207400g             241   1e-72    
gb|AAM61584.1|  putative pectate lyase                                  241   1e-72    
ref|XP_009391056.1|  PREDICTED: probable pectate lyase 8                243   1e-72    
gb|KFK39788.1|  hypothetical protein AALP_AA3G287800                    242   1e-72    
ref|XP_009408120.1|  PREDICTED: probable pectate lyase 8                242   1e-72    
ref|NP_187357.1|  putative pectate lyase 8                              241   1e-72    
ref|XP_002304700.1|  pectate lyase family protein                       242   2e-72    
gb|ADB90475.1|  pectate lyase                                           241   2e-72    
gb|KEH41255.1|  pectate lyase family protein                            242   2e-72    
ref|XP_004152502.1|  PREDICTED: probable pectate lyase 22-like          241   2e-72    
ref|XP_011020694.1|  PREDICTED: probable pectate lyase 8                242   2e-72    
ref|XP_002866540.1|  pectate lyase                                      241   2e-72    
ref|XP_008800563.1|  PREDICTED: probable pectate lyase 8 isoform X1     242   2e-72    
gb|AEN70984.1|  pectate lyase                                           241   2e-72    
gb|KDO82120.1|  hypothetical protein CISIN_1g015702mg                   241   2e-72    
emb|CDY33938.1|  BnaA02g30490D                                          241   2e-72    
gb|KHG19997.1|  hypothetical protein F383_02891                         241   2e-72    
gb|KCW57296.1|  hypothetical protein EUGRSUZ_H00093                     242   2e-72    
ref|XP_004975047.1|  PREDICTED: probable pectate lyase 15-like is...    243   2e-72    
ref|XP_004157771.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    241   2e-72    
emb|CDY05655.1|  BnaC02g38820D                                          241   2e-72    
ref|XP_009129753.1|  PREDICTED: probable pectate lyase 20               241   2e-72    
emb|CBI33346.3|  unnamed protein product                                241   2e-72    
ref|XP_011097349.1|  PREDICTED: pectate lyase-like                      241   2e-72    
ref|XP_008800564.1|  PREDICTED: probable pectate lyase 8 isoform X2     242   2e-72    
ref|XP_010248740.1|  PREDICTED: probable pectate lyase 18               241   2e-72    
ref|XP_009139642.1|  PREDICTED: putative pectate lyase 14               241   2e-72    
ref|XP_010444201.1|  PREDICTED: probable pectate lyase 22 isoform X3    239   2e-72    
ref|XP_006297766.1|  hypothetical protein CARUB_v10013802mg             240   2e-72    
ref|XP_010466894.1|  PREDICTED: probable pectate lyase 10               241   2e-72    
ref|XP_009370039.1|  PREDICTED: probable pectate lyase 8                242   2e-72    
gb|AFZ78654.1|  pectate lyase                                           242   2e-72    
ref|XP_010069078.1|  PREDICTED: probable pectate lyase 8                242   2e-72    
ref|XP_006283843.1|  hypothetical protein CARUB_v10004942mg             241   2e-72    
ref|XP_009384552.1|  PREDICTED: probable pectate lyase 8                242   2e-72    
gb|AEN70981.1|  pectate lyase                                           241   2e-72    
ref|XP_010488576.1|  PREDICTED: probable pectate lyase 10               241   2e-72    
gb|AEN70964.1|  pectate lyase                                           241   3e-72    
gb|AEN70963.1|  pectate lyase                                           241   3e-72    
ref|XP_003526981.1|  PREDICTED: probable pectate lyase 18-like          240   3e-72    
ref|NP_001242543.1|  uncharacterized protein LOC100779940 precursor     240   3e-72    
ref|XP_006297767.1|  hypothetical protein CARUB_v10013802mg             241   3e-72    
ref|XP_008372438.1|  PREDICTED: probable pectate lyase 8                241   3e-72    
ref|XP_006360328.1|  PREDICTED: probable pectate lyase 15-like          241   3e-72    
ref|XP_010513666.1|  PREDICTED: probable pectate lyase 10               241   3e-72    
ref|XP_007031685.1|  Pectin lyase-like superfamily protein              240   3e-72    
gb|ACB12931.1|  pectate lyase 1-27                                      241   3e-72    
gb|KFK39718.1|  hypothetical protein AALP_AA3G279700                    239   4e-72    
gb|KFK28033.1|  hypothetical protein AALP_AA8G463100                    240   4e-72    
ref|NP_001147553.1|  pectate lyase 8                                    242   4e-72    
ref|XP_010459939.1|  PREDICTED: probable pectate lyase 22               240   4e-72    
ref|XP_004975046.1|  PREDICTED: probable pectate lyase 15-like is...    243   4e-72    
gb|KHN15224.1|  Putative pectate lyase 15                               235   4e-72    
emb|CDP13269.1|  unnamed protein product                                239   4e-72    
ref|XP_010484044.1|  PREDICTED: probable pectate lyase 22               240   5e-72    
gb|KHN45481.1|  Putative pectate lyase 3                                239   5e-72    
emb|CDY47327.1|  BnaCnng14640D                                          241   5e-72    
ref|XP_009371193.1|  PREDICTED: probable pectate lyase 8                241   5e-72    
ref|XP_010933172.1|  PREDICTED: probable pectate lyase 8 isoform X2     240   5e-72    
ref|XP_006438176.1|  hypothetical protein CICLE_v10031429mg             241   5e-72    
ref|XP_010038352.1|  PREDICTED: probable pectate lyase 8                241   5e-72    
ref|XP_010023435.1|  PREDICTED: probable pectate lyase 5                239   5e-72    
gb|KFK39719.1|  hypothetical protein AALP_AA3G279700                    240   5e-72    



>ref|XP_010317101.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=389

 Score =   357 bits (915),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 184/248 (74%), Positives = 214/248 (86%), Gaps = 0/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GA I IQ+ KNVIIHG+HIH I EG+GG++RD +DH GLRTKSDGDGISI+GSSN+WIDH
Sbjct  142  GASIMIQYTKNVIIHGLHIHDIVEGSGGMVRDAVDHIGLRTKSDGDGISIYGSSNIWIDH  201

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM NCYDGLIDA+E ST ITISNGH+TDHN+VMLFGA+D S+ D+ MQIT+AFNHFGKR
Sbjct  202  MSMENCYDGLIDAVEGSTGITISNGHYTDHNEVMLFGASDSSSIDQKMQITLAFNHFGKR  261

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+GYIHVVNNDYTHWNMYAIGGS +PTIISQGNRFIAP DI K++IT R  +
Sbjct  262  LVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRFIAPPDIFKKEITKREYS  321

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
                W QWTWRSEGD+YM GA+FVQ+GDPD+ KKH  LYDG+    A+ VTW+TRFAGAL
Sbjct  322  PESVWMQWTWRSEGDLYMNGAYFVQAGDPDWSKKHQNLYDGIAPAPADQVTWITRFAGAL  381

Query  224  NCRVGSPC  201
            NC+VG PC
Sbjct  382  NCKVGLPC  389



>ref|XP_009599825.1| PREDICTED: probable pectate lyase P59 isoform X1 [Nicotiana tomentosiformis]
Length=445

 Score =   355 bits (911),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 181/248 (73%), Positives = 216/248 (87%), Gaps = 0/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+Q++KNVIIHG+HIH I EG+GG++RD +DH G+RT SDGDGISIFG+SN+WIDH
Sbjct  198  GAGITLQYIKNVIIHGLHIHDIVEGSGGMVRDAVDHIGIRTVSDGDGISIFGASNIWIDH  257

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSMR CYDG+IDA+E STAITISNGHFTDHN+VMLFGA+D S+ D++MQIT+AFNHFGKR
Sbjct  258  VSMRKCYDGIIDAVEGSTAITISNGHFTDHNEVMLFGASDSSSIDQVMQITLAFNHFGKR  317

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+GYIHVVNNDYTHWNMYAIGGS  PTII+QGNRFIAP DI K+Q+T R   
Sbjct  318  LVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPPDIFKKQVTKREYN  377

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
              E WK WTWRSEG+++M GA+F++SGDPD+ KKH ELYDG+    AE+VTW+TRFAGAL
Sbjct  378  PEEVWKHWTWRSEGNLFMNGAYFIESGDPDWSKKHKELYDGISAAPAEEVTWITRFAGAL  437

Query  224  NCRVGSPC  201
             C+ G  C
Sbjct  438  GCKKGKAC  445



>ref|XP_006357122.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=448

 Score =   355 bits (911),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 184/248 (74%), Positives = 212/248 (85%), Gaps = 0/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GA I IQ+ KNVIIHG+HIH I EGNGG++RD +DH G RTKSDGDGISIFGSSN+WIDH
Sbjct  201  GASIMIQYTKNVIIHGLHIHDIVEGNGGMVRDAVDHIGFRTKSDGDGISIFGSSNIWIDH  260

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM NCYDG+IDA+E ST ITISNGH+TDHN+VMLFGA+D S+ D+ MQIT+AFNHFGKR
Sbjct  261  MSMENCYDGIIDAVEGSTGITISNGHYTDHNEVMLFGASDSSSIDQKMQITLAFNHFGKR  320

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+GYIHVVNNDYTHWNMYAIGGS +PTIISQGNRFIAP DI K+QIT R  +
Sbjct  321  LVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRFIAPPDIFKKQITKREYS  380

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
                W QWTWRSEGD+YM GA+FVQ+GDPD+ KKH  LYDG+    A+ VTW+TRFAGAL
Sbjct  381  PESVWMQWTWRSEGDLYMNGAYFVQAGDPDWSKKHQNLYDGIAAAPADQVTWMTRFAGAL  440

Query  224  NCRVGSPC  201
            NC+VG  C
Sbjct  441  NCKVGKAC  448



>ref|XP_009599826.1| PREDICTED: probable pectate lyase P59 isoform X2 [Nicotiana tomentosiformis]
Length=444

 Score =   355 bits (911),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 181/248 (73%), Positives = 216/248 (87%), Gaps = 0/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+Q++KNVIIHG+HIH I EG+GG++RD +DH G+RT SDGDGISIFG+SN+WIDH
Sbjct  197  GAGITLQYIKNVIIHGLHIHDIVEGSGGMVRDAVDHIGIRTVSDGDGISIFGASNIWIDH  256

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSMR CYDG+IDA+E STAITISNGHFTDHN+VMLFGA+D S+ D++MQIT+AFNHFGKR
Sbjct  257  VSMRKCYDGIIDAVEGSTAITISNGHFTDHNEVMLFGASDSSSIDQVMQITLAFNHFGKR  316

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+GYIHVVNNDYTHWNMYAIGGS  PTII+QGNRFIAP DI K+Q+T R   
Sbjct  317  LVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPPDIFKKQVTKREYN  376

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
              E WK WTWRSEG+++M GA+F++SGDPD+ KKH ELYDG+    AE+VTW+TRFAGAL
Sbjct  377  PEEVWKHWTWRSEGNLFMNGAYFIESGDPDWSKKHKELYDGISAAPAEEVTWITRFAGAL  436

Query  224  NCRVGSPC  201
             C+ G  C
Sbjct  437  GCKKGKAC  444



>ref|XP_009779191.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score =   355 bits (911),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 180/248 (73%), Positives = 216/248 (87%), Gaps = 0/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+Q++KNVIIHG+HIH I EG+GG++RD +DH G+RT SDGDGISIFG+SN+WIDH
Sbjct  200  GAGITLQYIKNVIIHGLHIHDIVEGSGGMVRDAVDHIGIRTVSDGDGISIFGASNIWIDH  259

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM+ CYDG+IDA+E ST ITISNGHFTDHN+VMLFGA+D S+ D++MQIT+AFNHFGKR
Sbjct  260  VSMKKCYDGIIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQVMQITLAFNHFGKR  319

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+GYIHVVNNDYTHWNMYAIGGS  PTII+QGNRFIAP DI K+Q+T R   
Sbjct  320  LVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPPDIFKKQVTKREYN  379

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
              E WKQWTWRSEG+++M GA+F++SGDPD+ KKH ELYDG+    AE+VTW+TRFAGAL
Sbjct  380  PEEVWKQWTWRSEGNLFMNGAYFIESGDPDWSKKHKELYDGISAASAEEVTWITRFAGAL  439

Query  224  NCRVGSPC  201
             C+ G  C
Sbjct  440  GCKEGKAC  447



>ref|XP_006361835.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=447

 Score =   355 bits (910),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 181/248 (73%), Positives = 214/248 (86%), Gaps = 0/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+Q++KNVIIHG+HIH I EGNGG++RD +DH G+RTKSDGDGISIFG+SN+WIDH
Sbjct  200  GAGITLQYIKNVIIHGLHIHDIVEGNGGMVRDAVDHIGIRTKSDGDGISIFGASNIWIDH  259

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM+ CYDGLIDA+E ST ITISNGHFTDHN+VMLFGA+D S+ D++MQIT+AFNHFGKR
Sbjct  260  VSMQRCYDGLIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQVMQITLAFNHFGKR  319

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+GYIHVVNNDYTHWNMYAIGGS  PTII+QGNRFIAP DI K+Q+T R   
Sbjct  320  LVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPPDIFKKQVTKREYN  379

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
                W QWTWRSEG+++M GA+F +SGDPD+ KKH +LYDG+    AEDVTW+TRFAG L
Sbjct  380  PESVWMQWTWRSEGNLFMNGAYFTESGDPDWSKKHKDLYDGISAAPAEDVTWMTRFAGVL  439

Query  224  NCRVGSPC  201
             C+ G PC
Sbjct  440  ACKPGKPC  447



>ref|XP_009789921.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score =   354 bits (909),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 185/248 (75%), Positives = 212/248 (85%), Gaps = 0/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGI IQ+ KNVIIHG+HIH I +GNGG++RD +DH GLRT SDGDGISIFG+SN+WIDH
Sbjct  200  GAGIMIQYTKNVIIHGLHIHDIVQGNGGMVRDAVDHIGLRTMSDGDGISIFGASNIWIDH  259

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NCYDG+IDA+E ST ITISNGHFTDHN+VMLFGA+D S+ D+ MQIT+AFNHFGKR
Sbjct  260  VSMWNCYDGIIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQQMQITLAFNHFGKR  319

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+GYIHVVNNDYTHWNMYAIGGS +PTIISQGNRFIAP DI K+QIT R  +
Sbjct  320  LVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRFIAPPDIFKKQITKREYS  379

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
                W QWTWRSEGD+YM GA+FVQSGDPD+ KKH  LYDG+    A+ VTW+TRFAGAL
Sbjct  380  PESVWMQWTWRSEGDLYMNGAYFVQSGDPDWSKKHQNLYDGISAAPADQVTWITRFAGAL  439

Query  224  NCRVGSPC  201
             C+VG  C
Sbjct  440  GCKVGQAC  447



>emb|CDP02198.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   354 bits (909),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 190/252 (75%), Positives = 215/252 (85%), Gaps = 4/252 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQFVKNVIIHG+HIH I +G+GGL+RD +DHFG+RT SDGDGISIFGSSNVWIDH
Sbjct  225  GAGITIQFVKNVIIHGLHIHDIHQGSGGLVRDSVDHFGIRTMSDGDGISIFGSSNVWIDH  284

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM  CYDGLIDA+EASTAITISN HFTDHN+VMLFGA+D  +KD +MQIT+AFNHFGKR
Sbjct  285  VSMWKCYDGLIDAVEASTAITISNSHFTDHNEVMLFGASDSQSKDAVMQITVAFNHFGKR  344

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHK----RQITH  417
            LIQRMPRCR+G+IHVVNNDYTHW MYAIGGS  P IISQGNRFIAP DI K    R +T 
Sbjct  345  LIQRMPRCRWGFIHVVNNDYTHWEMYAIGGSQHPIIISQGNRFIAPPDIFKKEVRRTVTK  404

Query  416  RVGAAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRF  237
            R  A   +WK+WTWRSEGD++M GAFFVQSGDPDF KKH E++DG+    + +VTW+TRF
Sbjct  405  RDYAEEARWKEWTWRSEGDLFMNGAFFVQSGDPDFTKKHPEIFDGIAPADSSEVTWITRF  464

Query  236  AGALNCRVGSPC  201
            AGAL CR GSPC
Sbjct  465  AGALMCRPGSPC  476



>ref|XP_009587689.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=447

 Score =   353 bits (906),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 185/248 (75%), Positives = 211/248 (85%), Gaps = 0/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGI IQ+ KNVIIHG+HIH I +GNGG++RD +DH GLRT SDGDGISIFG+SN+WIDH
Sbjct  200  GAGIMIQYTKNVIIHGLHIHDIVQGNGGMVRDAVDHIGLRTMSDGDGISIFGASNIWIDH  259

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NCYDG+IDA+E ST ITISNGHFTDHN+VMLFGA+D S+ D+ MQIT+AFNHFGKR
Sbjct  260  VSMWNCYDGIIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQQMQITLAFNHFGKR  319

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+GYIHVVNNDYTHWNMYAIGGS +PTIISQGNRFIAP DI K+QIT R  +
Sbjct  320  LVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRFIAPPDIFKKQITKREYS  379

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
                W QWTWRSEGD+YM GA+FVQSGDPD+ KKH  LYDG+    A+ VTW+TRFAGAL
Sbjct  380  PESVWMQWTWRSEGDLYMNGAYFVQSGDPDWSKKHQNLYDGISAAPADQVTWITRFAGAL  439

Query  224  NCRVGSPC  201
             C VG  C
Sbjct  440  GCMVGQAC  447



>ref|XP_004234779.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=449

 Score =   352 bits (904),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 180/248 (73%), Positives = 213/248 (86%), Gaps = 0/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+Q++KNVIIHG+HIH I EGNGG++RD +DH G+RTKSDGDGISIFG+SN+WIDH
Sbjct  202  GAGITLQYIKNVIIHGLHIHDIVEGNGGMVRDAVDHIGIRTKSDGDGISIFGASNIWIDH  261

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM+ CYDGLIDA+E ST ITISNGHFTDHN+VMLFGA+D S+ D++MQIT+AFNHFGKR
Sbjct  262  VSMQRCYDGLIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQVMQITLAFNHFGKR  321

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            LIQRMPRCR+GYIHVVNNDYTHWNMYAIGGS  PTII+QGNRFIAP DI K+Q+T R   
Sbjct  322  LIQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPPDIFKKQVTKREYN  381

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
                W QWTWRSEG+++M GA+F +SGDP++  KH +LYDG+    AEDVTW+TRFAG L
Sbjct  382  PESVWMQWTWRSEGNLFMNGAYFTESGDPEWSSKHKDLYDGISAAPAEDVTWMTRFAGVL  441

Query  224  NCRVGSPC  201
             C+ G PC
Sbjct  442  GCKPGKPC  449



>sp|P15722.1|PLY59_SOLLC RecName: Full=Probable pectate lyase P59; Flags: Precursor [Solanum 
lycopersicum]
 emb|CAA33523.1| P59 protein [Solanum lycopersicum]
Length=449

 Score =   348 bits (893),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 179/248 (72%), Positives = 211/248 (85%), Gaps = 0/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+Q++KNVIIHG+HIH I EGNGG++RD +DH G+RTKSDGDGISIFG+S +WIDH
Sbjct  202  GAGITLQYIKNVIIHGLHIHDIVEGNGGMVRDAVDHIGIRTKSDGDGISIFGASYIWIDH  261

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM+ CYDGLIDA+E ST ITISNGHFTDHN+VMLFGA+D S+ D++MQIT+AFNHFGKR
Sbjct  262  VSMQRCYDGLIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQVMQITLAFNHFGKR  321

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            LIQRMPRCR+GYIHVVNNDYTHWNMYAIGGS  PTII QGNRFIAP DI K+Q+T R   
Sbjct  322  LIQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIIHQGNRFIAPPDIFKKQVTKREYN  381

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
                W QWTWRSEG+++M GA+F +SGDP++  KH +LYDG+    AEDVTW+TRFAG L
Sbjct  382  PESVWMQWTWRSEGNLFMNGAYFTESGDPEWSSKHKDLYDGISAAPAEDVTWMTRFAGVL  441

Query  224  NCRVGSPC  201
             C+ G PC
Sbjct  442  GCKPGKPC  449



>ref|XP_009802165.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=451

 Score =   343 bits (879),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 181/248 (73%), Positives = 211/248 (85%), Gaps = 0/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+Q+VKNVIIHG+HIH I  GNGG++   +DH G+RT+SDGDGISIFGSSN+WIDH
Sbjct  204  GAGITLQYVKNVIIHGLHIHDIVVGNGGMVISAVDHVGIRTQSDGDGISIFGSSNIWIDH  263

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM  C DGLIDA+E STAITISNGHFTDHN+VMLFGA+D S+ D+ MQIT+AFNHFGKR
Sbjct  264  VSMWRCSDGLIDAVEGSTAITISNGHFTDHNEVMLFGASDSSSIDQRMQITVAFNHFGKR  323

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+IHVVNNDYTHWNMYAIGGS  PTIISQGNRFIAP D+ K++IT R  A
Sbjct  324  LVQRMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGNRFIAPPDMFKKEITKRDYA  383

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
                WKQWTWRS+GD++M GAFFV+SGDPD+ KKH  L+DG+ +   E VTW+TRFAGAL
Sbjct  384  PESVWKQWTWRSQGDLFMNGAFFVESGDPDWTKKHQNLFDGISSAPGEQVTWITRFAGAL  443

Query  224  NCRVGSPC  201
            NCR G  C
Sbjct  444  NCRPGHAC  451



>ref|XP_009617495.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=451

 Score =   340 bits (871),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 179/248 (72%), Positives = 211/248 (85%), Gaps = 0/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+Q+VKNVIIHG+HIH I  GNGG++   +DH G+RT+SDGDGISIFGSSN+WIDH
Sbjct  204  GAGITLQYVKNVIIHGLHIHDIVVGNGGMVISAVDHVGIRTQSDGDGISIFGSSNIWIDH  263

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM  C DGLIDA+E STAITISNGHFTDHN+VMLFGA+D S+ D+ MQIT+AFNHFGKR
Sbjct  264  VSMWRCSDGLIDAVEGSTAITISNGHFTDHNEVMLFGASDSSSIDQRMQITVAFNHFGKR  323

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+IHVVNNDYTHWNMYAIGGS  PTIISQGNRFIAP ++ K++IT R  A
Sbjct  324  LVQRMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGNRFIAPPEMFKKEITKRDYA  383

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
                WKQWTWRS+GD++M GAFFV+SGDPD+ KKH  L+DG+ +   E VTW+TRFAGAL
Sbjct  384  PESVWKQWTWRSQGDLFMNGAFFVESGDPDWTKKHQNLFDGISSAPGEQVTWITRFAGAL  443

Query  224  NCRVGSPC  201
            NC+ G  C
Sbjct  444  NCKQGHAC  451



>ref|XP_006338480.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=446

 Score =   337 bits (865),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 172/249 (69%), Positives = 212/249 (85%), Gaps = 0/249 (0%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAG  +Q+VKNVIIHG+ IH I  G+GG+IRD +DH G RT+SDGDGISIFGSSN+W+D
Sbjct  198  NGAGFMLQYVKNVIIHGLRIHDIVVGSGGMIRDAMDHIGQRTQSDGDGISIFGSSNIWVD  257

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM +CYDGL+DA+E STA+TISN HFTDHN+VMLFGA+D S+ D+ MQIT+A+NHFGK
Sbjct  258  HVSMWSCYDGLVDAVEGSTAVTISNSHFTDHNEVMLFGASDSSSIDQRMQITVAYNHFGK  317

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
            RLIQRMPRCR+G+IHVVNNDYTHWNMYAIGGS  PTIISQGNRFIAP D+ K+++T R  
Sbjct  318  RLIQRMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGNRFIAPPDMFKKEVTKRDY  377

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            +    WKQW+WRS+GD++M GAFFV+SGDPD+ KKH EL+DG+ +   + VTW+TRF+GA
Sbjct  378  SPESVWKQWSWRSQGDLFMNGAFFVESGDPDWTKKHTELFDGIVSASGDQVTWITRFSGA  437

Query  227  LNCRVGSPC  201
            LNC+ G  C
Sbjct  438  LNCKPGEAC  446



>ref|XP_004232242.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=446

 Score =   334 bits (857),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 172/249 (69%), Positives = 212/249 (85%), Gaps = 0/249 (0%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAG  +Q+VKNVIIHG+ IH I  G+GG+IRD +DH G RT+SDGDGISIFGSSN+W+D
Sbjct  198  NGAGFMLQYVKNVIIHGLRIHDIVVGSGGMIRDAMDHVGQRTQSDGDGISIFGSSNIWVD  257

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM +CYDGL+DAIE STA+TISN HFTDHN+VMLFGA+D S+ D+ MQIT+A+NHFGK
Sbjct  258  HVSMWSCYDGLVDAIEGSTAVTISNSHFTDHNEVMLFGASDSSSIDQRMQITVAYNHFGK  317

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
            RLIQRMPRCR+G+IHVVNNDYTHWNMYAIGGS  PTIISQGNRFIAP D+ K+++T R  
Sbjct  318  RLIQRMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGNRFIAPPDMFKKEVTKRDY  377

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            +    WKQW+WRS+GD++M GAFFV+SGDPD+ +KH +L+DGV +   + VTW+TRF+GA
Sbjct  378  SPESVWKQWSWRSQGDLFMNGAFFVESGDPDWTQKHIQLFDGVVSASGDQVTWITRFSGA  437

Query  227  LNCRVGSPC  201
            LNC+ G  C
Sbjct  438  LNCKPGEAC  446



>gb|EPS66620.1| hypothetical protein M569_08154, partial [Genlisea aurea]
Length=451

 Score =   325 bits (834),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 173/251 (69%), Positives = 207/251 (82%), Gaps = 3/251 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QFV NVIIHG+HIH I +G+GG+IRD +DH+G RT+SDGDGISIFGS ++WIDH
Sbjct  201  GAGITLQFVSNVIIHGLHIHDIVQGSGGMIRDSVDHYGFRTRSDGDGISIFGSQDLWIDH  260

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSMR CYDGLIDAI  ST ITISN HFTDHN+VMLFGA+D  + D  MQ+T+AFNHFGKR
Sbjct  261  VSMRRCYDGLIDAIMGSTGITISNSHFTDHNEVMLFGASDGYSPDAKMQMTVAFNHFGKR  320

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSD---IHKRQITHR  414
            LIQRMPRCR+GYIHVVNNDYTHWNMYAIGGSS PTIISQGNR+IAP D   ++ +++T R
Sbjct  321  LIQRMPRCRWGYIHVVNNDYTHWNMYAIGGSSAPTIISQGNRYIAPPDDVNMYAKEVTKR  380

Query  413  VGAAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFA  234
              A    W+ WTWRS+GD++M GA+F QSGDP++M KH E YD +Q     +V  +TRFA
Sbjct  381  DYAPESVWQSWTWRSDGDVFMRGAYFTQSGDPNYMSKHPERYDLMQAADGSNVAAITRFA  440

Query  233  GALNCRVGSPC  201
            GAL C+VG+PC
Sbjct  441  GALLCKVGAPC  451



>gb|EYU34111.1| hypothetical protein MIMGU_mgv1a006386mg [Erythranthe guttata]
Length=446

 Score =   324 bits (831),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 173/249 (69%), Positives = 199/249 (80%), Gaps = 1/249 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQFVKN+IIHGI IH I  GNGGLIRD +DH+GLRT+SDGDGISI+G+ ++WIDH
Sbjct  198  GAGITIQFVKNIIIHGILIHDIVPGNGGLIRDSVDHYGLRTRSDGDGISIYGAQDIWIDH  257

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM  C DGLIDAI  ST ITISNGHFTDHN+ MLFGA+D  T+D  MQIT+AFNHFGKR
Sbjct  258  VSMTKCSDGLIDAIMGSTGITISNGHFTDHNEAMLFGASDSHTQDVKMQITVAFNHFGKR  317

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSD-IHKRQITHRVG  408
            ++QRMPRCRFGYIHVVNNDYTHWNMYAIGGS +P IISQGNRFIAP D    +++T R  
Sbjct  318  MVQRMPRCRFGYIHVVNNDYTHWNMYAIGGSKNPIIISQGNRFIAPPDNPFAKEVTKREY  377

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            +    W QW WRSEGDI++ GAFFVQSGD  +  KH E YD +Q   A  V  +T+FAGA
Sbjct  378  SPESVWSQWIWRSEGDIFLRGAFFVQSGDATYTSKHPEKYDLIQAASATQVGIMTKFAGA  437

Query  227  LNCRVGSPC  201
            L C+VG PC
Sbjct  438  LGCKVGQPC  446



>gb|EYU36839.1| hypothetical protein MIMGU_mgv1a006379mg [Erythranthe guttata]
Length=446

 Score =   323 bits (827),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 170/249 (68%), Positives = 199/249 (80%), Gaps = 1/249 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQFVKN+IIHG+ IH I  G+GG+IRD +DH+G RT+SDGDGISI+G+ ++WIDH
Sbjct  198  GAGITIQFVKNIIIHGLLIHDIVPGDGGMIRDSVDHYGFRTRSDGDGISIYGAQDIWIDH  257

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC DGLIDAI  ST ITISNGHFTDHN+ MLFGA+D  T+D  MQIT+AFNHFGKR
Sbjct  258  VSMTNCSDGLIDAIMGSTGITISNGHFTDHNEAMLFGASDSHTQDVKMQITVAFNHFGKR  317

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSD-IHKRQITHRVG  408
            L+QRMPRCRFGYIHVVNNDYTHWNMYAIGGS +P IISQGNRFIAP D    +++T R  
Sbjct  318  LVQRMPRCRFGYIHVVNNDYTHWNMYAIGGSKNPIIISQGNRFIAPPDNPFAKEVTKREY  377

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            +    W QW WRSEGDI++ GAFFVQSGDP +  KH E YD +Q   A  V  +T+FAGA
Sbjct  378  SPESVWSQWIWRSEGDIFLRGAFFVQSGDPTYTSKHPEKYDLIQAASATQVEIMTKFAGA  437

Query  227  LNCRVGSPC  201
            L C++G  C
Sbjct  438  LGCKIGQVC  446



>ref|XP_011098575.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=449

 Score =   319 bits (818),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 165/250 (66%), Positives = 203/250 (81%), Gaps = 1/250 (0%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAGIT+QFVKNVIIHGI I++I  G GG+IRD +DH+GLRT+SDGDGISIFGS ++WID
Sbjct  200  NGAGITLQFVKNVIIHGIKIYNISPGQGGMIRDAVDHYGLRTRSDGDGISIFGSQDIWID  259

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM NC DGLID I  ST +T+SN HFTDHN+ MLFGA+D  T+D  MQ+T+AFNHFGK
Sbjct  260  HVSMLNCADGLIDVIMGSTGVTVSNSHFTDHNEAMLFGASDSHTQDVKMQVTVAFNHFGK  319

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIA-PSDIHKRQITHRV  411
            R++QRMPR R+GYIHVVNNDYTHWNMYA+GGS +P IISQGNR+IA P++ + +++T R 
Sbjct  320  RMVQRMPRARYGYIHVVNNDYTHWNMYAVGGSKNPIIISQGNRYIAPPTNPYAKEVTKRE  379

Query  410  GAAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAG  231
             +    WK W WRSEGDI+ GGAFFVQSGDP +  KH E YD +Q   A++V  +T+FAG
Sbjct  380  YSPESVWKSWVWRSEGDIFQGGAFFVQSGDPTYTSKHPEKYDLIQAAPAQNVAEITKFAG  439

Query  230  ALNCRVGSPC  201
            AL C+VG PC
Sbjct  440  ALGCKVGVPC  449



>ref|XP_007153840.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
 gb|ESW25834.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
Length=447

 Score =   304 bits (779),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 164/248 (66%), Positives = 195/248 (79%), Gaps = 1/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QF++NVIIHGI ++ I    GG+IRD   H+GLRT+SDGDGISIFGSSN+WIDH
Sbjct  201  GAGITVQFIRNVIIHGIKVYDIQVHGGGMIRDSETHYGLRTQSDGDGISIFGSSNIWIDH  260

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSMRNCYDGLIDAI  STAITISN HFTDHN+ MLFGA+D   KDKIMQIT+AFNHFGKR
Sbjct  261  VSMRNCYDGLIDAIMGSTAITISNSHFTDHNEAMLFGASDSYDKDKIMQITLAFNHFGKR  320

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G++HVVNNDYTHW MYAIGGS  PTIIS+GNRFI P ++H ++IT R  +
Sbjct  321  LVQRMPRCRYGFVHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIGPDNVHAKEITKREYS  380

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
               +W  W WRS  D YM GAFFVQSG P+ + +     D ++      V  LTR+AG+L
Sbjct  381  PESEWSSWQWRSINDEYMNGAFFVQSG-PELVDRPFSRQDMIKAKPGSYVGRLTRYAGSL  439

Query  224  NCRVGSPC  201
            +CRVG PC
Sbjct  440  SCRVGLPC  447



>ref|XP_010678579.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=443

 Score =   303 bits (775),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 171/252 (68%), Positives = 193/252 (77%), Gaps = 9/252 (4%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGI +QFV NVIIH +HIH I  G GG IRD + HFG RT SDGDGISIFGS+N+WIDH
Sbjct  197  GAGIMLQFVDNVIIHNVHIHDIKTGGGGFIRDSVSHFGFRTASDGDGISIFGSTNIWIDH  256

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC DGLIDAIEASTAIT+SN HFTDHNDVMLFGA D S++D+IMQ+TIAFNHFGKR
Sbjct  257  VSMSNCMDGLIDAIEASTAITVSNCHFTDHNDVMLFGARDSSSQDEIMQVTIAFNHFGKR  316

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            LIQRMPRCRFG+ HV+NNDYTHW MYAIGGS  PTII QGNRFIAP +I  +++T R  A
Sbjct  317  LIQRMPRCRFGFFHVLNNDYTHWEMYAIGGSQHPTIICQGNRFIAPPNIFAKEVTKREYA  376

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGD----PDFMKKHNELYDGVQTFKAEDVTWLTRF  237
                WK W W SE DI M GAFF QSGD    P + KK     D ++     +VT LTRF
Sbjct  377  PYSVWKDWLWTSEDDIMMNGAFFNQSGDTSKKPSYAKK-----DMIKAKPGSEVTHLTRF  431

Query  236  AGALNCRVGSPC  201
            AGALNC+ G+ C
Sbjct  432  AGALNCKEGTAC  443



>ref|XP_010033216.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
Length=435

 Score =   302 bits (774),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 166/248 (67%), Positives = 195/248 (79%), Gaps = 2/248 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQFV+NVIIH I IH I    GG+IRD +DH G+RT SDGDGISIFGS+N+WIDH
Sbjct  190  GAGITIQFVRNVIIHNIRIHDIVTRPGGIIRDAVDHVGIRTMSDGDGISIFGSTNIWIDH  249

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM+ C DGLIDAIE STAITISNGH+T HNDVMLFGA+DL  +DKIMQ+T+AFNHFGK 
Sbjct  250  VSMKRCQDGLIDAIEGSTAITISNGHYTHHNDVMLFGASDLYPRDKIMQVTVAFNHFGKG  309

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            LIQRMPRCR+G+ HVVNNDYTHW MYAIGGSS PTIISQGNRFIAP ++  +++T R  A
Sbjct  310  LIQRMPRCRWGFFHVVNNDYTHWLMYAIGGSSQPTIISQGNRFIAPPNLAAKEVTKRDYA  369

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
             P+ W+ WTWRS+GD+ + GAFFVQSG P  +KK     D ++      V  LTRF+G L
Sbjct  370  TPDVWRSWTWRSQGDLLINGAFFVQSGQP--LKKKYGRKDMIKAKPGTFVRRLTRFSGTL  427

Query  224  NCRVGSPC  201
            NC+    C
Sbjct  428  NCKPKKRC  435



>ref|XP_008341537.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=454

 Score =   300 bits (768),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 169/248 (68%), Positives = 195/248 (79%), Gaps = 1/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QFV+NVIIHG+HIH    GNGG+IRD +DH G+RT SDGDGISI+GSSN+W+DH
Sbjct  208  GAGITLQFVQNVIIHGLHIHDTVPGNGGMIRDSVDHIGIRTHSDGDGISIYGSSNIWLDH  267

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D  + D IMQIT+AFNHFGK 
Sbjct  268  LSMWNCADGLIDAIQGSTAITISNSHFTRHNDVMLFGASDGFSGDAIMQITVAFNHFGKG  327

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            LIQRMPRCR+G+IHVVNNDYTHW MYAIGGSS PTIISQGNRFIAP +   +++T R  A
Sbjct  328  LIQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTIISQGNRFIAPPNQAAKEVTKRDYA  387

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
                WK W WRSEGD+ + GAFFVQSG P        L D ++      VT LTRFAG+L
Sbjct  388  PESVWKSWQWRSEGDLMINGAFFVQSGVPSKNHGFGRL-DVMKARPGTYVTRLTRFAGSL  446

Query  224  NCRVGSPC  201
            NC+VG PC
Sbjct  447  NCKVGHPC  454



>ref|XP_004302354.1| PREDICTED: probable pectate lyase P59-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score =   300 bits (767),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 166/249 (67%), Positives = 192/249 (77%), Gaps = 1/249 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQFV+NVIIHGIHIH I    GGLIRD LDH GLR +SDGDGI++FGSS++W+DH
Sbjct  199  GAGITIQFVENVIIHGIHIHDIVSVGGGLIRDSLDHIGLRGQSDGDGITVFGSSHIWLDH  258

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM NCYDGL D ++ STAITISN HFT HNDVMLFGANDL  +D+IMQIT+AFNHFGK 
Sbjct  259  LSMWNCYDGLTDVVQGSTAITISNCHFTRHNDVMLFGANDLYERDQIMQITVAFNHFGKG  318

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            LIQRMPRCRFG+ HVVNNDYTHW MYAIGGSS PTIISQGNR++AP D   ++IT R  +
Sbjct  319  LIQRMPRCRFGFFHVVNNDYTHWQMYAIGGSSHPTIISQGNRYVAPPDPKLKEITSRAYS  378

Query  404  APEQ-WKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
             PE  WK W WRSEGD+   GA+F +SG+P   + H   +D +       V  LTRFAG 
Sbjct  379  TPEAVWKTWQWRSEGDLMENGAYFRESGEPRKGRGHFSRFDVINAKPGSFVRRLTRFAGT  438

Query  227  LNCRVGSPC  201
            L CRVG  C
Sbjct  439  LGCRVGKAC  447



>ref|XP_009360393.1| PREDICTED: probable pectate lyase 3 [Pyrus x bretschneideri]
Length=452

 Score =   299 bits (765),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 190/249 (76%), Gaps = 2/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +G GIT+QFVKNVII  +HI  I    GG+IRD +DH GLRTKSDGDGIS+FG+SNVWID
Sbjct  206  EGGGITLQFVKNVIITNLHIKMIVSKPGGMIRDSVDHMGLRTKSDGDGISLFGASNVWID  265

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM  C DGLIDA+ ASTAITISN HFTDH+DVMLFGAN+  T+DKIMQIT+AFNHFG+
Sbjct  266  HVSMSRCADGLIDAVMASTAITISNSHFTDHDDVMLFGANNAHTQDKIMQITLAFNHFGQ  325

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L+QRMPR R G+ HVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP++   +Q+THR  
Sbjct  326  GLVQRMPRVRHGFFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIAPANAATKQVTHREH  385

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
                +WK W WRSEGD+ M GAFFV+SG      +H    D +        T LT+F+GA
Sbjct  386  TPESEWKNWEWRSEGDLMMNGAFFVESGSG--ASQHPAKLDMMPFQPGTFATKLTKFSGA  443

Query  227  LNCRVGSPC  201
            LNC VG PC
Sbjct  444  LNCVVGKPC  452



>gb|KHN01171.1| Putative pectate lyase 3 [Glycine soja]
Length=433

 Score =   298 bits (763),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 168/253 (66%), Positives = 196/253 (77%), Gaps = 9/253 (4%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAGITIQF+KNVIIHGI I +I  GNGGLIRD   H+G RT SDGDGISIFGSSNVWID
Sbjct  186  NGAGITIQFIKNVIIHGIKIFNIQVGNGGLIRDSETHYGFRTYSDGDGISIFGSSNVWID  245

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSMRNC DGLIDAI+ STAITISNGHFTDHN+VMLFGA+D    DKIMQIT+AFNHFGK
Sbjct  246  HVSMRNCKDGLIDAIQGSTAITISNGHFTDHNEVMLFGASDSYDGDKIMQITLAFNHFGK  305

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
            RL+QRMPRCR+G++HVVNNDYTHW MYAIGGS  PTIIS+GNRFIAP++++ ++IT R  
Sbjct  306  RLVQRMPRCRYGFVHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIAPNNVYAKEITKREY  365

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSG----DPDFMKKHNELYDGVQTFKAEDVTWLTR  240
            +  ++WK W WRS  D YM GAFF + G    D  F ++     D +       V  LTR
Sbjct  366  SPEQEWKNWQWRSINDEYMNGAFFREGGSQITDRPFSRQ-----DMITAKPGSYVGRLTR  420

Query  239  FAGALNCRVGSPC  201
            +AG+L C VG PC
Sbjct  421  YAGSLRCIVGKPC  433



>ref|XP_009342871.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=454

 Score =   298 bits (763),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 166/248 (67%), Positives = 194/248 (78%), Gaps = 1/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QFV+NVIIHG+ IH    G+GG+IRD L H G+RT+SDGDGISI+GSSN+W+DH
Sbjct  208  GAGITLQFVQNVIIHGLRIHDTVPGSGGMIRDSLSHIGIRTQSDGDGISIYGSSNIWLDH  267

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D    D IMQIT+AFNHFGK 
Sbjct  268  LSMWNCADGLIDAIQGSTAITISNCHFTRHNDVMLFGASDAFAGDAIMQITVAFNHFGKG  327

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            LIQRMPRCR+G++HVVNNDYTHW MYAIGGSS PTIISQGNRFIAP +   +++T R  A
Sbjct  328  LIQRMPRCRWGFVHVVNNDYTHWIMYAIGGSSHPTIISQGNRFIAPPNQAAKEVTKRDYA  387

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
                WK W WRSEGD+ M GAFFVQSG P+      +L D ++      VT LTRFAG+L
Sbjct  388  PESVWKSWQWRSEGDLMMNGAFFVQSGVPNRKHGFGKL-DMIKAKPGTFVTRLTRFAGSL  446

Query  224  NCRVGSPC  201
            NC+VG  C
Sbjct  447  NCKVGKKC  454



>ref|XP_010112093.1| putative pectate lyase 7 [Morus notabilis]
 gb|EXC32626.1| putative pectate lyase 7 [Morus notabilis]
Length=437

 Score =   298 bits (762),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 167/249 (67%), Positives = 196/249 (79%), Gaps = 1/249 (0%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAGITIQF +NVIIHG+HIH I    GG+IRD +DHFG RT +DGDGISIFGS+N+W+D
Sbjct  190  NGAGITIQFARNVIIHGLHIHDIVASGGGMIRDSVDHFGFRTPADGDGISIFGSTNIWLD  249

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            H+SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D    DKIMQ+T+AFNHFG+
Sbjct  250  HISMSNCQDGLIDAIQGSTAITISNCHFTHHNDVMLFGASDSFEGDKIMQVTVAFNHFGR  309

