BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25646_g3_i2 len=1816 path=[4971:0-86 5058:87-288 5260:289-336
4802:337-371 22435:372-384 5353:385-416 4344:417-455 5423:456-458
5426:459-536 5504:537-560 5528:561-599 5567:600-632 5599:633-664
1004:665-713 5678:714-720 1060:721-1056 417:1057-1094 6054:1095-1132
6091:1133-1146 22744:1147-1166 6124:1167-1208 6165:1209-1287
2464:1288-1314 6270:1315-1335 6291:1336-1377 6333:1378-1500
6456:1501-1543 6498:1544-1581 1123:1582-1610 18760:1611-1672
22388:1673-1673 18822:1674-1739 18888:1740-1763 18912:1764-1815]

Length=1816
                                                                      Score     E

ref|XP_009599825.1|  PREDICTED: probable pectate lyase P59 isofor...    589   0.0      
ref|XP_009779191.1|  PREDICTED: probable pectate lyase P59              588   0.0      
ref|XP_009599826.1|  PREDICTED: probable pectate lyase P59 isofor...    586   0.0      
ref|XP_004234779.1|  PREDICTED: probable pectate lyase P59              585   0.0      
ref|XP_006361835.1|  PREDICTED: probable pectate lyase P59-like         582   0.0      
ref|XP_006357122.1|  PREDICTED: probable pectate lyase P59-like         582   0.0      
sp|P15722.1|PLY59_SOLLC  RecName: Full=Probable pectate lyase P59...    581   0.0      Solanum lycopersicum
ref|XP_009789921.1|  PREDICTED: probable pectate lyase P59              576   0.0      
ref|XP_009587689.1|  PREDICTED: probable pectate lyase P59              575   0.0      
ref|XP_004232242.1|  PREDICTED: probable pectate lyase P59              558   0.0      
ref|XP_009802165.1|  PREDICTED: probable pectate lyase P59              556   0.0      
ref|XP_009617495.1|  PREDICTED: probable pectate lyase P59              556   0.0      
ref|XP_006338480.1|  PREDICTED: probable pectate lyase P59-like         553   0.0      
ref|XP_010317101.1|  PREDICTED: probable pectate lyase P59              547   0.0      
emb|CDP02198.1|  unnamed protein product                                537   0.0      
gb|EPS66620.1|  hypothetical protein M569_08154                         528   2e-179   
ref|XP_011098575.1|  PREDICTED: probable pectate lyase P59              524   7e-178   
ref|XP_007032453.1|  Pectate lyase family protein                       513   2e-173   
ref|XP_007046218.1|  Pectate lyase family protein, putative             510   1e-172   
emb|CAN79927.1|  hypothetical protein VITISV_042447                     507   2e-171   Vitis vinifera
ref|XP_002282500.3|  PREDICTED: pectate lyase                           507   2e-171   Vitis vinifera
emb|CBI22159.3|  unnamed protein product                                507   5e-171   
ref|XP_010256490.1|  PREDICTED: pectate lyase-like                      506   5e-171   
ref|XP_010033216.1|  PREDICTED: pectate lyase-like                      503   5e-170   
ref|XP_008341537.1|  PREDICTED: pectate lyase-like                      500   1e-168   
ref|XP_007037229.1|  Pectate lyase family protein                       497   2e-167   
ref|XP_010112093.1|  putative pectate lyase 7                           495   7e-167   
ref|XP_004165454.1|  PREDICTED: pectate lyase-like                      494   2e-166   
gb|KCW52797.1|  hypothetical protein EUGRSUZ_J02132                     494   3e-166   
ref|XP_008357758.1|  PREDICTED: pectate lyase-like                      494   3e-166   
ref|XP_010066949.1|  PREDICTED: pectate lyase                           493   4e-166   
ref|XP_009342871.1|  PREDICTED: pectate lyase-like                      492   2e-165   
ref|XP_010242445.1|  PREDICTED: pectate lyase                           491   4e-165   
ref|XP_009369346.1|  PREDICTED: pectate lyase-like                      490   9e-165   
gb|KHG08055.1|  putative pectate lyase P59                              489   2e-164   
gb|EYU34111.1|  hypothetical protein MIMGU_mgv1a006386mg                489   2e-164   
ref|XP_008374522.1|  PREDICTED: pectate lyase-like                      486   3e-163   
ref|XP_002311599.2|  pectate lyase family protein                       486   4e-163   Populus trichocarpa [western balsam poplar]
gb|EYU36839.1|  hypothetical protein MIMGU_mgv1a006379mg                485   7e-163   
ref|XP_002323835.1|  hypothetical protein POPTR_0017s11450g             485   9e-163   Populus trichocarpa [western balsam poplar]
ref|XP_007227702.1|  hypothetical protein PRUPE_ppa005744mg             485   1e-162   
emb|CDP14850.1|  unnamed protein product                                484   1e-162   
ref|XP_011005067.1|  PREDICTED: probable pectate lyase P59              484   1e-162   
ref|XP_010068708.1|  PREDICTED: pectate lyase-like                      484   2e-162   
gb|KHG16093.1|  hypothetical protein F383_07683                         483   7e-162   
ref|XP_010105747.1|  putative pectate lyase P59                         481   2e-161   
ref|XP_002272638.2|  PREDICTED: pectate lyase-like                      481   2e-161   Vitis vinifera
ref|XP_004155392.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    480   3e-161   
ref|XP_004135462.1|  PREDICTED: probable pectate lyase P59-like         480   4e-161   
ref|XP_002270089.1|  PREDICTED: pectate lyase                           480   5e-161   Vitis vinifera
ref|XP_007153840.1|  hypothetical protein PHAVU_003G069100g             480   7e-161   
ref|XP_011025954.1|  PREDICTED: probable pectate lyase P59              480   8e-161   
ref|XP_004152537.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    479   1e-160   
ref|XP_002520133.1|  Pectate lyase precursor, putative                  479   2e-160   Ricinus communis
ref|XP_009381244.1|  PREDICTED: pectate lyase-like                      478   3e-160   
ref|XP_011013803.1|  PREDICTED: pectate lyase-like                      477   6e-160   
ref|XP_008446316.1|  PREDICTED: probable pectate lyase P59              476   3e-159   
ref|XP_010678579.1|  PREDICTED: pectate lyase-like                      476   3e-159   
ref|XP_010528323.1|  PREDICTED: probable pectate lyase 19               475   7e-159   
ref|XP_008239834.1|  PREDICTED: pectate lyase-like                      474   2e-158   
ref|XP_006374492.1|  hypothetical protein POPTR_0015s07590g             473   3e-158   
ref|XP_007209148.1|  hypothetical protein PRUPE_ppa005859mg             473   3e-158   
ref|XP_009403112.1|  PREDICTED: pectate lyase-like                      472   9e-158   
gb|AES91206.2|  pectate lyase P59-like protein                          471   2e-157   
ref|XP_006842121.1|  hypothetical protein AMTR_s00078p00106380          470   5e-157   
ref|XP_009408830.1|  PREDICTED: pectate lyase-like                      469   8e-157   
ref|XP_008365507.1|  PREDICTED: pectate lyase-like                      467   1e-156   
gb|KHN08855.1|  Putative pectate lyase P59                              468   2e-156   
ref|XP_008446067.1|  PREDICTED: pectate lyase-like                      466   2e-156   
ref|XP_004302354.1|  PREDICTED: probable pectate lyase P59-like         468   3e-156   
ref|XP_010550068.1|  PREDICTED: probable pectate lyase 19               469   5e-156   
ref|XP_009360393.1|  PREDICTED: probable pectate lyase 3                468   6e-156   
ref|XP_006354795.1|  PREDICTED: pectate lyase-like                      467   6e-156   
gb|KHG07401.1|  putative pectate lyase P59                              467   8e-156   
ref|XP_009615547.1|  PREDICTED: probable pectate lyase P59              466   2e-155   
ref|XP_002306040.1|  hypothetical protein POPTR_0004s12300g             466   2e-155   Populus trichocarpa [western balsam poplar]
ref|XP_009389712.1|  PREDICTED: pectate lyase-like                      466   2e-155   
ref|XP_004147462.1|  PREDICTED: probable pectate lyase 7-like           465   3e-155   
ref|XP_008339935.1|  PREDICTED: probable pectate lyase 3                466   4e-155   
ref|XP_004490003.1|  PREDICTED: probable pectate lyase 3-like iso...    466   4e-155   
gb|KGN59593.1|  hypothetical protein Csa_3G827350                       465   6e-155   
ref|XP_008366366.1|  PREDICTED: pectate lyase-like                      466   8e-155   
ref|XP_008456459.1|  PREDICTED: pectate lyase-like                      464   9e-155   
ref|XP_011009454.1|  PREDICTED: pectate lyase-like                      465   2e-154   
ref|XP_011085780.1|  PREDICTED: probable pectate lyase P59              463   3e-154   
ref|XP_003609009.1|  Pectate lyase                                      463   4e-154   
ref|XP_008221660.1|  PREDICTED: probable pectate lyase 3                462   1e-153   
ref|XP_011085777.1|  PREDICTED: probable pectate lyase P59              461   1e-153   
ref|XP_008793504.1|  PREDICTED: pectate lyase-like                      461   2e-153   
ref|XP_003530685.1|  PREDICTED: probable pectate lyase 3-like           461   2e-153   
ref|XP_003519771.2|  PREDICTED: probable pectate lyase 3-like           461   3e-153   
ref|XP_008443432.1|  PREDICTED: probable pectate lyase 19               460   3e-153   
gb|KHN01171.1|  Putative pectate lyase 3                                460   4e-153   
gb|KHN08706.1|  Putative pectate lyase 3                                460   4e-153   
ref|XP_006573090.1|  PREDICTED: probable pectate lyase 3-like           460   6e-153   
ref|XP_009761969.1|  PREDICTED: probable pectate lyase P59              459   6e-153   
ref|XP_009788285.1|  PREDICTED: pectate lyase-like                      459   7e-153   
ref|XP_002270112.1|  PREDICTED: pectate lyase                           459   7e-153   Vitis vinifera
ref|XP_008389523.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    460   8e-153   
emb|CAN69904.1|  hypothetical protein VITISV_001006                     459   1e-152   Vitis vinifera
ref|XP_007138209.1|  hypothetical protein PHAVU_009G189800g             458   3e-152   
ref|XP_007224275.1|  hypothetical protein PRUPE_ppa019055mg             458   3e-152   
ref|XP_009598230.1|  PREDICTED: pectate lyase-like                      457   5e-152   
ref|XP_011087217.1|  PREDICTED: pectate lyase-like                      456   9e-152   
ref|XP_004146792.1|  PREDICTED: probable pectate lyase P59-like         457   9e-152   
ref|XP_004162547.1|  PREDICTED: probable pectate lyase P59-like         456   1e-151   
ref|XP_010925369.1|  PREDICTED: pectate lyase                           456   2e-151   
ref|XP_008221658.1|  PREDICTED: pectate lyase-like                      456   2e-151   
ref|XP_010915114.1|  PREDICTED: LOW QUALITY PROTEIN: pectate lyas...    454   8e-151   
gb|KDP45476.1|  hypothetical protein JCGZ_09725                         454   1e-150   
ref|XP_004490004.1|  PREDICTED: probable pectate lyase 3-like iso...    451   1e-150   
ref|XP_008339934.1|  PREDICTED: probable pectate lyase 3                454   1e-150   
ref|XP_004236194.1|  PREDICTED: probable pectate lyase P59              453   2e-150   
ref|XP_002871648.1|  pectate lyase family protein                       454   3e-150   
ref|XP_008230729.1|  PREDICTED: pectate lyase                           452   6e-150   
gb|KHG05193.1|  hypothetical protein F383_30875                         449   9e-150   
gb|KHG23093.1|  hypothetical protein F383_29772                         449   9e-150   
ref|XP_004508770.1|  PREDICTED: probable pectate lyase P59-like         451   1e-149   
ref|XP_002511525.1|  Pectate lyase precursor, putative                  451   1e-149   Ricinus communis
ref|XP_006344502.1|  PREDICTED: probable pectate lyase P59-like         451   1e-149   
ref|NP_001057945.1|  Os06g0583900                                       451   2e-149   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007157384.1|  hypothetical protein PHAVU_002G065800g             451   2e-149   
ref|XP_009117903.1|  PREDICTED: probable pectate lyase 3                451   3e-149   
ref|XP_007215366.1|  hypothetical protein PRUPE_ppa005602mg             450   4e-149   
ref|XP_002892805.1|  hypothetical protein ARALYDRAFT_471616             451   4e-149   
emb|CAN77957.1|  hypothetical protein VITISV_021245                     448   7e-149   Vitis vinifera
sp|Q9LFP5.1|PLY19_ARATH  RecName: Full=Probable pectate lyase 19;...    450   8e-149   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010420164.1|  PREDICTED: probable pectate lyase 19 isoform X2    450   1e-148   
ref|XP_006306515.1|  hypothetical protein CARUB_v10012514mg             449   2e-148   
ref|XP_006477525.1|  PREDICTED: pectate lyase-like                      448   2e-148   
ref|NP_197015.4|  putative pectate lyase 19                             449   2e-148   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28696.1|  unknown                                                 449   2e-148   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010527872.1|  PREDICTED: probable pectate lyase 3 isoform X2     449   2e-148   
gb|KEH19822.1|  pectate lyase-like protein                              448   4e-148   
ref|XP_009121613.1|  PREDICTED: probable pectate lyase 19               449   5e-148   
ref|XP_010551866.1|  PREDICTED: probable pectate lyase 19               448   5e-148   
ref|XP_004514773.1|  PREDICTED: probable pectate lyase 3-like           447   6e-148   
ref|XP_010496063.1|  PREDICTED: probable pectate lyase 3                447   6e-148   
ref|XP_010513594.1|  PREDICTED: probable pectate lyase 7                447   1e-147   
ref|XP_010476496.1|  PREDICTED: probable pectate lyase 3                446   2e-147   
gb|AAB69759.1|  putative pectate lyase                                  446   2e-147   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172894.1|  putative pectate lyase 3                              446   2e-147   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008786760.1|  PREDICTED: pectate lyase-like                      446   4e-147   
ref|XP_006439649.1|  hypothetical protein CICLE_v10020193mg             444   4e-147   
ref|XP_010463548.1|  PREDICTED: probable pectate lyase 7                446   5e-147   
gb|AAQ62996.1|  oil palm polygalacturonase allergen PEST361             445   5e-147   Elaeis guineensis
ref|XP_010453638.1|  PREDICTED: probable pectate lyase 19               446   5e-147   
emb|CDY53552.1|  BnaA09g57110D                                          446   5e-147   
ref|XP_010523445.1|  PREDICTED: probable pectate lyase 3                445   7e-147   
emb|CDX70590.1|  BnaC03g06740D                                          445   1e-146   
gb|KDO76053.1|  hypothetical protein CISIN_1g013757mg                   444   1e-146   
ref|XP_009131435.1|  PREDICTED: probable pectate lyase 19               445   1e-146   
emb|CDY66593.1|  BnaCnng51570D                                          446   1e-146   
ref|XP_006428983.1|  hypothetical protein CICLE_v10013750mg             443   1e-146   
ref|XP_011098576.1|  PREDICTED: probable pectate lyase P56              444   2e-146   
ref|XP_010683249.1|  PREDICTED: pectate lyase-like                      443   2e-146   
emb|CDX81636.1|  BnaC08g39650D                                          444   2e-146   
ref|XP_006480843.1|  PREDICTED: probable pectate lyase 19-like          442   3e-146   
ref|XP_010485518.1|  PREDICTED: probable pectate lyase 7                443   4e-146   
ref|XP_003552513.1|  PREDICTED: pectate lyase-like                      442   5e-146   
gb|KHN13652.1|  Pectate lyase                                           441   8e-146   
ref|XP_010670318.1|  PREDICTED: pectate lyase-like                      441   1e-145   
emb|CDX91953.1|  BnaC03g32550D                                          442   2e-145   
emb|CDX74293.1|  BnaA03g27540D                                          441   2e-145   
ref|XP_006826355.1|  hypothetical protein AMTR_s00004p00123190          441   3e-145   
emb|CDX85564.1|  BnaA02g02490D                                          441   3e-145   
gb|AAQ62997.1|  oil palm polygalacturonase allergen PEST411             440   3e-145   Elaeis guineensis
gb|KDO49230.1|  hypothetical protein CISIN_1g036607mg                   439   3e-145   
ref|XP_006484673.1|  PREDICTED: probable pectate lyase 19-like          439   4e-145   
ref|XP_003613595.1|  Pectate lyase                                      440   4e-145   
ref|XP_006437462.1|  hypothetical protein CICLE_v10031653mg             439   5e-145   
gb|ACU23277.1|  unknown                                                 439   5e-145   Glycine max [soybeans]
ref|XP_003543726.1|  PREDICTED: pectate lyase                           439   6e-145   
emb|CDP00293.1|  unnamed protein product                                439   7e-145   
ref|XP_003613596.1|  Pectate lyase                                      439   1e-144   
dbj|BAK06965.1|  predicted protein                                      439   1e-144   
emb|CDY68729.1|  BnaCnng60280D                                          439   1e-144   
gb|KFK43687.1|  hypothetical protein AALP_AA1G160000                    438   2e-144   
gb|KHN13490.1|  Putative pectate lyase 3                                435   2e-144   
gb|KFK33456.1|  hypothetical protein AALP_AA5G015800                    438   4e-144   
ref|XP_010420163.1|  PREDICTED: probable pectate lyase 19 isoform X1    439   5e-144   
emb|CDX96854.1|  BnaA08g23970D                                          437   5e-144   
ref|XP_006656188.1|  PREDICTED: pectate lyase-like                      437   6e-144   
ref|XP_009134622.1|  PREDICTED: probable pectate lyase 7                437   6e-144   
ref|XP_009110541.1|  PREDICTED: probable pectate lyase 3                437   6e-144   
ref|NP_186776.1|  putative pectate lyase 7                              437   7e-144   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010514040.1|  PREDICTED: probable pectate lyase 6                437   7e-144   
ref|XP_009126031.1|  PREDICTED: probable pectate lyase 19               438   7e-144   
emb|CDY28691.1|  BnaCnng05770D                                          437   8e-144   
gb|AAM60924.1|  putative pectate lyase                                  437   9e-144   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009125036.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    437   9e-144   
ref|XP_003563707.1|  PREDICTED: pectate lyase-like                      436   1e-143   
ref|XP_006286712.1|  hypothetical protein CARUB_v10002862mg             438   1e-143   
ref|XP_010492335.1|  PREDICTED: probable pectate lyase 19               437   2e-143   
emb|CDY09356.1|  BnaA02g26540D                                          436   2e-143   
ref|XP_004966014.1|  PREDICTED: pectate lyase-like                      437   2e-143   
ref|XP_009129128.1|  PREDICTED: probable pectate lyase 6                436   2e-143   
ref|XP_007139601.1|  hypothetical protein PHAVU_008G043600g             434   5e-143   
ref|XP_010425041.1|  PREDICTED: probable pectate lyase 6                434   7e-143   
ref|XP_006299938.1|  hypothetical protein CARUB_v10016149mg             435   9e-143   
gb|KHN13240.1|  Putative pectate lyase 3                                433   1e-142   
ref|XP_010502279.1|  PREDICTED: probable pectate lyase 6                433   2e-142   
ref|XP_009114192.1|  PREDICTED: probable pectate lyase 6                433   2e-142   
emb|CDY04133.1|  BnaA09g19110D                                          433   3e-142   
ref|XP_002437204.1|  hypothetical protein SORBIDRAFT_10g022830          432   3e-142   Sorghum bicolor [broomcorn]
ref|XP_007151201.1|  hypothetical protein PHAVU_004G026400g             432   5e-142   
gb|KEH24975.1|  pectate lyase P59-like protein                          432   5e-142   
gb|EAY99626.1|  hypothetical protein OsI_21605                          431   6e-142   Oryza sativa Indica Group [Indian rice]
ref|XP_006431087.1|  hypothetical protein CICLE_v10011762mg             431   6e-142   
emb|CDY41679.1|  BnaC02g34750D                                          432   7e-142   
emb|CDY45254.1|  BnaA06g09240D                                          431   1e-141   
ref|XP_006482544.1|  PREDICTED: probable pectate lyase 19-like          431   1e-141   
ref|XP_006292606.1|  hypothetical protein CARUB_v10018855mg             431   1e-141   
ref|XP_009148818.1|  PREDICTED: probable pectate lyase 3                431   1e-141   
emb|CDY17432.1|  BnaC09g21050D                                          431   1e-141   
gb|EYU22437.1|  hypothetical protein MIMGU_mgv1a006496mg                431   2e-141   
emb|CDY39314.1|  BnaC05g10650D                                          431   2e-141   
ref|XP_010420165.1|  PREDICTED: probable pectate lyase 19 isoform X3    432   3e-141   
gb|KFK25747.1|  hypothetical protein AALP_AA8G154300                    432   4e-141   
ref|XP_003554335.1|  PREDICTED: pectate lyase-like                      429   4e-141   
emb|CDY63769.1|  BnaCnng42620D                                          430   1e-140   
ref|XP_002882189.1|  pectate lyase family protein                       429   1e-140   
sp|P40973.1|PLY_LILLO  RecName: Full=Pectate lyase; Flags: Precursor    427   1e-140   Lilium longiflorum [Easter lily]
ref|NP_001046281.1|  Os02g0214400                                       427   2e-140   Oryza sativa Japonica Group [Japonica rice]
gb|KFK37588.1|  hypothetical protein AALP_AA3G002600                    428   3e-140   
gb|AAA16476.1|  pectate lyase homolog                                   427   3e-140   Zea mays [maize]
ref|NP_001150723.1|  pectate lyase precursor                            427   3e-140   Zea mays [maize]
gb|AFW87059.1|  pectate lyase                                           427   3e-140   
gb|EYU28712.1|  hypothetical protein MIMGU_mgv1a006498mg                427   4e-140   
ref|XP_002453531.1|  hypothetical protein SORBIDRAFT_04g007450          426   6e-140   Sorghum bicolor [broomcorn]
ref|XP_011086389.1|  PREDICTED: pectate lyase-like                      426   7e-140   
ref|XP_004228388.1|  PREDICTED: pectate lyase                           426   8e-140   
dbj|BAH20311.1|  AT3G01270                                              422   1e-139   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004489168.1|  PREDICTED: pectate lyase-like                      426   1e-139   
ref|XP_004489374.1|  PREDICTED: pectate lyase-like                      425   3e-139   
ref|XP_004298448.1|  PREDICTED: probable pectate lyase 3-like           425   3e-139   
gb|EPS73633.1|  hypothetical protein M569_01123                         425   3e-139   
ref|NP_178375.1|  putative pectate lyase 6                              424   5e-139   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011087066.1|  PREDICTED: pectate lyase                           423   6e-139   
ref|XP_008679844.1|  PREDICTED: pectate lyase                           424   6e-139   
ref|XP_007137422.1|  hypothetical protein PHAVU_009G125800g             424   7e-139   
ref|XP_010096345.1|  putative pectate lyase 7                           422   1e-138   
ref|XP_002437815.1|  hypothetical protein SORBIDRAFT_10g003090          423   1e-138   Sorghum bicolor [broomcorn]
ref|XP_004964534.1|  PREDICTED: pectate lyase-like                      423   1e-138   
ref|XP_009380431.1|  PREDICTED: pectate lyase-like                      422   2e-138   
gb|ACF87417.1|  unknown                                                 422   2e-138   Zea mays [maize]
ref|XP_006363934.1|  PREDICTED: pectate lyase-like                      422   2e-138   
ref|XP_002436463.1|  hypothetical protein SORBIDRAFT_10g003080          423   3e-138   Sorghum bicolor [broomcorn]
ref|XP_011071024.1|  PREDICTED: pectate lyase-like                      422   4e-138   
gb|EAY85003.1|  hypothetical protein OsI_06363                          421   8e-138   Oryza sativa Indica Group [Indian rice]
ref|XP_002875142.1|  pectate lyase family protein                       421   9e-138   
dbj|BAD68402.1|  putative pectate lyase homolog                         421   1e-137   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056781.1|  Os06g0144200                                       421   2e-137   Oryza sativa Japonica Group [Japonica rice]
gb|AGT16687.1|  pectate lyase                                           420   2e-137   
ref|XP_006579282.1|  PREDICTED: probable pectate lyase P59-like         418   3e-137   
ref|XP_011097774.1|  PREDICTED: pectate lyase-like                      419   4e-137   
ref|XP_010527871.1|  PREDICTED: probable pectate lyase 3 isoform X1     427   7e-137   
gb|EPS62426.1|  hypothetical protein M569_12361                         416   2e-136   
gb|KHG08946.1|  Pectate lyase                                           416   3e-136   
ref|XP_004951474.1|  PREDICTED: pectate lyase-like                      414   2e-135   
gb|AAA86241.1|  pectate lyase homolog                                   414   3e-135   Medicago sativa [alfalfa]
ref|XP_009101245.1|  PREDICTED: probable pectate lyase 6                415   4e-135   
ref|XP_003621115.1|  Pectate lyase                                      414   6e-135   
ref|XP_009758350.1|  PREDICTED: pectate lyase-like                      413   9e-135   
emb|CDY45202.1|  BnaA06g34060D                                          414   1e-134   
emb|CDY03043.1|  BnaC07g21840D                                          413   2e-134   
ref|XP_004301165.1|  PREDICTED: probable pectate lyase P59-like         412   3e-134   
ref|XP_006655782.1|  PREDICTED: pectate lyase-like                      408   3e-134   
ref|NP_001150425.1|  LOC100284055 precursor                             411   6e-134   Zea mays [maize]
gb|EAY99621.1|  hypothetical protein OsI_21600                          410   1e-133   Oryza sativa Indica Group [Indian rice]
ref|NP_001056784.1|  Os06g0144900                                       410   2e-133   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009599232.1|  PREDICTED: pectate lyase-like                      410   2e-133   
ref|XP_009587688.1|  PREDICTED: pectate lyase-like                      407   3e-133   
ref|XP_009789922.1|  PREDICTED: pectate lyase-like                      407   3e-133   
ref|XP_006357289.1|  PREDICTED: probable pectate lyase 3-like           409   8e-133   
gb|KDO49831.1|  hypothetical protein CISIN_1g044170mg                   405   1e-132   
ref|XP_009797403.1|  PREDICTED: pectate lyase-like                      407   2e-132   
ref|XP_003571658.1|  PREDICTED: pectate lyase-like                      405   1e-131   
ref|XP_009757256.1|  PREDICTED: pectate lyase                           404   1e-131   
ref|XP_006357121.1|  PREDICTED: pectate lyase-like                      403   1e-131   
ref|NP_001056786.1|  Os06g0145100                                       401   2e-131   
ref|XP_009627245.1|  PREDICTED: pectate lyase-like                      404   4e-131   
dbj|BAK05605.1|  predicted protein                                      403   9e-131   
ref|XP_004233352.1|  PREDICTED: pectate lyase-like                      401   1e-130   
emb|CDP02199.1|  unnamed protein product                                399   1e-130   
gb|KGN47799.1|  hypothetical protein Csa_6G404140                       397   5e-129   
ref|XP_004171543.1|  PREDICTED: probable pectate lyase 15-like          398   7e-129   
ref|XP_004138973.1|  PREDICTED: probable pectate lyase 15-like          398   8e-129   
ref|XP_008460726.1|  PREDICTED: probable pectate lyase 8 isoform X1     398   9e-129   
ref|XP_008460728.1|  PREDICTED: probable pectate lyase 1 isoform X3     395   1e-128   
ref|XP_010450167.1|  PREDICTED: probable pectate lyase 15 isoform X1    397   2e-128   
ref|XP_010450168.1|  PREDICTED: probable pectate lyase 15 isoform X2    397   2e-128   
ref|XP_008460727.1|  PREDICTED: probable pectate lyase 1 isoform X2     396   2e-128   
ref|XP_010435229.1|  PREDICTED: probable pectate lyase 15               397   2e-128   
ref|XP_010440536.1|  PREDICTED: probable pectate lyase 15 isoform X2    397   4e-128   
ref|XP_010440534.1|  PREDICTED: probable pectate lyase 15 isoform X1    397   4e-128   
dbj|BAF43573.1|  pectate lyase                                          394   2e-127   
ref|XP_004234780.1|  PREDICTED: probable pectate lyase P56              393   2e-127   
ref|XP_007222160.1|  hypothetical protein PRUPE_ppa005761mg             394   2e-127   
ref|XP_006852264.1|  hypothetical protein AMTR_s00049p00173370          392   5e-127   
gb|EMS45831.1|  Pectate lyase                                           397   5e-127   
ref|XP_006282594.1|  hypothetical protein CARUB_v10004736mg             394   9e-127   
ref|XP_002870357.1|  pectate lyase family protein                       394   1e-126   
gb|AAK66161.1|  pectate lyase                                           389   1e-126   
ref|XP_008438392.1|  PREDICTED: probable pectate lyase 8                392   1e-126   
ref|XP_006361836.1|  PREDICTED: probable pectate lyase P56-like         390   2e-126   
ref|XP_004289729.1|  PREDICTED: probable pectate lyase 15-like          392   2e-126   
gb|EYU30593.1|  hypothetical protein MIMGU_mgv1a007569mg                390   2e-126   
ref|XP_008391438.1|  PREDICTED: probable pectate lyase 8                392   2e-126   
ref|XP_009586995.1|  PREDICTED: probable pectate lyase 5                390   2e-126   
ref|NP_567409.1|  probable pectate lyase 15                             392   3e-126   
ref|XP_008360481.1|  PREDICTED: probable pectate lyase 8                391   3e-126   
emb|CDY18738.1|  BnaC08g08780D                                          392   3e-126   
ref|XP_004134015.1|  PREDICTED: probable pectate lyase 15-like          390   5e-126   
ref|NP_001190720.1|  probable pectate lyase 15                          391   5e-126   
ref|XP_011086987.1|  PREDICTED: probable pectate lyase 22               389   5e-126   
emb|CAB36835.1|  putative pectate lyase A11 (fragment)                  388   5e-126   
ref|XP_008223974.1|  PREDICTED: probable pectate lyase 8                390   6e-126   
gb|KHG22755.1|  hypothetical protein F383_29653                         389   6e-126   
ref|XP_009107745.1|  PREDICTED: probable pectate lyase 15               390   7e-126   
ref|XP_009362042.1|  PREDICTED: probable pectate lyase 8                390   7e-126   
emb|CDY53564.1|  BnaC04g55760D                                          390   8e-126   
ref|XP_007037815.1|  Pectin lyase-like superfamily protein isoform 1    388   1e-125   
gb|KHG06252.1|  hypothetical protein F383_10745                         389   2e-125   
gb|EMT27253.1|  hypothetical protein F775_20306                         386   2e-125   
gb|KHG30349.1|  hypothetical protein F383_15991                         390   3e-125   
dbj|BAK06362.1|  predicted protein                                      389   3e-125   
ref|XP_006341783.1|  PREDICTED: probable pectate lyase 5-like           387   4e-125   
ref|XP_010935686.1|  PREDICTED: probable pectate lyase 8 isoform X2     387   4e-125   
ref|XP_010935685.1|  PREDICTED: probable pectate lyase 8 isoform X1     389   4e-125   
ref|XP_009599824.1|  PREDICTED: pectate lyase                           387   4e-125   
gb|AAX88800.1|  ripening-related pectate lyase                          388   5e-125   
ref|XP_010527219.1|  PREDICTED: probable pectate lyase 10               386   5e-125   
ref|XP_011072008.1|  PREDICTED: probable pectate lyase 18               387   6e-125   
ref|XP_009804979.1|  PREDICTED: probable pectate lyase 5                386   6e-125   
ref|XP_010532870.1|  PREDICTED: putative pectate lyase 14               387   7e-125   
ref|XP_010239620.1|  PREDICTED: probable pectate lyase 8 isoform X2     387   7e-125   
gb|AEN70981.1|  pectate lyase                                           386   8e-125   
ref|XP_002884619.1|  pectate lyase family protein                       386   1e-124   
emb|CDY01151.1|  BnaA04g06680D                                          387   1e-124   
ref|XP_009139602.1|  PREDICTED: probable pectate lyase 15               387   1e-124   
ref|XP_007034463.1|  Pectin lyase-like superfamily protein              387   1e-124   
gb|AEN70985.1|  pectate lyase                                           385   1e-124   
ref|XP_010320956.1|  PREDICTED: probable pectate lyase 5                385   1e-124   
ref|XP_002304700.1|  pectate lyase family protein                       387   1e-124   
ref|XP_009397895.1|  PREDICTED: probable pectate lyase 8                387   2e-124   
ref|XP_008667903.1|  PREDICTED: pectate lyase 8 isoform X1              388   2e-124   
gb|AEN70964.1|  pectate lyase                                           385   2e-124   
gb|AEN70963.1|  pectate lyase                                           385   2e-124   
gb|ADB90475.1|  pectate lyase                                           385   2e-124   
ref|XP_010239619.1|  PREDICTED: probable pectate lyase 8 isoform X1     387   2e-124   
emb|CDP16631.1|  unnamed protein product                                385   2e-124   
ref|XP_010532807.1|  PREDICTED: probable pectate lyase 15               387   2e-124   
gb|KHG19997.1|  hypothetical protein F383_02891                         385   2e-124   
ref|XP_009370039.1|  PREDICTED: probable pectate lyase 8                386   2e-124   
ref|XP_011020694.1|  PREDICTED: probable pectate lyase 8                386   3e-124   
ref|XP_010106682.1|  hypothetical protein L484_004616                   384   3e-124   
ref|XP_003535958.1|  PREDICTED: probable pectate lyase 1-like           386   3e-124   
ref|XP_010672089.1|  PREDICTED: probable pectate lyase 1                385   3e-124   
gb|AEN70984.1|  pectate lyase                                           385   4e-124   
ref|XP_009406385.1|  PREDICTED: probable pectate lyase 18               384   4e-124   
ref|XP_003555714.2|  PREDICTED: probable pectate lyase 1-like           387   4e-124   
ref|XP_009385867.1|  PREDICTED: probable pectate lyase 8 isoform X2     386   4e-124   
emb|CBI33346.3|  unnamed protein product                                385   4e-124   
gb|AAF19196.1|AF206320_1  pectate lyase 2                               386   4e-124   
ref|XP_008800563.1|  PREDICTED: probable pectate lyase 8 isoform X1     386   5e-124   
ref|XP_006360328.1|  PREDICTED: probable pectate lyase 15-like          386   5e-124   
ref|XP_010264036.1|  PREDICTED: probable pectate lyase 8                385   6e-124   
ref|XP_008800564.1|  PREDICTED: probable pectate lyase 8 isoform X2     386   6e-124   
ref|XP_010250930.1|  PREDICTED: probable pectate lyase 5                384   6e-124   
gb|KDP33375.1|  hypothetical protein JCGZ_12924                         385   6e-124   
ref|XP_010464311.1|  PREDICTED: probable pectate lyase 8                384   7e-124   
gb|ADB90476.1|  pectate lyase                                           384   7e-124   
ref|NP_187357.1|  putative pectate lyase 8                              384   7e-124   
ref|XP_004152502.1|  PREDICTED: probable pectate lyase 22-like          384   8e-124   
ref|XP_010023767.1|  PREDICTED: probable pectate lyase 8 isoform X1     385   8e-124   
ref|XP_004501839.1|  PREDICTED: probable pectate lyase 5-like           384   9e-124   
ref|XP_004157771.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    384   9e-124   
ref|XP_011091390.1|  PREDICTED: probable pectate lyase 8                385   9e-124   
gb|AAY85180.1|  pectate lyase                                           384   1e-123   
ref|XP_006487597.1|  PREDICTED: probable pectate lyase 1-like           385   1e-123   
ref|XP_010243989.1|  PREDICTED: probable pectate lyase 8                385   1e-123   
ref|XP_010684949.1|  PREDICTED: probable pectate lyase 8                385   1e-123   
ref|XP_003523121.1|  PREDICTED: probable pectate lyase 18-like          383   1e-123   
ref|XP_009385866.1|  PREDICTED: probable pectate lyase 8 isoform X1     386   1e-123   
ref|XP_007145412.1|  hypothetical protein PHAVU_007G236800g             385   1e-123   
ref|XP_002297822.1|  pectate lyase family protein                       385   1e-123   
ref|XP_010023768.1|  PREDICTED: probable pectate lyase 1 isoform X2     384   1e-123   
ref|XP_010447044.1|  PREDICTED: probable pectate lyase 8                383   2e-123   
ref|XP_002863927.1|  pectate lyase family protein                       383   2e-123   
ref|XP_011086701.1|  PREDICTED: probable pectate lyase 5                382   2e-123   
dbj|BAB10313.1|  pectate lyase                                          382   2e-123   
ref|XP_010439830.1|  PREDICTED: probable pectate lyase 20               383   2e-123   
ref|NP_001147553.1|  pectate lyase 8                                    385   2e-123   
ref|XP_002285340.1|  PREDICTED: probable pectate lyase 5                382   2e-123   
ref|XP_002285639.2|  PREDICTED: probable pectate lyase 8                385   2e-123   
ref|NP_568705.1|  putative pectate lyase 20                             383   2e-123   
ref|XP_004247823.1|  PREDICTED: probable pectate lyase 8                384   2e-123   
ref|XP_008339288.1|  PREDICTED: probable pectate lyase 8                384   2e-123   
ref|XP_010486231.1|  PREDICTED: probable pectate lyase 8                383   2e-123   
gb|ACB12931.1|  pectate lyase 1-27                                      384   2e-123   
ref|XP_011097349.1|  PREDICTED: pectate lyase-like                      382   3e-123   
ref|XP_010248740.1|  PREDICTED: probable pectate lyase 18               382   3e-123   
gb|AFZ78654.1|  pectate lyase                                           384   3e-123   
ref|XP_009408120.1|  PREDICTED: probable pectate lyase 8                384   3e-123   
gb|AEN70977.1|  pectate lyase                                           382   3e-123   
gb|ADB90479.1|  pectate lyase                                           382   3e-123   
ref|XP_006285259.1|  hypothetical protein CARUB_v10006630mg             380   3e-123   
ref|XP_003638513.1|  Pectate lyase                                      382   3e-123   
ref|XP_002318694.1|  pectate lyase 22 precursor family protein          382   3e-123   
gb|AEN70968.1|  pectate lyase                                           382   4e-123   
ref|XP_004299169.1|  PREDICTED: probable pectate lyase 18-like          382   4e-123   
ref|XP_006297766.1|  hypothetical protein CARUB_v10013802mg             381   4e-123   
ref|XP_010100325.1|  hypothetical protein L484_027633                   382   4e-123   
dbj|BAI94495.1|  pectate lyase                                          382   4e-123   
ref|XP_006297767.1|  hypothetical protein CARUB_v10013802mg             382   4e-123   
ref|XP_010038352.1|  PREDICTED: probable pectate lyase 8                383   4e-123   
ref|XP_009400924.1|  PREDICTED: probable pectate lyase 8 isoform X2     383   4e-123   
ref|XP_002866540.1|  pectate lyase                                      382   4e-123   
ref|XP_004515913.1|  PREDICTED: probable pectate lyase 12-like          384   4e-123   
gb|EYU22243.1|  hypothetical protein MIMGU_mgv1a007460mg                382   4e-123   
emb|CAN78491.1|  hypothetical protein VITISV_004934                     382   5e-123   
ref|XP_009400922.1|  PREDICTED: probable pectate lyase 8 isoform X1     383   5e-123   
ref|XP_010940647.1|  PREDICTED: probable pectate lyase 8                383   5e-123   
emb|CDY56668.1|  BnaCnng30870D                                          382   5e-123   
ref|XP_009359518.1|  PREDICTED: probable pectate lyase 18               382   6e-123   
ref|XP_010442341.1|  PREDICTED: probable pectate lyase 20               382   6e-123   
gb|AAF19195.1|AF206319_1  pectate lyase 1                               381   6e-123   
ref|XP_011040439.1|  PREDICTED: probable pectate lyase 18               381   6e-123   
gb|KHN34377.1|  Putative pectate lyase 22                               381   6e-123   
ref|NP_568967.1|  putative pectate lyase 22                             382   6e-123   
dbj|BAB10560.1|  pectate lyase                                          381   6e-123   
gb|AEN70965.1|  pectate lyase                                           381   7e-123   
gb|ADB90478.1|  pectate lyase                                           381   8e-123   
gb|AAM61584.1|  putative pectate lyase                                  381   8e-123   
ref|XP_009391056.1|  PREDICTED: probable pectate lyase 8                382   8e-123   
ref|XP_007155507.1|  hypothetical protein PHAVU_003G207400g             381   9e-123   
gb|KFK39718.1|  hypothetical protein AALP_AA3G279700                    380   9e-123   
gb|ADB90477.1|  pectate lyase                                           381   1e-122   
gb|EEE60442.1|  hypothetical protein OsJ_13660                          382   1e-122   
ref|XP_009624534.1|  PREDICTED: probable pectate lyase 8                382   1e-122   
gb|AAM63307.1|  pectate lyase                                           381   1e-122   
ref|XP_011002172.1|  PREDICTED: probable pectate lyase 8                382   1e-122   
gb|KFK39719.1|  hypothetical protein AALP_AA3G279700                    381   1e-122   
ref|XP_006420567.1|  hypothetical protein CICLE_v10004783mg             384   1e-122   
ref|XP_002322215.1|  pectate lyase 22 precursor family protein          380   2e-122   
ref|XP_004515847.1|  PREDICTED: probable pectate lyase 22-like          380   2e-122   
ref|NP_001289258.1|  probable pectate lyase 18 precursor                380   2e-122   
gb|KDO65869.1|  hypothetical protein CISIN_1g013239mg                   382   2e-122   
ref|XP_011073763.1|  PREDICTED: probable pectate lyase 8                382   2e-122   
ref|XP_010444201.1|  PREDICTED: probable pectate lyase 22 isoform X3    379   2e-122   
gb|KDO40644.1|  hypothetical protein CISIN_1g015623mg                   380   2e-122   
ref|XP_006480190.1|  PREDICTED: probable pectate lyase 8-like           382   2e-122   
ref|XP_007137977.1|  hypothetical protein PHAVU_009G170500g             380   2e-122   
gb|EEC76710.1|  hypothetical protein OsI_14719                          382   2e-122   
emb|CDP13269.1|  unnamed protein product                                380   2e-122   
ref|XP_010663062.1|  PREDICTED: probable pectate lyase 5                380   2e-122   
ref|XP_004156698.1|  PREDICTED: putative pectate lyase 11-like          380   2e-122   
ref|XP_004142773.1|  PREDICTED: putative pectate lyase 11-like          380   2e-122   
ref|XP_009382167.1|  PREDICTED: probable pectate lyase 8                381   2e-122   
ref|XP_010918897.1|  PREDICTED: probable pectate lyase 8 isoform X2     381   2e-122   
emb|CAN76500.1|  hypothetical protein VITISV_004734                     380   2e-122   
emb|CAE02420.2|  OSJNBa0095E20.8                                        382   2e-122   
gb|KFK28033.1|  hypothetical protein AALP_AA8G463100                    380   2e-122   
gb|EMT28700.1|  hypothetical protein F775_17439                         380   2e-122   
ref|XP_010547043.1|  PREDICTED: probable pectate lyase 8                380   2e-122   
emb|CDO99404.1|  unnamed protein product                                381   2e-122   
emb|CDY56220.1|  BnaAnng14170D                                          380   2e-122   
ref|XP_009775177.1|  PREDICTED: probable pectate lyase 8                381   2e-122   
ref|XP_010918895.1|  PREDICTED: probable pectate lyase 8 isoform X1     381   2e-122   
ref|XP_010545988.1|  PREDICTED: probable pectate lyase 22               380   3e-122   
ref|XP_010484044.1|  PREDICTED: probable pectate lyase 22               380   3e-122   
ref|XP_009111860.1|  PREDICTED: probable pectate lyase 20               380   3e-122   
ref|XP_009411363.1|  PREDICTED: probable pectate lyase 8                381   3e-122   
ref|XP_009593549.1|  PREDICTED: probable pectate lyase 8                381   3e-122   
ref|XP_008340139.1|  PREDICTED: probable pectate lyase 5                379   3e-122   
ref|XP_010459939.1|  PREDICTED: probable pectate lyase 22               380   3e-122   
ref|XP_006280540.1|  hypothetical protein CARUB_v10026482mg             380   3e-122   
ref|XP_009804999.1|  PREDICTED: probable pectate lyase 8                380   3e-122   
ref|XP_008458848.1|  PREDICTED: pectate lyase-like                      380   3e-122   
ref|XP_006447221.1|  hypothetical protein CICLE_v10015474mg             379   3e-122   
ref|XP_003549832.1|  PREDICTED: probable pectate lyase 18 isoform 1     379   4e-122   
ref|XP_010556943.1|  PREDICTED: probable pectate lyase 1                380   4e-122   
ref|XP_006484000.1|  PREDICTED: probable pectate lyase 5-like           379   4e-122   
ref|XP_008804450.1|  PREDICTED: probable pectate lyase 8 isoform X2     380   4e-122   
ref|XP_004497757.1|  PREDICTED: probable pectate lyase 15-like          381   4e-122   
emb|CDX89799.1|  BnaA10g02830D                                          380   4e-122   
ref|XP_008351757.1|  PREDICTED: probable pectate lyase 18               379   4e-122   
ref|XP_010444198.1|  PREDICTED: probable pectate lyase 22               379   5e-122   
ref|XP_008804449.1|  PREDICTED: probable pectate lyase 8 isoform X1     380   5e-122   
ref|XP_009150377.1|  PREDICTED: probable pectate lyase 22               379   5e-122   
gb|KFK38096.1|  hypothetical protein AALP_AA3G068900                    379   6e-122   
ref|XP_006283843.1|  hypothetical protein CARUB_v10004942mg             379   6e-122   
gb|KDO82120.1|  hypothetical protein CISIN_1g015702mg                   379   6e-122   
ref|NP_001280201.1|  probable pectate lyase 18 precursor                379   7e-122   
ref|XP_011005597.1|  PREDICTED: probable pectate lyase 18               378   8e-122   
emb|CDY41506.1|  BnaA06g22590D                                          379   9e-122   
emb|CDY46471.1|  BnaC07g03950D                                          379   1e-121   
gb|EEE56553.1|  hypothetical protein OsJ_05879                          378   1e-121   
emb|CDY61137.1|  BnaC05g48970D                                          379   1e-121   



>ref|XP_009599825.1| PREDICTED: probable pectate lyase P59 isoform X1 [Nicotiana tomentosiformis]
Length=445

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/438 (67%), Positives = 351/438 (80%), Gaps = 10/438 (2%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               IIP  + HI ++DEVWRRR  EA E+A+Q YEPNP N++ +   +VR ++ E      
Sbjct  18    ATIIPCLMAHIGDFDEVWRRRAEEAREYARQIYEPNPENVTLAFNQKVRDSMKEV-----  72

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                     N++TR  LG+KKY GPC  TNPIDRCWRC  +WA NRKRLADCA+GFG K  
Sbjct  73    -----TVSNNSTRRGLGTKKYKGPCMVTNPIDRCWRCDPNWADNRKRLADCAMGFGSKAT  127

Query  1263  GGKLGNFYTVTDNADDPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GGK G  Y VTDN+DD + PKPGTLR+AVIQK+PLWIIF   M I+LHQELIMQ DKTID
Sbjct  128   GGKDGEIYIVTDNSDDYAEPKPGTLRYAVIQKEPLWIIFERSMTIRLHQELIMQSDKTID  187

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
              RGA VHI+ GAGIT+Q++KNVIIHG+HIH I EG+GG++RD +DH G+RT SDGDGISI
Sbjct  188   ARGANVHIAKGAGITLQYIKNVIIHGLHIHDIVEGSGGMVRDAVDHIGIRTVSDGDGISI  247

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FG+SN+WIDHVSMR CYDG+IDA+E STAITISNGHFTDHN+VMLFGA+D S+ D++MQI
Sbjct  248   FGASNIWIDHVSMRKCYDGIIDAVEGSTAITISNGHFTDHNEVMLFGASDSSSIDQVMQI  307