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L+QRMPRCR+G+ HVVNNDYTHW MYAIGGSS PTIISQGNRFIAP +   +Q+T R  
Sbjct  310  GLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSSHPTIISQGNRFIAPPNNAAKQVTKRDY  369

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            AA  +WK+WTWRSEGD+ M GAFFVQSG+    K+    +D ++      VT LTRFAGA
Sbjct  370  AAEWEWKRWTWRSEGDLMMNGAFFVQSGNRS-KKRPFTRHDMIKAKPGTFVTRLTRFAGA  428

Query  227  LNCRVGSPC  201
            LNC  G  C
Sbjct  429  LNCYAGKKC  437



>ref|XP_008239834.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=438

 Score =   297 bits (761),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 194/249 (78%), Gaps = 3/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            DGA I++QFVKNVII  +HIH+   GNGGLIRD ++HFG RT+SDGDGIS++G++NVWID
Sbjct  193  DGAQISLQFVKNVIITNLHIHNNKPGNGGLIRDSINHFGQRTRSDGDGISMYGATNVWID  252

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVS+ NC DGLIDAI+ STAITISN H T+HNDVMLFG++D +++D++MQIT+AFNHFGK
Sbjct  253  HVSLSNCADGLIDAIQGSTAITISNCHLTNHNDVMLFGSSDSNSQDQVMQITLAFNHFGK  312

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTIISQGNRFIAPS+   +++THR  
Sbjct  313  GLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPSNQATKEVTHRNN  372

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A   +W+ W WRSE D+ M GAFFVQSG P    ++    D +Q      VT LTRFAG 
Sbjct  373  AQEGEWRSWNWRSENDLMMNGAFFVQSGSP---IRNLPKADMIQAKPGSFVTRLTRFAGP  429

Query  227  LNCRVGSPC  201
            L C    PC
Sbjct  430  LKCIKNKPC  438



>ref|XP_006573090.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=448

 Score =   298 bits (762),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 168/253 (66%), Positives = 196/253 (77%), Gaps = 9/253 (4%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAGITIQF+KNVIIHGI I +I  GNGGLIRD   H+G RT SDGDGISIFGSSNVWID
Sbjct  201  NGAGITIQFIKNVIIHGIKIFNIQVGNGGLIRDSETHYGFRTYSDGDGISIFGSSNVWID  260

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSMRNC DGLIDAI+ STAITISNGHFTDHN+VMLFGA+D    DKIMQIT+AFNHFGK
Sbjct  261  HVSMRNCKDGLIDAIQGSTAITISNGHFTDHNEVMLFGASDSYDGDKIMQITLAFNHFGK  320

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
            RL+QRMPRCR+G++HVVNNDYTHW MYAIGGS  PTIIS+GNRFIAP++++ ++IT R  
Sbjct  321  RLVQRMPRCRYGFVHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIAPNNVYAKEITKREY  380

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSG----DPDFMKKHNELYDGVQTFKAEDVTWLTR  240
            +  ++WK W WRS  D YM GAFF + G    D  F ++     D +       V  LTR
Sbjct  381  SPEQEWKNWQWRSINDEYMNGAFFREGGSQITDRPFSRQ-----DMITAKPGSYVGRLTR  435

Query  239  FAGALNCRVGSPC  201
            +AG+L C VG PC
Sbjct  436  YAGSLRCIVGKPC  448



>ref|XP_008365507.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=396

 Score =   296 bits (757),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 168/251 (67%), Positives = 197/251 (78%), Gaps = 7/251 (3%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QFV+NVIIHG+ IH    G+GG+IRD L H G+RT+SDGDGISI+GSSN+W+DH
Sbjct  150  GAGITLQFVQNVIIHGLRIHDTVPGSGGMIRDSLSHIGIRTQSDGDGISIYGSSNIWLDH  209

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D    D IMQIT+AFNHFGK 
Sbjct  210  LSMWNCADGLIDAIQGSTAITISNCHFTHHNDVMLFGASDAFAGDAIMQITVAFNHFGKG  269

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            LIQRMPRCR+G++HVVNNDYTHW MYAIGGSS PTIISQGNRFIAP +   +++T R  A
Sbjct  270  LIQRMPRCRWGFVHVVNNDYTHWIMYAIGGSSHPTIISQGNRFIAPPNQAAKEVTKRDYA  329

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTW---LTRFA  234
                WK W WRSEGD+ M GAFFVQSG P+  KKH   +  +   KA+  T+   LTRFA
Sbjct  330  PESVWKSWQWRSEGDLMMNGAFFVQSGVPN--KKHG--FGKLDMIKAKPGTFVRRLTRFA  385

Query  233  GALNCRVGSPC  201
            G+LNC+VG  C
Sbjct  386  GSLNCKVGKKC  396



>ref|XP_008357758.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=459

 Score =   298 bits (762),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 168/251 (67%), Positives = 197/251 (78%), Gaps = 7/251 (3%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QFV+NVIIHG+ IH    G+GG+IRD L H G+RT+SDGDGISI+GSSN+W+DH
Sbjct  213  GAGITLQFVQNVIIHGLRIHDTVPGSGGMIRDSLSHIGIRTQSDGDGISIYGSSNIWLDH  272

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D    D IMQIT+AFNHFGK 
Sbjct  273  LSMWNCADGLIDAIQGSTAITISNCHFTHHNDVMLFGASDAFAGDAIMQITVAFNHFGKG  332

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            LIQRMPRCR+G++HVVNNDYTHW MYAIGGSS PTIISQGNRFIAP +   +++T R  A
Sbjct  333  LIQRMPRCRWGFVHVVNNDYTHWIMYAIGGSSHPTIISQGNRFIAPPNQAAKEVTKRDYA  392

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTW---LTRFA  234
                WK W WRSEGD+ M GAFFVQSG P+  KKH   +  +   KA+  T+   LTRFA
Sbjct  393  PESVWKSWQWRSEGDLMMNGAFFVQSGVPN--KKHG--FGKLDMIKAKPGTFVRRLTRFA  448

Query  233  GALNCRVGSPC  201
            G+LNC+VG  C
Sbjct  449  GSLNCKVGKKC  459



>emb|CAN79927.1| hypothetical protein VITISV_042447 [Vitis vinifera]
Length=439

 Score =   296 bits (759),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 160/249 (64%), Positives = 197/249 (79%), Gaps = 3/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            G GITIQFVKN+IIH +HIH I    GG+IRD +DH+GLRT SDGDG+SIFGSSNVW+DH
Sbjct  193  GCGITIQFVKNIIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGDGVSIFGSSNVWVDH  252

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM NC DGL+D I ASTAITISN HFT+HN+VMLFG ++    DKIMQ+T+AFNH+G+ 
Sbjct  253  LSMSNCKDGLVDVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDKIMQVTVAFNHYGRG  312

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G++HVVNNDYTHW MYAIGGS +PTIISQGNRFIAP ++  +++T R  A
Sbjct  313  LVQRMPRCRYGFVHVVNNDYTHWLMYAIGGSQNPTIISQGNRFIAPPNMACKEVTKRDYA  372

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHN-ELYDGVQTFKAEDVTWLTRFAGA  228
            +P++WK WTW S+GD+   GAFFVQSGDP   KKH    YD ++      V  LTRF+G+
Sbjct  373  SPDEWKSWTWISQGDLLQNGAFFVQSGDPK--KKHPFTRYDMIKAKPGTFVNRLTRFSGS  430

Query  227  LNCRVGSPC  201
            L C+V  PC
Sbjct  431  LGCKVNQPC  439



>ref|XP_002282500.3| PREDICTED: pectate lyase [Vitis vinifera]
Length=443

 Score =   296 bits (759),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 160/249 (64%), Positives = 197/249 (79%), Gaps = 3/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            G GITIQFVKN+IIH +HIH I    GG+IRD +DH+GLRT SDGDG+SIFGSSNVW+DH
Sbjct  197  GCGITIQFVKNIIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGDGVSIFGSSNVWVDH  256

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM NC DGL+D I ASTAITISN HFT+HN+VMLFG ++    DKIMQ+T+AFNH+G+ 
Sbjct  257  LSMSNCKDGLVDVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDKIMQVTVAFNHYGRG  316

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G++HVVNNDYTHW MYAIGGS +PTIISQGNRFIAP ++  +++T R  A
Sbjct  317  LVQRMPRCRYGFVHVVNNDYTHWLMYAIGGSQNPTIISQGNRFIAPPNMACKEVTKRDYA  376

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHN-ELYDGVQTFKAEDVTWLTRFAGA  228
            +P++WK WTW S+GD+   GAFFVQSGDP   KKH    YD ++      V  LTRF+G+
Sbjct  377  SPDEWKSWTWISQGDLLQNGAFFVQSGDPK--KKHPFTRYDMIKAKPGTFVNRLTRFSGS  434

Query  227  LNCRVGSPC  201
            L C+V  PC
Sbjct  435  LGCKVNQPC  443



>ref|XP_007209148.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
 gb|EMJ10347.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
Length=440

 Score =   296 bits (759),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 194/249 (78%), Gaps = 3/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            DGA I++QFVKNVII  +HIH+   GNGG+IRD ++HFG RT+SDGDGIS+FG++NVWID
Sbjct  195  DGAQISLQFVKNVIITNLHIHNNKPGNGGMIRDSINHFGQRTRSDGDGISMFGATNVWID  254

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVS+ NC DGLIDAI+ STAITISN H T+HNDVMLFG++D +++D++MQIT+AFNHFGK
Sbjct  255  HVSLSNCADGLIDAIQGSTAITISNCHLTNHNDVMLFGSSDSNSQDQVMQITLAFNHFGK  314

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTIISQGNRFIAPS+   +++THR  
Sbjct  315  GLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPSNQATKEVTHRNN  374

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A   +W+ W WRSE D+ M GAFFVQSG P    ++    D +Q      VT LTRFAG 
Sbjct  375  AQEGEWRSWNWRSENDLMMNGAFFVQSGSP---IRNLPKADMIQAKPGSFVTRLTRFAGP  431

Query  227  LNCRVGSPC  201
            L C    PC
Sbjct  432  LKCVKNKPC  440



>ref|XP_008339935.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score =   296 bits (758),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 188/249 (76%), Gaps = 2/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAGIT+QFVKNVII  +HI  I    GGLIRD +DH GLRT+SDGDGIS+FG+SNVWID
Sbjct  206  EGAGITLQFVKNVIITNLHIKMIVTKPGGLIRDSVDHIGLRTQSDGDGISLFGASNVWID  265

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM  C DGLIDAI  STAITISN HFTDH++ MLFGAN+  T+DKIMQIT+AFNHFG+
Sbjct  266  HVSMSRCADGLIDAIMGSTAITISNSHFTDHDEAMLFGANNAHTQDKIMQITLAFNHFGQ  325

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L+QRMPR R G+ HVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP +   +Q+THR  
Sbjct  326  GLVQRMPRVRHGFFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIAPINGVTKQVTHREN  385

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
                +WK W WRSEGD+ M GAFFV+SG      KH    D +       V  LT+F+GA
Sbjct  386  TPEAEWKNWEWRSEGDLMMNGAFFVESGSG--ASKHPAKLDXMPFKPGTXVXTLTKFSGA  443

Query  227  LNCRVGSPC  201
            LNC VG PC
Sbjct  444  LNCAVGKPC  452



>emb|CBI22159.3| unnamed protein product [Vitis vinifera]
Length=468

 Score =   296 bits (759),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 160/249 (64%), Positives = 197/249 (79%), Gaps = 3/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            G GITIQFVKN+IIH +HIH I    GG+IRD +DH+GLRT SDGDG+SIFGSSNVW+DH
Sbjct  222  GCGITIQFVKNIIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGDGVSIFGSSNVWVDH  281

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM NC DGL+D I ASTAITISN HFT+HN+VMLFG ++    DKIMQ+T+AFNH+G+ 
Sbjct  282  LSMSNCKDGLVDVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDKIMQVTVAFNHYGRG  341

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G++HVVNNDYTHW MYAIGGS +PTIISQGNRFIAP ++  +++T R  A
Sbjct  342  LVQRMPRCRYGFVHVVNNDYTHWLMYAIGGSQNPTIISQGNRFIAPPNMACKEVTKRDYA  401

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHN-ELYDGVQTFKAEDVTWLTRFAGA  228
            +P++WK WTW S+GD+   GAFFVQSGDP   KKH    YD ++      V  LTRF+G+
Sbjct  402  SPDEWKSWTWISQGDLLQNGAFFVQSGDPK--KKHPFTRYDMIKAKPGTFVNRLTRFSGS  459

Query  227  LNCRVGSPC  201
            L C+V  PC
Sbjct  460  LGCKVNQPC  468



>ref|XP_007037229.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY21730.1| Pectate lyase family protein [Theobroma cacao]
Length=434

 Score =   295 bits (756),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 164/248 (66%), Positives = 194/248 (78%), Gaps = 3/248 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GA IT+Q+++NVIIHGIHI    E NGG+IRD +DHFG RTKSDGDGISIFGS N+WIDH
Sbjct  190  GAQITLQYIQNVIIHGIHIRLSVEANGGMIRDSVDHFGFRTKSDGDGISIFGSHNIWIDH  249

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM  C DGLID I+ASTAITISN HFTDHNDVMLFGA+D  + DKIMQ+T+AFNHFG+ 
Sbjct  250  VSMSRCSDGLIDVIQASTAITISNCHFTDHNDVMLFGASDSFSDDKIMQVTVAFNHFGQG  309

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+IHVVNNDYTHW MYAIGGS+ PTI+SQGNRFIAP +I  +++T R  A
Sbjct  310  LVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSNQPTILSQGNRFIAPPNIACKEVTKREYA  369

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
               +WK W WRSE D+ M GAFFVQSG P  + + N   D ++      VT LTRF+GAL
Sbjct  370  PESEWKSWNWRSENDLMMNGAFFVQSGSP--IGRGNR-QDVIKAKPGTFVTRLTRFSGAL  426

Query  224  NCRVGSPC  201
            +C    PC
Sbjct  427  HCFKNKPC  434



>ref|XP_010256490.1| PREDICTED: pectate lyase-like [Nelumbo nucifera]
Length=441

 Score =   295 bits (755),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 160/249 (64%), Positives = 196/249 (79%), Gaps = 3/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQFVKNVIIHG+H+H I  G+GGLIRD +DH+GLRT+SDGDGIS+FG++NVWIDH
Sbjct  195  GAGITIQFVKNVIIHGLHVHDIVPGSGGLIRDSVDHYGLRTQSDGDGISLFGATNVWIDH  254

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM NC DGLIDAI ++TA+T+SN HFT HN+VMLFGA+   + D +MQIT+AFNHFG+ 
Sbjct  255  ISMSNCKDGLIDAIMSTTAVTVSNCHFTHHNEVMLFGASGSYSGDAVMQITVAFNHFGRG  314

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTIISQGNRFIAP  +  +++T R  A
Sbjct  315  LVQRMPRCRWGFAHVVNNDYTHWIMYAIGGSEHPTIISQGNRFIAPPTLAAKEVTKRDYA  374

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHN-ELYDGVQTFKAEDVTWLTRFAGA  228
               +WK WTWRSE D+ M GAFFVQSG+P   +KH     D +       V+ LTRF+GA
Sbjct  375  PESEWKHWTWRSEDDLMMNGAFFVQSGNPS--RKHPFSKKDMIPAKPGTYVSTLTRFSGA  432

Query  227  LNCRVGSPC  201
            L C++  PC
Sbjct  433  LGCKINKPC  441



>ref|XP_004147462.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
 ref|XP_004163529.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
Length=431

 Score =   295 bits (754),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 162/248 (65%), Positives = 193/248 (78%), Gaps = 1/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG++IQF +NVIIHG+ IHH+    GG+IRD  +H GLRT SDGDGISIFGS+N+W+DH
Sbjct  185  GAGLSIQFARNVIIHGLRIHHVISTGGGMIRDTANHVGLRTVSDGDGISIFGSTNIWLDH  244

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D    D IMQ+T+AFNHFGK 
Sbjct  245  LSMSNCQDGLIDAIQGSTAITISNSHFTHHNDVMLFGASDSYQGDSIMQVTVAFNHFGKG  304

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTIISQGNRFIAP +   RQIT+R  A
Sbjct  305  LVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPPNPAARQITNRNYA  364

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
                WK WTWRSEGD+ M GA+FVQSG+P   + ++  +D ++      V  LTRF+G+L
Sbjct  365  TESVWKTWTWRSEGDLMMNGAYFVQSGNPSKRRPYSR-FDMIKAKPGTFVRRLTRFSGSL  423

Query  224  NCRVGSPC  201
            NC VG PC
Sbjct  424  NCYVGRPC  431



>ref|XP_010068708.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
 gb|KCW64557.1| hypothetical protein EUGRSUZ_G02162 [Eucalyptus grandis]
Length=435

 Score =   295 bits (754),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 166/250 (66%), Positives = 197/250 (79%), Gaps = 5/250 (2%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            DGA IT+QFV+NVIIHG+HIH    GNGGLIRD L+H+G RT SDGDGIS+FG++NVWID
Sbjct  190  DGAQITLQFVRNVIIHGLHIHDTHPGNGGLIRDSLEHYGFRTGSDGDGISLFGATNVWID  249

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM +CYDGLID I+ASTAITISN HFT HN+VMLFG +D  + D  MQIT+AFNHFG+
Sbjct  250  HVSMSHCYDGLIDVIQASTAITISNCHFTRHNEVMLFGGSDTYSDDAHMQITVAFNHFGQ  309

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L+QRMPRCR+G++HVVNNDYTHW MYAIGGS  PTIISQGNRFIAP D + +++T R  
Sbjct  310  GLVQRMPRCRWGFVHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPLDPNCKEVTKRDY  369

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDP-DFMKKHNELYDGVQTFKAEDVTWLTRFAG  231
            AA + WK W+WRSE D+ + GAFFVQSG P   + K+N +     +F    VT LTRFAG
Sbjct  370  AAEDVWKSWSWRSEDDLMLNGAFFVQSGSPIRNVNKNNVIKAKPGSF----VTRLTRFAG  425

Query  230  ALNCRVGSPC  201
            ALNC  G PC
Sbjct  426  ALNCVKGKPC  435



>gb|KGN59593.1| hypothetical protein Csa_3G827350 [Cucumis sativus]
Length=441

 Score =   295 bits (754),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 162/248 (65%), Positives = 193/248 (78%), Gaps = 1/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG++IQF +NVIIHG+ IHH+    GG+IRD  +H GLRT SDGDGISIFGS+N+W+DH
Sbjct  195  GAGLSIQFARNVIIHGLRIHHVISTGGGMIRDTANHVGLRTVSDGDGISIFGSTNIWLDH  254

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D    D IMQ+T+AFNHFGK 
Sbjct  255  LSMSNCQDGLIDAIQGSTAITISNSHFTHHNDVMLFGASDSYQGDSIMQVTVAFNHFGKG  314

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTIISQGNRFIAP +   RQIT+R  A
Sbjct  315  LVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPPNPAARQITNRNYA  374

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
                WK WTWRSEGD+ M GA+FVQSG+P   + ++  +D ++      V  LTRF+G+L
Sbjct  375  TESVWKTWTWRSEGDLMMNGAYFVQSGNPSKRRPYSR-FDMIKAKPGTFVRRLTRFSGSL  433

Query  224  NCRVGSPC  201
            NC VG PC
Sbjct  434  NCYVGRPC  441



>ref|XP_007046218.1| Pectate lyase family protein, putative [Theobroma cacao]
 gb|EOY02050.1| Pectate lyase family protein, putative [Theobroma cacao]
Length=441

 Score =   295 bits (754),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 156/248 (63%), Positives = 200/248 (81%), Gaps = 1/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQF +N+IIHG+HIH I +G+GG+IRD +DH+G RTKSDGDG+S+FG++N+W+DH
Sbjct  195  GAGITIQFARNIIIHGLHIHDIVQGSGGMIRDSVDHYGFRTKSDGDGVSLFGATNIWLDH  254

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM NCYDGLIDAI+ STAITISN HFT+HN+VMLFGA+D  ++D+ MQIT+AF HFGK 
Sbjct  255  LSMYNCYDGLIDAIQGSTAITISNCHFTNHNEVMLFGASDSYSEDQKMQITVAFTHFGKG  314

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+IHVVNNDYTHW MYAIGGSS PTIISQGNRF+AP +   +++T R  A
Sbjct  315  LVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTIISQGNRFVAPPNAAAKEVTKRDYA  374

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
             PE WK W+WRSEGD+ + GAFF QSGDP   ++    +  +     + V+ LTR++G+L
Sbjct  375  PPEVWKNWSWRSEGDLMVNGAFFTQSGDPRASRRFLGNF-MISAKPGQMVSLLTRYSGSL  433

Query  224  NCRVGSPC  201
            +C    PC
Sbjct  434  DCVRRRPC  441



>ref|XP_002270089.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32015.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   294 bits (753),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 166/252 (66%), Positives = 199/252 (79%), Gaps = 5/252 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQFVKNVIIHG+HIH I  G+GGLIRD ++HFG R++SDGDGISI+GSS+VWIDH
Sbjct  193  GAGITIQFVKNVIIHGLHIHDIVSGSGGLIRDSVNHFGYRSRSDGDGISIYGSSHVWIDH  252

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
             SM NC DGLIDAI+ STAITISN HFT HN+VMLFGA+D ++ D+IMQIT+AFNHFG+ 
Sbjct  253  NSMSNCKDGLIDAIQGSTAITISNNHFTKHNEVMLFGASDSNSADEIMQITVAFNHFGRG  312

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHK----RQITH  417
            LIQRMPRCR+G+ HVVNNDYTHWNMYAIGGS+ PTIISQGNR+ AP  +      +Q+T 
Sbjct  313  LIQRMPRCRWGFFHVVNNDYTHWNMYAIGGSAHPTIISQGNRYTAPHLVDPKHDAKQVTK  372

Query  416  RVGAAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRF  237
            R  A   +WK+WTWRSEGD+   GAFFV SG+P     ++ L D ++      V+ LTRF
Sbjct  373  RDYAMESEWKKWTWRSEGDLMRNGAFFVPSGNPSKRMPYSRL-DMIKAKPGTYVSRLTRF  431

Query  236  AGALNCRVGSPC  201
            +GAL CR G PC
Sbjct  432  SGALTCRRGGPC  443



>ref|XP_008446067.1| PREDICTED: pectate lyase-like, partial [Cucumis melo]
Length=381

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 199/249 (80%), Gaps = 3/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +G  IT+QFV+N+IIH +HIH I  GNGG IRD + H+G RT+SDGDGIS+FGSS VWID
Sbjct  136  NGGQITLQFVRNIIIHNLHIHDIKAGNGGFIRDSVSHYGYRTQSDGDGISMFGSSRVWID  195

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM NC DGLIDA+ ASTAITISN HFT HNDV+L GA+D  + DKIMQ+T+AFNHFGK
Sbjct  196  HVSMSNCQDGLIDAVMASTAITISNCHFTHHNDVILLGASDSYSNDKIMQVTLAFNHFGK  255

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L+QRMPRCR+G+IHVVNNDYTHW MYAIGGS +PTIISQGNRFIAP + + +++T RV 
Sbjct  256  GLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSHNPTIISQGNRFIAPPNPNSKEVTKRVY  315

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A+  +W+ W WRSEGD+ M GAFF+QSG+P  ++++++  D + +     VT LTRFAG 
Sbjct  316  ASEREWRSWNWRSEGDLMMNGAFFIQSGNP--IRRYSK-KDVIHSKPGTFVTRLTRFAGP  372

Query  227  LNCRVGSPC  201
            L C++  PC
Sbjct  373  LKCKMNQPC  381



>ref|XP_009403112.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=437

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 164/248 (66%), Positives = 193/248 (78%), Gaps = 2/248 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGI +QFV NVIIHG+HIH I  GNGG+IRD   HFGLRT+SDGDGISI+GSSN+WIDH
Sbjct  192  GAGIMLQFVHNVIIHGLHIHDIKAGNGGMIRDSEHHFGLRTRSDGDGISIYGSSNIWIDH  251

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC DGLID I+ STAITISN HFT HNDVMLFGA+D    D +MQIT+AFNHFGK 
Sbjct  252  VSMSNCMDGLIDVIQGSTAITISNSHFTKHNDVMLFGASDSYQGDAMMQITVAFNHFGKG  311

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G++HVVNNDYTHW MYA+GGS  PTI+SQGNR+IAP  +  +++T R  A
Sbjct  312  LVQRMPRCRWGFVHVVNNDYTHWLMYAVGGSQHPTILSQGNRYIAPHSLAAKEVTKRDYA  371

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
                WK WTWRSEGD+   GAFFV+SG P+ MK + +  D ++      VT LTRF+GAL
Sbjct  372  PQAVWKDWTWRSEGDLMQNGAFFVESGPPNRMKFNTK--DLIKAKPGSFVTRLTRFSGAL  429

Query  224  NCRVGSPC  201
            NC  G PC
Sbjct  430  NCFPGRPC  437



>ref|XP_009389712.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=438

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 159/248 (64%), Positives = 195/248 (79%), Gaps = 1/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG+TIQ+V NVI+H +HI  I  GNGG+IRD   H+GLRT+SDGDGISI+GSSN+WIDH
Sbjct  192  GAGVTIQYVHNVIVHNLHIQDIKAGNGGMIRDSEHHYGLRTRSDGDGISIYGSSNIWIDH  251

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC DGLIDAIE STAITISN HFT HN+ MLFGA+D  + D IMQIT+AFNHFGK 
Sbjct  252  VSMSNCMDGLIDAIEGSTAITISNSHFTRHNEAMLFGASDAYSPDAIMQITVAFNHFGKG  311

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G++HVVNNDYTHW MYA+GGS  PTIISQGNR+IAPS+   +++T R  A
Sbjct  312  LVQRMPRCRWGFVHVVNNDYTHWEMYAVGGSQHPTIISQGNRYIAPSNPFAKEVTKRDYA  371

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
                WKQWTWRSEGD+ + GAFFV+SG    ++K+++  D ++      VT LTR++GAL
Sbjct  372  TESVWKQWTWRSEGDLMLNGAFFVKSGGGGGLQKYDKT-DIIKAKPGSFVTRLTRYSGAL  430

Query  224  NCRVGSPC  201
            +C    PC
Sbjct  431  DCFPQRPC  438



>ref|XP_007227702.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
 gb|EMJ28901.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
Length=446

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 165/249 (66%), Positives = 188/249 (76%), Gaps = 2/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAGIT+QFVKNVII  +HI  I    GG+IRD +DH G RTKSDGDGISIFGSSNVWID
Sbjct  200  NGAGITLQFVKNVIITNLHIKKIVPKQGGMIRDSVDHIGRRTKSDGDGISIFGSSNVWID  259

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM NC DGLIDAI  STAITISN HFT HNDVMLFGA++  T+DKIMQIT+AFNHFG+
Sbjct  260  HVSMENCADGLIDAIMGSTAITISNSHFTHHNDVMLFGASNSYTQDKIMQITVAFNHFGQ  319

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L+QRMPRCR G+ HVVNNDYTHW MYAIGGS +PTIISQGNRFIAP +   +++T R  
Sbjct  320  GLVQRMPRCRHGFFHVVNNDYTHWLMYAIGGSMNPTIISQGNRFIAPPNQGAKEVTKRDH  379

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
             A  +WK W WRSEGD+ M GA FVQSG      KH    D +       V  LT+F+GA
Sbjct  380  TAEAEWKNWEWRSEGDLMMNGAVFVQSGSGK--SKHPAKMDLMPFKPGTYVAKLTKFSGA  437

Query  227  LNCRVGSPC  201
            L+C VG PC
Sbjct  438  LDCFVGKPC  446



>ref|XP_008443432.1| PREDICTED: probable pectate lyase 19 [Cucumis melo]
Length=441

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 162/248 (65%), Positives = 193/248 (78%), Gaps = 1/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG++IQF +NVIIHG+ IHH+    GG+IRD  +H GLRT SDGDGISIFGSSN+W+DH
Sbjct  195  GAGLSIQFARNVIIHGLRIHHVISTGGGMIRDTANHVGLRTVSDGDGISIFGSSNIWLDH  254

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D    D IMQ+T+AFNHFGK 
Sbjct  255  LSMSNCQDGLIDAIQGSTAITISNSHFTHHNDVMLFGASDSYQGDSIMQVTVAFNHFGKG  314

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTIISQGNRFIAP +   RQIT+R  A
Sbjct  315  LVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPPNPAARQITNRNYA  374

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
                WK WTWRSEGD+ M GA+F+QSG+P   + ++  +D ++      V  LTRF+G+L
Sbjct  375  PESVWKTWTWRSEGDLMMNGAYFIQSGNPSKRRPYSR-FDMIKAKPGTFVRRLTRFSGSL  433

Query  224  NCRVGSPC  201
            NC VG PC
Sbjct  434  NCFVGRPC  441



>emb|CAN77957.1| hypothetical protein VITISV_021245 [Vitis vinifera]
Length=407

 Score =   292 bits (748),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 163/249 (65%), Positives = 196/249 (79%), Gaps = 3/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAG+T+QFV N+IIHG+HIH I  GNGGLIRD   H+G RT+SDGDGISIFG++N+WID
Sbjct  162  NGAGLTLQFVHNIIIHGLHIHDIKVGNGGLIRDSASHYGFRTRSDGDGISIFGATNIWID  221

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            H+SM NC DGLIDAI ASTAITISN HFT HN+VMLFGA+D  + D IMQITI FNHFG+
Sbjct  222  HISMSNCADGLIDAIMASTAITISNCHFTHHNEVMLFGASDGYSGDAIMQITITFNHFGQ  281

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTI+SQGNRFIAP DI+ +++T R  
Sbjct  282  GLTQRMPRCRWGFFHVVNNDYTHWLMYAIGGSHHPTILSQGNRFIAPPDINCKEVTKRDY  341

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            +    WK WTWRS+GD+ M GAFFV+SGDP+F   +  +   ++      VT LTRF+GA
Sbjct  342  SPESVWKSWTWRSQGDLMMNGAFFVESGDPNFDFSNKYV---IRAKPGAFVTRLTRFSGA  398

Query  227  LNCRVGSPC  201
            L+CR G PC
Sbjct  399  LSCREGMPC  407



>ref|XP_007224275.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
 gb|EMJ25474.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
Length=443

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 192/249 (77%), Gaps = 2/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            DGAGITIQFVKNVII  +HI  I    GG+IRD +DHFG RTKSDGDGISIFGSSN+WID
Sbjct  197  DGAGITIQFVKNVIITNLHIKQIKAKEGGIIRDSVDHFGQRTKSDGDGISIFGSSNIWID  256

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM NC DGLIDAI  ST ITISN HFT HN+V+LFGA++  T+DK+MQIT+AFNHFGK
Sbjct  257  HVSMENCTDGLIDAIMGSTGITISNCHFTKHNEVLLFGASNSYTQDKMMQITVAFNHFGK  316

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L+QRMPRCR G+ HVVNNDYTHW MYAIGGS +PTIISQGNRFIA  +   +++T R  
Sbjct  317  GLVQRMPRCRHGFFHVVNNDYTHWLMYAIGGSMNPTIISQGNRFIAGLNSATKEVTKREY  376

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
             A  +WK W W+SEGD++M GAFFV+SG P  ++   +  D +       VT +T+FAGA
Sbjct  377  TAEAEWKNWLWKSEGDLFMNGAFFVESGSPANLRA--DKLDMIPFKPGTYVTKMTKFAGA  434

Query  227  LNCRVGSPC  201
            L+C VG PC
Sbjct  435  LDCFVGKPC  443



>gb|KCW52797.1| hypothetical protein EUGRSUZ_J02132 [Eucalyptus grandis]
Length=451

 Score =   293 bits (751),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 166/261 (64%), Positives = 195/261 (75%), Gaps = 15/261 (6%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQFV+NVIIH I IH I    GG+IRD +DH G+RT SDGDGISIFGS+N+WIDH
Sbjct  193  GAGITIQFVRNVIIHNIRIHDIVTRPGGIIRDAVDHVGIRTMSDGDGISIFGSTNIWIDH  252

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHND-------------VMLFGANDLSTKDKI  624
            VSM+ C DGLIDAIE STAITISNGH+T HND             VMLFGA+DL  +DKI
Sbjct  253  VSMKRCQDGLIDAIEGSTAITISNGHYTHHNDTLMFNLHPGTYVQVMLFGASDLYPRDKI  312

Query  623  MQITIAFNHFGKRLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS  444
            MQ+T+AFNHFGK LIQRMPRCR+G+ HVVNNDYTHW MYAIGGSS PTIISQGNRFIAP 
Sbjct  313  MQVTVAFNHFGKGLIQRMPRCRWGFFHVVNNDYTHWLMYAIGGSSQPTIISQGNRFIAPP  372

Query  443  DIHKRQITHRVGAAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKA  264
            ++  +++T R  A P+ W+ WTWRS+GD+ + GAFFVQSG P  +KK     D ++    
Sbjct  373  NLAAKEVTKRDYATPDVWRSWTWRSQGDLLINGAFFVQSGQP--LKKKYGRKDMIKAKPG  430

Query  263  EDVTWLTRFAGALNCRVGSPC  201
              V  LTRF+G LNC+    C
Sbjct  431  TFVRRLTRFSGTLNCKPKKRC  451



>ref|XP_002272638.2| PREDICTED: pectate lyase-like [Vitis vinifera]
Length=434

 Score =   293 bits (749),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 163/249 (65%), Positives = 196/249 (79%), Gaps = 3/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAG+T+QFV N+IIHG+HIH I  GNGGLIRD   H+G RT+SDGDGISIFG++N+WID
Sbjct  189  NGAGLTLQFVHNIIIHGLHIHDIKVGNGGLIRDSASHYGFRTRSDGDGISIFGATNIWID  248

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            H+SM NC DGLIDAI ASTAITISN HFT HN+VMLFGA+D  + D IMQITI FNHFG+
Sbjct  249  HISMSNCADGLIDAIMASTAITISNCHFTHHNEVMLFGASDGYSGDAIMQITITFNHFGQ  308

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTI+SQGNRFIAP DI+ +++T R  
Sbjct  309  GLTQRMPRCRWGFFHVVNNDYTHWLMYAIGGSHHPTILSQGNRFIAPPDINCKEVTKRDY  368

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            +    WK WTWRS+GD+ M GAFFV+SGDP+F   +  +   ++      VT LTRF+GA
Sbjct  369  SPESVWKSWTWRSQGDLMMNGAFFVESGDPNFDFSNKYV---IRAKPGAFVTRLTRFSGA  425

Query  227  LNCRVGSPC  201
            L+CR G PC
Sbjct  426  LSCREGMPC  434



>ref|XP_008221660.1| PREDICTED: probable pectate lyase 3 [Prunus mume]
Length=443

 Score =   293 bits (749),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 164/249 (66%), Positives = 187/249 (75%), Gaps = 2/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            DGAGIT+QFVKNVII  +HI  I    GG+IRD +DH G RT+SDGDGISIFGSSNVWID
Sbjct  197  DGAGITLQFVKNVIITNLHIKRIVPKGGGMIRDSVDHLGQRTRSDGDGISIFGSSNVWID  256

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM NC DGLIDAI  STAITISN HFT HNDVMLFGA++  T+DKIMQIT+AFNHFG+
Sbjct  257  HVSMENCADGLIDAIMGSTAITISNSHFTHHNDVMLFGASNSYTQDKIMQITVAFNHFGQ  316

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L+QRMPRCR G+ HVVNNDYTHW MYAIGGS +PTIISQGNRFIAP +   +++T R  
Sbjct  317  GLVQRMPRCRHGFFHVVNNDYTHWLMYAIGGSMNPTIISQGNRFIAPPNQGAKEVTKRDH  376

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
                +WK+W WRSEGD+ M GA FVQSG       H    D +       V  LT+FAGA
Sbjct  377  TPEAEWKKWEWRSEGDLMMNGAIFVQSGSGK--SNHPAKMDLMPFKPGTYVAELTKFAGA  434

Query  227  LNCRVGSPC  201
            L+C VG PC
Sbjct  435  LDCFVGKPC  443



>ref|XP_003613595.1| Pectate lyase [Medicago truncatula]
 gb|AES96553.1| pectate lyase P59-like protein [Medicago truncatula]
Length=449

 Score =   293 bits (749),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 165/248 (67%), Positives = 191/248 (77%), Gaps = 1/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQF++NVIIHGI I  I  G+GGLIRDG DHFG RT SDGDGISIFGSSN+WIDH
Sbjct  203  GAGITIQFIENVIIHGIKIFDIVVGSGGLIRDGQDHFGQRTMSDGDGISIFGSSNIWIDH  262

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSMRNC DGL+DAI  STAITISN HFTDHN+VMLFGA+D    D+ MQIT+AFNHFGKR
Sbjct  263  VSMRNCRDGLVDAIMGSTAITISNSHFTDHNEVMLFGASDGYGGDEKMQITVAFNHFGKR  322

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            LIQRMPRCRFG+IHV+NNDYTHW MYAIGGS  PTIIS+GNRFIAP++ H ++IT R   
Sbjct  323  LIQRMPRCRFGFIHVLNNDYTHWEMYAIGGSMHPTIISEGNRFIAPNNGHAKEITKREYV  382

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
                WK W WRS  D+Y+ GAFF Q G P+   +     D +++     V  LTR++G+L
Sbjct  383  DESVWKSWQWRSINDVYLNGAFFRQGG-PELKDRPFSRKDMIKSRPGTYVGRLTRYSGSL  441

Query  224  NCRVGSPC  201
             C VG PC
Sbjct  442  RCIVGKPC  449



>ref|XP_004155392.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=432

 Score =   292 bits (748),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 162/248 (65%), Positives = 197/248 (79%), Gaps = 1/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+Q+++NVIIHG+ IHHI  G+GG+IRD +DH GLRT SDGDGISIFGSSNVWIDH
Sbjct  186  GAGITLQYIRNVIIHGLRIHHIVVGSGGMIRDAVDHVGLRTMSDGDGISIFGSSNVWIDH  245

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC+DGLIDAI  STAITISN HFT HN+VMLFGA+D  ++D+IMQIT+AFNHFG+ 
Sbjct  246  VSMSNCHDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDGYSQDQIMQITVAFNHFGQG  305

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTI+SQGNRFIAP +++ +++T R  +
Sbjct  306  LVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNVYAKEVTKREYS  365

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
              + WK WTWRSEGD+ M GAFFV SGD    +  + + D +       V  +TRFAG+L
Sbjct  366  PEQVWKSWTWRSEGDLMMNGAFFVTSGDQSKRRPFSRM-DMISYKPGTYVKRMTRFAGSL  424

Query  224  NCRVGSPC  201
             C VG PC
Sbjct  425  ACFVGRPC  432



>ref|XP_004135462.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
 gb|KGN51889.1| hypothetical protein Csa_5G604340 [Cucumis sativus]
Length=432

 Score =   292 bits (748),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 162/248 (65%), Positives = 197/248 (79%), Gaps = 1/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+Q+++NVIIHG+ IHHI  G+GG+IRD +DH GLRT SDGDGISIFGSSNVWIDH
Sbjct  186  GAGITLQYIRNVIIHGLRIHHIVVGSGGMIRDAVDHVGLRTMSDGDGISIFGSSNVWIDH  245

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC+DGLIDAI  STAITISN HFT HN+VMLFGA+D  ++D+IMQIT+AFNHFG+ 
Sbjct  246  VSMSNCHDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDGYSQDQIMQITVAFNHFGQG  305

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTI+SQGNRFIAP +++ +++T R  +
Sbjct  306  LVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNVYAKEVTKREYS  365

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
              + WK WTWRSEGD+ M GAFFV SGD    +  + + D +       V  +TRFAG+L
Sbjct  366  PEQVWKSWTWRSEGDLMMNGAFFVTSGDQSKRRPFSRM-DMISYKPGTYVKRMTRFAGSL  424

Query  224  NCRVGSPC  201
             C VG PC
Sbjct  425  ACFVGRPC  432



>ref|XP_004490004.1| PREDICTED: probable pectate lyase 3-like isoform X2 [Cicer arietinum]
Length=376

 Score =   290 bits (742),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 161/249 (65%), Positives = 190/249 (76%), Gaps = 1/249 (0%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAGITIQ+++NVIIHGI +  I  G+GGL+RD  +H+GLRT SDGDGISIFGSSN+WID
Sbjct  129  NGAGITIQYIRNVIIHGIKVFDIVVGSGGLVRDSENHYGLRTMSDGDGISIFGSSNIWID  188

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSMRNC DGLIDAI  STAITISN HFTDHN+VMLFGA+D    D+ MQIT+AFNHFGK
Sbjct  189  HVSMRNCRDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDGYDADQKMQITVAFNHFGK  248

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
            RLIQRMPRCRFG+IHVVNNDYTHW MYAIGGS  PTIIS+GNRFIAP + + ++IT R  
Sbjct  249  RLIQRMPRCRFGFIHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIAPDNGYAKEITKREY  308

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            +   +WK W WRS  D+YM GAFF Q G  +   +     D +       V  LTR++G+
Sbjct  309  SPESEWKNWQWRSINDVYMNGAFFRQGGS-ELTNRPFSKKDMITAKPGAYVGRLTRYSGS  367

Query  227  LNCRVGSPC  201
            L C VG PC
Sbjct  368  LKCIVGKPC  376



>ref|XP_008221658.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=443

 Score =   292 bits (748),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 190/249 (76%), Gaps = 2/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            DGA ITIQFVKNVII  IHI  I    GG+IRD +DHFG RTKSDGDGISI+GSSN+WID
Sbjct  197  DGACITIQFVKNVIITNIHIKQIKAKEGGMIRDSVDHFGQRTKSDGDGISIYGSSNIWID  256

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM NC DGLID I  ST ITISN HFT HN+VMLFGA++  T+DK+MQIT+AFNHFGK
Sbjct  257  HVSMENCTDGLIDVIMGSTGITISNSHFTKHNEVMLFGASNSYTQDKMMQITVAFNHFGK  316

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L+QRMPRCR G+ HVVNNDYTHW MYAIGGS +PTIISQGNRFIA  +   +++T R  
Sbjct  317  GLVQRMPRCRHGFFHVVNNDYTHWLMYAIGGSMNPTIISQGNRFIAGLNSAAKEVTKREY  376

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
             A  +WK W W+SEGD++M GAFFV+SG P  ++   +  D +       VT LT+FAGA
Sbjct  377  TAEAEWKNWLWKSEGDLFMNGAFFVESGSPANLRA--DKLDMIPFKPGTYVTKLTKFAGA  434

Query  227  LNCRVGSPC  201
            L+C VG PC
Sbjct  435  LDCFVGKPC  443



>ref|XP_009408830.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=436

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 161/248 (65%), Positives = 191/248 (77%), Gaps = 4/248 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG+TIQFV NVI+H I IH I  GNGG+IRD  +H+GLRT+SDGDGISIFG+SN+WIDH
Sbjct  193  GAGLTIQFVHNVIVHNIRIHDIKAGNGGMIRDSEEHYGLRTRSDGDGISIFGASNIWIDH  252

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC DGLIDAIE STAITISN HFT HNDVMLFGA+D  + D IMQIT+AFNHFGK 
Sbjct  253  VSMSNCMDGLIDAIEGSTAITISNSHFTQHNDVMLFGASDAFSGDAIMQITVAFNHFGKG  312