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             TLAFNHFGKRL+QRMPRCR+GYIHVVNNDYTHWNMYAIGGS HPTII QGNRFIAPPDI 
Sbjct  308   TLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPPDIF  367

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDV  364
             KK++TKR     E WK WTWRS+G+++M GA+F++SGDP++  KH +LYDG+    AE+V
Sbjct  368   KKQVTKREYNPEEVWKHWTWRSEGNLFMNGAYFIESGDPDWSKKHKELYDGISAAPAEEV  427

Query  363   TWLTRFAGALNCRVGSPC  310
             TW+TRFAGAL C+ G  C
Sbjct  428   TWITRFAGALGCKKGKAC  445



>ref|XP_009779191.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/438 (67%), Positives = 352/438 (80%), Gaps = 8/438 (2%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               II   + HI ++DEVWRRR  EA E+A+Q YEPNP N++ +   +VR T+ E      
Sbjct  18    ATIIRNLMAHIGDFDEVWRRRAEEAREYARQIYEPNPENVTLAFNQKVRDTMKELR----  73

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                  VT +++TR  LG+KKY GPC  TNPIDRCWRC  +WA NRKRLADCA+GFGYK  
Sbjct  74    ----QVTVSNSTRRGLGTKKYKGPCMVTNPIDRCWRCDPNWADNRKRLADCAMGFGYKAT  129

Query  1263  GGKLGNFYTVTDNADDPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GGK G  Y VTDN+DD + PKPGTLR+AVIQK+PLWIIF   M I+LHQE+IMQ DKTID
Sbjct  130   GGKDGEIYIVTDNSDDYAEPKPGTLRYAVIQKEPLWIIFERSMTIRLHQEMIMQSDKTID  189

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
              RGA VHI+ GAGIT+Q++KNVIIHG+HIH I EG+GG++RD +DH G+RT SDGDGISI
Sbjct  190   ARGANVHIAKGAGITLQYIKNVIIHGLHIHDIVEGSGGMVRDAVDHIGIRTVSDGDGISI  249

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FG+SN+WIDHVSM+ CYDG+IDA+E ST ITISNGHFTDHN+VMLFGA+D S+ D++MQI
Sbjct  250   FGASNIWIDHVSMKKCYDGIIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQVMQI  309

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             TLAFNHFGKRL+QRMPRCR+GYIHVVNNDYTHWNMYAIGGS HPTII QGNRFIAPPDI 
Sbjct  310   TLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPPDIF  369

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDV  364
             KK++TKR     E WK WTWRS+G+++M GA+F++SGDP++  KH +LYDG+    AE+V
Sbjct  370   KKQVTKREYNPEEVWKQWTWRSEGNLFMNGAYFIESGDPDWSKKHKELYDGISAASAEEV  429

Query  363   TWLTRFAGALNCRVGSPC  310
             TW+TRFAGAL C+ G  C
Sbjct  430   TWITRFAGALGCKEGKAC  447



>ref|XP_009599826.1| PREDICTED: probable pectate lyase P59 isoform X2 [Nicotiana tomentosiformis]
Length=444

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/438 (67%), Positives = 348/438 (79%), Gaps = 11/438 (3%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               IIP  + HI ++DEVWRRR  EA E+A+Q YEPNP N++ +   +VR           
Sbjct  18    ATIIPCLMAHIGDFDEVWRRRAEEAREYARQIYEPNPENVTLAFNQKVRDMKEV------  71

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                     N++TR  LG+KKY GPC  TNPIDRCWRC  +WA NRKRLADCA+GFG K  
Sbjct  72    -----TVSNNSTRRGLGTKKYKGPCMVTNPIDRCWRCDPNWADNRKRLADCAMGFGSKAT  126

Query  1263  GGKLGNFYTVTDNADDPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GGK G  Y VTDN+DD + PKPGTLR+AVIQK+PLWIIF   M I+LHQELIMQ DKTID
Sbjct  127   GGKDGEIYIVTDNSDDYAEPKPGTLRYAVIQKEPLWIIFERSMTIRLHQELIMQSDKTID  186

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
              RGA VHI+ GAGIT+Q++KNVIIHG+HIH I EG+GG++RD +DH G+RT SDGDGISI
Sbjct  187   ARGANVHIAKGAGITLQYIKNVIIHGLHIHDIVEGSGGMVRDAVDHIGIRTVSDGDGISI  246

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FG+SN+WIDHVSMR CYDG+IDA+E STAITISNGHFTDHN+VMLFGA+D S+ D++MQI
Sbjct  247   FGASNIWIDHVSMRKCYDGIIDAVEGSTAITISNGHFTDHNEVMLFGASDSSSIDQVMQI  306

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             TLAFNHFGKRL+QRMPRCR+GYIHVVNNDYTHWNMYAIGGS HPTII QGNRFIAPPDI 
Sbjct  307   TLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPPDIF  366

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDV  364
             KK++TKR     E WK WTWRS+G+++M GA+F++SGDP++  KH +LYDG+    AE+V
Sbjct  367   KKQVTKREYNPEEVWKHWTWRSEGNLFMNGAYFIESGDPDWSKKHKELYDGISAAPAEEV  426

Query  363   TWLTRFAGALNCRVGSPC  310
             TW+TRFAGAL C+ G  C
Sbjct  427   TWITRFAGALGCKKGKAC  444



>ref|XP_004234779.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=449

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/438 (67%), Positives = 349/438 (80%), Gaps = 6/438 (1%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               IIP+ + HI  YDEVWRRR  EA E+A++ YEP+P N++ +   ++R T+ E      
Sbjct  18    ATIIPSLMAHIGHYDEVWRRRAEEAKEYARKIYEPHPENVTLAFNQKLRDTMKELKKVKG  77

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                   T N++TR  LG+KKY GPC  TNPID+CWRC  +WA NRK+LADCA+GFG K  
Sbjct  78    ------THNNSTRRGLGTKKYTGPCMVTNPIDKCWRCDPNWADNRKKLADCAMGFGSKAI  131

Query  1263  GGKLGNFYTVTDNADDPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GGK G FY VTDN+DD ++PKPGTLRHAVIQK+PLWIIF   M+I+LHQE+IMQ DKTID
Sbjct  132   GGKDGEFYVVTDNSDDYNDPKPGTLRHAVIQKEPLWIIFKRGMNIRLHQEMIMQSDKTID  191

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
              RG  VHI+ GAGIT+Q++KNVIIHG+HIH I EGNGG++RD +DH G+RTKSDGDGISI
Sbjct  192   ARGVNVHITKGAGITLQYIKNVIIHGLHIHDIVEGNGGMVRDAVDHIGIRTKSDGDGISI  251

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FG+SN+WIDHVSM+ CYDGLIDA+E ST ITISNGHFTDHN+VMLFGA+D S+ D++MQI
Sbjct  252   FGASNIWIDHVSMQRCYDGLIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQVMQI  311

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             TLAFNHFGKRLIQRMPRCR+GYIHVVNNDYTHWNMYAIGGS HPTII QGNRFIAPPDI 
Sbjct  312   TLAFNHFGKRLIQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPPDIF  371

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDV  364
             KK++TKR       W  WTWRS+G+++M GA+F +SGDP +  KH  LYDG+    AEDV
Sbjct  372   KKQVTKREYNPESVWMQWTWRSEGNLFMNGAYFTESGDPEWSSKHKDLYDGISAAPAEDV  431

Query  363   TWLTRFAGALNCRVGSPC  310
             TW+TRFAG L C+ G PC
Sbjct  432   TWMTRFAGVLGCKPGKPC  449



>ref|XP_006361835.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=447

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/438 (66%), Positives = 349/438 (80%), Gaps = 8/438 (2%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               IIP+ + HI  YDEVWRRR  EA E+A+Q YE +P N++ +   ++R T+ E      
Sbjct  18    ATIIPSLMAHIGHYDEVWRRRAEEAKEYARQIYERHPENVTLAFNQKLRNTMKELK----  73

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                 +V   ++TR  LG+KKY GPC  TNPIDRCWRC  +WA NRKRLADCA+GFG K  
Sbjct  74    ----EVKGTNSTRRGLGTKKYCGPCIVTNPIDRCWRCDPNWADNRKRLADCAMGFGSKVT  129

Query  1263  GGKLGNFYTVTDNADDPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GGK G FY VTDN+DD ++PKPGTLR+AVIQK+PLWIIF   M+I+LHQE+IMQ DKTID
Sbjct  130   GGKNGEFYVVTDNSDDYNDPKPGTLRYAVIQKEPLWIIFKRGMNIRLHQEMIMQSDKTID  189

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
              RG  VHI+ GAGIT+Q++KNVIIHG+HIH I EGNGG++RD +DH G+RTKSDGDGISI
Sbjct  190   ARGVNVHITKGAGITLQYIKNVIIHGLHIHDIVEGNGGMVRDAVDHIGIRTKSDGDGISI  249

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FG+SN+WIDHVSM+ CYDGLIDA+E ST ITISNGHFTDHN+VMLFGA+D S+ D++MQI
Sbjct  250   FGASNIWIDHVSMQRCYDGLIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQVMQI  309

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             TLAFNHFGKRL+QRMPRCR+GYIHVVNNDYTHWNMYAIGGS HPTII QGNRFIAPPDI 
Sbjct  310   TLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPPDIF  369

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDV  364
             KK++TKR       W  WTWRS+G+++M GA+F +SGDP++  KH  LYDG+    AEDV
Sbjct  370   KKQVTKREYNPESVWMQWTWRSEGNLFMNGAYFTESGDPDWSKKHKDLYDGISAAPAEDV  429

Query  363   TWLTRFAGALNCRVGSPC  310
             TW+TRFAG L C+ G PC
Sbjct  430   TWMTRFAGVLACKPGKPC  447



>ref|XP_006357122.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=448

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/438 (67%), Positives = 349/438 (80%), Gaps = 8/438 (2%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
             GAIIPA   HI ++DEVWRRR  EA++   Q YE  P NI+ +   + R ++ E  A   
Sbjct  19    GAIIPAFNAHIGDFDEVWRRRAEEAMKFTIQTYESEPANITLAFNQKTRDSVKELSAV--  76

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                  V++N+T R L G+KKY GPC  TNPID+CWRC  +WA NRK+L +C++GFGYKT 
Sbjct  77    -----VSKNETRREL-GTKKYEGPCTVTNPIDKCWRCDPNWADNRKKLVECSMGFGYKTT  130

Query  1263  GGKLGNFYTVTDNADDPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GG+ G +Y V+D++DD + PKPGTLRHAVIQK+PLWIIF  +M IKLHQELIMQGDKTID
Sbjct  131   GGRDGKYYVVSDSSDDYTTPKPGTLRHAVIQKEPLWIIFDRNMKIKLHQELIMQGDKTID  190

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
             GRGA VHI+ GA I IQ+ KNVIIHG+HIH I EGNGG++RD +DH G RTKSDGDGISI
Sbjct  191   GRGATVHITGGASIMIQYTKNVIIHGLHIHDIVEGNGGMVRDAVDHIGFRTKSDGDGISI  250

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FGSSN+WIDH+SM NCYDG+IDA+E ST ITISNGH+TDHN+VMLFGA+D S+ D+ MQI
Sbjct  251   FGSSNIWIDHMSMENCYDGIIDAVEGSTGITISNGHYTDHNEVMLFGASDSSSIDQKMQI  310

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             TLAFNHFGKRL+QRMPRCR+GYIHVVNNDYTHWNMYAIGGS +PTII QGNRFIAPPDI 
Sbjct  311   TLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRFIAPPDIF  370

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDV  364
             KK+ITKR       W  WTWRS+GD+YM GA+FVQ+GDP++  KH  LYDG+    A+ V
Sbjct  371   KKQITKREYSPESVWMQWTWRSEGDLYMNGAYFVQAGDPDWSKKHQNLYDGIAAAPADQV  430

Query  363   TWLTRFAGALNCRVGSPC  310
             TW+TRFAGALNC+VG  C
Sbjct  431   TWMTRFAGALNCKVGKAC  448



>sp|P15722.1|PLY59_SOLLC RecName: Full=Probable pectate lyase P59; Flags: Precursor [Solanum 
lycopersicum]
 emb|CAA33523.1| P59 protein [Solanum lycopersicum]
Length=449

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/438 (66%), Positives = 347/438 (79%), Gaps = 6/438 (1%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               IIP+ + HI  YDEVWRRR  EA E+A+  YEP+P N++ +   ++R T+ E      
Sbjct  18    ATIIPSLMAHIGHYDEVWRRRAEEAKEYARNIYEPHPENVTLAFNQKLRDTMKELKKVKG  77

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                   T N++TR  LG+KKY GPC  TNPID+CWRC  +WA NRK+LADCA+GFG K  
Sbjct  78    ------THNNSTRRGLGTKKYTGPCMVTNPIDKCWRCDPNWADNRKKLADCAMGFGSKAI  131

Query  1263  GGKLGNFYTVTDNADDPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GGK G FY VTDN+DD ++PKPGTLRHAVIQK+PLWIIF   M+I+LHQE+IMQ DKTID
Sbjct  132   GGKDGEFYVVTDNSDDYNDPKPGTLRHAVIQKEPLWIIFKRGMNIRLHQEMIMQSDKTID  191

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
              RG  VHI+ GAGIT+Q++KNVIIHG+HIH I EGNGG++RD +DH G+RTKSDGDGISI
Sbjct  192   ARGVNVHITKGAGITLQYIKNVIIHGLHIHDIVEGNGGMVRDAVDHIGIRTKSDGDGISI  251

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FG+S +WIDHVSM+ CYDGLIDA+E ST ITISNGHFTDHN+VMLFGA+D S+ D++MQI
Sbjct  252   FGASYIWIDHVSMQRCYDGLIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQVMQI  311

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             TLAFNHFGKRLIQRMPRCR+GYIHVVNNDYTHWNMYAIGGS HPTII QGNRFIAPPDI 
Sbjct  312   TLAFNHFGKRLIQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIIHQGNRFIAPPDIF  371

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDV  364
             KK++TKR       W  WTWRS+G+++M GA+F +SGDP +  KH  LYDG+    AEDV
Sbjct  372   KKQVTKREYNPESVWMQWTWRSEGNLFMNGAYFTESGDPEWSSKHKDLYDGISAAPAEDV  431

Query  363   TWLTRFAGALNCRVGSPC  310
             TW+TRFAG L C+ G PC
Sbjct  432   TWMTRFAGVLGCKPGKPC  449



>ref|XP_009789921.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/437 (67%), Positives = 343/437 (78%), Gaps = 8/437 (2%)
 Frame = -2

Query  1620  AIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaea  1441
             AIIP+ + HI E+DEVWRRR  EA + A Q YE  P N++ +   +VR  + E       
Sbjct  19    AIIPSFLAHIGEFDEVWRRRAEEARKVALQTYESEPENVTLAFNKQVRDAMKELSEV---  75

Query  1440  eaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKG  1261
                 + +NDT R L G+KKY GPC  TNPID+CWRC  +WA NRK+LADCA+GFG K  G
Sbjct  76    ----IPKNDTRREL-GTKKYTGPCMVTNPIDKCWRCDPNWADNRKKLADCAMGFGSKATG  130

Query  1260  GKLGNFYTVTDNADDPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDG  1081
             GK G FY V D++DD ++PKPGTLRHAVIQK+PLWIIF   M I+LHQELIMQ DKTID 
Sbjct  131   GKAGRFYVVNDSSDDYTDPKPGTLRHAVIQKEPLWIIFDRGMTIRLHQELIMQSDKTIDA  190

Query  1080  RGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisif  901
             RGA VHI+ GAGI IQ+ KNVIIHG+HIH I +GNGG++RD +DH GLRT SDGDGISIF
Sbjct  191   RGANVHIAGGAGIMIQYTKNVIIHGLHIHDIVQGNGGMVRDAVDHIGLRTMSDGDGISIF  250

Query  900   gsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQIT  721
             G+SN+WIDHVSM NCYDG+IDA+E ST ITISNGHFTDHN+VMLFGA+D S+ D+ MQIT
Sbjct  251   GASNIWIDHVSMWNCYDGIIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQQMQIT  310

Query  720   LAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHK  541
             LAFNHFGKRL+QRMPRCR+GYIHVVNNDYTHWNMYAIGGS +PTII QGNRFIAPPDI K
Sbjct  311   LAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRFIAPPDIFK  370

Query  540   KEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVT  361
             K+ITKR       W  WTWRS+GD+YM GA+FVQSGDP++  KH  LYDG+    A+ VT
Sbjct  371   KQITKREYSPESVWMQWTWRSEGDLYMNGAYFVQSGDPDWSKKHQNLYDGISAAPADQVT  430

Query  360   WLTRFAGALNCRVGSPC  310
             W+TRFAGAL C+VG  C
Sbjct  431   WITRFAGALGCKVGQAC  447



>ref|XP_009587689.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=447

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/438 (67%), Positives = 341/438 (78%), Gaps = 8/438 (2%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
              AIIP+ + HI E+DEVWRRR  EA + A Q YE  P N++ +   +VR  + E      
Sbjct  18    AAIIPSFLAHIGEFDEVWRRRAEEARKVALQTYESEPENVTLAFNKQVRDAMKELSEV--  75

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                  + +NDT R L G+KKY GPC  TNPID+CWRC  +WA NRK+LADCA+GFG K  
Sbjct  76    -----IPKNDTRREL-GTKKYTGPCMVTNPIDKCWRCDPNWADNRKKLADCAMGFGSKAT  129

Query  1263  GGKLGNFYTVTDNADDPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GGK G FY V D +DD ++PKPGTLRHAVIQK+PLWIIF   M I+LHQELIMQ DKTID
Sbjct  130   GGKAGRFYVVNDPSDDYTDPKPGTLRHAVIQKEPLWIIFDRGMTIRLHQELIMQSDKTID  189

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
              RGA VHIS GAGI IQ+ KNVIIHG+HIH I +GNGG++RD +DH GLRT SDGDGISI
Sbjct  190   ARGANVHISGGAGIMIQYTKNVIIHGLHIHDIVQGNGGMVRDAVDHIGLRTMSDGDGISI  249

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FG+SN+WIDHVSM NCYDG+IDA+E ST ITISNGHFTDHN+VMLFGA+D S+ D+ MQI
Sbjct  250   FGASNIWIDHVSMWNCYDGIIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQQMQI  309

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             TLAFNHFGKRL+QRMPRCR+GYIHVVNNDYTHWNMYAIGGS +PTII QGNRFIAPPDI 
Sbjct  310   TLAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRFIAPPDIF  369

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDV  364
             KK+ITKR       W  WTWRS+GD+YM GA+FVQSGDP++  KH  LYDG+    A+ V
Sbjct  370   KKQITKREYSPESVWMQWTWRSEGDLYMNGAYFVQSGDPDWSKKHQNLYDGISAAPADQV  429

Query  363   TWLTRFAGALNCRVGSPC  310
             TW+TRFAGAL C VG  C
Sbjct  430   TWITRFAGALGCMVGQAC  447



>ref|XP_004232242.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=446

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/431 (65%), Positives = 339/431 (79%), Gaps = 7/431 (2%)
 Frame = -2

Query  1599  GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTR  1420
             GHI E+DEVWRRR  EA E A +AY+P+P N++ +   E  + L E           +  
Sbjct  22    GHIGEFDEVWRRRAQEADEWAIKAYKPDPINVTLAFAKETGQALKEIKEAK------LAV  75

Query  1419  NDTTRHLLGS-KKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNF  1243
             N T R L G  KKY GPC+ TNPIDRCWRC  DWA NRKRLADCA+GF   T GGK G  
Sbjct  76    NGTRRELKGGGKKYDGPCSVTNPIDRCWRCQPDWADNRKRLADCAMGFAKGTTGGKAGEI  135

Query  1242  YTVTDNADDPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVH  1063
             Y VTD++DD S+PKPGTLR+ VIQK+PLWIIF+  M I+LHQELI+Q DKTIDGRG  VH
Sbjct  136   YVVTDSSDDTSDPKPGTLRYGVIQKEPLWIIFAKSMTIRLHQELIVQSDKTIDGRGVNVH  195

Query  1062  ISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVW  883
             I++GAG  +Q+VKNVIIHG+ IH I  G+GG+IRD +DH G RT+SDGDGISIFGSSN+W
Sbjct  196   IANGAGFMLQYVKNVIIHGLRIHDIVVGSGGMIRDAMDHVGQRTQSDGDGISIFGSSNIW  255

Query  882   IDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHF  703
             +DHVSM +CYDGL+DAIE STA+TISN HFTDHN+VMLFGA+D S+ D+ MQIT+A+NHF
Sbjct  256   VDHVSMWSCYDGLVDAIEGSTAVTISNSHFTDHNEVMLFGASDSSSIDQRMQITVAYNHF  315

Query  702   GKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKR  523
             GKRLIQRMPRCR+G+IHVVNNDYTHWNMYAIGGS HPTII QGNRFIAPPD+ KKE+TKR
Sbjct  316   GKRLIQRMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGNRFIAPPDMFKKEVTKR  375

Query  522   VKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFA  343
                    WK W+WRSQGD++M GAFFV+SGDP++  KH +L+DGV++   + VTW+TRF+
Sbjct  376   DYSPESVWKQWSWRSQGDLFMNGAFFVESGDPDWTQKHIQLFDGVVSASGDQVTWITRFS  435

Query  342   GALNCRVGSPC  310
             GALNC+ G  C
Sbjct  436   GALNCKPGEAC  446



>ref|XP_009802165.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=451

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/438 (68%), Positives = 345/438 (79%), Gaps = 6/438 (1%)
 Frame = -2

Query  1620  AIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaea  1441
             AIIP+  GHI  +DEVWRRR  EA E A +AYEP+P N++ +   + R ++ E       
Sbjct  19    AIIPSLNGHIGNFDEVWRRRAQEAEEWALKAYEPDPVNVTLAFAKQTRESMKELKEVN--  76

Query  1440  eaEDVTRNDTTRHLLGSKK-YHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                 ++ N+T R L G  K Y GPC  TNPIDRCWRC  +WA NRKRLADCA+GFG  T 
Sbjct  77    ---KLSTNETRRELRGFHKIYAGPCLVTNPIDRCWRCQGNWADNRKRLADCAMGFGKGTT  133

Query  1263  GGKLGNFYTVTDNADDPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GGK G FY VTD++DD SNPKPGTLRHAVIQK+PLWIIF+  M I+LHQELIMQ DKTID
Sbjct  134   GGKAGQFYVVTDSSDDSSNPKPGTLRHAVIQKEPLWIIFAKSMTIRLHQELIMQSDKTID  193

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
             GRG  VHI+ GAGIT+Q+VKNVIIHG+HIH I  GNGG++   +DH G+RT+SDGDGISI
Sbjct  194   GRGVNVHIAYGAGITLQYVKNVIIHGLHIHDIVVGNGGMVISAVDHVGIRTQSDGDGISI  253

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FGSSN+WIDHVSM  C DGLIDA+E STAITISNGHFTDHN+VMLFGA+D S+ D+ MQI
Sbjct  254   FGSSNIWIDHVSMWRCSDGLIDAVEGSTAITISNGHFTDHNEVMLFGASDSSSIDQRMQI  313

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             T+AFNHFGKRL+QRMPRCR+G+IHVVNNDYTHWNMYAIGGS HPTII QGNRFIAPPD+ 
Sbjct  314   TVAFNHFGKRLVQRMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGNRFIAPPDMF  373

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDV  364
             KKEITKR       WK WTWRSQGD++M GAFFV+SGDP++  KH  L+DG+ +   E V
Sbjct  374   KKEITKRDYAPESVWKQWTWRSQGDLFMNGAFFVESGDPDWTKKHQNLFDGISSAPGEQV  433

Query  363   TWLTRFAGALNCRVGSPC  310
             TW+TRFAGALNCR G  C
Sbjct  434   TWITRFAGALNCRPGHAC  451



>ref|XP_009617495.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=451

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/438 (67%), Positives = 347/438 (79%), Gaps = 6/438 (1%)
 Frame = -2

Query  1620  AIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaea  1441
             AIIP+  GHI ++DEVWRRR  EA E A +AYEP+P N++ +   + + ++ E     + 
Sbjct  19    AIIPSLNGHIGDFDEVWRRRAQEAEEWALKAYEPDPVNVTLAFAKQTKESMKELKEVKK-  77

Query  1440  eaEDVTRNDTTRHLLG-SKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                 +  NDT R L G  K Y GPC  TNPIDRCWRC  +WA NRKRLADCALGFG  T 
Sbjct  78    ----LATNDTRRELRGFHKNYAGPCLVTNPIDRCWRCQGNWADNRKRLADCALGFGKGTT  133

Query  1263  GGKLGNFYTVTDNADDPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GGK G FY VTD++DD SNPKPGTLRHAVIQK+PLWIIF+  M+I+LHQELIMQ DKTID
Sbjct  134   GGKAGRFYVVTDSSDDSSNPKPGTLRHAVIQKEPLWIIFAKSMNIRLHQELIMQSDKTID  193

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
             GRG  VHI+ GAGIT+Q+VKNVIIHG+HIH I  GNGG++   +DH G+RT+SDGDGISI
Sbjct  194   GRGVNVHIAYGAGITLQYVKNVIIHGLHIHDIVVGNGGMVISAVDHVGIRTQSDGDGISI  253

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FGSSN+WIDHVSM  C DGLIDA+E STAITISNGHFTDHN+VMLFGA+D S+ D+ MQI
Sbjct  254   FGSSNIWIDHVSMWRCSDGLIDAVEGSTAITISNGHFTDHNEVMLFGASDSSSIDQRMQI  313

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             T+AFNHFGKRL+QRMPRCR+G+IHVVNNDYTHWNMYAIGGS HPTII QGNRFIAPP++ 
Sbjct  314   TVAFNHFGKRLVQRMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGNRFIAPPEMF  373

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDV  364
             KKEITKR       WK WTWRSQGD++M GAFFV+SGDP++  KH  L+DG+ +   E V
Sbjct  374   KKEITKRDYAPESVWKQWTWRSQGDLFMNGAFFVESGDPDWTKKHQNLFDGISSAPGEQV  433

Query  363   TWLTRFAGALNCRVGSPC  310
             TW+TRFAGALNC+ G  C
Sbjct  434   TWITRFAGALNCKQGHAC  451



>ref|XP_006338480.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=446

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/434 (64%), Positives = 340/434 (78%), Gaps = 7/434 (2%)
 Frame = -2

Query  1608  ATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaED  1429
             A  GHI E+DEVWRRR  EA E A +AY+P+P N++ +   +  + L E           
Sbjct  19    AINGHIGEFDEVWRRRAQEADEWAIKAYKPDPINVTLAFAKQTGQALKEIKEAK------  72

Query  1428  VTRNDTTRHLLGS-KKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKL  1252
             +  N T R L G  KKY+GPC  TNPIDRCWRC  +WA NRKRLADCA+GF   T GGK 
Sbjct  73    LAINGTRRELKGGGKKYNGPCLVTNPIDRCWRCQPNWADNRKRLADCAMGFAKGTTGGKA  132

Query  1251  GNFYTVTDNADDPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGA  1072
             G  Y VTD++DD S+PKPGTLR+ VIQK+PLWIIF+  M I+LHQELI+Q DKTIDGRG 
Sbjct  133   GEIYVVTDSSDDTSDPKPGTLRYGVIQKEPLWIIFAKSMTIRLHQELIVQSDKTIDGRGV  192

Query  1071  QVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsS  892
              VHI++GAG  +Q+VKNVIIHG+ IH I  G+GG+IRD +DH G RT+SDGDGISIFGSS
Sbjct  193   NVHIANGAGFMLQYVKNVIIHGLRIHDIVVGSGGMIRDAMDHIGQRTQSDGDGISIFGSS  252

Query  891   NVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAF  712
             N+W+DHVSM +CYDGL+DA+E STA+TISN HFTDHN+VMLFGA+D S+ D+ MQIT+A+
Sbjct  253   NIWVDHVSMWSCYDGLVDAVEGSTAVTISNSHFTDHNEVMLFGASDSSSIDQRMQITVAY  312

Query  711   NHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEI  532
             NHFGKRLIQRMPRCR+G+IHVVNNDYTHWNMYAIGGS HPTII QGNRFIAPPD+ KKE+
Sbjct  313   NHFGKRLIQRMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGNRFIAPPDMFKKEV  372

Query  531   TKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLT  352
             TKR       WK W+WRSQGD++M GAFFV+SGDP++  KH +L+DG+++   + VTW+T
Sbjct  373   TKRDYSPESVWKQWSWRSQGDLFMNGAFFVESGDPDWTKKHTELFDGIVSASGDQVTWIT  432

Query  351   RFAGALNCRVGSPC  310
             RF+GALNC+ G  C
Sbjct  433   RFSGALNCKPGEAC  446



>ref|XP_010317101.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=389

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/373 (73%), Positives = 315/373 (84%), Gaps = 0/373 (0%)
 Frame = -2

Query  1428  VTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLG  1249
             V++N+T R  LG+KKY GPC  TNPID+CWRC  +WA NRK+L +C++GFGYKT GG+ G
Sbjct  17    VSKNETIRRALGTKKYDGPCTVTNPIDKCWRCDPNWADNRKKLVECSMGFGYKTTGGRDG  76

Query  1248  NFYTVTDNADDPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQ  1069
              FY VTD +DD + PKPGTLRHAVIQK+PLWIIF  +M IKLHQELIMQGDKTIDGRGA 
Sbjct  77    EFYVVTDPSDDYTTPKPGTLRHAVIQKEPLWIIFEKNMKIKLHQELIMQGDKTIDGRGAT  136

Query  1068  VHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSN  889
             VHI+ GA I IQ+ KNVIIHG+HIH I EG+GG++RD +DH GLRTKSDGDGISI+GSSN
Sbjct  137   VHITGGASIMIQYTKNVIIHGLHIHDIVEGSGGMVRDAVDHIGLRTKSDGDGISIYGSSN  196

Query  888   VWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFN  709
             +WIDH+SM NCYDGLIDA+E ST ITISNGH+TDHN+VMLFGA+D S+ D+ MQITLAFN
Sbjct  197   IWIDHMSMENCYDGLIDAVEGSTGITISNGHYTDHNEVMLFGASDSSSIDQKMQITLAFN  256

Query  708   HFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEIT  529
             HFGKRL+QRMPRCR+GYIHVVNNDYTHWNMYAIGGS +PTII QGNRFIAPPDI KKEIT
Sbjct  257   HFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRFIAPPDIFKKEIT  316

Query  528   KRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTR  349
             KR       W  WTWRS+GD+YM GA+FVQ+GDP++  KH  LYDG+    A+ VTW+TR
Sbjct  317   KREYSPESVWMQWTWRSEGDLYMNGAYFVQAGDPDWSKKHQNLYDGIAPAPADQVTWITR  376

Query  348   FAGALNCRVGSPC  310
             FAGALNC+VG PC
Sbjct  377   FAGALNCKVGLPC  389



>emb|CDP02198.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/462 (63%), Positives = 340/462 (74%), Gaps = 29/462 (6%)
 Frame = -2

Query  1620  AIIPATV---GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavae  1450
              ++P  +   G  +  +E WR R  EA  H  +AYE NPH +    I    +  SE    
Sbjct  19    VVVPTLITAQGSGSAEEEYWRIRAEEAWNHTLKAYEANPHTV----IGAFNKQASENEMP  74

Query  1449  aeaeaED-----------------VTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADW  1321
              +  A+D                 ++  ++TR  L  KK+ G C ATNPIDRCWRC  +W
Sbjct  75    GKTAAQDDKLTKLNLPPCCHTQQFLSEKNSTRRELRGKKWGGGCLATNPIDRCWRCQPNW  134

Query  1320  ATNRKRLADCALGFGYKTKGGKLGNFYTVTDNADDP-SNPKPGTLRHAVIQKKPLWIIFS  1144
             A NRKRLADC +GFG  T GGK G FY VTD++DD    PKPGTLRHAVIQK+PLWIIF 
Sbjct  135   ADNRKRLADCVVGFGRGTTGGKNGAFYVVTDSSDDSILAPKPGTLRHAVIQKEPLWIIFE  194

Query  1143  HDMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLI  964
              DM I+L QELIMQGDKTIDGRG  VHI+ GAGITIQFVKNVIIHG+HIH I +G+GGL+
Sbjct  195   RDMVIRLTQELIMQGDKTIDGRGVSVHIAYGAGITIQFVKNVIIHGLHIHDIHQGSGGLV  254

Query  963   RDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDH  784
             RD +DHFG+RT SDGDGISIFGSSNVWIDHVSM  CYDGLIDA+EASTAITISN HFTDH
Sbjct  255   RDSVDHFGIRTMSDGDGISIFGSSNVWIDHVSMWKCYDGLIDAVEASTAITISNSHFTDH  314

Query  783   NDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGG  604
             N+VMLFGA+D  +KD +MQIT+AFNHFGKRLIQRMPRCR+G+IHVVNNDYTHW MYAIGG
Sbjct  315   NEVMLFGASDSQSKDAVMQITVAFNHFGKRLIQRMPRCRWGFIHVVNNDYTHWEMYAIGG  374

Query  603   SSHPTIICQGNRFIAPPDIHKKE----ITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQS  436
             S HP II QGNRFIAPPDI KKE    +TKR       WK WTWRS+GD++M GAFFVQS
Sbjct  375   SQHPIIISQGNRFIAPPDIFKKEVRRTVTKRDYAEEARWKEWTWRSEGDLFMNGAFFVQS  434

Query  435   GDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             GDP+F  KH +++DG+    + +VTW+TRFAGAL CR GSPC
Sbjct  435   GDPDFTKKHPEIFDGIAPADSSEVTWITRFAGALMCRPGSPC  476



>gb|EPS66620.1| hypothetical protein M569_08154, partial [Genlisea aurea]
Length=451

 Score =   528 bits (1359),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 278/447 (62%), Positives = 335/447 (75%), Gaps = 22/447 (5%)
 Frame = -2

Query  1617  IIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNI-------SASLIHEVRRTLSea  1459
             ++P +   IAEYD+ W++R AEA      +YEPNP  I       S  L+HE+  T    
Sbjct  16    LVPTSDARIAEYDDFWKKRRAEAWNRTLLSYEPNPAKIVTHLNLHSHRLLHELNAT----  71

Query  1458  vaeaeaeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGF  1279
                   +   +  N T R L G ++Y+GPC  TNPIDRCWRC +DWATNR RLADC LGF
Sbjct  72    ------DHFHLVGNHTRRSLRG-RRYNGPCTVTNPIDRCWRCRSDWATNRFRLADCGLGF  124

Query  1278  GYKTKGGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQ  1102
             GYK KGGK G  Y VTD++D D  NPKPGTLRHAVIQ  PLWI+F+  M I+L QEL++ 
Sbjct  125   GYKAKGGKNGPIYVVTDSSDNDMVNPKPGTLRHAVIQPGPLWIVFARSMVIRLSQELLVT  184

Query  1101  GDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsd  922
              DKTIDGRGA+VH++ GAGIT+QFV NVIIHG+HIH I +G+GG+IRD +DH+G RT+SD
Sbjct  185   SDKTIDGRGARVHVAYGAGITLQFVSNVIIHGLHIHDIVQGSGGMIRDSVDHYGFRTRSD  244

Query  921   gdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTK  742
             GDGISIFGS ++WIDHVSMR CYDGLIDAI  ST ITISN HFTDHN+VMLFGA+D  + 
Sbjct  245   GDGISIFGSQDLWIDHVSMRRCYDGLIDAIMGSTGITISNSHFTDHNEVMLFGASDGYSP  304

Query  741   DKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFI  562
             D  MQ+T+AFNHFGKRLIQRMPRCR+GYIHVVNNDYTHWNMYAIGGSS PTII QGNR+I
Sbjct  305   DAKMQMTVAFNHFGKRLIQRMPRCRWGYIHVVNNDYTHWNMYAIGGSSAPTIISQGNRYI  364

Query  561   APPD---IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDG  391
             APPD   ++ KE+TKR       W++WTWRS GD++M GA+F QSGDPN+M KH + YD 
Sbjct  365   APPDDVNMYAKEVTKRDYAPESVWQSWTWRSDGDVFMRGAYFTQSGDPNYMSKHPERYDL  424

Query  390   VMTFKAEDVTWLTRFAGALNCRVGSPC  310
             +      +V  +TRFAGAL C+VG+PC
Sbjct  425   MQAADGSNVAAITRFAGALLCKVGAPC  451



>ref|XP_011098575.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=449

 Score =   524 bits (1349),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 276/441 (63%), Positives = 329/441 (75%), Gaps = 11/441 (2%)
 Frame = -2

Query  1623  GAIIPATV-GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaea  1447
              + +P  V  HIAE+DEVW+RR  EA     ++YEP P  I + L   V R L E   E 
Sbjct  17    ASTLPGAVRAHIAEFDEVWQRRAEEAWNRTLESYEPAPAKIVSHLNLNVHRALKEVKEE-  75

Query  1446  eaeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKT  1267
                  +++ N T R L  S  Y GPC  TNPIDRCWRC A+WA NR RLADC LGFGYK 
Sbjct  76    -----ELSLNSTRRQL--SHGYDGPCRVTNPIDRCWRCQANWAQNRFRLADCVLGFGYKA  128

Query  1266  KGGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKT  1090
             KGGK G  Y VTD +D D  NPKPGTLRHAVIQK+PLWIIF  DM I+L QELI+Q DKT
Sbjct  129   KGGKNGKIYVVTDPSDNDMVNPKPGTLRHAVIQKEPLWIIFQRDMLIRLSQELIVQSDKT  188

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             IDGRGA+V I++GAGIT+QFVKNVIIHGI I++I  G GG+IRD +DH+GLRT+SDGDGI
Sbjct  189   IDGRGARVLIANGAGITLQFVKNVIIHGIKIYNISPGQGGMIRDAVDHYGLRTRSDGDGI  248

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             SIFGS ++WIDHVSM NC DGLID I  ST +T+SN HFTDHN+ MLFGA+D  T+D  M
Sbjct  249   SIFGSQDIWIDHVSMLNCADGLIDVIMGSTGVTVSNSHFTDHNEAMLFGASDSHTQDVKM  308

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP-  553
             Q+T+AFNHFGKR++QRMPR RYGYIHVVNNDYTHWNMYA+GGS +P II QGNR+IAPP 
Sbjct  309   QVTVAFNHFGKRMVQRMPRARYGYIHVVNNDYTHWNMYAVGGSKNPIIISQGNRYIAPPT  368

Query  552   DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKA  373
             + + KE+TKR       WK+W WRS+GDI+  GAFFVQSGDP +  KH + YD +    A
Sbjct  369   NPYAKEVTKREYSPESVWKSWVWRSEGDIFQGGAFFVQSGDPTYTSKHPEKYDLIQAAPA  428

Query  372   EDVTWLTRFAGALNCRVGSPC  310
             ++V  +T+FAGAL C+VG PC
Sbjct  429   QNVAEITKFAGALGCKVGVPC  449



>ref|XP_007032453.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY03379.1| Pectate lyase family protein [Theobroma cacao]
Length=454

 Score =   513 bits (1320),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 274/443 (62%), Positives = 335/443 (76%), Gaps = 8/443 (2%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
              A+IP+    IAE+DEVW++R  +A ++A +AYEP P N++++L + V + L +  A   
Sbjct  15    AALIPSLWADIAEFDEVWKQRAEQAWKNALEAYEPMPENVTSNLNYNVNKALLKGRANKT  74

Query  1443  aeaEDVTRNDTTRHLLGS-KKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKT  1267
                E VT N T R+L G+ KKY GPC ATNPIDRCWRC  +WA NRK+LA+C LGFG+KT
Sbjct  75    RAFEGVTTNSTRRNLRGNHKKYIGPCMATNPIDRCWRCRKNWARNRKQLANCVLGFGHKT  134

Query  1266  KGGKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKT  1090
             +GGK G +Y VTDN+DD   NP+PGTLRHAVIQK+PLWIIF+HDM+IKL QELI+Q  KT
Sbjct  135   EGGKQGGYYLVTDNSDDNVLNPRPGTLRHAVIQKEPLWIIFAHDMNIKLSQELIVQSKKT  194

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             IDGRGA VHI+ GAGIT+QFV NVIIH +HIHHI + +GGLIRD +DH+G RT  DGDGI
Sbjct  195   IDGRGANVHIAYGAGITLQFVDNVIIHNLHIHHIRKSSGGLIRDSVDHYGFRTVGDGDGI  254

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             SIFGS+N+W+DH+SM  C DGLIDAI+ STAITISN HFT HNDV+L GA+D  ++DK+M
Sbjct  255   SIFGSTNIWLDHLSMSECEDGLIDAIQGSTAITISNCHFTHHNDVILLGASDSYSRDKLM  314

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             Q+T+AFNHFGK LIQRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII QGNRFIAP D
Sbjct  315   QVTVAFNHFGKELIQRMPRCRWGFFHVVNNDYTHWKMYAIGGSQHPTIISQGNRFIAPND  374

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAE  370
                KEIT R       W+ W WRS+GD++M GAFF  SG P      H  Y+ +   KA+
Sbjct  375   PWAKEITNRNYAPESVWRHWVWRSEGDLFMNGAFFRTSGPP---APPHLKYNKLQMIKAK  431

Query  369   DVTW---LTRFAGALNCRVGSPC  310
               T+   LTRF+GALNC+    C
Sbjct  432   PATFVRRLTRFSGALNCKKRVKC  454



>ref|XP_007046218.1| Pectate lyase family protein, putative [Theobroma cacao]
 gb|EOY02050.1| Pectate lyase family protein, putative [Theobroma cacao]
Length=441

 Score =   510 bits (1313),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 268/441 (61%), Positives = 328/441 (74%), Gaps = 22/441 (5%)
 Frame = -2

Query  1620  AIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaea  1441
              IIP    HIAEYD+ WR+REAEA EH  +AY PNP  ++    H V RTL         
Sbjct  19    VIIPTLHAHIAEYDDYWRQREAEAKEHFNKAYNPNPEEVTQHFNHHVARTLMGF------  72

Query  1440  eaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKG  1261
                     ++TR  L  K+  GPC ATNPID+CWRC  +W  NRKRLADC+LGFG  T G
Sbjct  73    --------NSTRRSLRGKRRTGPCQATNPIDQCWRCDPNWHRNRKRLADCSLGFGRGTIG  124

Query  1260  GKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GK G +Y VTD +D D  NPKPGTLRHAVIQK+PLWIIF+  M IKL+QELIM  DKTID
Sbjct  125   GKNGRYYIVTDPSDNDMVNPKPGTLRHAVIQKRPLWIIFARSMIIKLNQELIMTSDKTID  184

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
              RGA VH++ GAGITIQF +N+IIHG+HIH I +G+GG+IRD +DH+G RTKSDGDG+S+
Sbjct  185   ARGANVHVAYGAGITIQFARNIIIHGLHIHDIVQGSGGMIRDSVDHYGFRTKSDGDGVSL  244

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FG++N+W+DH+SM NCYDGLIDAI+ STAITISN HFT+HN+VMLFGA+D  ++D+ MQI
Sbjct  245   FGATNIWLDHLSMYNCYDGLIDAIQGSTAITISNCHFTNHNEVMLFGASDSYSEDQKMQI  304

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             T+AF HFGK L+QRMPRCR+G+IHVVNNDYTHW MYAIGGSSHPTII QGNRF+APP+  
Sbjct  305   TVAFTHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTIISQGNRFVAPPNAA  364

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED-  367
              KE+TKR    PE WK W+WRS+GD+ + GAFF QSGDP    +  + + G     A+  
Sbjct  365   AKEVTKRDYAPPEVWKNWSWRSEGDLMVNGAFFTQSGDP----RASRRFLGNFMISAKPG  420

Query  366   --VTWLTRFAGALNCRVGSPC  310
               V+ LTR++G+L+C    PC
Sbjct  421   QMVSLLTRYSGSLDCVRRRPC  441



>emb|CAN79927.1| hypothetical protein VITISV_042447 [Vitis vinifera]
Length=439

 Score =   507 bits (1305),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 268/440 (61%), Positives = 324/440 (74%), Gaps = 22/440 (5%)
 Frame = -2

Query  1620  AIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaea  1441
              + P+   HI E+DEVW++R  EA + A +AY+PNP  ++      VR+++         
Sbjct  19    VLAPSIRAHIGEFDEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKSMQG-------  71

Query  1440  eaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKG  1261
                     +TTR  L S   +GPC ATNPIDRCWRC  DWA NRK+LADC LGFG +T G
Sbjct  72    -------TNTTRRNLRSN--NGPCMATNPIDRCWRCKQDWAKNRKKLADCVLGFGRRTTG  122

Query  1260  GKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GK G FY VTD +D D  +PKPGTLRHAVIQK+PLWIIF+ DM I+L QELIM G+KTID
Sbjct  123   GKDGEFYVVTDASDNDMIDPKPGTLRHAVIQKEPLWIIFARDMIIRLKQELIMAGNKTID  182

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
             GRGA VHI+ G GITIQFVKN+IIH +HIH I    GG+IRD +DH+GLRT SDGDG+SI
Sbjct  183   GRGANVHIAYGCGITIQFVKNIIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGDGVSI  242

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FGSSNVW+DH+SM NC DGL+D I ASTAITISN HFT+HN+VMLFG ++    DKIMQ+
Sbjct  243   FGSSNVWVDHLSMSNCKDGLVDVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDKIMQV  302

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             T+AFNH+G+ L+QRMPRCRYG++HVVNNDYTHW MYAIGGS +PTII QGNRFIAPP++ 
Sbjct  303   TVAFNHYGRGLVQRMPRCRYGFVHVVNNDYTHWLMYAIGGSQNPTIISQGNRFIAPPNMA  362

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKL--YDGVMTFKAE  370
              KE+TKR   +P+EWK+WTW SQGD+   GAFFVQSGDP    K H    YD +      
Sbjct  363   CKEVTKRDYASPDEWKSWTWISQGDLLQNGAFFVQSGDPK---KKHPFTRYDMIKAKPGT  419

Query  369   DVTWLTRFAGALNCRVGSPC  310
              V  LTRF+G+L C+V  PC
Sbjct  420   FVNRLTRFSGSLGCKVNQPC  439



>ref|XP_002282500.3| PREDICTED: pectate lyase [Vitis vinifera]
Length=443

 Score =   507 bits (1305),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 268/440 (61%), Positives = 324/440 (74%), Gaps = 22/440 (5%)
 Frame = -2

Query  1620  AIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaea  1441
              + P+   HI E+DEVW++R  EA + A +AY+PNP  ++      VR+++         
Sbjct  23    VLAPSIRAHIGEFDEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKSMQG-------  75

Query  1440  eaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKG  1261
                     +TTR  L S   +GPC ATNPIDRCWRC  DWA NRK+LADC LGFG +T G
Sbjct  76    -------TNTTRRNLRSN--NGPCMATNPIDRCWRCKQDWAKNRKKLADCVLGFGRRTTG  126

Query  1260  GKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GK G FY VTD +D D  +PKPGTLRHAVIQK+PLWIIF+ DM I+L QELIM G+KTID
Sbjct  127   GKDGEFYVVTDASDNDMIDPKPGTLRHAVIQKEPLWIIFARDMIIRLKQELIMAGNKTID  186

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
             GRGA VHI+ G GITIQFVKN+IIH +HIH I    GG+IRD +DH+GLRT SDGDG+SI
Sbjct  187   GRGANVHIAYGCGITIQFVKNIIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGDGVSI  246

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FGSSNVW+DH+SM NC DGL+D I ASTAITISN HFT+HN+VMLFG ++    DKIMQ+
Sbjct  247   FGSSNVWVDHLSMSNCKDGLVDVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDKIMQV  306

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             T+AFNH+G+ L+QRMPRCRYG++HVVNNDYTHW MYAIGGS +PTII QGNRFIAPP++ 
Sbjct  307   TVAFNHYGRGLVQRMPRCRYGFVHVVNNDYTHWLMYAIGGSQNPTIISQGNRFIAPPNMA  366

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKL--YDGVMTFKAE  370
              KE+TKR   +P+EWK+WTW SQGD+   GAFFVQSGDP    K H    YD +      
Sbjct  367   CKEVTKRDYASPDEWKSWTWISQGDLLQNGAFFVQSGDPK---KKHPFTRYDMIKAKPGT  423

Query  369   DVTWLTRFAGALNCRVGSPC  310
              V  LTRF+G+L C+V  PC
Sbjct  424   FVNRLTRFSGSLGCKVNQPC  443



>emb|CBI22159.3| unnamed protein product [Vitis vinifera]
Length=468

 Score =   507 bits (1305),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 268/440 (61%), Positives = 324/440 (74%), Gaps = 22/440 (5%)
 Frame = -2

Query  1620  AIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaea  1441
              + P+   HI E+DEVW++R  EA + A +AY+PNP  ++      VR+++         
Sbjct  48    VLAPSIRAHIGEFDEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKSMQG-------  100

Query  1440  eaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKG  1261
                     +TTR  L S   +GPC ATNPIDRCWRC  DWA NRK+LADC LGFG +T G
Sbjct  101   -------TNTTRRNLRSN--NGPCMATNPIDRCWRCKQDWAKNRKKLADCVLGFGRRTTG  151

Query  1260  GKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GK G FY VTD +D D  +PKPGTLRHAVIQK+PLWIIF+ DM I+L QELIM G+KTID
Sbjct  152   GKDGEFYVVTDASDNDMIDPKPGTLRHAVIQKEPLWIIFARDMIIRLKQELIMAGNKTID  211

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
             GRGA VHI+ G GITIQFVKN+IIH +HIH I    GG+IRD +DH+GLRT SDGDG+SI
Sbjct  212   GRGANVHIAYGCGITIQFVKNIIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGDGVSI  271

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FGSSNVW+DH+SM NC DGL+D I ASTAITISN HFT+HN+VMLFG ++    DKIMQ+
Sbjct  272   FGSSNVWVDHLSMSNCKDGLVDVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDKIMQV  331

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             T+AFNH+G+ L+QRMPRCRYG++HVVNNDYTHW MYAIGGS +PTII QGNRFIAPP++ 
Sbjct  332   TVAFNHYGRGLVQRMPRCRYGFVHVVNNDYTHWLMYAIGGSQNPTIISQGNRFIAPPNMA  391

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKL--YDGVMTFKAE  370
              KE+TKR   +P+EWK+WTW SQGD+   GAFFVQSGDP    K H    YD +      
Sbjct  392   CKEVTKRDYASPDEWKSWTWISQGDLLQNGAFFVQSGDPK---KKHPFTRYDMIKAKPGT  448

Query  369   DVTWLTRFAGALNCRVGSPC  310
              V  LTRF+G+L C+V  PC
Sbjct  449   FVNRLTRFSGSLGCKVNQPC  468



>ref|XP_010256490.1| PREDICTED: pectate lyase-like [Nelumbo nucifera]
Length=441

 Score =   506 bits (1303),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 266/439 (61%), Positives = 322/439 (73%), Gaps = 16/439 (4%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               I P    HIAE+DEVW++R  EA ++A  AY PNP  +   L   V   +        
Sbjct  18    AVITPTLRAHIAEFDEVWQKRAEEAKKNAMDAYHPNPDEVINHLNMNVHLAMQ-------  70

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                     ++ TR  L +K Y GPC ATNPIDRCWRC  +W+ NRK+LADC +GFG KT 
Sbjct  71    -------ESNGTRRSLKTKPYGGPCLATNPIDRCWRCQKNWSRNRKKLADCVVGFGRKTI  123

Query  1263  GGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTI  1087
             GGKLG FY VTD +D D  NPKPGTLRHAVIQK+PLWIIF+ DM I+L+QEL+M GDKTI
Sbjct  124   GGKLGKFYVVTDGSDNDMLNPKPGTLRHAVIQKEPLWIIFARDMVIRLNQELLMAGDKTI  183

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             D RGA VH++ GAGITIQFVKNVIIHG+H+H I  G+GGLIRD +DH+GLRT+SDGDGIS
Sbjct  184   DARGANVHVAYGAGITIQFVKNVIIHGLHVHDIVPGSGGLIRDSVDHYGLRTQSDGDGIS  243

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             +FG++NVWIDH+SM NC DGLIDAI ++TA+T+SN HFT HN+VMLFGA+   + D +MQ
Sbjct  244   LFGATNVWIDHISMSNCKDGLIDAIMSTTAVTVSNCHFTHHNEVMLFGASGSYSGDAVMQ  303

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             IT+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII QGNRFIAPP +
Sbjct  304   ITVAFNHFGRGLVQRMPRCRWGFAHVVNNDYTHWIMYAIGGSEHPTIISQGNRFIAPPTL  363

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED  367
               KE+TKR      EWK WTWRS+ D+ M GAFFVQSG+P+      K  D +       
Sbjct  364   AAKEVTKRDYAPESEWKHWTWRSEDDLMMNGAFFVQSGNPSRKHPFSK-KDMIPAKPGTY  422

Query  366   VTWLTRFAGALNCRVGSPC  310
             V+ LTRF+GAL C++  PC
Sbjct  423   VSTLTRFSGALGCKINKPC  441



>ref|XP_010033216.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
Length=435

 Score =   503 bits (1295),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 266/439 (61%), Positives = 318/439 (72%), Gaps = 17/439 (4%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               ++P+   HI E+DE W++R  EA + A +A+ P P N++A     V + L        
Sbjct  13    AVLVPSLEAHIKEFDEYWQKRAEEASQAALEAFNPEPENVTAQFNANVNKVLDG------  66

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                     N++TR  L   KY GPC ATNPIDRCWRC  +WA +RKRLA C LGFG KT 
Sbjct  67    --------NNSTRRQLHMHKYSGPCLATNPIDRCWRCRKNWAKDRKRLAKCVLGFGRKTT  118

Query  1263  GGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTI  1087
             GG  G +Y V D +D D  NPKPGTLRHAVIQK+PLWIIF+  M I+L+QEL++   KTI
Sbjct  119   GGLKGKYYVVYDCSDNDVVNPKPGTLRHAVIQKRPLWIIFARSMVIRLNQELMVASHKTI  178

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             DGRGA VHI+ GAGITIQFV+NVIIH I IH I    GG+IRD +DH G+RT SDGDGIS
Sbjct  179   DGRGANVHIAFGAGITIQFVRNVIIHNIRIHDIVTRPGGIIRDAVDHVGIRTMSDGDGIS  238

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             IFGS+N+WIDHVSM+ C DGLIDAIE STAITISNGH+T HNDVMLFGA+DL  +DKIMQ
Sbjct  239   IFGSTNIWIDHVSMKRCQDGLIDAIEGSTAITISNGHYTHHNDVMLFGASDLYPRDKIMQ  298

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             +T+AFNHFGK LIQRMPRCR+G+ HVVNNDYTHW MYAIGGSS PTII QGNRFIAPP++
Sbjct  299   VTVAFNHFGKGLIQRMPRCRWGFFHVVNNDYTHWLMYAIGGSSQPTIISQGNRFIAPPNL  358

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED  367
               KE+TKR   TP+ W++WTWRSQGD+ + GAFFVQSG P  + K +   D +       
Sbjct  359   AAKEVTKRDYATPDVWRSWTWRSQGDLLINGAFFVQSGQP--LKKKYGRKDMIKAKPGTF  416

Query  366   VTWLTRFAGALNCRVGSPC  310
             V  LTRF+G LNC+    C
Sbjct  417   VRRLTRFSGTLNCKPKKRC  435



>ref|XP_008341537.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=454

 Score =   500 bits (1288),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 272/432 (63%), Positives = 325/432 (75%), Gaps = 11/432 (3%)
 Frame = -2

Query  1596  HIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRN  1417
             +IAE+D VW++R  +A + A +AY+PNP  ++      V  T+     E + + +    N
Sbjct  31    NIAEFDSVWQQRALKAQKAALKAYQPNPEQVTEDFNESVEMTI----IEDDHDDDHAAGN  86

Query  1416  DTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYT  1237
              T RHLLG K+Y GPC ATNPIDRCWRC A+WA NRK LA C  GFG KT+GGK G +Y 
Sbjct  87    STGRHLLG-KRYTGPCKATNPIDRCWRCQANWADNRKHLASCVKGFGRKTRGGKKGAYYI  145

Query  1236  VTDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHI  1060
             VTD++DD   +PKPGTLRHAVIQK+PLWIIF+  M I+L QELI+   KTID RGA VHI
Sbjct  146   VTDSSDDNIHDPKPGTLRHAVIQKQPLWIIFARSMVIRLTQELIVTSHKTIDARGANVHI  205

Query  1059  SDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWI  880
             + GAGIT+QFV+NVIIHG+HIH    GNGG+IRD +DH G+RT SDGDGISI+GSSN+W+
Sbjct  206   AHGAGITLQFVQNVIIHGLHIHDTVPGNGGMIRDSVDHIGIRTHSDGDGISIYGSSNIWL  265

Query  879   DHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFG  700
             DH+SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D  + D IMQIT+AFNHFG
Sbjct  266   DHLSMWNCADGLIDAIQGSTAITISNSHFTRHNDVMLFGASDGFSGDAIMQITVAFNHFG  325

Query  699   KRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRV  520
             K LIQRMPRCR+G+IHVVNNDYTHW MYAIGGSSHPTII QGNRFIAPP+   KE+TKR 
Sbjct  326   KGLIQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTIISQGNRFIAPPNQAAKEVTKRD  385

Query  519   KGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKL--YDGVMTFKAEDVTWLTRF  346
                   WK+W WRS+GD+ + GAFFVQSG P+   K+H     D +       VT LTRF
Sbjct  386   YAPESVWKSWQWRSEGDLMINGAFFVQSGVPS---KNHGFGRLDVMKARPGTYVTRLTRF  442

Query  345   AGALNCRVGSPC  310
             AG+LNC+VG PC
Sbjct  443   AGSLNCKVGHPC  454



>ref|XP_007037229.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY21730.1| Pectate lyase family protein [Theobroma cacao]
Length=434

 Score =   497 bits (1279),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 267/435 (61%), Positives = 316/435 (73%), Gaps = 20/435 (5%)
 Frame = -2

Query  1611  PATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaE  1432
             P    +I E+DEVW++R  EA + A +AYEPNP  ++ +L  E  + L            
Sbjct  19    PIVKANIGEFDEVWQKRAEEAKKAALRAYEPNPEKVTDNLNKETGKALKG----------  68

Query  1431  DVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKL  1252
                 +++TR  LG  +Y GPC ATNPIDRCWRC   WA NRK+LA C LGFG +T GGK 
Sbjct  69    ----SNSTRRNLG--RYRGPCLATNPIDRCWRCDPHWAENRKKLATCVLGFGRRTTGGKD  122

Query  1251  GNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRG  1075
             G FY VTD +D D  NPKPGT+RHAVIQK+PLWIIF+HDM I+L++ELIM  DKTIDGRG
Sbjct  123   GRFYVVTDPSDNDMINPKPGTIRHAVIQKEPLWIIFAHDMVIRLNEELIMTSDKTIDGRG  182

Query  1074  AQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgs  895
             A VH   GA IT+Q+++NVIIHGIHI    E NGG+IRD +DHFG RTKSDGDGISIFGS
Sbjct  183   ANVHFFRGAQITLQYIQNVIIHGIHIRLSVEANGGMIRDSVDHFGFRTKSDGDGISIFGS  242

Query  894   SNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLA  715
              N+WIDHVSM  C DGLID I+ASTAITISN HFTDHNDVMLFGA+D  + DKIMQ+T+A
Sbjct  243   HNIWIDHVSMSRCSDGLIDVIQASTAITISNCHFTDHNDVMLFGASDSFSDDKIMQVTVA  302

Query  714   FNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKE  535
             FNHFG+ L+QRMPRCR+G+IHVVNNDYTHW MYAIGGS+ PTI+ QGNRFIAPP+I  KE
Sbjct  303   FNHFGQGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSNQPTILSQGNRFIAPPNIACKE  362

Query  534   ITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWL  355
             +TKR      EWK+W WRS+ D+ M GAFFVQSG P          D +       VT L
Sbjct  363   VTKREYAPESEWKSWNWRSENDLMMNGAFFVQSGSPIGRGNRQ---DVIKAKPGTFVTRL  419

Query  354   TRFAGALNCRVGSPC  310
             TRF+GAL+C    PC
Sbjct  420   TRFSGALHCFKNKPC  434



>ref|XP_010112093.1| putative pectate lyase 7 [Morus notabilis]
 gb|EXC32626.1| putative pectate lyase 7 [Morus notabilis]
Length=437

 Score =   495 bits (1274),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 262/438 (60%), Positives = 321/438 (73%), Gaps = 18/438 (4%)
 Frame = -2

Query  1620  AIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaea  1441
              +IP+   +I ++DE W++R  EA + A +AY+PNP  ++ S   EV + +  +      
Sbjct  17    VLIPSLQANIGDFDESWQQRAEEAHKAALEAYDPNPEEVTDSFNEEVDKVIDGS------  70

Query  1440  eaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKG  1261
                    N T R L   ++Y GPC ATNPIDRCWRC ++WA+NRKRLA C LGFG KT G
Sbjct  71    -------NSTRREL---RRYSGPCAATNPIDRCWRCRSNWASNRKRLARCVLGFGRKTTG  120

Query  1260  GKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             G+ G +Y VTD +D D  NP+PGTLRHAVIQK+PLWIIF+H M I+L QEL++   KTID
Sbjct  121   GRSGRYYVVTDPSDNDVQNPRPGTLRHAVIQKQPLWIIFAHSMIIRLSQELLITSHKTID  180

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
              RGA +HI++GAGITIQF +NVIIHG+HIH I    GG+IRD +DHFG RT +DGDGISI
Sbjct  181   ARGANIHIANGAGITIQFARNVIIHGLHIHDIVASGGGMIRDSVDHFGFRTPADGDGISI  240

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FGS+N+W+DH+SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D    DKIMQ+
Sbjct  241   FGSTNIWLDHISMSNCQDGLIDAIQGSTAITISNCHFTHHNDVMLFGASDSFEGDKIMQV  300

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             T+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGSSHPTII QGNRFIAPP+  
Sbjct  301   TVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSSHPTIISQGNRFIAPPNNA  360

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDV  364
              K++TKR      EWK WTWRS+GD+ M GAFFVQSG+ +   +    +D +       V
Sbjct  361   AKQVTKRDYAAEWEWKRWTWRSEGDLMMNGAFFVQSGNRS-KKRPFTRHDMIKAKPGTFV  419

Query  363   TWLTRFAGALNCRVGSPC  310
             T LTRFAGALNC  G  C
Sbjct  420   TRLTRFAGALNCYAGKKC  437



>ref|XP_004165454.1| PREDICTED: pectate lyase-like [Cucumis sativus]
 gb|KGN64253.1| hypothetical protein Csa_1G045510 [Cucumis sativus]
Length=439

 Score =   494 bits (1271),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 263/437 (60%), Positives = 325/437 (74%), Gaps = 20/437 (5%)
 Frame = -2

Query  1617  IIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeae  1438
             I P    +IA++DEVW++R  EA + + +AYEP+P   + +   +V R+L          
Sbjct  22    IFPTLKANIADFDEVWQKRAIEAQKASFEAYEPHPEEETNNFNKQVHRSLDGG-------  74

Query  1437  aEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGG  1258
                   N+T RHL   +KY GPC ATNPIDRCWRC  +WA NRK+LADCALGFG +T GG
Sbjct  75    ------NNTRRHL---RKYTGPCLATNPIDRCWRCDRNWARNRKKLADCALGFGRRTTGG  125

Query  1257  KLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDG  1081
             K G  Y V D++D D  NPKPGTLRHAVIQ++PLWIIF+HDM I+L +ELI+  DKT+DG
Sbjct  126   KDGKIYVVRDSSDNDLVNPKPGTLRHAVIQERPLWIIFAHDMVIRLSEELIVTDDKTLDG  185

Query  1080  RGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisif  901
             RGA VHI++G  IT+QFVKN+IIH +HIH I  GNGG+IRD + H+G RT+SDGDGIS+F
Sbjct  186   RGANVHIANGGQITLQFVKNIIIHNLHIHDIKAGNGGMIRDSVSHYGFRTRSDGDGISMF  245

Query  900   gsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQIT  721
             G+S VWIDHVSM NC DGLIDA+ ASTAITISN HFT HNDV+L GA++  + D+IMQ+T
Sbjct  246   GASRVWIDHVSMSNCQDGLIDAVMASTAITISNCHFTHHNDVILLGASNGYSNDQIMQVT  305

Query  720   LAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHK  541
             LAFNHFGK L+QRMPRCR+G+IHVVNNDYTHW MYAIGGS +PTII QGNRFIAPP+ + 
Sbjct  306   LAFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSHNPTIISQGNRFIAPPNPNC  365

Query  540   KEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVT  361
             KE+TKRV     EW++W WRS+GD+ M GAFF+QSG+P    K +   D + +     VT
Sbjct  366   KEVTKRVYAPESEWRSWNWRSEGDLMMNGAFFIQSGNP---IKRYSKKDVIHSKPGTFVT  422

Query  360   WLTRFAGALNCRVGSPC  310
              LTRFAG L C+   PC
Sbjct  423   RLTRFAGPLKCKKNQPC  439



>gb|KCW52797.1| hypothetical protein EUGRSUZ_J02132 [Eucalyptus grandis]
Length=451

 Score =   494 bits (1272),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 266/452 (59%), Positives = 318/452 (70%), Gaps = 30/452 (7%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               ++P+   HI E+DE W++R  EA + A +A+ P P N++A     V + L        
Sbjct  16    AVLVPSLEAHIKEFDEYWQKRAEEASQAALEAFNPEPENVTAQFNANVNKVLDG------  69

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                     N++TR  L   KY GPC ATNPIDRCWRC  +WA +RKRLA C LGFG KT 
Sbjct  70    --------NNSTRRQLHMHKYSGPCLATNPIDRCWRCRKNWAKDRKRLAKCVLGFGRKTT  121

Query  1263  GGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTI  1087
             GG  G +Y V D +D D  NPKPGTLRHAVIQK+PLWIIF+  M I+L+QEL++   KTI
Sbjct  122   GGLKGKYYVVYDCSDNDVVNPKPGTLRHAVIQKRPLWIIFARSMVIRLNQELMVASHKTI  181

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             DGRGA VHI+ GAGITIQFV+NVIIH I IH I    GG+IRD +DH G+RT SDGDGIS
Sbjct  182   DGRGANVHIAFGAGITIQFVRNVIIHNIRIHDIVTRPGGIIRDAVDHVGIRTMSDGDGIS  241

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHND-------------VMLF  766
             IFGS+N+WIDHVSM+ C DGLIDAIE STAITISNGH+T HND             VMLF
Sbjct  242   IFGSTNIWIDHVSMKRCQDGLIDAIEGSTAITISNGHYTHHNDTLMFNLHPGTYVQVMLF  301

Query  765   GANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTI  586
             GA+DL  +DKIMQ+T+AFNHFGK LIQRMPRCR+G+ HVVNNDYTHW MYAIGGSS PTI
Sbjct  302   GASDLYPRDKIMQVTVAFNHFGKGLIQRMPRCRWGFFHVVNNDYTHWLMYAIGGSSQPTI  361

Query  585   ICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHH  406
             I QGNRFIAPP++  KE+TKR   TP+ W++WTWRSQGD+ + GAFFVQSG P  + K +
Sbjct  362   ISQGNRFIAPPNLAAKEVTKRDYATPDVWRSWTWRSQGDLLINGAFFVQSGQP--LKKKY  419

Query  405   KLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
                D +       V  LTRF+G LNC+    C
Sbjct  420   GRKDMIKAKPGTFVRRLTRFSGTLNCKPKKRC  451



>ref|XP_008357758.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=459

 Score =   494 bits (1272),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 264/430 (61%), Positives = 316/430 (73%), Gaps = 7/430 (2%)
 Frame = -2

Query  1596  HIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRN  1417
             +IA +D VW+ R  +A + A +AY+PNP  ++      V +T+       E   +D +  
Sbjct  36    NIANFDAVWQERAMKAQKAALKAYQPNPEQVTEDFNESVEQTV-----VEEDLEDDQSAG  90

Query  1416  DTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYT  1237
             ++TR  L  K Y GPC ATNPIDRCWRC A+WA NRK+LA C  GFG KT+GGK G +Y 
Sbjct  91    NSTRRNLRGKXYKGPCKATNPIDRCWRCRANWANNRKKLASCVKGFGRKTRGGKKGAYYI  150

Query  1236  VTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHI  1060
             VTD++DD   +PKPGTLRHAVIQ +PLWIIF+  M I+L QELI+   KTID RGA VHI
Sbjct  151   VTDSSDDNVHDPKPGTLRHAVIQTQPLWIIFARSMVIRLSQELIVTSHKTIDARGANVHI  210

Query  1059  SDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWI  880
             + GAGIT+QFV+NVIIHG+ IH    G+GG+IRD L H G+RT+SDGDGISI+GSSN+W+
Sbjct  211   AHGAGITLQFVQNVIIHGLRIHDTVPGSGGMIRDSLSHIGIRTQSDGDGISIYGSSNIWL  270

Query  879   DHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFG  700
             DH+SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D    D IMQIT+AFNHFG
Sbjct  271   DHLSMWNCADGLIDAIQGSTAITISNCHFTHHNDVMLFGASDAFAGDAIMQITVAFNHFG  330

Query  699   KRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRV  520
             K LIQRMPRCR+G++HVVNNDYTHW MYAIGGSSHPTII QGNRFIAPP+   KE+TKR 
Sbjct  331   KGLIQRMPRCRWGFVHVVNNDYTHWIMYAIGGSSHPTIISQGNRFIAPPNQAAKEVTKRD  390

Query  519   KGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAG  340
                   WK+W WRS+GD+ M GAFFVQSG PN      KL D +       V  LTRFAG
Sbjct  391   YAPESVWKSWQWRSEGDLMMNGAFFVQSGVPNKKHGFGKL-DMIKAKPGTFVRRLTRFAG  449

Query  339   ALNCRVGSPC  310
             +LNC+VG  C
Sbjct  450   SLNCKVGKKC  459



>ref|XP_010066949.1| PREDICTED: pectate lyase [Eucalyptus grandis]
 gb|KCW65002.1| hypothetical protein EUGRSUZ_G02541 [Eucalyptus grandis]
Length=436

 Score =   493 bits (1269),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 268/439 (61%), Positives = 324/439 (74%), Gaps = 18/439 (4%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               ++P+   +I E+DE W +R  EA + A +AY+P+P  +++    +V +          
Sbjct  15    AVLVPSLQANIEEFDEYWAKRAEEAQKDALKAYDPHPETVTSLFNAKVDKA---------  65

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                  V  N++TR  L  KKY GPC ATNPIDRCWRC+ +WA NRKRLA+C LGFG KT+
Sbjct  66    -----VRGNNSTRRQL--KKYKGPCLATNPIDRCWRCNRNWARNRKRLANCVLGFGRKTR  118

Query  1263  GGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTI  1087
             GGK G FY VTD++D D  NPKPGTLRHAV+QK PLWIIF+  M I+L+QELIM  DKTI
Sbjct  119   GGKRGWFYVVTDSSDNDMVNPKPGTLRHAVVQKGPLWIIFAGSMVIRLNQELIMTSDKTI  178

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             D RGA VHI+ GAGIT+QF++NVIIHG+HIH I  G+GGLIRD  DH GLRT SDGDGIS
Sbjct  179   DARGANVHIAYGAGITLQFIRNVIIHGLHIHDIVRGSGGLIRDAHDHVGLRTASDGDGIS  238

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             IFGSS++WIDHVSM  C DGLIDAI+ STAITISN HFT HN+VMLFGA+D  ++D+IMQ
Sbjct  239   IFGSSHLWIDHVSMSACSDGLIDAIQGSTAITISNCHFTHHNEVMLFGASDGYSQDQIMQ  298

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             IT+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII QGNRFIAPP+I
Sbjct  299   ITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPPNI  358

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED  367
               KE+TKR   T ++WK W W+S+GD+ M GAFFV SG+P       +  D +       
Sbjct  359   AAKEVTKRDYATEDQWKNWLWKSEGDLMMNGAFFVNSGNPRARFPFSR-RDVIKAKPGTY  417

Query  366   VTWLTRFAGALNCRVGSPC  310
             V  LTRFAG L CRVG PC
Sbjct  418   VRRLTRFAGKLGCRVGRPC  436



>ref|XP_009342871.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=454

 Score =   492 bits (1267),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 268/430 (62%), Positives = 318/430 (74%), Gaps = 7/430 (2%)
 Frame = -2

Query  1596  HIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRN  1417
             +IA +D VW+ R  +A + A +AY+PNP  ++      V +T+ E   E +  A + TR 
Sbjct  31    NIANFDAVWQERGMKAQKAALKAYQPNPEQVTEDFNESVEQTVVEEDLEDDQSAGNSTR-  89

Query  1416  DTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYT  1237
                RHL G K   GPC ATNPIDRCWRC A+WA NRK+LA C  GFG KT+GGK G +Y 
Sbjct  90    ---RHLRG-KHNKGPCKATNPIDRCWRCRANWANNRKKLASCVKGFGRKTRGGKKGAYYI  145

Query  1236  VTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHI  1060
             VTD++DD   +PKPGTLRHAVIQ +PLWIIF+  M I+L QELI+   KTID RGA VHI
Sbjct  146   VTDSSDDNVHDPKPGTLRHAVIQTQPLWIIFARSMVIRLSQELIVTSHKTIDARGANVHI  205

Query  1059  SDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWI  880
             + GAGIT+QFV+NVIIHG+ IH    G+GG+IRD L H G+RT+SDGDGISI+GSSN+W+
Sbjct  206   AHGAGITLQFVQNVIIHGLRIHDTVPGSGGMIRDSLSHIGIRTQSDGDGISIYGSSNIWL  265

Query  879   DHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFG  700
             DH+SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D    D IMQIT+AFNHFG
Sbjct  266   DHLSMWNCADGLIDAIQGSTAITISNCHFTRHNDVMLFGASDAFAGDAIMQITVAFNHFG  325

Query  699   KRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRV  520
             K LIQRMPRCR+G++HVVNNDYTHW MYAIGGSSHPTII QGNRFIAPP+   KE+TKR 
Sbjct  326   KGLIQRMPRCRWGFVHVVNNDYTHWIMYAIGGSSHPTIISQGNRFIAPPNQAAKEVTKRD  385

Query  519   KGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAG  340
                   WK+W WRS+GD+ M GAFFVQSG PN      KL D +       VT LTRFAG
Sbjct  386   YAPESVWKSWQWRSEGDLMMNGAFFVQSGVPNRKHGFGKL-DMIKAKPGTFVTRLTRFAG  444

Query  339   ALNCRVGSPC  310
             +LNC+VG  C
Sbjct  445   SLNCKVGKKC  454



>ref|XP_010242445.1| PREDICTED: pectate lyase [Nelumbo nucifera]
Length=443

 Score =   491 bits (1263),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 263/439 (60%), Positives = 308/439 (70%), Gaps = 16/439 (4%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
              AIIP    HI ++DEVW++R  EA  +A +AY P+P  +     H V    +E      
Sbjct  20    AAIIPTLRAHIGDFDEVWQKRAEEAKSNALEAYHPDPDEVINHFNHHVHLATAEVR----  75

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                   + N +TR  L +K+Y GPC ATNPIDRCWRC + W  NRK+LADC LGFG KT 
Sbjct  76    ------SGNSSTRRSLRNKEYKGPCMATNPIDRCWRCRSKWGKNRKKLADCVLGFGRKTV  129

Query  1263  GGKLGNFYTVTDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTI  1087
             GGK G FY VTD +DD   NPKPGTLRHAVIQ +PLWIIF HDM I+L QELIM  DKT+
Sbjct  130   GGKYGKFYVVTDGSDDDMENPKPGTLRHAVIQTEPLWIIFEHDMIIRLKQELIMTSDKTL  189

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             DGRGA+VHI+ GAGITIQF+KNVIIH +H H I    GG+IRD ++H G RT SDGD IS
Sbjct  190   DGRGARVHIAYGAGITIQFIKNVIIHNLHFHDIVAREGGMIRDSVNHLGFRTASDGDAIS  249

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             IFGS+NVWIDH SM NC DGL+DAI  STAITISN H T HN+VMLFGA+D    D  MQ
Sbjct  250   IFGSTNVWIDHNSMSNCKDGLVDAIMGSTAITISNNHLTHHNEVMLFGASDSYPDDSKMQ  309

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             IT+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGSS+PTII QGNRFIAPP  
Sbjct  310   ITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSSNPTIISQGNRFIAPPTE  369

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED  367
               K++T R       WK WTWRS+GD+ M GA+F+QSG P       K  D +   K   
Sbjct  370   AAKQVTNRNYAPESVWKHWTWRSEGDLMMNGAYFIQSGKPI-----KKKRDMITAKKGTF  424

Query  366   VTWLTRFAGALNCRVGSPC  310
             V  L RF+GALNC+VG  C
Sbjct  425   VKRLVRFSGALNCKVGKRC  443



>ref|XP_009369346.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=441

 Score =   490 bits (1261),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 270/457 (59%), Positives = 322/457 (70%), Gaps = 20/457 (4%)
 Frame = -2

Query  1674  MEGFNKNNcllllvvcVGAIIPATV-GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISA  1498
             ME   K N  +L +  V   IPATV  +IA +DE W+ R  EA + A +AY  NP  ++ 
Sbjct  3     MEAAYKLNVFILCIFIVAITIPATVTANIAVFDEHWQGRAKEAKQAANKAYNKNPAEVTG  62

Query  1497  SLIHEVRRTLSeavaeaeaeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWA  1318
             S   EV  T               + N+T R+L   +KY GPC ATNPIDRCWRC  +W 
Sbjct  63    SFNKEVHNTFD-------------SMNNTRRNL--KEKYKGPCLATNPIDRCWRCDPNWE  107

Query  1317  TNRKRLADCALGFGYKTKGGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSH  1141
             TNRK+LADCA GFG+KT GGK G  Y VTDN+D D  NPKPGTLRHAVIQ  PLWIIF+H
Sbjct  108   TNRKKLADCAQGFGHKTTGGKAGEIYVVTDNSDNDLVNPKPGTLRHAVIQTGPLWIIFAH  167

Query  1140  DMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIR  961
             DM IKL +EL++  DKTID RGA VHI DG  IT+QFVKNVIIH +HIH    GNGG+IR
Sbjct  168   DMKIKLSEELMVTSDKTIDARGANVHIQDGGQITLQFVKNVIIHNLHIHDNKAGNGGMIR  227

Query  960   DGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHN  781
             D ++H+G RT+SDGDGIS++G+SNVWIDHVS  NC DGLIDAI+ STAITISN HFT+HN
Sbjct  228   DSVNHYGQRTRSDGDGISMYGASNVWIDHVSASNCEDGLIDAIQGSTAITISNCHFTNHN  287

Query  780   DVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGS  601
             DVMLFG++D +++D++MQITLAFNHFG+ L QRMPRCR+G+ HVVNNDYTHW MYAIGGS
Sbjct  288   DVMLFGSSDSNSQDEVMQITLAFNHFGQGLTQRMPRCRWGFFHVVNNDYTHWLMYAIGGS  347

Query  600   SHPTIICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNF  421
              HPTII QGNRFIAP +   KE+TKR       WK+W WRS+ D+ M GAFFV+SG P  
Sbjct  348   QHPTIISQGNRFIAPLNEASKEVTKREYAAENVWKSWNWRSENDLMMNGAFFVESGSP--  405

Query  420   MDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
               ++    D +       V  LTRFAG L C  G PC
Sbjct  406   -IRNLPEADMIQAKPGTFVAKLTRFAGPLKCIKGKPC  441



>gb|KHG08055.1| putative pectate lyase P59 [Gossypium arboreum]
 gb|KHG08558.1| putative pectate lyase P59 [Gossypium arboreum]
Length=440

 Score =   489 bits (1259),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 268/439 (61%), Positives = 317/439 (72%), Gaps = 16/439 (4%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
              AIIPA  GHI EYDE W++RE EA E+ +QAY PNP  ++  + H V R+L        
Sbjct  17    AAIIPALQGHIGEYDENWKQRELEAKENTEQAYNPNPEEVTQHVNHLVSRSL--------  68

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                  +  N T RHL   KK  GPC+ TNPID+CWRC  +W  NR+RLADCA+GF   T 
Sbjct  69    -----MGLNSTRRHLRARKK-GGPCDPTNPIDQCWRCDRNWEKNRQRLADCAIGFARGTI  122

Query  1263  GGKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTI  1087
             GGK G  Y VTD +DD   NPKPGTLRHAVIQK+PLWIIF+  M I+L +ELIM G+KTI
Sbjct  123   GGKYGRIYVVTDPSDDDLLNPKPGTLRHAVIQKEPLWIIFARAMIIRLKEELIMSGNKTI  182

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             D RGA VH++ GAGITIQ+V+NVIIHG+HIHHI  GNGG+IRD ++H+G RTKSDGDGIS
Sbjct  183   DARGANVHVAYGAGITIQYVRNVIIHGLHIHHIVPGNGGMIRDSVNHYGFRTKSDGDGIS  242

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             +FG++NVW+DH+SM  C DGLIDAI+ STAITISN HFT H+ VMLFGAND    D+ MQ
Sbjct  243   LFGATNVWLDHLSMYKCRDGLIDAIQGSTAITISNCHFTHHDQVMLFGANDNHKMDEKMQ  302

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             ITL FNHFGK L+QRMPRCR+G+IHVVNNDYTHW MYAIGGSSHPT+I QGNR+IA   +
Sbjct  303   ITLVFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTVISQGNRYIARRHV  362

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED  367
               KE+TKR    PE WKTW WRS+GD+ + GAFF QSGDP    K  K    V    A  
Sbjct  363   ASKEVTKRDYAPPEVWKTWNWRSEGDLLLNGAFFSQSGDPKASSK-FKGDTKVSAKPAYK  421

Query  366   VTWLTRFAGALNCRVGSPC  310
             V  LT+ +G L C  G  C
Sbjct  422   VDLLTKDSGTLICIRGRAC  440



>gb|EYU34111.1| hypothetical protein MIMGU_mgv1a006386mg [Erythranthe guttata]
Length=446

 Score =   489 bits (1259),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 270/440 (61%), Positives = 321/440 (73%), Gaps = 10/440 (2%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
              + +P+   + A++D+ W +R  +A  +  Q+YE +P  I + L    +R L E      
Sbjct  15    ASALPSISANFADFDDYWLKRSVQAWNNTLQSYESHPAKIVSHLNLHSKRALKEIKDI--  72

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                 ++  N + R L  +  Y GPC ATNPIDRCWRC A+WA NR RLADC LGFGYK K
Sbjct  73    ----NLVSNSSRRQL--AHGYEGPCMATNPIDRCWRCQANWADNRFRLADCGLGFGYKAK  126

Query  1263  GGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTI  1087
             GGK G  Y V D++D D  NPKPGTLRHAVIQ +PLWIIFS  M I+L QELIMQ DKTI
Sbjct  127   GGKGGRIYVVNDSSDGDMVNPKPGTLRHAVIQTEPLWIIFSRSMVIRLSQELIMQSDKTI  186

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             DGRG +VHI+ GAGITIQFVKN+IIHGI IH I  GNGGLIRD +DH+GLRT+SDGDGIS
Sbjct  187   DGRGVRVHITGGAGITIQFVKNIIIHGILIHDIVPGNGGLIRDSVDHYGLRTRSDGDGIS  246

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             I+G+ ++WIDHVSM  C DGLIDAI  ST ITISNGHFTDHN+ MLFGA+D  T+D  MQ
Sbjct  247   IYGAQDIWIDHVSMTKCSDGLIDAIMGSTGITISNGHFTDHNEAMLFGASDSHTQDVKMQ  306

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD-  550
             IT+AFNHFGKR++QRMPRCR+GYIHVVNNDYTHWNMYAIGGS +P II QGNRFIAPPD 
Sbjct  307   ITVAFNHFGKRMVQRMPRCRFGYIHVVNNDYTHWNMYAIGGSKNPIIISQGNRFIAPPDN  366

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAE  370
                KE+TKR       W  W WRS+GDI++ GAFFVQSGD  +  KH + YD +    A 
Sbjct  367   PFAKEVTKREYSPESVWSQWIWRSEGDIFLRGAFFVQSGDATYTSKHPEKYDLIQAASAT  426

Query  369   DVTWLTRFAGALNCRVGSPC  310
              V  +T+FAGAL C+VG PC
Sbjct  427   QVGIMTKFAGALGCKVGQPC  446



>ref|XP_008374522.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=441

 Score =   486 bits (1251),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 261/437 (60%), Positives = 314/437 (72%), Gaps = 20/437 (5%)
 Frame = -2

Query  1614  IPATV-GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeae  1438
             IPATV  +IA +DE W+ R  EA + A +AY  NP  ++ S   EV  T           
Sbjct  23    IPATVTANIAVFDEHWQGRAKEAKQAANKAYNKNPAEVTGSFNKEVHNTFD---------  73

Query  1437  aEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGG  1258
                 + N+T R+L   +KY GPC ATNPIDRCWRC  +W TNRK+LADCA GFG+KT GG
Sbjct  74    ----SMNNTRRNL--KEKYKGPCVATNPIDRCWRCDPNWETNRKKLADCAKGFGHKTTGG  127

Query  1257  KLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDG  1081
             K G  Y VTDN+D D  NPKPGTLRHAVIQ  PLWIIF+HDM IKL +EL++  DKTID 
Sbjct  128   KAGEIYVVTDNSDNDLVNPKPGTLRHAVIQTGPLWIIFAHDMKIKLSEELMVTSDKTIDA  187

Query  1080  RGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisif  901
             RGA VHI DG  IT+QFVKNVIIH +HIH    GNGG+IRD ++H+G RT+SDGDGIS++
Sbjct  188   RGANVHIQDGGQITLQFVKNVIIHNLHIHDNKAGNGGMIRDSVNHYGQRTRSDGDGISMY  247

Query  900   gsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQIT  721
             G+SNVWIDHVS  NC DGLIDAI+ STAITISN HFT+HNDVMLFG++D +++D++MQIT
Sbjct  248   GASNVWIDHVSASNCEDGLIDAIQGSTAITISNCHFTNHNDVMLFGSSDSNSQDEVMQIT  307

Query  720   LAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHK  541
             +AFNHFG+ L QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII QGNRFIAP +   
Sbjct  308   IAFNHFGQGLTQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPXNEAS  367

Query  540   KEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVT  361
             KE+TKR       WK+W WRS+ D+ + GAFF++SG P    ++    D +       V 
Sbjct  368   KEVTKREYAAENVWKSWNWRSENDLMVNGAFFIESGSP---IRNLPEADMIQAKPGTFVA  424

Query  360   WLTRFAGALNCRVGSPC  310
              LTRFAG L C  G PC
Sbjct  425   KLTRFAGPLKCIKGKPC  441



>ref|XP_002311599.2| pectate lyase family protein [Populus trichocarpa]
 gb|EEE88966.2| pectate lyase family protein [Populus trichocarpa]
Length=441

 Score =   486 bits (1250),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 257/439 (59%), Positives = 317/439 (72%), Gaps = 16/439 (4%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
              A +P   GHI E+DE W+++  EA++ AQ+A+ P+P N++     +V + +        
Sbjct  18    AAFVPTLQGHIGEFDEYWKKKADEALKAAQEAFYPDPMNVTNQFNFQVNKVM--------  69

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                   T  ++TR  L SK+  G C ATNPIDRCWRC  +WA++R++LADC LGFG+KT 
Sbjct  70    ------TETNSTRRSLVSKR-GGRCMATNPIDRCWRCDPNWASHRQKLADCVLGFGHKTV  122

Query  1263  GGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTI  1087
             GGK G  Y VTD +D D  NPKPGTLRHAVIQK+PLWIIFS  M I+L+QEL++  +KTI
Sbjct  123   GGKYGKIYVVTDASDNDMLNPKPGTLRHAVIQKEPLWIIFSGSMVIRLNQELMVASNKTI  182

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             D RGA+VHI+ GAGIT+QFV+NVIIHG+ IH I  G+GGL+RD +DH+G RTKSDGDGIS
Sbjct  183   DSRGAKVHIAYGAGITLQFVQNVIIHGLRIHDIVIGSGGLVRDSVDHYGFRTKSDGDGIS  242

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             IFGSSN+WIDHVSM NC DGLID I  S AITISN HFT HN+VMLFGA+D  + D IMQ
Sbjct  243   IFGSSNIWIDHVSMSNCQDGLIDVIMGSNAITISNSHFTRHNEVMLFGASDSYSGDSIMQ  302

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             IT+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS +PTI+ QGNRFIAP + 
Sbjct  303   ITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSHNPTIVSQGNRFIAPNNT  362

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED  367
               KE+TKR      EWK W WRS  D+ M GAFFVQSG P    +    +  + +     
Sbjct  363   FAKEVTKRDYAVESEWKNWNWRSDNDLMMNGAFFVQSGSPITSSRRISRFHVMKSKPGTF  422

Query  366   VTWLTRFAGALNCRVGSPC  310
             VT LTRF+G+L C  G PC
Sbjct  423   VTRLTRFSGSLGCFKGKPC  441



>gb|EYU36839.1| hypothetical protein MIMGU_mgv1a006379mg [Erythranthe guttata]
Length=446

 Score =   485 bits (1249),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 267/437 (61%), Positives = 318/437 (73%), Gaps = 10/437 (2%)
 Frame = -2

Query  1614  IPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaea  1435
             +P+   +  + DE W +R  +A  +  ++YEP+P  I + L     R L E         
Sbjct  18    LPSISANFLDSDEYWVKRSVQAWNNTLESYEPHPAKIVSHLNLHSTRALEEIKDL-----  72

Query  1434  EDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGK  1255
              ++  N + RHL  +  Y GPC ATNPIDRCWRC A+WA NR RLADC LGFGYK KGGK
Sbjct  73    -ELVSNSSRRHL--AHGYDGPCMATNPIDRCWRCQANWADNRFRLADCGLGFGYKAKGGK  129

Query  1254  LGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGR  1078
              G  Y V D++D D  NP PGTLRHAVIQ +PLWIIFS  M I+L QELIMQ DKTIDGR
Sbjct  130   GGRIYVVNDSSDSDMVNPIPGTLRHAVIQTEPLWIIFSRSMVIRLSQELIMQSDKTIDGR  189

Query  1077  GAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifg  898
             G +VHI+ GAGITIQFVKN+IIHG+ IH I  G+GG+IRD +DH+G RT+SDGDGISI+G
Sbjct  190   GVRVHITGGAGITIQFVKNIIIHGLLIHDIVPGDGGMIRDSVDHYGFRTRSDGDGISIYG  249

Query  897   sSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITL  718
             + ++WIDHVSM NC DGLIDAI  ST ITISNGHFTDHN+ MLFGA+D  T+D  MQIT+
Sbjct  250   AQDIWIDHVSMTNCSDGLIDAIMGSTGITISNGHFTDHNEAMLFGASDSHTQDVKMQITV  309

Query  717   AFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD-IHK  541
             AFNHFGKRL+QRMPRCR+GYIHVVNNDYTHWNMYAIGGS +P II QGNRFIAPPD    
Sbjct  310   AFNHFGKRLVQRMPRCRFGYIHVVNNDYTHWNMYAIGGSKNPIIISQGNRFIAPPDNPFA  369

Query  540   KEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVT  361
             KE+TKR       W  W WRS+GDI++ GAFFVQSGDP +  KH + YD +    A  V 
Sbjct  370   KEVTKREYSPESVWSQWIWRSEGDIFLRGAFFVQSGDPTYTSKHPEKYDLIQAASATQVE  429

Query  360   WLTRFAGALNCRVGSPC  310
              +T+FAGAL C++G  C
Sbjct  430   IMTKFAGALGCKIGQVC  446



>ref|XP_002323835.1| hypothetical protein POPTR_0017s11450g [Populus trichocarpa]
 gb|EEF03968.1| hypothetical protein POPTR_0017s11450g [Populus trichocarpa]
Length=452

 Score =   485 bits (1249),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 261/441 (59%), Positives = 319/441 (72%), Gaps = 6/441 (1%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               +IP  +  IA +DEVW++R  EA +    +Y PNP + +     EV  TL +   +  
Sbjct  15    ATLIPGLLADIAFFDEVWQKRAEEAKKVTLNSYIPNPEDATDDFNFEVNNTLVDFDDDRN  74

Query  1443  aeaEDVTRNDTTRHL-LGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKT  1267
                 ++  N T R+L  G KKY GPC  TNPID+CWRC  +WA NRKRLA CALGFG + 
Sbjct  75    DAGFELHANSTRRNLKQGKKKYLGPCKVTNPIDKCWRCRRNWARNRKRLAKCALGFGRRA  134

Query  1266  KGGKLGNFYTVTDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKT  1090
              GG  G  Y VT+N+DD   NPKPGTLRHAVIQK PLWIIFS +M+I+L +ELIM   KT
Sbjct  135   TGGLKGRVYVVTENSDDDVMNPKPGTLRHAVIQKGPLWIIFSKNMNIRLSKELIMTSHKT  194

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             IDGRG  +HI+ GAGITIQF++NVIIHGI IHHI   +GG IRD ++H+G+RT SDGDGI
Sbjct  195   IDGRGHHIHIAYGAGITIQFIQNVIIHGIRIHHIVATSGGNIRDSVEHYGIRTNSDGDGI  254

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             SIFGSSN+WIDHVSM  C DGLIDAI  STAITISN HFT HND +L GA+D  + D++M
Sbjct  255   SIFGSSNIWIDHVSMSRCTDGLIDAIMGSTAITISNSHFTHHNDAILLGASDSFSGDELM  314

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             Q+T+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII QGNRFIAPP+
Sbjct  315   QVTVAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWRMYAIGGSKHPTIISQGNRFIAPPE  374

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAE  370
             +H K++TKR   T  EWKTWTWRS+ D+ M GAFF++SG P     H K    ++T K  
Sbjct  375   LHLKQVTKRDYATESEWKTWTWRSENDLMMNGAFFIESGKPRTKRPHKKF---MITAKPG  431

Query  369   DV-TWLTRFAGALNCRVGSPC  310
              + T +T FAGAL+C+ G  C
Sbjct  432   SLATRMTLFAGALDCKSGRKC  452



>ref|XP_007227702.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
 gb|EMJ28901.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
Length=446

 Score =   485 bits (1248),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 264/429 (62%), Positives = 308/429 (72%), Gaps = 18/429 (4%)
 Frame = -2

Query  1590  AEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRNDT  1411
              + D  W++R  EA + A Q++E +P  ++      V   L             + +N T
Sbjct  34    VQLDIYWKQRAEEAKKEAMQSFETDPEQVTEEFNSNVGELL-------------MKQNGT  80

Query  1410  TRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVT  1231
              RHL G+KKY+GPC ATNP+D CWRC  +WA NRKRLADC  GFG KT GGK G  Y VT
Sbjct  81    RRHLRGNKKYNGPCMATNPMDACWRCDKNWAKNRKRLADCVQGFGKKTTGGKAGPIYVVT  140

Query  1230  DNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISD  1054
             D +D D  NPKPGTLRHAVIQK PLWIIF+ +M I+L QEL++  DKTIDGRGA V+I +
Sbjct  141   DPSDLDLVNPKPGTLRHAVIQKGPLWIIFARNMVIRLQQELLVTSDKTIDGRGANVNIHN  200

Query  1053  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  874
             GAGIT+QFVKNVII  +HI  I    GG+IRD +DH G RTKSDGDGISIFGSSNVWIDH
Sbjct  201   GAGITLQFVKNVIITNLHIKKIVPKQGGMIRDSVDHIGRRTKSDGDGISIFGSSNVWIDH  260