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G++HVVNNDYTHW MYA+GGS  PTI+SQGNRFIAP  +  +++T R  +
Sbjct  313  LVQRMPRCRWGFVHVVNNDYTHWMMYAVGGSQHPTILSQGNRFIAPPTLFAKEVTKREYS  372

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
                WKQW+WRSEGD+   GAFFV+SG P   K + +L   ++      VT LTRFAG+ 
Sbjct  373  PEPVWKQWSWRSEGDLMANGAFFVESGAP-ITKPYADL---IKAKPGSFVTRLTRFAGSR  428

Query  224  NCRVGSPC  201
             C    PC
Sbjct  429  PCIPNQPC  436



>ref|XP_008366366.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=479

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 158/249 (63%), Positives = 193/249 (78%), Gaps = 3/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            DGA IT+QFV NVIIH +HIH    GNGG+IRD ++H+G RT+SDGDGIS++G+SNVWID
Sbjct  234  DGAQITLQFVXNVIIHNLHIHDTKPGNGGMIRDSVNHYGQRTRSDGDGISMYGASNVWID  293

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVS  NC DGL+DAI+ STAITISN HFT+HNDVMLFG++D +++D++MQIT+AFNHFG+
Sbjct  294  HVSGSNCADGLVDAIQGSTAITISNCHFTNHNDVMLFGSSDSNSQDEVMQITLAFNHFGQ  353

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             LIQRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTIISQGNRFIAPS+   +++T R  
Sbjct  354  GLIQRMPRCRWGFFHVVNNDYTHWIMYAIGGSQHPTIISQGNRFIAPSNNASKEVTKRTS  413

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
             A  +WK W WRSE D+ M GAFFV+SG P    ++    D ++      VT LTRFAG 
Sbjct  414  GAENEWKSWNWRSENDLMMNGAFFVESGSP---IRNLPKADMIKAKPGTFVTRLTRFAGP  470

Query  227  LNCRVGSPC  201
            L C  G PC
Sbjct  471  LKCIKGKPC  479



>ref|XP_009761969.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=434

 Score =   291 bits (745),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 156/250 (62%), Positives = 194/250 (78%), Gaps = 6/250 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            G G+ +QF+ NVII  + IH    GNGGLIRD +DH+G RTKSDGDGISIFGS+NVWIDH
Sbjct  189  GGGLMLQFIHNVIISNLRIHDTKAGNGGLIRDSVDHYGYRTKSDGDGISIFGSTNVWIDH  248

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC DGLIDA+EASTAITISN HFT HN+VMLFGA+D S++D IMQIT+AFNHFG+ 
Sbjct  249  VSMSNCQDGLIDAVEASTAITISNSHFTKHNEVMLFGASDSSSRDSIMQITLAFNHFGQG  308

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPR R+G++H VNNDYTHW MYAIGGS  PTI+SQGNRFIAP + + +++T R  A
Sbjct  309  LMQRMPRVRWGFVHAVNNDYTHWLMYAIGGSMHPTILSQGNRFIAPPNPNAKEVTKRDYA  368

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPD--FMKKHNELYDGVQTFKAEDVTWLTRFAG  231
                WK W W+S+GD+ M GAFFV+SG+P+  F++  + +     +F    V+ LTRF+G
Sbjct  369  PESVWKNWVWKSQGDLMMNGAFFVESGNPNHAFLRSPDMISSKPGSF----VSSLTRFSG  424

Query  230  ALNCRVGSPC  201
            +LNC  G PC
Sbjct  425  SLNCIEGKPC  434



>ref|XP_010066949.1| PREDICTED: pectate lyase [Eucalyptus grandis]
 gb|KCW65002.1| hypothetical protein EUGRSUZ_G02541 [Eucalyptus grandis]
Length=436

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 165/248 (67%), Positives = 194/248 (78%), Gaps = 1/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QF++NVIIHG+HIH I  G+GGLIRD  DH GLRT SDGDGISIFGSS++WIDH
Sbjct  190  GAGITLQFIRNVIIHGLHIHDIVRGSGGLIRDAHDHVGLRTASDGDGISIFGSSHLWIDH  249

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM  C DGLIDAI+ STAITISN HFT HN+VMLFGA+D  ++D+IMQIT+AFNHFG+ 
Sbjct  250  VSMSACSDGLIDAIQGSTAITISNCHFTHHNEVMLFGASDGYSQDQIMQITVAFNHFGRG  309

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTIISQGNRFIAP +I  +++T R  A
Sbjct  310  LVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPPNIAAKEVTKRDYA  369

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
              +QWK W W+SEGD+ M GAFFV SG+P      +   D ++      V  LTRFAG L
Sbjct  370  TEDQWKNWLWKSEGDLMMNGAFFVNSGNPRARFPFSR-RDVIKAKPGTYVRRLTRFAGKL  428

Query  224  NCRVGSPC  201
             CRVG PC
Sbjct  429  GCRVGRPC  436



>ref|XP_008339934.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 188/249 (76%), Gaps = 2/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAGIT+QFVKNVII  +HI  I    GG+IRD +DH GLRT+SDGDGIS+FG+SNVWID
Sbjct  206  EGAGITLQFVKNVIITNLHIKMIVPKPGGMIRDSVDHIGLRTQSDGDGISLFGASNVWID  265

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM  C DGLIDA+  ST+ITISN HFTDH++ MLFGAN+  T+DKIMQIT+AFNHFG+
Sbjct  266  HVSMSRCADGLIDAVMGSTSITISNSHFTDHDEAMLFGANNAHTQDKIMQITLAFNHFGQ  325

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L+QRMPR R G+ HVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP +   +Q+THR  
Sbjct  326  GLVQRMPRVRHGFFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIAPINGVTKQVTHREN  385

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
                +WK W WRSEGD+ M GAFFV+SG      KH    D +       V  LT+F+GA
Sbjct  386  TPEAEWKNWEWRSEGDLMMNGAFFVESGSG--ASKHPAKLDMMPFKPGTFVATLTKFSGA  443

Query  227  LNCRVGSPC  201
            LNC VG PC
Sbjct  444  LNCAVGKPC  452



>ref|XP_004490003.1| PREDICTED: probable pectate lyase 3-like isoform X1 [Cicer arietinum]
Length=450

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 161/249 (65%), Positives = 190/249 (76%), Gaps = 1/249 (0%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAGITIQ+++NVIIHGI +  I  G+GGL+RD  +H+GLRT SDGDGISIFGSSN+WID
Sbjct  203  NGAGITIQYIRNVIIHGIKVFDIVVGSGGLVRDSENHYGLRTMSDGDGISIFGSSNIWID  262

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSMRNC DGLIDAI  STAITISN HFTDHN+VMLFGA+D    D+ MQIT+AFNHFGK
Sbjct  263  HVSMRNCRDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDGYDADQKMQITVAFNHFGK  322

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
            RLIQRMPRCRFG+IHVVNNDYTHW MYAIGGS  PTIIS+GNRFIAP + + ++IT R  
Sbjct  323  RLIQRMPRCRFGFIHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIAPDNGYAKEITKREY  382

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            +   +WK W WRS  D+YM GAFF Q G  +   +     D +       V  LTR++G+
Sbjct  383  SPESEWKNWQWRSINDVYMNGAFFRQGGS-ELTNRPFSKKDMITAKPGAYVGRLTRYSGS  441

Query  227  LNCRVGSPC  201
            L C VG PC
Sbjct  442  LKCIVGKPC  450



>ref|XP_008793504.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=446

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 167/251 (67%), Positives = 192/251 (76%), Gaps = 8/251 (3%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GA IT+QFV NVIIHGIHIH I   NGG+IRD L HFG+RTKSDGDGISI+GSS++WIDH
Sbjct  201  GAQITLQFVHNVIIHGIHIHDIKPSNGGIIRDSLQHFGIRTKSDGDGISIYGSSDIWIDH  260

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
             S+RNC DGLIDAIE STAITISN HFT HNDV+LFGA+D +  D IMQIT+AFNHFGK 
Sbjct  261  CSLRNCADGLIDAIEGSTAITISNCHFTHHNDVLLFGASDSNEHDSIMQITVAFNHFGKG  320

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G++HVVNNDYT W MYAIGGS  PTIISQGNRFIAP     +++T R  A
Sbjct  321  LVQRMPRCRWGFVHVVNNDYTQWIMYAIGGSQHPTIISQGNRFIAPLMQFAKEVTKRDYA  380

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTW---LTRFA  234
              + WKQWTWRSEGD+   GAFF +SG P+    H + +      KA+  TW   LTRFA
Sbjct  381  TEDVWKQWTWRSEGDLMQNGAFFRESGSPNTKSFHRKDF-----IKAKPGTWVRRLTRFA  435

Query  233  GALNCRVGSPC  201
            G L CR G PC
Sbjct  436  GPLGCRAGRPC  446



>ref|XP_008446316.1| PREDICTED: probable pectate lyase P59 [Cucumis melo]
Length=432

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 163/248 (66%), Positives = 194/248 (78%), Gaps = 1/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+Q+V+NVIIHG+ IHHI  GNGG+IRD +DH GLRT SDGDGISIFGSSNVWIDH
Sbjct  186  GAGITLQYVRNVIIHGLRIHHIVVGNGGMIRDAVDHVGLRTMSDGDGISIFGSSNVWIDH  245

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC DGLIDAI  STAITISN HFT HN+VMLFGA+D  + D+IMQ+T+AFNHFG+ 
Sbjct  246  VSMSNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDGYSNDQIMQVTVAFNHFGQG  305

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTI+SQGNRFIAP +++ +++T R  +
Sbjct  306  LVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNVYAKEVTKREYS  365

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
              + WK WTWRSEGD+ M GAFFV SGD    +  +   D +       V  +TRF+GAL
Sbjct  366  PEQVWKSWTWRSEGDLMMNGAFFVTSGDQRKRRPFSS-KDMISYKPGTYVKRMTRFSGAL  424

Query  224  NCRVGSPC  201
             C VG PC
Sbjct  425  ACFVGRPC  432



>ref|XP_010528323.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=458

 Score =   291 bits (744),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 196/249 (79%), Gaps = 2/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQF +NVIIHG+HIHHI   NGG+IRD +DH G+RT++DGDGIS+FGSSNVW+DH
Sbjct  211  GAGITIQFAQNVIIHGLHIHHIVTSNGGMIRDSVDHIGIRTQADGDGISVFGSSNVWLDH  270

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLID I+ STAITISN HFT HNDV+L GA+D  + D IMQ+TIA+NHFGK 
Sbjct  271  LSMSRCQDGLIDVIQGSTAITISNCHFTHHNDVILLGASDQFSGDSIMQVTIAYNHFGKG  330

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIH-KRQITHRVG  408
            L+QRMPRCR+G++HVVNNDYTHW MYAIGGS  PTI+SQGNRFIAP  I   +Q+T R  
Sbjct  331  LVQRMPRCRWGFVHVVNNDYTHWEMYAIGGSQHPTILSQGNRFIAPPHISWAKQVTKRDY  390

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A P +WK+WTW+SE D++M GA+FV+SGDP+F  K     D ++       + LTR+AG+
Sbjct  391  AQPSEWKRWTWQSEMDVFMNGAYFVESGDPNFKHKFTR-QDIIRAKHGMAASMLTRYAGS  449

Query  227  LNCRVGSPC  201
            L+C  G PC
Sbjct  450  LHCFAGKPC  458



>ref|XP_004165454.1| PREDICTED: pectate lyase-like [Cucumis sativus]
 gb|KGN64253.1| hypothetical protein Csa_1G045510 [Cucumis sativus]
Length=439

 Score =   290 bits (742),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 158/249 (63%), Positives = 198/249 (80%), Gaps = 3/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +G  IT+QFVKN+IIH +HIH I  GNGG+IRD + H+G RT+SDGDGIS+FG+S VWID
Sbjct  194  NGGQITLQFVKNIIIHNLHIHDIKAGNGGMIRDSVSHYGFRTRSDGDGISMFGASRVWID  253

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM NC DGLIDA+ ASTAITISN HFT HNDV+L GA++  + D+IMQ+T+AFNHFGK
Sbjct  254  HVSMSNCQDGLIDAVMASTAITISNCHFTHHNDVILLGASNGYSNDQIMQVTLAFNHFGK  313

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L+QRMPRCR+G+IHVVNNDYTHW MYAIGGS +PTIISQGNRFIAP + + +++T RV 
Sbjct  314  GLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSHNPTIISQGNRFIAPPNPNCKEVTKRVY  373

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A   +W+ W WRSEGD+ M GAFF+QSG+P  +K++++  D + +     VT LTRFAG 
Sbjct  374  APESEWRSWNWRSEGDLMMNGAFFIQSGNP--IKRYSK-KDVIHSKPGTFVTRLTRFAGP  430

Query  227  LNCRVGSPC  201
            L C+   PC
Sbjct  431  LKCKKNQPC  439



>gb|KHN13490.1| Putative pectate lyase 3, partial [Glycine soja]
Length=364

 Score =   287 bits (734),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 163/249 (65%), Positives = 187/249 (75%), Gaps = 2/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QFVKN+IIHGI +  I    GG+IRD   H+G RTKSDGDGISIFGSSN+WIDH
Sbjct  117  GAGITVQFVKNIIIHGIKVFDIVIREGGMIRDSETHYGFRTKSDGDGISIFGSSNIWIDH  176

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSMRNC DGLIDAI  STAITISN HFTDHN+VMLFGA+D  + DKIMQIT+AFNHFGKR
Sbjct  177  VSMRNCSDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDSYSDDKIMQITLAFNHFGKR  236

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPR R+G++H VNNDYTHW MYAIGGS +PTIIS+GNRFIAP +   +QIT R  A
Sbjct  237  LVQRMPRVRYGFVHSVNNDYTHWEMYAIGGSKNPTIISEGNRFIAPDNQFAKQITKREYA  296

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAG-A  228
                W  W WRS  D+YM GAFFVQSG P+   +     D +       V  LTR++G  
Sbjct  297  PENVWANWQWRSINDVYMNGAFFVQSG-PELASRPFSREDMITAKVGNYVGRLTRYSGNL  355

Query  227  LNCRVGSPC  201
            L CRVG PC
Sbjct  356  LKCRVGRPC  364



>gb|KHN13240.1| Putative pectate lyase 3 [Glycine soja]
Length=446

 Score =   290 bits (741),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 160/249 (64%), Positives = 191/249 (77%), Gaps = 2/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            DGAG+TIQFV NVIIHG+ I  I   +GG+IRD  DH+GLRT+SDGD ISIFGS+N+WID
Sbjct  200  DGAGLTIQFVNNVIIHGVRIKDIVPKDGGMIRDSADHYGLRTRSDGDAISIFGSTNIWID  259

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVS+ NC DGLID I+ STAITISN H T HNDV LFGA+D    DKIMQIT+AFNHFG+
Sbjct  260  HVSLSNCADGLIDIIQGSTAITISNCHMTKHNDVFLFGASDSYNGDKIMQITVAFNHFGQ  319

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L+QRMPRCR+G++HV+NNDYTHW MYAIGGSS PTI+SQGNRFIAP++ + ++ITHR  
Sbjct  320  GLVQRMPRCRWGFVHVLNNDYTHWLMYAIGGSSGPTILSQGNRFIAPNNDNAKEITHRDY  379

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A P+ WK W W+SE D++M GA FV SG P  M     L   ++      V+ LTR AGA
Sbjct  380  AGPDVWKNWQWQSEMDLFMNGAKFVTSGSPIKMTYKKGLI--MKPRDGTHVSRLTRHAGA  437

Query  227  LNCRVGSPC  201
            LNC VG PC
Sbjct  438  LNCFVGKPC  446



>ref|XP_002520133.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF42188.1| Pectate lyase precursor, putative [Ricinus communis]
Length=440

 Score =   289 bits (740),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 164/254 (65%), Positives = 198/254 (78%), Gaps = 14/254 (6%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG+T+QFV+NVIIHGI IH I  G+GGL+RD +DH+G RTKSDGDGISIFGSSN+WIDH
Sbjct  195  GAGLTLQFVQNVIIHGIRIHDIVSGSGGLVRDSVDHYGFRTKSDGDGISIFGSSNIWIDH  254

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC DGLIDAI  ST+ITISN HFT+HN+VMLFGA+D  + D IMQIT+AFNHFG+ 
Sbjct  255  VSMSNCQDGLIDAIMGSTSITISNCHFTNHNEVMLFGASDGYSADTIMQITVAFNHFGRG  314

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTIISQGNRFIAP++I  +++T R  +
Sbjct  315  LVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSRKPTIISQGNRFIAPNNIFSKEVTKREYS  374

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDP---DFMKKHNELYDGVQTFKAED---VTWLT  243
               +WK W WRS+ D+ M GA FV+SG P   DF +        +Q  KA+    VT LT
Sbjct  375  LESEWKNWNWRSDRDLMMNGAVFVESGKPITHDFSR--------LQLIKAKPGTFVTRLT  426

Query  242  RFAGALNCRVGSPC  201
            R++GAL+C VG PC
Sbjct  427  RYSGALDCFVGKPC  440



>ref|XP_008389523.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 3 [Malus 
domestica]
Length=452

 Score =   290 bits (741),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 157/250 (63%), Positives = 188/250 (75%), Gaps = 4/250 (2%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +G GIT+QFVKNVI+  +HI  I    GG+IRD +DH GLRTKSDGDGIS+FG+SNVWID
Sbjct  206  EGGGITLQFVKNVILTNLHIKMIVSKTGGMIRDSVDHMGLRTKSDGDGISLFGASNVWID  265

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            H+SM  C DGLIDA+ ASTAITISN HFTDH+DVMLFGAN+  T+DKIMQIT+AFNHFG+
Sbjct  266  HMSMSRCADGLIDAVMASTAITISNSHFTDHDDVMLFGANNAHTQDKIMQITLAFNHFGR  325

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L+QRMPR R G+ H+VNNDY HW MYAIGG+ +PTIISQGNRFIAP +   +Q+THR  
Sbjct  326  GLVQRMPRVRHGFFHLVNNDYNHWIMYAIGGNMNPTIISQGNRFIAPVNEATKQVTHREH  385

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAED-VTWLTRFAG  231
                +WK W WRSEGD+ M GAFFV+SG        N     +  F+     T LT+F+G
Sbjct  386  TPESEWKNWEWRSEGDLMMNGAFFVESGS---RASQNPAKLDMMPFQPGTFATKLTKFSG  442

Query  230  ALNCRVGSPC  201
            AL+C VG PC
Sbjct  443  ALSCVVGKPC  452



>ref|XP_002311599.2| pectate lyase family protein [Populus trichocarpa]
 gb|EEE88966.2| pectate lyase family protein [Populus trichocarpa]
Length=441

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 158/248 (64%), Positives = 191/248 (77%), Gaps = 0/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QFV+NVIIHG+ IH I  G+GGL+RD +DH+G RTKSDGDGISIFGSSN+WIDH
Sbjct  194  GAGITLQFVQNVIIHGLRIHDIVIGSGGLVRDSVDHYGFRTKSDGDGISIFGSSNIWIDH  253

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC DGLID I  S AITISN HFT HN+VMLFGA+D  + D IMQIT+AFNHFG+ 
Sbjct  254  VSMSNCQDGLIDVIMGSNAITISNSHFTRHNEVMLFGASDSYSGDSIMQITVAFNHFGRG  313

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS +PTI+SQGNRFIAP++   +++T R  A
Sbjct  314  LVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSHNPTIVSQGNRFIAPNNTFAKEVTKRDYA  373

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
               +WK W WRS+ D+ M GAFFVQSG P    +    +  +++     VT LTRF+G+L
Sbjct  374  VESEWKNWNWRSDNDLMMNGAFFVQSGSPITSSRRISRFHVMKSKPGTFVTRLTRFSGSL  433

Query  224  NCRVGSPC  201
             C  G PC
Sbjct  434  GCFKGKPC  441



>ref|XP_011025954.1| PREDICTED: probable pectate lyase P59 [Populus euphratica]
Length=441

 Score =   289 bits (739),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 158/248 (64%), Positives = 189/248 (76%), Gaps = 0/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QF +NVIIHG+ IH I  G+GGLIRD +DH+G RTKSDGDGISIFGSSN+WIDH
Sbjct  194  GAGITLQFAQNVIIHGLRIHDIVSGSGGLIRDSVDHYGFRTKSDGDGISIFGSSNIWIDH  253

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC DGLID I  S AITISN HFT HN+VMLFGA+D  + D IMQIT++FNHFGK 
Sbjct  254  VSMSNCQDGLIDVIMGSNAITISNSHFTRHNEVMLFGASDSYSGDSIMQITVSFNHFGKG  313

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS +PTI+SQGNRFIAP +   +++T R  A
Sbjct  314  LVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSHNPTIVSQGNRFIAPGNTFAKEVTKRDYA  373

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
               +WK W WRS+ D+ M GAFFVQSG P    +    +  +++     VT LTRF+G+L
Sbjct  374  VESEWKNWNWRSDNDLMMNGAFFVQSGSPITSSRRISRFHVMKSKPGTFVTRLTRFSGSL  433

Query  224  NCRVGSPC  201
             C  G PC
Sbjct  434  GCFKGKPC  441



>ref|XP_007157384.1| hypothetical protein PHAVU_002G065800g [Phaseolus vulgaris]
 gb|ESW29378.1| hypothetical protein PHAVU_002G065800g [Phaseolus vulgaris]
Length=448

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 164/249 (66%), Positives = 188/249 (76%), Gaps = 1/249 (0%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAG TIQFVKNVIIHGI I  I  G GGLIRD   H+GLRT+SDGDGISIFGSS +WID
Sbjct  201  NGAGFTIQFVKNVIIHGIKIFDINAGQGGLIRDSESHYGLRTQSDGDGISIFGSSYIWID  260

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSMRN  DGLIDAI+ STAITISN HFTDHN+VMLFGA+D   +DKIMQIT+ FNHFGK
Sbjct  261  HVSMRNARDGLIDAIQGSTAITISNSHFTDHNEVMLFGASDSHEEDKIMQITLVFNHFGK  320

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
            RL+QRMPRCRFG+IHVVNNDYTHW MYAIGGS  PTIIS+GNRF+AP     +QIT R  
Sbjct  321  RLVQRMPRCRFGFIHVVNNDYTHWEMYAIGGSKHPTIISEGNRFVAPDSKDAKQITKREY  380

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            +   +WK+W WRS  D  + GAFF++SG PD   +     D + +     V  LTR AG+
Sbjct  381  SLEPEWKKWQWRSIKDEVINGAFFIESG-PDLTNRPFTRKDMISSRPGTYVGRLTRHAGS  439

Query  227  LNCRVGSPC  201
            L C VG PC
Sbjct  440  LRCIVGKPC  448



>ref|XP_003530685.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=451

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 164/249 (66%), Positives = 187/249 (75%), Gaps = 2/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QFVKN+IIHGI +  I    GG+IRD   H+G RTKSDGDGISIFGSSNVWIDH
Sbjct  204  GAGITVQFVKNIIIHGIKVFDIVIREGGMIRDSETHYGFRTKSDGDGISIFGSSNVWIDH  263

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSMRNC DGLIDAI  STAITISN HFTDHN+VMLFGA+D  + DKIMQIT+AFNHFGKR
Sbjct  264  VSMRNCSDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDSYSDDKIMQITLAFNHFGKR  323

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPR R+G++H VNNDYTHW MYAIGGS +PTIIS+GNRFIAP +   +QIT R  A
Sbjct  324  LVQRMPRVRYGFVHSVNNDYTHWEMYAIGGSKNPTIISEGNRFIAPDNQFAKQITKREYA  383

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAG-A  228
                W  W WRS  D+YM GAFFVQSG P+   +     D +       V  LTR++G  
Sbjct  384  PENVWANWQWRSINDVYMNGAFFVQSG-PELASRPFSREDMITAKVGNYVGRLTRYSGNL  442

Query  227  LNCRVGSPC  201
            L CRVG PC
Sbjct  443  LKCRVGRPC  451



>ref|XP_010915114.1| PREDICTED: LOW QUALITY PROTEIN: pectate lyase-like [Elaeis guineensis]
Length=444

 Score =   288 bits (738),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 166/251 (66%), Positives = 193/251 (77%), Gaps = 8/251 (3%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GA ITIQFV +VIIHGIHIH I   NGG+IRD L HFG+RTKSDGDGISI+GSS++WIDH
Sbjct  199  GAQITIQFVHDVIIHGIHIHDIRPSNGGIIRDSLQHFGIRTKSDGDGISIYGSSDIWIDH  258

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
             S+RNC DGLIDAIEASTAITISN HFT HNDV+LFGA+D +  D +MQ T+AFNHFGK 
Sbjct  259  CSLRNCADGLIDAIEASTAITISNCHFTHHNDVLLFGASDSNEHDSMMQATVAFNHFGKG  318

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYT W MYAIGGS  PTIISQGNRF+AP  +  +++T R  A
Sbjct  319  LVQRMPRCRWGFFHVVNNDYTQWIMYAIGGSQHPTIISQGNRFVAPRMLFSKEVTKRDYA  378

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTW---LTRFA  234
              + WKQWTWRSEGD+   GAFF +SG+P+  K     +D     KA+  TW   LTRFA
Sbjct  379  TEDVWKQWTWRSEGDLMQNGAFFRESGNPNARK-----FDRKDFIKAKPGTWVRRLTRFA  433

Query  233  GALNCRVGSPC  201
            G L CR G PC
Sbjct  434  GPLGCRAGRPC  444



>gb|KHN08706.1| Putative pectate lyase 3 [Glycine soja]
Length=444

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 160/248 (65%), Positives = 188/248 (76%), Gaps = 1/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQF+KNVIIHG+ I  I  GNGGLI D  +H+GLRT SDGDGISIFGSSN+WIDH
Sbjct  198  GAGITIQFIKNVIIHGVKIFDIQVGNGGLIIDSENHYGLRTMSDGDGISIFGSSNIWIDH  257

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSMR C DGLIDAI+ STAITISN HFTDHN+VMLFGA+D    D IMQIT+AFNHFGKR
Sbjct  258  VSMRKCKDGLIDAIQGSTAITISNSHFTDHNEVMLFGASDSYDGDTIMQITLAFNHFGKR  317

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G++HVVNNDYTHW MYAIGGS  PTIIS+GNRFIAP +I+ ++IT R  +
Sbjct  318  LVQRMPRCRYGFVHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIAPDNINAKEITKREYS  377

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
              ++WK W WRS  D Y+ G FF + G      +    +D +       V  LTR+AG+L
Sbjct  378  PEQEWKSWQWRSINDEYLNGGFF-REGGAQLTDRPYSRHDMMTARPGSYVGRLTRYAGSL  436

Query  224  NCRVGSPC  201
             C VG PC
Sbjct  437  KCMVGKPC  444



>ref|XP_009369346.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=441

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 158/249 (63%), Positives = 190/249 (76%), Gaps = 3/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            DG  IT+QFVKNVIIH +HIH    GNGG+IRD ++H+G RT+SDGDGIS++G+SNVWID
Sbjct  196  DGGQITLQFVKNVIIHNLHIHDNKAGNGGMIRDSVNHYGQRTRSDGDGISMYGASNVWID  255

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVS  NC DGLIDAI+ STAITISN HFT+HNDVMLFG++D +++D++MQIT+AFNHFG+
Sbjct  256  HVSASNCEDGLIDAIQGSTAITISNCHFTNHNDVMLFGSSDSNSQDEVMQITLAFNHFGQ  315

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTIISQGNRFIAP +   +++T R  
Sbjct  316  GLTQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPLNEASKEVTKREY  375

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            AA   WK W WRSE D+ M GAFFV+SG P    ++    D +Q      V  LTRFAG 
Sbjct  376  AAENVWKSWNWRSENDLMMNGAFFVESGSP---IRNLPEADMIQAKPGTFVAKLTRFAGP  432

Query  227  LNCRVGSPC  201
            L C  G PC
Sbjct  433  LKCIKGKPC  441



>ref|XP_003519771.2| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=447

 Score =   288 bits (737),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 160/248 (65%), Positives = 188/248 (76%), Gaps = 1/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQF+KNVIIHG+ I  I  GNGGLI D  +H+GLRT SDGDGISIFGSSN+WIDH
Sbjct  201  GAGITIQFIKNVIIHGVKIFDIQVGNGGLIIDSENHYGLRTMSDGDGISIFGSSNIWIDH  260

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSMR C DGLIDAI+ STAITISN HFTDHN+VMLFGA+D    D IMQIT+AFNHFGKR
Sbjct  261  VSMRKCKDGLIDAIQGSTAITISNSHFTDHNEVMLFGASDSYDGDTIMQITLAFNHFGKR  320

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G++HVVNNDYTHW MYAIGGS  PTIIS+GNRFIAP +I+ ++IT R  +
Sbjct  321  LVQRMPRCRYGFVHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIAPDNINAKEITKREYS  380

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
              ++WK W WRS  D Y+ G FF + G      +    +D +       V  LTR+AG+L
Sbjct  381  PEQEWKSWQWRSINDEYLNGGFF-REGGAQLTDRPYSRHDMMTARPGSYVGRLTRYAGSL  439

Query  224  NCRVGSPC  201
             C VG PC
Sbjct  440  KCMVGKPC  447



>ref|XP_010925369.1| PREDICTED: pectate lyase [Elaeis guineensis]
Length=444

 Score =   288 bits (736),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 167/251 (67%), Positives = 190/251 (76%), Gaps = 8/251 (3%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GA ITIQFV NVIIHG+HIH I   NGG+IRD L HFGLRTKSDGDGISI+GSS+VWIDH
Sbjct  199  GAQITIQFVNNVIIHGLHIHDIKPSNGGMIRDSLHHFGLRTKSDGDGISIYGSSDVWIDH  258

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
             SMRNC DGLIDAIE STAITISN HFT HNDV+LFGA+D +  D IMQ T+AFNHFGK 
Sbjct  259  CSMRNCADGLIDAIEGSTAITISNCHFTHHNDVLLFGASDSNENDSIMQATVAFNHFGKG  318

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTIISQGNRFIAP     +++T R  A
Sbjct  319  LVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSKHPTIISQGNRFIAPPLRFAKEVTKRDYA  378

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTW---LTRFA  234
              + WKQWTWRSEGD+   GAFF +SG P+    H + +      +A+  TW   LTRFA
Sbjct  379  TEDVWKQWTWRSEGDLMQNGAFFRESGTPNTRTFHRKDF-----IRAKPGTWVRRLTRFA  433

Query  233  GALNCRVGSPC  201
            G L C+ G  C
Sbjct  434  GPLGCKAGRAC  444



>ref|XP_009121613.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
 emb|CDX69550.1| BnaA10g18990D [Brassica napus]
Length=499

 Score =   290 bits (741),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 160/253 (63%), Positives = 200/253 (79%), Gaps = 9/253 (4%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QFV+NVIIHG+HIHHI E NGG+IRD +DHFG+RT++DGDG+SI+GSSN+WIDH
Sbjct  251  GAGITMQFVRNVIIHGLHIHHISESNGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWIDH  310

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGA-NDLSTKDKIMQITIAFNHFGK  588
            VSM  C DGLIDAI  STAITISN HFT HNDVML GA N+++  D+ MQ+T+A+NHFGK
Sbjct  311  VSMSKCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNNMNEADQKMQVTVAYNHFGK  370

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDI-HKRQITHRV  411
             L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP  + + +++T R 
Sbjct  371  GLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHLPYYKEVTKRD  430

Query  410  GAAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAED---VTWLTR  240
             A+ ++WK WTWRSE DI+M GAFF QSGDP +   H       Q  K ++   V+ LT+
Sbjct  431  YASEDEWKHWTWRSEKDIFMNGAFFRQSGDPHYKSAHTRK----QMIKPKNGYAVSKLTK  486

Query  239  FAGALNCRVGSPC  201
            +AGAL+CRVG  C
Sbjct  487  YAGALDCRVGRRC  499



>ref|XP_003543726.1| PREDICTED: pectate lyase [Glycine max]
Length=443

 Score =   288 bits (736),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 159/248 (64%), Positives = 190/248 (77%), Gaps = 2/248 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG+TIQFV NVIIHG+ I  I   +GG+IRD  DH+GLRT+SDGD ISIFGS+N+WIDH
Sbjct  198  GAGLTIQFVNNVIIHGVRIKDIVPKDGGMIRDSADHYGLRTRSDGDAISIFGSTNIWIDH  257

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VS+ NC DGLID I+ STAITISN H T HNDV LFGA+D    DKIMQIT+AFNHFG+ 
Sbjct  258  VSLSNCADGLIDIIQGSTAITISNCHMTKHNDVFLFGASDSYNGDKIMQITVAFNHFGQG  317

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G++HV+NNDYTHW MYAIGGSS PTI+SQGNRFIAP++ + ++ITHR  A
Sbjct  318  LVQRMPRCRWGFVHVLNNDYTHWLMYAIGGSSGPTILSQGNRFIAPNNDNAKEITHRDYA  377

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
             P+ WK W W+SE D++M GA FV SG P  M     L   ++      V+ LTR AGAL
Sbjct  378  GPDVWKNWQWQSEMDLFMNGAKFVTSGSPIKMTYKKGLI--MKPRDGTHVSRLTRHAGAL  435

Query  224  NCRVGSPC  201
            NC VG PC
Sbjct  436  NCFVGKPC  443



>gb|ACU23277.1| unknown [Glycine max]
Length=443

 Score =   288 bits (736),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 159/248 (64%), Positives = 190/248 (77%), Gaps = 2/248 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG+TIQFV NVIIHG+ I  I   +GG+IRD  DH+GLRT+SDGD ISIFGS+N+WIDH
Sbjct  198  GAGLTIQFVNNVIIHGVRIKDIVPKDGGMIRDSADHYGLRTRSDGDAISIFGSTNIWIDH  257

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VS+ NC DGLID I+ STAITISN H T HNDV LFGA+D    DKIMQIT+AFNHFG+ 
Sbjct  258  VSLSNCADGLIDIIQGSTAITISNCHMTKHNDVFLFGASDSYNGDKIMQITVAFNHFGQG  317

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G++HV+NNDYTHW MYAIGGSS PTI+SQGNRFIAP++ + ++ITHR  A
Sbjct  318  LVQRMPRCRWGFVHVLNNDYTHWLMYAIGGSSGPTILSQGNRFIAPNNDNAKEITHRDYA  377

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
             P+ WK W W+SE D++M GA FV SG P  M     L   ++      V+ LTR AGAL
Sbjct  378  GPDVWKNWQWQSEMDLFMNGAKFVTSGSPIKMTYKKGLI--MKPRDGTHVSRLTRHAGAL  435

Query  224  NCRVGSPC  201
            NC VG PC
Sbjct  436  NCFVGKPC  443



>ref|XP_009615547.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=434

 Score =   287 bits (735),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 155/250 (62%), Positives = 193/250 (77%), Gaps = 6/250 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            G G+ +QF+ NVII  + IH    GNGGLIRD ++H+G RTKSDGDGISIFGS+NVWIDH
Sbjct  189  GGGLMLQFIHNVIISNLRIHDTKAGNGGLIRDSVNHYGYRTKSDGDGISIFGSTNVWIDH  248

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC DGLIDA+EASTAITISN HFT HN+VMLFGA+D S++D IMQIT+AFNHFG+ 
Sbjct  249  VSMSNCQDGLIDAVEASTAITISNCHFTKHNEVMLFGASDSSSRDSIMQITLAFNHFGQG  308

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L QRMPR R+G++H VNNDYTHW MYAIGGS  PTI+SQGNRFIAP + + +++T R  A
Sbjct  309  LRQRMPRVRWGFVHAVNNDYTHWLMYAIGGSMHPTILSQGNRFIAPPNPNAKEVTKRDYA  368

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPD--FMKKHNELYDGVQTFKAEDVTWLTRFAG  231
                WK W W+S+GD+ M GAFFV+SG+P+  F++  + +     +F    V+ LTRF+G
Sbjct  369  PESVWKNWVWKSQGDLMMNGAFFVESGNPNHAFLRSPDMISSKPGSF----VSSLTRFSG  424

Query  230  ALNCRVGSPC  201
            +LNC  G PC
Sbjct  425  SLNCIEGKPC  434



>ref|XP_008374522.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=441

 Score =   287 bits (734),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 157/249 (63%), Positives = 190/249 (76%), Gaps = 3/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            DG  IT+QFVKNVIIH +HIH    GNGG+IRD ++H+G RT+SDGDGIS++G+SNVWID
Sbjct  196  DGGQITLQFVKNVIIHNLHIHDNKAGNGGMIRDSVNHYGQRTRSDGDGISMYGASNVWID  255

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVS  NC DGLIDAI+ STAITISN HFT+HNDVMLFG++D +++D++MQITIAFNHFG+
Sbjct  256  HVSASNCEDGLIDAIQGSTAITISNCHFTNHNDVMLFGSSDSNSQDEVMQITIAFNHFGQ  315

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTIISQGNRFIAP +   +++T R  
Sbjct  316  GLTQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPXNEASKEVTKREY  375

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            AA   WK W WRSE D+ + GAFF++SG P    ++    D +Q      V  LTRFAG 
Sbjct  376  AAENVWKSWNWRSENDLMVNGAFFIESGSP---IRNLPEADMIQAKPGTFVAKLTRFAGP  432

Query  227  LNCRVGSPC  201
            L C  G PC
Sbjct  433  LKCIKGKPC  441



>emb|CDY66593.1| BnaCnng51570D [Brassica napus]
Length=499

 Score =   289 bits (739),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 160/253 (63%), Positives = 199/253 (79%), Gaps = 9/253 (4%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QFV+NVIIHG+HIHHI E NGG+IRD +DHFG+RT++DGDG+SI+GSSN+WIDH
Sbjct  251  GAGITMQFVRNVIIHGLHIHHISESNGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWIDH  310

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGA-NDLSTKDKIMQITIAFNHFGK  588
            VSM  C DGLIDAI  STAITISN HFT HNDVML GA N+++  D+ MQ+T+A+NHFGK
Sbjct  311  VSMSKCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNNMNEADQKMQVTVAYNHFGK  370

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDI-HKRQITHRV  411
             L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP  + + +++T R 
Sbjct  371  GLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHLPYYKEVTKRD  430

Query  410  GAAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAED---VTWLTR  240
             A  ++WK WTWRSE DI+M GAFF QSGDP +   H       Q  K ++   V+ LT+
Sbjct  431  YALEDEWKHWTWRSEKDIFMNGAFFRQSGDPHYKSAHTRK----QMIKPKNGYAVSKLTK  486

Query  239  FAGALNCRVGSPC  201
            +AGAL+CRVG  C
Sbjct  487  YAGALDCRVGKRC  499



>gb|KEH19822.1| pectate lyase-like protein [Medicago truncatula]
Length=455

 Score =   287 bits (735),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 164/256 (64%), Positives = 193/256 (75%), Gaps = 8/256 (3%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAGITIQFVKNVIIHGI I+ I   +GG+IRD   H+G RTKSDGDGISIFG+SNVWID
Sbjct  201  NGAGITIQFVKNVIIHGIKIYDIQVRDGGMIRDSEAHYGFRTKSDGDGISIFGASNVWID  260

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSMRNC DGLIDAI  STAITISN HFTDHN+VMLFGA++  ++DKIMQIT+AFNHFGK
Sbjct  261  HVSMRNCTDGLIDAIMGSTAITISNSHFTDHNEVMLFGASNDYSEDKIMQITLAFNHFGK  320

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSD-------IHKR  429
            RL+QRMPR RFG++H VNNDYTHW MYAIGGS +PTIIS+GNRFI P +       I+ +
Sbjct  321  RLVQRMPRARFGFVHCVNNDYTHWEMYAIGGSQNPTIISEGNRFIGPYNKMLGNDLINSK  380

Query  428  QITHRVGAAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTW  249
            +IT R      +WK W WRS  D Y+ GAFFVQSG P+   +     D ++      V  
Sbjct  381  EITKREYTEESEWKTWQWRSINDEYINGAFFVQSG-PELKDRPFSQKDMIKAKPGSFVGR  439

Query  248  LTRFAGALNCRVGSPC  201
            LTR++G L CRVG PC
Sbjct  440  LTRYSGNLRCRVGEPC  455



>ref|XP_007032453.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY03379.1| Pectate lyase family protein [Theobroma cacao]
Length=454

 Score =   287 bits (735),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 160/251 (64%), Positives = 194/251 (77%), Gaps = 6/251 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QFV NVIIH +HIHHI + +GGLIRD +DH+G RT  DGDGISIFGS+N+W+DH
Sbjct  207  GAGITLQFVDNVIIHNLHIHHIRKSSGGLIRDSVDHYGFRTVGDGDGISIFGSTNIWLDH  266

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI+ STAITISN HFT HNDV+L GA+D  ++DK+MQ+T+AFNHFGK 
Sbjct  267  LSMSECEDGLIDAIQGSTAITISNCHFTHHNDVILLGASDSYSRDKLMQVTVAFNHFGKE  326

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            LIQRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTIISQGNRFIAP+D   ++IT+R  A
Sbjct  327  LIQRMPRCRWGFFHVVNNDYTHWKMYAIGGSQHPTIISQGNRFIAPNDPWAKEITNRNYA  386

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTW---LTRFA  234
                W+ W WRSEGD++M GAFF  SG P      +  Y+ +Q  KA+  T+   LTRF+
Sbjct  387  PESVWRHWVWRSEGDLFMNGAFFRTSGPP---APPHLKYNKLQMIKAKPATFVRRLTRFS  443

Query  233  GALNCRVGSPC  201
            GALNC+    C
Sbjct  444  GALNCKKRVKC  454



>ref|XP_008786760.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=467

 Score =   287 bits (735),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 166/251 (66%), Positives = 193/251 (77%), Gaps = 8/251 (3%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GA I+IQFV+NVIIHG+HIH I  GNGG+IRD L H+G RTKSDGDGISI+GSS++WIDH
Sbjct  222  GAQISIQFVQNVIIHGLHIHDIKPGNGGMIRDSLRHYGFRTKSDGDGISIYGSSDIWIDH  281

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
             SMRNC DGLIDAIEASTAITISN HF  HNDV+LFGA+D + +D IMQ+T+AFNHFGK 
Sbjct  282  CSMRNCADGLIDAIEASTAITISNCHFARHNDVLLFGASDSNERDSIMQVTVAFNHFGKG  341

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTIISQGNRF+AP     ++IT R  A
Sbjct  342  LVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSQHPTIISQGNRFLAPPMRFAKEITKRDYA  401

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTW---LTRFA  234
              + WK WTWRSEGD+   GAFF +SG P    K+N  +D     KA+  TW   LTR+A
Sbjct  402  TEDVWKHWTWRSEGDLMQNGAFFRESGAP---AKNN--FDKKDFIKAKPGTWVKRLTRYA  456

Query  233  GALNCRVGSPC  201
            G L CR G  C
Sbjct  457  GPLGCRAGRAC  467



>ref|XP_009381244.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=423

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 162/250 (65%), Positives = 189/250 (76%), Gaps = 4/250 (2%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAGITIQ+V N+IIH + IH I  GNGG+IRD   H+GLRT+SDGDGISIFG+SNVWID
Sbjct  177  NGAGITIQYVDNIIIHNLRIHDIKAGNGGMIRDSEHHYGLRTRSDGDGISIFGASNVWID  236

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D  + D +MQIT+AFNHFGK
Sbjct  237  HVSMSNCMDGLIDAIQGSTAITISNSHFTQHNDVMLFGASDAFSGDAVMQITVAFNHFGK  296

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L+QRMPRCR+G++HVVNNDYTHW MYAIGGS  PTI+SQGNRFIAP  +  +++T R  
Sbjct  297  GLVQRMPRCRWGFVHVVNNDYTHWMMYAIGGSQHPTILSQGNRFIAPPTLFAKEVTKREY  356

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELY-DGVQTFKAEDVTWLTRFAG  231
            +  E WK W WRSEGD+   GAFFV SG     K  N  Y D ++      VT LTRF+G
Sbjct  357  SPEEVWKSWQWRSEGDLLKNGAFFVPSGAG---KLGNVSYKDLIKAKPGTFVTRLTRFSG  413

Query  230  ALNCRVGSPC  201
            AL C    PC
Sbjct  414  ALKCVPNRPC  423



>gb|KEH24975.1| pectate lyase P59-like protein [Medicago truncatula]
Length=453

 Score =   286 bits (732),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 188/249 (76%), Gaps = 1/249 (0%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            DGAGIT+QFV NVIIHG+HI +I    GGLIRD  DH G RT+SDGD ISI+GSSN+WID
Sbjct  206  DGAGITMQFVNNVIIHGLHIQNIKAKPGGLIRDSFDHTGQRTRSDGDAISIYGSSNIWID  265

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            H+S+  C DGL+D I+ ST ITISN H T HNDVMLFGA+D  T DK+MQIT+AFNHFG+
Sbjct  266  HLSLSECEDGLVDIIQGSTGITISNCHMTKHNDVMLFGASDSYTGDKLMQITVAFNHFGQ  325

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             LIQRMPRCR+G++HV+NNDYTHW MYAIGGSS PTI+SQGNRFIAP +   +++THR  
Sbjct  326  GLIQRMPRCRYGFVHVLNNDYTHWIMYAIGGSSSPTILSQGNRFIAPDNGAAKEVTHRDY  385

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A P+ WK W W SE D++M GA FV SG P   K   + Y  +Q      V+ LTR AGA
Sbjct  386  APPDVWKNWQWSSELDVFMNGAKFVPSGAPINRKPFKKAY-MMQPRDGSHVSRLTRNAGA  444

Query  227  LNCRVGSPC  201
            LNC VG PC
Sbjct  445  LNCVVGKPC  453



>gb|AAB69766.1| putative pectate lyase Nt59 [Nicotiana tabacum]
Length=171

 Score =   276 bits (705),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = -2

Query  713  TAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKRLIQRMPRCRFGYIHVVN  534
            TAITISNGHFTDHN+VMLFGA+D S+ D++MQIT+AFNHFGKRL+QRMPRCR+GYIHVVN
Sbjct  1    TAITISNGHFTDHNEVMLFGASDSSSIDQVMQITLAFNHFGKRLVQRMPRCRWGYIHVVN  60

Query  533  NDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAAPEQWKQWTWRSEGDIY  354
            NDYTHWNMYAIGGS  PTII+QGNRFIAP DI K Q+T R     E WK WTWRSEG+++
Sbjct  61   NDYTHWNMYAIGGSMHPTIITQGNRFIAPPDIFKEQVTKREYNPEEVWKHWTWRSEGNLF  120

Query  353  MGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGALNCRVGSPC  201
            M GA+F++SGDPD+ KKH ELYDG+    AE+VTW+TRFAGAL C+ G  C
Sbjct  121  MNGAYFIESGDPDWSKKHKELYDGISAAPAEEVTWITRFAGALGCKKGKAC  171



>ref|XP_010242445.1| PREDICTED: pectate lyase [Nelumbo nucifera]
Length=443

 Score =   285 bits (729),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 159/248 (64%), Positives = 184/248 (74%), Gaps = 5/248 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQF+KNVIIH +H H I    GG+IRD ++H G RT SDGD ISIFGS+NVWIDH
Sbjct  201  GAGITIQFIKNVIIHNLHFHDIVAREGGMIRDSVNHLGFRTASDGDAISIFGSTNVWIDH  260

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
             SM NC DGL+DAI  STAITISN H T HN+VMLFGA+D    D  MQIT+AFNHFG+ 
Sbjct  261  NSMSNCKDGLVDAIMGSTAITISNNHLTHHNEVMLFGASDSYPDDSKMQITVAFNHFGRG  320

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW MYAIGGSS+PTIISQGNRFIAP     +Q+T+R  A
Sbjct  321  LVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSSNPTIISQGNRFIAPPTEAAKQVTNRNYA  380

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
                WK WTWRSEGD+ M GA+F+QSG P   K+     D +   K   V  L RF+GAL
Sbjct  381  PESVWKHWTWRSEGDLMMNGAYFIQSGKPIKKKR-----DMITAKKGTFVKRLVRFSGAL  435

Query  224  NCRVGSPC  201
            NC+VG  C
Sbjct  436  NCKVGKRC  443



>ref|XP_009131435.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
 emb|CDX78607.1| BnaA03g05190D [Brassica napus]
Length=475

 Score =   286 bits (731),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 195/249 (78%), Gaps = 2/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG+T+QFV++VIIHG+HIHHI E +GG+IRD  DHFG+RT++DGDG+SI+GSSN+W+DH
Sbjct  228  GAGVTMQFVRHVIIHGLHIHHISESSGGMIRDSADHFGMRTRADGDGLSIYGSSNIWLDH  287

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM  C DGLIDAI  STAITISN HFT HNDVML GA +    DK MQ+T+A+NHFGK 
Sbjct  288  VSMSQCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNTYDLDKKMQVTVAYNHFGKG  347

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDI-HKRQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+SQGNRFIAP  + H R++T R  
Sbjct  348  LVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQSPTILSQGNRFIAPPHLPHYREVTKRDY  407

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A  E+WK W WRSE DI+M GA+F QSGDP++   H    + ++      V+ LT++AGA
Sbjct  408  APEEEWKHWNWRSEKDIFMNGAYFRQSGDPNYETDHTR-RNMIKPKNGYAVSKLTKYAGA  466

Query  227  LNCRVGSPC  201
            L+CRVG  C
Sbjct  467  LDCRVGRRC  475



>ref|XP_010492335.1| PREDICTED: probable pectate lyase 19 [Camelina sativa]
Length=499

 Score =   286 bits (733),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 157/252 (62%), Positives = 195/252 (77%), Gaps = 8/252 (3%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QFVKNVIIHG+HIHHI E +GG+IRD +DHFG+RT++DGDG+SI+GSSN+W+DH
Sbjct  252  GAGITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDH  311

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI  ST ITISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK 
Sbjct  312  ISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKG  371

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  
Sbjct  372  LVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDY  431

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAED---VTWLTRF  237
            A  ++WK WTWRSE D++M GA+F QSG+P F   H       Q  K ++   V+ LT++
Sbjct  432  APEDEWKHWTWRSEKDVFMNGAYFRQSGNPHFKSAHTR----KQMIKPKNGMAVSKLTKY  487

Query  236  AGALNCRVGSPC  201
            AGAL+CRVG  C
Sbjct  488  AGALDCRVGKRC  499



>emb|CDP14850.1| unnamed protein product [Coffea canephora]
Length=435

 Score =   285 bits (728),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 155/248 (63%), Positives = 191/248 (77%), Gaps = 2/248 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG T+QFV N+IIH +HIH I  GNGG+IRD ++H+G+R++SDGDGISI+GS+N+WIDH
Sbjct  190  GAGFTLQFVHNIIIHNLHIHDIKSGNGGMIRDSVNHYGIRSRSDGDGISIYGSTNIWIDH  249

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM NC DGLIDA++ASTAITISNGHFT HN+ MLFGA+D  + D IMQIT+AFNHFG+ 
Sbjct  250  ISMSNCNDGLIDAVQASTAITISNGHFTHHNEAMLFGASDSYSDDSIMQITLAFNHFGQG  309

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            + QRMPR R+G++HVVNNDYTHW MYAIGGS  PTI+SQGNRFIAP + + +++T R  A
Sbjct  310  IEQRMPRARWGFVHVVNNDYTHWLMYAIGGSQHPTILSQGNRFIAPENPYAKEVTKRDYA  369

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
                WK W W+S+GD+ M GAFFVQSGDP+     N   D +     E    LTRFAGAL
Sbjct  370  PESVWKDWVWKSQGDLMMNGAFFVQSGDPNHNFGSNA--DLIGPKPGEFANRLTRFAGAL  427

Query  224  NCRVGSPC  201
            NC    PC
Sbjct  428  NCIAKRPC  435



>gb|EYU24412.1| hypothetical protein MIMGU_mgv1a011674mg [Erythranthe guttata]
Length=274

 Score =   278 bits (712),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 152/249 (61%), Positives = 183/249 (73%), Gaps = 2/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAG+TIQ+V NV+IH I IH I  GNGGLIRD ++H+G R++SDGD IS+FG++NVWID
Sbjct  28   NGAGLTIQYVSNVVIHNIRIHDIKAGNGGLIRDSVNHYGYRSRSDGDAISMFGATNVWID  87

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVS+  C DGLIDAIE STAITISN HFT HNDVMLFGA+D  + D++MQIT+AFNHFGK
Sbjct  88   HVSLSKCVDGLIDAIEGSTAITISNSHFTHHNDVMLFGASDSYSGDQVMQITVAFNHFGK  147

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             LIQRMPR R+G++H+VNNDYT W MYAIGGS  PTI+SQGN F+AP D   +++T R  
Sbjct  148  GLIQRMPRVRWGFVHIVNNDYTRWEMYAIGGSQHPTILSQGNNFVAPQDRFAKEVTKRDY  207

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A    WK W W+SEGD+   GAFF QSGDP    K    Y  +       V  LT+FAG 
Sbjct  208  APESVWKNWVWKSEGDVMKNGAFFKQSGDPK--HKFALGYGTIAPKPGGYVPSLTKFAGP  265

Query  227  LNCRVGSPC  201
            L C  G PC
Sbjct  266  LKCIKGRPC  274



>ref|XP_004514773.1| PREDICTED: probable pectate lyase 3-like [Cicer arietinum]
Length=454

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 159/256 (62%), Positives = 192/256 (75%), Gaps = 8/256 (3%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAGIT+QFVKN+IIHGI I++I    GG+IRD   H+G RTKSDGDGISIFG+SNVWID
Sbjct  200  NGAGITVQFVKNIIIHGIKIYNIKVKEGGMIRDSESHYGFRTKSDGDGISIFGASNVWID  259

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSMRNC DGLIDAI  STAITISNGHFTDHN+VMLFGA+D  + DKIMQIT+AFNHFGK
Sbjct  260  HVSMRNCTDGLIDAIMGSTAITISNGHFTDHNEVMLFGASDDYSDDKIMQITLAFNHFGK  319

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDI-------HKR  429
            RL+QRMPR RFG++HVVNNDYTHW MYA+GGS +PTIIS+GNRFI P ++       + +
Sbjct  320  RLVQRMPRARFGFVHVVNNDYTHWEMYAMGGSQNPTIISEGNRFIGPDNVMVGGNQLNLK  379

Query  428  QITHRVGAAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTW  249
            ++T R       WK W WRS  D ++ GA+F+QSG P+   +     D +       V  
Sbjct  380  EVTKREYTDESVWKNWQWRSINDEFLNGAYFIQSG-PELKNRPFSKKDMITAKPGSYVGR  438

Query  248  LTRFAGALNCRVGSPC  201
            LTR++G L CRVG PC
Sbjct  439  LTRYSGNLQCRVGKPC  454



>ref|XP_009598230.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=434

 Score =   283 bits (725),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 155/250 (62%), Positives = 197/250 (79%), Gaps = 6/250 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GA   +QF+ NVIIHG+HIH I  GNGGLIRD ++H+G R++SDGDGISIFGS+N+WIDH
Sbjct  189  GASFMLQFINNVIIHGLHIHDIKAGNGGLIRDSINHYGFRSRSDGDGISIFGSTNIWIDH  248

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC DGLIDA++ASTAITISN HFT+HNDVMLFGA+D  ++D I+QIT+AFNHFG+ 
Sbjct  249  VSMSNCDDGLIDAVQASTAITISNSHFTNHNDVMLFGASDSYSEDSILQITLAFNHFGQG  308

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            LIQRMPR R+G++H VNNDYTHW MYAIGGS  PTI+SQGNRFIAP + + +++T R  +
Sbjct  309  LIQRMPRVRWGFVHAVNNDYTHWLMYAIGGSQHPTILSQGNRFIAPPNPNAKEVTKREYS  368

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPD--FMKKHNELYDGVQTFKAEDVTWLTRFAG  231
                WK W WRS+GD+ M GAFFV+SG+P+  FMK  + ++    ++ +     LTRF+G
Sbjct  369  PESVWKNWVWRSQGDLMMNGAFFVESGNPNHIFMKGPDMIHPRPGSYASR----LTRFSG  424

Query  230  ALNCRVGSPC  201
            +LNC  G PC
Sbjct  425  SLNCIEGKPC  434



>ref|XP_006286712.1| hypothetical protein CARUB_v10002862mg [Capsella rubella]
 gb|EOA19610.1| hypothetical protein CARUB_v10002862mg [Capsella rubella]
Length=512

 Score =   286 bits (731),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 155/249 (62%), Positives = 194/249 (78%), Gaps = 2/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QFV+NVIIHG+HIHHIFE +GG+IRD +DHFG+RT++DGDGISI+GSS +W+DH
Sbjct  265  GAGITMQFVRNVIIHGLHIHHIFESSGGMIRDSVDHFGMRTRADGDGISIYGSSKIWLDH  324

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI  STAITISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK 
Sbjct  325  ISMSKCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKG  384

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  
Sbjct  385  LVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDY  444

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A+ ++WK W WRSE D++M GA+F QSGDP +   H      ++      V+ LT++AGA
Sbjct  445  ASEDEWKHWNWRSEKDVFMNGAYFRQSGDPKYKCAHTR-QQMIKPKHGLAVSKLTKYAGA  503

Query  227  LNCRVGSPC  201
            L+CRVG  C
Sbjct  504  LDCRVGKRC  512



>ref|XP_002323835.1| hypothetical protein POPTR_0017s11450g [Populus trichocarpa]
 gb|EEF03968.1| hypothetical protein POPTR_0017s11450g [Populus trichocarpa]
Length=452

 Score =   284 bits (726),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 156/248 (63%), Positives = 189/248 (76%), Gaps = 2/248 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQF++NVIIHGI IHHI   +GG IRD ++H+G+RT SDGDGISIFGSSN+WIDH
Sbjct  207  GAGITIQFIQNVIIHGIRIHHIVATSGGNIRDSVEHYGIRTNSDGDGISIFGSSNIWIDH  266

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM  C DGLIDAI  STAITISN HFT HND +L GA+D  + D++MQ+T+AFNHFG+ 
Sbjct  267  VSMSRCTDGLIDAIMGSTAITISNSHFTHHNDAILLGASDSFSGDELMQVTVAFNHFGQG  326

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTIISQGNRFIAP ++H +Q+T R  A
Sbjct  327  LVQRMPRCRWGFFHVVNNDYTHWRMYAIGGSKHPTIISQGNRFIAPPELHLKQVTKRDYA  386

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
               +WK WTWRSE D+ M GAFF++SG P   + H +    +        T +T FAGAL
Sbjct  387  TESEWKTWTWRSENDLMMNGAFFIESGKPRTKRPHKKFM--ITAKPGSLATRMTLFAGAL  444

Query  224  NCRVGSPC  201
            +C+ G  C
Sbjct  445  DCKSGRKC  452



>ref|XP_007215366.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
 gb|EMJ16565.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
Length=452

 Score =   283 bits (725),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 165/251 (66%), Positives = 194/251 (77%), Gaps = 7/251 (3%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QFV+NVIIHG+HIH I  G+GG IRD +DHFG RT+SDGDGISIFGSS++W+DH
Sbjct  206  GAGITLQFVQNVIIHGLHIHDIVPGSGGTIRDSVDHFGTRTQSDGDGISIFGSSHIWLDH  265

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM NC DGLID I+ STAITISN HFT HNDV+LFGA+D    D IMQIT+AFNHFGK 
Sbjct  266  LSMWNCGDGLIDVIQGSTAITISNCHFTRHNDVLLFGASDSFAGDAIMQITVAFNHFGKG  325

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+IHVVNNDYTHW MYAIGGSS PTIISQGNRFIAP +   +++T R  A
Sbjct  326  LVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTIISQGNRFIAPPNHAAKEVTKRDYA  385

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAED---VTWLTRFA  234
              + WK W WRSEGD+ + GAFFV+SG    + K N  +  +    A+    VT LTRFA
Sbjct  386  PVDVWKNWQWRSEGDLMLNGAFFVESG----VAKKNHGFGKLDMMTAKPGTFVTRLTRFA  441

Query  233  GALNCRVGSPC  201
            G L CRVG  C
Sbjct  442  GTLGCRVGQKC  452



>ref|XP_009788285.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=434

 Score =   283 bits (724),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 155/250 (62%), Positives = 197/250 (79%), Gaps = 6/250 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GA   +QF+ NVIIHG+HIH I  GNGGLIRD ++H+G R++SDGDGISIFGS+N+WIDH
Sbjct  189  GASFMLQFINNVIIHGLHIHDIKAGNGGLIRDSINHYGFRSRSDGDGISIFGSTNIWIDH  248

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC DGLIDA++ASTAITISN HFT+HNDVMLFGA+D  ++D I+QIT+AFNHFG+ 
Sbjct  249  VSMSNCDDGLIDAVQASTAITISNCHFTNHNDVMLFGASDSYSEDSILQITLAFNHFGQG  308

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            LIQRMPR R+G++H VNNDYTHW MYAIGGS  PTI+SQGNRFIAP + + +++T R  +
Sbjct  309  LIQRMPRVRWGFVHAVNNDYTHWLMYAIGGSQHPTILSQGNRFIAPPNPNAKEVTKREYS  368

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPD--FMKKHNELYDGVQTFKAEDVTWLTRFAG  231
                WK W WRS+GD+ M GAFFV+SG+P+  FMK  + ++    ++ +     LTRF+G
Sbjct  369  PESVWKNWVWRSQGDLMMNGAFFVESGNPNHIFMKGPDMIHPRPGSYASR----LTRFSG  424

Query  230  ALNCRVGSPC  201
            +LNC  G PC
Sbjct  425  SLNCIEGKPC  434



>emb|CDX70590.1| BnaC03g06740D [Brassica napus]
Length=475

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 155/249 (62%), Positives = 195/249 (78%), Gaps = 2/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG+T+QFV++VIIHG+HIHHI E +GG+IRD  DHFG+RT++DGDG+SI+GSSN+W+DH
Sbjct  228  GAGVTMQFVRHVIIHGLHIHHISESSGGMIRDSADHFGMRTRADGDGLSIYGSSNIWLDH  287

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM  C DGLIDAI  STAITISN HFT HNDVML GA +    DK MQ+T+A+NHFGK 
Sbjct  288  VSMSQCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNTYDLDKKMQVTVAYNHFGKG  347

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDI-HKRQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+SQGNRFIAP  + H R++T R  
Sbjct  348  LVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQSPTILSQGNRFIAPPHLPHYREVTKRDY  407

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A  E+WK W WRSE DI+M GA+F QSG+P++   H    + ++      V+ LT++AGA
Sbjct  408  APEEEWKHWNWRSEKDIFMNGAYFRQSGNPNYETDHTR-RNMIKPKNGYAVSKLTKYAGA  466

Query  227  LNCRVGSPC  201
            L+CRVG  C
Sbjct  467  LDCRVGRRC  475



>ref|XP_003554335.1| PREDICTED: pectate lyase-like [Glycine max]
Length=443

 Score =   283 bits (724),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 157/249 (63%), Positives = 188/249 (76%), Gaps = 2/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            DGAG+TIQFV NVIIHG+ I +I    GG+IRD  +H GLRTKSDGD ISIFG+SNVWID
Sbjct  197  DGAGLTIQFVNNVIIHGVRIKNIVPKEGGMIRDSYNHVGLRTKSDGDAISIFGASNVWID  256

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVS+ NC DGLID I+ STAITISN H T HNDVMLFGA+D  + DKIMQIT+AFNHFG+
Sbjct  257  HVSLSNCADGLIDVIQGSTAITISNCHMTKHNDVMLFGASDSYSGDKIMQITVAFNHFGQ  316

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L+QRMPRCR+G++HV+NNDYTHW MYAIGGSS PTI+SQGNRFIAP++   + ITHR  
Sbjct  317  GLVQRMPRCRWGFVHVLNNDYTHWMMYAIGGSSGPTILSQGNRFIAPNNNAAKLITHRDY  376

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A P+ WK W W+SE D+++ GA F+ SG P        L   ++       + LTR +GA
Sbjct  377  AEPQVWKNWQWQSEMDLFINGAQFIPSGSPIKTTYKKGLL--MKPRDGTHASRLTRNSGA  434

Query  227  LNCRVGSPC  201
            LNC VG PC
Sbjct  435  LNCIVGRPC  443



>ref|XP_010550068.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=469

 Score =   284 bits (726),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 155/249 (62%), Positives = 194/249 (78%), Gaps = 2/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QFV N+IIHG+HIHHI   NGG+IRD +DH+G RT++DGDG+SIFG+SN+WIDH
Sbjct  222  GAGITMQFVTNIIIHGLHIHHIVSSNGGMIRDSVDHYGFRTRADGDGLSIFGASNIWIDH  281

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM  C DGLIDAI+ ST ITISN HFT HNDVML GA+++  KDK MQ+T+A+NHFGK 
Sbjct  282  VSMSRCQDGLIDAIDGSTGITISNSHFTHHNDVMLLGAHNVIDKDKRMQVTVAYNHFGKG  341

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHK-RQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP  I + +++T R  
Sbjct  342  LVQRMPRVRWGFVHVVNNDYTHWELYAIGGSQSPTILSHGNRFIAPPHIPQYKEVTKRDY  401

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A   +WK W WRSE DI+M GAFF QSG+P+F   H      ++      V+ LT++AGA
Sbjct  402  APEAEWKNWNWRSERDIFMNGAFFRQSGNPNFRCTHTR-QQMIKPKHGLAVSMLTKYAGA  460

Query  227  LNCRVGSPC  201
            L+C+VG PC
Sbjct  461  LDCKVGRPC  469



>ref|XP_008456459.1| PREDICTED: pectate lyase-like [Cucumis melo]
Length=434

 Score =   283 bits (723),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 188/249 (76%), Gaps = 1/249 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG+TIQFV NVIIH +HIH I   +GG+IRD +DH+G RT+SDGDGISIFGSS+VWIDH
Sbjct  186  GAGLTIQFVNNVIIHNLHIHDIISKSGGMIRDSVDHYGFRTQSDGDGISIFGSSHVWIDH  245

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC DGLIDAI  STAITISN HFT HN+VMLFGA+D   +D+IMQ+T+AFNHFG+ 
Sbjct  246  VSMSNCEDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDSYAEDEIMQVTLAFNHFGRG  305

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTI+SQGNRFIAP + + +Q+T R  A
Sbjct  306  LVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNPNAKQVTKREYA  365

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHN-ELYDGVQTFKAEDVTWLTRFAGA  228
              ++WK W+WRSEGD  M GA F+ SGD    KK     YD +       V  L RF+G 
Sbjct  366  MEDEWKHWSWRSEGDELMNGAVFIPSGDQTKGKKKGLSRYDMISFKPGTYVRRLARFSGT  425

Query  227  LNCRVGSPC  201
            L C  G PC
Sbjct  426  LECTPGKPC  434



>ref|XP_010105747.1| putative pectate lyase P59 [Morus notabilis]
 gb|EXC05967.1| putative pectate lyase P59 [Morus notabilis]
Length=421

 Score =   282 bits (721),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 166/249 (67%), Positives = 191/249 (77%), Gaps = 3/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQFVKNVIIH IHIH I  G+GG IRD ++H G RTKSDGDGISIFGSS++WIDH
Sbjct  175  GAGITIQFVKNVIIHNIHIHDINAGSGGNIRDSINHIGFRTKSDGDGISIFGSSHIWIDH  234

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC DGLIDAI  STAITISN HFT HN+VMLFGA+D  + D+ MQ+T+AFNHFG+ 
Sbjct  235  VSMSNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDSYSDDQRMQVTVAFNHFGQG  294

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTIISQGNRFIAP D++ +Q+T R  A
Sbjct  295  LVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPLDLNAKQVTKRDYA  354

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAED-VTWLTRFAGA  228
                WK W WRSEGD+ M GAFFVQSG    + K      G+  +K    VT LTR+AG 
Sbjct  355  PESDWKNWRWRSEGDLLMNGAFFVQSGKR--LSKRRYSRPGMIKYKPGTFVTRLTRYAGT  412

Query  227  LNCRVGSPC  201
            L C +G PC
Sbjct  413  LVCGIGRPC  421



>ref|XP_007137422.1| hypothetical protein PHAVU_009G125800g [Phaseolus vulgaris]
 gb|ESW09416.1| hypothetical protein PHAVU_009G125800g [Phaseolus vulgaris]
Length=439

 Score =   282 bits (721),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 186/249 (75%), Gaps = 2/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            DGAG+T+QFV NVIIHGI + +I    GG+IRD  +H GLRT+SDGD IS+FG+SN+WID
Sbjct  193  DGAGLTMQFVNNVIIHGIRVKNIVSKEGGMIRDSYNHVGLRTRSDGDAISVFGASNIWID  252

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVS+ N  DGLID I+ STAITISN H T HNDVMLFGA D  + DKIMQIT+AFNHFG+
Sbjct  253  HVSLSNSDDGLIDVIQGSTAITISNCHMTRHNDVMLFGATDTYSGDKIMQITVAFNHFGQ  312

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             LIQRMPRCR G+ HV+NNDYTHW MYAIGGS+ PTI+SQGNRFIAP++   ++ITHRV 
Sbjct  313  GLIQRMPRCRMGFFHVLNNDYTHWMMYAIGGSAAPTILSQGNRFIAPNNDAAKEITHRVD  372

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A PE WK W W+S+ D+ M GA F  SG P   +    L   ++      V+ LTR AGA
Sbjct  373  AEPEVWKNWQWQSDMDLLMNGATFNTSGSPITTQYKKGLL--MKPRDGTHVSRLTRHAGA  430

Query  227  LNCRVGSPC  201
            LNC VG PC
Sbjct  431  LNCFVGLPC  439



>ref|XP_006842121.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
 gb|ERN03796.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
Length=438

 Score =   282 bits (721),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 161/248 (65%), Positives = 188/248 (76%), Gaps = 2/248 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQ+ KNVIIHG+HIH I  GNGG+IRD  +H+GLRTKSDGD ISIF SS VWIDH
Sbjct  193  GAGITIQYQKNVIIHGLHIHDIKAGNGGMIRDSPEHYGLRTKSDGDAISIFASSFVWIDH  252

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
             SM NC DGLIDAI  STAITISN HFT+HN+V L GA+D  + DKIMQ+T AFNHFG+ 
Sbjct  253  NSMSNCMDGLIDAIMGSTAITISNNHFTNHNEVSLMGASDSFSDDKIMQVTFAFNHFGRG  312

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            LIQRMPRCR+G+ HVVNNDYTHW MYA+GGS  PTIISQGNR+IAP+  + +++T R  A
Sbjct  313  LIQRMPRCRWGFFHVVNNDYTHWGMYAVGGSQHPTIISQGNRYIAPTANYAKEVTKRDYA  372

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
            + + WKQWTWRSEGD+   GAFF +SG P   K   +  D +       V  LTRFAGAL
Sbjct  373  SEDVWKQWTWRSEGDVMKNGAFFRESGPPSTDKYTRQ--DKITAKPGTFVGRLTRFAGAL  430

Query  224  NCRVGSPC  201
             C+  SPC
Sbjct  431  VCKRKSPC  438



>ref|XP_003621115.1| Pectate lyase [Medicago truncatula]
 gb|AES77333.1| pectate lyase P59-like protein [Medicago truncatula]
Length=451

 Score =   282 bits (722),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 157/251 (63%), Positives = 186/251 (74%), Gaps = 5/251 (2%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAGIT+QFV NVIIHG+ I +I   NGGLIRD  DH G+RT+SDGD IS+FGSSN+WID
Sbjct  204  EGAGITMQFVNNVIIHGLRIKNIKAKNGGLIRDSFDHLGVRTRSDGDAISVFGSSNIWID  263

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            H+S+ NC DGL+D I+ STA+TISN H T HNDVMLFGA+D    DKIMQ+T+AFNHFG+
Sbjct  264  HISLSNCEDGLVDVIQGSTAVTISNCHMTKHNDVMLFGASDTYQDDKIMQVTVAFNHFGQ  323

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             LIQRMPRCR+G+ HV+NNDYTHW MYAIGGSS PTI+SQGNRFIAP +   + ITHR  
Sbjct  324  GLIQRMPRCRWGFFHVLNNDYTHWIMYAIGGSSAPTILSQGNRFIAPHNNAAKTITHRDY  383

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDG--VQTFKAEDVTWLTRFA  234
            A    W +W WRSEGD +M GA F+QSG P    K      G  ++         LTRF+
Sbjct  384  APEAVWSKWQWRSEGDHFMNGANFIQSGPP---IKSLPFKKGFLMKPRHGSQANRLTRFS  440

Query  233  GALNCRVGSPC  201
            GALNC VG PC
Sbjct  441  GALNCVVGRPC  451



>ref|XP_002871648.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47907.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=472

 Score =   283 bits (723),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 153/249 (61%), Positives = 193/249 (78%), Gaps = 2/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QFVKNVIIHG+HIHHI E +GG+IRD +DHFG+RT++DGDG+SI+GSSN+W+DH
Sbjct  225  GAGITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDH  284

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI  ST ITISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK 
Sbjct  285  ISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKG  344

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  
Sbjct  345  LVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDY  404

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A+ ++WK W WRSE D++M GA+F QSG+P +   H      ++      V+ LT++AGA
Sbjct  405  ASEDEWKHWNWRSEKDVFMNGAYFRQSGNPQYKCAHTR-QQMIKPKHGLAVSKLTKYAGA  463

Query  227  LNCRVGSPC  201
            L+CRVG  C
Sbjct  464  LDCRVGKRC  472



>gb|AAA86241.1| pectate lyase homolog [Medicago sativa]
Length=450

 Score =   282 bits (721),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 157/251 (63%), Positives = 187/251 (75%), Gaps = 5/251 (2%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            DGAGIT+QFV NVIIHG+ I +I   NGGLIRD  DH G+RT+SDGD IS+FGSSN+WID
Sbjct  203  DGAGITMQFVNNVIIHGLRIKNIKARNGGLIRDSFDHIGVRTRSDGDAISVFGSSNIWID  262

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            H+S+ +C DGL+D I+ STA+TISN H T HNDVMLFGA+D    DKIMQIT+AFNHFG+
Sbjct  263  HISLSDCEDGLVDVIQGSTAVTISNCHMTKHNDVMLFGASDTYQDDKIMQITVAFNHFGQ  322

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             LIQRMPRCR+G+ HV+NNDYTHW MYAIGGSS PTI+SQGNRFIAP +   + +THR  
Sbjct  323  GLIQRMPRCRWGFFHVLNNDYTHWIMYAIGGSSAPTILSQGNRFIAPHNNAAKTVTHRDY  382

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDG--VQTFKAEDVTWLTRFA  234
            A    W +W WRSEGD +M GA F+QSG P    K+     G  ++         LTRF+
Sbjct  383  APESVWSKWQWRSEGDHFMNGATFIQSGPP---IKNLPFKKGFLMKPRHGSQANRLTRFS  439

Query  233  GALNCRVGSPC  201
            GALNC VG PC
Sbjct  440  GALNCVVGRPC  450



>ref|XP_011005067.1| PREDICTED: probable pectate lyase P59 [Populus euphratica]
Length=452

 Score =   282 bits (721),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 155/248 (63%), Positives = 188/248 (76%), Gaps = 2/248 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQF++NVIIHGI IHHI   +GG IRD + H+G+RT SDGDGISIFGSSN+WIDH
Sbjct  207  GAGITIQFIQNVIIHGIRIHHIVATSGGNIRDSVGHYGIRTNSDGDGISIFGSSNIWIDH  266

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM  C DGLIDAI  STAITISN HFT HND +L GA+D  + D++MQ+T+AFNHFG+ 
Sbjct  267  VSMSRCTDGLIDAIMGSTAITISNSHFTHHNDAILLGASDSFSGDELMQVTVAFNHFGQG  326

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTI+SQGNRFIAP ++H +Q+T R  A
Sbjct  327  LVQRMPRCRWGFFHVVNNDYTHWRMYAIGGSKHPTIVSQGNRFIAPPELHLKQVTKRDYA  386

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
               +WK WTWRSE D+ M GAFF++SG P   + H +    +        T +T FAGAL
Sbjct  387  PESEWKTWTWRSENDLMMNGAFFIESGKPRTKRPHKKFM--ITAKPGSLATRMTLFAGAL  444

Query  224  NCRVGSPC  201
            +C+ G  C
Sbjct  445  DCKSGRKC  452



>ref|XP_010420163.1| PREDICTED: probable pectate lyase 19 isoform X1 [Camelina sativa]
Length=499

 Score =   283 bits (725),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 156/252 (62%), Positives = 194/252 (77%), Gaps = 8/252 (3%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QFVKNVIIHG+HIHHI E +GG+IRD +DHFG+RT++DGDG+SI+GSSN+W+DH
Sbjct  252  GAGITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDH  311

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI  ST ITISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK 
Sbjct  312  ISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKG  371

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  
Sbjct  372  LVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDY  431

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAED---VTWLTRF  237
            A  ++WK W WRSE D++M GA+F QSG+P F   H       Q  K ++   V+ LT++
Sbjct  432  APEDEWKHWIWRSEKDVFMNGAYFRQSGNPHFKCAHTR----KQMIKPKNGMAVSKLTKY  487

Query  236  AGALNCRVGSPC  201
            AGAL+CRVG  C
Sbjct  488  AGALDCRVGKRC  499



>ref|XP_010420164.1| PREDICTED: probable pectate lyase 19 isoform X2 [Camelina sativa]
Length=472

 Score =   282 bits (722),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 156/252 (62%), Positives = 194/252 (77%), Gaps = 8/252 (3%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QFVKNVIIHG+HIHHI E +GG+IRD +DHFG+RT++DGDG+SI+GSSN+W+DH
Sbjct  225  GAGITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDH  284

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI  ST ITISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK 
Sbjct  285  ISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKG  344

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  
Sbjct  345  LVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDY  404

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAED---VTWLTRF  237
            A  ++WK W WRSE D++M GA+F QSG+P F   H       Q  K ++   V+ LT++
Sbjct  405  APEDEWKHWIWRSEKDVFMNGAYFRQSGNPHFKCAHTR----KQMIKPKNGMAVSKLTKY  460

Query  236  AGALNCRVGSPC  201
            AGAL+CRVG  C
Sbjct  461  AGALDCRVGKRC  472



>ref|XP_004489374.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=447

 Score =   281 bits (720),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 157/249 (63%), Positives = 186/249 (75%), Gaps = 1/249 (0%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            DG GIT+QFV NVIIHG+HI +I    G +IRD  +H G RT+SDGD +SIFGSSN+WID
Sbjct  200  DGGGITMQFVNNVIIHGLHISNIKSKPGAMIRDSYNHVGQRTRSDGDALSIFGSSNIWID  259

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVS+  C DGLID I+ STAITISN H T HNDVMLFGA+D    DK+MQIT+AFNHFG+
Sbjct  260  HVSLSQCEDGLIDVIQGSTAITISNCHMTKHNDVMLFGASDTYNGDKLMQITVAFNHFGQ  319

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             LIQRMPRCRFG++HVVNNDYTHW MYAIGGSS PTI+SQGNRFIAP +   ++ITHR  
Sbjct  320  GLIQRMPRCRFGFVHVVNNDYTHWQMYAIGGSSGPTILSQGNRFIAPDNDAAKEITHRDY  379

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A PE WK W W+SE D++M GA FV SG P       + +  ++      V+ LTR +GA
Sbjct  380  AEPEVWKNWQWQSEMDLFMNGAKFVTSGSPINKAPFKKGFI-MKPRDGSHVSRLTRHSGA  438

Query  227  LNCRVGSPC  201
            LNC VG PC
Sbjct  439  LNCVVGKPC  447



>ref|XP_010420165.1| PREDICTED: probable pectate lyase 19 isoform X3 [Camelina sativa]
Length=506

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 156/252 (62%), Positives = 194/252 (77%), Gaps = 8/252 (3%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QFVKNVIIHG+HIHHI E +GG+IRD +DHFG+RT++DGDG+SI+GSSN+W+DH
Sbjct  259  GAGITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDH  318

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI  ST ITISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK 
Sbjct  319  ISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKG  378

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  
Sbjct  379  LVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDY  438

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAED---VTWLTRF  237
            A  ++WK W WRSE D++M GA+F QSG+P F   H       Q  K ++   V+ LT++
Sbjct  439  APEDEWKHWIWRSEKDVFMNGAYFRQSGNPHFKCAHTR----KQMIKPKNGMAVSKLTKY  494

Query  236  AGALNCRVGSPC  201
            AGAL+CRVG  C
Sbjct  495  AGALDCRVGKRC  506



>ref|XP_006374492.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
 gb|ERP52289.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
Length=435

 Score =   281 bits (719),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 158/249 (63%), Positives = 191/249 (77%), Gaps = 3/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GA IT+QFVKNVIIHGIHIH    GNGG+IRD +DH+G R++SDGDGISIFGS+++WID
Sbjct  190  NGAQITLQFVKNVIIHGIHIHDAKAGNGGMIRDSVDHYGFRSRSDGDGISIFGSTDIWID  249

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            H+S+ NC DGLIDAI  S AITISN HFT HNDVMLFGA+D  + D +MQIT+AFNHFG+
Sbjct  250  HISLSNCEDGLIDAIMGSNAITISNCHFTKHNDVMLFGASDSYSGDSVMQITVAFNHFGR  309

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L+QRMPR R+G++HVVNNDYTHW MYAIGGS  PTIISQGNRF+AP D   +++T R  
Sbjct  310  GLVQRMPRVRWGFVHVVNNDYTHWEMYAIGGSQHPTIISQGNRFVAPPDPACKEVTKRDY  369

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A    WK W WRSEGD+ + GAFFVQSG+   +K  N+    +       V+ LTRF+GA
Sbjct  370  AVESVWKSWNWRSEGDLMLNGAFFVQSGNA--IKTMNK-QAVISAKPGRYVSRLTRFSGA  426

Query  227  LNCRVGSPC  201
            LNC  G PC
Sbjct  427  LNCVRGRPC  435



>ref|XP_008230729.1| PREDICTED: pectate lyase [Prunus mume]
Length=452

 Score =   281 bits (720),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 163/251 (65%), Positives = 193/251 (77%), Gaps = 7/251 (3%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG+T+QFV+NVIIHG+HIH I  G+GG IRD +DHFG RT+SDGDGISIFGSS+VW+DH
Sbjct  206  GAGLTLQFVQNVIIHGLHIHDIVPGSGGTIRDSVDHFGTRTQSDGDGISIFGSSHVWLDH  265

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM NC DGLID I+ STA+TISN HFT HNDV+LFGA+D    D IMQIT+AFNHFGK 
Sbjct  266  LSMWNCADGLIDVIQGSTAVTISNCHFTRHNDVLLFGASDSFAGDAIMQITVAFNHFGKG  325

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+IHVVNNDYTHW MYAIGGSS PTIISQGNRFIAP +   +++T R  A
Sbjct  326  LVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTIISQGNRFIAPPNQAAKEVTKRDYA  385

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAED---VTWLTRFA  234
                WK W WRSEGD+ + GAFFV+SG    + K N  +  +    A+    V+ LTRFA
Sbjct  386  PMGVWKNWQWRSEGDLMLNGAFFVESG----VAKKNHGFGKLDMMTAKPGTFVSRLTRFA  441

Query  233  GALNCRVGSPC  201
            G L CRVG  C
Sbjct  442  GTLGCRVGQKC  452



>ref|XP_010453638.1| PREDICTED: probable pectate lyase 19 [Camelina sativa]
Length=490

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 156/252 (62%), Positives = 194/252 (77%), Gaps = 8/252 (3%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QFVKNVIIHG+HIHHI E +GG+IRD +DHFG+RT++DGDG+SI+GSSN+W+DH
Sbjct  243  GAGITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDH  302

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI  ST ITISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK 
Sbjct  303  ISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKG  362

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  
Sbjct  363  LVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDY  422

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAED---VTWLTRF  237
            A  ++WK W WRSE D++M GA+F QSG+P F   H       Q  K ++   V+ LT++
Sbjct  423  APEDEWKHWNWRSEKDVFMNGAYFRQSGNPHFKCTHTR----KQMIKHKNGMAVSKLTKY  478

Query  236  AGALNCRVGSPC  201
            AGAL+CRVG  C
Sbjct  479  AGALDCRVGKRC  490



>ref|XP_007139601.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
 gb|ESW11595.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
Length=444

 Score =   280 bits (717),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 152/249 (61%), Positives = 189/249 (76%), Gaps = 1/249 (0%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            DG+G+T+QFV NVIIHG+ + +I    GG IRD  +H G+RTK+DGD ISIFGSSN+WID
Sbjct  197  DGSGLTMQFVNNVIIHGLRLQNIKSTPGGTIRDSWNHVGIRTKADGDAISIFGSSNIWID  256

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            H+S+ +C DGL+D I+ ST ITISN H T HNDVMLFGA+D  T DKIMQ+T+AFNHFG+
Sbjct  257  HLSLSDCEDGLVDIIQGSTGITISNCHMTKHNDVMLFGASDTFTGDKIMQVTVAFNHFGQ  316

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             LIQRMPRCR+G+ HV+NNDYTHW MYAIGGSS PTI+SQGNRFIAP++   +++THR  
Sbjct  317  GLIQRMPRCRWGFFHVLNNDYTHWLMYAIGGSSAPTILSQGNRFIAPNNNAAKEVTHRDY  376

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A P  W++W WRSE D++M GA FVQSG P      N+ +  ++         LTRFAGA
Sbjct  377  AEPSVWEKWQWRSENDVFMNGANFVQSGPPLGKLPFNKGFL-MKPRHGSQANRLTRFAGA  435

Query  227  LNCRVGSPC  201
            LNC+  SPC
Sbjct  436  LNCKANSPC  444



>ref|XP_011013803.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=419

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 157/249 (63%), Positives = 191/249 (77%), Gaps = 3/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GA IT+QFVKNVIIHGIHIH    GNGG+IRD +DH+G R++SDGDGISIFGS+++WID
Sbjct  174  NGAQITLQFVKNVIIHGIHIHDAKAGNGGMIRDSVDHYGFRSRSDGDGISIFGSTDIWID  233

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            H+S+ NC DGLIDA+  S AITISN HFT HNDVMLFGA+D  + D +MQIT+AFNHFG+
Sbjct  234  HISLSNCEDGLIDAVMGSNAITISNCHFTKHNDVMLFGASDGYSGDSVMQITVAFNHFGR  293

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L+QRMPR R+G+ HVVNNDYTHW MYAIGGS  PTIISQGNRFIAP D+  +++T R  
Sbjct  294  GLVQRMPRVRWGFAHVVNNDYTHWEMYAIGGSQHPTIISQGNRFIAPPDLACKEVTKRDY  353