Query  873   VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKR  694
             VSM NC DGLIDAI  STAITISN HFT HNDVMLFGA++  T+DKIMQIT+AFNHFG+ 
Sbjct  261   VSMENCADGLIDAIMGSTAITISNSHFTHHNDVMLFGASNSYTQDKIMQITVAFNHFGQG  320

Query  693   LIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKG  514
             L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS +PTII QGNRFIAPP+   KE+TKR   
Sbjct  321   LVQRMPRCRHGFFHVVNNDYTHWLMYAIGGSMNPTIISQGNRFIAPPNQGAKEVTKRDHT  380

Query  513   TPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFK-AEDVTWLTRFAGA  337
                EWK W WRS+GD+ M GA FVQSG      KH    D +M FK    V  LT+F+GA
Sbjct  381   AEAEWKNWEWRSEGDLMMNGAVFVQSGSGK--SKHPAKMD-LMPFKPGTYVAKLTKFSGA  437

Query  336   LNCRVGSPC  310
             L+C VG PC
Sbjct  438   LDCFVGKPC  446



>emb|CDP14850.1| unnamed protein product [Coffea canephora]
Length=435

 Score =   484 bits (1246),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 258/438 (59%), Positives = 315/438 (72%), Gaps = 19/438 (4%)
 Frame = -2

Query  1620  AIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaea  1441
             A++     HIAE+DEVW++R  EA + A+QAY PNP N+++    EV R++         
Sbjct  16    ALVYTIEAHIAEFDEVWQKRAEEAKKAARQAYHPNPENVTSHFNEEVHRSIDG-------  68

Query  1440  eaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKG  1261
                    N   R L    KY+GPC ATNPID+CWRC  +W  NR +LADCALGFG    G
Sbjct  69    ------HNSRRRDL---HKYNGPCTATNPIDQCWRCQKNWRKNRMKLADCALGFGRHATG  119

Query  1260  GKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GK G  Y VTD +D D  NPKPGTLRHA+IQ +PLW+IF+ +M I+L QELIM  +KTID
Sbjct  120   GKGGRIYKVTDPSDNDLVNPKPGTLRHALIQPEPLWVIFTKNMVIRLSQELIMTSNKTID  179

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
             GRG QVHI+ GAG T+QFV N+IIH +HIH I  GNGG+IRD ++H+G+R++SDGDGISI
Sbjct  180   GRGVQVHIAYGAGFTLQFVHNIIIHNLHIHDIKSGNGGMIRDSVNHYGIRSRSDGDGISI  239

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             +GS+N+WIDH+SM NC DGLIDA++ASTAITISNGHFT HN+ MLFGA+D  + D IMQI
Sbjct  240   YGSTNIWIDHISMSNCNDGLIDAVQASTAITISNGHFTHHNEAMLFGASDSYSDDSIMQI  299

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             TLAFNHFG+ + QRMPR R+G++HVVNNDYTHW MYAIGGS HPTI+ QGNRFIAP + +
Sbjct  300   TLAFNHFGQGIEQRMPRARWGFVHVVNNDYTHWLMYAIGGSQHPTILSQGNRFIAPENPY  359

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDV  364
              KE+TKR       WK W W+SQGD+ M GAFFVQSGDPN     +   D +     E  
Sbjct  360   AKEVTKRDYAPESVWKDWVWKSQGDLMMNGAFFVQSGDPNHNFGSNA--DLIGPKPGEFA  417

Query  363   TWLTRFAGALNCRVGSPC  310
               LTRFAGALNC    PC
Sbjct  418   NRLTRFAGALNCIAKRPC  435



>ref|XP_011005067.1| PREDICTED: probable pectate lyase P59 [Populus euphratica]
Length=452

 Score =   484 bits (1247),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 258/440 (59%), Positives = 315/440 (72%), Gaps = 4/440 (1%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               +IPA +  IA +DEVW++R  EA +    +Y PNP + +     EV  TL +   +  
Sbjct  15    ATLIPALLADIAFFDEVWQKRAEEAKKVTLNSYVPNPEDATDDFNFEVNNTLVDFDDDGN  74

Query  1443  aeaEDVTRNDTTRHL-LGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKT  1267
                 ++  N T R+L  G KKY GPC  TNPID+CWRC  +WA NRKRLA CALGFG + 
Sbjct  75    DAGFELLANSTRRNLKQGKKKYLGPCKVTNPIDKCWRCRRNWARNRKRLAKCALGFGRRA  134

Query  1266  KGGKLGNFYTVTDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKT  1090
              GG  G  Y VT+N+DD   NPKPGTLRHAVIQK+PLWIIFS +M+I+L +ELIM   KT
Sbjct  135   TGGLKGRVYVVTENSDDDVMNPKPGTLRHAVIQKEPLWIIFSKNMNIRLSKELIMTSHKT  194

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             IDGRG  +HI+ GAGITIQF++NVIIHGI IHHI   +GG IRD + H+G+RT SDGDGI
Sbjct  195   IDGRGHHIHIAYGAGITIQFIQNVIIHGIRIHHIVATSGGNIRDSVGHYGIRTNSDGDGI  254

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             SIFGSSN+WIDHVSM  C DGLIDAI  STAITISN HFT HND +L GA+D  + D++M
Sbjct  255   SIFGSSNIWIDHVSMSRCTDGLIDAIMGSTAITISNSHFTHHNDAILLGASDSFSGDELM  314

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             Q+T+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTI+ QGNRFIAPP+
Sbjct  315   QVTVAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWRMYAIGGSKHPTIVSQGNRFIAPPE  374

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAE  370
             +H K++TKR      EWKTWTWRS+ D+ M GAFF++SG P     H K    +      
Sbjct  375   LHLKQVTKRDYAPESEWKTWTWRSENDLMMNGAFFIESGKPRTKRPHKKFM--ITAKPGS  432

Query  369   DVTWLTRFAGALNCRVGSPC  310
               T +T FAGAL+C+ G  C
Sbjct  433   LATRMTLFAGALDCKSGRKC  452



>ref|XP_010068708.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
 gb|KCW64557.1| hypothetical protein EUGRSUZ_G02162 [Eucalyptus grandis]
Length=435

 Score =   484 bits (1245),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 263/437 (60%), Positives = 322/437 (74%), Gaps = 22/437 (5%)
 Frame = -2

Query  1614  IPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaea  1435
             +P    +IA++DEVW++R  EA +   +AYEP+P  ++    H V               
Sbjct  19    VPVLRANIADFDEVWQKRAEEAKKATIKAYEPDPAKVAEDFNHRVHE-------------  65

Query  1434  EDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGK  1255
              D+ R++ TR  L  K+  G C ATNPIDRCWRC  DWA++RKRLA+CALGFG  T GGK
Sbjct  66    -DMQRSNNTRRSL--KRTKGGCLATNPIDRCWRCRKDWASHRKRLANCALGFGRGTTGGK  122

Query  1254  LGNFYTVTDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGR  1078
              G  Y VTD +DD   NPKPGTLRHAVIQ +PLWIIF+H+M I+L +ELI+  +KTIDGR
Sbjct  123   AGKIYKVTDPSDDNLMNPKPGTLRHAVIQPEPLWIIFAHNMVIRLSEELIVTDNKTIDGR  182

Query  1077  GAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifg  898
             GA VHI DGA IT+QFV+NVIIHG+HIH    GNGGLIRD L+H+G RT SDGDGIS+FG
Sbjct  183   GANVHICDGAQITLQFVRNVIIHGLHIHDTHPGNGGLIRDSLEHYGFRTGSDGDGISLFG  242

Query  897   sSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITL  718
             ++NVWIDHVSM +CYDGLID I+ASTAITISN HFT HN+VMLFG +D  + D  MQIT+
Sbjct  243   ATNVWIDHVSMSHCYDGLIDVIQASTAITISNCHFTRHNEVMLFGGSDTYSDDAHMQITV  302

Query  717   AFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKK  538
             AFNHFG+ L+QRMPRCR+G++HVVNNDYTHW MYAIGGS HPTII QGNRFIAP D + K
Sbjct  303   AFNHFGQGLVQRMPRCRWGFVHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPLDPNCK  362

Query  537   EITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDP-NFMDKHHKLYDGVMTFKAEDVT  361
             E+TKR     + WK+W+WRS+ D+ + GAFFVQSG P   ++K++ +     +F    VT
Sbjct  363   EVTKRDYAAEDVWKSWSWRSEDDLMLNGAFFVQSGSPIRNVNKNNVIKAKPGSF----VT  418

Query  360   WLTRFAGALNCRVGSPC  310
              LTRFAGALNC  G PC
Sbjct  419   RLTRFAGALNCVKGKPC  435



>gb|KHG16093.1| hypothetical protein F383_07683 [Gossypium arboreum]
Length=454

 Score =   483 bits (1243),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 262/436 (60%), Positives = 321/436 (74%), Gaps = 13/436 (3%)
 Frame = -2

Query  1599  GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTR  1420
             G+IA++D+VW+RR  +A ++   AYEP+P N+++     V + L   VA    + +D+  
Sbjct  26    GNIADFDDVWKRRADQAWKNTLAAYEPSPENVTSKFNENVHKAL---VANKSNKTKDLEG  82

Query  1419  NDTTRHLLGS-KKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNF  1243
             ++  R+L G  KKY GPC ATNPIDRCWRC  DWA NRKRL  C +GFG++T+GG+ G +
Sbjct  83    SEDRRNLRGKHKKYTGPCMATNPIDRCWRCRPDWAENRKRLTQCVIGFGHRTEGGEKGKY  142

Query  1242  YTVTDNADD-PSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQV  1066
             Y VTDN+DD P NPKPGTLR AVIQK+PLWIIF+HDM IKL +ELI+Q  KTIDGRGA V
Sbjct  143   YEVTDNSDDDPVNPKPGTLRFAVIQKRPLWIIFAHDMHIKLSRELIVQSKKTIDGRGANV  202

Query  1065  HISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNV  886
             HI+ GAGIT+QFV +VIIH IHIHHI     GLIRD +DH GLRT  DGDGI+IFGS+N+
Sbjct  203   HIAHGAGITLQFVDDVIIHSIHIHHIGPSKAGLIRDSVDHIGLRTTGDGDGINIFGSTNI  262

Query  885   WIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNH  706
             W+DH+SM  C DGLIDAI+ STAITISN HFT HNDV+L GA+D   +DK+MQ+T+AFNH
Sbjct  263   WLDHLSMSECQDGLIDAIQGSTAITISNCHFTHHNDVILLGASDTYERDKLMQVTVAFNH  322

Query  705   FGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITK  526
             FGK LIQRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII QGNRFIAP D   KEIT 
Sbjct  323   FGKELIQRMPRCRWGFFHVVNNDYTHWKMYAIGGSMHPTIISQGNRFIAPDDPKAKEITN  382

Query  525   RVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKL-YDGVMTFKAEDVTW---  358
             R      EW  W WRS+GD+ + GA F +SG     DK  +  +  +   KA+  T+   
Sbjct  383   RNYAPQSEWSKWVWRSEGDLLLNGARFTKSGP----DKSPQFDFTKMQMIKAKPATFVRR  438

Query  357   LTRFAGALNCRVGSPC  310
             LTRFAGAL+C  G+ C
Sbjct  439   LTRFAGALDCEKGNKC  454



>ref|XP_010105747.1| putative pectate lyase P59 [Morus notabilis]
 gb|EXC05967.1| putative pectate lyase P59 [Morus notabilis]
Length=421

 Score =   481 bits (1238),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 266/433 (61%), Positives = 316/433 (73%), Gaps = 18/433 (4%)
 Frame = -2

Query  1599  GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTR  1420
              HIAE+D+ W+ R  +A + A QAY P+P  ++  L ++V   L+              +
Sbjct  4     AHIAEFDDYWKSRAEQAQKDALQAYHPHPEEVTNQLNYDVEEALT-------------VK  50

Query  1419  NDTTRHLLGSK-KYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNF  1243
             N T R L G K K  GPC ATNPIDRCWRC  +WA+NRKRLADCA GFG  + GGK G +
Sbjct  51    NSTRRVLRGKKNKKGGPCMATNPIDRCWRCDPNWASNRKRLADCARGFGRNSVGGKFGRY  110

Query  1242  YTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQV  1066
             Y VTD++D D  NPKPGTLRHAVIQK PLWIIF+  M I+L +ELIM GDKTIDGRGA V
Sbjct  111   YVVTDSSDTDLVNPKPGTLRHAVIQKAPLWIIFARSMIIRLSEELIMTGDKTIDGRGANV  170

Query  1065  HISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNV  886
              I+ GAGITIQFVKNVIIH IHIH I  G+GG IRD ++H G RTKSDGDGISIFGSS++
Sbjct  171   RIAYGAGITIQFVKNVIIHNIHIHDINAGSGGNIRDSINHIGFRTKSDGDGISIFGSSHI  230

Query  885   WIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNH  706
             WIDHVSM NC DGLIDAI  STAITISN HFT HN+VMLFGA+D  + D+ MQ+T+AFNH
Sbjct  231   WIDHVSMSNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDSYSDDQRMQVTVAFNH  290

Query  705   FGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITK  526
             FG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII QGNRFIAP D++ K++TK
Sbjct  291   FGQGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPLDLNAKQVTK  350

Query  525   RVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED-VTWLTR  349
             R      +WK W WRS+GD+ M GAFFVQSG    + K      G++ +K    VT LTR
Sbjct  351   RDYAPESDWKNWRWRSEGDLLMNGAFFVQSGKR--LSKRRYSRPGMIKYKPGTFVTRLTR  408

Query  348   FAGALNCRVGSPC  310
             +AG L C +G PC
Sbjct  409   YAGTLVCGIGRPC  421



>ref|XP_002272638.2| PREDICTED: pectate lyase-like [Vitis vinifera]
Length=434

 Score =   481 bits (1238),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 267/438 (61%), Positives = 323/438 (74%), Gaps = 20/438 (5%)
 Frame = -2

Query  1620  AIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaea  1441
              I+PA   +I ++DEVW+ R  EA + A QAY P+P  ++ +   +V ++          
Sbjct  16    VIVPAVTANIGDFDEVWQTRAEEARKAALQAYNPHPEKVTDNFNKKVHKSFD--------  67

Query  1440  eaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKG  1261
                  + N T R+L    K+ G C ATNPIDRCWRC +DWA+NR +LADC LGFG KT G
Sbjct  68    -----STNHTRRNL---SKFSGLCMATNPIDRCWRCRSDWASNRMKLADCVLGFGQKTTG  119

Query  1260  GKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GK G  Y VTD +D D  NPKPGTLRHA IQ++PLWIIF+H M I+L++ELIM  +KTID
Sbjct  120   GKGGKIYVVTDPSDNDMVNPKPGTLRHAAIQEEPLWIIFAHSMAIRLNEELIMTSNKTID  179

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
              RGA VHI++GAG+T+QFV N+IIHG+HIH I  GNGGLIRD   H+G RT+SDGDGISI
Sbjct  180   ARGANVHIANGAGLTLQFVHNIIIHGLHIHDIKVGNGGLIRDSASHYGFRTRSDGDGISI  239

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FG++N+WIDH+SM NC DGLIDAI ASTAITISN HFT HN+VMLFGA+D  + D IMQI
Sbjct  240   FGATNIWIDHISMSNCADGLIDAIMASTAITISNCHFTHHNEVMLFGASDGYSGDAIMQI  299

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             T+ FNHFG+ L QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTI+ QGNRFIAPPDI+
Sbjct  300   TITFNHFGQGLTQRMPRCRWGFFHVVNNDYTHWLMYAIGGSHHPTILSQGNRFIAPPDIN  359

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDV  364
              KE+TKR       WK+WTWRSQGD+ M GAFFV+SGDPNF D  +K    +       V
Sbjct  360   CKEVTKRDYSPESVWKSWTWRSQGDLMMNGAFFVESGDPNF-DFSNKYV--IRAKPGAFV  416

Query  363   TWLTRFAGALNCRVGSPC  310
             T LTRF+GAL+CR G PC
Sbjct  417   TRLTRFSGALSCREGMPC  434



>ref|XP_004155392.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=432

 Score =   480 bits (1236),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 265/429 (62%), Positives = 319/429 (74%), Gaps = 18/429 (4%)
 Frame = -2

Query  1593  IAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRND  1414
             I ++D+ W+ R A A + A  AY+P+P  ++ S+  E+    S              RN 
Sbjct  21    IGDFDDYWKARAAAAEKAAADAYDPDPETVANSVNAEIAHASSG-------------RNS  67

Query  1413  TTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTV  1234
             T R+L   KKY GPC ATNPIDRCWRC  +WA NRK+LADC LGFG KT GGKLG +Y V
Sbjct  68    TRRNL---KKYAGPCLATNPIDRCWRCDPNWAQNRKKLADCVLGFGRKTTGGKLGPYYVV  124

Query  1233  TDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHIS  1057
              D++D D  NPKPGTLRHAVIQK PLWIIFS +M I+L QELIM  DKTID RGA V I+
Sbjct  125   NDSSDSDLMNPKPGTLRHAVIQKGPLWIIFSXNMAIRLSQELIMTSDKTIDARGANVQIA  184

Query  1056  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  877
              GAGIT+Q+++NVIIHG+ IHHI  G+GG+IRD +DH GLRT SDGDGISIFGSSNVWID
Sbjct  185   YGAGITLQYIRNVIIHGLRIHHIVVGSGGMIRDAVDHVGLRTMSDGDGISIFGSSNVWID  244

Query  876   HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGK  697
             HVSM NC+DGLIDAI  STAITISN HFT HN+VMLFGA+D  ++D+IMQIT+AFNHFG+
Sbjct  245   HVSMSNCHDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDGYSQDQIMQITVAFNHFGQ  304

Query  696   RLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVK  517
              L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTI+ QGNRFIAPP+++ KE+TKR  
Sbjct  305   GLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNVYAKEVTKREY  364

Query  516   GTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGA  337
                + WK+WTWRS+GD+ M GAFFV SGD +      ++ D +       V  +TRFAG+
Sbjct  365   SPEQVWKSWTWRSEGDLMMNGAFFVTSGDQSKRRPFSRM-DMISYKPGTYVKRMTRFAGS  423

Query  336   LNCRVGSPC  310
             L C VG PC
Sbjct  424   LACFVGRPC  432



>ref|XP_004135462.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
 gb|KGN51889.1| hypothetical protein Csa_5G604340 [Cucumis sativus]
Length=432

 Score =   480 bits (1236),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 265/429 (62%), Positives = 319/429 (74%), Gaps = 18/429 (4%)
 Frame = -2

Query  1593  IAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRND  1414
             I ++D+ W+ R A A + A  AY+P+P  ++ S+  E+    S              RN 
Sbjct  21    IGDFDDYWKARAAAAEKAAADAYDPDPETVANSVNAEIAHASSG-------------RNS  67

Query  1413  TTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTV  1234
             T R+L   KKY GPC ATNPIDRCWRC  +WA NRK+LADC LGFG KT GGKLG +Y V
Sbjct  68    TRRNL---KKYAGPCLATNPIDRCWRCDPNWAQNRKKLADCVLGFGRKTTGGKLGPYYVV  124

Query  1233  TDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHIS  1057
              D++D D  NPKPGTLRHAVIQK PLWIIFS +M I+L QELIM  DKTID RGA V I+
Sbjct  125   NDSSDSDLMNPKPGTLRHAVIQKGPLWIIFSTNMAIRLSQELIMTSDKTIDARGANVQIA  184

Query  1056  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  877
              GAGIT+Q+++NVIIHG+ IHHI  G+GG+IRD +DH GLRT SDGDGISIFGSSNVWID
Sbjct  185   YGAGITLQYIRNVIIHGLRIHHIVVGSGGMIRDAVDHVGLRTMSDGDGISIFGSSNVWID  244

Query  876   HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGK  697
             HVSM NC+DGLIDAI  STAITISN HFT HN+VMLFGA+D  ++D+IMQIT+AFNHFG+
Sbjct  245   HVSMSNCHDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDGYSQDQIMQITVAFNHFGQ  304

Query  696   RLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVK  517
              L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTI+ QGNRFIAPP+++ KE+TKR  
Sbjct  305   GLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNVYAKEVTKREY  364

Query  516   GTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGA  337
                + WK+WTWRS+GD+ M GAFFV SGD +      ++ D +       V  +TRFAG+
Sbjct  365   SPEQVWKSWTWRSEGDLMMNGAFFVTSGDQSKRRPFSRM-DMISYKPGTYVKRMTRFAGS  423

Query  336   LNCRVGSPC  310
             L C VG PC
Sbjct  424   LACFVGRPC  432



>ref|XP_002270089.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32015.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   480 bits (1236),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 265/443 (60%), Positives = 316/443 (71%), Gaps = 22/443 (5%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               I P    HIAEYD+ W+ RE EA + A +A+ P P  ++      V   L+ +     
Sbjct  18    AVIAPTIRAHIAEYDDYWKEREEEAKKAALEAFHPTPQEVNDHFNLHVEDELTGS-----  72

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                     N T R L  +K   GPC ATNPIDRCWRC  +WA+ RKRLADC LGFG  T 
Sbjct  73    --------NGTRRSLRVNK---GPCKATNPIDRCWRCRPNWASQRKRLADCVLGFGRNTV  121

Query  1263  GGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTI  1087
             GGK G +Y VTD +D D  NPK GTLRHAVIQ +PLWI+F+  M I+L+QELIM  DKTI
Sbjct  122   GGKYGKYYFVTDPSDNDMVNPKKGTLRHAVIQPRPLWIVFARSMIIRLNQELIMTSDKTI  181

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             DGRG  VHI+ GAGITIQFVKNVIIHG+HIH I  G+GGLIRD ++HFG R++SDGDGIS
Sbjct  182   DGRGVNVHIAYGAGITIQFVKNVIIHGLHIHDIVSGSGGLIRDSVNHFGYRSRSDGDGIS  241

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             I+GSS+VWIDH SM NC DGLIDAI+ STAITISN HFT HN+VMLFGA+D ++ D+IMQ
Sbjct  242   IYGSSHVWIDHNSMSNCKDGLIDAIQGSTAITISNNHFTKHNEVMLFGASDSNSADEIMQ  301

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAP---  556
             IT+AFNHFG+ LIQRMPRCR+G+ HVVNNDYTHWNMYAIGGS+HPTII QGNR+ AP   
Sbjct  302   ITVAFNHFGRGLIQRMPRCRWGFFHVVNNDYTHWNMYAIGGSAHPTIISQGNRYTAPHLV  361

Query  555   -PDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTF  379
              P    K++TKR      EWK WTWRS+GD+   GAFFV SG+P+    + +L D +   
Sbjct  362   DPKHDAKQVTKRDYAMESEWKKWTWRSEGDLMRNGAFFVPSGNPSKRMPYSRL-DMIKAK  420

Query  378   KAEDVTWLTRFAGALNCRVGSPC  310
                 V+ LTRF+GAL CR G PC
Sbjct  421   PGTYVSRLTRFSGALTCRRGGPC  443



>ref|XP_007153840.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
 gb|ESW25834.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
Length=447

 Score =   480 bits (1236),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 260/430 (60%), Positives = 304/430 (71%), Gaps = 17/430 (4%)
 Frame = -2

Query  1596  HIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRN  1417
             H  E+D  W+ R   A      AY P+P+++S +L   V                 +   
Sbjct  34    HENEFDPYWKGRAETAAVDNNAAYFPDPYSVSGNLSSSVSEL--------------IVGK  79

Query  1416  DTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYT  1237
             D  R+L G ++Y GPC ATNPIDRCWRC  +WA NR++LADC  GFG  T GGK G FY 
Sbjct  80    DKRRNLKG-QRYTGPCMATNPIDRCWRCDPNWANNRQKLADCVQGFGRNTVGGKGGPFYV  138

Query  1236  VTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHI  1060
             VTD +DD   + KPGTLRHAV +  PLWIIF   M IKL QELIM  DKTIDGRG +V+I
Sbjct  139   VTDPSDDNMVDLKPGTLRHAVTRTGPLWIIFERSMMIKLKQELIMTSDKTIDGRGVEVYI  198

Query  1059  SDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWI  880
             + GAGIT+QF++NVIIHGI ++ I    GG+IRD   H+GLRT+SDGDGISIFGSSN+WI
Sbjct  199   ASGAGITVQFIRNVIIHGIKVYDIQVHGGGMIRDSETHYGLRTQSDGDGISIFGSSNIWI  258

Query  879   DHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFG  700
             DHVSMRNCYDGLIDAI  STAITISN HFTDHN+ MLFGA+D   KDKIMQITLAFNHFG
Sbjct  259   DHVSMRNCYDGLIDAIMGSTAITISNSHFTDHNEAMLFGASDSYDKDKIMQITLAFNHFG  318

Query  699   KRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRV  520
             KRL+QRMPRCRYG++HVVNNDYTHW MYAIGGS HPTII +GNRFI P ++H KEITKR 
Sbjct  319   KRLVQRMPRCRYGFVHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIGPDNVHAKEITKRE  378

Query  519   KGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAG  340
                  EW +W WRS  D YM GAFFVQSG P  +D+     D +       V  LTR+AG
Sbjct  379   YSPESEWSSWQWRSINDEYMNGAFFVQSG-PELVDRPFSRQDMIKAKPGSYVGRLTRYAG  437

Query  339   ALNCRVGSPC  310
             +L+CRVG PC
Sbjct  438   SLSCRVGLPC  447



>ref|XP_011025954.1| PREDICTED: probable pectate lyase P59 [Populus euphratica]
Length=441

 Score =   480 bits (1235),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 256/439 (58%), Positives = 314/439 (72%), Gaps = 16/439 (4%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
                +P   GHI E+DE W+++  EA + AQ+A+ P+P N+++    +V + L+E      
Sbjct  18    AVFVPTLQGHIGEFDEYWKKKADEARKAAQEAFYPDPLNVTSQFNFQVNKVLTET-----  72

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                     N T R L+  +K  G C ATNPIDRCWRC  +WA++R++LADC LGFG+KT 
Sbjct  73    --------NSTRRSLV--RKRGGRCIATNPIDRCWRCDPNWASHRQKLADCVLGFGHKTV  122

Query  1263  GGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTI  1087
             GGK G  Y VTD +D D  NPKPGTLRHAVIQK+PLWIIFS  M I+L+QEL++  +KTI
Sbjct  123   GGKYGKIYVVTDASDNDMLNPKPGTLRHAVIQKEPLWIIFSGSMVIRLNQELMVASNKTI  182

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             D RG +VHI+ GAGIT+QF +NVIIHG+ IH I  G+GGLIRD +DH+G RTKSDGDGIS
Sbjct  183   DSRGFKVHIAYGAGITLQFAQNVIIHGLRIHDIVSGSGGLIRDSVDHYGFRTKSDGDGIS  242

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             IFGSSN+WIDHVSM NC DGLID I  S AITISN HFT HN+VMLFGA+D  + D IMQ
Sbjct  243   IFGSSNIWIDHVSMSNCQDGLIDVIMGSNAITISNSHFTRHNEVMLFGASDSYSGDSIMQ  302

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             IT++FNHFGK L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS +PTI+ QGNRFIAP + 
Sbjct  303   ITVSFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSHNPTIVSQGNRFIAPGNT  362

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED  367
               KE+TKR      EWK W WRS  D+ M GAFFVQSG P    +    +  + +     
Sbjct  363   FAKEVTKRDYAVESEWKNWNWRSDNDLMMNGAFFVQSGSPITSSRRISRFHVMKSKPGTF  422

Query  366   VTWLTRFAGALNCRVGSPC  310
             VT LTRF+G+L C  G PC
Sbjct  423   VTRLTRFSGSLGCFKGKPC  441



>ref|XP_004152537.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=434

 Score =   479 bits (1234),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 259/437 (59%), Positives = 320/437 (73%), Gaps = 25/437 (6%)
 Frame = -2

Query  1617  IIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeae  1438
             I P    +IA++DEVW++R  EA + + +AYEP+P   + +   +V R+L          
Sbjct  22    IFPTLKANIADFDEVWQKRAIEAQKASFEAYEPHPEEETNNFNKQVHRSLDGG-------  74

Query  1437  aEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGG  1258
                   N+T RHL   +KY GPC ATNPIDRCWRC  +WA NRK+LADCALGFG +T GG
Sbjct  75    ------NNTRRHL---RKYTGPCLATNPIDRCWRCDRNWARNRKKLADCALGFGRRTTGG  125

Query  1257  KLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDG  1081
             K G  Y V D++D D  NPKPGTLRHAVIQ++PLWIIF+HDM I+L +ELI+  DKT+DG
Sbjct  126   KDGKIYVVRDSSDNDLVNPKPGTLRHAVIQERPLWIIFAHDMVIRLSEELIVTDDKTLDG  185

Query  1080  RGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisif  901
             RGA VHI++G  IT+QFVKN+IIH +HIH I  GNGG+IRD + H+G RT+SDGDGIS+F
Sbjct  186   RGANVHIANGGQITLQFVKNIIIHNLHIHDIKAGNGGMIRDSVSHYGFRTRSDGDGISMF  245

Query  900   gsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQIT  721
             G+S VWIDHVSM NC DGLIDA+ ASTAITISN HFT HNDV+L GA++  + D+IMQ+T
Sbjct  246   GASRVWIDHVSMSNCQDGLIDAVMASTAITISNCHFTHHNDVILLGASNGYSNDQIMQVT  305

Query  720   LAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHK  541
             LAFNHFGK L+QRMPRCR+G+IHVVNNDYTHW MYAIGGS       QGNRFIAPP+ + 
Sbjct  306   LAFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSHX-----QGNRFIAPPNPNC  360

Query  540   KEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVT  361
             KE+TKRV     EW++W WRS+GD+ M GAFF+QSG+P    K +   D + +     VT
Sbjct  361   KEVTKRVYAPESEWRSWNWRSEGDLMMNGAFFIQSGNP---IKRYSKKDVIHSKPGTFVT  417

Query  360   WLTRFAGALNCRVGSPC  310
              LTRFAG L C+   PC
Sbjct  418   RLTRFAGPLKCKKNQPC  434



>ref|XP_002520133.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF42188.1| Pectate lyase precursor, putative [Ricinus communis]
Length=440

 Score =   479 bits (1233),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 260/442 (59%), Positives = 315/442 (71%), Gaps = 23/442 (5%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               I P    +I ++DE W+++   A E A ++Y PNP N+S  L ++V + +S       
Sbjct  18    AVIFPTLHANIGDFDEYWKQKADIAREAAYRSYNPNPFNVSNQLNYQVNKAVSG------  71

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                      ++TR  L  +K  GPC ATNPIDRCWRC   WA NRKRL +C LGFG+ T 
Sbjct  72    --------TNSTRRNLMRRKGGGPCKATNPIDRCWRCDPKWALNRKRLVECVLGFGHSTT  123

Query  1263  GGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTI  1087
             GGK G FY VTD +D D  NPKPGTLRHAVIQ +PLWIIF+  M I+L+QEL++  +KTI
Sbjct  124   GGKDGKFYIVTDPSDNDMVNPKPGTLRHAVIQNEPLWIIFARSMIIRLNQELMISSNKTI  183

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             D RGA VHI+ GAG+T+QFV+NVIIHGI IH I  G+GGL+RD +DH+G RTKSDGDGIS
Sbjct  184   DARGANVHIAGGAGLTLQFVQNVIIHGIRIHDIVSGSGGLVRDSVDHYGFRTKSDGDGIS  243

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             IFGSSN+WIDHVSM NC DGLIDAI  ST+ITISN HFT+HN+VMLFGA+D  + D IMQ
Sbjct  244   IFGSSNIWIDHVSMSNCQDGLIDAIMGSTSITISNCHFTNHNEVMLFGASDGYSADTIMQ  303

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             IT+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTII QGNRFIAP +I
Sbjct  304   ITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSRKPTIISQGNRFIAPNNI  363

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED  367
               KE+TKR      EWK W WRS  D+ M GA FV+SG P   D     +  +   KA+ 
Sbjct  364   FSKEVTKREYSLESEWKNWNWRSDRDLMMNGAVFVESGKPITHD-----FSRLQLIKAKP  418

Query  366   ---VTWLTRFAGALNCRVGSPC  310
                VT LTR++GAL+C VG PC
Sbjct  419   GTFVTRLTRYSGALDCFVGKPC  440



>ref|XP_009381244.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=423

 Score =   478 bits (1229),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 254/431 (59%), Positives = 308/431 (71%), Gaps = 17/431 (4%)
 Frame = -2

Query  1599  GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTR  1420
              HIAE+DE W+++EA A  + Q AY PNP +++      V +              D+ +
Sbjct  9     AHIAEFDEYWQKKEAMARANVQNAYNPNPESVTKHFNDAVLK--------------DLEK  54

Query  1419  NDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFY  1240
             N+T R L G ++Y GPC ATNPIDRCWRC  +WA +RKRLA CA GFG    GGK G+FY
Sbjct  55    NNTRRGLRGKRRYDGPCMATNPIDRCWRCQENWAHHRKRLATCAKGFGRHVTGGKNGDFY  114

Query  1239  TVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVH  1063
              VTD +D D  NP+ GTLR+ VIQ +PLWI+F+ DM I+L +ELI+  +KTIDGRG  V 
Sbjct  115   VVTDPSDLDLVNPRKGTLRYGVIQDRPLWIVFARDMVIRLTEELIVNSNKTIDGRGVDVQ  174

Query  1062  ISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVW  883
             I +GAGITIQ+V N+IIH + IH I  GNGG+IRD   H+GLRT+SDGDGISIFG+SNVW
Sbjct  175   IMNGAGITIQYVDNIIIHNLRIHDIKAGNGGMIRDSEHHYGLRTRSDGDGISIFGASNVW  234

Query  882   IDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHF  703
             IDHVSM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D  + D +MQIT+AFNHF
Sbjct  235   IDHVSMSNCMDGLIDAIQGSTAITISNSHFTQHNDVMLFGASDAFSGDAVMQITVAFNHF  294

Query  702   GKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKR  523
             GK L+QRMPRCR+G++HVVNNDYTHW MYAIGGS HPTI+ QGNRFIAPP +  KE+TKR
Sbjct  295   GKGLVQRMPRCRWGFVHVVNNDYTHWMMYAIGGSQHPTILSQGNRFIAPPTLFAKEVTKR  354

Query  522   VKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFA  343
                  E WK+W WRS+GD+   GAFFV SG     +  +K  D +       VT LTRF+
Sbjct  355   EYSPEEVWKSWQWRSEGDLLKNGAFFVPSGAGKLGNVSYK--DLIKAKPGTFVTRLTRFS  412

Query  342   GALNCRVGSPC  310
             GAL C    PC
Sbjct  413   GALKCVPNRPC  423



>ref|XP_011013803.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=419

 Score =   477 bits (1227),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 258/431 (60%), Positives = 314/431 (73%), Gaps = 24/431 (6%)
 Frame = -2

Query  1593  IAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRND  1414
             IA +DE W++R  EA E +++AYEPNP  ++     EV ++L                 +
Sbjct  10    IANFDEYWKKRAEEAKEASREAYEPNPEKVAKHFNDEVHKSLEG--------------GN  55

Query  1413  TTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTV  1234
             +TR  LG  KY GPC ATNPIDRCWRC  +WA NRK+L  CALGFG KT GGK G +Y V
Sbjct  56    STRRNLG--KYKGPCLATNPIDRCWRCDKNWAKNRKKLGGCALGFGRKTIGGKNGKYYRV  113

Query  1233  TDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHIS  1057
             TD +D D  NPKPGTLR+ VIQ KPLWIIF+HDM I+L +EL++  +KTIDGRG  VHI 
Sbjct  114   TDPSDNDMVNPKPGTLRYGVIQDKPLWIIFAHDMVIRLSEELMVASNKTIDGRGVNVHIY  173

Query  1056  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  877
             +GA IT+QFVKNVIIHGIHIH    GNGG+IRD +DH+G R++SDGDGISIFGS+++WID
Sbjct  174   NGAQITLQFVKNVIIHGIHIHDAKAGNGGMIRDSVDHYGFRSRSDGDGISIFGSTDIWID  233

Query  876   HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGK  697
             H+S+ NC DGLIDA+  S AITISN HFT HNDVMLFGA+D  + D +MQIT+AFNHFG+
Sbjct  234   HISLSNCEDGLIDAVMGSNAITISNCHFTKHNDVMLFGASDGYSGDSVMQITVAFNHFGR  293

Query  696   RLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVK  517
              L+QRMPR R+G+ HVVNNDYTHW MYAIGGS HPTII QGNRFIAPPD+  KE+TKR  
Sbjct  294   GLVQRMPRVRWGFAHVVNNDYTHWEMYAIGGSQHPTIISQGNRFIAPPDLACKEVTKRDY  353

Query  516   GTPEEWKTWTWRSQGDIYMEGAFFVQSGDP-NFMDKHHKLYDGVM-TFKAEDVTWLTRFA  343
                  WK+W WRS+GD+ + GAFFVQSG+    M+K      GV+       V+ LTRF+
Sbjct  354   AVESVWKSWNWRSEGDLMLNGAFFVQSGNAIKTMNKQ-----GVINAMPGRHVSRLTRFS  408

Query  342   GALNCRVGSPC  310
             GAL+C  G PC
Sbjct  409   GALDCVRGRPC  419



>ref|XP_008446316.1| PREDICTED: probable pectate lyase P59 [Cucumis melo]
Length=432

 Score =   476 bits (1224),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 270/429 (63%), Positives = 317/429 (74%), Gaps = 18/429 (4%)
 Frame = -2

Query  1593  IAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRND  1414
             I ++D+ W+ R AEA + A  AYEPNP  I+ SL  EV + LS +             N 
Sbjct  21    IGDFDDYWKARAAEAEQAAADAYEPNPETIADSLNAEVGQALSGS-------------NS  67

Query  1413  TTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTV  1234
             T R+L   KKY GPC ATNPIDRCWRC  +WA NRK+LADC LGFG KT GGKLG +Y V
Sbjct  68    TRRNL---KKYTGPCRATNPIDRCWRCDPNWAQNRKKLADCVLGFGRKTIGGKLGPYYVV  124

Query  1233  TDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHIS  1057
              D++D D  NPKPGTLRHAVIQK PLWI FS +M I+L QELI+  DKTID RGA V I+
Sbjct  125   NDSSDSDLMNPKPGTLRHAVIQKGPLWITFSTNMAIRLTQELIVTSDKTIDARGANVQIA  184

Query  1056  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  877
              GAGIT+Q+V+NVIIHG+ IHHI  GNGG+IRD +DH GLRT SDGDGISIFGSSNVWID
Sbjct  185   YGAGITLQYVRNVIIHGLRIHHIVVGNGGMIRDAVDHVGLRTMSDGDGISIFGSSNVWID  244

Query  876   HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGK  697
             HVSM NC DGLIDAI  STAITISN HFT HN+VMLFGA+D  + D+IMQ+T+AFNHFG+
Sbjct  245   HVSMSNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDGYSNDQIMQVTVAFNHFGQ  304

Query  696   RLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVK  517
              L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTI+ QGNRFIAPP+++ KE+TKR  
Sbjct  305   GLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNVYAKEVTKREY  364

Query  516   GTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGA  337
                + WK+WTWRS+GD+ M GAFFV SGD     +     D +       V  +TRF+GA
Sbjct  365   SPEQVWKSWTWRSEGDLMMNGAFFVTSGDQR-KRRPFSSKDMISYKPGTYVKRMTRFSGA  423

Query  336   LNCRVGSPC  310
             L C VG PC
Sbjct  424   LACFVGRPC  432



>ref|XP_010678579.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=443

 Score =   476 bits (1224),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 258/431 (60%), Positives = 309/431 (72%), Gaps = 13/431 (3%)
 Frame = -2

Query  1599  GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTR  1420
              +I  YD+ W++RE  A  +A +AY  +PH I+    H+  + +            +  R
Sbjct  25    ANIGNYDDHWKQREQAAKANAARAYNTDPHGIT----HQTNQRVHNMGMNRTNRTNNYAR  80

Query  1419  NDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFY  1240
                     G  KY GPC A NPIDRCWRC  +W+ +R++LADC +GFG+KT GGK GN Y
Sbjct  81    R-------GLGKYEGPCQADNPIDRCWRCDDNWSKDRQKLADCVVGFGHKTTGGKKGNIY  133

Query  1239  TVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVH  1063
              VTD++D+   +PKPGTLRHAVIQ  PLWIIF H M IKL +EL++  +KTIDGRG  VH
Sbjct  134   VVTDDSDNELLDPKPGTLRHAVIQDGPLWIIFKHGMVIKLKEELLVSSNKTIDGRGGHVH  193

Query  1062  ISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVW  883
             I+ GAGI +QFV NVIIH +HIH I  G GG IRD + HFG RT SDGDGISIFGS+N+W
Sbjct  194   IAGGAGIMLQFVDNVIIHNVHIHDIKTGGGGFIRDSVSHFGFRTASDGDGISIFGSTNIW  253

Query  882   IDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHF  703
             IDHVSM NC DGLIDAIEASTAIT+SN HFTDHNDVMLFGA D S++D+IMQ+T+AFNHF
Sbjct  254   IDHVSMSNCMDGLIDAIEASTAITVSNCHFTDHNDVMLFGARDSSSQDEIMQVTIAFNHF  313

Query  702   GKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKR  523
             GKRLIQRMPRCR+G+ HV+NNDYTHW MYAIGGS HPTIICQGNRFIAPP+I  KE+TKR
Sbjct  314   GKRLIQRMPRCRFGFFHVLNNDYTHWEMYAIGGSQHPTIICQGNRFIAPPNIFAKEVTKR  373

Query  522   VKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFA  343
                    WK W W S+ DI M GAFF QSGD +    + K  D +      +VT LTRFA
Sbjct  374   EYAPYSVWKDWLWTSEDDIMMNGAFFNQSGDTSKKPSYAK-KDMIKAKPGSEVTHLTRFA  432

Query  342   GALNCRVGSPC  310
             GALNC+ G+ C
Sbjct  433   GALNCKEGTAC  443



>ref|XP_010528323.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=458

 Score =   475 bits (1223),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 256/440 (58%), Positives = 312/440 (71%), Gaps = 6/440 (1%)
 Frame = -2

Query  1614  IPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaea  1435
             IP   G I EYD+  R++EAEA E A +AY+P          H      +  ++      
Sbjct  20    IPNLRGKIGEYDDYLRKQEAEAQEQALRAYDPEFDQTVKKFDHNDPSHQNATISIKGGYR  79

Query  1434  EDVTRNDTTRHLLGS---KKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
              +     T R L G    KK  GPC ATNP+D+CWRC ADWA NRKRL  C  GFG+KT 
Sbjct  80    PNKNTTSTRRSLRGRGNWKKIAGPCKATNPVDKCWRCQADWAQNRKRLVSCVRGFGHKTT  139

Query  1263  GGKLGNFYTVTDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTI  1087
             GG  G FY VTD +DD   NPKPGT+RHAVIQK PLWIIF+  M I+L QEL++  +KTI
Sbjct  140   GGFSGKFYKVTDPSDDDMQNPKPGTIRHAVIQKVPLWIIFARSMHIRLKQELMITSNKTI  199

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             D RGA VHI+ GAGITIQF +NVIIHG+HIHHI   NGG+IRD +DH G+RT++DGDGIS
Sbjct  200   DARGANVHIAFGAGITIQFAQNVIIHGLHIHHIVTSNGGMIRDSVDHIGIRTQADGDGIS  259

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             +FGSSNVW+DH+SM  C DGLID I+ STAITISN HFT HNDV+L GA+D  + D IMQ
Sbjct  260   VFGSSNVWLDHLSMSRCQDGLIDVIQGSTAITISNCHFTHHNDVILLGASDQFSGDSIMQ  319

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             +T+A+NHFGK L+QRMPRCR+G++HVVNNDYTHW MYAIGGS HPTI+ QGNRFIAPP I
Sbjct  320   VTIAYNHFGKGLVQRMPRCRWGFVHVVNNDYTHWEMYAIGGSQHPTILSQGNRFIAPPHI  379

Query  546   H-KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAE  370
                K++TKR    P EWK WTW+S+ D++M GA+FV+SGDPNF  K  +  D +      
Sbjct  380   SWAKQVTKRDYAQPSEWKRWTWQSEMDVFMNGAYFVESGDPNFKHKFTR-QDIIRAKHGM  438

Query  369   DVTWLTRFAGALNCRVGSPC  310
               + LTR+AG+L+C  G PC
Sbjct  439   AASMLTRYAGSLHCFAGKPC  458



>ref|XP_008239834.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=438

 Score =   474 bits (1219),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 262/437 (60%), Positives = 315/437 (72%), Gaps = 20/437 (5%)
 Frame = -2

Query  1614  IPATV-GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeae  1438
             IP TV  +IA++DE W++R AEA + A +AY  +P  ++     +V  T   A       
Sbjct  20    IPTTVRANIADFDEHWQQRAAEAKKAAHEAYHDDPIAVTEHFNKQVLDTFDYA-------  72

Query  1437  aEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGG  1258
                   N+T R+L  ++KY GPC ATNPIDRCWRC  +W  NRKRLADCALGFG K  GG
Sbjct  73    ------NNTRRNL--NQKYKGPCMATNPIDRCWRCDPNWEKNRKRLADCALGFGRKATGG  124

Query  1257  KLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDG  1081
             KLG  Y VTDN D D  NPKPGTLRHAVIQ  PLWIIF+ DM IKL +EL++  DKTID 
Sbjct  125   KLGPIYVVTDNTDADLVNPKPGTLRHAVIQNGPLWIIFARDMRIKLTEELLVASDKTIDA  184

Query  1080  RGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisif  901
             RGA VHI DGA I++QFVKNVII  +HIH+   GNGGLIRD ++HFG RT+SDGDGIS++
Sbjct  185   RGANVHILDGAQISLQFVKNVIITNLHIHNNKPGNGGLIRDSINHFGQRTRSDGDGISMY  244

Query  900   gsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQIT  721
             G++NVWIDHVS+ NC DGLIDAI+ STAITISN H T+HNDVMLFG++D +++D++MQIT
Sbjct  245   GATNVWIDHVSLSNCADGLIDAIQGSTAITISNCHLTNHNDVMLFGSSDSNSQDQVMQIT  304

Query  720   LAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHK  541
             LAFNHFGK L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII QGNRFIAP +   
Sbjct  305   LAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPSNQAT  364

Query  540   KEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVT  361
             KE+T R      EW++W WRS+ D+ M GAFFVQSG P    ++    D +       VT
Sbjct  365   KEVTHRNNAQEGEWRSWNWRSENDLMMNGAFFVQSGSP---IRNLPKADMIQAKPGSFVT  421

Query  360   WLTRFAGALNCRVGSPC  310
              LTRFAG L C    PC
Sbjct  422   RLTRFAGPLKCIKNKPC  438



>ref|XP_006374492.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
 gb|ERP52289.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
Length=435

 Score =   473 bits (1217),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 257/431 (60%), Positives = 313/431 (73%), Gaps = 24/431 (6%)
 Frame = -2

Query  1593  IAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRND  1414
             IA +DE W++R  EA E +++AYEPNP  ++     EV ++L                 +
Sbjct  26    IANFDEYWKKRAEEAKEASREAYEPNPAKVTKHFNDEVHKSLEG--------------GN  71

Query  1413  TTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTV  1234
             +TR  LG  K  GPC ATNPIDRCWRC  +WA NRK+L  CALGFG KT GGK G +Y V
Sbjct  72    STRRNLGKNK--GPCLATNPIDRCWRCDKNWAKNRKKLGGCALGFGRKTIGGKHGKYYRV  129

Query  1233  TDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHIS  1057
             TD +D D  NPK GTLR+ VIQ KPLWIIF+HDM I+L +EL++  +KTIDGRG  VHI 
Sbjct  130   TDPSDNDMVNPKAGTLRYGVIQDKPLWIIFAHDMVIRLSEELMVASNKTIDGRGVNVHIY  189

Query  1056  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  877
             +GA IT+QFVKNVIIHGIHIH    GNGG+IRD +DH+G R++SDGDGISIFGS+++WID
Sbjct  190   NGAQITLQFVKNVIIHGIHIHDAKAGNGGMIRDSVDHYGFRSRSDGDGISIFGSTDIWID  249

Query  876   HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGK  697
             H+S+ NC DGLIDAI  S AITISN HFT HNDVMLFGA+D  + D +MQIT+AFNHFG+
Sbjct  250   HISLSNCEDGLIDAIMGSNAITISNCHFTKHNDVMLFGASDSYSGDSVMQITVAFNHFGR  309

Query  696   RLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVK  517
              L+QRMPR R+G++HVVNNDYTHW MYAIGGS HPTII QGNRF+APPD   KE+TKR  
Sbjct  310   GLVQRMPRVRWGFVHVVNNDYTHWEMYAIGGSQHPTIISQGNRFVAPPDPACKEVTKRDY  369

Query  516   GTPEEWKTWTWRSQGDIYMEGAFFVQSGDP-NFMDKHHKLYDGVMTFK-AEDVTWLTRFA  343
                  WK+W WRS+GD+ + GAFFVQSG+    M+K       V++ K    V+ LTRF+
Sbjct  370   AVESVWKSWNWRSEGDLMLNGAFFVQSGNAIKTMNKQ-----AVISAKPGRYVSRLTRFS  424

Query  342   GALNCRVGSPC  310
             GALNC  G PC
Sbjct  425   GALNCVRGRPC  435



>ref|XP_007209148.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
 gb|EMJ10347.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
Length=440

 Score =   473 bits (1217),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 262/437 (60%), Positives = 315/437 (72%), Gaps = 20/437 (5%)
 Frame = -2

Query  1614  IPATV-GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeae  1438
             IP TV  +IA++DE W++R AEA + A +AY  +P  ++     +V  T   A       
Sbjct  22    IPTTVRANIADFDEHWQQRAAEAKKAAHEAYHDDPIAVTEHFNKQVLDTFDYA-------  74

Query  1437  aEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGG  1258
                   N+T R+L  ++KY GPC ATNPIDRCWRC  +W  NRKRLADCALGFG K  GG
Sbjct  75    ------NNTRRNL--NQKYKGPCMATNPIDRCWRCDPNWEKNRKRLADCALGFGRKATGG  126

Query  1257  KLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDG  1081
             KLG  Y VTDN D D  NPKPGTLRHAVIQ  PLWIIF+ DM IKL +EL++  DKTID 
Sbjct  127   KLGPIYVVTDNTDADLVNPKPGTLRHAVIQNGPLWIIFARDMRIKLTEELLVASDKTIDA  186

Query  1080  RGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisif  901
             RGA VHI DGA I++QFVKNVII  +HIH+   GNGG+IRD ++HFG RT+SDGDGIS+F
Sbjct  187   RGANVHILDGAQISLQFVKNVIITNLHIHNNKPGNGGMIRDSINHFGQRTRSDGDGISMF  246

Query  900   gsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQIT  721
             G++NVWIDHVS+ NC DGLIDAI+ STAITISN H T+HNDVMLFG++D +++D++MQIT
Sbjct  247   GATNVWIDHVSLSNCADGLIDAIQGSTAITISNCHLTNHNDVMLFGSSDSNSQDQVMQIT  306

Query  720   LAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHK  541
             LAFNHFGK L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII QGNRFIAP +   
Sbjct  307   LAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPSNQAT  366

Query  540   KEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVT  361
             KE+T R      EW++W WRS+ D+ M GAFFVQSG P    ++    D +       VT
Sbjct  367   KEVTHRNNAQEGEWRSWNWRSENDLMMNGAFFVQSGSP---IRNLPKADMIQAKPGSFVT  423

Query  360   WLTRFAGALNCRVGSPC  310
              LTRFAG L C    PC
Sbjct  424   RLTRFAGPLKCVKNKPC  440



>ref|XP_009403112.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=437

 Score =   472 bits (1214),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 254/431 (59%), Positives = 307/431 (71%), Gaps = 17/431 (4%)
 Frame = -2

Query  1599  GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTR  1420
              HI ++DE W+++   A + AQ +Y P+P +++ S    V +              D+  
Sbjct  23    AHIGDFDEYWQKKAEAARDRAQGSYNPDPESVTQSFNEAVSK--------------DLEG  68

Query  1419  NDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFY  1240
             N T R L G  K++GPC ATNPIDRCWRC  DW  NRKRLA CA GFG  T GGK G+ Y
Sbjct  69    NVTRRSLRGKHKFNGPCVATNPIDRCWRCKKDWMQNRKRLAKCAKGFGRHTIGGKNGDLY  128

Query  1239  TVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVH  1063
              VTD +D D  +PK GTLR+ VIQ +PLWI+F+ DM I+L++EL++  DKTID RG+ VH
Sbjct  129   VVTDASDNDLISPKKGTLRYGVIQDRPLWIVFASDMIIRLNEELLVTSDKTIDARGSNVH  188

Query  1062  ISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVW  883
             I  GAGI +QFV NVIIHG+HIH I  GNGG+IRD   HFGLRT+SDGDGISI+GSSN+W
Sbjct  189   IMGGAGIMLQFVHNVIIHGLHIHDIKAGNGGMIRDSEHHFGLRTRSDGDGISIYGSSNIW  248

Query  882   IDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHF  703
             IDHVSM NC DGLID I+ STAITISN HFT HNDVMLFGA+D    D +MQIT+AFNHF
Sbjct  249   IDHVSMSNCMDGLIDVIQGSTAITISNSHFTKHNDVMLFGASDSYQGDAMMQITVAFNHF  308

Query  702   GKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKR  523
             GK L+QRMPRCR+G++HVVNNDYTHW MYA+GGS HPTI+ QGNR+IAP  +  KE+TKR
Sbjct  309   GKGLVQRMPRCRWGFVHVVNNDYTHWLMYAVGGSQHPTILSQGNRYIAPHSLAAKEVTKR  368

Query  522   VKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFA  343
                    WK WTWRS+GD+   GAFFV+SG PN M  + K  D +       VT LTRF+
Sbjct  369   DYAPQAVWKDWTWRSEGDLMQNGAFFVESGPPNRMKFNTK--DLIKAKPGSFVTRLTRFS  426

Query  342   GALNCRVGSPC  310
             GALNC  G PC
Sbjct  427   GALNCFPGRPC  437



>gb|AES91206.2| pectate lyase P59-like protein [Medicago truncatula]
Length=434

 Score =   471 bits (1211),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 255/440 (58%), Positives = 311/440 (71%), Gaps = 25/440 (6%)
 Frame = -2

Query  1620  AIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaea  1441
             AI+P    +I  +D+ W+ R  +A + AQQAY+PNP  I+++L   V + LS +      
Sbjct  17    AIVPIFEANIVHFDQYWQNRSDDAKKAAQQAYKPNPQEITSNLNMHVHKALSGS------  70

Query  1440  eaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKG  1261
                    N T R L    KY GPC+ATNPID CWRC  +W  NRK+LADC LGFG+ T G
Sbjct  71    -------NSTRREL---AKYKGPCSATNPIDSCWRCDPNWEKNRKKLADCVLGFGHGTTG  120

Query  1260  GKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GK G  Y VTD++D D   PKPGTLR A IQK+PLWIIF H+M+IKL  EL++  DKTID
Sbjct  121   GKAGKIYVVTDSSDNDLVTPKPGTLRFAAIQKEPLWIIFKHNMNIKLKAELLLTSDKTID  180

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
              RGA VHIS+GA IT+Q+VKN+IIHG+HIH   + +GG IRD +DH+G R+ SDGD IS+
Sbjct  181   ARGANVHISEGAQITLQYVKNIIIHGLHIHDTKKTSGGQIRDSMDHYGSRSASDGDAISM  240

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FG+S+VWIDH+SM NC DGL+DA+  STAITISN H T HNDVMLFGAND  + D+I QI
Sbjct  241   FGASHVWIDHISMWNCADGLVDAVAGSTAITISNCHMTRHNDVMLFGANDGFSGDQISQI  300

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             T+AFNHFGK LIQRMPRCR+G+ H+VNNDYTHW MYAIGGS+HPTI+ QGNRFIAPP+ +
Sbjct  301   TVAFNHFGKGLIQRMPRCRWGFFHIVNNDYTHWLMYAIGGSTHPTILSQGNRFIAPPNPN  360

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGD--PNFMDKHHKLYDGVMTFKAE  370
              KE+TKR       WK W+WRS+ D+ M GAFF QSG    NF     K   G  +F A 
Sbjct  361   AKEVTKRDYAPESVWKAWSWRSENDLMMNGAFFKQSGTKAANFPKSDIKAKPG--SFAAA  418

Query  369   DVTWLTRFAGALNCRVGSPC  310
                 LTRF+G L C VG PC
Sbjct  419   ----LTRFSGCLKCEVGKPC  434



>ref|XP_006842121.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
 gb|ERN03796.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
Length=438

 Score =   470 bits (1209),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 259/436 (59%), Positives = 308/436 (71%), Gaps = 20/436 (5%)
 Frame = -2

Query  1614  IPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaea  1435
             +P    HIA++DE W+ R A A + A +AY   PHN++  + H V + L           
Sbjct  22    VPKAEAHIADFDETWQNRSAIARQVALEAYVHEPHNVTDHVNHMVHKALEG---------  72

Query  1434  EDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGK  1255
                  N T RHL    KY G C ATNPIDRCWRC  +WA +RKRLA CALGFG KT GG 
Sbjct  73    -----NSTRRHL---GKYTGACMATNPIDRCWRCQRNWARDRKRLAKCALGFGRKTTGGL  124

Query  1254  LGNFYTVTDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGR  1078
              G FY VTD +D+  ++PKPGTLRHAVIQ +PLWI F HDM I+L +EL++   KTIDGR
Sbjct  125   KGRFYVVTDASDESLTDPKPGTLRHAVIQDRPLWITFKHDMIIRLTEELLVNSHKTIDGR  184

Query  1077  GAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifg  898
             G  VHI+ GAGITIQ+ KNVIIHG+HIH I  GNGG+IRD  +H+GLRTKSDGD ISIF 
Sbjct  185   GTNVHIAYGAGITIQYQKNVIIHGLHIHDIKAGNGGMIRDSPEHYGLRTKSDGDAISIFA  244

Query  897   sSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITL  718
             SS VWIDH SM NC DGLIDAI  STAITISN HFT+HN+V L GA+D  + DKIMQ+T 
Sbjct  245   SSFVWIDHNSMSNCMDGLIDAIMGSTAITISNNHFTNHNEVSLMGASDSFSDDKIMQVTF  304

Query  717   AFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKK  538
             AFNHFG+ LIQRMPRCR+G+ HVVNNDYTHW MYA+GGS HPTII QGNR+IAP   + K
Sbjct  305   AFNHFGRGLIQRMPRCRWGFFHVVNNDYTHWGMYAVGGSQHPTIISQGNRYIAPTANYAK  364

Query  537   EITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTW  358
             E+TKR   + + WK WTWRS+GD+   GAFF +SG P+  DK+ +  D +       V  
Sbjct  365   EVTKRDYASEDVWKQWTWRSEGDVMKNGAFFRESGPPS-TDKYTR-QDKITAKPGTFVGR  422

Query  357   LTRFAGALNCRVGSPC  310
             LTRFAGAL C+  SPC
Sbjct  423   LTRFAGALVCKRKSPC  438



>ref|XP_009408830.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=436

 Score =   469 bits (1208),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 255/434 (59%), Positives = 308/434 (71%), Gaps = 20/434 (5%)
 Frame = -2

Query  1605  TVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDV  1426
             T  HIA+YDE W+++ A A  HA  AY PNP +++      V R              D+
Sbjct  21    TSAHIADYDEYWQKKAALARSHANNAYNPNPESVTHHFNEAVMR--------------DL  66

Query  1425  TRNDTTRHLLGSKKYH-GPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLG  1249
               N T R L G  +   G C ATNPIDRC+RC ++W  +RK+LA CA GFG    GGK G
Sbjct  67    ASNSTRRGLRGKMRNEDGACQATNPIDRCFRCQSNWVHHRKKLATCAKGFGRHATGGKNG  126

Query  1248  NFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGA  1072
             +FY VTD++D D  NP+ GTLRHAVIQ +PLWI+F+HDM I+L +ELI+  +KTIDGRGA
Sbjct  127   DFYVVTDSSDADLVNPRNGTLRHAVIQDRPLWIVFAHDMLIRLTEELIINSNKTIDGRGA  186

Query  1071  QVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsS  892
              V I+ GAG+TIQFV NVI+H I IH I  GNGG+IRD  +H+GLRT+SDGDGISIFG+S
Sbjct  187   NVQIAYGAGLTIQFVHNVIVHNIRIHDIKAGNGGMIRDSEEHYGLRTRSDGDGISIFGAS  246

Query  891   NVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAF  712
             N+WIDHVSM NC DGLIDAIE STAITISN HFT HNDVMLFGA+D  + D IMQIT+AF
Sbjct  247   NIWIDHVSMSNCMDGLIDAIEGSTAITISNSHFTQHNDVMLFGASDAFSGDAIMQITVAF  306

Query  711   NHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEI  532
             NHFGK L+QRMPRCR+G++HVVNNDYTHW MYA+GGS HPTI+ QGNRFIAPP +  KE+
Sbjct  307   NHFGKGLVQRMPRCRWGFVHVVNNDYTHWMMYAVGGSQHPTILSQGNRFIAPPTLFAKEV  366

Query  531   TKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLT  352
             TKR       WK W+WRS+GD+   GAFFV+SG P  + K +   D +       VT LT
Sbjct  367   TKREYSPEPVWKQWSWRSEGDLMANGAFFVESGAP--ITKPYA--DLIKAKPGSFVTRLT  422

Query  351   RFAGALNCRVGSPC  310
             RFAG+  C    PC
Sbjct  423   RFAGSRPCIPNQPC  436



>ref|XP_008365507.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=396

 Score =   467 bits (1202),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 248/375 (66%), Positives = 289/375 (77%), Gaps = 2/375 (1%)
 Frame = -2

Query  1431  DVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKL  1252
             D +  ++TR  L  K+Y GPC ATNPIDRCWRC A+WA NRK+LA C  GFG KT+GGK 
Sbjct  23    DQSAGNSTRRNLRGKQYKGPCKATNPIDRCWRCRANWANNRKKLASCVKGFGRKTRGGKK  82

Query  1251  GNFYTVTDNADD-PSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRG  1075
             G +Y VTD++DD   +PKPGTLRHAVIQ +PLWIIF+  M I+L QELI+   KTID RG
Sbjct  83    GAYYIVTDSSDDNVHDPKPGTLRHAVIQTQPLWIIFARSMVIRLSQELIVTSHKTIDARG  142

Query  1074  AQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgs  895
             A VHI+ GAGIT+QFV+NVIIHG+ IH    G+GG+IRD L H G+RT+SDGDGISI+GS
Sbjct  143   ANVHIAHGAGITLQFVQNVIIHGLRIHDTVPGSGGMIRDSLSHIGIRTQSDGDGISIYGS  202

Query  894   SNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLA  715
             SN+W+DH+SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D    D IMQIT+A
Sbjct  203   SNIWLDHLSMWNCADGLIDAIQGSTAITISNCHFTHHNDVMLFGASDAFAGDAIMQITVA  262

Query  714   FNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKE  535
             FNHFGK LIQRMPRCR+G++HVVNNDYTHW MYAIGGSSHPTII QGNRFIAPP+   KE
Sbjct  263   FNHFGKGLIQRMPRCRWGFVHVVNNDYTHWIMYAIGGSSHPTIISQGNRFIAPPNQAAKE  322

Query  534   ITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWL  355
             +TKR       WK+W WRS+GD+ M GAFFVQSG PN      KL D +       V  L
Sbjct  323   VTKRDYAPESVWKSWQWRSEGDLMMNGAFFVQSGVPNKKHGFGKL-DMIKAKPGTFVRRL  381

Query  354   TRFAGALNCRVGSPC  310
             TRFAG+LNC+VG  C
Sbjct  382   TRFAGSLNCKVGKKC  396



>gb|KHN08855.1| Putative pectate lyase P59 [Glycine soja]
Length=435

 Score =   468 bits (1205),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 256/438 (58%), Positives = 310/438 (71%), Gaps = 20/438 (5%)
 Frame = -2

Query  1620  AIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaea  1441
             AI P    +I  +D VW RR  EA E A+QAY+PNP  ++A     V R +  +      
Sbjct  17    AIFPTLNANIGHFDHVWHRRLKEAREAAKQAYKPNPMKVTAEFNTHVIRAMRGS------  70

Query  1440  eaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKG  1261
                    N++ R L  S +Y GPC ATNPID+CWRC  +W  NRKRLADCALGFG+ T G
Sbjct  71    -------NNSRRGL--SNQYDGPCKATNPIDKCWRCDPNWEKNRKRLADCALGFGHGTTG  121

Query  1260  GKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GK G  Y V D++D D  NPKPGTLRHA IQ++PLWIIF  +M+IKLH EL++  +KTID
Sbjct  122   GKDGKIYVVNDSSDNDLVNPKPGTLRHAAIQREPLWIIFDRNMNIKLHAELMLTDNKTID  181

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
              RGA VHIS+GA IT+Q+VKN+IIHG+HIH I + +GGLIRD +DH+G+R  SDGD IS+
Sbjct  182   ARGANVHISEGAQITLQYVKNIIIHGLHIHDIKKCSGGLIRDSMDHYGVRAMSDGDAISV  241

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FGS+ VWIDHVS  NC DGLID + ASTA+TISN H T HNDV+LFGA+D  + DKIMQ+
Sbjct  242   FGSTYVWIDHVSFTNCDDGLIDVVSASTAVTISNCHLTKHNDVLLFGASDSYSGDKIMQV  301

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             TLAFNHFGK LIQRMPRCR+G+ H+VNNDYTHW MYAIGGS  PTII QGNRFIAP D +
Sbjct  302   TLAFNHFGKGLIQRMPRCRWGFFHIVNNDYTHWLMYAIGGSQQPTIISQGNRFIAPNDRN  361

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDV  364
              KE+TKR       WK W WRS+GD+ M GAFFVQSG    + K+ K    ++    + V
Sbjct  362   AKEVTKRDYAPESVWKNWNWRSEGDLLMNGAFFVQSGKN--VAKNPKAE--IIAKPGKAV  417

Query  363   TWLTRFAGALNCRVGSPC  310
             + LTRFAG L C V   C
Sbjct  418   SSLTRFAGPLKCEVNKSC  435



>ref|XP_008446067.1| PREDICTED: pectate lyase-like, partial [Cucumis melo]
Length=381

 Score =   466 bits (1199),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 245/371 (66%), Positives = 293/371 (79%), Gaps = 7/371 (2%)
 Frame = -2

Query  1419  NDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFY  1240
             N+T RHL   +KY GPC ATNPIDRCWRC  +WA NRK+LADCALGFG  T GGK G  Y
Sbjct  17    NNTRRHL---RKYTGPCLATNPIDRCWRCDRNWARNRKKLADCALGFGRGTTGGKDGKIY  73

Query  1239  TVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVH  1063
              V D++D D  NPKPGTLRHAVIQ++PLWIIF+HDM I+L +ELIM  +KT+DGRGA VH
Sbjct  74    VVRDSSDNDLVNPKPGTLRHAVIQERPLWIIFAHDMVIRLSEELIMTDNKTLDGRGANVH  133

Query  1062  ISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVW  883
             I++G  IT+QFV+N+IIH +HIH I  GNGG IRD + H+G RT+SDGDGIS+FGSS VW
Sbjct  134   IANGGQITLQFVRNIIIHNLHIHDIKAGNGGFIRDSVSHYGYRTQSDGDGISMFGSSRVW  193

Query  882   IDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHF  703
             IDHVSM NC DGLIDA+ ASTAITISN HFT HNDV+L GA+D  + DKIMQ+TLAFNHF
Sbjct  194   IDHVSMSNCQDGLIDAVMASTAITISNCHFTHHNDVILLGASDSYSNDKIMQVTLAFNHF  253

Query  702   GKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKR  523
             GK L+QRMPRCR+G+IHVVNNDYTHW MYAIGGS +PTII QGNRFIAPP+ + KE+TKR
Sbjct  254   GKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSHNPTIISQGNRFIAPPNPNSKEVTKR  313

Query  522   VKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFA  343
             V  +  EW++W WRS+GD+ M GAFF+QSG+P    + +   D + +     VT LTRFA
Sbjct  314   VYASEREWRSWNWRSEGDLMMNGAFFIQSGNP---IRRYSKKDVIHSKPGTFVTRLTRFA  370

Query  342   GALNCRVGSPC  310
             G L C++  PC
Sbjct  371   GPLKCKMNQPC  381



>ref|XP_004302354.1| PREDICTED: probable pectate lyase P59-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score =   468 bits (1205),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 266/432 (62%), Positives = 314/432 (73%), Gaps = 17/432 (4%)
 Frame = -2

Query  1599  GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTR  1420
             G IA +D V + RE  A   A +AY+P+P +++  LI +V  ++  +             
Sbjct  31    GTIAVFDPVLQEREKRAEIAALKAYQPDPESVTDELIKDVETSIERS-------------  77

Query  1419  NDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFY  1240
             N T RHL  +KK    C ATNPIDRCWRC+ DWA NRK+LA+C LGFG +T+GGK G  Y
Sbjct  78    NTTRRHL--AKKIKAECTATNPIDRCWRCNPDWAKNRKQLANCVLGFGRRTRGGKRGPIY  135

Query  1239  TVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVH  1063
              V D++D D +NPKPGTLRHAVIQ  PLWIIF H M IKL++ELIM   KTIDGRGA VH
Sbjct  136   VVHDSSDNDMANPKPGTLRHAVIQTGPLWIIFKHSMTIKLNKELIMTSHKTIDGRGANVH  195

Query  1062  ISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVW  883
             I+ GAGITIQFV+NVIIHGIHIH I    GGLIRD LDH GLR +SDGDGI++FGSS++W
Sbjct  196   IAHGAGITIQFVENVIIHGIHIHDIVSVGGGLIRDSLDHIGLRGQSDGDGITVFGSSHIW  255

Query  882   IDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHF  703
             +DH+SM NCYDGL D ++ STAITISN HFT HNDVMLFGANDL  +D+IMQIT+AFNHF
Sbjct  256   LDHLSMWNCYDGLTDVVQGSTAITISNCHFTRHNDVMLFGANDLYERDQIMQITVAFNHF  315

Query  702   GKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKR  523
             GK LIQRMPRCR+G+ HVVNNDYTHW MYAIGGSSHPTII QGNR++APPD   KEIT R
Sbjct  316   GKGLIQRMPRCRFGFFHVVNNDYTHWQMYAIGGSSHPTIISQGNRYVAPPDPKLKEITSR  375

Query  522   VKGTPEE-WKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRF  346
                TPE  WKTW WRS+GD+   GA+F +SG+P     H   +D +       V  LTRF
Sbjct  376   AYSTPEAVWKTWQWRSEGDLMENGAYFRESGEPRKGRGHFSRFDVINAKPGSFVRRLTRF  435

Query  345   AGALNCRVGSPC  310
             AG L CRVG  C
Sbjct  436   AGTLGCRVGKAC  447



>ref|XP_010550068.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=469

 Score =   469 bits (1206),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 256/458 (56%), Positives = 317/458 (69%), Gaps = 24/458 (5%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
              ++IPA   +IAE DE W++R  EA +H+  AY  +P  I   + H   R    +     
Sbjct  16    ASLIPAIRSNIAELDEYWQQRSEEAEKHSLAAYHSDPFEI---VDHFHERHYDNSTDIET  72

Query  1443  aeaEDVTRNDTTRHLLGS------------------KKYHGPCNATNPIDRCWRCHADWA  1318
                +D    D+   L GS                   K  GPC+A+NPID+CWRC  DWA
Sbjct  73    ERQDDQEEEDSIAMLTGSINSTRRSLRGGRRGRGKWSKLKGPCSASNPIDKCWRCMPDWA  132

Query  1317  TNRKRLADCALGFGYKTKGGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSH  1141
               R++LADC  GFGYKT GGKLG  Y VT N D D  NP+PGTLRHAVIQK+PLWIIF +
Sbjct  133   RRRQKLADCVRGFGYKTTGGKLGRIYVVTSNLDNDLINPRPGTLRHAVIQKEPLWIIFKN  192

Query  1140  DMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIR  961
             DM+I+L QEL++   KTID RGA VHI+ GAGIT+QFV N+IIHG+HIHHI   NGG+IR
Sbjct  193   DMNIRLQQELMINSHKTIDARGANVHIAYGAGITMQFVTNIIIHGLHIHHIVSSNGGMIR  252

Query  960   DGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHN  781
             D +DH+G RT++DGDG+SIFG+SN+WIDHVSM  C DGLIDAI+ ST ITISN HFT HN
Sbjct  253   DSVDHYGFRTRADGDGLSIFGASNIWIDHVSMSRCQDGLIDAIDGSTGITISNSHFTHHN  312

Query  780   DVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGS  601
             DVML GA+++  KDK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW +YAIGGS
Sbjct  313   DVMLLGAHNVIDKDKRMQVTVAYNHFGKGLVQRMPRVRWGFVHVVNNDYTHWELYAIGGS  372

Query  600   SHPTIICQGNRFIAPPDIHK-KEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN  424
               PTI+  GNRFIAPP I + KE+TKR      EWK W WRS+ DI+M GAFF QSG+PN
Sbjct  373   QSPTILSHGNRFIAPPHIPQYKEVTKRDYAPEAEWKNWNWRSERDIFMNGAFFRQSGNPN  432

Query  423   FMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             F   H +    +       V+ LT++AGAL+C+VG PC
Sbjct  433   FRCTHTR-QQMIKPKHGLAVSMLTKYAGALDCKVGRPC  469



>ref|XP_009360393.1| PREDICTED: probable pectate lyase 3 [Pyrus x bretschneideri]
Length=452

 Score =   468 bits (1204),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 252/430 (59%), Positives = 298/430 (69%), Gaps = 18/430 (4%)
 Frame = -2

Query  1593  IAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRND  1414
             + + D  W+ R  EA++ A ++Y  NP   +      V   LS+              N 
Sbjct  39    VLDLDAYWKERAQEALKEAMESYHKNPEQAAEEFHTGVAELLSK-------------ENT  85

Query  1413  TTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTV  1234
             T R+L G+K Y+GPC ATNPID CWRC A+WA NRK++  CA GFG K  GGK G  Y V
Sbjct  86    TRRNLRGNKGYNGPCMATNPIDACWRCDANWANNRKKIVGCAQGFGKKATGGKDGPIYVV  145

Query  1233  TDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHIS  1057
             T   D D  NPKPGTLRHAVIQK PLWIIF+  M I+L QEL++  DKTIDGRGA V I 
Sbjct  146   TVGTDNDVQNPKPGTLRHAVIQKGPLWIIFARSMVIRLEQELMVTSDKTIDGRGANVVIE  205

Query  1056  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  877
             +G GIT+QFVKNVII  +HI  I    GG+IRD +DH GLRTKSDGDGIS+FG+SNVWID
Sbjct  206   EGGGITLQFVKNVIITNLHIKMIVSKPGGMIRDSVDHMGLRTKSDGDGISLFGASNVWID  265

Query  876   HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGK  697
             HVSM  C DGLIDA+ ASTAITISN HFTDH+DVMLFGAN+  T+DKIMQITLAFNHFG+
Sbjct  266   HVSMSRCADGLIDAVMASTAITISNSHFTDHDDVMLFGANNAHTQDKIMQITLAFNHFGQ  325

Query  696   RLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVK  517
              L+QRMPR R+G+ HVVNNDYTHW MYAIGG+ +PTII QGNRFIAP +   K++T R  
Sbjct  326   GLVQRMPRVRHGFFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIAPANAATKQVTHREH  385

Query  516   GTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED-VTWLTRFAG  340
                 EWK W WRS+GD+ M GAFFV+SG        H     +M F+     T LT+F+G
Sbjct  386   TPESEWKNWEWRSEGDLMMNGAFFVESGSG---ASQHPAKLDMMPFQPGTFATKLTKFSG  442

Query  339   ALNCRVGSPC  310
             ALNC VG PC
Sbjct  443   ALNCVVGKPC  452



>ref|XP_006354795.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=435

 Score =   467 bits (1202),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 263/440 (60%), Positives = 317/440 (72%), Gaps = 25/440 (6%)
 Frame = -2

Query  1617  IIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeae  1438
             ++ +   +I E+DEVWR R  +A ++A+++Y P+P  ++A+L   V R+           
Sbjct  17    LVFSIEANIGEFDEVWRTRATQANKNAKESYNPHPEKVAANLNKHVHRS-----------  65

Query  1437  aEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGG  1258
               +   N T R L    KY+GPC ATNPIDRCWRC   WA NR++LADC LGFG+ T GG
Sbjct  66    --EEGSNSTRRDL---HKYNGPCVATNPIDRCWRCDPHWAKNRQKLADCVLGFGHHTTGG  120

Query  1257  KLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDG  1081
             K G  Y VTD  D D  NPKPGTLRHAVIQ  PLWIIF+H M IKL+QELIM GDKTID 
Sbjct  121   KGGKIYIVTDPGDNDMVNPKPGTLRHAVIQPGPLWIIFAHHMVIKLNQELIMTGDKTIDA  180

Query  1080  RGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisif  901
             RG QVHI+ GA + +Q++ NVIIHG+HIH I  GNGGLIRD ++H+G RT+SDGDGISIF
Sbjct  181   RGQQVHITGGASLMLQYINNVIIHGLHIHDIKSGNGGLIRDSINHYGFRTRSDGDGISIF  240

Query  900   gsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQIT  721
             GS+N+WIDHVSM NC DGLIDA++ASTAITISN HFT HNDVMLFGA+D   +D I+QIT
Sbjct  241   GSTNIWIDHVSMSNCDDGLIDAVQASTAITISNCHFTHHNDVMLFGASDSYKQDAILQIT  300

Query  720   LAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHK  541
             LAFNHFG+ LIQRMPR R+G++H VNNDYTHW MYAIGGS HPTI+ QGNRFIAPP+ + 
Sbjct  301   LAFNHFGQGLIQRMPRVRWGFVHAVNNDYTHWIMYAIGGSQHPTILSQGNRFIAPPNPNA  360

Query  540   KEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDG---VMTFKAE  370
             KE+TKR       WK W WRSQGD+ M GAFFV+SG+ N     HK   G   +      
Sbjct  361   KEVTKRDYSPESVWKNWVWRSQGDLMMNGAFFVESGNRN-----HKFMTGPDMIHPRAGS  415

Query  369   DVTWLTRFAGALNCRVGSPC  310
             D   LTRF+G+LNC  G PC
Sbjct  416   DAGRLTRFSGSLNCIEGKPC  435



>gb|KHG07401.1| putative pectate lyase P59 [Gossypium arboreum]
Length=442

 Score =   467 bits (1202),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 255/439 (58%), Positives = 308/439 (70%), Gaps = 16/439 (4%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
             G IIP+   HIAEYD+ WR RE +A E+ ++AY PNP  ++      V R L        
Sbjct  19    GVIIPSLEAHIAEYDDYWRERELQAKENLEKAYNPNPEEVTQHFNDHVARILMGF-----  73

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                    R ++TR +L  K+  GPC ATNPID+CWRC  +W  NRK+LADCALGFG  T 
Sbjct  74    -------RTNSTRRML-KKRKGGPCEATNPIDQCWRCDRNWEKNRKKLADCALGFGRGTT  125

Query  1263  GGKLGNFYTVTDNADDPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GGK G  Y VTD  DD  NP  GTLRHAVIQ +PLWI F+  M I+L +EL+M  +KTID
Sbjct  126   GGKDGPIYVVTDPTDDVLNPSRGTLRHAVIQNRPLWITFARGMIIRLKEELLMTSNKTID  185

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
             GRGA VHI+ GAGITIQF KNVIIH IHIH+IF   GG I+DG +H GLRT+SDGDGIS+
Sbjct  186   GRGANVHIAYGAGITIQFAKNVIIHNIHIHNIFPSKGGKIKDGENHLGLRTRSDGDGISL  245

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FG++NVW+DH+S+  C DG+IDAI+ STAITISN HFTDHNDVMLFGA+D  + D+ MQI
Sbjct  246   FGATNVWLDHLSVYKCSDGIIDAIQGSTAITISNCHFTDHNDVMLFGASDSYSADEKMQI  305

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             T+AF HFGK L+QRMPR R+G++HVVNNDY HW M AIGGSSHPTII  GNRF AP +I 
Sbjct  306   TVAFTHFGKNLVQRMPRVRFGFVHVVNNDYRHWIMSAIGGSSHPTIISHGNRFRAPRNIA  365

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFK-AED  367
              KE+ KR   T +EWK W WRS+GD+ + GA F QSGDP    K     D ++ +K A  
Sbjct  366   AKEVCKREYATEQEWKNWDWRSEGDLMLNGAIFTQSGDPRAAKKFGG--DKMIAYKPAHM  423

Query  366   VTWLTRFAGALNCRVGSPC  310
             V  L R++G L CR   PC
Sbjct  424   VPLLVRWSGTLECRPNKPC  442



>ref|XP_009615547.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=434

 Score =   466 bits (1199),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 255/438 (58%), Positives = 315/438 (72%), Gaps = 19/438 (4%)
 Frame = -2

Query  1620  AIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaea  1441
              ++ +   HI E+DEVWR+R  +A + A+ AY PNP  ++  L ++V + +  +      
Sbjct  15    VLVLSIEAHIGEFDEVWRKRAQQAKKAARHAYHPNPKIVADHLNNQVDKAVRGS------  68

Query  1440  eaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKG  1261
                    N   R L    +Y+G C ATNPID+CWRC  +WA NR +LADC LGFG KT G
Sbjct  69    -------NSRRRDL---HRYNGQCKATNPIDQCWRCDPNWARNRMKLADCVLGFGRKTTG  118

Query  1260  GKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GK G  Y VTDN+D D  NPKPGTLRHAVIQ +PLWIIF+ +M I+L++ELIM  +KTID
Sbjct  119   GKGGKSYVVTDNSDNDLVNPKPGTLRHAVIQPQPLWIIFAKNMVIRLNEELIMTSNKTID  178

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
              RG QVHI+ G G+ +QF+ NVII  + IH    GNGGLIRD ++H+G RTKSDGDGISI
Sbjct  179   ARGKQVHIAHGGGLMLQFIHNVIISNLRIHDTKAGNGGLIRDSVNHYGYRTKSDGDGISI  238

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FGS+NVWIDHVSM NC DGLIDA+EASTAITISN HFT HN+VMLFGA+D S++D IMQI
Sbjct  239   FGSTNVWIDHVSMSNCQDGLIDAVEASTAITISNCHFTKHNEVMLFGASDSSSRDSIMQI  298

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             TLAFNHFG+ L QRMPR R+G++H VNNDYTHW MYAIGGS HPTI+ QGNRFIAPP+ +
Sbjct  299   TLAFNHFGQGLRQRMPRVRWGFVHAVNNDYTHWLMYAIGGSMHPTILSQGNRFIAPPNPN  358

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDV  364
              KE+TKR       WK W W+SQGD+ M GAFFV+SG+PN      +  D + +     V
Sbjct  359   AKEVTKRDYAPESVWKNWVWKSQGDLMMNGAFFVESGNPN--HAFLRSPDMISSKPGSFV  416

Query  363   TWLTRFAGALNCRVGSPC  310
             + LTRF+G+LNC  G PC
Sbjct  417   SSLTRFSGSLNCIEGKPC  434



>ref|XP_002306040.1| hypothetical protein POPTR_0004s12300g [Populus trichocarpa]
 gb|EEE86551.1| hypothetical protein POPTR_0004s12300g [Populus trichocarpa]
Length=432

 Score =   466 bits (1198),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 254/440 (58%), Positives = 307/440 (70%), Gaps = 24/440 (5%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               +IP+ +  I  +D+VW++R  +A +   +AY P+P   + +   EV            
Sbjct  15    ATLIPSLLADIGIFDDVWQKRAQDAKKMTLEAYVPDPEEATDAFNVEV------------  62

Query  1443  aeaEDVTRNDTTRHL-LGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKT  1267
                     N+T R+L  G KKY GPC  TNPIDRCWRC  +WA NRK+LA CALGFG +T
Sbjct  63    --------NNTRRNLRQGRKKYAGPCQVTNPIDRCWRCQRNWAKNRKQLAKCALGFGRRT  114

Query  1266  KGGKLGNFYTVTDNADD-PSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKT  1090
              GG  G  Y VTD++D+    PKPGTLRHAVIQK+PLWIIFS +M+IKL +ELIM   KT
Sbjct  115   TGGMAGRIYVVTDSSDNNVMKPKPGTLRHAVIQKEPLWIIFSKNMNIKLSKELIMSSHKT  174

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             IDGRG  VHIS G GITIQF+ NVIIHGI IHHI   +GG IRD +DH+G+RT SDGDGI
Sbjct  175   IDGRGHHVHISYGGGITIQFIHNVIIHGIRIHHIIATSGGNIRDSVDHYGIRTNSDGDGI  234

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             SIFGS++VWIDHVSM  C DGLIDAI  STAITISN HFT HND +L GA+D  + D +M
Sbjct  235   SIFGSTDVWIDHVSMSRCTDGLIDAIMGSTAITISNCHFTHHNDAILLGASDSYSGDHLM  294

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             Q+T+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW +YAIGGS HPTII QGNRFIAPP+
Sbjct  295   QVTVAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWRLYAIGGSKHPTIISQGNRFIAPPE  354

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAE  370
              H K++TKR   T  EW  WTWRS+ D+ M GAFFVQSG P     + K    +      
Sbjct  355   SHLKQVTKRDYATKGEWSKWTWRSENDLMMNGAFFVQSGQPRTKKPNRKFM--IKAKPGA  412

Query  369   DVTWLTRFAGALNCRVGSPC  310
               T +TRFAGAL+C+ G  C
Sbjct  413   VATRMTRFAGALDCKPGRKC  432



>ref|XP_009389712.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=438

 Score =   466 bits (1198),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 249/431 (58%), Positives = 304/431 (71%), Gaps = 16/431 (4%)
 Frame = -2

Query  1599  GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTR  1420
              HIA++DE W+++   A   A+ +Y P+P +++      V                D   
Sbjct  23    AHIADFDEYWQKKAEVAQSKARNSYNPDPESVTRHFNEAVYE--------------DAQT  68

Query  1419  NDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFY  1240
             N T R L G K+ HGPC ATNPIDRCWRC+ +W  +RK+LA CA GFG  T GGK G FY
Sbjct  69    NVTRRGLRGQKRSHGPCLATNPIDRCWRCNENWIHHRKQLATCAKGFGRHTIGGKNGKFY  128

Query  1239  TVTDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVH  1063
              VTD +DD   NPK GTLR+ VIQ +PLWI+F+HDM I+L +ELI+   KTIDGRGA V 
Sbjct  129   VVTDASDDDLVNPKKGTLRYGVIQDRPLWIVFAHDMVIRLTEELIVNSYKTIDGRGANVQ  188

Query  1062  ISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVW  883
             I  GAG+TIQ+V NVI+H +HI  I  GNGG+IRD   H+GLRT+SDGDGISI+GSSN+W
Sbjct  189   IMGGAGVTIQYVHNVIVHNLHIQDIKAGNGGMIRDSEHHYGLRTRSDGDGISIYGSSNIW  248

Query  882   IDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHF  703
             IDHVSM NC DGLIDAIE STAITISN HFT HN+ MLFGA+D  + D IMQIT+AFNHF
Sbjct  249   IDHVSMSNCMDGLIDAIEGSTAITISNSHFTRHNEAMLFGASDAYSPDAIMQITVAFNHF  308

Query  702   GKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKR  523
             GK L+QRMPRCR+G++HVVNNDYTHW MYA+GGS HPTII QGNR+IAP +   KE+TKR
Sbjct  309   GKGLVQRMPRCRWGFVHVVNNDYTHWEMYAVGGSQHPTIISQGNRYIAPSNPFAKEVTKR  368

Query  522   VKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFA  343
                T   WK WTWRS+GD+ + GAFFV+SG    + K+ K  D +       VT LTR++
Sbjct  369   DYATESVWKQWTWRSEGDLMLNGAFFVKSGGGGGLQKYDKT-DIIKAKPGSFVTRLTRYS  427

Query  342   GALNCRVGSPC  310
             GAL+C    PC
Sbjct  428   GALDCFPQRPC  438



>ref|XP_004147462.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
 ref|XP_004163529.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
Length=431

 Score =   465 bits (1197),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 248/439 (56%), Positives = 310/439 (71%), Gaps = 15/439 (3%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               ++P     IAE+D+   ++  EA + + +A+ P+P N++      V   L        
Sbjct  7     AVLMPTLRAGIAEFDDFLLQKSEEAKQASLEAFHPDPMNVTDHFNQHVHLALE-------  59

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                  +  +++TR  L   KY+GPC ATNPIDRCWRC  +WA NRK+LA C LGFG KT 
Sbjct  60    ----GIEGSNSTRRSL--SKYNGPCLATNPIDRCWRCDPNWAKNRKKLAKCVLGFGRKTT  113

Query  1263  GGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTI  1087
             GGK G  Y VTD +D D  NP+PGTLR+  +QKKPLWIIF+  M I+L +EL++   KTI
Sbjct  114   GGKKGRIYVVTDPSDNDVINPRPGTLRYGALQKKPLWIIFARSMIIRLSKELMITSHKTI  173

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             D RGA VHI+ GAG++IQF +NVIIHG+ IHH+    GG+IRD  +H GLRT SDGDGIS
Sbjct  174   DARGANVHIAYGAGLSIQFARNVIIHGLRIHHVISTGGGMIRDTANHVGLRTVSDGDGIS  233

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             IFGS+N+W+DH+SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D    D IMQ
Sbjct  234   IFGSTNIWLDHLSMSNCQDGLIDAIQGSTAITISNSHFTHHNDVMLFGASDSYQGDSIMQ  293

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             +T+AFNHFGK L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII QGNRFIAPP+ 
Sbjct  294   VTVAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPPNP  353

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED  367
               ++IT R   T   WKTWTWRS+GD+ M GA+FVQSG+P+   + +  +D +       
Sbjct  354   AARQITNRNYATESVWKTWTWRSEGDLMMNGAYFVQSGNPS-KRRPYSRFDMIKAKPGTF  412

Query  366   VTWLTRFAGALNCRVGSPC  310
             V  LTRF+G+LNC VG PC
Sbjct  413   VRRLTRFSGSLNCYVGRPC  431



>ref|XP_008339935.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score =   466 bits (1198),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 254/437 (58%), Positives = 303/437 (69%), Gaps = 18/437 (4%)
 Frame = -2

Query  1614  IPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaea  1435
             +P     + + D  W+ R  EA + A ++Y  NP  ++     EV + +S+         
Sbjct  32    VPNEDTLVLDLDAYWKERAEEAEKVAMESYNKNPEKVTEEFNTEVGKLMSK---------  82

Query  1434  EDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGK  1255
                  N T R+L G+K Y GPC ATNP+D CWRC  +WA NRK++  CA GFG KT GGK
Sbjct  83    ----ENTTRRNLRGNKAYTGPCMATNPMDACWRCDPNWANNRKKIVGCAQGFGKKTTGGK  138

Query  1254  LGNFYTVTDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGR  1078
              G FY VT   DD   NPKPGTLRHAVIQK PLWIIF+  M I+L QEL++  DKTID R
Sbjct  139   DGPFYVVTMGTDDDVQNPKPGTLRHAVIQKGPLWIIFTKSMVIRLQQELMVTSDKTIDAR  198

Query  1077  GAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifg  898
             GA V I +GAGIT+QFVKNVII  +HI  I    GGLIRD +DH GLRT+SDGDGIS+FG
Sbjct  199   GANVVIEEGAGITLQFVKNVIITNLHIKMIVTKPGGLIRDSVDHIGLRTQSDGDGISLFG  258

Query  897   sSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITL  718
             +SNVWIDHVSM  C DGLIDAI  STAITISN HFTDH++ MLFGAN+  T+DKIMQITL
Sbjct  259   ASNVWIDHVSMSRCADGLIDAIMGSTAITISNSHFTDHDEAMLFGANNAHTQDKIMQITL  318

Query  717   AFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKK  538
             AFNHFG+ L+QRMPR R+G+ HVVNNDYTHW MYAIGG+ +PTII QGNRFIAP +   K
Sbjct  319   AFNHFGQGLVQRMPRVRHGFFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIAPINGVTK  378

Query  537   EITKRVKGTPE-EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVT  361
             ++T R + TPE EWK W WRS+GD+ M GAFFV+SG      KH    D +       V 
Sbjct  379   QVTHR-ENTPEAEWKNWEWRSEGDLMMNGAFFVESGSG--ASKHPAKLDXMPFKPGTXVX  435

Query  360   WLTRFAGALNCRVGSPC  310
              LT+F+GALNC VG PC
Sbjct  436   TLTKFSGALNCAVGKPC  452



>ref|XP_004490003.1| PREDICTED: probable pectate lyase 3-like isoform X1 [Cicer arietinum]
Length=450

 Score =   466 bits (1198),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 250/425 (59%), Positives = 301/425 (71%), Gaps = 16/425 (4%)
 Frame = -2

Query  1581  DEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRNDTTRH  1402
             D  W+ +   A +  ++AY P+P+ +S +L   +   +             +      R+
Sbjct  41    DSYWKEKAEIAAKANEEAYTPDPYAVSGNLTSTISEMI-------------IGGKKGRRN  87

Query  1401  LLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVTDNA  1222
             L G +K  GPC ATNPIDRCWRC  +WA NRK+LADC  GFG KT GGK G FY VTD +
Sbjct  88    LRG-RKTAGPCMATNPIDRCWRCDPNWANNRKKLADCVQGFGRKTTGGKAGPFYVVTDPS  146

Query  1221  D-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAG  1045
             D D  NP+PGTLRHAV +  PLWIIF+  M+I+L+QELIM  DKTIDGRGA + I++GAG
Sbjct  147   DSDMVNPRPGTLRHAVTRNGPLWIIFARSMNIRLNQELIMTSDKTIDGRGADIVIANGAG  206

Query  1044  ITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSM  865
             ITIQ+++NVIIHGI +  I  G+GGL+RD  +H+GLRT SDGDGISIFGSSN+WIDHVSM
Sbjct  207   ITIQYIRNVIIHGIKVFDIVVGSGGLVRDSENHYGLRTMSDGDGISIFGSSNIWIDHVSM  266

Query  864   RNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQ  685
             RNC DGLIDAI  STAITISN HFTDHN+VMLFGA+D    D+ MQIT+AFNHFGKRLIQ
Sbjct  267   RNCRDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDGYDADQKMQITVAFNHFGKRLIQ  326

Query  684   RMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPE  505
             RMPRCR+G+IHVVNNDYTHW MYAIGGS HPTII +GNRFIAP + + KEITKR      
Sbjct  327   RMPRCRFGFIHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIAPDNGYAKEITKREYSPES  386

Query  504   EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCR  325
             EWK W WRS  D+YM GAFF Q G     ++     D +       V  LTR++G+L C 
Sbjct  387   EWKNWQWRSINDVYMNGAFFRQGGS-ELTNRPFSKKDMITAKPGAYVGRLTRYSGSLKCI  445

Query  324   VGSPC  310
             VG PC
Sbjct  446   VGKPC  450



>gb|KGN59593.1| hypothetical protein Csa_3G827350 [Cucumis sativus]
Length=441

 Score =   465 bits (1196),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 248/439 (56%), Positives = 310/439 (71%), Gaps = 15/439 (3%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               ++P     IAE+D+   ++  EA + + +A+ P+P N++      V   L        
Sbjct  17    AVLMPTLRAGIAEFDDFLLQKSEEAKQASLEAFHPDPMNVTDHFNQHVHLALE-------  69