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A    WK W WRSEGD+ + GAFFVQSG+   +K  N+    +       V+ LTRF+GA
Sbjct  354  AVESVWKSWNWRSEGDLMLNGAFFVQSGNA--IKTMNK-QGVINAMPGRHVSRLTRFSGA  410

Query  227  LNCRVGSPC  201
            L+C  G PC
Sbjct  411  LDCVRGRPC  419



>ref|XP_004162547.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
Length=435

 Score =   280 bits (716),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 157/249 (63%), Positives = 187/249 (75%), Gaps = 1/249 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG+TIQFV NVIIH +HIH I   +GG+IRD +DH+G RT+SDGDGISIFGSS+VWIDH
Sbjct  187  GAGLTIQFVNNVIIHNLHIHDIVSKSGGMIRDSVDHYGFRTQSDGDGISIFGSSHVWIDH  246

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC DGLIDAI  STAITISN HFT HN+VMLFGA+D   +D+IMQ+T+AFNHFG+ 
Sbjct  247  VSMSNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDSYAEDEIMQVTLAFNHFGRG  306

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTI+SQGNRFIAP + + +Q+T R  A
Sbjct  307  LVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNPNAKQVTKREYA  366

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHN-ELYDGVQTFKAEDVTWLTRFAGA  228
              ++WK W+WRSEGD  M GA F+ SGD    KK     YD +       V  L R +G 
Sbjct  367  MEDEWKHWSWRSEGDELMNGAVFIASGDQTKGKKKGLSRYDMISFKPGTYVRRLVRLSGT  426

Query  227  LNCRVGSPC  201
            + C  G PC
Sbjct  427  IECTPGKPC  435



>ref|XP_004146792.1| PREDICTED: probable pectate lyase P59-like, partial [Cucumis 
sativus]
Length=442

 Score =   280 bits (716),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 158/249 (63%), Positives = 187/249 (75%), Gaps = 1/249 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG+TIQFV NVIIH +HIH I   +GG+IRD +DH+G RT+SDGDGISIFGSS+VWIDH
Sbjct  194  GAGLTIQFVNNVIIHNLHIHDIVSKSGGMIRDSVDHYGFRTQSDGDGISIFGSSHVWIDH  253

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC DGLIDAI  STAITISN HFT HN+VMLFGA+D   +D+IMQ+T+AFNHFG+ 
Sbjct  254  VSMSNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDSYAEDEIMQVTLAFNHFGRG  313

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTI+SQGNRFIAP + + +QIT R  A
Sbjct  314  LVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNPNAKQITKREYA  373

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHN-ELYDGVQTFKAEDVTWLTRFAGA  228
              ++WK W+WRSEGD  M GA F+ SGD    KK     YD +       V  L R +G 
Sbjct  374  MEDEWKHWSWRSEGDELMNGAVFIASGDQTKGKKKGLSRYDMISFKPGTYVRRLVRLSGT  433

Query  227  LNCRVGSPC  201
            + C  G PC
Sbjct  434  IECTPGKPC  442



>sp|Q9LFP5.1|PLY19_ARATH RecName: Full=Probable pectate lyase 19; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAC01830.1| pectate lyase-like protein [Arabidopsis thaliana]
Length=472

 Score =   281 bits (718),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 154/252 (61%), Positives = 195/252 (77%), Gaps = 8/252 (3%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QFVKNVIIHG+HIHHI E +GG+IRD +DHFG+RT++DGDG+SI+GSSN+W+DH
Sbjct  225  GAGITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDH  284

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI  ST ITISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK 
Sbjct  285  ISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKG  344

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  
Sbjct  345  LVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDY  404

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAED---VTWLTRF  237
            A+ ++WK W WRS+ D++M GA+F QSG+P +   H       Q  K ++   V+ LT++
Sbjct  405  ASEDEWKHWNWRSDKDVFMNGAYFRQSGNPQYKCAHTRQ----QMIKPKNGLAVSKLTKY  460

Query  236  AGALNCRVGSPC  201
            AGAL+CRVG  C
Sbjct  461  AGALDCRVGRRC  472



>ref|XP_011009454.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=474

 Score =   281 bits (718),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 157/248 (63%), Positives = 188/248 (76%), Gaps = 2/248 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQF+ NVIIHGI IHHI   +GG IRD +DH+G+RT SDGDGISIFGS++VWIDH
Sbjct  229  GAGITIQFIHNVIIHGIRIHHIIATSGGNIRDSVDHYGIRTNSDGDGISIFGSTDVWIDH  288

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM  C DGLIDAI  STAITISN HFT HND +L GA+D  + D +MQ+T+AFNHFG+ 
Sbjct  289  VSMSRCTDGLIDAIMGSTAITISNCHFTHHNDAILLGASDSYSGDHLMQVTVAFNHFGQG  348

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW +YAIGGS  PTIISQGNRFIAP + H +Q+T R  A
Sbjct  349  LVQRMPRCRWGFFHVVNNDYTHWRLYAIGGSKHPTIISQGNRFIAPPESHLKQVTKRDYA  408

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
               +W +WTWRSE D+ M GAFFVQSG P   K + +    ++       T +TRFAGAL
Sbjct  409  TKGEWSKWTWRSENDLMMNGAFFVQSGQPRTKKPNRKFM--IKAKPGAVATRMTRFAGAL  466

Query  224  NCRVGSPC  201
            +C+ G  C
Sbjct  467  DCKPGREC  474



>ref|XP_010551866.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=475

 Score =   281 bits (718),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 152/249 (61%), Positives = 194/249 (78%), Gaps = 2/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QFV N+IIHG+HIHHI   NGG+IRD +DH+G RT++DGDG+SIFG+SN+WIDH
Sbjct  228  GAGITMQFVTNIIIHGLHIHHIVSSNGGMIRDSVDHYGFRTRADGDGLSIFGASNIWIDH  287

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM  C DGLIDAI+ ST ITISN HFT HNDVML GA+++  KDK MQ+T+A+NHFGK 
Sbjct  288  VSMSRCQDGLIDAIDGSTGITISNSHFTHHNDVMLLGAHNVIDKDKRMQVTVAYNHFGKG  347

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHK-RQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP  I + +++T R  
Sbjct  348  LVQRMPRVRWGFVHVVNNDYTHWQLYAIGGSQGPTILSHGNRFIAPPHIPQYKEVTKRDY  407

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A   +W++W WRSE D++M GAFF QSG+P F   H      ++      V+ LT++AG+
Sbjct  408  APESEWRKWNWRSEKDVFMNGAFFRQSGNPKFRCTHTR-QQMIRPKHGMAVSMLTKYAGS  466

Query  227  LNCRVGSPC  201
            L+C+VG PC
Sbjct  467  LDCKVGRPC  475



>ref|XP_010476496.1| PREDICTED: probable pectate lyase 3 [Camelina sativa]
Length=455

 Score =   280 bits (716),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 157/253 (62%), Positives = 184/253 (73%), Gaps = 4/253 (2%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAG+T+QFV NVIIH I++  I  GNGGLIRD   H GLRTKSDGDGIS+FG++N+WID
Sbjct  203  EGAGLTLQFVNNVIIHNIYVKQIVTGNGGLIRDSEQHIGLRTKSDGDGISLFGATNIWID  262

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM  C DG+IDAI+ STA+TISN HFTDH +VMLFGA D    DK MQIT+AFNHFGK
Sbjct  263  HVSMTRCEDGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDKKMQITVAFNHFGK  322

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
            RL QRMPRCRFG IHVVNNDYTHW MYAIGG+ DPTIISQGNRFIAP +   +QIT R  
Sbjct  323  RLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMDPTIISQGNRFIAPPNEQAKQITKREY  382

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDF--MKKHNELYD--GVQTFKAEDVTWLTR  240
                +WK W W+SEGD ++ GA+FVQSG  +    K HN +     ++      V  LT 
Sbjct  383  TPFVEWKSWNWQSEGDYFLNGAYFVQSGKANAWSAKLHNPIPSKFAIRPKPGTMVRKLTM  442

Query  239  FAGALNCRVGSPC  201
             AG L C+ G  C
Sbjct  443  EAGVLGCKHGKEC  455



>ref|XP_009117903.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=452

 Score =   279 bits (714),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 155/253 (61%), Positives = 185/253 (73%), Gaps = 4/253 (2%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +G G+T+QFV NVII+ I++ HI  GNGGLIRD  +H G+RTKSDGDGIS+FG++NVWID
Sbjct  200  EGVGLTLQFVNNVIINNIYVKHIIPGNGGLIRDSEEHVGIRTKSDGDGISLFGATNVWID  259

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM  C DG+IDAIE STA+TISN HFTDH +VMLFGA D    DK MQIT+AFNHFGK
Sbjct  260  HVSMTRCTDGMIDAIEGSTAVTISNSHFTDHQEVMLFGAKDEHVIDKNMQITVAFNHFGK  319

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
            RL QRMPRCRFG IHVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP +   +++T R  
Sbjct  320  RLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQAKEVTKREY  379

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDF--MKKHNELYD--GVQTFKAEDVTWLTR  240
             +   WK W W+SEGD ++ GA+FVQSG P+    K  N +     ++      V  LT 
Sbjct  380  TSYTDWKSWNWQSEGDYFLNGAYFVQSGRPNAWSPKPKNPVPSKFAIRPKPGTMVRELTM  439

Query  239  FAGALNCRVGSPC  201
             AGAL C  G  C
Sbjct  440  DAGALGCEAGKAC  452



>ref|XP_006344502.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=435

 Score =   279 bits (713),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 152/250 (61%), Positives = 188/250 (75%), Gaps = 6/250 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            G G+ +QFV NV+I  +HIH    G+GGLIRD + H+G R+KSDGDGISIFGS+NVWIDH
Sbjct  190  GGGLMLQFVHNVLISNLHIHDTKAGSGGLIRDSVSHYGYRSKSDGDGISIFGSTNVWIDH  249

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM NC DGLIDA+E STAITISN HFT HNDVMLFGA+D ++ D +MQIT+AFNHFG  
Sbjct  250  ISMSNCQDGLIDAVEGSTAITISNCHFTKHNDVMLFGASDTASGDSVMQITLAFNHFGHG  309

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L QRMPR R+G++H VNNDYTHW MYAIGGS  PTI+SQGNRFIAP + + +++T R  A
Sbjct  310  LTQRMPRIRWGFVHAVNNDYTHWLMYAIGGSMHPTILSQGNRFIAPPNPNAKEVTKRDYA  369

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPD--FMKKHNELYDGVQTFKAEDVTWLTRFAG  231
                WK W W+S+GD+ M GAFFV+SGDP   F+K  + +     +F    V+ LTRF+G
Sbjct  370  PENVWKNWVWKSQGDLMMNGAFFVESGDPKHAFLKGPDMITSKPGSF----VSSLTRFSG  425

Query  230  ALNCRVGSPC  201
            +L C  G PC
Sbjct  426  SLKCIEGRPC  435



>ref|NP_197015.4| putative pectate lyase 19 [Arabidopsis thaliana]
 gb|AED92118.1| putative pectate lyase 19 [Arabidopsis thaliana]
Length=472

 Score =   280 bits (716),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 153/252 (61%), Positives = 195/252 (77%), Gaps = 8/252 (3%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QFVKNV+IHG+HIHHI E +GG+IRD +DHFG+RT++DGDG+SI+GSSN+W+DH
Sbjct  225  GAGITMQFVKNVVIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDH  284

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI  ST ITISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK 
Sbjct  285  ISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKG  344

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  
Sbjct  345  LVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDY  404

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAED---VTWLTRF  237
            A+ ++WK W WRS+ D++M GA+F QSG+P +   H       Q  K ++   V+ LT++
Sbjct  405  ASEDEWKHWNWRSDKDVFMNGAYFRQSGNPQYKCAHTRQ----QMIKPKNGLAVSKLTKY  460

Query  236  AGALNCRVGSPC  201
            AGAL+CRVG  C
Sbjct  461  AGALDCRVGRRC  472



>ref|XP_011085780.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=447

 Score =   279 bits (714),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 190/249 (76%), Gaps = 4/249 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQFVKNVIIH + IHHI E +GGLIRD   H GLRT+SDGDGISIFGS ++WIDH
Sbjct  202  GAGITIQFVKNVIIHNLKIHHIVEKDGGLIRDSASHTGLRTQSDGDGISIFGSQDIWIDH  261

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM  C DGLID I+ ST ITISN HFTDH+  MLFG ND    D+ MQIT+AFNHFGKR
Sbjct  262  VSMTRCADGLIDIIQGSTGITISNSHFTDHDHAMLFGGNDKYPGDEKMQITVAFNHFGKR  321

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            ++QRMPRCR+G+ HVVNNDYTHW MYAIGGSS PTIISQGNR+IA    + +Q+T R   
Sbjct  322  MVQRMPRCRYGFFHVVNNDYTHWKMYAIGGSSHPTIISQGNRYIA-DHPYAKQVTKR--E  378

Query  404  APE-QWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
             PE +WK WTW ++GD+++ GA+F+ SGD D+  KH E  D ++   A+ V+ +T+FAG 
Sbjct  379  CPESEWKHWTWVTDGDLFLRGAYFIPSGDQDWPSKHPEKSDNIKPASAKLVSQMTKFAGR  438

Query  227  LNCRVGSPC  201
            L C++   C
Sbjct  439  LGCKLKYAC  447



>gb|KHG16093.1| hypothetical protein F383_07683 [Gossypium arboreum]
Length=454

 Score =   279 bits (714),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 158/251 (63%), Positives = 191/251 (76%), Gaps = 6/251 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QFV +VIIH IHIHHI     GLIRD +DH GLRT  DGDGI+IFGS+N+W+DH
Sbjct  207  GAGITLQFVDDVIIHSIHIHHIGPSKAGLIRDSVDHIGLRTTGDGDGINIFGSTNIWLDH  266

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI+ STAITISN HFT HNDV+L GA+D   +DK+MQ+T+AFNHFGK 
Sbjct  267  LSMSECQDGLIDAIQGSTAITISNCHFTHHNDVILLGASDTYERDKLMQVTVAFNHFGKE  326

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            LIQRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTIISQGNRFIAP D   ++IT+R  A
Sbjct  327  LIQRMPRCRWGFFHVVNNDYTHWKMYAIGGSMHPTIISQGNRFIAPDDPKAKEITNRNYA  386

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTW---LTRFA  234
               +W +W WRSEGD+ + GA F +SG PD   + +  +  +Q  KA+  T+   LTRFA
Sbjct  387  PQSEWSKWVWRSEGDLLLNGARFTKSG-PDKSPQFD--FTKMQMIKAKPATFVRRLTRFA  443

Query  233  GALNCRVGSPC  201
            GAL+C  G+ C
Sbjct  444  GALDCEKGNKC  454



>ref|XP_002892805.1| hypothetical protein ARALYDRAFT_471616 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69064.1| hypothetical protein ARALYDRAFT_471616 [Arabidopsis lyrata subsp. 
lyrata]
Length=459

 Score =   280 bits (715),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 157/253 (62%), Positives = 187/253 (74%), Gaps = 4/253 (2%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAG+T+Q+V NVIIH I++ HI  GNGGLIRD  DH GLRTKSDGDGIS+FG++N+WID
Sbjct  207  EGAGLTLQYVNNVIIHNIYVKHIVPGNGGLIRDSEDHIGLRTKSDGDGISLFGATNIWID  266

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM  C DG+IDAI+ STA+TISN HFTDH +VMLFGA D    DK MQIT+AFNHFGK
Sbjct  267  HVSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDKKMQITVAFNHFGK  326

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
            RL QRMPRCR+G IHVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP +   +QIT R  
Sbjct  327  RLEQRMPRCRYGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQAKQITKREY  386

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDF--MKKHNELYD--GVQTFKAEDVTWLTR  240
                +WK W W+SEGD ++ GA+FVQSG  +    K  N L +   ++      V  LT 
Sbjct  387  TPYTEWKSWNWQSEGDYFLNGAYFVQSGKANAWSSKPKNPLPNKFAIRPKPGTMVRKLTM  446

Query  239  FAGALNCRVGSPC  201
             AGAL C+ G  C
Sbjct  447  DAGALGCKQGKAC  459



>ref|XP_010496063.1| PREDICTED: probable pectate lyase 3 [Camelina sativa]
Length=455

 Score =   279 bits (714),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 158/253 (62%), Positives = 186/253 (74%), Gaps = 4/253 (2%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAG+T+QFV NVIIH I++ HI  GNGGLIRD   H GLRTKSDGDGIS+FG++N+WID
Sbjct  203  EGAGLTLQFVNNVIIHNIYVKHIVTGNGGLIRDSEQHIGLRTKSDGDGISLFGATNIWID  262

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM  C DG+IDAI+ STA+TISN HFTDH +VMLFGA D    DK MQIT+AFNHFGK
Sbjct  263  HVSMTRCEDGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDKKMQITVAFNHFGK  322

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
            RL QRMPRCRFG IHVVNNDYTHW MYAIGG+ DPTIISQGNRFIAP +   +QIT R  
Sbjct  323  RLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMDPTIISQGNRFIAPPNEQAKQITKREY  382

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDF--MKKHNELYD--GVQTFKAEDVTWLTR  240
                +WK W W+SEGD ++ GA+FVQSG  +    K HN + +   ++      V  LT 
Sbjct  383  TPFVEWKSWNWQSEGDYFLNGAYFVQSGKANAWSAKLHNPIPNKFAIRPKPGMMVRKLTM  442

Query  239  FAGALNCRVGSPC  201
             AG L C+ G  C
Sbjct  443  EAGVLGCKHGKAC  455



>gb|ABK28696.1| unknown [Arabidopsis thaliana]
Length=473

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 153/252 (61%), Positives = 195/252 (77%), Gaps = 8/252 (3%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QFVKNV+IHG+HIHHI E +GG+IRD +DHFG+RT++DGDG+SI+GSSN+W+DH
Sbjct  225  GAGITMQFVKNVVIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDH  284

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI  ST ITISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK 
Sbjct  285  ISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKG  344

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  
Sbjct  345  LVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDY  404

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAED---VTWLTRF  237
            A+ ++WK W WRS+ D++M GA+F QSG+P +   H       Q  K ++   V+ LT++
Sbjct  405  ASEDEWKHWNWRSDKDVFMNGAYFRQSGNPQYKCAHTRQ----QMIKPKNGLAVSKLTKY  460

Query  236  AGALNCRVGSPC  201
            AGAL+CRVG  C
Sbjct  461  AGALDCRVGRRC  472



>gb|KFK25747.1| hypothetical protein AALP_AA8G154300 [Arabis alpina]
Length=504

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 154/252 (61%), Positives = 195/252 (77%), Gaps = 8/252 (3%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QFV+NVIIHG+HIHHI E +GG+IRD +DH+G+RT++DGDG+SI+GSSN+W+DH
Sbjct  257  GAGITMQFVRNVIIHGLHIHHISESSGGMIRDSVDHYGMRTRADGDGLSIYGSSNIWLDH  316

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI  ST ITISN HFT HNDVML GA + + +DK MQ+T+A+NHFGK 
Sbjct  317  ISMSKCQDGLIDAICGSTGITISNSHFTHHNDVMLLGAQNTNEEDKKMQVTVAYNHFGKG  376

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  
Sbjct  377  LVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDY  436

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAED---VTWLTRF  237
            A+ ++WK W WRSE DI+M GA+F QSG P +   H       Q  K ++   V+ LT++
Sbjct  437  ASEDEWKHWNWRSEKDIFMNGAYFRQSGTPGYKCAHTR----KQMIKPKNGMAVSKLTKY  492

Query  236  AGALNCRVGSPC  201
            AGAL+CRVG  C
Sbjct  493  AGALDCRVGKRC  504



>ref|XP_002306040.1| hypothetical protein POPTR_0004s12300g [Populus trichocarpa]
 gb|EEE86551.1| hypothetical protein POPTR_0004s12300g [Populus trichocarpa]
Length=432

 Score =   278 bits (712),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 156/248 (63%), Positives = 187/248 (75%), Gaps = 2/248 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            G GITIQF+ NVIIHGI IHHI   +GG IRD +DH+G+RT SDGDGISIFGS++VWIDH
Sbjct  187  GGGITIQFIHNVIIHGIRIHHIIATSGGNIRDSVDHYGIRTNSDGDGISIFGSTDVWIDH  246

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM  C DGLIDAI  STAITISN HFT HND +L GA+D  + D +MQ+T+AFNHFG+ 
Sbjct  247  VSMSRCTDGLIDAIMGSTAITISNCHFTHHNDAILLGASDSYSGDHLMQVTVAFNHFGQG  306

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW +YAIGGS  PTIISQGNRFIAP + H +Q+T R  A
Sbjct  307  LVQRMPRCRWGFFHVVNNDYTHWRLYAIGGSKHPTIISQGNRFIAPPESHLKQVTKRDYA  366

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
               +W +WTWRSE D+ M GAFFVQSG P   K + +    ++       T +TRFAGAL
Sbjct  367  TKGEWSKWTWRSENDLMMNGAFFVQSGQPRTKKPNRKFM--IKAKPGAVATRMTRFAGAL  424

Query  224  NCRVGSPC  201
            +C+ G  C
Sbjct  425  DCKPGRKC  432



>ref|XP_007151201.1| hypothetical protein PHAVU_004G026400g [Phaseolus vulgaris]
 gb|ESW23195.1| hypothetical protein PHAVU_004G026400g [Phaseolus vulgaris]
Length=441

 Score =   278 bits (712),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 155/249 (62%), Positives = 183/249 (73%), Gaps = 2/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            DG G+T+QFV NVIIHGI +  I    GGLIRD  +H G RT+SDGD IS+FG+SN+WID
Sbjct  195  DGGGLTMQFVNNVIIHGIRVKDIVPKEGGLIRDSYNHIGQRTRSDGDAISVFGASNIWID  254

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVS+ N  DGLID I+ STAITISN H T HNDVMLFGA D  T DKIMQIT+AFNHFG+
Sbjct  255  HVSLSNSADGLIDVIQGSTAITISNCHMTRHNDVMLFGAADSYTGDKIMQITVAFNHFGQ  314

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             LIQRMPRCR G+ HV+NNDYTHW MYAIGGS+ PTI+SQGNRFIAP++   ++ITHR  
Sbjct  315  GLIQRMPRCRMGFFHVLNNDYTHWMMYAIGGSAGPTILSQGNRFIAPNNDAAKEITHRDY  374

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A PE+WK W W+S+ D+ M GA F  SG P  MK        ++      V+ LTR +GA
Sbjct  375  ATPEEWKNWQWQSDMDLLMNGATFNSSGSPIAMKHKKGFI--MKPRDGTHVSRLTRHSGA  432

Query  227  LNCRVGSPC  201
            LNC VG PC
Sbjct  433  LNCFVGLPC  441



>ref|XP_004236194.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=435

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 153/250 (61%), Positives = 187/250 (75%), Gaps = 6/250 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            G G+ +QF+ NVII  +HIH    G GGLIRD + H+G R+KSDGDGISIFGS+NVWIDH
Sbjct  190  GGGLMLQFIHNVIISNLHIHDTKAGAGGLIRDSVSHYGYRSKSDGDGISIFGSTNVWIDH  249

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM NC DGLIDA+E STAITISN HFT HNDVMLFGA+D ++ D +MQIT+AFNHFG  
Sbjct  250  ISMSNCQDGLIDAVEGSTAITISNCHFTKHNDVMLFGASDTASGDSVMQITLAFNHFGHG  309

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L QRMPR R+G++HVVNNDYTHW MYAIGGS  PTI+SQGNRFIAP + + +++T R  A
Sbjct  310  LTQRMPRVRWGFVHVVNNDYTHWLMYAIGGSMHPTILSQGNRFIAPPNPNAKEVTKRDYA  369

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELY--DGVQTFKAEDVTWLTRFAG  231
                WK W W+S+GD+ M GAFFV+SGDP    KH  L   D + +     V+ LT+F+G
Sbjct  370  PENVWKNWVWKSQGDLMMNGAFFVESGDP----KHAFLKGPDMITSKPGSSVSSLTQFSG  425

Query  230  ALNCRVGSPC  201
            +L C  G PC
Sbjct  426  SLKCIEGRPC  435



>gb|KDP45476.1| hypothetical protein JCGZ_09725 [Jatropha curcas]
Length=462

 Score =   278 bits (712),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 153/248 (62%), Positives = 193/248 (78%), Gaps = 1/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQFV N+IIHG+ IHHI    GG+IRD +DH GLRT SDGDGISIFGS+NVWIDH
Sbjct  216  GAGITIQFVSNIIIHGLRIHHICSTCGGMIRDSVDHVGLRTASDGDGISIFGSTNVWIDH  275

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC DGLIDAI+ STAITISN HF++HND +L GA+D  + D+ MQIT+AFNHFG+ 
Sbjct  276  VSMSNCQDGLIDAIQGSTAITISNCHFSNHNDAILLGASDSFSGDQFMQITVAFNHFGQG  335

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW +YAIGGS  PTI+SQGN+F+AP D + +++T R  A
Sbjct  336  LVQRMPRCRWGFFHVVNNDYTHWLLYAIGGSMHPTIVSQGNQFVAPDDKYIKEVTKRDYA  395

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
               +WK+W WRSEGD+ + GAFFV+SG+P    + ++ +  ++       T +TRFAGAL
Sbjct  396  PMSEWKKWNWRSEGDLMVNGAFFVESGEPALHLRPSKKF-MIKAKHGRFATQMTRFAGAL  454

Query  224  NCRVGSPC  201
            +C+ G  C
Sbjct  455  DCKYGKKC  462



>gb|KHG08055.1| putative pectate lyase P59 [Gossypium arboreum]
 gb|KHG08558.1| putative pectate lyase P59 [Gossypium arboreum]
Length=440

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 159/251 (63%), Positives = 190/251 (76%), Gaps = 7/251 (3%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQ+V+NVIIHG+HIHHI  GNGG+IRD ++H+G RTKSDGDGIS+FG++NVW+DH
Sbjct  194  GAGITIQYVRNVIIHGLHIHHIVPGNGGMIRDSVNHYGFRTKSDGDGISLFGATNVWLDH  253

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI+ STAITISN HFT H+ VMLFGAND    D+ MQIT+ FNHFGK 
Sbjct  254  LSMYKCRDGLIDAIQGSTAITISNCHFTHHDQVMLFGANDNHKMDEKMQITLVFNHFGKG  313

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+IHVVNNDYTHW MYAIGGSS PT+ISQGNR+IA   +  +++T R  A
Sbjct  314  LVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTVISQGNRYIARRHVASKEVTKRDYA  373

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDG---VQTFKAEDVTWLTRFA  234
             PE WK W WRSEGD+ + GAFF QSGDP    K +  + G   V    A  V  LT+ +
Sbjct  374  PPEVWKTWNWRSEGDLLLNGAFFSQSGDP----KASSKFKGDTKVSAKPAYKVDLLTKDS  429

Query  233  GALNCRVGSPC  201
            G L C  G  C
Sbjct  430  GTLICIRGRAC  440



>ref|XP_003552513.1| PREDICTED: pectate lyase-like [Glycine max]
Length=440

 Score =   277 bits (709),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 147/248 (59%), Positives = 188/248 (76%), Gaps = 1/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG+ +QFV N+IIHGI I+ I    G ++RD  +H G+RT+ DGD +SIFGSSN+W+DH
Sbjct  194  GAGLAMQFVNNIIIHGIRINKIKSMEGTMLRDLWNHVGIRTRCDGDAVSIFGSSNIWLDH  253

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +S+  C DGLID ++ ST ITISN H T HNDVMLFGA+D    DKIMQ+T+AFNHFG+ 
Sbjct  254  LSLSECEDGLIDIVQGSTGITISNCHMTKHNDVMLFGASDTYAGDKIMQVTVAFNHFGQG  313

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            LIQRMPRCR+G++HV+NNDYTHW MYAIGGSS+PTI+SQGNRFIAP++   ++ITHR  A
Sbjct  314  LIQRMPRCRWGFVHVINNDYTHWLMYAIGGSSEPTILSQGNRFIAPNNNAAKEITHRDYA  373

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
             PE+W +W W+SE D++M GA F+QSG P      N+    ++     +   LTRFAGAL
Sbjct  374  PPEEWSKWQWKSENDLFMNGATFLQSGSPLGKLPFNKGL-MMKPRPGAEANRLTRFAGAL  432

Query  224  NCRVGSPC  201
            NC+VG PC
Sbjct  433  NCKVGKPC  440



>ref|XP_004489168.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=444

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 153/249 (61%), Positives = 190/249 (76%), Gaps = 1/249 (0%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            DGAGIT+QFV NVIIHG+HI +I   +GG+IRD  +H GLRT+SDGD +S+FGSSN+WID
Sbjct  197  DGAGITMQFVNNVIIHGLHIRNIKARSGGMIRDSYNHVGLRTRSDGDALSVFGSSNIWID  256

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            H+S+    DGLID I+ STAITISN H T HNDVMLFGA+D  + DKIMQIT+AFNHFG+
Sbjct  257  HISLSESEDGLIDVIQGSTAITISNCHMTKHNDVMLFGASDSYSDDKIMQITVAFNHFGQ  316

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             LIQRMPRCR+G+ HV+NNDYTHW MYAIGGSS PTI+SQGNRFIAP++   + ITHR  
Sbjct  317  GLIQRMPRCRWGFFHVLNNDYTHWLMYAIGGSSGPTILSQGNRFIAPNNNAAKTITHRDY  376

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A+ + W +W WRSE D++M GA F++SG P       + Y  ++         LTR+AGA
Sbjct  377  ASQDVWSKWQWRSENDLFMNGATFIESGAPIKNLPFKKGYL-MKPRPGTQANRLTRYAGA  435

Query  227  LNCRVGSPC  201
            LNC++G PC
Sbjct  436  LNCQIGRPC  444



>ref|XP_006306515.1| hypothetical protein CARUB_v10012514mg [Capsella rubella]
 gb|EOA39413.1| hypothetical protein CARUB_v10012514mg [Capsella rubella]
Length=455

 Score =   278 bits (710),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 156/253 (62%), Positives = 185/253 (73%), Gaps = 4/253 (2%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAG+T+Q+V NVIIH I++ HI  GNGGLIRD   H GLRTKSDGDGIS+FG++N+WID
Sbjct  203  EGAGLTMQYVNNVIIHSIYVKHIVPGNGGLIRDSEHHVGLRTKSDGDGISLFGATNIWID  262

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM  C DG+IDAI+ STA+TISN HFTDH +VMLFGA D    DK MQIT+AFNHFGK
Sbjct  263  HVSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDKKMQITVAFNHFGK  322

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
            RL QRMPRCR+G IHVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP     +QIT R  
Sbjct  323  RLEQRMPRCRYGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPSEQAKQITKREY  382

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDF--MKKHNELYD--GVQTFKAEDVTWLTR  240
                +WK W W+SEGD ++ GA+FVQSG  +    K  N + +   ++      V  LT 
Sbjct  383  TPLAEWKSWNWQSEGDYFLNGAYFVQSGKANAWSPKPQNPIPNKFAIRPKPGTMVRKLTM  442

Query  239  FAGALNCRVGSPC  201
             AGAL CR G  C
Sbjct  443  EAGALGCRQGQAC  455



>ref|XP_003613596.1| Pectate lyase [Medicago truncatula]
 gb|AES96554.1| pectate lyase P59-like protein [Medicago truncatula]
Length=449

 Score =   277 bits (709),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 155/249 (62%), Positives = 189/249 (76%), Gaps = 1/249 (0%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAGITIQF++NVIIHGI I+ I  G+GGL+RD  DH+GLRT SDGDGISIFGSS++WID
Sbjct  202  NGAGITIQFIENVIIHGIKIYDIMVGSGGLVRDSEDHYGLRTISDGDGISIFGSSHIWID  261

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSMRNC DGLIDAI  STAITISN HFTDHN+VMLFGA+D    D+ MQIT+ FN FGK
Sbjct  262  HVSMRNCRDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDTYDGDQKMQITVVFNRFGK  321

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
            +LIQRMPRCRFG+IHV+NN Y  W MYAIGG+  PTIIS+GN+FIAP++ H ++IT R  
Sbjct  322  KLIQRMPRCRFGFIHVLNNFYNRWEMYAIGGTMHPTIISEGNKFIAPNNGHAKEITKRTL  381

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
                +WK W WRS  D+Y+ GAFF QSG  + + +     D ++      V  LTR++ +
Sbjct  382  VPEAEWKTWQWRSINDLYLNGAFFRQSG-AELINRPFSNKDMIKAKPGSYVGRLTRYSRS  440

Query  227  LNCRVGSPC  201
            L CRVG PC
Sbjct  441  LRCRVGKPC  449



>emb|CDX74293.1| BnaA03g27540D [Brassica napus]
Length=471

 Score =   278 bits (711),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 151/249 (61%), Positives = 191/249 (77%), Gaps = 2/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+Q+V+N+IIHG+H+HHI  G+GG+IR+  DHFG R ++DGDGISIFG++N+W+DH
Sbjct  224  GAGITMQYVRNIIIHGLHVHHIVPGSGGMIRNSNDHFGFRGQADGDGISIFGATNIWLDH  283

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI  ST ITISN HFT HNDVML GA + +  DK MQ+T+AFNHFGK 
Sbjct  284  ISMSKCQDGLIDAIMGSTGITISNSHFTHHNDVMLLGAQNDNHADKKMQVTVAFNHFGKG  343

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDI-HKRQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP  I H R++T R  
Sbjct  344  LVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQSPTILSHGNRFIAPPHIQHYREVTKRDY  403

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A   +WK W WRS+ DI+M  A+F QSG+P FM  H+     ++      V+ LT++AGA
Sbjct  404  APESEWKNWNWRSDKDIFMNNAYFRQSGNPKFMCSHSR-QQMIKPKHGSAVSKLTKYAGA  462

Query  227  LNCRVGSPC  201
            L+CRVG PC
Sbjct  463  LDCRVGKPC  471



>emb|CDX91953.1| BnaC03g32550D [Brassica napus]
Length=471

 Score =   278 bits (711),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 151/249 (61%), Positives = 191/249 (77%), Gaps = 2/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+Q+V+N+IIHG+H+HHI  G+GG+IR+  DHFG R ++DGDGISIFG++N+W+DH
Sbjct  224  GAGITMQYVRNIIIHGLHVHHIVPGSGGMIRNSNDHFGFRGQADGDGISIFGATNIWLDH  283

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI  ST ITISN HFT HNDVML GA + +  DK MQ+T+AFNHFGK 
Sbjct  284  ISMSKCQDGLIDAIMGSTGITISNSHFTHHNDVMLLGAQNDNHADKKMQVTVAFNHFGKG  343

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDI-HKRQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP  I H R++T R  
Sbjct  344  LVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQSPTILSHGNRFIAPPHIQHYREVTKRDY  403

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A   +WK W WRS+ DI+M  A+F QSG+P FM  H+     ++      V+ LT++AGA
Sbjct  404  APESEWKNWNWRSDKDIFMNNAYFRQSGNPKFMCSHSR-QQMIKPKHGSAVSKLTKYAGA  462

Query  227  LNCRVGSPC  201
            L+CRVG PC
Sbjct  463  LDCRVGKPC  471



>gb|KHN13652.1| Pectate lyase [Glycine soja]
Length=440

 Score =   277 bits (708),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 147/248 (59%), Positives = 188/248 (76%), Gaps = 1/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG+ +QFV N+IIHGI I+ I    G ++RD  +H G+RT+ DGD +SIFGSSN+W+DH
Sbjct  194  GAGLAMQFVNNIIIHGIRINKIKSMEGTMLRDLWNHVGIRTRCDGDAVSIFGSSNIWLDH  253

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +S+  C DGLID ++ ST ITISN H T HNDVMLFGA+D    DKIMQ+T+AFNHFG+ 
Sbjct  254  LSLSECEDGLIDIVQGSTGITISNCHMTKHNDVMLFGASDTYAGDKIMQVTVAFNHFGQG  313

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            LIQRMPRCR+G++HV+NNDYTHW MYAIGGSS+PTI+SQGNRFIAP++   ++ITHR  A
Sbjct  314  LIQRMPRCRWGFVHVINNDYTHWLMYAIGGSSEPTILSQGNRFIAPNNNAAKEITHRDYA  373

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
             PE+W +W W+SE D++M GA F+QSG P      N+    ++     +   LTRFAGAL
Sbjct  374  PPEEWSKWQWKSENDLFMNGATFLQSGAPLGKLPFNKGL-MMKPRPGAEANRLTRFAGAL  432

Query  224  NCRVGSPC  201
            NC+VG PC
Sbjct  433  NCKVGKPC  440



>emb|CDX85564.1| BnaA02g02490D [Brassica napus]
Length=473

 Score =   278 bits (710),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 154/249 (62%), Positives = 192/249 (77%), Gaps = 2/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQFV++VIIHG+ IHHI + NGG+IRD  DHFG+RTK+DGDGISI+GSS +W+DH
Sbjct  226  GAGITIQFVRHVIIHGLRIHHICQSNGGMIRDSTDHFGMRTKADGDGISIYGSSMIWLDH  285

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI  STAITISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK 
Sbjct  286  ISMSKCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNDNQGDKKMQVTVAYNHFGKG  345

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  
Sbjct  346  LVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQAPTILSHGNRFIAPPHKPHYREVTKRDY  405

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A+  +WK W WRS+ D++M GA+F QSG+P F K H+     ++      V+ LT++AGA
Sbjct  406  ASEHEWKHWNWRSDKDMFMNGAYFRQSGNPHF-KCHHTRKQMIKPKHGIAVSMLTKYAGA  464

Query  227  LNCRVGSPC  201
            L+CRVG  C
Sbjct  465  LDCRVGKRC  473



>gb|AAQ62997.1| oil palm polygalacturonase allergen PEST411 [Elaeis guineensis]
Length=447

 Score =   276 bits (707),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 165/255 (65%), Positives = 188/255 (74%), Gaps = 13/255 (5%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GA ITIQFV NVIIHG+HIH I   NGG+IRD L HFGLRTKSDGDGISI+GSS+VWIDH
Sbjct  199  GAQITIQFVNNVIIHGLHIHDIKPSNGGMIRDSLHHFGLRTKSDGDGISIYGSSDVWIDH  258

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
             SMRNC DGLIDAIE STAITISN HFT HNDV+LFGA+D +  D IMQ T+AFNHFGK 
Sbjct  259  CSMRNCADGLIDAIEGSTAITISNCHFTHHNDVLLFGASDSNENDSIMQATVAFNHFGKG  318

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG-  408
            L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTIISQGNRFIAP     +++T  V  
Sbjct  319  LVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSKHPTIISQGNRFIAPPLRFAKEVTKEVTK  378

Query  407  ---AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTW---L  246
               A  + WKQWTWRSEGD+   GAFF        + KH +++      +A+  TW   L
Sbjct  379  RDYATEDVWKQWTWRSEGDLMQNGAFFAS-----LVLKHKDVHRK-DFIRAKPGTWVRRL  432

Query  245  TRFAGALNCRVGSPC  201
            TRFAG L C+ G  C
Sbjct  433  TRFAGPLGCKAGRAC  447



>ref|XP_009126031.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
Length=481

 Score =   277 bits (709),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 154/249 (62%), Positives = 192/249 (77%), Gaps = 2/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQFV++VIIHG+ IHHI + NGG+IRD  DHFG+RTK+DGDGISI+GSS +W+DH
Sbjct  234  GAGITIQFVRHVIIHGLRIHHICQSNGGMIRDSTDHFGMRTKADGDGISIYGSSMIWLDH  293

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI  STAITISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK 
Sbjct  294  ISMSKCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNDNQGDKKMQVTVAYNHFGKG  353

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  
Sbjct  354  LVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQAPTILSHGNRFIAPPHKPHYREVTKRDY  413

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A+  +WK W WRS+ D++M GA+F QSG+P F K H+     ++      V+ LT++AGA
Sbjct  414  ASEHEWKHWNWRSDKDMFMNGAYFRQSGNPHF-KCHHTRKQMIKPKHGIAVSMLTKYAGA  472

Query  227  LNCRVGSPC  201
            L+CRVG  C
Sbjct  473  LDCRVGKRC  481



>ref|XP_006354795.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=435

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 154/248 (62%), Positives = 190/248 (77%), Gaps = 2/248 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GA + +Q++ NVIIHG+HIH I  GNGGLIRD ++H+G RT+SDGDGISIFGS+N+WIDH
Sbjct  190  GASLMLQYINNVIIHGLHIHDIKSGNGGLIRDSINHYGFRTRSDGDGISIFGSTNIWIDH  249

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC DGLIDA++ASTAITISN HFT HNDVMLFGA+D   +D I+QIT+AFNHFG+ 
Sbjct  250  VSMSNCDDGLIDAVQASTAITISNCHFTHHNDVMLFGASDSYKQDAILQITLAFNHFGQG  309

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            LIQRMPR R+G++H VNNDYTHW MYAIGGS  PTI+SQGNRFIAP + + +++T R  +
Sbjct  310  LIQRMPRVRWGFVHAVNNDYTHWIMYAIGGSQHPTILSQGNRFIAPPNPNAKEVTKRDYS  369

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
                WK W WRS+GD+ M GAFFV+SG+ +   K     D +      D   LTRF+G+L
Sbjct  370  PESVWKNWVWRSQGDLMMNGAFFVESGNRN--HKFMTGPDMIHPRAGSDAGRLTRFSGSL  427

Query  224  NCRVGSPC  201
            NC  G PC
Sbjct  428  NCIEGKPC  435



>sp|P40973.1|PLY_LILLO RecName: Full=Pectate lyase; Flags: Precursor [Lilium longiflorum]
 emb|CAA78976.1| pectate lyase [Lilium longiflorum]
 gb|AAA33398.1| pectate lyase [Lilium longiflorum]
Length=434

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 153/248 (62%), Positives = 191/248 (77%), Gaps = 2/248 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GA +T+QFV NVIIHGIHIH I  G GGLIRD   H G+RT+SDGDGISI GSSN+WIDH
Sbjct  189  GAQLTVQFVHNVIIHGIHIHDIKPGEGGLIRDSEKHSGIRTRSDGDGISIIGSSNIWIDH  248

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VS+  C DGLID I  STAITISN H T+H+DVML GA+D  T+D+IMQ+T+AFNHFG+ 
Sbjct  249  VSLARCSDGLIDVILGSTAITISNCHLTEHDDVMLLGASDTYTQDEIMQVTVAFNHFGRG  308

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G++HVVNNDYTHW MYA+GGS  PTIISQGNR+IAP     +++T R  A
Sbjct  309  LVQRMPRCRYGFVHVVNNDYTHWIMYAVGGSQHPTIISQGNRYIAPHIEAAKEVTKRDYA  368

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
             P +W +WTW+S+GD+++ GAFFV+SG P F  K+++  D ++      V  LTRF+GAL
Sbjct  369  EPAEWSKWTWKSQGDLFVSGAFFVESGGP-FENKYSK-KDLIKAKPGTFVQRLTRFSGAL  426

Query  224  NCRVGSPC  201
            NC+    C
Sbjct  427  NCKENMEC  434



>gb|KFK43687.1| hypothetical protein AALP_AA1G160000 [Arabis alpina]
Length=460

 Score =   276 bits (706),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 158/253 (62%), Positives = 186/253 (74%), Gaps = 4/253 (2%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAG+T+Q+V NVIIH I++ HI  GNGGLIRD   H GLRTKSDGDGIS+FG++NVWID
Sbjct  208  EGAGLTLQYVNNVIIHNIYVKHIVPGNGGLIRDSEHHLGLRTKSDGDGISLFGATNVWID  267

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM  C DG+IDAI+ STA+TISN HFTDH +VMLFGA D    DK MQIT+AFNHFGK
Sbjct  268  HVSMTRCADGMIDAIQGSTAVTISNSHFTDHQEVMLFGARDEDVIDKKMQITVAFNHFGK  327

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
            RL QRMPRCRFG IHVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP +   +QIT R  
Sbjct  328  RLEQRMPRCRFGLIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQAKQITKREY  387

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDF--MKKHNELYDG--VQTFKAEDVTWLTR  240
                +WK W W+SEGD ++ GA+FVQSG  +    K  N L +   ++      V  LT 
Sbjct  388  TPFIEWKSWNWQSEGDYFLNGAYFVQSGKANAWSPKPVNPLPNKFRIRPKPGTMVRKLTM  447

Query  239  FAGALNCRVGSPC  201
             AGAL C+ G  C
Sbjct  448  DAGALGCKHGKAC  460



>gb|AAQ62996.1| oil palm polygalacturonase allergen PEST361 [Elaeis guineensis]
Length=447

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 161/243 (66%), Positives = 188/243 (77%), Gaps = 8/243 (3%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GA ITIQFV +VIIHGIHIH I   NGG+IRD L HFG+RTKSDGDGISI+GSS++WIDH
Sbjct  199  GAQITIQFVHDVIIHGIHIHDIRPSNGGIIRDSLQHFGIRTKSDGDGISIYGSSDIWIDH  258

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
             S+RNC DGLIDAIEASTAITISN HFT HNDV+LFGA+D +  D +MQ T+AFNHFGK 
Sbjct  259  CSLRNCADGLIDAIEASTAITISNCHFTHHNDVLLFGASDSNEHDSMMQATVAFNHFGKG  318

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYT W MYAIGGS  PTIISQGNRF+AP  +  +++T R  A
Sbjct  319  LVQRMPRCRWGFFHVVNNDYTQWIMYAIGGSQHPTIISQGNRFVAPRMLFSKEVTKRDYA  378

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTW---LTRFA  234
              + WKQWTWRSEGD+   GAFF +SG+P+  K     +D     KA+  TW   LTRFA
Sbjct  379  TEDVWKQWTWRSEGDLMQNGAFFRESGNPNARK-----FDRKDFIKAKPGTWVRRLTRFA  433

Query  233  GAL  225
            G L
Sbjct  434  GPL  436



>ref|NP_001057945.1| Os06g0583900 [Oryza sativa Japonica Group]
 dbj|BAD68734.1| putative pectate lyase [Oryza sativa Japonica Group]
 dbj|BAF19859.1| Os06g0583900 [Oryza sativa Japonica Group]
 dbj|BAG93046.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80871.1| hypothetical protein OsI_23497 [Oryza sativa Indica Group]
Length=448

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 150/249 (60%), Positives = 191/249 (77%), Gaps = 2/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GA +T+Q   NVIIH IHIH I +G GG+IRD  +HFG RT+SDGDGISIFGS+NVW+D
Sbjct  202  NGAQVTVQNSNNVIIHNIHIHDILQGKGGMIRDSPEHFGFRTQSDGDGISIFGSTNVWLD  261

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            H+S+ NC DGLID I  ST +TISN H T+HNDVMLFG++D  ++D+IMQIT+AFNHFG+
Sbjct  262  HLSLSNCQDGLIDVIAKSTGVTISNCHLTNHNDVMLFGSSDSFSEDQIMQITVAFNHFGR  321

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS +PTIISQGNR+IAP ++  ++IT ++G
Sbjct  322  GLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKNPTIISQGNRYIAPPNLAAKRITKQLG  381

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A  E+WK W W SE D++M GA+F  SG P  ++K     D ++      VT LTRFAG+
Sbjct  382  ATEEEWKNWVWHSEEDLFMEGAYFTTSGGP--IQKQFSNKDLIKPKPGSYVTRLTRFAGS  439

Query  227  LNCRVGSPC  201
            + C  G PC
Sbjct  440  IPCVAGKPC  448



>gb|KHN08855.1| Putative pectate lyase P59 [Glycine soja]
Length=435

 Score =   275 bits (703),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 154/249 (62%), Positives = 185/249 (74%), Gaps = 4/249 (2%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GA IT+Q+VKN+IIHG+HIH I + +GGLIRD +DH+G+R  SDGD IS+FGS+ VWID
Sbjct  191  EGAQITLQYVKNIIIHGLHIHDIKKCSGGLIRDSMDHYGVRAMSDGDAISVFGSTYVWID  250

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVS  NC DGLID + ASTA+TISN H T HNDV+LFGA+D  + DKIMQ+T+AFNHFGK
Sbjct  251  HVSFTNCDDGLIDVVSASTAVTISNCHLTKHNDVLLFGASDSYSGDKIMQVTLAFNHFGK  310

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             LIQRMPRCR+G+ H+VNNDYTHW MYAIGGS  PTIISQGNRFIAP+D + +++T R  
Sbjct  311  GLIQRMPRCRWGFFHIVNNDYTHWLMYAIGGSQQPTIISQGNRFIAPNDRNAKEVTKRDY  370

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A    WK W WRSEGD+ M GAFFVQSG         E+         + V+ LTRFAG 
Sbjct  371  APESVWKNWNWRSEGDLLMNGAFFVQSGKNVAKNPKAEII----AKPGKAVSSLTRFAGP  426

Query  227  LNCRVGSPC  201
            L C V   C
Sbjct  427  LKCEVNKSC  435



>gb|EAY99626.1| hypothetical protein OsI_21605 [Oryza sativa Indica Group]
Length=441

 Score =   275 bits (703),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 149/248 (60%), Positives = 190/248 (77%), Gaps = 2/248 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GA IT+Q V++VIIH +HIHH     GG+IRD   H+GLRT+SDGDGISI  SSN+WIDH
Sbjct  196  GAQITLQGVQHVIIHNVHIHHSVPHGGGMIRDSKRHYGLRTRSDGDGISIMSSSNIWIDH  255

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC DGLIDA+  STAITISNGHFT H+ VMLFGA++   +D++MQIT+AFNHFGK 
Sbjct  256  VSMSNCSDGLIDAVSGSTAITISNGHFTKHDHVMLFGASNSDAQDEVMQITVAFNHFGKG  315

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QR+PRCRFG+ HVVNNDY HW MYAIGG+ +PTIISQGNRFIAP D++ +++T R   
Sbjct  316  LVQRLPRCRFGFFHVVNNDYMHWLMYAIGGNMNPTIISQGNRFIAPDDVNAKEVTKREYT  375

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
              +++K+W W+S+GD+ M GAFF +SG  +  ++  +  D +     + V  LT+FAGAL
Sbjct  376  PYDEYKEWVWKSQGDVMMNGAFFNESGGQN--ERSYDQLDFIPAKHGKYVGQLTKFAGAL  433

Query  224  NCRVGSPC  201
            NC VG PC
Sbjct  434  NCHVGMPC  441



>gb|KHG05193.1| hypothetical protein F383_30875 [Gossypium arboreum]
Length=385

 Score =   273 bits (698),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 154/248 (62%), Positives = 183/248 (74%), Gaps = 0/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            G GIT+QFV NVIIH IHIH +   +GGLIRD  DH+G RT  DGDGISIFGSS +W+DH
Sbjct  138  GCGITLQFVHNVIIHNIHIHRVVRSSGGLIRDSEDHYGYRTVGDGDGISIFGSSKIWLDH  197

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI+ STAITISN HFT H+ V+L GA+D  +KD+ MQ+T+AFNHFGK 
Sbjct  198  ISMSECQDGLIDAIQGSTAITISNCHFTHHDHVILLGASDTYSKDQYMQVTLAFNHFGKE  257

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            LIQRMPRCR+GY HVVNNDYTHW +YAIGGS+ PTIISQGNRFIAP D   ++ITHR  A
Sbjct  258  LIQRMPRCRWGYFHVVNNDYTHWKLYAIGGSTHPTIISQGNRFIAPDDPLTKEITHRNYA  317

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
               +W+ W WRSEGD +M GAFFV SG P       +  D ++   A  V  LT+F+G L
Sbjct  318  PESEWRNWIWRSEGDRFMNGAFFVTSGPPSPPHLKLKKKDIIKAKPAIFVGRLTKFSGTL  377

Query  224  NCRVGSPC  201
             C+ G  C
Sbjct  378  KCKEGVKC  385



>ref|XP_006655782.1| PREDICTED: pectate lyase-like [Oryza brachyantha]
Length=351

 Score =   272 bits (695),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 149/248 (60%), Positives = 190/248 (77%), Gaps = 2/248 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GA IT+Q V++VI+H +HIHH     GG+IRD   H+G RT+SDGDGIS+  SSNVWIDH
Sbjct  106  GAQITLQGVQHVIVHNVHIHHSAPHGGGMIRDSKRHYGRRTRSDGDGISVMSSSNVWIDH  165

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC DGL+D +  STAITISNGHFT H+ VMLFGA++   +D++MQIT+AFNHFGK 
Sbjct  166  VSMSNCSDGLVDVVSGSTAITISNGHFTKHDHVMLFGASNSDPQDRVMQITVAFNHFGKG  225

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCRFG+ HVVNNDYTHW MYAIGG+ +PTIISQGNRF AP D   +++T R   
Sbjct  226  LVQRMPRCRFGFFHVVNNDYTHWMMYAIGGNMNPTIISQGNRFRAPDDGELKEVTKREYT  285

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
            A E++K+W W+S+GD+++ GAFF QSG  +  +++++L D +       V  LT+FAG L
Sbjct  286  AYEEYKEWVWKSQGDLFLNGAFFNQSGGRN-ERRYDQL-DFIPAKHGSYVGQLTQFAGTL  343

Query  224  NCRVGSPC  201
            NCRVG PC
Sbjct  344  NCRVGHPC  351



>ref|XP_011085777.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=446

 Score =   275 bits (703),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 155/249 (62%), Positives = 191/249 (77%), Gaps = 4/249 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+Q+V+N+IIH I IH+I E  GG+IRD   H GLRT+SDGDGISIFG+ ++WIDH
Sbjct  201  GAGITVQYVRNIIIHNIKIHNIVEKKGGIIRDSTTHSGLRTQSDGDGISIFGAQDIWIDH  260

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM  C DGLIDAI+ STAITISNGHFTDH+  MLFGAND    D+ MQIT+AFNHFGKR
Sbjct  261  VSMTRCDDGLIDAIQGSTAITISNGHFTDHDHAMLFGANDKYPGDEKMQITVAFNHFGKR  320

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            ++QRMPRCR+G+ HVVNNDYTHW MYAIGGSS PTIISQGNR+IA    + +Q+T R   
Sbjct  321  MVQRMPRCRYGFFHVVNNDYTHWKMYAIGGSSHPTIISQGNRYIA-DHPYAKQVTKR--E  377

Query  404  APE-QWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
             PE +W+ WTW ++GDI++ GA+F  SGD D+  KH E  DG++   A  V  +T+FAG 
Sbjct  378  CPESEWRHWTWVTDGDIFLNGAYFRASGDQDWHHKHPEKSDGIKPGPATLVAQMTQFAGR  437

Query  227  LNCRVGSPC  201
            L+C+    C
Sbjct  438  LDCKKKYAC  446



>ref|XP_004301165.1| PREDICTED: probable pectate lyase P59-like [Fragaria vesca subsp. 
vesca]
Length=445

 Score =   275 bits (702),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 148/255 (58%), Positives = 190/255 (75%), Gaps = 11/255 (4%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            G  IT+Q+V+N+II  IH+      NGG+IRD ++H+GLRT+SDGDGIS+FG++NVWIDH
Sbjct  195  GGQITLQYVRNIIISNIHVRDTIPKNGGMIRDSINHYGLRTESDGDGISLFGATNVWIDH  254

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDV------MLFGANDLSTKDKIMQITIAF  603
            VS  NC DGLID I+ASTAITISN HFTDHNDV      MLFG++D ++KD+IMQIT+AF
Sbjct  255  VSASNCADGLIDVIQASTAITISNSHFTDHNDVIINLSVMLFGSSDSNSKDEIMQITLAF  314

Query  602  NHFGKRLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQI  423
            NHFG+ L+QRMPRCRFG+ HVVNNDYTHW MYAIGGSS PTI+SQGNR+IAP +   +++
Sbjct  315  NHFGQGLVQRMPRCRFGFFHVVNNDYTHWIMYAIGGSSHPTILSQGNRYIAPENEAAKEV  374

Query  422  THRVGAAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHN-ELYDGVQTFKAEDVTWL  246
             +RV      WK W W+S+ D+++ GA F +SG P     H+ +  D ++      VT+L
Sbjct  375  CYRVNTDKSVWKNWNWQSDKDLFVNGATFTESGGP----VHSIDTKDMIEAQAGTAVTFL  430

Query  245  TRFAGALNCRVGSPC  201
            TR+AG L CR G  C
Sbjct  431  TRYAGPLKCRKGQGC  445



>emb|CAN69904.1| hypothetical protein VITISV_001006 [Vitis vinifera]
Length=443

 Score =   274 bits (701),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 158/252 (63%), Positives = 191/252 (76%), Gaps = 5/252 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQF +NVIIHG+HIH I    GGLIRD + HFGLRT+SDGDGISIFGSS+VWIDH
Sbjct  193  GAGITIQFARNVIIHGLHIHDIVSHPGGLIRDSVHHFGLRTRSDGDGISIFGSSHVWIDH  252

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
             SM  C DGL+DAI+ STAITISN HFT HN+ ML GA+D  + D IMQ+T+AFNHFG+ 
Sbjct  253  NSMSKCEDGLVDAIQGSTAITISNNHFTKHNETMLLGASDGYSGDIIMQVTVAFNHFGRG  312

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHK----RQITH  417
            LIQRMPRCR+G+ HVVNNDYTHWNMYA+GGS+ PTI+SQGNR++A   +      +++T 
Sbjct  313  LIQRMPRCRWGFFHVVNNDYTHWNMYAVGGSAHPTIVSQGNRYVAAPLMDPKHDAKEVTK  372

Query  416  RVGAAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRF  237
            R  A   +W +WTWRSEGD+ + GAFFVQSG P F KK    YD ++    + V  LTR+
Sbjct  373  RDHATKAEWSKWTWRSEGDLMVNGAFFVQSGVP-FKKKPFSRYDMIKAKPGKFVPRLTRY  431

Query  236  AGALNCRVGSPC  201
            +GAL C   SPC
Sbjct  432  SGALTCWRTSPC  443



>ref|XP_002270112.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32014.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   274 bits (701),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 158/252 (63%), Positives = 191/252 (76%), Gaps = 5/252 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQF +NVIIHG+HIH I    GGLIRD + HFGLRT+SDGDGISIFGSS+VWIDH
Sbjct  193  GAGITIQFARNVIIHGLHIHDIVSRPGGLIRDSVHHFGLRTRSDGDGISIFGSSHVWIDH  252

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
             SM  C DGL+DAI+ STAITISN HFT HN+ ML GA+D  + D IMQ+T+AFNHFG+ 
Sbjct  253  NSMSKCEDGLVDAIQGSTAITISNNHFTKHNETMLLGASDGYSGDIIMQVTVAFNHFGRG  312

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHK----RQITH  417
            LIQRMPRCR+G+ HVVNNDYTHWNMYA+GGS+ PTI+SQGNR++A   +      +++T 
Sbjct  313  LIQRMPRCRWGFFHVVNNDYTHWNMYAVGGSAHPTIVSQGNRYVAAPLMDPKHDAKEVTK  372

Query  416  RVGAAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRF  237
            R  A   +W +WTWRSEGD+ + GAFFVQSG P F KK    YD ++    + V  LTR+
Sbjct  373  RDHATKAEWSKWTWRSEGDLMVNGAFFVQSGVP-FKKKPFSRYDMIKAKPGKFVPRLTRY  431

Query  236  AGALNCRVGSPC  201
            +GAL C   SPC
Sbjct  432  SGALTCWRTSPC  443



>ref|XP_009125036.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 7 [Brassica 
rapa]
Length=470

 Score =   275 bits (703),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 153/249 (61%), Positives = 189/249 (76%), Gaps = 2/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+Q+V N+IIHG+HIHHI +G GG+IR+  DHFG R  +DGDGISIFG++N+W+DH
Sbjct  223  GAGITMQYVHNIIIHGLHIHHIVQGRGGMIRNSNDHFGFRGVADGDGISIFGATNIWLDH  282

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI  ST ITISN HFT HNDVML GA + +  DK MQ+T+AFNHFGK 
Sbjct  283  ISMSKCQDGLIDAIMGSTGITISNSHFTHHNDVMLLGAQNDNHADKKMQVTVAFNHFGKG  342

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDI-HKRQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP  I H R++T R  
Sbjct  343  LVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQSPTILSHGNRFIAPPHIQHYREVTKRDS  402

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A   +WK W WRSE DI+M  A+F QSG+P FM  H+     ++      V+ LT++AGA
Sbjct  403  APESEWKNWNWRSEKDIFMNNAYFRQSGNPKFMCSHSR-QQMIKPKHGVAVSKLTKYAGA  461

Query  227  LNCRVGSPC  201
            L+CRVG PC
Sbjct  462  LDCRVGKPC  470



>emb|CDY53552.1| BnaA09g57110D [Brassica napus]
Length=495

 Score =   276 bits (705),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 154/249 (62%), Positives = 183/249 (73%), Gaps = 4/249 (2%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +G G+T+QFV NVII+ I++ HI  GNGGLIRD  +H GLRTKSDGDGIS+FG++NVWID
Sbjct  200  EGVGLTLQFVNNVIINNIYVKHIIPGNGGLIRDSEEHVGLRTKSDGDGISLFGATNVWID  259

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM  C DG+IDAIE STA+TISN HFTDH +VMLFGA D    DK MQIT+AFNHFGK
Sbjct  260  HVSMTRCTDGMIDAIEGSTAVTISNSHFTDHQEVMLFGAKDEHVIDKNMQITVAFNHFGK  319

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
            RL QRMPRCRFG IHVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP +   +++T R  
Sbjct  320  RLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQAKEVTKREY  379

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDF--MKKHNELYD--GVQTFKAEDVTWLTR  240
             +   WK W W+SEGD ++ GA+FVQSG P+    K  N +     ++      V  LT 
Sbjct  380  TSYTDWKSWNWQSEGDYFLNGAYFVQSGRPNAWSPKPKNPVPSKFAIRPKPGTMVRELTM  439

Query  239  FAGALNCRV  213
             AGAL C  
Sbjct  440  DAGALGCEA  448



>gb|AAB69759.1| putative pectate lyase [Arabidopsis thaliana]
Length=459

 Score =   274 bits (701),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 154/253 (61%), Positives = 184/253 (73%), Gaps = 4/253 (2%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAG+T+QFV NVIIH I++ HI  GNGGLIRD   H GLRTKSDGDGIS+ G++N+WID
Sbjct  207  EGAGLTLQFVNNVIIHNIYVKHIVPGNGGLIRDSEAHIGLRTKSDGDGISLIGATNIWID  266

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM  C DG+IDAI+ STA+TISN HFTDH +VMLFGA D    DK MQIT+AFNHFGK
Sbjct  267  HVSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDKKMQITVAFNHFGK  326

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
            RL QRMPRCR+G IHVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP +   +QIT R  
Sbjct  327  RLEQRMPRCRYGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEEAKQITKREY  386

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPD-FMKKHNELYDGVQTFKAED---VTWLTR  240
                +WK W W+SEGD ++ GA+FVQSG  + +  K         T + +    V  LT 
Sbjct  387  TPYGEWKSWNWQSEGDYFLNGAYFVQSGKANAWSSKPKTPLPNKFTIRPKPGTMVRKLTM  446

Query  239  FAGALNCRVGSPC  201
             AG L C++G  C
Sbjct  447  DAGVLGCKLGEAC  459



>ref|XP_009134622.1| PREDICTED: probable pectate lyase 7 [Brassica rapa]
Length=471

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/249 (59%), Positives = 190/249 (76%), Gaps = 2/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+Q+V+N+IIHG+H+HHI  G+GG+IR+  DHFG R ++DGDGIS+FG++N+W+DH
Sbjct  224  GAGITMQYVRNIIIHGLHVHHIVPGSGGMIRNSNDHFGFRGQADGDGISLFGATNIWLDH  283

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI  S  IT+SN HFT HNDVML GA + +  DK MQ+T+AFNHFGK 
Sbjct  284  ISMSKCQDGLIDAIMGSPGITLSNSHFTHHNDVMLLGAQNDNHADKKMQVTVAFNHFGKG  343

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDI-HKRQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP  + H R++T R  
Sbjct  344  LVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQSPTILSHGNRFIAPPHLQHYREVTKRDY  403

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A   +WK W WRS+ DI+M  A+F QSG+P FM  H+     ++      V+ LT++AGA
Sbjct  404  APESEWKNWNWRSDKDIFMNNAYFRQSGNPKFMCSHSR-QQMIKPKHGSAVSTLTKYAGA  462

Query  227  LNCRVGSPC  201
            L+CRVG PC
Sbjct  463  LDCRVGKPC  471



>ref|NP_172894.1| putative pectate lyase 3 [Arabidopsis thaliana]
 sp|Q9M9S2.1|PLY3_ARATH RecName: Full=Probable pectate lyase 3; AltName: Full=Pectate 
lyase A2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF43942.1|AC012188_19 Strong similarity to Pectate Lyase Precursor from Lilium longiflorum 
gi|730290 and contains a Pectate lyase PF|00544 domain. 
EST gb|AW004514 comes from this gene [Arabidopsis thaliana]
 gb|AAQ62871.1| At1g14420 [Arabidopsis thaliana]
 dbj|BAD43564.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43610.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43654.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43743.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43876.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43899.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29161.1| putative pectate lyase 3 [Arabidopsis thaliana]
Length=459

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 155/253 (61%), Positives = 185/253 (73%), Gaps = 4/253 (2%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAG+T+QFV NVIIH I++ HI  GNGGLIRD   H GLRTKSDGDGIS+FG++N+WID
Sbjct  207  EGAGLTLQFVNNVIIHNIYVKHIVPGNGGLIRDSEAHIGLRTKSDGDGISLFGATNIWID  266

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM  C DG+IDAI+ STA+TISN HFTDH +VMLFGA D    DK MQIT+AFNHFGK
Sbjct  267  HVSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDKKMQITVAFNHFGK  326

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
            RL QRMPRCR+G IHVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP +   +QIT R  
Sbjct  327  RLEQRMPRCRYGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEEAKQITKREY  386

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPD-FMKKHNELYDGVQTFKAED---VTWLTR  240
                +WK W W+SEGD ++ GA+FVQSG  + +  K         T + +    V  LT 
Sbjct  387  TPYGEWKSWNWQSEGDYFLNGAYFVQSGKANAWSSKPKTPLPNKFTIRPKPGTMVRKLTM  446

Query  239  FAGALNCRVGSPC  201
             AG L C++G  C
Sbjct  447  DAGVLGCKLGEAC  459



>ref|XP_004152537.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=434

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 153/249 (61%), Positives = 192/249 (77%), Gaps = 8/249 (3%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +G  IT+QFVKN+IIH +HIH I  GNGG+IRD + H+G RT+SDGDGIS+FG+S VWID
Sbjct  194  NGGQITLQFVKNIIIHNLHIHDIKAGNGGMIRDSVSHYGFRTRSDGDGISMFGASRVWID  253

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM NC DGLIDA+ ASTAITISN HFT HNDV+L GA++  + D+IMQ+T+AFNHFGK
Sbjct  254  HVSMSNCQDGLIDAVMASTAITISNCHFTHHNDVILLGASNGYSNDQIMQVTLAFNHFGK  313

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L+QRMPRCR+G+IHVVNNDYTHW MYAIGGS       QGNRFIAP + + +++T RV 
Sbjct  314  GLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSH-----XQGNRFIAPPNPNCKEVTKRVY  368

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A   +W+ W WRSEGD+ M GAFF+QSG+P  +K++++  D + +     VT LTRFAG 
Sbjct  369  APESEWRSWNWRSEGDLMMNGAFFIQSGNP--IKRYSK-KDVIHSKPGTFVTRLTRFAGP  425

Query  227  LNCRVGSPC  201
            L C+   PC
Sbjct  426  LKCKKNQPC  434



>emb|CDY28691.1| BnaCnng05770D [Brassica napus]
Length=469

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 152/249 (61%), Positives = 189/249 (76%), Gaps = 2/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+Q+V N+IIHG+HIHHI +G GG+IR+  DHFG R  +DGDGISIFG++N+W+DH
Sbjct  222  GAGITMQYVHNIIIHGLHIHHIVQGRGGMIRNSNDHFGFRGVADGDGISIFGATNIWLDH  281

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI  ST ITISN HFT HNDVML GA + +  DK MQ+T+AFNHFGK 
Sbjct  282  ISMSKCQDGLIDAIMGSTGITISNSHFTHHNDVMLLGAQNDNHADKKMQVTVAFNHFGKG  341

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDI-HKRQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP  + H R++T R  
Sbjct  342  LVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQSPTILSHGNRFIAPPHLQHYREVTKRDS  401

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A   +WK W WRSE DI+M  A+F QSG+P FM  H+     ++      V+ LT++AGA
Sbjct  402  APESEWKNWNWRSEKDIFMNNAYFRQSGNPKFMCSHSR-QQMIKPKHGVAVSKLTKYAGA  460

Query  227  LNCRVGSPC  201
            L+CRVG PC
Sbjct  461  LDCRVGKPC  469



>ref|XP_011087217.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=436

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 151/252 (60%), Positives = 186/252 (74%), Gaps = 7/252 (3%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAGIT+Q++ NVIIH I +H I  GNGG+IRD   H+G RT+SDGDGIS+FGS+N+WID
Sbjct  189  NGAGITLQYIHNVIIHNIRVHDIKTGNGGMIRDSATHYGFRTRSDGDGISLFGSTNIWID  248

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVS+  C DGLIDAIEASTAITISN HF  HNDV+LFGA+D  ++D IMQIT+AFNHFGK
Sbjct  249  HVSLSRCDDGLIDAIEASTAITISNCHFAHHNDVLLFGASDSRSEDHIMQITVAFNHFGK  308

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             LIQRMPR R+G++H+VNNDYT W MYAIGGS  PTI+SQGNRF+AP +   +++T R  
Sbjct  309  GLIQRMPRVRWGFVHIVNNDYTRWQMYAIGGSQQPTILSQGNRFVAPDNPFAKEVTKRDY  368

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAED---VTWLTRF  237
            A    WK W W+SEGD+   GAFFVQSGD      H++   G      +     + L++F
Sbjct  369  ATESVWKNWVWKSEGDVMNNGAFFVQSGD----VAHHKFAKGPDMVTPKPGGFASKLSQF  424

Query  236  AGALNCRVGSPC  201
            AG LNC  G PC
Sbjct  425  AGPLNCIPGKPC  436



>ref|XP_009110541.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=458

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 156/254 (61%), Positives = 184/254 (72%), Gaps = 6/254 (2%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAG+T+QFV NVIIH I++ H+   +GGLIRD   H GLRT SDGDGIS+FG++NVWID
Sbjct  206  EGAGLTLQFVNNVIIHNIYVKHVVPKSGGLIRDSEQHIGLRTVSDGDGISLFGATNVWID  265

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM  C DG+IDAI  STAITISN HFTDH +VMLFGAND    DK MQIT+AFNHFGK
Sbjct  266  HVSMTRCSDGMIDAILGSTAITISNSHFTDHEEVMLFGANDKHVIDKKMQITVAFNHFGK  325

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
            RL QRMPRCRFG IHVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP +   +QIT R  
Sbjct  326  RLDQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQAKQITKREY  385

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSG-----DPDFMKKHNELYDGVQTFKAEDVTWLT  243
                 WK W W+SEGD ++ GA+FVQSG      P  +    + +  ++      V  LT
Sbjct  386  TPYVNWKMWNWQSEGDYFLNGAYFVQSGKQNAWSPKPINPVPKKF-AIRPQPGTMVRKLT  444

Query  242  RFAGALNCRVGSPC  201
              AGAL C+ G+PC
Sbjct  445  MDAGALGCKPGTPC  458



>ref|XP_003563707.1| PREDICTED: pectate lyase-like [Brachypodium distachyon]
Length=448

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 144/249 (58%), Positives = 188/249 (76%), Gaps = 2/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            DGA +T+Q+  NVIIH IHI+ +  G GG+IRD   HFG RT+SDGDG+++FGS++VW+D
Sbjct  202  DGAQVTVQYAHNVIIHNIHINDLIVGKGGMIRDSPAHFGFRTQSDGDGVNVFGSTSVWLD  261

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            H+S+  C DGLID I  ST +TISN H T+HNDVMLFG++D + KD IMQIT+AFNHFG+
Sbjct  262  HLSLATCQDGLIDVIAESTGVTISNCHLTNHNDVMLFGSSDSNPKDVIMQITVAFNHFGR  321

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS DPTI+SQGNR+IAP ++  +QIT ++G
Sbjct  322  GLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKDPTILSQGNRYIAPPNLAAKQITKQIG  381

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            AA  +WK W W S+ D+ M GAFF ++G    +K+  +  D ++      VT LTR+AG 
Sbjct  382  AAEPEWKNWVWHSQEDLLMNGAFFTETGGD--IKRKFDKDDLIKPKPGTYVTRLTRYAGC  439

Query  227  LNCRVGSPC  201
            + CR G PC
Sbjct  440  IPCRPGKPC  448



>emb|CDX96854.1| BnaA08g23970D [Brassica napus]
Length=458

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 157/253 (62%), Positives = 184/253 (73%), Gaps = 4/253 (2%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAG+T+QFV NVIIH I++ H+   +GGLIRD   H GLRT SDGDGIS+FG++NVWID
Sbjct  206  EGAGLTLQFVNNVIIHNIYVKHVVPKSGGLIRDSEQHIGLRTVSDGDGISLFGATNVWID  265

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM  C DG+IDAI  STAITISN HFTDH +VMLFGAND    DK MQIT+AFNHFGK
Sbjct  266  HVSMTRCSDGMIDAILGSTAITISNSHFTDHEEVMLFGANDKHVIDKKMQITVAFNHFGK  325

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
            RL QRMPRCRFG IHVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP +   +QIT R  
Sbjct  326  RLDQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQAKQITKREY  385

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDF--MKKHNELYD--GVQTFKAEDVTWLTR  240
                 WK W W+SEGD ++ GA+FVQSG  +    K  N +     ++      V  LT 
Sbjct  386  TPYVDWKMWNWQSEGDYFLNGAYFVQSGKQNAWSPKPVNPVPKKFAIRPQPGTMVRKLTM  445

Query  239  FAGALNCRVGSPC  201
             AGAL C+ G+PC
Sbjct  446  DAGALGCKPGTPC  458



>emb|CDX81636.1| BnaC08g39650D [Brassica napus]
Length=484

 Score =   274 bits (700),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 154/248 (62%), Positives = 182/248 (73%), Gaps = 4/248 (2%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAG+T QFV NVII+ I++ HI  GNGGLIRD  +H GLRTKSDGDGIS+FG++NVWID
Sbjct  200  EGAGLTQQFVNNVIINNIYVKHIIPGNGGLIRDSEEHVGLRTKSDGDGISLFGATNVWID  259

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM  C DG+IDAIE STA+TISN HFTDH +VMLFGA D    DK MQIT+AFNHFGK
Sbjct  260  HVSMTRCTDGMIDAIEGSTAVTISNSHFTDHQEVMLFGAKDEHVIDKNMQITVAFNHFGK  319

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
            RL QRMPRCRFG IHVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP +   +++T R  
Sbjct  320  RLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQAKEVTKREY  379

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDF--MKKHNELYD--GVQTFKAEDVTWLTR  240
             +   WK W W+SEGD ++ GA+FVQSG P+    K  N +     ++      V  LT 
Sbjct  380  TSYTDWKSWNWQSEGDYFLNGAYFVQSGRPNAWSPKPKNPVPSKFAIRPKPGTMVRELTM  439

Query  239  FAGALNCR  216
             AG L C 
Sbjct  440  DAGVLGCE  447



>ref|XP_004298448.1| PREDICTED: probable pectate lyase 3-like [Fragaria vesca subsp. 
vesca]
Length=443

 Score =   272 bits (696),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 150/249 (60%), Positives = 179/249 (72%), Gaps = 4/249 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            G GIT+Q+V NVII  I +  I    GG++RD  DH GLRT+SDGDGIS+F +SN+WIDH
Sbjct  198  GGGITLQYVNNVIITNIKVKDIQSLPGGMLRDAEDHVGLRTRSDGDGISLFSASNIWIDH  257

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM    DGLID I  STA+TISNGHFTDHN+ MLFGA +  T+DK MQIT+AFNHFG+ 
Sbjct  258  VSMARTADGLIDCIMGSTAVTISNGHFTDHNEAMLFGAKNTHTQDKNMQITLAFNHFGQG  317

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCRFG+ HVVNNDYT W MYAIGG+ +PTIISQGNRFIAP     +++T R   
Sbjct  318  LVQRMPRCRFGFFHVVNNDYTQWIMYAIGGNMNPTIISQGNRFIAPESHVAKEVTKREYT  377

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVT-WLTRFAGA  228
               +WK W WRSEGD+   GAFFV+SG+P+  K  N     +  FK   +   LT FAGA
Sbjct  378  DESEWKNWNWRSEGDVMENGAFFVESGNPNCAKSTN---IEMMPFKPGKLAPQLTSFAGA  434

Query  227  LNCRVGSPC  201
            L C VG PC
Sbjct  435  LECFVGRPC  443



>dbj|BAH20311.1| AT3G01270 [Arabidopsis thaliana]
Length=365

 Score =   270 bits (689),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 150/252 (60%), Positives = 192/252 (76%), Gaps = 8/252 (3%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+Q+V N+IIHG+H+HHI + +GGLIRD ++HFG R ++DGDGISIFG++N+W+DH
Sbjct  118  GAGITMQYVHNIIIHGLHVHHIVKSSGGLIRDSINHFGHRGEADGDGISIFGATNIWLDH  177

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI  STAITISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK 
Sbjct  178  ISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGAQNNNMDDKKMQVTVAYNHFGKG  237

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  
Sbjct  238  LVQRMPRVRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDY  297

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAED---VTWLTRF  237
            A+  +WK W WRSE D++M  A+F QSG+P F   H+      Q  K ++   V+ LT++
Sbjct  298  ASESEWKNWNWRSEKDVFMNNAYFRQSGNPHFKCSHSRQ----QMIKPKNGMAVSKLTKY  353

Query  236  AGALNCRVGSPC  201
            AGAL+CRVG  C
Sbjct  354  AGALDCRVGKAC  365



>emb|CDY68729.1| BnaCnng60280D [Brassica napus]
Length=458

 Score =   273 bits (697),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 158/253 (62%), Positives = 184/253 (73%), Gaps = 4/253 (2%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAG+T+QFV NVIIH I+I H+   +GGLIRD   H GLRT SDGDGIS+FG++NVWID
Sbjct  206  EGAGLTLQFVNNVIIHNIYIKHVVPKSGGLIRDSEQHIGLRTVSDGDGISLFGATNVWID  265

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM  C DG+IDAI  STAITISN HFTDH +VMLFGAND    DK MQIT+AFNHFGK
Sbjct  266  HVSMTRCSDGMIDAILGSTAITISNSHFTDHEEVMLFGANDKHVIDKKMQITVAFNHFGK  325

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
            RL QRMPRCRFG IHVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP +   +QIT R  
Sbjct  326  RLDQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQAKQITKREY  385

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDF--MKKHNELYD--GVQTFKAEDVTWLTR  240
                 WK W W+SEGD ++ GA+FVQSG  +    K  N +     ++      V  LT 
Sbjct  386  TPYVDWKMWNWQSEGDYFLNGAYFVQSGKQNAWSPKPVNPVPRKFAIRPQPGTMVRKLTM  445

Query  239  FAGALNCRVGSPC  201
             AGAL C+ G+PC
Sbjct  446  DAGALGCKPGTPC  458



>gb|AES91206.2| pectate lyase P59-like protein [Medicago truncatula]
Length=434

 Score =   272 bits (695),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 150/249 (60%), Positives = 186/249 (75%), Gaps = 4/249 (2%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GA IT+Q+VKN+IIHG+HIH   + +GG IRD +DH+G R+ SDGD IS+FG+S+VWID
Sbjct  190  EGAQITLQYVKNIIIHGLHIHDTKKTSGGQIRDSMDHYGSRSASDGDAISMFGASHVWID  249

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            H+SM NC DGL+DA+  STAITISN H T HNDVMLFGAND  + D+I QIT+AFNHFGK
Sbjct  250  HISMWNCADGLVDAVAGSTAITISNCHMTRHNDVMLFGANDGFSGDQISQITVAFNHFGK  309

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             LIQRMPRCR+G+ H+VNNDYTHW MYAIGGS+ PTI+SQGNRFIAP + + +++T R  
Sbjct  310  GLIQRMPRCRWGFFHIVNNDYTHWLMYAIGGSTHPTILSQGNRFIAPPNPNAKEVTKRDY  369

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A    WK W+WRSE D+ M GAFF QSG        +++     +F A     LTRF+G 
Sbjct  370  APESVWKAWSWRSENDLMMNGAFFKQSGTKAANFPKSDIKAKPGSFAAA----LTRFSGC  425

Query  227  LNCRVGSPC  201
            L C VG PC
Sbjct  426  LKCEVGKPC  434



>ref|XP_006656188.1| PREDICTED: pectate lyase-like [Oryza brachyantha]
Length=446

 Score =   272 bits (695),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 147/249 (59%), Positives = 188/249 (76%), Gaps = 2/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GA +T+Q   NVIIH IH+H I  G GG+IRD  +HFG RT+SDGDGI+IFGS+NVW+D
Sbjct  200  NGAQVTVQNSNNVIIHNIHVHDIVLGKGGMIRDSPEHFGFRTQSDGDGITIFGSTNVWLD  259

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            H+S+ NC DGLID I  ST +TISN H T+HNDVMLFG++D  ++D+IMQIT+AFNHFG+
Sbjct  260  HLSLSNCQDGLIDVIAKSTGVTISNCHLTNHNDVMLFGSSDSFSEDQIMQITVAFNHFGR  319

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS +PTIISQGNR+IAP ++  +QIT ++G
Sbjct  320  GLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKNPTIISQGNRYIAPPNLAAKQITKQLG  379

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A   +WK W W SE D++M GA+F  SG    ++      D ++      VT LTRFAG+
Sbjct  380  AEESEWKNWVWHSEEDLFMEGAYFTTSGGA--IRTSINKKDLIKPKPGSYVTRLTRFAGS  437

Query  227  LNCRVGSPC  201
            + CR G PC
Sbjct  438  IPCRPGKPC  446



>ref|XP_010463548.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   273 bits (697),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 150/249 (60%), Positives = 189/249 (76%), Gaps = 2/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+Q+VKN+IIHG+H+HHI   +GGLIRD +DHFG R ++DGDGISIFG++++W+DH
Sbjct  226  GAGITMQYVKNIIIHGLHVHHIVTSSGGLIRDSIDHFGQRGQADGDGISIFGATDIWLDH  285

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI  STAITISN HFT HNDVML GA D +  DK MQ+T+A+NHFGK 
Sbjct  286  ISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGAQDHNQDDKKMQVTVAYNHFGKG  345

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  
Sbjct  346  LVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDY  405

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A   +WK W WRSE D ++ GA+F QSG+P F   H+     ++      V+ LT++AGA
Sbjct  406  APEAEWKNWNWRSEKDYFLNGAYFRQSGNPHFKCSHSR-QQMIKPKHGVAVSKLTKYAGA  464

Query  227  LNCRVGSPC  201
            L+CRVG  C
Sbjct  465  LDCRVGKAC  473



>ref|XP_007138209.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
 gb|ESW10203.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
Length=434

 Score =   271 bits (694),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 149/250 (60%), Positives = 188/250 (75%), Gaps = 6/250 (2%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            DGA +TIQFVKN+IIHG+HIH I   +GGLIRD + H+G+R  SDGDGIS+FGS+++WID
Sbjct  190  DGAQMTIQFVKNIIIHGLHIHDIQPISGGLIRDSMSHYGVRAMSDGDGISVFGSTHIWID  249

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM NC DGLID + ASTA+TISN HF  HNDV+LFGA D  ++DK+MQ+T+AFNHFGK
Sbjct  250  HVSMTNCSDGLIDVVSASTAVTISNCHFVKHNDVLLFGATDSFSRDKVMQVTLAFNHFGK  309

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L+QRMPRCR+G+ H+VNNDYTHW MYA+GGS  PTIISQGNRF+AP D + +++T R  
Sbjct  310  GLVQRMPRCRWGFFHIVNNDYTHWLMYAVGGSQQPTIISQGNRFVAPKDRNAKEVTKRDY  369

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNEL-YDGVQTFKAEDVTWLTRFAG  231
            A   +WK W WRSEGD++  GAFFV+SG     KK  +      +   A+ V +LT+ AG
Sbjct  370  APESEWKNWNWRSEGDLFENGAFFVESG-----KKVTKFPKTDAKAVSAKSVAFLTKDAG  424

Query  230  ALNCRVGSPC  201
             + C    PC
Sbjct  425  PIKCIPNKPC  434



>emb|CDP02199.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   269 bits (687),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 148/249 (59%), Positives = 191/249 (77%), Gaps = 3/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG TIQFV+N+IIH +HIH +   +GG+IRD +DH GLRT ++GDGISIFG+ +VW+DH
Sbjct  107  GAGFTIQFVRNIIIHNVHIHDVKTTSGGMIRDSVDHVGLRTANEGDGISIFGARDVWLDH  166

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDA++ASTAITISN HFTDH+ V+LFGA+D++  DK MQ+T+AFNHFGKR
Sbjct  167  LSMSKCSDGLIDAVQASTAITISNCHFTDHDKVLLFGASDVTEVDKNMQVTVAFNHFGKR  226

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVG  408
            L+QRMPRCR G+ H+VNNDYTHW MYAIGGS D TIISQGNRFIAP      +++THR  
Sbjct  227  LVQRMPRCRSGFFHLVNNDYTHWEMYAIGGSHDATIISQGNRFIAPPLSQFFKEVTHR-D  285

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A    W +WTW S+GD+++ GA FV SG+PD  ++   L + ++     +V  LTRF+G 
Sbjct  286  APVALWSKWTWVSDGDVFLNGARFVPSGNPDGARQFAAL-ELIKAAPGTEVFTLTRFSGF  344

Query  227  LNCRVGSPC  201
            L+C +G  C
Sbjct  345  LSCVIGRAC  353



>ref|XP_010523445.1| PREDICTED: probable pectate lyase 3 [Tarenaya hassleriana]
Length=464

 Score =   272 bits (696),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 152/252 (60%), Positives = 183/252 (73%), Gaps = 4/252 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG+T+QFV NVIIH I+I  I  GNGGLIRD   HFGLRT+SDGDGI+IFG++NVWIDH
Sbjct  213  GAGLTVQFVNNVIIHNIYIKDIVPGNGGLIRDSETHFGLRTRSDGDGINIFGATNVWIDH  272