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                  +  +++TR  L   KY+GPC ATNPIDRCWRC  +WA NRK+LA C LGFG KT 
Sbjct  70    ----GIEGSNSTRRSL--SKYNGPCLATNPIDRCWRCDPNWAKNRKKLAKCVLGFGRKTT  123

Query  1263  GGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTI  1087
             GGK G  Y VTD +D D  NP+PGTLR+  +QKKPLWIIF+  M I+L +EL++   KTI
Sbjct  124   GGKKGRIYVVTDPSDNDVINPRPGTLRYGALQKKPLWIIFARSMIIRLSKELMITSHKTI  183

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             D RGA VHI+ GAG++IQF +NVIIHG+ IHH+    GG+IRD  +H GLRT SDGDGIS
Sbjct  184   DARGANVHIAYGAGLSIQFARNVIIHGLRIHHVISTGGGMIRDTANHVGLRTVSDGDGIS  243

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             IFGS+N+W+DH+SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D    D IMQ
Sbjct  244   IFGSTNIWLDHLSMSNCQDGLIDAIQGSTAITISNSHFTHHNDVMLFGASDSYQGDSIMQ  303

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             +T+AFNHFGK L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII QGNRFIAPP+ 
Sbjct  304   VTVAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPPNP  363

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED  367
               ++IT R   T   WKTWTWRS+GD+ M GA+FVQSG+P+   + +  +D +       
Sbjct  364   AARQITNRNYATESVWKTWTWRSEGDLMMNGAYFVQSGNPS-KRRPYSRFDMIKAKPGTF  422

Query  366   VTWLTRFAGALNCRVGSPC  310
             V  LTRF+G+LNC VG PC
Sbjct  423   VRRLTRFSGSLNCYVGRPC  441



>ref|XP_008366366.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=479

 Score =   466 bits (1199),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 244/371 (66%), Positives = 286/371 (77%), Gaps = 6/371 (2%)
 Frame = -2

Query  1419  NDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFY  1240
             N T R+L   +KY GPC ATNPIDRCWRC  +W TNRK+LADCA GFG+KT GGK G  Y
Sbjct  114   NKTRRNL--KQKYKGPCLATNPIDRCWRCDPNWETNRKKLADCAKGFGHKTTGGKAGKIY  171

Query  1239  TVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVH  1063
              VTDN+D D  NPKPGTLRHAVIQ  PLWIIF+ DM IKL +EL++  DKTID RGA VH
Sbjct  172   VVTDNSDNDMVNPKPGTLRHAVIQTGPLWIIFARDMRIKLREELMVTSDKTIDARGANVH  231

Query  1062  ISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVW  883
             I DGA IT+QFV NVIIH +HIH    GNGG+IRD ++H+G RT+SDGDGIS++G+SNVW
Sbjct  232   IEDGAQITLQFVXNVIIHNLHIHDTKPGNGGMIRDSVNHYGQRTRSDGDGISMYGASNVW  291

Query  882   IDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHF  703
             IDHVS  NC DGL+DAI+ STAITISN HFT+HNDVMLFG++D +++D++MQITLAFNHF
Sbjct  292   IDHVSGSNCADGLVDAIQGSTAITISNCHFTNHNDVMLFGSSDSNSQDEVMQITLAFNHF  351

Query  702   GKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKR  523
             G+ LIQRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII QGNRFIAP +   KE+TKR
Sbjct  352   GQGLIQRMPRCRWGFFHVVNNDYTHWIMYAIGGSQHPTIISQGNRFIAPSNNASKEVTKR  411

Query  522   VKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFA  343
               G   EWK+W WRS+ D+ M GAFFV+SG P    ++    D +       VT LTRFA
Sbjct  412   TSGAENEWKSWNWRSENDLMMNGAFFVESGSP---IRNLPKADMIKAKPGTFVTRLTRFA  468

Query  342   GALNCRVGSPC  310
             G L C  G PC
Sbjct  469   GPLKCIKGKPC  479



>ref|XP_008456459.1| PREDICTED: pectate lyase-like [Cucumis melo]
Length=434

 Score =   464 bits (1194),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 255/426 (60%), Positives = 303/426 (71%), Gaps = 18/426 (4%)
 Frame = -2

Query  1581  DEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRNDTTRH  1402
             DE W  R  EA + A+ A+ PNP  ++ +L   V R +             V RN T R 
Sbjct  25    DEYWNTRATEAKKVAKSAFNPNPEIVTDNLNAAVSRAM-------------VGRNSTRRS  71

Query  1401  LLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVTDNA  1222
             L   KKY GPC ATNPIDRCWRC  +WA NRK+LA+C LGFG++T GGK G  Y VTD +
Sbjct  72    L---KKYRGPCLATNPIDRCWRCDRNWAKNRKKLAECPLGFGHQTIGGKRGPIYVVTDAS  128

Query  1221  DDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAG  1045
             DD   NPKPGTLR+ VIQK PLWIIF   M I+L QEL++  DKTID RGA VHI+ GAG
Sbjct  129   DDDLVNPKPGTLRYGVIQKGPLWIIFGRSMIIRLSQELMISSDKTIDARGANVHIAFGAG  188

Query  1044  ITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSM  865
             +TIQFV NVIIH +HIH I   +GG+IRD +DH+G RT+SDGDGISIFGSS+VWIDHVSM
Sbjct  189   LTIQFVNNVIIHNLHIHDIISKSGGMIRDSVDHYGFRTQSDGDGISIFGSSHVWIDHVSM  248

Query  864   RNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQ  685
              NC DGLIDAI  STAITISN HFT HN+VMLFGA+D   +D+IMQ+TLAFNHFG+ L+Q
Sbjct  249   SNCEDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDSYAEDEIMQVTLAFNHFGRGLVQ  308

Query  684   RMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPE  505
             RMPRCR+G+ HVVNNDYTHW MYAIGGS HPTI+ QGNRFIAPP+ + K++TKR     +
Sbjct  309   RMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNPNAKQVTKREYAMED  368

Query  504   EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFK-AEDVTWLTRFAGALNC  328
             EWK W+WRS+GD  M GA F+ SGD     K       +++FK    V  L RF+G L C
Sbjct  369   EWKHWSWRSEGDELMNGAVFIPSGDQTKGKKKGLSRYDMISFKPGTYVRRLARFSGTLEC  428

Query  327   RVGSPC  310
               G PC
Sbjct  429   TPGKPC  434



>ref|XP_011009454.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=474

 Score =   465 bits (1196),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 258/460 (56%), Positives = 312/460 (68%), Gaps = 26/460 (6%)
 Frame = -2

Query  1617  IIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeae  1438
             +IP+ +  +  +D+VWR+R  EA +   +AY P+P   + +   EV +      + +   
Sbjct  17    LIPSLLADLGIFDDVWRKRAEEAKKMTLEAYVPDPEEATDAFNVEVNKYSLAKNSSSLYG  76

Query  1437  aEDVTR----------------------NDTTRHL-LGSKKYHGPCNATNPIDRCWRCHA  1327
             A   T                       N T R+L  G KKY GPC  TNPIDRCWRC  
Sbjct  77    AFGSTNITNLDLDDIDDNDNDADFEQFANSTRRNLRQGRKKYAGPCQVTNPIDRCWRCQR  136

Query  1326  DWATNRKRLADCALGFGYKTKGGKLGNFYTVTDNADD-PSNPKPGTLRHAVIQKKPLWII  1150
             +WA NRK+LA CALGFG +T GG  G  Y VTD++D+    PKPGTLRHAVIQK+PLWII
Sbjct  137   NWAKNRKQLAKCALGFGRRTTGGMAGRIYVVTDSSDNNVMKPKPGTLRHAVIQKEPLWII  196

Query  1149  FSHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGG  970
             FS +M+IKL +ELIM   KTIDGRG  VHIS GAGITIQF+ NVIIHGI IHHI   +GG
Sbjct  197   FSKNMNIKLSKELIMSSHKTIDGRGHHVHISYGAGITIQFIHNVIIHGIRIHHIIATSGG  256

Query  969   LIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFT  790
              IRD +DH+G+RT SDGDGISIFGS++VWIDHVSM  C DGLIDAI  STAITISN HFT
Sbjct  257   NIRDSVDHYGIRTNSDGDGISIFGSTDVWIDHVSMSRCTDGLIDAIMGSTAITISNCHFT  316

Query  789   DHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAI  610
              HND +L GA+D  + D +MQ+T+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW +YAI
Sbjct  317   HHNDAILLGASDSYSGDHLMQVTVAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWRLYAI  376

Query  609   GGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGD  430
             GGS HPTII QGNRFIAPP+ H K++TKR   T  EW  WTWRS+ D+ M GAFFVQSG 
Sbjct  377   GGSKHPTIISQGNRFIAPPESHLKQVTKRDYATKGEWSKWTWRSENDLMMNGAFFVQSGQ  436

Query  429   PNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             P     + K    +        T +TRFAGAL+C+ G  C
Sbjct  437   PRTKKPNRKFM--IKAKPGAVATRMTRFAGALDCKPGREC  474



>ref|XP_011085780.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=447

 Score =   463 bits (1192),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 266/457 (58%), Positives = 317/457 (69%), Gaps = 12/457 (3%)
 Frame = -2

Query  1674  MEGFNKNNcllllvvcVGAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISAS  1495
             MEG  K N LL+  +   +I+P     IAEYDEVWRRR AEA     QAY P+P  +   
Sbjct  1     MEG-TKLNWLLISFLAFASILPLLRADIAEYDEVWRRRAAEAYNRTVQAYHPDPLKVVMH  59

Query  1494  LIHEVRRTLSeavaeaeaeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWAT  1315
                 V + + E+         DV   +TTR  LG K Y GPC  TNPID CWRC+  W  
Sbjct  60    FNKHVNKHVEESGGLD-----DVMMLNTTRRHLG-KAYKGPCKVTNPIDACWRCNPKWHL  113

Query  1314  NRKRLADCALGFGYKTKGGKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHD  1138
             NR RLADC +GFG K  GGK G  Y VTD +DD   NPKPGTLRHAVIQ++PLWI F  +
Sbjct  114   NRFRLADCGMGFGSKATGGKGGRIYMVTDKSDDDVLNPKPGTLRHAVIQEEPLWITFRRN  173

Query  1137  MDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRD  958
             M IKL QEL++  DKTIDGRGA V I+ GAGITIQFVKNVIIH + IHHI E +GGLIRD
Sbjct  174   MVIKLKQELMVTSDKTIDGRGAIVQIAYGAGITIQFVKNVIIHNLKIHHIVEKDGGLIRD  233

Query  957   GLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHND  778
                H GLRT+SDGDGISIFGS ++WIDHVSM  C DGLID I+ ST ITISN HFTDH+ 
Sbjct  234   SASHTGLRTQSDGDGISIFGSQDIWIDHVSMTRCADGLIDIIQGSTGITISNSHFTDHDH  293

Query  777   VMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSS  598
              MLFG ND    D+ MQIT+AFNHFGKR++QRMPRCRYG+ HVVNNDYTHW MYAIGGSS
Sbjct  294   AMLFGGNDKYPGDEKMQITVAFNHFGKRMVQRMPRCRYGFFHVVNNDYTHWKMYAIGGSS  353

Query  597   HPTIICQGNRFIAPPDIHKKEITKRVKGTPE-EWKTWTWRSQGDIYMEGAFFVQSGDPNF  421
             HPTII QGNR+IA    + K++TKR    PE EWK WTW + GD+++ GA+F+ SGD ++
Sbjct  354   HPTIISQGNRYIADHP-YAKQVTKR--ECPESEWKHWTWVTDGDLFLRGAYFIPSGDQDW  410

Query  420   MDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
               KH +  D +    A+ V+ +T+FAG L C++   C
Sbjct  411   PSKHPEKSDNIKPASAKLVSQMTKFAGRLGCKLKYAC  447



>ref|XP_003609009.1| Pectate lyase [Medicago truncatula]
Length=445

 Score =   463 bits (1191),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 255/451 (57%), Positives = 311/451 (69%), Gaps = 36/451 (8%)
 Frame = -2

Query  1620  AIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaea  1441
             AI+P    +I  +D+ W+ R  +A + AQQAY+PNP  I+++L   V + LS +      
Sbjct  17    AIVPIFEANIVHFDQYWQNRSDDAKKAAQQAYKPNPQEITSNLNMHVHKALSGS------  70

Query  1440  eaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKG  1261
                    N T R L    KY GPC+ATNPID CWRC  +W  NRK+LADC LGFG+ T G
Sbjct  71    -------NSTRREL---AKYKGPCSATNPIDSCWRCDPNWEKNRKKLADCVLGFGHGTTG  120

Query  1260  GKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GK G  Y VTD++D D   PKPGTLR A IQK+PLWIIF H+M+IKL  EL++  DKTID
Sbjct  121   GKAGKIYVVTDSSDNDLVTPKPGTLRFAAIQKEPLWIIFKHNMNIKLKAELLLTSDKTID  180

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
              RGA VHIS+GA IT+Q+VKN+IIHG+HIH   + +GG IRD +DH+G R+ SDGD IS+
Sbjct  181   ARGANVHISEGAQITLQYVKNIIIHGLHIHDTKKTSGGQIRDSMDHYGSRSASDGDAISM  240

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDV-----------MLFGAN  757
             FG+S+VWIDH+SM NC DGL+DA+  STAITISN H T HNDV           MLFGAN
Sbjct  241   FGASHVWIDHISMWNCADGLVDAVAGSTAITISNCHMTRHNDVINNISSTYSFVMLFGAN  300

Query  756   DLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQ  577
             D  + D+I QIT+AFNHFGK LIQRMPRCR+G+ H+VNNDYTHW MYAIGGS+HPTI+ Q
Sbjct  301   DGFSGDQISQITVAFNHFGKGLIQRMPRCRWGFFHIVNNDYTHWLMYAIGGSTHPTILSQ  360

Query  576   GNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGD--PNFMDKHHK  403
             GNRFIAPP+ + KE+TKR       WK W+WRS+ D+ M GAFF QSG    NF     K
Sbjct  361   GNRFIAPPNPNAKEVTKRDYAPESVWKAWSWRSENDLMMNGAFFKQSGTKAANFPKSDIK  420

Query  402   LYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
                G  +F A     LTRF+G L C VG PC
Sbjct  421   AKPG--SFAAA----LTRFSGCLKCEVGKPC  445



>ref|XP_008221660.1| PREDICTED: probable pectate lyase 3 [Prunus mume]
Length=443

 Score =   462 bits (1188),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 262/429 (61%), Positives = 304/429 (71%), Gaps = 18/429 (4%)
 Frame = -2

Query  1590  AEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRNDT  1411
              + D  W++R  EA + A Q+++ +P  ++      V   L             +  N T
Sbjct  31    VQLDAYWKQRAEEAEKVAMQSFQTDPELVTEEFNSNVGELL-------------MKLNGT  77

Query  1410  TRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVT  1231
              R+L G KKY+GPC ATNPID CWRC  +WA NRKRLA+C  GFG KT GGK G  Y VT
Sbjct  78    RRNLRGVKKYNGPCMATNPIDACWRCDKNWAKNRKRLANCVQGFGRKTTGGKGGPIYVVT  137

Query  1230  DNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISD  1054
             D +D D  NPKPGTLRHAVIQK PLWIIF+  M I+L QELI+  DKTIDGRGA V+I D
Sbjct  138   DPSDLDLVNPKPGTLRHAVIQKGPLWIIFARSMVIRLQQELIVTSDKTIDGRGANVNIHD  197

Query  1053  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  874
             GAGIT+QFVKNVII  +HI  I    GG+IRD +DH G RT+SDGDGISIFGSSNVWIDH
Sbjct  198   GAGITLQFVKNVIITNLHIKRIVPKGGGMIRDSVDHLGQRTRSDGDGISIFGSSNVWIDH  257

Query  873   VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKR  694
             VSM NC DGLIDAI  STAITISN HFT HNDVMLFGA++  T+DKIMQIT+AFNHFG+ 
Sbjct  258   VSMENCADGLIDAIMGSTAITISNSHFTHHNDVMLFGASNSYTQDKIMQITVAFNHFGQG  317

Query  693   LIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKG  514
             L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS +PTII QGNRFIAPP+   KE+TKR   
Sbjct  318   LVQRMPRCRHGFFHVVNNDYTHWLMYAIGGSMNPTIISQGNRFIAPPNQGAKEVTKRDHT  377

Query  513   TPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED-VTWLTRFAGA  337
                EWK W WRS+GD+ M GA FVQSG       +H     +M FK    V  LT+FAGA
Sbjct  378   PEAEWKKWEWRSEGDLMMNGAIFVQSGSGK---SNHPAKMDLMPFKPGTYVAELTKFAGA  434

Query  336   LNCRVGSPC  310
             L+C VG PC
Sbjct  435   LDCFVGKPC  443



>ref|XP_011085777.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=446

 Score =   461 bits (1187),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 266/457 (58%), Positives = 319/457 (70%), Gaps = 13/457 (3%)
 Frame = -2

Query  1674  MEGFNKNNcllllvvcVGAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISAS  1495
             MEG  K N L +L   V +I+P    +IAEYDEVWRRR AEA     QAYEP+P  +   
Sbjct  1     MEG-TKVNWLPILFFVVASILPVLRANIAEYDEVWRRRAAEAYNRTLQAYEPDPLKVVMH  59

Query  1494  LIHEVRRTLSeavaeaeaeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWAT  1315
                 V R + E+         D+   ++TR  LG KKY GPC  TNPID CWRC  +W  
Sbjct  60    FNENVHRHIKESGGV------DMMMLNSTRRRLG-KKYRGPCKVTNPIDACWRCDPNWHL  112

Query  1314  NRKRLADCALGFGYKTKGGKLGNFYTVTDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHD  1138
             NR +LADC+LGFG K  GGK G  Y VTD +DD    PKPGTLRHAVIQ++PLWI F   
Sbjct  113   NRFKLADCSLGFGRKATGGKGGRIYVVTDPSDDDILTPKPGTLRHAVIQEEPLWITFKRS  172

Query  1137  MDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRD  958
             M I L QELIM  DKTIDGRG +V I+ GAGIT+Q+V+N+IIH I IH+I E  GG+IRD
Sbjct  173   MVITLAQELIMTSDKTIDGRGVKVQIAHGAGITVQYVRNIIIHNIKIHNIVEKKGGIIRD  232

Query  957   GLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHND  778
                H GLRT+SDGDGISIFG+ ++WIDHVSM  C DGLIDAI+ STAITISNGHFTDH+ 
Sbjct  233   STTHSGLRTQSDGDGISIFGAQDIWIDHVSMTRCDDGLIDAIQGSTAITISNGHFTDHDH  292

Query  777   VMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSS  598
              MLFGAND    D+ MQIT+AFNHFGKR++QRMPRCRYG+ HVVNNDYTHW MYAIGGSS
Sbjct  293   AMLFGANDKYPGDEKMQITVAFNHFGKRMVQRMPRCRYGFFHVVNNDYTHWKMYAIGGSS  352

Query  597   HPTIICQGNRFIAPPDIHKKEITKRVKGTPE-EWKTWTWRSQGDIYMEGAFFVQSGDPNF  421
             HPTII QGNR+IA    + K++TKR    PE EW+ WTW + GDI++ GA+F  SGD ++
Sbjct  353   HPTIISQGNRYIADHP-YAKQVTKR--ECPESEWRHWTWVTDGDIFLNGAYFRASGDQDW  409

Query  420   MDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
               KH +  DG+    A  V  +T+FAG L+C+    C
Sbjct  410   HHKHPEKSDGIKPGPATLVAQMTQFAGRLDCKKKYAC  446



>ref|XP_008793504.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=446

 Score =   461 bits (1187),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 257/436 (59%), Positives = 306/436 (70%), Gaps = 23/436 (5%)
 Frame = -2

Query  1599  GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTR  1420
              ++AE+D+ W+++  EA   ++ AY P+P  ++      V   +S+             R
Sbjct  28    ANMAEFDDHWQKKAEEAFARSRAAYHPDPEAVTNKFNKAVHLAVSQ------------AR  75

Query  1419  NDTTRHL--LGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGN  1246
             N T R L   G  K+ GPC ATNPIDRCWRC  +W  NRK+LA CA GFG    GGK G+
Sbjct  76    NSTRRALRSAGVNKFKGPCVATNPIDRCWRCRENWMENRKKLAGCAKGFGRNAVGGKDGD  135

Query  1245  FYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQ  1069
             FY VTD +D D  NPK GTLR  VIQ +PLWIIF+ DM I+L +EL++  +KTIDGRGA 
Sbjct  136   FYVVTDPSDNDLVNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELMINSNKTIDGRGAN  195

Query  1068  VHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSN  889
             V I+ GA IT+QFV NVIIHGIHIH I   NGG+IRD L HFG+RTKSDGDGISI+GSS+
Sbjct  196   VRIAYGAQITLQFVHNVIIHGIHIHDIKPSNGGIIRDSLQHFGIRTKSDGDGISIYGSSD  255

Query  888   VWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFN  709
             +WIDH S+RNC DGLIDAIE STAITISN HFT HNDV+LFGA+D +  D IMQIT+AFN
Sbjct  256   IWIDHCSLRNCADGLIDAIEGSTAITISNCHFTHHNDVLLFGASDSNEHDSIMQITVAFN  315

Query  708   HFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEIT  529
             HFGK L+QRMPRCR+G++HVVNNDYT W MYAIGGS HPTII QGNRFIAP     KE+T
Sbjct  316   HFGKGLVQRMPRCRWGFVHVVNNDYTQWIMYAIGGSQHPTIISQGNRFIAPLMQFAKEVT  375

Query  528   KRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTW---  358
             KR   T + WK WTWRS+GD+   GAFF +SG PN    H K +      KA+  TW   
Sbjct  376   KRDYATEDVWKQWTWRSEGDLMQNGAFFRESGSPNTKSFHRKDF-----IKAKPGTWVRR  430

Query  357   LTRFAGALNCRVGSPC  310
             LTRFAG L CR G PC
Sbjct  431   LTRFAGPLGCRAGRPC  446



>ref|XP_003530685.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=451

 Score =   461 bits (1186),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 252/431 (58%), Positives = 295/431 (68%), Gaps = 16/431 (4%)
 Frame = -2

Query  1596  HIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRN  1417
             H+ E+D  W+ R   A   +Q AY  +P+++S++    V                 + + 
Sbjct  35    HVYEFDSYWQERAKAAKVDSQAAYFEDPYSVSSNFTSSVSELT-------------IGKK  81

Query  1416  DTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYT  1237
             D  R+L G  +  GPC ATNPIDRCWRC  +WA NR++LADC  GFG  T GGK G FY 
Sbjct  82    DLRRNLKGKYRGDGPCIATNPIDRCWRCDPNWANNRQKLADCVQGFGRNTVGGKGGPFYV  141

Query  1236  VTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHI  1060
             VTD +DD   NPKPGTLRHAV +  PLWIIF+  M I L QELIM  +KTIDGRG  V+I
Sbjct  142   VTDPSDDDMVNPKPGTLRHAVTRDGPLWIIFARSMFITLQQELIMNSNKTIDGRGVDVYI  201

Query  1059  SDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWI  880
             + GAGIT+QFVKN+IIHGI +  I    GG+IRD   H+G RTKSDGDGISIFGSSNVWI
Sbjct  202   AKGAGITVQFVKNIIIHGIKVFDIVIREGGMIRDSETHYGFRTKSDGDGISIFGSSNVWI  261

Query  879   DHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFG  700
             DHVSMRNC DGLIDAI  STAITISN HFTDHN+VMLFGA+D  + DKIMQITLAFNHFG
Sbjct  262   DHVSMRNCSDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDSYSDDKIMQITLAFNHFG  321

Query  699   KRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRV  520
             KRL+QRMPR RYG++H VNNDYTHW MYAIGGS +PTII +GNRFIAP +   K+ITKR 
Sbjct  322   KRLVQRMPRVRYGFVHSVNNDYTHWEMYAIGGSKNPTIISEGNRFIAPDNQFAKQITKRE  381

Query  519   KGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAG  340
                   W  W WRS  D+YM GAFFVQSG P    +     D +       V  LTR++G
Sbjct  382   YAPENVWANWQWRSINDVYMNGAFFVQSG-PELASRPFSREDMITAKVGNYVGRLTRYSG  440

Query  339   -ALNCRVGSPC  310
               L CRVG PC
Sbjct  441   NLLKCRVGRPC  451



>ref|XP_003519771.2| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=447

 Score =   461 bits (1185),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 250/425 (59%), Positives = 300/425 (71%), Gaps = 18/425 (4%)
 Frame = -2

Query  1581  DEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRNDTTRH  1402
             D  W+++ + A +  +QAY  +P++++ +L + V   +             V   +  R+
Sbjct  40    DSYWKQKASVAEKENKQAYTSDPYSLTKNLTYSVSEII-------------VGEQNGRRN  86

Query  1401  LLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVTDNA  1222
             L G     G C ATNPIDRCWRC  +WA NRK+LA+C  GFG  T GGK G FY VT N 
Sbjct  87    LKGKG---GNCMATNPIDRCWRCDPNWANNRKKLANCVQGFGRNTVGGKNGPFYVVTSNL  143

Query  1221  D-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAG  1045
             D D  NP PGTLRHAV +  PLWIIF+H M I+L+QELIM  DKTIDGRG  V+++ GAG
Sbjct  144   DNDMVNPVPGTLRHAVTRTGPLWIIFAHSMKIRLNQELIMASDKTIDGRGVDVYLAGGAG  203

Query  1044  ITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSM  865
             ITIQF+KNVIIHG+ I  I  GNGGLI D  +H+GLRT SDGDGISIFGSSN+WIDHVSM
Sbjct  204   ITIQFIKNVIIHGVKIFDIQVGNGGLIIDSENHYGLRTMSDGDGISIFGSSNIWIDHVSM  263

Query  864   RNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQ  685
             R C DGLIDAI+ STAITISN HFTDHN+VMLFGA+D    D IMQITLAFNHFGKRL+Q
Sbjct  264   RKCKDGLIDAIQGSTAITISNSHFTDHNEVMLFGASDSYDGDTIMQITLAFNHFGKRLVQ  323

Query  684   RMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPE  505
             RMPRCRYG++HVVNNDYTHW MYAIGGS HPTII +GNRFIAP +I+ KEITKR     +
Sbjct  324   RMPRCRYGFVHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIAPDNINAKEITKREYSPEQ  383

Query  504   EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCR  325
             EWK+W WRS  D Y+ G FF + G     D+ +  +D +       V  LTR+AG+L C 
Sbjct  384   EWKSWQWRSINDEYLNGGFF-REGGAQLTDRPYSRHDMMTARPGSYVGRLTRYAGSLKCM  442

Query  324   VGSPC  310
             VG PC
Sbjct  443   VGKPC  447



>ref|XP_008443432.1| PREDICTED: probable pectate lyase 19 [Cucumis melo]
Length=441

 Score =   460 bits (1184),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 246/439 (56%), Positives = 308/439 (70%), Gaps = 15/439 (3%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               ++P     IAE+D+   ++  EA + + +A+ P+P N++      V   L        
Sbjct  17    AVLMPTLRAGIAEFDDYLLQKAEEAKQASLEAFHPDPMNVTDHFNQHVHLALE-------  69

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                  +  +++TR  L   KY GPC ATNPIDRCWRC  +WA NRK+LA C LGFG KT 
Sbjct  70    ----GIEGSNSTRRSLA--KYKGPCLATNPIDRCWRCDPNWAKNRKKLAKCVLGFGRKTT  123

Query  1263  GGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTI  1087
             GGK G  Y VTD +D D  NPKPGTLR+  +QK+PLWIIF+  M I+L +EL++   KTI
Sbjct  124   GGKKGRIYVVTDPSDNDVVNPKPGTLRYGALQKRPLWIIFARSMIIRLSKELMVTSHKTI  183

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             D RG+ VHI+ GAG++IQF +NVIIHG+ IHH+    GG+IRD  +H GLRT SDGDGIS
Sbjct  184   DARGSNVHIAYGAGLSIQFARNVIIHGLRIHHVISTGGGMIRDTANHVGLRTVSDGDGIS  243

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             IFGSSN+W+DH+SM NC DGLIDAI+ STAITISN HFT HNDVMLFGA+D    D IMQ
Sbjct  244   IFGSSNIWLDHLSMSNCQDGLIDAIQGSTAITISNSHFTHHNDVMLFGASDSYQGDSIMQ  303

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             +T+AFNHFGK L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII QGNRFIAPP+ 
Sbjct  304   VTVAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPPNP  363

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED  367
               ++IT R       WKTWTWRS+GD+ M GA+F+QSG+P+   + +  +D +       
Sbjct  364   AARQITNRNYAPESVWKTWTWRSEGDLMMNGAYFIQSGNPS-KRRPYSRFDMIKAKPGTF  422

Query  366   VTWLTRFAGALNCRVGSPC  310
             V  LTRF+G+LNC VG PC
Sbjct  423   VRRLTRFSGSLNCFVGRPC  441



>gb|KHN01171.1| Putative pectate lyase 3 [Glycine soja]
Length=433

 Score =   460 bits (1183),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 252/425 (59%), Positives = 292/425 (69%), Gaps = 18/425 (4%)
 Frame = -2

Query  1581  DEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRNDTTRH  1402
             D  W+ R + A +  QQAY  +P++++ +L   V   +               +      
Sbjct  26    DSYWQERASIAEKENQQAYTSDPYSLTKNLTFSVSEIIIGEKNGRRNLRGRGGK------  79

Query  1401  LLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVTDNA  1222
                       C ATNPIDRCWRC  +WA NRK+LADC  GFG  T GGK G FY V  + 
Sbjct  80    ----------CMATNPIDRCWRCDPNWANNRKKLADCVQGFGRNTIGGKNGPFYVVNSSL  129

Query  1221  D-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAG  1045
             D D  NP PGTLRHAV +  PLWIIF+  M+I+L QELIM  DKTIDGRG  V+I++GAG
Sbjct  130   DNDMVNPAPGTLRHAVTRSGPLWIIFARSMNIRLSQELIMTSDKTIDGRGVDVYIANGAG  189

Query  1044  ITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSM  865
             ITIQF+KNVIIHGI I +I  GNGGLIRD   H+G RT SDGDGISIFGSSNVWIDHVSM
Sbjct  190   ITIQFIKNVIIHGIKIFNIQVGNGGLIRDSETHYGFRTYSDGDGISIFGSSNVWIDHVSM  249

Query  864   RNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQ  685
             RNC DGLIDAI+ STAITISNGHFTDHN+VMLFGA+D    DKIMQITLAFNHFGKRL+Q
Sbjct  250   RNCKDGLIDAIQGSTAITISNGHFTDHNEVMLFGASDSYDGDKIMQITLAFNHFGKRLVQ  309

Query  684   RMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPE  505
             RMPRCRYG++HVVNNDYTHW MYAIGGS HPTII +GNRFIAP +++ KEITKR     +
Sbjct  310   RMPRCRYGFVHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIAPNNVYAKEITKREYSPEQ  369

Query  504   EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCR  325
             EWK W WRS  D YM GAFF + G     D+     D +       V  LTR+AG+L C 
Sbjct  370   EWKNWQWRSINDEYMNGAFF-REGGSQITDRPFSRQDMITAKPGSYVGRLTRYAGSLRCI  428

Query  324   VGSPC  310
             VG PC
Sbjct  429   VGKPC  433



>gb|KHN08706.1| Putative pectate lyase 3 [Glycine soja]
Length=444

 Score =   460 bits (1184),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 250/425 (59%), Positives = 300/425 (71%), Gaps = 18/425 (4%)
 Frame = -2

Query  1581  DEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRNDTTRH  1402
             D  W+++ + A +  +QAY  +P++++ +L + V   +             V   +  R+
Sbjct  37    DSYWKQKASVAEKENKQAYTSDPYSLTKNLTYSVSEII-------------VGEQNGRRN  83

Query  1401  LLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVTDNA  1222
             L G     G C ATNPIDRCWRC  +WA NRK+LA+C  GFG  T GGK G FY VT N 
Sbjct  84    LKGKG---GNCMATNPIDRCWRCDPNWANNRKKLANCVQGFGRNTVGGKNGPFYVVTSNL  140

Query  1221  D-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAG  1045
             D D  NP PGTLRHAV +  PLWIIF+H M I+L+QELIM  DKTIDGRG  V+++ GAG
Sbjct  141   DNDMVNPVPGTLRHAVTRTGPLWIIFAHSMKIRLNQELIMASDKTIDGRGVDVYLAGGAG  200

Query  1044  ITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSM  865
             ITIQF+KNVIIHG+ I  I  GNGGLI D  +H+GLRT SDGDGISIFGSSN+WIDHVSM
Sbjct  201   ITIQFIKNVIIHGVKIFDIQVGNGGLIIDSENHYGLRTMSDGDGISIFGSSNIWIDHVSM  260

Query  864   RNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQ  685
             R C DGLIDAI+ STAITISN HFTDHN+VMLFGA+D    D IMQITLAFNHFGKRL+Q
Sbjct  261   RKCKDGLIDAIQGSTAITISNSHFTDHNEVMLFGASDSYDGDTIMQITLAFNHFGKRLVQ  320

Query  684   RMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPE  505
             RMPRCRYG++HVVNNDYTHW MYAIGGS HPTII +GNRFIAP +I+ KEITKR     +
Sbjct  321   RMPRCRYGFVHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIAPDNINAKEITKREYSPEQ  380

Query  504   EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCR  325
             EWK+W WRS  D Y+ G FF + G     D+ +  +D +       V  LTR+AG+L C 
Sbjct  381   EWKSWQWRSINDEYLNGGFF-REGGAQLTDRPYSRHDMMTARPGSYVGRLTRYAGSLKCM  439

Query  324   VGSPC  310
             VG PC
Sbjct  440   VGKPC  444



>ref|XP_006573090.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=448

 Score =   460 bits (1183),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 252/425 (59%), Positives = 293/425 (69%), Gaps = 18/425 (4%)
 Frame = -2

Query  1581  DEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRNDTTRH  1402
             D  W+ R + A +  QQAY  +P++++ +L   V   +    +          +      
Sbjct  41    DSYWQERASIAEKENQQAYTSDPYSLTKNLTFSVSEIIIGEKSGRRNLRGRGGK------  94

Query  1401  LLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVTDNA  1222
                       C ATNPIDRCWRC  +WA NRK+LADC  GFG  T GGK G FY V  + 
Sbjct  95    ----------CMATNPIDRCWRCDPNWANNRKKLADCVQGFGRNTIGGKNGPFYVVNSSL  144

Query  1221  D-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAG  1045
             D D  NP PGTLRHAV +  PLWIIF+  M+I+L QELIM  DKTIDGRG  V+I++GAG
Sbjct  145   DNDMVNPAPGTLRHAVTRSGPLWIIFARSMNIRLSQELIMTSDKTIDGRGVDVYIANGAG  204

Query  1044  ITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSM  865
             ITIQF+KNVIIHGI I +I  GNGGLIRD   H+G RT SDGDGISIFGSSNVWIDHVSM
Sbjct  205   ITIQFIKNVIIHGIKIFNIQVGNGGLIRDSETHYGFRTYSDGDGISIFGSSNVWIDHVSM  264

Query  864   RNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQ  685
             RNC DGLIDAI+ STAITISNGHFTDHN+VMLFGA+D    DKIMQITLAFNHFGKRL+Q
Sbjct  265   RNCKDGLIDAIQGSTAITISNGHFTDHNEVMLFGASDSYDGDKIMQITLAFNHFGKRLVQ  324

Query  684   RMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPE  505
             RMPRCRYG++HVVNNDYTHW MYAIGGS HPTII +GNRFIAP +++ KEITKR     +
Sbjct  325   RMPRCRYGFVHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIAPNNVYAKEITKREYSPEQ  384

Query  504   EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCR  325
             EWK W WRS  D YM GAFF + G     D+     D +       V  LTR+AG+L C 
Sbjct  385   EWKNWQWRSINDEYMNGAFF-REGGSQITDRPFSRQDMITAKPGSYVGRLTRYAGSLRCI  443

Query  324   VGSPC  310
             VG PC
Sbjct  444   VGKPC  448



>ref|XP_009761969.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=434

 Score =   459 bits (1182),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 262/453 (58%), Positives = 324/453 (72%), Gaps = 22/453 (5%)
 Frame = -2

Query  1665  FNKNNcllllvvcVGAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIH  1486
             F KNN  L ++V    ++ +   HI E+DEVWR+R  +A + A+ AY PNP  ++  L +
Sbjct  3     FTKNNLFLFVMV---VLVLSIEAHIGEFDEVWRKRAEKAKKAARHAYHPNPKIVADHLNN  59

Query  1485  EVRRTLSeavaeaeaeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRK  1306
             +V + +  +             N   R L    +Y+G C ATNPID+CWRC  +WA NR 
Sbjct  60    QVDKAVRGS-------------NSRRRDL---HRYNGQCKATNPIDQCWRCDPNWARNRM  103

Query  1305  RLADCALGFGYKTKGGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDI  1129
             +LADC LGFG KT GGK G  Y VTDN+D D  NPKPGTLRHAVIQ +PLWIIF+ +M I
Sbjct  104   KLADCVLGFGRKTTGGKGGKIYVVTDNSDSDLVNPKPGTLRHAVIQPQPLWIIFAKNMVI  163

Query  1128  KLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLD  949
             +L++ELIM  +KTID RG QVHI+ G G+ +QF+ NVII  + IH    GNGGLIRD +D
Sbjct  164   RLNEELIMTSNKTIDARGKQVHIAHGGGLMLQFIHNVIISNLRIHDTKAGNGGLIRDSVD  223

Query  948   HFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVML  769
             H+G RTKSDGDGISIFGS+NVWIDHVSM NC DGLIDA+EASTAITISN HFT HN+VML
Sbjct  224   HYGYRTKSDGDGISIFGSTNVWIDHVSMSNCQDGLIDAVEASTAITISNSHFTKHNEVML  283

Query  768   FGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPT  589
             FGA+D S++D IMQITLAFNHFG+ L+QRMPR R+G++H VNNDYTHW MYAIGGS HPT
Sbjct  284   FGASDSSSRDSIMQITLAFNHFGQGLMQRMPRVRWGFVHAVNNDYTHWLMYAIGGSMHPT  343

Query  588   IICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKH  409
             I+ QGNRFIAPP+ + KE+TKR       WK W W+SQGD+ M GAFFV+SG+PN     
Sbjct  344   ILSQGNRFIAPPNPNAKEVTKRDYAPESVWKNWVWKSQGDLMMNGAFFVESGNPN--HAF  401

Query  408   HKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              +  D + +     V+ LTRF+G+LNC  G PC
Sbjct  402   LRSPDMISSKPGSFVSSLTRFSGSLNCIEGKPC  434



>ref|XP_009788285.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=434

 Score =   459 bits (1181),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 257/440 (58%), Positives = 316/440 (72%), Gaps = 23/440 (5%)
 Frame = -2

Query  1620  AIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaea  1441
              ++ +   +I+E+DEVW+ R  +A + AQ +Y P+P  ++ +L   V  +          
Sbjct  15    TLVLSIEANISEFDEVWQTRATQAKKTAQDSYNPHPETVADNLNKHVHTS----------  64

Query  1440  eaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKG  1261
                +   N T R L    KY+GPC +TNPIDRCWRC  +WA  R +LADC LGFG+ T G
Sbjct  65    ---EEGSNSTRRDL---HKYNGPCMSTNPIDRCWRCDPNWAKTRMKLADCVLGFGHHTTG  118

Query  1260  GKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GK G  Y VTD +DD   NPKPGTLRHAVIQ +PLWIIF H M I+L+QELIM  +KTID
Sbjct  119   GKGGKIYVVTDPSDDDMVNPKPGTLRHAVIQPEPLWIIFKHHMVIRLNQELIMTSNKTID  178

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
              RG QVHI+ GA   +QF+ NVIIHG+HIH I  GNGGLIRD ++H+G R++SDGDGISI
Sbjct  179   ARGQQVHIAFGASFMLQFINNVIIHGLHIHDIKAGNGGLIRDSINHYGFRSRSDGDGISI  238

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FGS+N+WIDHVSM NC DGLIDA++ASTAITISN HFT+HNDVMLFGA+D  ++D I+QI
Sbjct  239   FGSTNIWIDHVSMSNCDDGLIDAVQASTAITISNCHFTNHNDVMLFGASDSYSEDSILQI  298

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             TLAFNHFG+ LIQRMPR R+G++H VNNDYTHW MYAIGGS HPTI+ QGNRFIAPP+ +
Sbjct  299   TLAFNHFGQGLIQRMPRVRWGFVHAVNNDYTHWLMYAIGGSQHPTILSQGNRFIAPPNPN  358

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN--FMDKHHKLYDGVMTFKAE  370
              KE+TKR       WK W WRSQGD+ M GAFFV+SG+PN  FM    K  D +      
Sbjct  359   AKEVTKREYSPESVWKNWVWRSQGDLMMNGAFFVESGNPNHIFM----KGPDMIHPRPGS  414

Query  369   DVTWLTRFAGALNCRVGSPC  310
               + LTRF+G+LNC  G PC
Sbjct  415   YASRLTRFSGSLNCIEGKPC  434



>ref|XP_002270112.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32014.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   459 bits (1182),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 255/439 (58%), Positives = 309/439 (70%), Gaps = 22/439 (5%)
 Frame = -2

Query  1611  PATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaE  1432
             P    HIAEYD+ W+ RE EA   A  A++P+P +++      V +++            
Sbjct  22    PTIRAHIAEYDDYWKAREKEAKTVAIDAFDPSPEDVNDDFNKNVEKSI------------  69

Query  1431  DVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKL  1252
                +N T R+L  +K   GPC ATNPIDRCWRC  +WA +R+RLADC LGFG +T GGK 
Sbjct  70    -FGKNGTRRNLKVNK---GPCKATNPIDRCWRCRRNWAMDRRRLADCVLGFGRRTVGGKH  125

Query  1251  GNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRG  1075
             G  Y VTD +D D  NPKPGTLR+AVIQ +PLWI+F   M IKL QEL++  DKTIDGRG
Sbjct  126   GRLYIVTDPSDNDMLNPKPGTLRYAVIQPQPLWIVFGRSMIIKLKQELMVTSDKTIDGRG  185

Query  1074  AQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgs  895
               VHI+ GAGITIQF +NVIIHG+HIH I    GGLIRD + HFGLRT+SDGDGISIFGS
Sbjct  186   VNVHIAYGAGITIQFARNVIIHGLHIHDIVSRPGGLIRDSVHHFGLRTRSDGDGISIFGS  245

Query  894   SNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLA  715
             S+VWIDH SM  C DGL+DAI+ STAITISN HFT HN+ ML GA+D  + D IMQ+T+A
Sbjct  246   SHVWIDHNSMSKCEDGLVDAIQGSTAITISNNHFTKHNETMLLGASDGYSGDIIMQVTVA  305

Query  714   FNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI----  547
             FNHFG+ LIQRMPRCR+G+ HVVNNDYTHWNMYA+GGS+HPTI+ QGNR++A P +    
Sbjct  306   FNHFGRGLIQRMPRCRWGFFHVVNNDYTHWNMYAVGGSAHPTIVSQGNRYVAAPLMDPKH  365

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED  367
               KE+TKR   T  EW  WTWRS+GD+ + GAFFVQSG P F  K    YD +     + 
Sbjct  366   DAKEVTKRDHATKAEWSKWTWRSEGDLMVNGAFFVQSGVP-FKKKPFSRYDMIKAKPGKF  424

Query  366   VTWLTRFAGALNCRVGSPC  310
             V  LTR++GAL C   SPC
Sbjct  425   VPRLTRYSGALTCWRTSPC  443



>ref|XP_008389523.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 3 [Malus 
domestica]
Length=452

 Score =   460 bits (1183),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 247/435 (57%), Positives = 300/435 (69%), Gaps = 28/435 (6%)
 Frame = -2

Query  1593  IAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRND  1414
             + + D  W+ R  EA++ A ++Y  NP  ++      V   LS+              N 
Sbjct  39    VLDLDAYWKERAQEALKEAMESYHKNPEQVTEEFNTGVAELLSK-------------ENT  85

Query  1413  TTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTV  1234
             T R+L G+K Y+GPC ATNPID CWRC  +WA NRK++  CA GFG K  GGK G  Y V
Sbjct  86    TRRNLRGNKGYNGPCMATNPIDACWRCDPNWADNRKKIVGCAQGFGKKATGGKDGPIYVV  145

Query  1233  TDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHIS  1057
             T   DD   NPKPGTLRHAVIQK PLWIIF+  M I+L QEL++  DKTIDGRGA V I 
Sbjct  146   TVGTDDDVQNPKPGTLRHAVIQKGPLWIIFARSMVIRLQQELMVTSDKTIDGRGANVVIE  205

Query  1056  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  877
             +G GIT+QFVKNVI+  +HI  I    GG+IRD +DH GLRTKSDGDGIS+FG+SNVWID
Sbjct  206   EGGGITLQFVKNVILTNLHIKMIVSKTGGMIRDSVDHMGLRTKSDGDGISLFGASNVWID  265

Query  876   HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGK  697
             H+SM  C DGLIDA+ ASTAITISN HFTDH+DVMLFGAN+  T+DKIMQITLAFNHFG+
Sbjct  266   HMSMSRCADGLIDAVMASTAITISNSHFTDHDDVMLFGANNAHTQDKIMQITLAFNHFGR  325

Query  696   RLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVK  517
              L+QRMPR R+G+ H+VNNDY HW MYAIGG+ +PTII QGNRFIAP +   K++T R  
Sbjct  326   GLVQRMPRVRHGFFHLVNNDYNHWIMYAIGGNMNPTIISQGNRFIAPVNEATKQVTHREH  385

Query  516   GTPEEWKTWTWRSQGDIYMEGAFFVQSG-----DPNFMDKHHKLYDGVMTFKAED-VTWL  355
                 EWK W WRS+GD+ M GAFFV+SG     +P  +D        +M F+     T L
Sbjct  386   TPESEWKNWEWRSEGDLMMNGAFFVESGSRASQNPAKLD--------MMPFQPGTFATKL  437

Query  354   TRFAGALNCRVGSPC  310
             T+F+GAL+C VG PC
Sbjct  438   TKFSGALSCVVGKPC  452



>emb|CAN69904.1| hypothetical protein VITISV_001006 [Vitis vinifera]
Length=443

 Score =   459 bits (1181),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 255/439 (58%), Positives = 309/439 (70%), Gaps = 22/439 (5%)
 Frame = -2

Query  1611  PATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaE  1432
             P    HIAEYD+ W+ RE EA   A  A++P+P +++      V +++            
Sbjct  22    PTIRAHIAEYDDYWKAREKEAKTVAIDAFDPSPEDVNDDFNKNVEKSI------------  69

Query  1431  DVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKL  1252
                +N T R+L  +K   GPC ATNPIDRCWRC  +WA +R+RLADC LGFG +T GGK 
Sbjct  70    -FGKNGTRRNLKVNK---GPCKATNPIDRCWRCRRNWAMDRRRLADCVLGFGRRTVGGKH  125

Query  1251  GNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRG  1075
             G  Y VTD +D D  NPKPGTLR+AVIQ +PLWI+F   M IKL QEL++  DKTIDGRG
Sbjct  126   GRLYIVTDPSDNDMLNPKPGTLRYAVIQPQPLWIVFGRSMIIKLKQELMVTSDKTIDGRG  185

Query  1074  AQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgs  895
               VHI+ GAGITIQF +NVIIHG+HIH I    GGLIRD + HFGLRT+SDGDGISIFGS
Sbjct  186   VNVHIAYGAGITIQFARNVIIHGLHIHDIVSHPGGLIRDSVHHFGLRTRSDGDGISIFGS  245