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM +C DG+IDAI+ ST ITISN H TDH +VMLFGA D    D  MQIT+AFNHFGKR
Sbjct  273  VSMAHCSDGMIDAIQGSTGITISNCHLTDHGEVMLFGATDKDEIDTKMQITVAFNHFGKR  332

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G IHVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP +   +Q+T R   
Sbjct  333  LVQRMPRCRYGLIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQAKQVTKREYT  392

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDF--MKKHNELYD--GVQTFKAEDVTWLTRF  237
               +WK W W+SEGD ++ GA+FVQSG  +   +   N +     ++      V  LT  
Sbjct  393  PYPEWKSWNWQSEGDYFLNGAYFVQSGRANAWSVAPKNPVPSKFAIRPQPGTLVRKLTMN  452

Query  236  AGALNCRVGSPC  201
            +G L C+ G PC
Sbjct  453  SGVLGCKKGKPC  464



>ref|XP_010513594.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   272 bits (696),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 150/249 (60%), Positives = 188/249 (76%), Gaps = 2/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+Q+V N+IIHG+H+HHI   +GGLIRD +DHFG R ++DGDGISIFG++N+W+DH
Sbjct  226  GAGITMQYVHNIIIHGLHVHHIVSSSGGLIRDSIDHFGQRGQADGDGISIFGATNIWLDH  285

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI  STAITISN HFT HNDVML GA D +  DK MQ+T+A+NHFGK 
Sbjct  286  ISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGAQDHNQDDKKMQVTVAYNHFGKG  345

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  
Sbjct  346  LVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDY  405

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A   +WK W WRSE D ++ GA+F QSG+P F   H+     ++      V+ LT++AGA
Sbjct  406  APEAEWKNWNWRSEKDYFLNGAYFRQSGNPHFKCSHSR-QQMIKPKHGVAVSKLTKYAGA  464

Query  227  LNCRVGSPC  201
            L+CRVG  C
Sbjct  465  LDCRVGKAC  473



>ref|XP_010527872.1| PREDICTED: probable pectate lyase 3 isoform X2 [Tarenaya hassleriana]
Length=461

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 152/252 (60%), Positives = 182/252 (72%), Gaps = 4/252 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG T+QFV NVIIH I+I +I  GNGGLIRD   HFGLRT+SDGDGI+IFG++NVWIDH
Sbjct  210  GAGFTLQFVNNVIIHNIYIKNIVPGNGGLIRDSETHFGLRTRSDGDGINIFGATNVWIDH  269

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM +C DG+IDAI+ ST ITISN H TDH +VMLFG  D    DK MQIT+AFNHFGKR
Sbjct  270  VSMSHCSDGMIDAIQGSTGITISNCHLTDHQEVMLFGGTDKDVIDKKMQITVAFNHFGKR  329

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G IHVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP +   +Q+T R   
Sbjct  330  LVQRMPRCRYGLIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEEAKQVTKREYT  389

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFM----KKHNELYDGVQTFKAEDVTWLTRF  237
               +WK W W+SEGD ++ GA+FVQSG  + +    K        ++      V  LT  
Sbjct  390  PFTEWKSWNWQSEGDYFLNGAYFVQSGRANALSAAPKNPVPSKFAIRPQPGTLVRKLTMD  449

Query  236  AGALNCRVGSPC  201
            AG L+C+   PC
Sbjct  450  AGVLSCKKRKPC  461



>gb|KHG08946.1| Pectate lyase [Gossypium arboreum]
Length=405

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 155/248 (63%), Positives = 182/248 (73%), Gaps = 0/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            G GIT+QFV NVIIH +HIHHI E  GGLIRD  DH+G RT  DGDGISIFGSSN+W+DH
Sbjct  158  GCGITLQFVHNVIIHNVHIHHIIESRGGLIRDSEDHYGYRTVGDGDGISIFGSSNIWLDH  217

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLID I+ STAITISN HFT H+ V+L G +D  + D+ MQ+TIAFNHFGK 
Sbjct  218  ISMSECQDGLIDVIQGSTAITISNCHFTHHDHVILLGGSDTYSNDQYMQVTIAFNHFGKE  277

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            LIQRMPRCR+G+ HVVNNDYTHW MYAIGGS+ PTIIS+GNR+IAP D + ++IT+R  A
Sbjct  278  LIQRMPRCRWGFFHVVNNDYTHWKMYAIGGSTHPTIISEGNRYIAPDDPNTKEITNRNYA  337

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
               +WK W WRSEGD+YM GAFF  SG P          D ++   A  V  LTRFAG L
Sbjct  338  PESEWKNWVWRSEGDLYMNGAFFRTSGPPSPPNLSFSEKDVIKAKPATFVRRLTRFAGTL  397

Query  224  NCRVGSPC  201
            NC+    C
Sbjct  398  NCKQYVKC  405



>gb|KHG07401.1| putative pectate lyase P59 [Gossypium arboreum]
Length=442

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 155/249 (62%), Positives = 186/249 (75%), Gaps = 3/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQF KNVIIH IHIH+IF   GG I+DG +H GLRT+SDGDGIS+FG++NVW+DH
Sbjct  196  GAGITIQFAKNVIIHNIHIHNIFPSKGGKIKDGENHLGLRTRSDGDGISLFGATNVWLDH  255

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +S+  C DG+IDAI+ STAITISN HFTDHNDVMLFGA+D  + D+ MQIT+AF HFGK 
Sbjct  256  LSVYKCSDGIIDAIQGSTAITISNCHFTDHNDVMLFGASDSYSADEKMQITVAFTHFGKN  315

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPR RFG++HVVNNDY HW M AIGGSS PTIIS GNRF AP +I  +++  R  A
Sbjct  316  LVQRMPRVRFGFVHVVNNDYRHWIMSAIGGSSHPTIISHGNRFRAPRNIAAKEVCKREYA  375

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFK-AEDVTWLTRFAGA  228
              ++WK W WRSEGD+ + GA F QSGDP   KK     D +  +K A  V  L R++G 
Sbjct  376  TEQEWKNWDWRSEGDLMLNGAIFTQSGDPRAAKKFGG--DKMIAYKPAHMVPLLVRWSGT  433

Query  227  LNCRVGSPC  201
            L CR   PC
Sbjct  434  LECRPNKPC  442



>ref|XP_009114192.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=459

 Score =   271 bits (693),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 155/252 (62%), Positives = 181/252 (72%), Gaps = 4/252 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG+T+QFVKNVIIH IHI  I  GNGG+IRD   HFG RT SDGDGI+IFGS+NVWIDH
Sbjct  208  GAGLTLQFVKNVIIHNIHIKTIVPGNGGMIRDSEHHFGHRTTSDGDGINIFGSTNVWIDH  267

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC DG+ID I  STAITISN H TDHN+VMLFGA +    DK MQIT+AFNHFGKR
Sbjct  268  VSMTNCTDGMIDVIMGSTAITISNCHLTDHNEVMLFGAREEDVVDKKMQITVAFNHFGKR  327

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPR RFG +HVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP   + +Q+T R  A
Sbjct  328  LVQRMPRARFGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPKENSKQVTKREYA  387

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNE----LYDGVQTFKAEDVTWLTRF  237
               +WK W W+SE D ++ GA+FV+SG  +      E     +  +Q      V  LT+ 
Sbjct  388  KYSEWKSWNWQSERDYFLNGAYFVKSGRANAWSPAPENPIPRHFAIQPQPGTGVRRLTKD  447

Query  236  AGALNCRVGSPC  201
            AG L CR G  C
Sbjct  448  AGTLGCRPGKSC  459



>emb|CDY04133.1| BnaA09g19110D [Brassica napus]
 gb|AIS67292.1| pectate lyase-like protein 9 [Brassica rapa subsp. chinensis]
Length=459

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 155/252 (62%), Positives = 181/252 (72%), Gaps = 4/252 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG+T+QFVKNVIIH IHI  I  GNGG+IRD   HFG RT SDGDGI+IFGS+NVWIDH
Sbjct  208  GAGLTLQFVKNVIIHNIHIKTIVPGNGGMIRDSEHHFGHRTTSDGDGINIFGSTNVWIDH  267

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC DG+ID I  STAITISN H TDHN+VMLFGA +    DK MQIT+AFNHFGKR
Sbjct  268  VSMTNCTDGMIDVIMGSTAITISNCHLTDHNEVMLFGAREEDVIDKKMQITVAFNHFGKR  327

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPR RFG +HVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP   + +Q+T R  A
Sbjct  328  LVQRMPRARFGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPKENSKQVTKREYA  387

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNE----LYDGVQTFKAEDVTWLTRF  237
               +WK W W+SE D ++ GA+FV+SG  +      E     +  +Q      V  LT+ 
Sbjct  388  KYSEWKSWNWQSERDYFLNGAYFVKSGRANAWSPAPENPIPRHFAIQPQPGTGVRRLTKD  447

Query  236  AGALNCRVGSPC  201
            AG L CR G  C
Sbjct  448  AGTLGCRPGKSC  459



>gb|AAM60924.1| putative pectate lyase [Arabidopsis thaliana]
Length=475

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 150/252 (60%), Positives = 192/252 (76%), Gaps = 8/252 (3%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+Q+V N+IIHG+H+HHI + +GGLIRD ++HFG R ++DGDGISIFG++N+W+DH
Sbjct  228  GAGITMQYVHNIIIHGLHVHHIVKSSGGLIRDSINHFGHRGEADGDGISIFGATNIWLDH  287

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI  STAITISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK 
Sbjct  288  ISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGAQNNNMDDKKMQVTVAYNHFGKG  347

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  
Sbjct  348  LVQRMPRVRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDY  407

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAED---VTWLTRF  237
            A+  +WK W WRSE D++M  A+F QSG+P F   H+      Q  K ++   V+ LT++
Sbjct  408  ASESEWKNWNWRSEKDVFMNNAYFRQSGNPHFKCSHSRQ----QMIKPKNGMAVSKLTKY  463

Query  236  AGALNCRVGSPC  201
            AGAL+CRVG  C
Sbjct  464  AGALDCRVGKAC  475



>ref|XP_002882189.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58448.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=475

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 150/249 (60%), Positives = 190/249 (76%), Gaps = 2/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+Q+V N+IIHG+HIHHI + +GG+IRD +DHFG R ++DGDGISIFG++N+W+DH
Sbjct  228  GAGITMQYVHNIIIHGLHIHHIVQSSGGMIRDSIDHFGQRGRADGDGISIFGATNIWLDH  287

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI  STAITISN HFT HNDVML GA D +  DK MQ+T+A+NHFGK 
Sbjct  288  ISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGAQDNNMDDKKMQVTVAYNHFGKG  347

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  
Sbjct  348  LVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDY  407

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A+  +WK W WRSE D++M  A+F QSG+P F   H+     ++      V+ LT++AGA
Sbjct  408  ASESEWKNWNWRSEKDVFMNNAYFRQSGNPHFKCSHSR-QQMIKPKHGVAVSKLTKYAGA  466

Query  227  LNCRVGSPC  201
            L+CRVG  C
Sbjct  467  LDCRVGKAC  475



>ref|NP_186776.1| putative pectate lyase 7 [Arabidopsis thaliana]
 sp|Q9SRH4.1|PLY7_ARATH RecName: Full=Probable pectate lyase 7; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF03499.1|AC010676_9 putative pectate lyase [Arabidopsis thaliana]
 gb|AAF26147.1|AC008261_4 putative pectate lyase [Arabidopsis thaliana]
 gb|ABI93918.1| At3g01270 [Arabidopsis thaliana]
 gb|AEE73631.1| putative pectate lyase 7 [Arabidopsis thaliana]
Length=475

 Score =   271 bits (693),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 150/252 (60%), Positives = 192/252 (76%), Gaps = 8/252 (3%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+Q+V N+IIHG+H+HHI + +GGLIRD ++HFG R ++DGDGISIFG++N+W+DH
Sbjct  228  GAGITMQYVHNIIIHGLHVHHIVKSSGGLIRDSINHFGHRGEADGDGISIFGATNIWLDH  287

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI  STAITISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK 
Sbjct  288  ISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGAQNNNMDDKKMQVTVAYNHFGKG  347

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  
Sbjct  348  LVQRMPRVRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDY  407

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAED---VTWLTRF  237
            A+  +WK W WRSE D++M  A+F QSG+P F   H+      Q  K ++   V+ LT++
Sbjct  408  ASESEWKNWNWRSEKDVFMNNAYFRQSGNPHFKCSHSRQ----QMIKPKNGMAVSKLTKY  463

Query  236  AGALNCRVGSPC  201
            AGAL+CRVG  C
Sbjct  464  AGALDCRVGKAC  475



>emb|CDY63769.1| BnaCnng42620D [Brassica napus]
Length=479

 Score =   271 bits (692),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 152/249 (61%), Positives = 192/249 (77%), Gaps = 2/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQFV++VIIHG+HIHHI + NGG+IRD   HFG+RT++DGDGISI+GSS +W+DH
Sbjct  232  GAGITIQFVRHVIIHGLHIHHICQSNGGMIRDSEGHFGMRTRADGDGISIYGSSMIWLDH  291

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI  STAITISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK 
Sbjct  292  ISMSKCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNDNQGDKKMQVTVAYNHFGKG  351

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRF+AP    H R++T R  
Sbjct  352  LVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQAPTILSHGNRFVAPPHKPHYREVTKRDY  411

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A+  +WK W WRS+ D++M GA+F QSG+P F K H+     ++      V+ LT++AGA
Sbjct  412  ASEHEWKHWNWRSDKDMFMNGAYFRQSGNPHF-KCHHTRKQMIKPKHGIAVSMLTKYAGA  470

Query  227  LNCRVGSPC  201
            L+CRVG  C
Sbjct  471  LDCRVGKRC  479



>ref|XP_010485518.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   270 bits (691),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 149/249 (60%), Positives = 188/249 (76%), Gaps = 2/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+Q+V N+IIHG+H+HHI   +GGLIRD +DHFG R ++DGDGISIFG++N+W+DH
Sbjct  226  GAGITMQYVHNIIIHGLHVHHIVTSSGGLIRDSIDHFGQRGQADGDGISIFGATNIWLDH  285

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI  STAITISN HFT HNDVML GA D +  DK MQ+T+A+NHFGK 
Sbjct  286  ISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGAQDHNQDDKKMQVTVAYNHFGKG  345

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  
Sbjct  346  LVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDY  405

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A   +WK W WRS+ D ++ GA+F QSG+P F   H+     ++      V+ LT++AGA
Sbjct  406  APEAEWKNWNWRSDKDYFLNGAYFRQSGNPHFKCSHSR-QQMIKPKHGVAVSKLTKYAGA  464

Query  227  LNCRVGSPC  201
            L+CRVG  C
Sbjct  465  LDCRVGKAC  473



>gb|KHG23093.1| hypothetical protein F383_29772 [Gossypium arboreum]
Length=385

 Score =   267 bits (683),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 151/248 (61%), Positives = 184/248 (74%), Gaps = 0/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            G GIT+QFV NVIIH IHIH +   +GGLIRD  DH+G RT  DGDGISIFGSS +W+DH
Sbjct  138  GCGITLQFVHNVIIHNIHIHRVVRSSGGLIRDSEDHYGFRTVGDGDGISIFGSSKIWLDH  197

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI+ STAITISN HFT H+ V+L GA+D  ++D+ MQ+T+AFNHFGK 
Sbjct  198  ISMSECQDGLIDAIQGSTAITISNCHFTHHDHVILLGASDTYSRDQFMQVTLAFNHFGKE  257

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            LIQRMPRCR+GY HVVNNDYTHW +YAIGGS+ PTIISQGNRFIAP D   ++IT+R  A
Sbjct  258  LIQRMPRCRWGYFHVVNNDYTHWKLYAIGGSTHPTIISQGNRFIAPDDPLTKEITNRNYA  317

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
            +  +W+ W WRSEGD +M GAFFV SG     +   +  D ++   A  V  LT+F+G L
Sbjct  318  SESEWRHWVWRSEGDRFMNGAFFVTSGPHSPPRLKFKKKDIIKPKPAIFVGRLTKFSGTL  377

Query  224  NCRVGSPC  201
             C+ G  C
Sbjct  378  KCKEGVKC  385



>gb|KFK37588.1| hypothetical protein AALP_AA3G002600 [Arabis alpina]
Length=472

 Score =   270 bits (689),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 148/251 (59%), Positives = 190/251 (76%), Gaps = 6/251 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+Q+V N+IIHG+H+HHI EG+GG++R+ +DHFG R K+DGDGISIFG++N+W+DH
Sbjct  225  GAGITMQYVHNIIIHGLHVHHIIEGSGGMVRNSVDHFGFRGKADGDGISIFGATNIWLDH  284

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI  ST ITISN HFT HNDVML GA+D +  DK MQ+T+A+NHFGK 
Sbjct  285  ISMSKCQDGLIDAIMGSTGITISNSHFTHHNDVMLLGAHDSNKDDKKMQVTVAYNHFGKG  344

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQ---ITHR  414
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIA   +HK Q   +T R
Sbjct  345  LVQRMPRVRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIA--SLHKPQYNEVTKR  402

Query  413  VGAAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFA  234
              A+  +WK W WRS+ D++M  A+F QSG+P F   H      ++       + LT++A
Sbjct  403  DYASESEWKNWNWRSDRDVFMNRAYFRQSGNPKFKCTHTR-QQMIKPKHGVAASMLTKYA  461

Query  233  GALNCRVGSPC  201
            GAL+CRVG PC
Sbjct  462  GALDCRVGKPC  472



>ref|XP_009380431.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=436

 Score =   268 bits (686),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 148/248 (60%), Positives = 185/248 (75%), Gaps = 2/248 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG+TIQFVK+VI+H +HIH I  G GG IRD   H+G+RT+SDGDG+SIFG+S+VW+DH
Sbjct  191  GAGLTIQFVKHVIVHNLHIHDIKPGAGGNIRDSEGHWGIRTRSDGDGVSIFGASHVWVDH  250

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM NC DGLIDA++ASTAITISN H T HNDV+L GA+D S +D +MQ+T+A+NHFGK 
Sbjct  251  LSMSNCADGLIDAVKASTAITISNCHLTRHNDVILLGASDKSQEDAVMQVTVAYNHFGKG  310

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW MYA+GGS  PTIISQGNRF+ P     +++THR  A
Sbjct  311  LVQRMPRCRWGFFHVVNNDYTHWMMYAVGGSQHPTIISQGNRFVGPPIQFAKEVTHREYA  370

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
               +WK W W SE D +  GAFF+QSG   +  KH+  YD ++         LTRF+GAL
Sbjct  371  PESEWKNWIWTSEDDEFKSGAFFIQSGH-KYQGKHSR-YDVIKAKPGSIAGRLTRFSGAL  428

Query  224  NCRVGSPC  201
             C    PC
Sbjct  429  QCSPNRPC  436



>emb|CDY39314.1| BnaC05g10650D [Brassica napus]
Length=459

 Score =   269 bits (687),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 151/252 (60%), Positives = 181/252 (72%), Gaps = 4/252 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            G+G+T+QFV NVI+H I+I  I   NGGLIRD   H GLRT+SDGDGI++FG++NVWIDH
Sbjct  208  GSGLTLQFVNNVIVHNIYIKQIVPANGGLIRDSEQHIGLRTRSDGDGINLFGATNVWIDH  267

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM  C DG+IDAI  STA+T+SN HFTDH +VMLFGAND    DK MQIT+AFNHFGKR
Sbjct  268  VSMTRCSDGMIDAILGSTAVTVSNSHFTDHQEVMLFGANDKHEIDKKMQITVAFNHFGKR  327

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L QRMPR RFG IHVVNNDYTHW MYAIGG+ +PTIIS GNRFIAP +   +QIT R   
Sbjct  328  LEQRMPRVRFGTIHVVNNDYTHWEMYAIGGNMNPTIISHGNRFIAPPNEQAKQITKREYT  387

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDF--MKKHNELYD--GVQTFKAEDVTWLTRF  237
            +   WK W W+SEGD ++ GA+FVQSG P+    K  N + +   ++      V  LT  
Sbjct  388  SYVDWKLWNWQSEGDYFLNGAYFVQSGKPNAWSPKPKNPIPNKFAIRPKPGTMVRKLTMD  447

Query  236  AGALNCRVGSPC  201
            AG L C+ G  C
Sbjct  448  AGVLGCKQGQAC  459



>gb|EAY99621.1| hypothetical protein OsI_21600 [Oryza sativa Indica Group]
Length=448

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 149/248 (60%), Positives = 188/248 (76%), Gaps = 2/248 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GA IT+Q V NVIIH +HIH+    +GGLIRD + HFG+R +SDGDGIS+ GSSN+WIDH
Sbjct  203  GAQITVQAVSNVIIHNLHIHNSVPRSGGLIRDSMHHFGIRGESDGDGISVMGSSNIWIDH  262

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC DGLID  + STAITISN HFT H+ VMLFGA+D S KDKIMQ+T+AFNHFGK 
Sbjct  263  VSMSNCSDGLIDITDGSTAITISNSHFTKHDHVMLFGASDDSPKDKIMQVTLAFNHFGKG  322

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCRFG+ H VNNDYTHW MYAIGG+ +PTIISQGNRF A  D+  +++T R   
Sbjct  323  LVQRMPRCRFGFFHTVNNDYTHWLMYAIGGNMNPTIISQGNRFRASDDMKLKEVTKREYT  382

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
            + +++K+W W+S+ D+++ GAFF +SG  +  +++N L D +Q      V  +TRFAG L
Sbjct  383  SYDEYKEWVWKSQDDLFLNGAFFNESGGRN-ERRYNRL-DLIQARNGRYVGRMTRFAGTL  440

Query  224  NCRVGSPC  201
             CRVG  C
Sbjct  441  PCRVGKKC  448



>ref|XP_009148818.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=458

 Score =   269 bits (687),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 152/252 (60%), Positives = 181/252 (72%), Gaps = 4/252 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            G+G+T+QFV NVIIH I+I  I   NGGLIRD   H GLRT+SDGDGI++FG++NVWIDH
Sbjct  207  GSGLTLQFVNNVIIHNIYIKQIVPANGGLIRDSEQHIGLRTRSDGDGINLFGATNVWIDH  266

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM  C DG+IDAI  STA+T+SN HFTDH +VMLFGAND    DK MQIT+AFNHFGKR
Sbjct  267  VSMTRCSDGMIDAILGSTAVTVSNSHFTDHQEVMLFGANDKHEIDKKMQITVAFNHFGKR  326

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L QRMPR RFG IHVVNNDYTHW MYAIGG+ +PTIIS GNRFIAP +   +QIT R   
Sbjct  327  LEQRMPRVRFGTIHVVNNDYTHWEMYAIGGNMNPTIISHGNRFIAPPNEQAKQITKREYT  386

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDF--MKKHNELYD--GVQTFKAEDVTWLTRF  237
            +   WK W W+SEGD ++ GA+FVQSG P+    K  N + +   ++      V  LT  
Sbjct  387  SYVDWKLWNWQSEGDYFLNGAYFVQSGKPNAWSPKPKNPIPNKFAIRPKPGTMVRKLTMD  446

Query  236  AGALNCRVGSPC  201
            AG L C+ G  C
Sbjct  447  AGVLGCKQGQAC  458



>ref|NP_001056784.1| Os06g0144900 [Oryza sativa Japonica Group]
 dbj|BAD68407.1| putative pectate lyase homolog [Oryza sativa Japonica Group]
 dbj|BAD68762.1| putative pectate lyase homolog [Oryza sativa Japonica Group]
 dbj|BAF18698.1| Os06g0144900 [Oryza sativa Japonica Group]
 gb|EAZ35811.1| hypothetical protein OsJ_20103 [Oryza sativa Japonica Group]
 dbj|BAG91996.1| unnamed protein product [Oryza sativa Japonica Group]
Length=448

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 149/248 (60%), Positives = 188/248 (76%), Gaps = 2/248 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GA IT+Q V NVIIH +HIH+    +GGLIRD + HFG+R +SDGDGIS+ GSSN+WIDH
Sbjct  203  GAQITVQAVSNVIIHNLHIHNSVPRSGGLIRDSMHHFGIRGESDGDGISVMGSSNIWIDH  262

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC DGLID  + STAITISN HFT H+ VMLFGA D S KDKIMQ+T+AFNHFGK 
Sbjct  263  VSMSNCSDGLIDITDGSTAITISNSHFTKHDHVMLFGARDDSPKDKIMQVTLAFNHFGKG  322

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCRFG+ H+VNNDYTHW MYAIGG+ +PTIISQGNRF A  D+  +++T R   
Sbjct  323  LVQRMPRCRFGFFHMVNNDYTHWLMYAIGGNMNPTIISQGNRFRASDDMKLKEVTKREYT  382

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
            + +++K+W W+S+ D+++ GAFF +SG  +  +++N L D +Q      V  +TRFAG L
Sbjct  383  SYDEYKEWVWKSQDDLFLNGAFFNESGGRN-ERRYNRL-DLIQARNGRYVGRMTRFAGTL  440

Query  224  NCRVGSPC  201
             CRVG  C
Sbjct  441  PCRVGKKC  448



>emb|CDY45254.1| BnaA06g09240D [Brassica napus]
Length=458

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 152/252 (60%), Positives = 181/252 (72%), Gaps = 4/252 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            G+G+T+QFV NVIIH I+I  I   NGGLIRD   H GLRT+SDGDGI++FG++NVWIDH
Sbjct  207  GSGLTLQFVNNVIIHNIYIKQIVPANGGLIRDSEQHIGLRTRSDGDGINLFGATNVWIDH  266

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM  C DG+IDAI  STA+T+SN HFTDH +VMLFGAND    DK MQIT+AFNHFGKR
Sbjct  267  VSMTRCSDGMIDAILGSTAVTVSNSHFTDHQEVMLFGANDKHEIDKKMQITVAFNHFGKR  326

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L QRMPR RFG IHVVNNDYTHW MYAIGG+ +PTIIS GNRFIAP +   +QIT R   
Sbjct  327  LEQRMPRVRFGTIHVVNNDYTHWEMYAIGGNMNPTIISHGNRFIAPPNEQAKQITKREYT  386

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDF--MKKHNELYD--GVQTFKAEDVTWLTRF  237
            +   WK W W+SEGD ++ GA+FVQSG P+    K  N + +   ++      V  LT  
Sbjct  387  SYVDWKLWNWQSEGDYFLNGAYFVQSGKPNAWSPKPKNPIPNKFAIRPKPGTMVRKLTMD  446

Query  236  AGALNCRVGSPC  201
            AG L C+ G  C
Sbjct  447  AGVLGCKQGQAC  458



>gb|EPS62426.1| hypothetical protein M569_12361, partial [Genlisea aurea]
Length=410

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 145/248 (58%), Positives = 180/248 (73%), Gaps = 4/248 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+Q+V NVI+H + IH I  G+GG IRD   HFG RT SDGD IS+FG++N+WIDH
Sbjct  167  GAGITLQYVSNVILHNLRIHDIKPGSGGTIRDSPTHFGFRTPSDGDAISMFGATNIWIDH  226

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VS   C DGLIDAI+ASTAITISN HF  HNDVML GA+D S++D+I+Q+T+AFNHFG  
Sbjct  227  VSAARCSDGLIDAIQASTAITISNCHFAQHNDVMLLGASDKSSEDQILQVTLAFNHFGTG  286

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            LIQRMPR R+G++H+VNNDYT W MYAIGGS  PTI+SQGNRF AP +   +++T R  +
Sbjct  287  LIQRMPRIRWGFVHIVNNDYTKWEMYAIGGSQHPTILSQGNRFHAPDNAAAKEVTKREYS  346

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
                WK W W+S+GD +  GAFFV+SGD +F    N + D V     ++V  LT FAG L
Sbjct  347  PESVWKNWNWKSQGDSFSNGAFFVESGDKNF----NYVSDSVGAKSGKEVGELTEFAGPL  402

Query  224  NCRVGSPC  201
             C  G  C
Sbjct  403  ACFAGKAC  410



>gb|KFK33456.1| hypothetical protein AALP_AA5G015800 [Arabis alpina]
Length=460

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 154/252 (61%), Positives = 182/252 (72%), Gaps = 4/252 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG+TIQFVKNVIIH IH+  I    GG+IRD  +HFGLRT+SDGDGI+IFG++NVWIDH
Sbjct  209  GAGLTIQFVKNVIIHNIHMKFIERRAGGMIRDSENHFGLRTESDGDGINIFGATNVWIDH  268

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSMRNC DG+IDAI  STAITISN HFTDH +VMLFGA +    DK MQIT+AFNHFGKR
Sbjct  269  VSMRNCSDGMIDAIMGSTAITISNCHFTDHEEVMLFGAKNGDVIDKKMQITVAFNHFGKR  328

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L QRMPR R+G +HVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP +  K+QIT R   
Sbjct  329  LDQRMPRVRYGMVHVVNNDYTHWQMYAIGGNMNPTIISQGNRFIAPPEEDKKQITKREYT  388

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDF----MKKHNELYDGVQTFKAEDVTWLTRF  237
               +WK W W+SE D ++ GA+FVQSG  +      K        ++      V  LT+ 
Sbjct  389  PYPEWKSWNWQSERDYFLNGAYFVQSGKSNAWSSTPKNPIPRKFTIRPQPGTKVRRLTKD  448

Query  236  AGALNCRVGSPC  201
            AG L C+ G  C
Sbjct  449  AGTLGCKPGKSC  460



>gb|AAA16476.1| pectate lyase homolog [Zea mays]
 gb|AFW85884.1| hypothetical protein ZEAMMB73_308319 [Zea mays]
Length=438

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/247 (57%), Positives = 185/247 (75%), Gaps = 2/247 (1%)
 Frame = -2

Query  941  AGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHV  762
            A IT+Q V+NVI+H +HIH     +GG+IRD   H+GLRT+SDGDG+S+  SSNVWIDHV
Sbjct  194  AQITLQNVQNVILHNLHIHDSKAHSGGMIRDSKRHYGLRTRSDGDGVSVLSSSNVWIDHV  253

Query  761  SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKRL  582
            SM +C DGLID +  STAIT+SN HFTDH+ VMLFGA++ S +D +MQ+T+AFNHFG+ L
Sbjct  254  SMSSCSDGLIDVVNGSTAITVSNSHFTDHDHVMLFGASNDSPQDAVMQVTVAFNHFGRGL  313

Query  581  IQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGAA  402
            +QRMPRCR+G+ HVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP D + +++T R    
Sbjct  314  VQRMPRCRYGFFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIAPDDPNAKEVTKREYTP  373

Query  401  PEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGALN  222
             + +K+W W+S+GD+ M GAFF +SG  +  ++  + +D +       V  LTRFAG L 
Sbjct  374  YKDYKEWVWKSQGDVMMNGAFFNESGGQN--ERKYDRFDFIPAKHGRYVGQLTRFAGPLK  431

Query  221  CRVGSPC  201
            C VG PC
Sbjct  432  CIVGQPC  438



>emb|CDY17432.1| BnaC09g21050D [Brassica napus]
Length=459

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 154/252 (61%), Positives = 180/252 (71%), Gaps = 4/252 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG+T+QFVKNVIIH IHI  I  GNGG+IRD   HFG RT SDGDGI+IFGS+NVWIDH
Sbjct  208  GAGLTLQFVKNVIIHNIHIKTIIPGNGGMIRDSEHHFGHRTTSDGDGINIFGSTNVWIDH  267

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC DG+ID I  STAITISN H TDHN+VMLFGA +    DK MQIT+AFNHFGKR
Sbjct  268  VSMTNCTDGMIDVIMGSTAITISNCHLTDHNEVMLFGAREEDVIDKKMQITVAFNHFGKR  327

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPR RFG +HVVNNDYTHW MYAIGG+ +PTIISQGNRF AP   + +Q+T R  A
Sbjct  328  LVQRMPRARFGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFTAPPKENCKQVTKREYA  387

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNE----LYDGVQTFKAEDVTWLTRF  237
               +WK W W+SE D ++ GA+FV+SG  +      E     +  +Q      V  LT+ 
Sbjct  388  KYSEWKSWNWQSERDYFLNGAYFVKSGRANAWSPAPENPIPRHFAIQPQPGTGVRRLTKD  447

Query  236  AGALNCRVGSPC  201
            AG L CR G  C
Sbjct  448  AGTLGCRPGKSC  459



>ref|XP_006826355.1| hypothetical protein AMTR_s00004p00123190 [Amborella trichopoda]
 gb|ERM93592.1| hypothetical protein AMTR_s00004p00123190 [Amborella trichopoda]
Length=479

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 149/248 (60%), Positives = 185/248 (75%), Gaps = 5/248 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GA ITIQ+VKNVIIHG+HIH    GNGG+IRD  DHFG+RT+SDGDGISI+GS+NVW+DH
Sbjct  237  GACITIQYVKNVIIHGLHIHDCKAGNGGMIRDSEDHFGIRTRSDGDGISIYGSTNVWVDH  296

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
             ++  C DGL+DAI  STAITISN HF+ H++V+L G +DL   DK+MQ+T+AFNHFGK 
Sbjct  297  NTLSKCQDGLVDAIMGSTAITISNNHFSKHDEVLLLGGSDLYPMDKVMQVTVAFNHFGKG  356

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L QRMPRCRFGY HVVNNDYTHW  YAIGGS +PTI+SQGNRF+AP D + ++IT R G 
Sbjct  357  LSQRMPRCRFGYFHVVNNDYTHWGKYAIGGSMNPTILSQGNRFVAPLDPYFKEITKRFGP  416

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
              + W  W W+SEGD++  GA F QSG+     +  E    ++      V  LTRF+GAL
Sbjct  417  DLD-WGSWNWKSEGDLFKNGAIFTQSGN----GRKYERKISIRAKPGSYVGILTRFSGAL  471

Query  224  NCRVGSPC  201
             C+ G+PC
Sbjct  472  KCKTGTPC  479



>ref|XP_004964534.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=438

 Score =   267 bits (682),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 145/248 (58%), Positives = 186/248 (75%), Gaps = 2/248 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GA IT+Q V +VIIH +HIHH    +GG+IRD   H+GLRT+SDGDGIS+  SSNVWIDH
Sbjct  193  GAQITLQSVSHVIIHNVHIHHSAPHSGGIIRDSKRHYGLRTRSDGDGISVLSSSNVWIDH  252

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM  C DGLID +  ST IT+SN HFT H+ VMLFGA++ + +D++MQ+T+AFNHFGK 
Sbjct  253  VSMYRCSDGLIDVVNGSTGITVSNSHFTKHDHVMLFGASNDNPQDRMMQVTVAFNHFGKG  312

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP D + +++T R   
Sbjct  313  LVQRMPRCRYGFFHVVNNDYTHWQMYAIGGNKNPTIISQGNRFIAPDDPNAKEVTKREYT  372

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
               ++K W W+S+GD+ M GAFF +SG  +  +K+++L D +       V  LT+FAG L
Sbjct  373  PYSEYKDWVWKSQGDVMMNGAFFNESGGQN-ERKYDQL-DFIPARHGSYVGELTKFAGTL  430

Query  224  NCRVGSPC  201
            NCR G PC
Sbjct  431  NCRAGKPC  438



>gb|AGT16685.1| pectate lyase precursor [Saccharum hybrid cultivar R570]
Length=326

 Score =   263 bits (672),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 144/248 (58%), Positives = 185/248 (75%), Gaps = 2/248 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GA IT+Q V NVI+H +HIH      GG+IRD   H G+R +SDGDGIS+ GSS++WIDH
Sbjct  81   GAQITLQNVHNVILHNLHIHDAVPRGGGVIRDSKHHSGVRGESDGDGISVMGSSDIWIDH  140

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSMR+C DGL+D ++ STA+TISNGHFT H+ VMLFGA+D + KDK+MQ+T+AFNHFGK 
Sbjct  141  VSMRSCADGLVDVVDGSTAVTISNGHFTKHDHVMLFGASDSAVKDKLMQVTVAFNHFGKG  200

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS +PTIISQGNRF A  D + +++T R   
Sbjct  201  LVQRMPRCRYGFFHVVNNDYTHWLMYAIGGSQNPTIISQGNRFRAVDDRNFKEVTKREYT  260

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
               Q+K W W+S+ D+++ GAFF QSG  +  ++  +  D +Q    +    LTR+AGAL
Sbjct  261  PYSQYKDWVWKSQDDLFLNGAFFNQSGGQN--ERRFDRLDLIQAKGGQYAESLTRYAGAL  318

Query  224  NCRVGSPC  201
            NCRVG  C
Sbjct  319  NCRVGKKC  326



>emb|CDY09356.1| BnaA02g26540D [Brassica napus]
Length=457

 Score =   267 bits (682),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 154/252 (61%), Positives = 182/252 (72%), Gaps = 4/252 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG T+QFVKNVIIH IH+  I  G GGLIRD  +HFGLRT SDGDGI+IFG++N+WIDH
Sbjct  206  GAGFTLQFVKNVIIHNIHMKFIKRGFGGLIRDSEEHFGLRTISDGDGINIFGATNIWIDH  265

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSMRNC DG+IDAI  STAITISN HFTDH +VMLFGA +    DK MQIT+AFNHFGKR
Sbjct  266  VSMRNCSDGMIDAIMGSTAITISNSHFTDHKEVMLFGAKNGDEFDKKMQITVAFNHFGKR  325

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L QRMPR R+G +HVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP     +Q+T R   
Sbjct  326  LNQRMPRVRYGMVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPKEDCKQVTKREYT  385

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDF--MKKHNELYD--GVQTFKAEDVTWLTRF  237
            A  +WK W W+SE D ++ GA+FVQSG  +       N +     ++      V  LT+ 
Sbjct  386  AYPEWKSWNWQSERDYFLNGAYFVQSGKSNAWSAAPKNPIPKEFTIRPQPGTKVRSLTKD  445

Query  236  AGALNCRVGSPC  201
            AG L+CR G  C
Sbjct  446  AGTLDCRPGKSC  457



>gb|EMS65801.1| hypothetical protein TRIUR3_32637 [Triticum urartu]
Length=273

 Score =   261 bits (667),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 142/248 (57%), Positives = 183/248 (74%), Gaps = 2/248 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GA +T+Q V++VIIH +HIHH    +GG+IRD   H+G RT+SDGDG+SI  SS+VWIDH
Sbjct  28   GAQMTLQGVRHVIIHNVHIHHSVPHSGGMIRDSKHHYGRRTRSDGDGVSILSSSSVWIDH  87

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM +C DGLID +  STAIT+SN HFT H+ VMLFGA++   +D++MQ+T+AFNHFGK 
Sbjct  88   VSMSSCADGLIDVVSGSTAITVSNSHFTKHDHVMLFGASNTEEQDRMMQVTVAFNHFGKG  147

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCRFG+  VVNNDYTHW MYAIGG+ DPTIISQGNRFIAP D + +++T R  A
Sbjct  148  LVQRMPRCRFGFFQVVNNDYTHWQMYAIGGNRDPTIISQGNRFIAPDDGNAKEVTKREYA  207

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
               ++K W W+S+GD+ + GAFF +SG  +  +  N   D +       V  LTRFAG L
Sbjct  208  PYTEYKDWVWKSQGDVMVNGAFFNESGGQNERRYGN--MDFIPAKHGRYVGQLTRFAGVL  265

Query  224  NCRVGSPC  201
            +C +G PC
Sbjct  266  DCGIGKPC  273



>ref|XP_009129128.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=457

 Score =   267 bits (682),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 154/252 (61%), Positives = 182/252 (72%), Gaps = 4/252 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG T+QFVKNVIIH IH+  I  G GGLIRD  +HFGLRT SDGDGI+IFG++N+WIDH
Sbjct  206  GAGFTLQFVKNVIIHNIHMKFIKRGFGGLIRDSEEHFGLRTISDGDGINIFGATNIWIDH  265

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSMRNC DG+IDAI  STAITISN HFTDH +VMLFGA +    DK MQIT+AFNHFGKR
Sbjct  266  VSMRNCSDGMIDAIMGSTAITISNSHFTDHKEVMLFGAKNGDEFDKKMQITVAFNHFGKR  325

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L QRMPR R+G +HVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP     +Q+T R   
Sbjct  326  LNQRMPRVRYGMVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPKEDCKQVTKREYT  385

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDF--MKKHNELYD--GVQTFKAEDVTWLTRF  237
            A  +WK W W+SE D ++ GA+FVQSG  +       N +     ++      V  LT+ 
Sbjct  386  AYPEWKSWNWQSERDYFLNGAYFVQSGKSNAWSAAPKNPIPKEFTIRPQPGTKVRSLTKD  445

Query  236  AGALNCRVGSPC  201
            AG L+CR G  C
Sbjct  446  AGTLDCRPGKSC  457



>dbj|BAK05605.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=448

 Score =   266 bits (681),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 148/249 (59%), Positives = 182/249 (73%), Gaps = 3/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GA IT+Q VK+VIIH +H+HH    +GG+IRD   H+G RT+SDGDG+SI  SSNVWIDH
Sbjct  202  GAQITLQGVKHVIIHNVHVHHSAPHSGGMIRDSKHHYGRRTRSDGDGVSILSSSNVWIDH  261

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGA-NDLSTKDKIMQITIAFNHFGK  588
            VSM  C DGLID +  STAIT+SN HFT+H+ VMLFGA N    +D++MQ+T+AFNHFGK
Sbjct  262  VSMSTCADGLIDVVSGSTAITVSNSHFTNHDHVMLFGASNAQEQQDRMMQVTVAFNHFGK  321

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L+QRMPRCRFG+ HVVNNDYTHW MYAIGG+ DPTIISQGNRFIAP D + +++T R  
Sbjct  322  GLVQRMPRCRFGFFHVVNNDYTHWKMYAIGGNRDPTIISQGNRFIAPDDPNAKEVTKREY  381

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
                ++K W W+S+GD+ M GAFF QSG  +     N   D +     + V  LT+FAG 
Sbjct  382  TPYNEYKDWVWKSQGDVMMNGAFFNQSGGQNERTYGN--MDFIPAKHGKYVGQLTQFAGT  439

Query  227  LNCRVGSPC  201
            L CRVG PC
Sbjct  440  LECRVGKPC  448



>ref|XP_010670318.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=450

 Score =   266 bits (681),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 147/249 (59%), Positives = 182/249 (73%), Gaps = 2/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            DGAGITIQF  NVIIH I IH I    GG+IRD  +H G+R   DGDGI++F SSN+W+D
Sbjct  204  DGAGITIQFANNVIIHNIKIHDIVPSTGGMIRDTNNHVGIRGADDGDGINVFASSNIWLD  263

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            H+SM NC DGLID ++ASTAIT+SN HFT H+ V+LFGA+D    D+IMQI++AFNHFGK
Sbjct  264  HLSMWNCKDGLIDIVKASTAITLSNNHFTRHDHVLLFGADDKDPADEIMQISLAFNHFGK  323

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L+QRMPRCRFG+ HV+NNDYTHW MYAIGG+S PTIISQGNRFIAP +   + IT+R  
Sbjct  324  GLVQRMPRCRFGFFHVLNNDYTHWIMYAIGGTSHPTIISQGNRFIAPPNPTAKMITNRNN  383

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
               + WK+W WRSE D ++ GA+FV+SG P  + +     D ++      V  LTRF+G 
Sbjct  384  VVGDDWKKWIWRSENDQFVNGAYFVESGHP--LDETRFKKDFIKAKPGTYVRRLTRFSGQ  441