Query  894   SNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLA  715
             S+VWIDH SM  C DGL+DAI+ STAITISN HFT HN+ ML GA+D  + D IMQ+T+A
Sbjct  246   SHVWIDHNSMSKCEDGLVDAIQGSTAITISNNHFTKHNETMLLGASDGYSGDIIMQVTVA  305

Query  714   FNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI----  547
             FNHFG+ LIQRMPRCR+G+ HVVNNDYTHWNMYA+GGS+HPTI+ QGNR++A P +    
Sbjct  306   FNHFGRGLIQRMPRCRWGFFHVVNNDYTHWNMYAVGGSAHPTIVSQGNRYVAAPLMDPKH  365

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED  367
               KE+TKR   T  EW  WTWRS+GD+ + GAFFVQSG P F  K    YD +     + 
Sbjct  366   DAKEVTKRDHATKAEWSKWTWRSEGDLMVNGAFFVQSGVP-FKKKPFSRYDMIKAKPGKF  424

Query  366   VTWLTRFAGALNCRVGSPC  310
             V  LTR++GAL C   SPC
Sbjct  425   VPRLTRYSGALTCWRTSPC  443



>ref|XP_007138209.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
 gb|ESW10203.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
Length=434

 Score =   458 bits (1178),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 247/438 (56%), Positives = 307/438 (70%), Gaps = 21/438 (5%)
 Frame = -2

Query  1620  AIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaea  1441
             AI+P    +I ++D VW RR  EA E A+QAY+PNP  ++A     V R +         
Sbjct  17    AILPTLQANIGQFDHVWHRRLKEAREAAKQAYKPNPMKVTAEFNTHVMRAMKG-------  69

Query  1440  eaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKG  1261
                    +++TR  LG K  +  C A NPID+CWRC  DW  NRK+LADCA+GFG+ T G
Sbjct  70    -------SNSTRRGLGKK--NDECEAANPIDKCWRCDPDWEKNRKKLADCAIGFGHGTTG  120

Query  1260  GKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GK G  Y V DN+D D  NPKPGTLRHAVIQ +PLWIIFS +M+I+L  EL++  +KTID
Sbjct  121   GKDGKIYVVGDNSDKDLVNPKPGTLRHAVIQTEPLWIIFSRNMNIRLTAELLITDNKTID  180

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
              RGA VHI DGA +TIQFVKN+IIHG+HIH I   +GGLIRD + H+G+R  SDGDGIS+
Sbjct  181   ARGANVHILDGAQMTIQFVKNIIIHGLHIHDIQPISGGLIRDSMSHYGVRAMSDGDGISV  240

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FGS+++WIDHVSM NC DGLID + ASTA+TISN HF  HNDV+LFGA D  ++DK+MQ+
Sbjct  241   FGSTHIWIDHVSMTNCSDGLIDVVSASTAVTISNCHFVKHNDVLLFGATDSFSRDKVMQV  300

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             TLAFNHFGK L+QRMPRCR+G+ H+VNNDYTHW MYA+GGS  PTII QGNRF+AP D +
Sbjct  301   TLAFNHFGKGLVQRMPRCRWGFFHIVNNDYTHWLMYAVGGSQQPTIISQGNRFVAPKDRN  360

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDV  364
              KE+TKR      EWK W WRS+GD++  GAFFV+SG    + K  K         A+ V
Sbjct  361   AKEVTKRDYAPESEWKNWNWRSEGDLFENGAFFVESGKK--VTKFPKT--DAKAVSAKSV  416

Query  363   TWLTRFAGALNCRVGSPC  310
              +LT+ AG + C    PC
Sbjct  417   AFLTKDAGPIKCIPNKPC  434



>ref|XP_007224275.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
 gb|EMJ25474.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
Length=443

 Score =   458 bits (1178),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 255/428 (60%), Positives = 308/428 (72%), Gaps = 18/428 (4%)
 Frame = -2

Query  1587  EYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRNDTT  1408
             + DE W++R  +A  +  ++YEPNP  ++     EV   +             + +N+T 
Sbjct  32    QLDEYWKKRAEQAENYTMESYEPNPQRVTDEFNAEVGELI-------------MGKNETR  78

Query  1407  RHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVTD  1228
             R+L G KKY GPC  TNPID CWRC  +WA NR ++ DC  GFG KT GGK G  Y VTD
Sbjct  79    RNLKGQKKYVGPCKVTNPIDSCWRCDPNWANNRMKIVDCIQGFGRKTTGGKGGPIYVVTD  138

Query  1227  NAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDG  1051
              +D D  NP+PGTLRHAVIQK PLWI F+ +M IKL QEL++  DKTIDGRGA V+I DG
Sbjct  139   PSDGDLVNPRPGTLRHAVIQKGPLWITFARNMVIKLQQELMVASDKTIDGRGANVNIFDG  198

Query  1050  AGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHV  871
             AGITIQFVKNVII  +HI  I    GG+IRD +DHFG RTKSDGDGISIFGSSN+WIDHV
Sbjct  199   AGITIQFVKNVIITNLHIKQIKAKEGGIIRDSVDHFGQRTKSDGDGISIFGSSNIWIDHV  258

Query  870   SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRL  691
             SM NC DGLIDAI  ST ITISN HFT HN+V+LFGA++  T+DK+MQIT+AFNHFGK L
Sbjct  259   SMENCTDGLIDAIMGSTGITISNCHFTKHNEVLLFGASNSYTQDKMMQITVAFNHFGKGL  318

Query  690   IQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGT  511
             +QRMPRCR+G+ HVVNNDYTHW MYAIGGS +PTII QGNRFIA  +   KE+TKR    
Sbjct  319   VQRMPRCRHGFFHVVNNDYTHWLMYAIGGSMNPTIISQGNRFIAGLNSATKEVTKREYTA  378

Query  510   PEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFK-AEDVTWLTRFAGAL  334
               EWK W W+S+GD++M GAFFV+SG P  + +  KL   ++ FK    VT +T+FAGAL
Sbjct  379   EAEWKNWLWKSEGDLFMNGAFFVESGSPANL-RADKL--DMIPFKPGTYVTKMTKFAGAL  435

Query  333   NCRVGSPC  310
             +C VG PC
Sbjct  436   DCFVGKPC  443



>ref|XP_009598230.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=434

 Score =   457 bits (1176),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 256/440 (58%), Positives = 315/440 (72%), Gaps = 23/440 (5%)
 Frame = -2

Query  1620  AIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaea  1441
              ++ +   +I+E+DEVW+ R  +A + AQ +Y P+P  ++ +L   V +           
Sbjct  15    TLVLSIEANISEFDEVWQTRATQAKKTAQDSYNPHPETVADNLNKHVHK-----------  63

Query  1440  eaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKG  1261
                +   N T R L    KY GPC +TNPIDRCWRC  +W  NR +LADC LGFG+ T G
Sbjct  64    --WEEGSNSTRRDL---HKYDGPCMSTNPIDRCWRCDPNWVKNRMKLADCVLGFGHHTTG  118

Query  1260  GKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GK G  Y VTD +DD   NPKPGTLRHAVIQ +PLWIIF H M I+L+QELIM  +KTID
Sbjct  119   GKGGKIYVVTDPSDDDMVNPKPGTLRHAVIQPEPLWIIFKHHMVIRLNQELIMTSNKTID  178

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
              RG +VHI+ GA   +QF+ NVIIHG+HIH I  GNGGLIRD ++H+G R++SDGDGISI
Sbjct  179   ARGQKVHIAFGASFMLQFINNVIIHGLHIHDIKAGNGGLIRDSINHYGFRSRSDGDGISI  238

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FGS+N+WIDHVSM NC DGLIDA++ASTAITISN HFT+HNDVMLFGA+D  ++D I+QI
Sbjct  239   FGSTNIWIDHVSMSNCDDGLIDAVQASTAITISNSHFTNHNDVMLFGASDSYSEDSILQI  298

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             TLAFNHFG+ LIQRMPR R+G++H VNNDYTHW MYAIGGS HPTI+ QGNRFIAPP+ +
Sbjct  299   TLAFNHFGQGLIQRMPRVRWGFVHAVNNDYTHWLMYAIGGSQHPTILSQGNRFIAPPNPN  358

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN--FMDKHHKLYDGVMTFKAE  370
              KE+TKR       WK W WRSQGD+ M GAFFV+SG+PN  FM    K  D +      
Sbjct  359   AKEVTKREYSPESVWKNWVWRSQGDLMMNGAFFVESGNPNHIFM----KGPDMIHPRPGS  414

Query  369   DVTWLTRFAGALNCRVGSPC  310
               + LTRF+G+LNC  G PC
Sbjct  415   YASRLTRFSGSLNCIEGKPC  434



>ref|XP_011087217.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=436

 Score =   456 bits (1174),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 248/441 (56%), Positives = 305/441 (69%), Gaps = 24/441 (5%)
 Frame = -2

Query  1620  AIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaea  1441
              +     G+I  +D VW+ R   A + A+QAY+PNP  +   L   V +++  +      
Sbjct  16    VVFTTVAGNIGVHDAVWQERREAAKKAARQAYQPNPGEVLDHLNENVHKSVEGS------  69

Query  1440  eaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKG  1261
                    N+  R   G  KY G C ATNPID+CWRC  +WA NRK+L DCALGFG  T G
Sbjct  70    -------NNQRR---GLSKYKGSCLATNPIDQCWRCQPNWANNRKKLVDCALGFGRHTTG  119

Query  1260  GKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GK G  Y VTD +D D  +PK GTLRHAVIQ +PLWIIF ++M+I+L +ELIM  +KTID
Sbjct  120   GKAGKMYVVTDPSDSDLVSPKKGTLRHAVIQPEPLWIIFKNNMNIRLSEELIMTSNKTID  179

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
             GRGAQVHI++GAGIT+Q++ NVIIH I +H I  GNGG+IRD   H+G RT+SDGDGIS+
Sbjct  180   GRGAQVHIANGAGITLQYIHNVIIHNIRVHDIKTGNGGMIRDSATHYGFRTRSDGDGISL  239

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FGS+N+WIDHVS+  C DGLIDAIEASTAITISN HF  HNDV+LFGA+D  ++D IMQI
Sbjct  240   FGSTNIWIDHVSLSRCDDGLIDAIEASTAITISNCHFAHHNDVLLFGASDSRSEDHIMQI  299

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             T+AFNHFGK LIQRMPR R+G++H+VNNDYT W MYAIGGS  PTI+ QGNRF+AP +  
Sbjct  300   TVAFNHFGKGLIQRMPRVRWGFVHIVNNDYTRWQMYAIGGSQQPTILSQGNRFVAPDNPF  359

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDG---VMTFKA  373
              KE+TKR   T   WK W W+S+GD+   GAFFVQSGD      HHK   G   V     
Sbjct  360   AKEVTKRDYATESVWKNWVWKSEGDVMNNGAFFVQSGDV----AHHKFAKGPDMVTPKPG  415

Query  372   EDVTWLTRFAGALNCRVGSPC  310
                + L++FAG LNC  G PC
Sbjct  416   GFASKLSQFAGPLNCIPGKPC  436



>ref|XP_004146792.1| PREDICTED: probable pectate lyase P59-like, partial [Cucumis 
sativus]
Length=442

 Score =   457 bits (1175),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 252/426 (59%), Positives = 301/426 (71%), Gaps = 17/426 (4%)
 Frame = -2

Query  1581  DEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRNDTTRH  1402
             DE W+ R  EA + AQ A+  NP  ++ +L   V RT+             +  N T R 
Sbjct  32    DEYWQTRATEAKKVAQGAFNANPEIVTDTLNAAVSRTM-------------LGHNSTRRS  78

Query  1401  LLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVTDNA  1222
             L   KKY GPC ATNPIDRCWRC  +WA NR++LA+C LGFG++T GGK G  Y VTD +
Sbjct  79    L--RKKYRGPCLATNPIDRCWRCDRNWAKNRRKLAECPLGFGHQTIGGKRGPIYVVTDAS  136

Query  1221  DDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAG  1045
             DD   NPKPGTLRH VIQK PLWIIF   M I+L QEL++   KTID RGA VHI+ GAG
Sbjct  137   DDDLVNPKPGTLRHGVIQKGPLWIIFGRSMVIRLSQELMISSHKTIDARGANVHIAFGAG  196

Query  1044  ITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSM  865
             +TIQFV NVIIH +HIH I   +GG+IRD +DH+G RT+SDGDGISIFGSS+VWIDHVSM
Sbjct  197   LTIQFVNNVIIHNLHIHDIVSKSGGMIRDSVDHYGFRTQSDGDGISIFGSSHVWIDHVSM  256

Query  864   RNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQ  685
              NC DGLIDAI  STAITISN HFT HN+VMLFGA+D   +D+IMQ+TLAFNHFG+ L+Q
Sbjct  257   SNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDSYAEDEIMQVTLAFNHFGRGLVQ  316

Query  684   RMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPE  505
             RMPRCR+G+ HVVNNDYTHW MYAIGGS HPTI+ QGNRFIAPP+ + K+ITKR     +
Sbjct  317   RMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNPNAKQITKREYAMED  376

Query  504   EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFK-AEDVTWLTRFAGALNC  328
             EWK W+WRS+GD  M GA F+ SGD     K       +++FK    V  L R +G + C
Sbjct  377   EWKHWSWRSEGDELMNGAVFIASGDQTKGKKKGLSRYDMISFKPGTYVRRLVRLSGTIEC  436

Query  327   RVGSPC  310
               G PC
Sbjct  437   TPGKPC  442



>ref|XP_004162547.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
Length=435

 Score =   456 bits (1173),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 251/426 (59%), Positives = 300/426 (70%), Gaps = 17/426 (4%)
 Frame = -2

Query  1581  DEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRNDTTRH  1402
             DE W  R  EA + AQ A+  NP  ++ +L   V RT+             +  N T R 
Sbjct  25    DEYWETRATEAKKVAQGAFNANPEIVTDTLNAAVSRTM-------------LGHNSTRRS  71

Query  1401  LLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVTDNA  1222
             L   KKY GPC ATNPIDRCWRC  +WA NR++LA+C LGFG++T GGK G  Y VTD +
Sbjct  72    L--RKKYRGPCLATNPIDRCWRCDRNWAKNRRKLAECPLGFGHQTIGGKRGPIYVVTDAS  129

Query  1221  DDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAG  1045
             DD   NPKPGTLRH VIQK PLWIIF   M I+L QEL++   KTID RGA VHI+ GAG
Sbjct  130   DDDLVNPKPGTLRHGVIQKGPLWIIFGRSMVIRLSQELMISSHKTIDARGANVHIAFGAG  189

Query  1044  ITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSM  865
             +TIQFV NVIIH +HIH I   +GG+IRD +DH+G RT+SDGDGISIFGSS+VWIDHVSM
Sbjct  190   LTIQFVNNVIIHNLHIHDIVSKSGGMIRDSVDHYGFRTQSDGDGISIFGSSHVWIDHVSM  249

Query  864   RNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQ  685
              NC DGLIDAI  STAITISN HFT HN+VMLFGA+D   +D+IMQ+TLAFNHFG+ L+Q
Sbjct  250   SNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDSYAEDEIMQVTLAFNHFGRGLVQ  309

Query  684   RMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPE  505
             RMPRCR+G+ HVVNNDYTHW MYAIGGS HPTI+ QGNRFIAPP+ + K++TKR     +
Sbjct  310   RMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNPNAKQVTKREYAMED  369

Query  504   EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFK-AEDVTWLTRFAGALNC  328
             EWK W+WRS+GD  M GA F+ SGD     K       +++FK    V  L R +G + C
Sbjct  370   EWKHWSWRSEGDELMNGAVFIASGDQTKGKKKGLSRYDMISFKPGTYVRRLVRLSGTIEC  429

Query  327   RVGSPC  310
               G PC
Sbjct  430   TPGKPC  435



>ref|XP_010925369.1| PREDICTED: pectate lyase [Elaeis guineensis]
Length=444

 Score =   456 bits (1173),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 256/434 (59%), Positives = 303/434 (70%), Gaps = 23/434 (5%)
 Frame = -2

Query  1593  IAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRND  1414
             I E D+ W+++  EA+  ++ AY P+P  ++      V   L+E             RN 
Sbjct  28    IPELDDHWQKKAEEALARSRAAYHPDPEAVTNHFNKAVHLALAE------------ARNS  75

Query  1413  TTRHL--LGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFY  1240
             T R L  +G KK+ G C ATNPIDRCWRC  +W  +RK+LA C  GFG    GGK G+FY
Sbjct  76    TRRSLRAVGVKKFKGKCVATNPIDRCWRCQKNWIKHRKKLATCGKGFGRHATGGKAGDFY  135

Query  1239  TVTDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVH  1063
              VTD +DD   NPK GTLR  VIQ +PLWI+F+ DM I+L +EL++  +KTID RGA VH
Sbjct  136   VVTDPSDDDLVNPKFGTLRWGVIQDRPLWIVFARDMIIRLSEELMINSNKTIDARGANVH  195

Query  1062  ISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVW  883
             I+ GA ITIQFV NVIIHG+HIH I   NGG+IRD L HFGLRTKSDGDGISI+GSS+VW
Sbjct  196   IAYGAQITIQFVNNVIIHGLHIHDIKPSNGGMIRDSLHHFGLRTKSDGDGISIYGSSDVW  255

Query  882   IDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHF  703
             IDH SMRNC DGLIDAIE STAITISN HFT HNDV+LFGA+D +  D IMQ T+AFNHF
Sbjct  256   IDHCSMRNCADGLIDAIEGSTAITISNCHFTHHNDVLLFGASDSNENDSIMQATVAFNHF  315

Query  702   GKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKR  523
             GK L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII QGNRFIAPP    KE+TKR
Sbjct  316   GKGLVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSKHPTIISQGNRFIAPPLRFAKEVTKR  375

Query  522   VKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTW---LT  352
                T + WK WTWRS+GD+   GAFF +SG PN    H K +      +A+  TW   LT
Sbjct  376   DYATEDVWKQWTWRSEGDLMQNGAFFRESGTPNTRTFHRKDF-----IRAKPGTWVRRLT  430

Query  351   RFAGALNCRVGSPC  310
             RFAG L C+ G  C
Sbjct  431   RFAGPLGCKAGRAC  444



>ref|XP_008221658.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=443

 Score =   456 bits (1172),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 255/428 (60%), Positives = 306/428 (71%), Gaps = 18/428 (4%)
 Frame = -2

Query  1587  EYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRNDTT  1408
             E DE W++R  +A  +  ++YEPNP  ++     +V   +             + +N+T 
Sbjct  32    ELDEYWKKRADQAENYTMESYEPNPERVTDEFNAQVGELI-------------MGKNETR  78

Query  1407  RHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVTD  1228
             R+L G KKY GPC  TNPID CWRC  +WA NR ++ DC  GFG KT GGK G  Y VTD
Sbjct  79    RNLKGQKKYVGPCTVTNPIDACWRCDPNWANNRMKIVDCIQGFGRKTTGGKGGPIYVVTD  138

Query  1227  NAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDG  1051
              +D D  NP+PGTLRHAVIQK PLWI F+ +M IKL QEL++  DKTIDGRGA V+I DG
Sbjct  139   PSDGDLVNPRPGTLRHAVIQKGPLWITFARNMVIKLQQELMVASDKTIDGRGANVNIFDG  198

Query  1050  AGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHV  871
             A ITIQFVKNVII  IHI  I    GG+IRD +DHFG RTKSDGDGISI+GSSN+WIDHV
Sbjct  199   ACITIQFVKNVIITNIHIKQIKAKEGGMIRDSVDHFGQRTKSDGDGISIYGSSNIWIDHV  258

Query  870   SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRL  691
             SM NC DGLID I  ST ITISN HFT HN+VMLFGA++  T+DK+MQIT+AFNHFGK L
Sbjct  259   SMENCTDGLIDVIMGSTGITISNSHFTKHNEVMLFGASNSYTQDKMMQITVAFNHFGKGL  318

Query  690   IQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGT  511
             +QRMPRCR+G+ HVVNNDYTHW MYAIGGS +PTII QGNRFIA  +   KE+TKR    
Sbjct  319   VQRMPRCRHGFFHVVNNDYTHWLMYAIGGSMNPTIISQGNRFIAGLNSAAKEVTKREYTA  378

Query  510   PEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFK-AEDVTWLTRFAGAL  334
               EWK W W+S+GD++M GAFFV+SG P  + +  KL   ++ FK    VT LT+FAGAL
Sbjct  379   EAEWKNWLWKSEGDLFMNGAFFVESGSPANL-RADKL--DMIPFKPGTYVTKLTKFAGAL  435

Query  333   NCRVGSPC  310
             +C VG PC
Sbjct  436   DCFVGKPC  443



>ref|XP_010915114.1| PREDICTED: LOW QUALITY PROTEIN: pectate lyase-like [Elaeis guineensis]
Length=444

 Score =   454 bits (1169),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 254/434 (59%), Positives = 306/434 (71%), Gaps = 19/434 (4%)
 Frame = -2

Query  1599  GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTR  1420
              +I E+D+ W+++  EA+  ++ AY P+P  ++      V   LSEA          V R
Sbjct  26    ANIVEFDDHWQKKAEEALARSRAAYNPDPEGVTHDFNKAVHLALSEARNSTRRTLRSVHR  85

Query  1419  NDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFY  1240
             N          K+ GPC ATNPIDRCWRC  +W  +RK+LA CA GFG    GGK G+FY
Sbjct  86    N----------KFKGPCVATNPIDRCWRCQKNWINHRKKLATCAKGFGRNAIGGKNGDFY  135

Query  1239  TVTDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVH  1063
              VTD +DD   NPK GTLR  VIQ +PLWIIF+ DM I+L +EL++  +KTIDGRGA VH
Sbjct  136   VVTDPSDDDLVNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELMINSNKTIDGRGANVH  195

Query  1062  ISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVW  883
             I+ GA ITIQFV +VIIHGIHIH I   NGG+IRD L HFG+RTKSDGDGISI+GSS++W
Sbjct  196   IAFGAQITIQFVHDVIIHGIHIHDIRPSNGGIIRDSLQHFGIRTKSDGDGISIYGSSDIW  255

Query  882   IDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHF  703
             IDH S+RNC DGLIDAIEASTAITISN HFT HNDV+LFGA+D +  D +MQ T+AFNHF
Sbjct  256   IDHCSLRNCADGLIDAIEASTAITISNCHFTHHNDVLLFGASDSNEHDSMMQATVAFNHF  315

Query  702   GKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKR  523
             GK L+QRMPRCR+G+ HVVNNDYT W MYAIGGS HPTII QGNRF+AP  +  KE+TKR
Sbjct  316   GKGLVQRMPRCRWGFFHVVNNDYTQWIMYAIGGSQHPTIISQGNRFVAPRMLFSKEVTKR  375

Query  522   VKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTW---LT  352
                T + WK WTWRS+GD+   GAFF +SG+PN      + +D     KA+  TW   LT
Sbjct  376   DYATEDVWKQWTWRSEGDLMQNGAFFRESGNPN-----ARKFDRKDFIKAKPGTWVRRLT  430

Query  351   RFAGALNCRVGSPC  310
             RFAG L CR G PC
Sbjct  431   RFAGPLGCRAGRPC  444



>gb|KDP45476.1| hypothetical protein JCGZ_09725 [Jatropha curcas]
Length=462

 Score =   454 bits (1169),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 254/449 (57%), Positives = 315/449 (70%), Gaps = 12/449 (3%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
             G I P  +  + +YD+VW+ R  EA ++  +AY+P+P  ++A +  +V   +        
Sbjct  15    GFITPNLMADMKKYDKVWQERSEEARKNMMEAYDPDPIAVTAEVNEQVNHQIDGNAKTNS  74

Query  1443  ae---------aEDVTRNDTTRHLLGSK-KYHGPCNATNPIDRCWRCHADWATNRKRLAD  1294
                              N+T R L   K KY+GPC A NPID+CWRC  +W  +R+RLA 
Sbjct  75    TINHTKGTNNFETGAEANNTRRSLKQKKQKYNGPCQANNPIDKCWRCRKNWVKDRQRLAS  134

Query  1293  CALGFGYKTKGGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQ  1117
             CALGFG +T GGK G  Y VTDN+D D   PKPGTLRHAVIQK+PLWIIF+ DM+IKL Q
Sbjct  135   CALGFGRRTTGGKGGKIYVVTDNSDHDCVEPKPGTLRHAVIQKEPLWIIFACDMNIKLSQ  194

Query  1116  ELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGL  937
             ELIM  +KTIDGRG  VHIS GAGITIQFV N+IIHG+ IHHI    GG+IRD +DH GL
Sbjct  195   ELIMAHNKTIDGRGFNVHISHGAGITIQFVSNIIIHGLRIHHICSTCGGMIRDSVDHVGL  254

Query  936   RTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGAN  757
             RT SDGDGISIFGS+NVWIDHVSM NC DGLIDAI+ STAITISN HF++HND +L GA+
Sbjct  255   RTASDGDGISIFGSTNVWIDHVSMSNCQDGLIDAIQGSTAITISNCHFSNHNDAILLGAS  314

Query  756   DLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQ  577
             D  + D+ MQIT+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW +YAIGGS HPTI+ Q
Sbjct  315   DSFSGDQFMQITVAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWLLYAIGGSMHPTIVSQ  374

Query  576   GNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLY  397
             GN+F+AP D + KE+TKR      EWK W WRS+GD+ + GAFFV+SG+P    +  K +
Sbjct  375   GNQFVAPDDKYIKEVTKRDYAPMSEWKKWNWRSEGDLMVNGAFFVESGEPALHLRPSKKF  434

Query  396   DGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
               +        T +TRFAGAL+C+ G  C
Sbjct  435   -MIKAKHGRFATQMTRFAGALDCKYGKKC  462



>ref|XP_004490004.1| PREDICTED: probable pectate lyase 3-like isoform X2 [Cicer arietinum]
Length=376

 Score =   451 bits (1161),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 240/367 (65%), Positives = 278/367 (76%), Gaps = 2/367 (1%)
 Frame = -2

Query  1407  RHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVTD  1228
             R  L  +K  GPC ATNPIDRCWRC  +WA NRK+LADC  GFG KT GGK G FY VTD
Sbjct  11    RRNLRGRKTAGPCMATNPIDRCWRCDPNWANNRKKLADCVQGFGRKTTGGKAGPFYVVTD  70

Query  1227  NAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDG  1051
              +D D  NP+PGTLRHAV +  PLWIIF+  M+I+L+QELIM  DKTIDGRGA + I++G
Sbjct  71    PSDSDMVNPRPGTLRHAVTRNGPLWIIFARSMNIRLNQELIMTSDKTIDGRGADIVIANG  130

Query  1050  AGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHV  871
             AGITIQ+++NVIIHGI +  I  G+GGL+RD  +H+GLRT SDGDGISIFGSSN+WIDHV
Sbjct  131   AGITIQYIRNVIIHGIKVFDIVVGSGGLVRDSENHYGLRTMSDGDGISIFGSSNIWIDHV  190

Query  870   SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRL  691
             SMRNC DGLIDAI  STAITISN HFTDHN+VMLFGA+D    D+ MQIT+AFNHFGKRL
Sbjct  191   SMRNCRDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDGYDADQKMQITVAFNHFGKRL  250

Query  690   IQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGT  511
             IQRMPRCR+G+IHVVNNDYTHW MYAIGGS HPTII +GNRFIAP + + KEITKR    
Sbjct  251   IQRMPRCRFGFIHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIAPDNGYAKEITKREYSP  310

Query  510   PEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALN  331
               EWK W WRS  D+YM GAFF Q G     ++     D +       V  LTR++G+L 
Sbjct  311   ESEWKNWQWRSINDVYMNGAFFRQGGS-ELTNRPFSKKDMITAKPGAYVGRLTRYSGSLK  369

Query  330   CRVGSPC  310
             C VG PC
Sbjct  370   CIVGKPC  376



>ref|XP_008339934.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score =   454 bits (1168),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 253/438 (58%), Positives = 306/438 (70%), Gaps = 20/438 (5%)
 Frame = -2

Query  1614  IPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaea  1435
             +P     + + D  W++R  EA + A ++Y  NP  ++    +EV + +           
Sbjct  32    VPNEDTQVLDLDAYWKQRAEEAEKEALESYNKNPEQVTEEFNNEVGKLM-----------  80

Query  1434  EDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGK  1255
               +  N T R+L G+K Y GPC ATNPID CWRC   WA NRK++  CA GFG K  GGK
Sbjct  81    --LKENTTRRNLRGNKAYKGPCMATNPIDACWRCDPYWANNRKKIVGCAQGFGKKATGGK  138

Query  1254  LGNFYTVTDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGR  1078
              G FY VT   DD   NPKPGTLRHAVIQK PLWIIF+  M I+L QEL++  DKTID R
Sbjct  139   DGPFYVVTMGTDDDVQNPKPGTLRHAVIQKGPLWIIFAKSMVIRLQQELMVTSDKTIDAR  198

Query  1077  GAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifg  898
             GA V I +GAGIT+QFVKNVII  +HI  I    GG+IRD +DH GLRT+SDGDGIS+FG
Sbjct  199   GANVVIEEGAGITLQFVKNVIITNLHIKMIVPKPGGMIRDSVDHIGLRTQSDGDGISLFG  258

Query  897   sSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITL  718
             +SNVWIDHVSM  C DGLIDA+  ST+ITISN HFTDH++ MLFGAN+  T+DKIMQITL
Sbjct  259   ASNVWIDHVSMSRCADGLIDAVMGSTSITISNSHFTDHDEAMLFGANNAHTQDKIMQITL  318

Query  717   AFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKK  538
             AFNHFG+ L+QRMPR R+G+ HVVNNDYTHW MYAIGG+ +PTII QGNRFIAP +   K
Sbjct  319   AFNHFGQGLVQRMPRVRHGFFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIAPINGVTK  378

Query  537   EITKRVKGTPE-EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED-V  364
             ++T R + TPE EWK W WRS+GD+ M GAFFV+SG  +   KH    D +M FK    V
Sbjct  379   QVTHR-ENTPEAEWKNWEWRSEGDLMMNGAFFVESG--SGASKHPAKLD-MMPFKPGTFV  434

Query  363   TWLTRFAGALNCRVGSPC  310
               LT+F+GALNC VG PC
Sbjct  435   ATLTKFSGALNCAVGKPC  452



>ref|XP_004236194.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=435

 Score =   453 bits (1165),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 251/433 (58%), Positives = 306/433 (71%), Gaps = 23/433 (5%)
 Frame = -2

Query  1599  GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTR  1420
              HI E+DEVW++R  +A + A+ AY PNP  ++  L ++V + +  + +          R
Sbjct  23    AHIKEFDEVWKKRAQQAKKAARHAYNPNPKIVADHLNYQVDKAVRGSKSR---------R  73

Query  1419  NDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFY  1240
              D  R       Y G C ATNPID+CWRC  +WA NR +L DC LGFG KT GGK G  Y
Sbjct  74    RDLQR-------YSGKCMATNPIDQCWRCDPNWARNRMKLTDCVLGFGRKTTGGKGGKIY  126

Query  1239  TVTDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVH  1063
              V DN+D+   NPKPGTLRHAVIQ +PLWIIF+ +M IKL+QELIM  +KTID RG QVH
Sbjct  127   VVMDNSDNELVNPKPGTLRHAVIQPEPLWIIFAKNMVIKLNQELIMTSNKTIDARGRQVH  186

Query  1062  ISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVW  883
             I+ G G+ +QF+ NVII  +HIH    G GGLIRD + H+G R+KSDGDGISIFGS+NVW
Sbjct  187   IAHGGGLMLQFIHNVIISNLHIHDTKAGAGGLIRDSVSHYGYRSKSDGDGISIFGSTNVW  246

Query  882   IDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHF  703
             IDH+SM NC DGLIDA+E STAITISN HFT HNDVMLFGA+D ++ D +MQITLAFNHF
Sbjct  247   IDHISMSNCQDGLIDAVEGSTAITISNCHFTKHNDVMLFGASDTASGDSVMQITLAFNHF  306

Query  702   GKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKR  523
             G  L QRMPR R+G++HVVNNDYTHW MYAIGGS HPTI+ QGNRFIAPP+ + KE+TKR
Sbjct  307   GHGLTQRMPRVRWGFVHVVNNDYTHWLMYAIGGSMHPTILSQGNRFIAPPNPNAKEVTKR  366

Query  522   VKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLY--DGVMTFKAEDVTWLTR  349
                    WK W W+SQGD+ M GAFFV+SGDP    KH  L   D + +     V+ LT+
Sbjct  367   DYAPENVWKNWVWKSQGDLMMNGAFFVESGDP----KHAFLKGPDMITSKPGSSVSSLTQ  422

Query  348   FAGALNCRVGSPC  310
             F+G+L C  G PC
Sbjct  423   FSGSLKCIEGRPC  435



>ref|XP_002871648.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47907.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=472

 Score =   454 bits (1168),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 249/458 (54%), Positives = 311/458 (68%), Gaps = 21/458 (5%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNI-------------SASLIHE  1483
               +IP   G+I+E DE W +R  EA E   QAY  +P+ I               +   E
Sbjct  16    AVLIPTIRGNISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTDVTTTEE  75

Query  1482  VRRTLSeavaeaeaeaEDVTRNDTTRHLLGS-----KKYHGPCNATNPIDRCWRCHADWA  1318
                   E   +   E    + N T R L G       K  GPC A+NPID+CWRC +DWA
Sbjct  76    EGDAKPEEEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWRCRSDWA  135

Query  1317  TNRKRLADCALGFGYKTKGGKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSH  1141
               RKRL  C  GFG++T GGK G  Y VT N DD   NPKPGTLRHAVIQK+PLWIIF +
Sbjct  136   KRRKRLTRCVRGFGHRTTGGKRGRIYVVTSNLDDDMVNPKPGTLRHAVIQKEPLWIIFKN  195

Query  1140  DMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIR  961
             DM I+L+QEL++   KTID RGA VH++ GAGIT+QFVKNVIIHG+HIHHI E +GG+IR
Sbjct  196   DMSIRLNQELLINSHKTIDARGANVHVAHGAGITMQFVKNVIIHGLHIHHISESSGGMIR  255

Query  960   DGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHN  781
             D +DHFG+RT++DGDG+SI+GSSN+W+DH+SM  C DGLIDAI  ST ITISN HFT HN
Sbjct  256   DSVDHFGMRTRADGDGLSIYGSSNIWLDHISMSKCQDGLIDAIVGSTGITISNSHFTHHN  315

Query  780   DVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGS  601
             DVML GA + +  DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW +YAIGGS
Sbjct  316   DVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGS  375

Query  600   SHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN  424
               PTI+  GNRFIAPP   H +E+TKR   + +EWK W WRS+ D++M GA+F QSG+P 
Sbjct  376   QGPTILSHGNRFIAPPHKPHYREVTKRDYASEDEWKHWNWRSEKDVFMNGAYFRQSGNPQ  435

Query  423   FMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             +   H +    +       V+ LT++AGAL+CRVG  C
Sbjct  436   YKCAHTR-QQMIKPKHGLAVSKLTKYAGALDCRVGKRC  472



>ref|XP_008230729.1| PREDICTED: pectate lyase [Prunus mume]
Length=452

 Score =   452 bits (1164),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 261/432 (60%), Positives = 313/432 (72%), Gaps = 12/432 (3%)
 Frame = -2

Query  1596  HIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRN  1417
             ++ ++D VW+ RE +A + A +AY+ NP  ++      V+        +   E +D   N
Sbjct  30    NVGQFDAVWKERELKAEKTALKAYQRNPEKVTDDFNESVQEV-----DDLNFEDDDQVSN  84

Query  1416  DTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYT  1237
              T RHLLG KKY GPC ATNPIDRCWRC  DWA +RK+LA+C  GFG +T+GGK G FY 
Sbjct  85    ITGRHLLG-KKYKGPCKATNPIDRCWRCRKDWANDRKKLANCVKGFGRRTRGGKRGEFYV  143

Query  1236  VTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHI  1060
             VTD +D +   PKPGTLRHAVIQ +PLWIIF+  M I+L QELIM   KTID RGA VHI
Sbjct  144   VTDPSDSNVVEPKPGTLRHAVIQPQPLWIIFARSMTIRLTQELIMTSHKTIDARGANVHI  203

Query  1059  SDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWI  880
             + GAG+T+QFV+NVIIHG+HIH I  G+GG IRD +DHFG RT+SDGDGISIFGSS+VW+
Sbjct  204   AHGAGLTLQFVQNVIIHGLHIHDIVPGSGGTIRDSVDHFGTRTQSDGDGISIFGSSHVWL  263

Query  879   DHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFG  700
             DH+SM NC DGLID I+ STA+TISN HFT HNDV+LFGA+D    D IMQIT+AFNHFG
Sbjct  264   DHLSMWNCADGLIDVIQGSTAVTISNCHFTRHNDVLLFGASDSFAGDAIMQITVAFNHFG  323

Query  699   KRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRV  520
             K L+QRMPRCR+G+IHVVNNDYTHW MYAIGGSSHPTII QGNRFIAPP+   KE+TKR 
Sbjct  324   KGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTIISQGNRFIAPPNQAAKEVTKRD  383

Query  519   KGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKL--YDGVMTFKAEDVTWLTRF  346
                   WK W WRS+GD+ + GAFFV+SG      K+H     D +       V+ LTRF
Sbjct  384   YAPMGVWKNWQWRSEGDLMLNGAFFVESG---VAKKNHGFGKLDMMTAKPGTFVSRLTRF  440

Query  345   AGALNCRVGSPC  310
             AG L CRVG  C
Sbjct  441   AGTLGCRVGQKC  452



>gb|KHG05193.1| hypothetical protein F383_30875 [Gossypium arboreum]
Length=385

 Score =   449 bits (1156),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 244/376 (65%), Positives = 281/376 (75%), Gaps = 2/376 (1%)
 Frame = -2

Query  1431  DVTRNDTTRHLLGS-KKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGK  1255
             DV  N T R L G  KKY GPC A NPIDRCWRC  +WA NRKRLA C LGFG+KT+GGK
Sbjct  10    DVITNSTRRSLRGKHKKYTGPCMAINPIDRCWRCKKNWAKNRKRLAKCVLGFGHKTRGGK  69

Query  1254  LGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGR  1078
              G +Y VTDN+DD   NPKPGTLRHAVIQK+PLWIIF+HDM+IKL +EL++Q  KTIDGR
Sbjct  70    KGEYYLVTDNSDDDVVNPKPGTLRHAVIQKRPLWIIFAHDMNIKLSKELMVQSHKTIDGR  129

Query  1077  GAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifg  898
             G  VHI+ G GIT+QFV NVIIH IHIH +   +GGLIRD  DH+G RT  DGDGISIFG
Sbjct  130   GVNVHIAYGCGITLQFVHNVIIHNIHIHRVVRSSGGLIRDSEDHYGYRTVGDGDGISIFG  189

Query  897   sSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITL  718
             SS +W+DH+SM  C DGLIDAI+ STAITISN HFT H+ V+L GA+D  +KD+ MQ+TL
Sbjct  190   SSKIWLDHISMSECQDGLIDAIQGSTAITISNCHFTHHDHVILLGASDTYSKDQYMQVTL  249

Query  717   AFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKK  538
             AFNHFGK LIQRMPRCR+GY HVVNNDYTHW +YAIGGS+HPTII QGNRFIAP D   K
Sbjct  250   AFNHFGKELIQRMPRCRWGYFHVVNNDYTHWKLYAIGGSTHPTIISQGNRFIAPDDPLTK  309

Query  537   EITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTW  358
             EIT R      EW+ W WRS+GD +M GAFFV SG P+      K  D +    A  V  
Sbjct  310   EITHRNYAPESEWRNWIWRSEGDRFMNGAFFVTSGPPSPPHLKLKKKDIIKAKPAIFVGR  369

Query  357   LTRFAGALNCRVGSPC  310
             LT+F+G L C+ G  C
Sbjct  370   LTKFSGTLKCKEGVKC  385



>gb|KHG23093.1| hypothetical protein F383_29772 [Gossypium arboreum]
Length=385

 Score =   449 bits (1156),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 244/376 (65%), Positives = 282/376 (75%), Gaps = 2/376 (1%)
 Frame = -2

Query  1431  DVTRNDTTRHLLGS-KKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGK  1255
             DV  N T R L G  KKY GPC A NPIDRCWRC  +WA NRKRLA C LGFG+KT+GGK
Sbjct  10    DVITNSTRRDLRGKHKKYTGPCMAINPIDRCWRCRKNWAKNRKRLAKCVLGFGHKTRGGK  69

Query  1254  LGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGR  1078
              G +Y VTDN+DD   NPKPGTLRHAVIQK+PLWIIF+HDM+IKL QEL++Q  KTIDGR
Sbjct  70    KGEYYLVTDNSDDDVVNPKPGTLRHAVIQKRPLWIIFAHDMNIKLSQELMVQSHKTIDGR  129

Query  1077  GAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifg  898
             GA VHI+ G GIT+QFV NVIIH IHIH +   +GGLIRD  DH+G RT  DGDGISIFG
Sbjct  130   GANVHIAYGCGITLQFVHNVIIHNIHIHRVVRSSGGLIRDSEDHYGFRTVGDGDGISIFG  189

Query  897   sSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITL  718
             SS +W+DH+SM  C DGLIDAI+ STAITISN HFT H+ V+L GA+D  ++D+ MQ+TL
Sbjct  190   SSKIWLDHISMSECQDGLIDAIQGSTAITISNCHFTHHDHVILLGASDTYSRDQFMQVTL  249

Query  717   AFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKK  538
             AFNHFGK LIQRMPRCR+GY HVVNNDYTHW +YAIGGS+HPTII QGNRFIAP D   K
Sbjct  250   AFNHFGKELIQRMPRCRWGYFHVVNNDYTHWKLYAIGGSTHPTIISQGNRFIAPDDPLTK  309

Query  537   EITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTW  358
             EIT R   +  EW+ W WRS+GD +M GAFFV SG  +      K  D +    A  V  
Sbjct  310   EITNRNYASESEWRHWVWRSEGDRFMNGAFFVTSGPHSPPRLKFKKKDIIKPKPAIFVGR  369

Query  357   LTRFAGALNCRVGSPC  310
             LT+F+G L C+ G  C
Sbjct  370   LTKFSGTLKCKEGVKC  385



>ref|XP_004508770.1| PREDICTED: probable pectate lyase P59-like [Cicer arietinum]
Length=434

 Score =   451 bits (1160),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 249/440 (57%), Positives = 307/440 (70%), Gaps = 25/440 (6%)
 Frame = -2

Query  1620  AIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaea  1441
             A+ P     IA   + W+ R  EA + AQ+AY+PNPH+I+ +    V ++          
Sbjct  17    ALFPTLRASIAHDAQFWQTRAREAKQAAQKAYKPNPHDIALTFNKHVDKSFK--------  68

Query  1440  eaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKG  1261
                  + N T R   G  KY GPC ATNPID+CWRC  +W  NRK+LA+CALGFG+ T G
Sbjct  69    -----SSNGTRR---GLSKYTGPCLATNPIDKCWRCDPNWEKNRKKLANCALGFGHGTTG  120

Query  1260  GKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GK G  Y VTD++D D  NPKPGTLRHAVIQ +PLWIIF H M+IKL  ELI   +KTID
Sbjct  121   GKNGKIYVVTDSSDHDLINPKPGTLRHAVIQNEPLWIIFKHSMNIKLSSELIFTDNKTID  180

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
              RGA VHIS+GA +T+Q+VKN+IIHG+HIH I +G GGLIRD ++H+G R+ SDGD IS+
Sbjct  181   ARGANVHISNGAQMTLQYVKNIIIHGLHIHDIKKGGGGLIRDSVNHYGYRSSSDGDAISL  240

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FGSS+VWIDH+S+ NC DGLID +E STAITISN H T HNDVMLFGA+D  + DK++Q+
Sbjct  241   FGSSHVWIDHISLWNCDDGLIDVVEGSTAITISNCHMTRHNDVMLFGASDGYSGDKVLQV  300

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             T+AFNHFGK LIQRMPRCR+G+ H+VNNDYT W MYAIGGS  PTI+ QGNRFIAP + +
Sbjct  301   TVAFNHFGKGLIQRMPRCRWGFFHIVNNDYTQWVMYAIGGSQQPTILSQGNRFIAPNNPN  360

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDP--NFMDKHHKLYDGVMTFKAE  370
              KE+TKR       WKTW+W S+ D+   GAFFVQSG    NF     K   G  ++ A 
Sbjct  361   AKEVTKRDYAAESVWKTWSWTSENDLMRNGAFFVQSGKKSGNFPKTDIKAKPG--SYAAS  418

Query  369   DVTWLTRFAGALNCRVGSPC  310
                 LTRF+GA+ C V  PC
Sbjct  419   ----LTRFSGAIKCVVNKPC  434



>ref|XP_002511525.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF52127.1| Pectate lyase precursor, putative [Ricinus communis]
Length=433

 Score =   451 bits (1160),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 251/439 (57%), Positives = 305/439 (69%), Gaps = 21/439 (5%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               IIP    +IA +D+VW++R  EA   A QAY PNP +I      EV ++L        
Sbjct  15    ATIIPTLKANIAHFDKVWQQRAKEASHAALQAYHPNPEDIVNHFNKEVAKSL--------  66

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                     ND +       ++  PC+ATNPIDRCWRC A+WA+NRK+LA CALGFG  T 
Sbjct  67    --------NDFSSTSSQLSQHKRPCHATNPIDRCWRCDANWASNRKKLAGCALGFGRMTT  118

Query  1263  GGKLGNFYTVTDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTI  1087
             GGK G++Y VTD +DD   NP+ GTLR+ VIQ +PLWI F+ DM I L QELI+  +KTI
Sbjct  119   GGKDGDYYVVTDPSDDDLVNPREGTLRYGVIQDRPLWITFAGDMVITLSQELIINSNKTI  178

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             DGRGA VHIS GA ITIQ+ +N+IIHGIHIH I  G+GG IRD   HFG RT SDGDGIS
Sbjct  179   DGRGANVHISCGAQITIQYARNIIIHGIHIHDIRGGSGGKIRDSETHFGKRTASDGDGIS  238

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             I+GS+N+WIDHVS+ NC DGLIDAI ASTAITISN HFT HN VML G N+  + D +MQ
Sbjct  239   IYGSNNIWIDHVSISNCTDGLIDAIMASTAITISNCHFTRHNTVMLLGGNNKFSADSVMQ  298

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             +T+AFNHF ++L+QRMPR RYG  HVVNNDYT W MYAIGGS HPTII QGNRF+APPD 
Sbjct  299   VTVAFNHFDRKLVQRMPRVRYGLAHVVNNDYTSWEMYAIGGSEHPTIISQGNRFLAPPDP  358

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED  367
               K++TKR      EWK+W WRS+GD+ + GAFFV+SG P  ++ H K  + V       
Sbjct  359   DCKQVTKRNVEPESEWKSWNWRSEGDLMLNGAFFVESGSP--IETHGK--EEVHAMPGTL  414

Query  366   VTWLTRFAGALNCRVGSPC  310
             V  LTR+AGAL+C+   PC
Sbjct  415   VHRLTRYAGALHCKKQKPC  433



>ref|XP_006344502.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=435

 Score =   451 bits (1159),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 250/433 (58%), Positives = 306/433 (71%), Gaps = 23/433 (5%)
 Frame = -2

Query  1599  GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTR  1420
              HI E+DEVW++R  +A + A+ AY PNP  ++  L ++V + +  +             
Sbjct  23    AHIKEFDEVWKKRAQQAKKAARHAYNPNPKIVADHLNYQVDKAVRGS-------------  69

Query  1419  NDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFY  1240
             N   R L    +Y G C ATNPID+CWRC  +WA NR +L DC LGFG KT GGK G  Y
Sbjct  70    NSRRRDL---HRYSGKCMATNPIDQCWRCDPNWARNRMKLTDCVLGFGRKTTGGKGGKIY  126