Query  227  LNCRVGSPC  201
            L CRVG  C
Sbjct  442  LRCRVGQSC  450



>ref|NP_001056786.1| Os06g0145100 [Oryza sativa Japonica Group]
 dbj|BAD68408.1| putative pectate lyase homolog [Oryza sativa Japonica Group]
 dbj|BAD68763.1| putative pectate lyase homolog [Oryza sativa Japonica Group]
 dbj|BAF18700.1| Os06g0145100 [Oryza sativa Japonica Group]
 gb|EAZ35810.1| hypothetical protein OsJ_20102 [Oryza sativa Japonica Group]
Length=348

 Score =   263 bits (673),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 147/248 (59%), Positives = 187/248 (75%), Gaps = 5/248 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GA IT+Q V++VIIH +HIHH     GG+IRD   H+GLRT+SDGDGISI  SSN+WIDH
Sbjct  106  GAQITLQGVQHVIIHNVHIHHSVPHGGGMIRDSKRHYGLRTRSDGDGISIMSSSNIWIDH  165

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC DGLIDA+  STAITISNGHFT H+ VMLFGA++   +D++MQIT+AFNHFGK 
Sbjct  166  VSMSNCSDGLIDAVSGSTAITISNGHFTKHDHVMLFGASNSDAQDEVMQITVAFNHFGKG  225

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+   PRCRFG+ HVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP D++ +++T R   
Sbjct  226  LV---PRCRFGFFHVVNNDYTHWLMYAIGGNMNPTIISQGNRFIAPDDLNAKEVTKREYT  282

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
              +++K+W W+S+GD+ M GAFF +SG  +  ++  +  D +     + V  LT+FAG L
Sbjct  283  PYDEYKEWVWKSQGDVMMNGAFFNESGGQN--ERSYDQLDFIPAKHGKYVGQLTKFAGTL  340

Query  224  NCRVGSPC  201
            NC VG PC
Sbjct  341  NCHVGMPC  348



>gb|EEE56553.1| hypothetical protein OsJ_05879 [Oryza sativa Japonica Group]
Length=410

 Score =   265 bits (678),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 183/249 (73%), Gaps = 5/249 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QF +NVII  +H+H +   +GG +RD   H G RT++DGDGIS+F +++VW+DH
Sbjct  166  GAGITVQFARNVIITSLHVHDVKHSDGGAVRDSPTHIGPRTRADGDGISLFAATDVWVDH  225

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM  C DGLID ++ ST +TISN HFT+HNDVMLFGA+D   +DK+MQIT+AFNHFG+ 
Sbjct  226  VSMSMCEDGLIDVVQGSTGVTISNSHFTNHNDVMLFGASDSYPQDKVMQITVAFNHFGRG  285

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW MYAIGG   PTI+SQGNR+IAP +I  + IT     
Sbjct  286  LVQRMPRCRWGFFHVVNNDYTHWLMYAIGGGMSPTILSQGNRYIAPPNIAAKLITRHY--  343

Query  404  APE-QWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            APE +WK W WRS+GD++M GA+F  S     + +  +  D V+      V  LTRFAGA
Sbjct  344  APEWEWKNWAWRSDGDLFMNGAYFQASNGA--INRKVKGSDMVKPKPGSYVRRLTRFAGA  401

Query  227  LNCRVGSPC  201
            L+CR G PC
Sbjct  402  LSCRPGEPC  410



>gb|EAY85003.1| hypothetical protein OsI_06363 [Oryza sativa Indica Group]
Length=439

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 183/249 (73%), Gaps = 5/249 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QF +NVII  +H+H +   +GG +RD   H G RT++DGDGIS+F +++VW+DH
Sbjct  195  GAGITVQFARNVIITSLHVHDVKHSDGGAVRDSPTHIGPRTRADGDGISLFAATDVWVDH  254

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM  C DGLID ++ ST +TISN HFT+HNDVMLFGA+D   +DK+MQIT+AFNHFG+ 
Sbjct  255  VSMSMCEDGLIDVVQGSTGVTISNSHFTNHNDVMLFGASDSYPQDKVMQITVAFNHFGRG  314

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW MYAIGG   PTI+SQGNR+IAP +I  + IT     
Sbjct  315  LVQRMPRCRWGFFHVVNNDYTHWLMYAIGGGMSPTILSQGNRYIAPPNIAAKLITRHY--  372

Query  404  APE-QWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            APE +WK W WRS+GD++M GA+F  S     + +  +  D V+      V  LTRFAGA
Sbjct  373  APEWEWKNWAWRSDGDLFMNGAYFQASNGA--INRKVKGSDMVKPKPGSYVRRLTRFAGA  430

Query  227  LNCRVGSPC  201
            L+CR G PC
Sbjct  431  LSCRPGEPC  439



>emb|CDP00293.1| unnamed protein product [Coffea canephora]
Length=445

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 153/249 (61%), Positives = 183/249 (73%), Gaps = 3/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG++IQFV+NVIIH I IHHI   NGGL+RD   H GLRT+SDGDGISIFGS++VWIDH
Sbjct  199  GAGLSIQFVQNVIIHNIKIHHIVPKNGGLVRDSTSHIGLRTRSDGDGISIFGSNHVWIDH  258

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VS+  C DGLIDAI ASTAITISN  F +HNDV+L GA+D  ++D IMQ+T+AFN FGK 
Sbjct  259  VSLSKCSDGLIDAIMASTAITISNCKFNNHNDVILLGASDEHSEDAIMQVTVAFNRFGKG  318

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ H+VNNDY+ W MYAIGGS+ PTIISQGNRF A  +   +++T R  A
Sbjct  319  LVQRMPRCRWGFFHIVNNDYSQWQMYAIGGSAHPTIISQGNRFKASKNQFTKEVTKRDYA  378

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVT-WLTRFAGA  228
               QW  W WRSEGD ++ GAFFV+SG P  +KK          FK       LTR+AGA
Sbjct  379  EKSQWMGWQWRSEGDKFLNGAFFVESGPP--LKKSPFTGKNKLQFKPGSYAGRLTRYAGA  436

Query  227  LNCRVGSPC  201
            L CR G PC
Sbjct  437  LKCREGKPC  445



>ref|XP_010527871.1| PREDICTED: probable pectate lyase 3 isoform X1 [Tarenaya hassleriana]
Length=709

 Score =   273 bits (697),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 152/252 (60%), Positives = 182/252 (72%), Gaps = 4/252 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG T+QFV NVIIH I+I +I  GNGGLIRD   HFGLRT+SDGDGI+IFG++NVWIDH
Sbjct  458  GAGFTLQFVNNVIIHNIYIKNIVPGNGGLIRDSETHFGLRTRSDGDGINIFGATNVWIDH  517

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM +C DG+IDAI+ ST ITISN H TDH +VMLFG  D    DK MQIT+AFNHFGKR
Sbjct  518  VSMSHCSDGMIDAIQGSTGITISNCHLTDHQEVMLFGGTDKDVIDKKMQITVAFNHFGKR  577

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G IHVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP +   +Q+T R   
Sbjct  578  LVQRMPRCRYGLIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEEAKQVTKREYT  637

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFM----KKHNELYDGVQTFKAEDVTWLTRF  237
               +WK W W+SEGD ++ GA+FVQSG  + +    K        ++      V  LT  
Sbjct  638  PFTEWKSWNWQSEGDYFLNGAYFVQSGRANALSAAPKNPVPSKFAIRPQPGTLVRKLTMD  697

Query  236  AGALNCRVGSPC  201
            AG L+C+   PC
Sbjct  698  AGVLSCKKRKPC  709



>ref|NP_001046281.1| Os02g0214400 [Oryza sativa Japonica Group]
 dbj|BAD25039.1| putative pectate lyase precursor [Oryza sativa Japonica Group]
 dbj|BAF08195.1| Os02g0214400 [Oryza sativa Japonica Group]
 dbj|BAG94880.1| unnamed protein product [Oryza sativa Japonica Group]
Length=446

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 183/249 (73%), Gaps = 5/249 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QF +NVII  +H+H +   +GG +RD   H G RT++DGDGIS+F +++VW+DH
Sbjct  202  GAGITVQFARNVIITSLHVHDVKHSDGGAVRDSPTHIGPRTRADGDGISLFAATDVWVDH  261

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM  C DGLID ++ ST +TISN HFT+HNDVMLFGA+D   +DK+MQIT+AFNHFG+ 
Sbjct  262  VSMSMCEDGLIDVVQGSTGVTISNSHFTNHNDVMLFGASDSYPQDKVMQITVAFNHFGRG  321

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW MYAIGG   PTI+SQGNR+IAP +I  + IT     
Sbjct  322  LVQRMPRCRWGFFHVVNNDYTHWLMYAIGGGMSPTILSQGNRYIAPPNIAAKLITRHY--  379

Query  404  APE-QWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            APE +WK W WRS+GD++M GA+F  S     + +  +  D V+      V  LTRFAGA
Sbjct  380  APEWEWKNWAWRSDGDLFMNGAYFQASNGA--INRKVKGSDMVKPKPGSYVRRLTRFAGA  437

Query  227  LNCRVGSPC  201
            L+CR G PC
Sbjct  438  LSCRPGEPC  446



>ref|XP_006299938.1| hypothetical protein CARUB_v10016149mg [Capsella rubella]
 gb|EOA32836.1| hypothetical protein CARUB_v10016149mg [Capsella rubella]
Length=472

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 150/249 (60%), Positives = 189/249 (76%), Gaps = 2/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQ+V N+IIHG+HIHHI + +GGLIRD ++HFG R ++DGDGISIFG++N+W+DH
Sbjct  225  GAGITIQYVHNIIIHGLHIHHIVKSSGGLIRDSINHFGQRGQADGDGISIFGATNIWLDH  284

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM  C DGLIDAI  STAITISN HFT HNDVML GA D +  DK MQ+T+A+NHFGK 
Sbjct  285  ISMSRCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGAQDNNQDDKKMQVTVAYNHFGKG  344

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPS-DIHKRQITHRVG  408
            L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+S GNRFIAP    H R++T R  
Sbjct  345  LVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDY  404

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A+  +WK W WRSE D ++ GA F +SG+P F   H+     ++      V+ LT++AGA
Sbjct  405  ASEGEWKHWNWRSEKDYFLNGAHFRESGNPHFKCSHSR-QQMIKPKHGVAVSKLTKYAGA  463

Query  227  LNCRVGSPC  201
            L+CRVG  C
Sbjct  464  LDCRVGKAC  472



>ref|XP_004508770.1| PREDICTED: probable pectate lyase P59-like [Cicer arietinum]
Length=434

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 148/249 (59%), Positives = 186/249 (75%), Gaps = 4/249 (2%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GA +T+Q+VKN+IIHG+HIH I +G GGLIRD ++H+G R+ SDGD IS+FGSS+VWID
Sbjct  190  NGAQMTLQYVKNIIIHGLHIHDIKKGGGGLIRDSVNHYGYRSSSDGDAISLFGSSHVWID  249

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            H+S+ NC DGLID +E STAITISN H T HNDVMLFGA+D  + DK++Q+T+AFNHFGK
Sbjct  250  HISLWNCDDGLIDVVEGSTAITISNCHMTRHNDVMLFGASDGYSGDKVLQVTVAFNHFGK  309

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             LIQRMPRCR+G+ H+VNNDYT W MYAIGGS  PTI+SQGNRFIAP++ + +++T R  
Sbjct  310  GLIQRMPRCRWGFFHIVNNDYTQWVMYAIGGSQQPTILSQGNRFIAPNNPNAKEVTKRDY  369

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            AA   WK W+W SE D+   GAFFVQSG     K  N     ++         LTRF+GA
Sbjct  370  AAESVWKTWSWTSENDLMRNGAFFVQSGK----KSGNFPKTDIKAKPGSYAASLTRFSGA  425

Query  227  LNCRVGSPC  201
            + C V  PC
Sbjct  426  IKCVVNKPC  434



>ref|XP_002437815.1| hypothetical protein SORBIDRAFT_10g003090 [Sorghum bicolor]
 gb|EER89182.1| hypothetical protein SORBIDRAFT_10g003090 [Sorghum bicolor]
Length=444

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 144/248 (58%), Positives = 186/248 (75%), Gaps = 2/248 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GA +T+Q V +VI+H +HIH     +GG+IRD   H G+RT+SDGDGIS+  SSNVWIDH
Sbjct  199  GAQVTLQSVHDVILHNLHIHDAVAHSGGMIRDSKRHTGMRTRSDGDGISVLSSSNVWIDH  258

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM  C DGLID +  STAIT+SN HFT H+ VMLFGA++ + +D++MQIT+AFNHFG+ 
Sbjct  259  VSMSRCADGLIDVVNGSTAITVSNSHFTHHDHVMLFGASNDNPQDEVMQITVAFNHFGRG  318

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR+G+ HVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP D + +++T R   
Sbjct  319  LVQRMPRCRYGFFHVVNNDYTHWIMYAIGGNKNPTIISQGNRFIAPDDPNAKEVTKREYT  378

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
            A + +K+W W+S+GD+ M GAFF +SG  +  +K++EL D +       V  LTRFAG L
Sbjct  379  AYKDYKEWVWKSQGDVMMNGAFFNESGGQN-ERKYDEL-DFIPAKHGRYVGQLTRFAGPL  436

Query  224  NCRVGSPC  201
             C VG PC
Sbjct  437  KCIVGQPC  444



>emb|CDY41679.1| BnaC02g34750D [Brassica napus]
Length=457

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 153/252 (61%), Positives = 181/252 (72%), Gaps = 4/252 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG T+QFVKNVIIH IH+  I  G GGLIRD  +HFGLRT SDGDGI+IFG++N+WIDH
Sbjct  206  GAGFTLQFVKNVIIHNIHMKFIKRGFGGLIRDSEEHFGLRTISDGDGINIFGATNIWIDH  265

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSMRNC DG+IDAI  STAITISN HFTDH +VMLFGA +    DK MQIT+AFNHFGKR
Sbjct  266  VSMRNCSDGMIDAIMGSTAITISNSHFTDHKEVMLFGAKNGDEFDKKMQITVAFNHFGKR  325

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L QRMPR R+G +HVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP     +Q+T R   
Sbjct  326  LNQRMPRVRYGMVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPKEDCKQVTKREYT  385

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDF--MKKHNELYD--GVQTFKAEDVTWLTRF  237
               +WK W W+SE D ++ GA+FVQSG  +       N +     ++      V  LT+ 
Sbjct  386  PYPEWKSWNWQSERDYFLNGAYFVQSGKSNAWSAAPKNPIPKEFTIRPQPGTKVRSLTKD  445

Query  236  AGALNCRVGSPC  201
            AG L+CR G  C
Sbjct  446  AGTLDCRPGKSC  457



>ref|XP_002511525.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF52127.1| Pectate lyase precursor, putative [Ricinus communis]
Length=433

 Score =   265 bits (676),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 151/248 (61%), Positives = 182/248 (73%), Gaps = 4/248 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GA ITIQ+ +N+IIHGIHIH I  G+GG IRD   HFG RT SDGDGISI+GS+N+WIDH
Sbjct  190  GAQITIQYARNIIIHGIHIHDIRGGSGGKIRDSETHFGKRTASDGDGISIYGSNNIWIDH  249

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VS+ NC DGLIDAI ASTAITISN HFT HN VML G N+  + D +MQ+T+AFNHF ++
Sbjct  250  VSISNCTDGLIDAIMASTAITISNCHFTRHNTVMLLGGNNKFSADSVMQVTVAFNHFDRK  309

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPR R+G  HVVNNDYT W MYAIGGS  PTIISQGNRF+AP D   +Q+T R   
Sbjct  310  LVQRMPRVRYGLAHVVNNDYTSWEMYAIGGSEHPTIISQGNRFLAPPDPDCKQVTKRNVE  369

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
               +WK W WRSEGD+ + GAFFV+SG P  ++ H +  + V       V  LTR+AGAL
Sbjct  370  PESEWKSWNWRSEGDLMLNGAFFVESGSP--IETHGK--EEVHAMPGTLVHRLTRYAGAL  425

Query  224  NCRVGSPC  201
            +C+   PC
Sbjct  426  HCKKQKPC  433



>ref|XP_011098576.1| PREDICTED: probable pectate lyase P56 [Sesamum indicum]
Length=465

 Score =   265 bits (678),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 145/249 (58%), Positives = 179/249 (72%), Gaps = 2/249 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG+TIQFV N+II  + I +I    GG IRD ++HFG RT SDGD I+IFGS N+WIDH
Sbjct  218  GAGLTIQFVHNIIITNLKITNIVPSPGGTIRDSVNHFGFRTGSDGDAINIFGSHNIWIDH  277

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            +SM    DGLIDA+  STAITISN HF  H+ V+LFG  D+   D  MQIT+AFNHFGK 
Sbjct  278  LSMSGGADGLIDAVMGSTAITISNCHFVRHDKVLLFGGRDMDEIDSKMQITLAFNHFGKH  337

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR G+ H+VNNDYTHW MYAIGGS   TIISQGNR+IAP    KRQ+THR   
Sbjct  338  LVQRMPRCRRGFFHLVNNDYTHWLMYAIGGSHHATIISQGNRYIAPPLPDKRQVTHREAD  397

Query  404  APE-QWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            +PE +W++WTW ++ D+++ GA+FV SGDP+    +  L + ++    E V  LTRFAGA
Sbjct  398  SPESEWRKWTWVTDHDVFLNGAYFVPSGDPNGAATYLAL-EKIRPAPGEQVYDLTRFAGA  456

Query  227  LNCRVGSPC  201
            L C V  PC
Sbjct  457  LKCVVSLPC  465



>ref|XP_010425041.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   265 bits (677),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 150/252 (60%), Positives = 182/252 (72%), Gaps = 4/252 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG+T+Q+V+NVIIH I+I  I +G GGLIRD   HFGLRT SDGDGISIFG++NVWIDH
Sbjct  202  GAGLTLQYVRNVIIHNIYIKQIKKGPGGLIRDSEHHFGLRTMSDGDGISIFGATNVWIDH  261

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM +C DG+IDAI  STAITISN HFTDH++VMLFG  +    DK MQIT+AFNHFGKR
Sbjct  262  VSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGKNTDVIDKKMQITVAFNHFGKR  321

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L QRMPR R+G +HVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP +   +Q+T R   
Sbjct  322  LKQRMPRARYGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEDSKQVTKREYT  381

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDF--MKKHNELYD--GVQTFKAEDVTWLTRF  237
               +WK W W+SE D ++ GA+FVQSG  +       N +     ++      V  LT+ 
Sbjct  382  PYPEWKSWNWQSEKDYFLNGAYFVQSGKANAWSTAPKNPIPRKFAIRPQPGTKVRRLTKD  441

Query  236  AGALNCRVGSPC  201
            AGAL C+ G  C
Sbjct  442  AGALGCKPGKSC  453



>dbj|BAD68402.1| putative pectate lyase homolog [Oryza sativa Japonica Group]
Length=438

 Score =   264 bits (675),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 147/248 (59%), Positives = 187/248 (75%), Gaps = 5/248 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GA IT+Q V++VIIH +HIHH     GG+IRD   H+GLRT+SDGDGISI  SSN+WIDH
Sbjct  196  GAQITLQGVQHVIIHNVHIHHSVPHGGGMIRDSKRHYGLRTRSDGDGISIMSSSNIWIDH  255

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC DGLIDA+  STAITISNGHFT H+ VMLFGA++   +D++MQIT+AFNHFGK 
Sbjct  256  VSMSNCSDGLIDAVSGSTAITISNGHFTKHDHVMLFGASNSDAQDEVMQITVAFNHFGKG  315

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+   PRCRFG+ HVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP D++ +++T R   
Sbjct  316  LV---PRCRFGFFHVVNNDYTHWLMYAIGGNMNPTIISQGNRFIAPDDLNAKEVTKREYT  372

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
              +++K+W W+S+GD+ M GAFF +SG  +  ++  +  D +     + V  LT+FAG L
Sbjct  373  PYDEYKEWVWKSQGDVMMNGAFFNESGGQN--ERSYDQLDFIPAKHGKYVGQLTKFAGTL  430

Query  224  NCRVGSPC  201
            NC VG PC
Sbjct  431  NCHVGMPC  438



>ref|NP_001056781.1| Os06g0144200 [Oryza sativa Japonica Group]
 dbj|BAF18695.1| Os06g0144200 [Oryza sativa Japonica Group]
Length=450

 Score =   265 bits (676),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 147/248 (59%), Positives = 187/248 (75%), Gaps = 5/248 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GA IT+Q V++VIIH +HIHH     GG+IRD   H+GLRT+SDGDGISI  SSN+WIDH
Sbjct  208  GAQITLQGVQHVIIHNVHIHHSVPHGGGMIRDSKRHYGLRTRSDGDGISIMSSSNIWIDH  267

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM NC DGLIDA+  STAITISNGHFT H+ VMLFGA++   +D++MQIT+AFNHFGK 
Sbjct  268  VSMSNCSDGLIDAVSGSTAITISNGHFTKHDHVMLFGASNSDAQDEVMQITVAFNHFGKG  327

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+   PRCRFG+ HVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP D++ +++T R   
Sbjct  328  LV---PRCRFGFFHVVNNDYTHWLMYAIGGNMNPTIISQGNRFIAPDDLNAKEVTKREYT  384

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
              +++K+W W+S+GD+ M GAFF +SG  +  ++  +  D +     + V  LT+FAG L
Sbjct  385  PYDEYKEWVWKSQGDVMMNGAFFNESGGQN--ERSYDQLDFIPAKHGKYVGQLTKFAGTL  442

Query  224  NCRVGSPC  201
            NC VG PC
Sbjct  443  NCHVGMPC  450



>ref|XP_010514040.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   265 bits (676),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 149/252 (59%), Positives = 182/252 (72%), Gaps = 4/252 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG+T+Q+V+NVIIH I+I  I +G GGLIRD   HFGLRT SDGDGISIFG++N+WIDH
Sbjct  202  GAGLTLQYVRNVIIHNIYIKQIKKGPGGLIRDSEHHFGLRTMSDGDGISIFGATNIWIDH  261

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM +C DG+IDAI  STAITISN HFTDH++VMLFG  +    DK MQIT+AFNHFGKR
Sbjct  262  VSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGKNTDVIDKKMQITVAFNHFGKR  321

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L QRMPR R+G +HVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP +   +Q+T R   
Sbjct  322  LKQRMPRARYGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEDSKQVTKREYT  381

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDF--MKKHNELYD--GVQTFKAEDVTWLTRF  237
               +WK W W+SE D ++ GA+FVQSG  +       N +     ++      V  LT+ 
Sbjct  382  PYPEWKTWNWQSEKDYFLNGAYFVQSGKANAWSTAPKNPIPRKFAIRPQPGTKVRRLTKD  441

Query  236  AGALNCRVGSPC  201
            AGAL C+ G  C
Sbjct  442  AGALGCKAGKSC  453



>ref|XP_006363934.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=439

 Score =   264 bits (674),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 147/249 (59%), Positives = 179/249 (72%), Gaps = 0/249 (0%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GAG+TIQFV NVIIH I I +I   NGG+IRD ++H GLRT SDGDGISIFGS+++WID
Sbjct  191  NGAGLTIQFVHNVIIHNIRIQNIISTNGGMIRDSVNHIGLRTVSDGDGISIFGSNHIWID  250

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            H ++  C DGL+DAI ASTAITISN  F  HNDVML GA D   +D IMQ+T+AFN FG+
Sbjct  251  HCTLSECTDGLVDAIMASTAITISNCKFNHHNDVMLLGATDAFPQDSIMQVTVAFNRFGE  310

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             LIQRMPRCR+G+ HVVNNDYTHW MYAIGGS+ PTIISQGNRF A  + + +Q+T R  
Sbjct  311  GLIQRMPRCRWGFFHVVNNDYTHWQMYAIGGSAHPTIISQGNRFKAADNPNTKQVTKRDY  370

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A   +WK+W W SEGD ++ GA+FV+SG  D  K        ++         LTRFAG 
Sbjct  371  APESEWKKWQWVSEGDSFLNGAYFVESGPQDKKKTALTKNHKIKFKPGSHAGRLTRFAGV  430

Query  227  LNCRVGSPC  201
            L C+ G PC
Sbjct  431  LKCKPGIPC  439



>ref|XP_011087066.1| PREDICTED: pectate lyase [Sesamum indicum]
Length=431

 Score =   263 bits (672),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 150/250 (60%), Positives = 184/250 (74%), Gaps = 3/250 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGIT+QFV NVIIH I IH I    GG+IRD +DH GLRT+SDGDGIS+F S+N+WIDH
Sbjct  183  GAGITLQFVHNVIIHNIRIHDIHPAPGGMIRDAVDHIGLRTRSDGDGISVFNSNNIWIDH  242

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VS+    DGLID IE STAITISN  F  HNDVML GA+D + KD IMQIT+AFN FGK 
Sbjct  243  VSLSKGTDGLIDVIEGSTAITISNCKFNHHNDVMLLGAHDSTAKDSIMQITVAFNRFGKG  302

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            LIQRMPR R+G++HV+NNDY+HW MYAIGGS+ PTIISQGNRF A ++ H +++T R+ A
Sbjct  303  LIQRMPRIRWGFVHVINNDYSHWEMYAIGGSAHPTIISQGNRFKAANNQHTKEVTKRMFA  362

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYD-GVQTFKAEDVT-WLTRFAG  231
               +W++W WRSEGD +  GA+FV+SG P   + +  L +  +  FK       LTR+AG
Sbjct  363  EKSEWEKWQWRSEGDKFTNGAYFVESG-PAIRRTNLPLTEKSLIKFKPGSFAGRLTRYAG  421

Query  230  ALNCRVGSPC  201
            AL CR G  C
Sbjct  422  ALKCREGKLC  431



>ref|XP_010502279.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   264 bits (674),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 149/252 (59%), Positives = 181/252 (72%), Gaps = 4/252 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG+T+Q+V+NVIIH I+I  I  G GGLIRD   HFGLRT SDGDGI+IFG++NVWIDH
Sbjct  202  GAGLTLQYVRNVIIHNIYIKQIKRGPGGLIRDSEHHFGLRTMSDGDGINIFGATNVWIDH  261

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM +C DG+IDAI  STAITISN HFTDH++VMLFG  +    DK MQIT+AFNHFGKR
Sbjct  262  VSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGKNTDVIDKKMQITVAFNHFGKR  321

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L QRMPR R+G +HVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP +   +Q+T R   
Sbjct  322  LKQRMPRARYGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEDSKQVTKREYT  381

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDF--MKKHNELYD--GVQTFKAEDVTWLTRF  237
               +WK W W+SE D ++ GA+FVQSG  +       N +     ++      V  LT+ 
Sbjct  382  PYPEWKTWNWQSEKDYFLNGAYFVQSGKANAWSTAPKNPIPRKFAIRPQPGTKVRRLTKD  441

Query  236  AGALNCRVGSPC  201
            AGAL C+ G  C
Sbjct  442  AGALGCKPGKSC  453



>ref|XP_003609009.1| Pectate lyase [Medicago truncatula]
Length=445

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 150/260 (58%), Positives = 186/260 (72%), Gaps = 15/260 (6%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GA IT+Q+VKN+IIHG+HIH   + +GG IRD +DH+G R+ SDGD IS+FG+S+VWID
Sbjct  190  EGAQITLQYVKNIIIHGLHIHDTKKTSGGQIRDSMDHYGSRSASDGDAISMFGASHVWID  249

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDV-----------MLFGANDLSTKDKIM  621
            H+SM NC DGL+DA+  STAITISN H T HNDV           MLFGAND  + D+I 
Sbjct  250  HISMWNCADGLVDAVAGSTAITISNCHMTRHNDVINNISSTYSFVMLFGANDGFSGDQIS  309

Query  620  QITIAFNHFGKRLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSD  441
            QIT+AFNHFGK LIQRMPRCR+G+ H+VNNDYTHW MYAIGGS+ PTI+SQGNRFIAP +
Sbjct  310  QITVAFNHFGKGLIQRMPRCRWGFFHIVNNDYTHWLMYAIGGSTHPTILSQGNRFIAPPN  369

Query  440  IHKRQITHRVGAAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAE  261
             + +++T R  A    WK W+WRSE D+ M GAFF QSG        +++     +F A 
Sbjct  370  PNAKEVTKRDYAPESVWKAWSWRSENDLMMNGAFFKQSGTKAANFPKSDIKAKPGSFAAA  429

Query  260  DVTWLTRFAGALNCRVGSPC  201
                LTRF+G L C VG PC
Sbjct  430  ----LTRFSGCLKCEVGKPC  445



>ref|XP_006477525.1| PREDICTED: pectate lyase-like [Citrus sinensis]
Length=437

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/249 (58%), Positives = 182/249 (73%), Gaps = 3/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GA IT+QFVKN+IIHG+HI     G GG+IRD + H+G R+ SDGDGIS+FG+S++WID
Sbjct  192  NGAQITMQFVKNIIIHGLHIRKTKAGKGGMIRDSVSHYGFRSSSDGDGISMFGASHIWID  251

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM  C DGLIDA+  STAIT+SN HFT  + VML GA+D   +D IMQ+T+AFNHFGK
Sbjct  252  HVSMSGCQDGLIDAVMGSTAITVSNSHFTHQDHVMLLGASDGHPQDSIMQVTVAFNHFGK  311

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
            +L+QRMPR RFG+ HVVNNDYTHW MYAIGGS  PTI+SQGNRF+A +  H +++T R  
Sbjct  312  QLVQRMPRVRFGFAHVVNNDYTHWLMYAIGGSQHPTILSQGNRFLASNSHHSKEVTKRDS  371

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            +    WK W WRSE D+ M GAFFV+SG  D    + +  D +     +  + +TRF+GA
Sbjct  372  SPQSVWKTWNWRSEMDLMMNGAFFVESGS-DVRNVNRQ--DVIPAKPGKFASQMTRFSGA  428

Query  227  LNCRVGSPC  201
            LNC V  PC
Sbjct  429  LNCYVNKPC  437



>ref|XP_010683249.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=444

 Score =   262 bits (670),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 156/252 (62%), Positives = 185/252 (73%), Gaps = 10/252 (4%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAGITIQF+KNVIIHG+HIH I+ G+GGLIRD  +HFGLRT+SDGD ISIFG+SN+WIDH
Sbjct  199  GAGITIQFIKNVIIHGLHIHQIYPGDGGLIRDSANHFGLRTRSDGDAISIFGASNIWIDH  258

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM    DGLID I+ STAITISN H TDHN+V LFGA +  T D+ MQ+T+AFNHFGK 
Sbjct  259  VSMARGTDGLIDIIQGSTAITISNCHMTDHNEVFLFGATNDYTDDQKMQVTVAFNHFGKG  318

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPR RFG+IHVVNNDYTHW MYAIGGS  PTIISQGNRF+AP +   +++T R   
Sbjct  319  LVQRMPRARFGFIHVVNNDYTHWQMYAIGGSQHPTIISQGNRFVAPFNPFAKEVTKR--E  376

Query  404  APE-QWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKA---EDVTWLTRF  237
            APE +WK WTW S+ D ++ GAFF  SG  + +   N+     Q F A     V  LTR 
Sbjct  377  APESEWKSWTWLSDKDWFLNGAFFRDSGRGNAIDSKNK----AQMFSAMAGTKVGELTRC  432

Query  236  AGALNCRVGSPC  201
            +G   C  G PC
Sbjct  433  SGPRKCTPGKPC  444



>dbj|BAJ99909.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score =   258 bits (658),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 141/249 (57%), Positives = 181/249 (73%), Gaps = 2/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +G G+TIQ   NVIIH +H+H I   +GG +    +H  +RT++DGDG+SIF ++NVW+D
Sbjct  56   NGGGLTIQHQNNVIIHNLHVHDIKHTDGGNVSLAANHATIRTRADGDGVSIFNATNVWVD  115

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            H+SM  C DG+ID + ASTAITISN H T+HNDVMLFGA+D   +DK+MQ+T+AFNHFG+
Sbjct  116  HLSMALCEDGMIDVVAASTAITISNCHLTNHNDVMLFGADDNKPEDKVMQVTVAFNHFGR  175

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L+QRMPRCR+G+ HVVNNDYTHW MYAIGGSS+PTIISQGNR+IAP ++  +Q+T R  
Sbjct  176  GLVQRMPRCRYGFFHVVNNDYTHWLMYAIGGSSEPTIISQGNRYIAPPNMAAKQVTKRDY  235

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A    WK W WRSEGD+ M  AFF  SG     K + +  D ++    E VT LTRF+G 
Sbjct  236  APEAVWKNWVWRSEGDLMMNNAFFQTSGGQISQKLNGK--DLIKPKPGEYVTRLTRFSGT  293

Query  227  LNCRVGSPC  201
            L C+ G  C
Sbjct  294  LACKPGCAC  302



>ref|XP_002436463.1| hypothetical protein SORBIDRAFT_10g003080 [Sorghum bicolor]
 gb|EER87830.1| hypothetical protein SORBIDRAFT_10g003080 [Sorghum bicolor]
Length=465

 Score =   262 bits (670),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 143/248 (58%), Positives = 184/248 (74%), Gaps = 2/248 (1%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GA IT+Q V+NVI+H +HIH      GG+IRD   H+GLR +SDGDG+S+ GSS++WIDH
Sbjct  220  GAQITLQNVRNVILHNLHIHDAAPRGGGVIRDSKHHWGLRGESDGDGVSVMGSSDIWIDH  279

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSMR+C DGL+D ++ STA+TISNGHFT H+ VMLFGA+D + KDK MQ+T+AFNHFGK 
Sbjct  280  VSMRSCADGLVDVVDGSTAVTISNGHFTRHDHVMLFGASDAAVKDKAMQVTVAFNHFGKG  339

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L+QRMPRCR G+ HVVNNDYTHW MYAIGGS +PTIISQGNRF A  D   +++T R   
Sbjct  340  LVQRMPRCRHGFFHVVNNDYTHWLMYAIGGSQNPTIISQGNRFRAVDDGRFKEVTKREYT  399

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
               ++K W W+S+ D+++ GAFF QSG  +  ++  +  D +Q    +    LTR+AGAL
Sbjct  400  PYSEYKDWVWKSQDDLFLNGAFFNQSGGEN--ERRFDRLDLIQAKGGQYAELLTRYAGAL  457

Query  224  NCRVGSPC  201
            NCRVG  C
Sbjct  458  NCRVGKKC  465



>ref|XP_006439649.1| hypothetical protein CICLE_v10020193mg [Citrus clementina]
 gb|ESR52889.1| hypothetical protein CICLE_v10020193mg [Citrus clementina]
Length=437

 Score =   261 bits (667),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 144/249 (58%), Positives = 181/249 (73%), Gaps = 3/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GA IT+QFVKN+IIHG+HI     G GG+IRD + H G R+ SDGDGIS+FG+S++WID
Sbjct  192  NGAQITMQFVKNIIIHGLHIRKTKAGKGGMIRDSVSHHGFRSSSDGDGISMFGASHIWID  251

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM  C DGLIDA+  STAIT+SN HFT  + VML GA+D   +D IMQ+T+AFNHFGK
Sbjct  252  HVSMSGCQDGLIDAVMGSTAITVSNSHFTHQDHVMLLGASDSHPQDSIMQVTVAFNHFGK  311

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
            +L+QRMPR RFG+ HVVNNDYTHW MYAIGGS  PTI+SQGNRF+A +  H +++T R  
Sbjct  312  QLVQRMPRVRFGFAHVVNNDYTHWLMYAIGGSQHPTILSQGNRFLASNSHHSKEVTKRDS  371

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            +    WK W WRSE D+ M GAFFV+SG  D    + +  D +     +  + +TRF+GA
Sbjct  372  SPQSVWKTWNWRSEMDLMMNGAFFVESGS-DVRNVNRQ--DVIPAKPGKFASQMTRFSGA  428

Query  227  LNCRVGSPC  201
            LNC V  PC
Sbjct  429  LNCYVNKPC  437



>dbj|BAK06965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   261 bits (667),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 181/249 (73%), Gaps = 2/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            DGA +T+Q+  NVIIH IH++ +  G GG IRD   H G RT+SDGDG+S+FGS+NVW+D
Sbjct  198  DGAQVTVQYSHNVIIHNIHVNDLIVGKGGRIRDSPQHAGFRTQSDGDGVSVFGSTNVWLD  257

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            H+S+  C DGLID I  +T +TISN H T+HNDVMLFG++D + KD+IMQ+T+AFNHFG+
Sbjct  258  HLSLATCQDGLIDVIAEATGVTISNCHLTNHNDVMLFGSSDSNPKDQIMQVTVAFNHFGR  317

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
             L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS +PTIISQGNR+IAP ++  + IT R+G
Sbjct  318  GLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKNPTIISQGNRYIAPPNLAAKLITKRLG  377

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            A+  +WK W W S+ D+ +  A F  SG  +  K   +  D +       VT LTRFAG 
Sbjct  378  ASEAEWKNWVWHSQDDLLLNDAVFADSGGANERKFDKD--DLITPKPGSYVTRLTRFAGC  435

Query  227  LNCRVGSPC  201
            L C+ G PC
Sbjct  436  LPCKPGKPC  444



>ref|XP_004228388.1| PREDICTED: pectate lyase [Solanum lycopersicum]
Length=439

 Score =   261 bits (667),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 147/248 (59%), Positives = 177/248 (71%), Gaps = 0/248 (0%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG+ IQFV NVIIH I I +I   NGG+IRD ++H GLRT SDGDGISIFGS+++WIDH
Sbjct  192  GAGLMIQFVHNVIIHNIRIQNIISTNGGMIRDSINHIGLRTVSDGDGISIFGSNHIWIDH  251

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
             ++  C DGLIDAI ASTAITISN  F  HNDVML GA D   +D IMQ+T+AFN FG+ 
Sbjct  252  CTLSECTDGLIDAIMASTAITISNCKFNYHNDVMLLGATDAFPQDAIMQVTVAFNRFGEG  311

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            LIQRMPRCR+G+ HVVNNDYTHW MYAIGGS+ PTIISQGNRF A  + + +Q+T R  A
Sbjct  312  LIQRMPRCRWGFFHVVNNDYTHWQMYAIGGSAHPTIISQGNRFKASDNPNTKQVTKRDYA  371

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGAL  225
               +WK+W W SEGD ++ GA+FV+SG  D  K        ++         LTRFAG L
Sbjct  372  TESEWKKWQWVSEGDSFLNGAYFVESGPQDKKKTALTKNHKIKFKPGSHAGRLTRFAGVL  431

Query  224  NCRVGSPC  201
             C+ G PC
Sbjct  432  KCKPGIPC  439



>emb|CBI15265.3| unnamed protein product [Vitis vinifera]
Length=398

 Score =   259 bits (663),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 149/194 (77%), Gaps = 3/194 (2%)
 Frame = -2

Query  782  NVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAF  603
            N+WIDH+SM NC DGLIDAI ASTAITISN HFT HN+VMLFGA+D  + D IMQITI F
Sbjct  208  NIWIDHISMSNCADGLIDAIMASTAITISNCHFTHHNEVMLFGASDGYSGDAIMQITITF  267

Query  602  NHFGKRLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQI  423
            NHFG+ L QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTI+SQGNRFIAP DI+ +++
Sbjct  268  NHFGQGLTQRMPRCRWGFFHVVNNDYTHWLMYAIGGSHHPTILSQGNRFIAPPDINCKEV  327

Query  422  THRVGAAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLT  243
            T R  +    WK WTWRS+GD+ M GAFFV+SGDP+F   +  +   ++      VT LT
Sbjct  328  TKRDYSPESVWKSWTWRSQGDLMMNGAFFVESGDPNFDFSNKYV---IRAKPGAFVTRLT  384

Query  242  RFAGALNCRVGSPC  201
            RF+GAL+CR G PC
Sbjct  385  RFSGALSCREGMPC  398



>gb|KDO76053.1| hypothetical protein CISIN_1g013757mg [Citrus sinensis]
Length=437

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 144/249 (58%), Positives = 181/249 (73%), Gaps = 3/249 (1%)
 Frame = -2

Query  947  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  768
            +GA IT+QFVKN+IIHG+HI     G GG+IRD + H G R+ SDGDGIS+FG+S++WID
Sbjct  192  NGAQITMQFVKNIIIHGLHIRKTKAGKGGMIRDSVSHHGFRSSSDGDGISMFGASHIWID  251

Query  767  HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGK  588
            HVSM  C DGLIDA+  STAIT+SN HFT  + VML GA+D   +D IMQ+T+AFNHFGK
Sbjct  252  HVSMSGCQDGLIDAVMGSTAITVSNSHFTHQDHVMLLGASDGHPQDSIMQVTVAFNHFGK  311

Query  587  RLIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVG  408
            +L+QRMPR RFG+ HVVNNDYTHW MYAIGGS  PTI+SQGNRF+A +  H +++T R  
Sbjct  312  QLVQRMPRVRFGFAHVVNNDYTHWLMYAIGGSQHPTILSQGNRFLASNSHHSKEVTKRDS  371

Query  407  AAPEQWKQWTWRSEGDIYMGGAFFVQSGDPDFMKKHNELYDGVQTFKAEDVTWLTRFAGA  228
            +    WK W WRSE D+ M GAFFV+SG  D    + +  D +     +  + +TRF+GA
Sbjct  372  SPQSVWKTWNWRSEMDLMMNGAFFVESGS-DVRNVNRQ--DVIPAKPGKFASQMTRFSGA  428

Query  227  LNCRVGSPC  201
            LNC V  PC
Sbjct  429  LNCYVNKPC  437



>ref|XP_006292606.1| hypothetical protein CARUB_v10018855mg [Capsella rubella]
 gb|EOA25504.1| hypothetical protein CARUB_v10018855mg [Capsella rubella]
Length=455

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 149/252 (59%), Positives = 180/252 (71%), Gaps = 4/252 (2%)
 Frame = -2

Query  944  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  765
            GAG+T+QFV+NVIIH I+I  I +G GGLIRD   HFGLRT SDGDGI+IFG++NVWIDH
Sbjct  204  GAGLTLQFVRNVIIHNIYIKQIKKGAGGLIRDSEHHFGLRTVSDGDGINIFGATNVWIDH  263

Query  764  VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITIAFNHFGKR  585
            VSM +C DG+IDAI  STAITISN HFTDH++VMLFG  +    DK MQIT+AFNHFGKR
Sbjct  264  VSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGTNKDVIDKKMQITVAFNHFGKR  323

Query  584  LIQRMPRCRFGYIHVVNNDYTHWNMYAIGGSSDPTIISQGNRFIAPSDIHKRQITHRVGA  405
            L QRMPR R+G +HVVNNDYTHW MYAIGG+ +PTIISQGNRFIAP     +Q+T R   
Sbjct  324  LKQRMPRVRYGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPIEDSKQVTKREYT  383

Query  404  APEQWKQWTWRSEGDIYMGGAFFVQSGDPDF--MKKHNELYD--GVQTFKAEDVTWLTRF  237
               +WK W W+SE D ++ GA+FVQSG  +       N +     ++      V  LT+ 
Sbjct  384  PYPEWKTWNWQSEKDYFLNGAYFVQSGKANAWSTAPKNPIPRKFAIRPQPGTKVRRLTKD  443

Query  236  AGALNCRVGSPC  201
            AG L C+ G  C
Sbjct  444  AGTLGCKPGKSC  455



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2071794642481