Query  1239  TVTDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVH  1063
              V DN+D+   NPKPGTLRHAVIQ +PLWIIF+ +M I+L+QELIM  +KTID RG QVH
Sbjct  127   VVMDNSDNELVNPKPGTLRHAVIQPEPLWIIFAKNMVIRLNQELIMTSNKTIDARGRQVH  186

Query  1062  ISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVW  883
             I+ G G+ +QFV NV+I  +HIH    G+GGLIRD + H+G R+KSDGDGISIFGS+NVW
Sbjct  187   IAHGGGLMLQFVHNVLISNLHIHDTKAGSGGLIRDSVSHYGYRSKSDGDGISIFGSTNVW  246

Query  882   IDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHF  703
             IDH+SM NC DGLIDA+E STAITISN HFT HNDVMLFGA+D ++ D +MQITLAFNHF
Sbjct  247   IDHISMSNCQDGLIDAVEGSTAITISNCHFTKHNDVMLFGASDTASGDSVMQITLAFNHF  306

Query  702   GKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKR  523
             G  L QRMPR R+G++H VNNDYTHW MYAIGGS HPTI+ QGNRFIAPP+ + KE+TKR
Sbjct  307   GHGLTQRMPRIRWGFVHAVNNDYTHWLMYAIGGSMHPTILSQGNRFIAPPNPNAKEVTKR  366

Query  522   VKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLY--DGVMTFKAEDVTWLTR  349
                    WK W W+SQGD+ M GAFFV+SGDP    KH  L   D + +     V+ LTR
Sbjct  367   DYAPENVWKNWVWKSQGDLMMNGAFFVESGDP----KHAFLKGPDMITSKPGSFVSSLTR  422

Query  348   FAGALNCRVGSPC  310
             F+G+L C  G PC
Sbjct  423   FSGSLKCIEGRPC  435



>ref|NP_001057945.1| Os06g0583900 [Oryza sativa Japonica Group]
 dbj|BAD68734.1| putative pectate lyase [Oryza sativa Japonica Group]
 dbj|BAF19859.1| Os06g0583900 [Oryza sativa Japonica Group]
 dbj|BAG93046.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80871.1| hypothetical protein OsI_23497 [Oryza sativa Indica Group]
Length=448

 Score =   451 bits (1159),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 242/434 (56%), Positives = 301/434 (69%), Gaps = 22/434 (5%)
 Frame = -2

Query  1599  GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTR  1420
              +I EYDE W++R+  A   A+  Y+ +P  ++ S    V R+                 
Sbjct  33    ANIGEYDEYWQKRKLMADAAAEATYKRDPFEVTNSFNRAVHRS----------------E  76

Query  1419  NDTTRHLLG---SKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLG  1249
              ++ R  L     KK+ GPC ATNPIDRCWRC ADW T+RKRLA CA GFG  T GG  G
Sbjct  77    EESGRRELAMTKRKKFAGPCKATNPIDRCWRCRADWVTDRKRLARCAQGFGRNTTGGLAG  136

Query  1248  NFYTVTDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGA  1072
              FY VTD  DD   NP+PGTLR  VIQ +PLWIIF+ DM I L +E+++  DKTIDGRGA
Sbjct  137   KFYLVTDGTDDDVENPRPGTLRWGVIQDEPLWIIFAKDMIINLKEEMMINSDKTIDGRGA  196

Query  1071  QVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsS  892
             QV I++GA +T+Q   NVIIH IHIH I +G GG+IRD  +HFG RT+SDGDGISIFGS+
Sbjct  197   QVRITNGAQVTVQNSNNVIIHNIHIHDILQGKGGMIRDSPEHFGFRTQSDGDGISIFGST  256

Query  891   NVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAF  712
             NVW+DH+S+ NC DGLID I  ST +TISN H T+HNDVMLFG++D  ++D+IMQIT+AF
Sbjct  257   NVWLDHLSLSNCQDGLIDVIAKSTGVTISNCHLTNHNDVMLFGSSDSFSEDQIMQITVAF  316

Query  711   NHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEI  532
             NHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS +PTII QGNR+IAPP++  K I
Sbjct  317   NHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKNPTIISQGNRYIAPPNLAAKRI  376

Query  531   TKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLT  352
             TK++  T EEWK W W S+ D++MEGA+F  SG P  + K     D +       VT LT
Sbjct  377   TKQLGATEEEWKNWVWHSEEDLFMEGAYFTTSGGP--IQKQFSNKDLIKPKPGSYVTRLT  434

Query  351   RFAGALNCRVGSPC  310
             RFAG++ C  G PC
Sbjct  435   RFAGSIPCVAGKPC  448



>ref|XP_007157384.1| hypothetical protein PHAVU_002G065800g [Phaseolus vulgaris]
 gb|ESW29378.1| hypothetical protein PHAVU_002G065800g [Phaseolus vulgaris]
Length=448

 Score =   451 bits (1159),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 247/427 (58%), Positives = 295/427 (69%), Gaps = 16/427 (4%)
 Frame = -2

Query  1587  EYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRNDTT  1408
              +D  W+ R+  A +  Q+AY  +P++ + ++ + +                 +T  +  
Sbjct  37    SFDGYWKGRKQVAEKQNQEAYITDPYSFTINMTNNISDL--------------ITGEEKG  82

Query  1407  RHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVTD  1228
             R  L  K+    C ATNPIDRCWRC   W+ NRK+LADC  GFG  T GGK G FY VT 
Sbjct  83    RRNLAGKQSQDSCLATNPIDRCWRCDPKWSENRKKLADCVQGFGRDTIGGKKGPFYVVTS  142

Query  1227  NAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDG  1051
             N D D  NP PGTLRHAV +  PLWIIF+H M+I+L QELI+ GDKTIDGRGA ++I +G
Sbjct  143   NLDNDMVNPVPGTLRHAVTRNGPLWIIFAHSMNIRLSQELIVAGDKTIDGRGADIYIVNG  202

Query  1050  AGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHV  871
             AG TIQFVKNVIIHGI I  I  G GGLIRD   H+GLRT+SDGDGISIFGSS +WIDHV
Sbjct  203   AGFTIQFVKNVIIHGIKIFDINAGQGGLIRDSESHYGLRTQSDGDGISIFGSSYIWIDHV  262

Query  870   SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRL  691
             SMRN  DGLIDAI+ STAITISN HFTDHN+VMLFGA+D   +DKIMQITL FNHFGKRL
Sbjct  263   SMRNARDGLIDAIQGSTAITISNSHFTDHNEVMLFGASDSHEEDKIMQITLVFNHFGKRL  322

Query  690   IQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGT  511
             +QRMPRCR+G+IHVVNNDYTHW MYAIGGS HPTII +GNRF+AP     K+ITKR    
Sbjct  323   VQRMPRCRFGFIHVVNNDYTHWEMYAIGGSKHPTIISEGNRFVAPDSKDAKQITKREYSL  382

Query  510   PEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALN  331
               EWK W WRS  D  + GAFF++SG P+  ++     D + +     V  LTR AG+L 
Sbjct  383   EPEWKKWQWRSIKDEVINGAFFIESG-PDLTNRPFTRKDMISSRPGTYVGRLTRHAGSLR  441

Query  330   CRVGSPC  310
             C VG PC
Sbjct  442   CIVGKPC  448



>ref|XP_009117903.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=452

 Score =   451 bits (1159),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 242/443 (55%), Positives = 304/443 (69%), Gaps = 17/443 (4%)
 Frame = -2

Query  1617  IIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeae  1438
             ++P    ++A +D  W +R+ +A++    +Y+PNP N++  L + V   +          
Sbjct  20    LVPHVQSNVAVFDNYWTQRQGDALKQTIASYDPNPLNVTDHLNYHVALAVDATE------  73

Query  1437  aEDVTRNDTTRHLLGSKKYHGP--CNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                 + N+T R L+G K   G   C A NPID+CWRC  +W  NRK+LA+C LGFG KT 
Sbjct  74    ----STNNTRRELIGRKTQEGSGKCIAYNPIDKCWRCDPNWEKNRKKLAECVLGFGRKTT  129

Query  1263  GGKLGNFYTVTDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTI  1087
             GGK G  Y V D++DD   NPKPGTLRHAV +  PLWIIF++ M IKL QEL++  +KTI
Sbjct  130   GGKDGPIYVVNDSSDDDLVNPKPGTLRHAVTRDGPLWIIFANSMVIKLQQELMITSNKTI  189

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             DGRGA+V+I +G G+T+QFV NVII+ I++ HI  GNGGLIRD  +H G+RTKSDGDGIS
Sbjct  190   DGRGAKVYIMEGVGLTLQFVNNVIINNIYVKHIIPGNGGLIRDSEEHVGIRTKSDGDGIS  249

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             +FG++NVWIDHVSM  C DG+IDAIE STA+TISN HFTDH +VMLFGA D    DK MQ
Sbjct  250   LFGATNVWIDHVSMTRCTDGMIDAIEGSTAVTISNSHFTDHQEVMLFGAKDEHVIDKNMQ  309

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             IT+AFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+ +PTII QGNRFIAPP+ 
Sbjct  310   ITVAFNHFGKRLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNE  369

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK----LYDGVMTF  379
               KE+TKR   +  +WK+W W+S+GD ++ GA+FVQSG PN      K        +   
Sbjct  370   QAKEVTKREYTSYTDWKSWNWQSEGDYFLNGAYFVQSGRPNAWSPKPKNPVPSKFAIRPK  429

Query  378   KAEDVTWLTRFAGALNCRVGSPC  310
                 V  LT  AGAL C  G  C
Sbjct  430   PGTMVRELTMDAGALGCEAGKAC  452



>ref|XP_007215366.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
 gb|EMJ16565.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
Length=452

 Score =   450 bits (1158),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 263/436 (60%), Positives = 316/436 (72%), Gaps = 12/436 (3%)
 Frame = -2

Query  1608  ATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaED  1429
             A   ++ ++D VW+ RE +A + A +AY+PNP  ++      V+        +   E +D
Sbjct  26    ANDSNVGQFDAVWKERELKAEKAALKAYQPNPEKVTDDFNESVQE-----FDDLNFEDDD  80

Query  1428  VTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLG  1249
                N T RHLLG KKY GPC ATNPIDRCWRC  DWA +RK+LA+C  GFG +T+GGK G
Sbjct  81    QVSNITGRHLLG-KKYKGPCKATNPIDRCWRCRKDWANDRKKLANCVKGFGRRTRGGKRG  139

Query  1248  NFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGA  1072
              FY VTD +D +  +PKPGTLRHAVIQ +PLWIIF+  M I+L QELI+   KTID RGA
Sbjct  140   GFYVVTDPSDSNVVDPKPGTLRHAVIQPQPLWIIFARSMTIRLTQELILTSHKTIDARGA  199

Query  1071  QVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsS  892
              V I+ GAGIT+QFV+NVIIHG+HIH I  G+GG IRD +DHFG RT+SDGDGISIFGSS
Sbjct  200   NVRIAHGAGITLQFVQNVIIHGLHIHDIVPGSGGTIRDSVDHFGTRTQSDGDGISIFGSS  259

Query  891   NVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAF  712
             ++W+DH+SM NC DGLID I+ STAITISN HFT HNDV+LFGA+D    D IMQIT+AF
Sbjct  260   HIWLDHLSMWNCGDGLIDVIQGSTAITISNCHFTRHNDVLLFGASDSFAGDAIMQITVAF  319

Query  711   NHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEI  532
             NHFGK L+QRMPRCR+G+IHVVNNDYTHW MYAIGGSSHPTII QGNRFIAPP+   KE+
Sbjct  320   NHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTIISQGNRFIAPPNHAAKEV  379

Query  531   TKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKL--YDGVMTFKAEDVTW  358
             TKR     + WK W WRS+GD+ + GAFFV+SG      K+H     D +       VT 
Sbjct  380   TKRDYAPVDVWKNWQWRSEGDLMLNGAFFVESG---VAKKNHGFGKLDMMTAKPGTFVTR  436

Query  357   LTRFAGALNCRVGSPC  310
             LTRFAG L CRVG  C
Sbjct  437   LTRFAGTLGCRVGQKC  452



>ref|XP_002892805.1| hypothetical protein ARALYDRAFT_471616 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69064.1| hypothetical protein ARALYDRAFT_471616 [Arabidopsis lyrata subsp. 
lyrata]
Length=459

 Score =   451 bits (1159),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 246/447 (55%), Positives = 306/447 (68%), Gaps = 21/447 (5%)
 Frame = -2

Query  1617  IIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeae  1438
             + P    ++A +D  W +R+++A++    +Y+PNP N++    + V   +  +       
Sbjct  23    VAPQVRANVAVFDSYWTQRQSDALKQTMGSYDPNPINVTNHFNYHVNIAVDVSE------  76

Query  1437  aEDVTRNDTTRHLL------GSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFG  1276
                 + NDT R L        +KK+ G C A NPID+CWRC  +WA NRK+LADC LGFG
Sbjct  77    ----SNNDTRRELTQVRSGRKTKKHSGKCLAYNPIDKCWRCDRNWAKNRKKLADCVLGFG  132

Query  1275  YKTKGGKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQG  1099
              +T GGK G  Y V D +DD   NPKPGTLRHAV +  PLWIIF+  M IKL QEL++  
Sbjct  133   RRTTGGKDGPIYVVKDASDDDLINPKPGTLRHAVTRNGPLWIIFARSMIIKLQQELMITS  192

Query  1098  DKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdg  919
             DKTIDGRGA+V+I +GAG+T+Q+V NVIIH I++ HI  GNGGLIRD  DH GLRTKSDG
Sbjct  193   DKTIDGRGARVYIMEGAGLTLQYVNNVIIHNIYVKHIVPGNGGLIRDSEDHIGLRTKSDG  252

Query  918   dgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKD  739
             DGIS+FG++N+WIDHVSM  C DG+IDAI+ STA+TISN HFTDH +VMLFGA D    D
Sbjct  253   DGISLFGATNIWIDHVSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVID  312

Query  738   KIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIA  559
             K MQIT+AFNHFGKRL QRMPRCRYG IHVVNNDYTHW MYAIGG+ +PTII QGNRFIA
Sbjct  313   KKMQITVAFNHFGKRLEQRMPRCRYGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIA  372

Query  558   PPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN-FMDKHHKLYDGVMT  382
             PP+   K+ITKR      EWK+W W+S+GD ++ GA+FVQSG  N +  K          
Sbjct  373   PPNEQAKQITKREYTPYTEWKSWNWQSEGDYFLNGAYFVQSGKANAWSSKPKNPLPNKFA  432

Query  381   FKAEDVTW---LTRFAGALNCRVGSPC  310
              + +  T    LT  AGAL C+ G  C
Sbjct  433   IRPKPGTMVRKLTMDAGALGCKQGKAC  459



>emb|CAN77957.1| hypothetical protein VITISV_021245 [Vitis vinifera]
Length=407

 Score =   448 bits (1152),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 255/438 (58%), Positives = 307/438 (70%), Gaps = 47/438 (11%)
 Frame = -2

Query  1620  AIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaea  1441
              I+PA   +I ++DEVW+ R  EA + A QAY P+P  ++ +                  
Sbjct  16    VIVPAVTANIGDFDEVWQTRAEEARKAALQAYNPHPEKVTDNF-----------------  58

Query  1440  eaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKG  1261
                             +KK H          +CWRC +DWA+NR +LADC LGFG KT G
Sbjct  59    ----------------NKKVH----------KCWRCRSDWASNRMKLADCVLGFGQKTTG  92

Query  1260  GKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GK G  Y VTD +D D  NPKPGTLRHA IQ++PLWIIF+H M I+L++ELIM  +KTID
Sbjct  93    GKGGKIYVVTDPSDNDMVNPKPGTLRHAAIQEEPLWIIFAHSMAIRLNEELIMTSNKTID  152

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
              RGA VHI++GAG+T+QFV N+IIHG+HIH I  GNGGLIRD   H+G RT+SDGDGISI
Sbjct  153   ARGANVHIANGAGLTLQFVHNIIIHGLHIHDIKVGNGGLIRDSASHYGFRTRSDGDGISI  212

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FG++N+WIDH+SM NC DGLIDAI ASTAITISN HFT HN+VMLFGA+D  + D IMQI
Sbjct  213   FGATNIWIDHISMSNCADGLIDAIMASTAITISNCHFTHHNEVMLFGASDGYSGDAIMQI  272

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             T+ FNHFG+ L QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTI+ QGNRFIAPPDI+
Sbjct  273   TITFNHFGQGLTQRMPRCRWGFFHVVNNDYTHWLMYAIGGSHHPTILSQGNRFIAPPDIN  332

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDV  364
              KE+TKR       WK+WTWRSQGD+ M GAFFV+SGDPNF D  +K    +       V
Sbjct  333   CKEVTKRDYSPESVWKSWTWRSQGDLMMNGAFFVESGDPNF-DFSNKYV--IRAKPGAFV  389

Query  363   TWLTRFAGALNCRVGSPC  310
             T LTRF+GAL+CR G PC
Sbjct  390   TRLTRFSGALSCREGMPC  407



>sp|Q9LFP5.1|PLY19_ARATH RecName: Full=Probable pectate lyase 19; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAC01830.1| pectate lyase-like protein [Arabidopsis thaliana]
Length=472

 Score =   450 bits (1158),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 250/460 (54%), Positives = 311/460 (68%), Gaps = 25/460 (5%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               +IP   G+I+E DE W +R  EA E   QAY  +P+ I     HE R   +       
Sbjct  16    AVLIPTIRGNISELDEYWSQRADEAREFTLQAYHSDPYEI-VDHFHE-RHYDNSTDVTTP  73

Query  1443  aeaEDV---------------TRNDTTRHLLGS-----KKYHGPCNATNPIDRCWRCHAD  1324
              E  D                + N T R L G       K  GPC A+NPID+CWRC +D
Sbjct  74    EEDGDAKPEEEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWRCRSD  133

Query  1323  WATNRKRLADCALGFGYKTKGGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIF  1147
             WA  RK+L  C  GFG++T GGK G  Y VT N D D  NPKPGTLRHAVIQK+PLWIIF
Sbjct  134   WAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEPLWIIF  193

Query  1146  SHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGL  967
              +DM I+L+QEL++   KTID RGA VH++ GAGIT+QFVKNVIIHG+HIHHI E +GG+
Sbjct  194   KNDMSIRLNQELLINSHKTIDARGANVHVAHGAGITMQFVKNVIIHGLHIHHISESSGGM  253

Query  966   IRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTD  787
             IRD +DHFG+RT++DGDG+SI+GSSN+W+DH+SM  C DGLIDAI  ST ITISN HFT 
Sbjct  254   IRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISMSKCQDGLIDAIVGSTGITISNSHFTH  313

Query  786   HNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIG  607
             HNDVML GA + +  DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW +YAIG
Sbjct  314   HNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIG  373

Query  606   GSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGD  430
             GS  PTI+  GNRFIAPP   H +E+TKR   + +EWK W WRS  D++M GA+F QSG+
Sbjct  374   GSQGPTILSHGNRFIAPPHKPHYREVTKRDYASEDEWKHWNWRSDKDVFMNGAYFRQSGN  433

Query  429   PNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             P +   H +    +       V+ LT++AGAL+CRVG  C
Sbjct  434   PQYKCAHTR-QQMIKPKNGLAVSKLTKYAGALDCRVGRRC  472



>ref|XP_010420164.1| PREDICTED: probable pectate lyase 19 isoform X2 [Camelina sativa]
Length=472

 Score =   450 bits (1157),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 250/458 (55%), Positives = 309/458 (67%), Gaps = 21/458 (5%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNI-------------SASLIHE  1483
               +IP   G+I+E DE W RR  EA E   QAY  +P+ I              A+   E
Sbjct  16    AGLIPTIRGNISELDEYWSRRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTDATETEE  75

Query  1482  VRRTLSeavaeaeaeaEDVTRNDTTRHLLGS-----KKYHGPCNATNPIDRCWRCHADWA  1318
                   E   E   +    +   T R L G       K  GPC A+NPID+CWRC  +WA
Sbjct  76    DGGAKPEEEEEEGIKMVGNSTKSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWRCRTNWA  135

Query  1317  TNRKRLADCALGFGYKTKGGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSH  1141
               RK+L  C  GFG++T GGK G  Y VT N D D  NPKPGTLRHAVIQK+PLWIIF +
Sbjct  136   KRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEPLWIIFKN  195

Query  1140  DMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIR  961
             DM I+L QEL++   KTID RGA VHI+ GAGIT+QFVKNVIIHG+HIHHI E +GG+IR
Sbjct  196   DMSIRLSQELLINSHKTIDARGANVHIAHGAGITMQFVKNVIIHGLHIHHISESSGGMIR  255

Query  960   DGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHN  781
             D +DHFG+RT++DGDG+SI+GSSN+W+DH+SM  C DGLIDAI  ST ITISN HFT HN
Sbjct  256   DSVDHFGMRTRADGDGLSIYGSSNIWLDHISMSKCQDGLIDAIVGSTGITISNSHFTHHN  315

Query  780   DVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGS  601
             DVML GA + +  DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW +YAIGGS
Sbjct  316   DVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGS  375

Query  600   SHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN  424
               PTI+  GNRFIAPP   H +E+TKR     +EWK W WRS+ D++M GA+F QSG+P+
Sbjct  376   QGPTILSHGNRFIAPPHKPHYREVTKRDYAPEDEWKHWIWRSEKDVFMNGAYFRQSGNPH  435

Query  423   FMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             F   H +    +       V+ LT++AGAL+CRVG  C
Sbjct  436   FKCAHTR-KQMIKPKNGMAVSKLTKYAGALDCRVGKRC  472



>ref|XP_006306515.1| hypothetical protein CARUB_v10012514mg [Capsella rubella]
 gb|EOA39413.1| hypothetical protein CARUB_v10012514mg [Capsella rubella]
Length=455

 Score =   449 bits (1154),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 248/447 (55%), Positives = 303/447 (68%), Gaps = 21/447 (5%)
 Frame = -2

Query  1617  IIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeae  1438
             + P    H+A +D  W +R+++A++    +Y+PNP N++  L + V   +  A       
Sbjct  19    VAPQVKAHVAVFDSYWTQRQSDALKRTMGSYDPNPLNVTNHLNYHVNLAVDAAE------  72

Query  1437  aEDVTRNDTTRHLLGSKKYH------GPCNATNPIDRCWRCHADWATNRKRLADCALGFG  1276
                 + NDT R L   +  H      G C A NPID+CWRC  +WA NRK+LADC LGFG
Sbjct  73    ----SFNDTRRELTQVRSGHRKLKRSGKCLAYNPIDKCWRCDRNWANNRKKLADCVLGFG  128

Query  1275  YKTKGGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQG  1099
              KT GGK G  Y V D +D D  NPKPGTLR+AV +  PLWIIF+  M IKL QEL++  
Sbjct  129   RKTTGGKDGPIYVVNDASDNDLVNPKPGTLRYAVTRDGPLWIIFARSMIIKLQQELMIAS  188

Query  1098  DKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdg  919
             DKTIDGRGA+V+I +GAG+T+Q+V NVIIH I++ HI  GNGGLIRD   H GLRTKSDG
Sbjct  189   DKTIDGRGAKVYIMEGAGLTMQYVNNVIIHSIYVKHIVPGNGGLIRDSEHHVGLRTKSDG  248

Query  918   dgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKD  739
             DGIS+FG++N+WIDHVSM  C DG+IDAI+ STA+TISN HFTDH +VMLFGA D    D
Sbjct  249   DGISLFGATNIWIDHVSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVID  308

Query  738   KIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIA  559
             K MQIT+AFNHFGKRL QRMPRCRYG IHVVNNDYTHW MYAIGG+ +PTII QGNRFIA
Sbjct  309   KKMQITVAFNHFGKRLEQRMPRCRYGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIA  368

Query  558   PPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN-FMDKHHKLYDGVMT  382
             PP    K+ITKR      EWK+W W+S+GD ++ GA+FVQSG  N +  K          
Sbjct  369   PPSEQAKQITKREYTPLAEWKSWNWQSEGDYFLNGAYFVQSGKANAWSPKPQNPIPNKFA  428

Query  381   FKAEDVTW---LTRFAGALNCRVGSPC  310
              + +  T    LT  AGAL CR G  C
Sbjct  429   IRPKPGTMVRKLTMEAGALGCRQGQAC  455



>ref|XP_006477525.1| PREDICTED: pectate lyase-like [Citrus sinensis]
Length=437

 Score =   448 bits (1152),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 240/440 (55%), Positives = 300/440 (68%), Gaps = 20/440 (5%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
              +I P    +I ++DEVW++R   A  HA +AY PNP  + +S    V            
Sbjct  16    ASISPILKANIHDFDEVWQKRAENARRHALEAYHPNPEEVVSSFNKHVHMMFE-------  68

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                      ++TR  L  + Y G C ATNPID+CWRC  +WA NRKRLADCA GFG  T 
Sbjct  69    -------NGNSTRRYLRGRPYTGRCAATNPIDQCWRCDRNWANNRKRLADCAQGFGRGTI  121

Query  1263  GGKLGNFYTVTDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTI  1087
             GGK G FY VT+ ADD   NPKPGTLRHAVIQ++PLWI F+HDM I+L +EL++  DKTI
Sbjct  122   GGKNGPFYVVTNPADDDLVNPKPGTLRHAVIQERPLWITFAHDMVIRLSEELLITSDKTI  181

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             D RG+ V I +GA IT+QFVKN+IIHG+HI     G GG+IRD + H+G R+ SDGDGIS
Sbjct  182   DARGSNVQIYNGAQITMQFVKNIIIHGLHIRKTKAGKGGMIRDSVSHYGFRSSSDGDGIS  241

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             +FG+S++WIDHVSM  C DGLIDA+  STAIT+SN HFT  + VML GA+D   +D IMQ
Sbjct  242   MFGASHIWIDHVSMSGCQDGLIDAVMGSTAITVSNSHFTHQDHVMLLGASDGHPQDSIMQ  301

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             +T+AFNHFGK+L+QRMPR R+G+ HVVNNDYTHW MYAIGGS HPTI+ QGNRF+A    
Sbjct  302   VTVAFNHFGKQLVQRMPRVRFGFAHVVNNDYTHWLMYAIGGSQHPTILSQGNRFLASNSH  361

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSG-DPNFMDKHHKLYDGVMTFKAE  370
             H KE+TKR       WKTW WRS+ D+ M GAFFV+SG D   +++     D +     +
Sbjct  362   HSKEVTKRDSSPQSVWKTWNWRSEMDLMMNGAFFVESGSDVRNVNRQ----DVIPAKPGK  417

Query  369   DVTWLTRFAGALNCRVGSPC  310
               + +TRF+GALNC V  PC
Sbjct  418   FASQMTRFSGALNCYVNKPC  437



>ref|NP_197015.4| putative pectate lyase 19 [Arabidopsis thaliana]
 gb|AED92118.1| putative pectate lyase 19 [Arabidopsis thaliana]
Length=472

 Score =   449 bits (1155),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 249/460 (54%), Positives = 311/460 (68%), Gaps = 25/460 (5%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               +IP   G+I+E DE W +R  EA E   QAY  +P+ I     HE R   +       
Sbjct  16    AVLIPTIRGNISELDEYWSQRADEAREFTLQAYHSDPYEI-VDHFHE-RHYDNSTDVTTP  73

Query  1443  aeaEDV---------------TRNDTTRHLLGS-----KKYHGPCNATNPIDRCWRCHAD  1324
              E  D                + N T R L G       K  GPC A+NPID+CWRC +D
Sbjct  74    EEDGDAKPEEEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWRCRSD  133

Query  1323  WATNRKRLADCALGFGYKTKGGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIF  1147
             WA  RK+L  C  GFG++T GGK G  Y VT N D D  NPKPGTLRHAVIQK+PLWIIF
Sbjct  134   WAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEPLWIIF  193

Query  1146  SHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGL  967
              +DM I+L+QEL++   KTID RGA VH++ GAGIT+QFVKNV+IHG+HIHHI E +GG+
Sbjct  194   KNDMSIRLNQELLINSHKTIDARGANVHVAHGAGITMQFVKNVVIHGLHIHHISESSGGM  253

Query  966   IRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTD  787
             IRD +DHFG+RT++DGDG+SI+GSSN+W+DH+SM  C DGLIDAI  ST ITISN HFT 
Sbjct  254   IRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISMSKCQDGLIDAIVGSTGITISNSHFTH  313

Query  786   HNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIG  607
             HNDVML GA + +  DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW +YAIG
Sbjct  314   HNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIG  373

Query  606   GSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGD  430
             GS  PTI+  GNRFIAPP   H +E+TKR   + +EWK W WRS  D++M GA+F QSG+
Sbjct  374   GSQGPTILSHGNRFIAPPHKPHYREVTKRDYASEDEWKHWNWRSDKDVFMNGAYFRQSGN  433

Query  429   PNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             P +   H +    +       V+ LT++AGAL+CRVG  C
Sbjct  434   PQYKCAHTR-QQMIKPKNGLAVSKLTKYAGALDCRVGRRC  472



>gb|ABK28696.1| unknown [Arabidopsis thaliana]
Length=473

 Score =   449 bits (1155),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 249/460 (54%), Positives = 311/460 (68%), Gaps = 25/460 (5%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               +IP   G+I+E DE W +R  EA E   QAY  +P+ I     HE R   +       
Sbjct  16    AVLIPTIRGNISELDEYWSQRADEAREFTLQAYHSDPYEI-VDHFHE-RHYDNSTDVTTP  73

Query  1443  aeaEDV---------------TRNDTTRHLLGS-----KKYHGPCNATNPIDRCWRCHAD  1324
              E  D                + N T R L G       K  GPC A+NPID+CWRC +D
Sbjct  74    EEDGDAKPEEEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWRCRSD  133

Query  1323  WATNRKRLADCALGFGYKTKGGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIF  1147
             WA  RK+L  C  GFG++T GGK G  Y VT N D D  NPKPGTLRHAVIQK+PLWIIF
Sbjct  134   WAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEPLWIIF  193

Query  1146  SHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGL  967
              +DM I+L+QEL++   KTID RGA VH++ GAGIT+QFVKNV+IHG+HIHHI E +GG+
Sbjct  194   KNDMSIRLNQELLINSHKTIDARGANVHVAHGAGITMQFVKNVVIHGLHIHHISESSGGM  253

Query  966   IRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTD  787
             IRD +DHFG+RT++DGDG+SI+GSSN+W+DH+SM  C DGLIDAI  ST ITISN HFT 
Sbjct  254   IRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISMSKCQDGLIDAIVGSTGITISNSHFTH  313

Query  786   HNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIG  607
             HNDVML GA + +  DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW +YAIG
Sbjct  314   HNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIG  373

Query  606   GSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGD  430
             GS  PTI+  GNRFIAPP   H +E+TKR   + +EWK W WRS  D++M GA+F QSG+
Sbjct  374   GSQGPTILSHGNRFIAPPHKPHYREVTKRDYASEDEWKHWNWRSDKDVFMNGAYFRQSGN  433

Query  429   PNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             P +   H +    +       V+ LT++AGAL+CRVG  C
Sbjct  434   PQYKCAHTR-QQMIKPKNGLAVSKLTKYAGALDCRVGRRC  472



>ref|XP_010527872.1| PREDICTED: probable pectate lyase 3 isoform X2 [Tarenaya hassleriana]
Length=461

 Score =   449 bits (1154),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 249/445 (56%), Positives = 302/445 (68%), Gaps = 23/445 (5%)
 Frame = -2

Query  1599  GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTR  1420
             GH+A +DE W +R+ +A+    + Y+PNP N++    + V   + E +            
Sbjct  25    GHVAVFDEYWTQRQDKALRQTLRFYDPNPFNVTDHFNYHVNLAVEETM--------KTGN  76

Query  1419  NDTTRHLLG---SKKYH-------GPCNATNPIDRCWRCHADWATNRKRLADCALGFGYK  1270
             N T R LL    S+  H       G C A NPIDRCWRC   W+ NRK+LADCALGFG K
Sbjct  77    NGTRRELLQVGQSRGQHPKRRNLGGKCVAYNPIDRCWRCDPGWSKNRKKLADCALGFGRK  136

Query  1269  TKGGKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDK  1093
             T GGK G +Y VTD +DD   NPK GTLRHAV +++PLWI+F+  M IKL QELIM  DK
Sbjct  137   TTGGKAGPYYVVTDASDDDLLNPKAGTLRHAVTREEPLWIVFAKSMVIKLQQELIMTSDK  196

Query  1092  TIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdg  913
             TIDGRG +VHI+ GAG T+QFV NVIIH I+I +I  GNGGLIRD   HFGLRT+SDGDG
Sbjct  197   TIDGRGVRVHITGGAGFTLQFVNNVIIHNIYIKNIVPGNGGLIRDSETHFGLRTRSDGDG  256

Query  912   isifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKI  733
             I+IFG++NVWIDHVSM +C DG+IDAI+ ST ITISN H TDH +VMLFG  D    DK 
Sbjct  257   INIFGATNVWIDHVSMSHCSDGMIDAIQGSTGITISNCHLTDHQEVMLFGGTDKDVIDKK  316

Query  732   MQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP  553
             MQIT+AFNHFGKRL+QRMPRCRYG IHVVNNDYTHW MYAIGG+ +PTII QGNRFIAPP
Sbjct  317   MQITVAFNHFGKRLVQRMPRCRYGLIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPP  376

Query  552   DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK----LYDGVM  385
             +   K++TKR      EWK+W W+S+GD ++ GA+FVQSG  N +    K        + 
Sbjct  377   NEEAKQVTKREYTPFTEWKSWNWQSEGDYFLNGAYFVQSGRANALSAAPKNPVPSKFAIR  436

Query  384   TFKAEDVTWLTRFAGALNCRVGSPC  310
                   V  LT  AG L+C+   PC
Sbjct  437   PQPGTLVRKLTMDAGVLSCKKRKPC  461



>gb|KEH19822.1| pectate lyase-like protein [Medicago truncatula]
Length=455

 Score =   448 bits (1152),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 252/434 (58%), Positives = 297/434 (68%), Gaps = 24/434 (6%)
 Frame = -2

Query  1587  EYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRNDTT  1408
             E+D  W+ R   A +  + AY  +P+ IS +    +   ++           +  RN   
Sbjct  38    EFDSYWQERAKVAKQENKAAYFKDPYAISGNFTASISEIIAVK---------EKGRN---  85

Query  1407  RHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVTD  1228
                LG  K  G C ATNPIDRCWRC  +WA NR++LADC  GFG  T+GG+ G  Y VTD
Sbjct  86    ---LGGLKDDGTCLATNPIDRCWRCDPNWANNRQKLADCVQGFGRNTRGGQGGPIYVVTD  142

Query  1227  NADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDG  1051
              +DD   NPKPGTLR+AV +   LWI F+  M I L QELIM GDKTIDGRG  V+IS+G
Sbjct  143   PSDDDMMNPKPGTLRYAVTRNGSLWITFARSMAITLQQELIMSGDKTIDGRGVDVYISNG  202

Query  1050  AGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHV  871
             AGITIQFVKNVIIHGI I+ I   +GG+IRD   H+G RTKSDGDGISIFG+SNVWIDHV
Sbjct  203   AGITIQFVKNVIIHGIKIYDIQVRDGGMIRDSEAHYGFRTKSDGDGISIFGASNVWIDHV  262

Query  870   SMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRL  691
             SMRNC DGLIDAI  STAITISN HFTDHN+VMLFGA++  ++DKIMQITLAFNHFGKRL
Sbjct  263   SMRNCTDGLIDAIMGSTAITISNSHFTDHNEVMLFGASNDYSEDKIMQITLAFNHFGKRL  322

Query  690   IQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD-------IHKKEI  532
             +QRMPR R+G++H VNNDYTHW MYAIGGS +PTII +GNRFI P +       I+ KEI
Sbjct  323   VQRMPRARFGFVHCVNNDYTHWEMYAIGGSQNPTIISEGNRFIGPYNKMLGNDLINSKEI  382

Query  531   TKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLT  352
             TKR      EWKTW WRS  D Y+ GAFFVQSG P   D+     D +       V  LT
Sbjct  383   TKREYTEESEWKTWQWRSINDEYINGAFFVQSG-PELKDRPFSQKDMIKAKPGSFVGRLT  441

Query  351   RFAGALNCRVGSPC  310
             R++G L CRVG PC
Sbjct  442   RYSGNLRCRVGEPC  455



>ref|XP_009121613.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
 emb|CDX69550.1| BnaA10g18990D [Brassica napus]
Length=499

 Score =   449 bits (1155),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 256/485 (53%), Positives = 323/485 (67%), Gaps = 48/485 (10%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNI---------------SASLI  1489
               +IP    +I+E DE W +R  EA E   QAY  +P+ I               + +  
Sbjct  16    AGLIPTIKANISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTDDTTTEE  75

Query  1488  HEVRRTLSeavaeaeaeaEDVT---RNDTTR---------HLLGSKK-------------  1384
             H    T   A  E  + + DVT    + +T+          ++G+ K             
Sbjct  76    HSSNSTDVTATEEDNSNSTDVTATEEDSSTKPEEEGTEVIEMVGNSKNSTRRSLKGKGKG  135

Query  1383  ----YHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVTDNAD-  1219
                   GPC A+NPID+CWRC ++WA  RK+LA C  GFG+ T GGK G  Y VT N D 
Sbjct  136   KWSKLKGPCTASNPIDKCWRCRSNWANRRKKLAKCVRGFGHGTTGGKRGRIYVVTSNLDE  195

Query  1218  DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAGIT  1039
             D  NP PGTLRHAVIQK+PLWIIF +DM I+L QEL++  DKTID RGA VHI+ GAGIT
Sbjct  196   DMVNPIPGTLRHAVIQKEPLWIIFKNDMSIRLSQELLVNSDKTIDARGADVHIAHGAGIT  255

Query  1038  IQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRN  859
             +QFV+NVIIHG+HIHHI E NGG+IRD +DHFG+RT++DGDG+SI+GSSN+WIDHVSM  
Sbjct  256   MQFVRNVIIHGLHIHHISESNGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWIDHVSMSK  315

Query  858   CYDGLIDAIEASTAITISNGHFTDHNDVMLFGA-NDLSTKDKIMQITLAFNHFGKRLIQR  682
             C DGLIDAI  STAITISN HFT HNDVML GA N+++  D+ MQ+T+A+NHFGK L+QR
Sbjct  316   CQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNNMNEADQKMQVTVAYNHFGKGLVQR  375

Query  681   MPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI-HKKEITKRVKGTPE  505
             MPR R+G++HVVNNDYTHW +YAIGGS  PTI+  GNRFIAPP + + KE+TKR   + +
Sbjct  376   MPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHLPYYKEVTKRDYASED  435

Query  504   EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCR  325
             EWK WTWRS+ DI+M GAFF QSGDP++   H +    +       V+ LT++AGAL+CR
Sbjct  436   EWKHWTWRSEKDIFMNGAFFRQSGDPHYKSAHTR-KQMIKPKNGYAVSKLTKYAGALDCR  494

Query  324   VGSPC  310
             VG  C
Sbjct  495   VGRRC  499



>ref|XP_010551866.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=475

 Score =   448 bits (1153),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 251/456 (55%), Positives = 308/456 (68%), Gaps = 27/456 (6%)
 Frame = -2

Query  1599  GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNI-----------SASLIHEVRRTLSeava  1453
             G++AE+DE W++R  EA  H+ +AY  +P  I           S  +  E          
Sbjct  21    GNVAEFDEYWQKRSEEAHNHSLEAYHSDPFEIVDHFHERHYDNSTDIEAEREEEDDHEEE  80

Query  1452  eaeaeaEDVTRNDTTRHLLGS-------------KKYHGPCNATNPIDRCWRCHADWATN  1312
             E E E        TT     S              K  GPC A+NPID+CWRC ADWA  
Sbjct  81    EEEEEYSIAMLTGTTNSTRRSLRGRSRRGRRGKWSKLKGPCTASNPIDKCWRCRADWANR  140

Query  1311  RKRLADCALGFGYKTKGGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDM  1135
             RK+LADC  GFG+KT GGKLG  Y VT N D D  NP+PGTLRHAVIQK PLWIIF  DM
Sbjct  141   RKKLADCVRGFGFKTTGGKLGRIYVVTSNLDSDVVNPRPGTLRHAVIQKVPLWIIFKKDM  200

Query  1134  DIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDG  955
              I+L QEL++   KTID RGA VHI+ GAGIT+QFV N+IIHG+HIHHI   NGG+IRD 
Sbjct  201   HIRLQQELLINSHKTIDARGANVHIAYGAGITMQFVTNIIIHGLHIHHIVSSNGGMIRDS  260

Query  954   LDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDV  775
             +DH+G RT++DGDG+SIFG+SN+WIDHVSM  C DGLIDAI+ ST ITISN HFT HNDV
Sbjct  261   VDHYGFRTRADGDGLSIFGASNIWIDHVSMSRCQDGLIDAIDGSTGITISNSHFTHHNDV  320

Query  774   MLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSH  595
             ML GA+++  KDK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW +YAIGGS  
Sbjct  321   MLLGAHNVIDKDKRMQVTVAYNHFGKGLVQRMPRVRWGFVHVVNNDYTHWQLYAIGGSQG  380

Query  594   PTIICQGNRFIAPPDIHK-KEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFM  418
             PTI+  GNRFIAPP I + KE+TKR      EW+ W WRS+ D++M GAFF QSG+P F 
Sbjct  381   PTILSHGNRFIAPPHIPQYKEVTKRDYAPESEWRKWNWRSEKDVFMNGAFFRQSGNPKFR  440

Query  417   DKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
               H +    +       V+ LT++AG+L+C+VG PC
Sbjct  441   CTHTR-QQMIRPKHGMAVSMLTKYAGSLDCKVGRPC  475



>ref|XP_004514773.1| PREDICTED: probable pectate lyase 3-like [Cicer arietinum]
Length=454

 Score =   447 bits (1151),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 245/437 (56%), Positives = 299/437 (68%), Gaps = 25/437 (6%)
 Frame = -2

Query  1596  HIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRN  1417
             H+ E+D  W+ R   A E  Q AY  +P+ +S +    V   ++                
Sbjct  35    HVPEFDSYWQERAKVAKEANQAAYFVDPYAVSGNFTATVSEIIAA--------------K  80

Query  1416  DTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYT  1237
                R L G+   +G C ATNPIDRCWRC  +WA NR++LADC  GFG  T+GGK G FY 
Sbjct  81    SARRSLRGNN--NGTCMATNPIDRCWRCDPNWANNRQKLADCVQGFGRNTRGGKGGPFYV  138

Query  1236  VTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHI  1060
             VTD +D+   +PKPGTLRHAV +  PLWI F+  M I L QELIM  DKTIDGRG +V+I
Sbjct  139   VTDPSDNELLDPKPGTLRHAVTRNGPLWITFARSMVITLQQELIMSSDKTIDGRGVEVYI  198

Query  1059  SDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWI  880
             ++GAGIT+QFVKN+IIHGI I++I    GG+IRD   H+G RTKSDGDGISIFG+SNVWI
Sbjct  199   ANGAGITVQFVKNIIIHGIKIYNIKVKEGGMIRDSESHYGFRTKSDGDGISIFGASNVWI  258

Query  879   DHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFG  700
             DHVSMRNC DGLIDAI  STAITISNGHFTDHN+VMLFGA+D  + DKIMQITLAFNHFG
Sbjct  259   DHVSMRNCTDGLIDAIMGSTAITISNGHFTDHNEVMLFGASDDYSDDKIMQITLAFNHFG  318

Query  699   KRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI-------HK  541
             KRL+QRMPR R+G++HVVNNDYTHW MYA+GGS +PTII +GNRFI P ++       + 
Sbjct  319   KRLVQRMPRARFGFVHVVNNDYTHWEMYAMGGSQNPTIISEGNRFIGPDNVMVGGNQLNL  378

Query  540   KEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVT  361
             KE+TKR       WK W WRS  D ++ GA+F+QSG P   ++     D +       V 
Sbjct  379   KEVTKREYTDESVWKNWQWRSINDEFLNGAYFIQSG-PELKNRPFSKKDMITAKPGSYVG  437

Query  360   WLTRFAGALNCRVGSPC  310
              LTR++G L CRVG PC
Sbjct  438   RLTRYSGNLQCRVGKPC  454



>ref|XP_010496063.1| PREDICTED: probable pectate lyase 3 [Camelina sativa]
Length=455

 Score =   447 bits (1151),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 250/449 (56%), Positives = 307/449 (68%), Gaps = 22/449 (5%)
 Frame = -2

Query  1620  AIIPATVG-HIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
             AI+   VG H+A +D  W +R+++A++    +Y+PNP N++    + V   +        
Sbjct  17    AIVAPQVGAHVAVFDSYWMQRKSDALKQTFGSYDPNPLNVTNHFNYHVNLAVDATE----  72

Query  1443  aeaEDVTRNDTTRHLLGSK------KYHGPCNATNPIDRCWRCHADWATNRKRLADCALG  1282
                   + NDT R L   +      K+ G C A NPID+CWRC  +WA NRK+LADCALG
Sbjct  73    ------SINDTRRELTQVRSRRKLQKHGGKCVAYNPIDKCWRCDRNWANNRKKLADCALG  126

Query  1281  FGYKTKGGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIM  1105
             FG KT GGK G  Y VTD +D D  NPKPGTLR+AV +  PLWIIF+  M IKL QEL++
Sbjct  127   FGRKTTGGKDGPIYVVTDASDNDLINPKPGTLRYAVTRDGPLWIIFARSMIIKLQQELMI  186

Query  1104  QGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKs  925
               DKTIDGRGA+V+I +GAG+T+QFV NVIIH I++ HI  GNGGLIRD   H GLRTKS
Sbjct  187   TSDKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKHIVTGNGGLIRDSEQHIGLRTKS  246

Query  924   dgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLST  745
             DGDGIS+FG++N+WIDHVSM  C DG+IDAI+ STA+TISN HFTDH +VMLFGA D   
Sbjct  247   DGDGISLFGATNIWIDHVSMTRCEDGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHV  306

Query  744   KDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRF  565
              DK MQIT+AFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+  PTII QGNRF
Sbjct  307   IDKKMQITVAFNHFGKRLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMDPTIISQGNRF  366

Query  564   IAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN-FMDKHHKLYDGV  388
             IAPP+   K+ITKR      EWK+W W+S+GD ++ GA+FVQSG  N +  K H      
Sbjct  367   IAPPNEQAKQITKREYTPFVEWKSWNWQSEGDYFLNGAYFVQSGKANAWSAKLHNPIPNK  426

Query  387   MTFKAED---VTWLTRFAGALNCRVGSPC  310
                + +    V  LT  AG L C+ G  C
Sbjct  427   FAIRPKPGMMVRKLTMEAGVLGCKHGKAC  455



>ref|XP_010513594.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   447 bits (1151),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 245/459 (53%), Positives = 306/459 (67%), Gaps = 22/459 (5%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIH------------EV  1480
              ++IP  + ++AE DE W  +  EA +H   AY P+P++I                  E 
Sbjct  16    ASLIPTILANVAETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYDNSTDVEGTEE  75

Query  1479  RRTLSeavaeaeaeaEDVTRNDTTRHLLGSK-------KYHGPCNATNPIDRCWRCHADW  1321
              + +     E   E      N T R L G +       K  GPC A+NPID+CWRC  DW
Sbjct  76    DKAVDSTEDEDVIEMTSSPTNSTRRSLSGKRRGRGKWSKLKGPCTASNPIDKCWRCQPDW  135

Query  1320  ATNRKRLADCALGFGYKTKGGKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFS  1144
             A  RKRL  C  GFGY+T GGK G  Y VT   DD + NP+PGTLRHAVIQK+PLWIIF 
Sbjct  136   ARRRKRLVRCVRGFGYRTTGGKRGRIYVVTSPRDDDTVNPRPGTLRHAVIQKEPLWIIFK  195

Query  1143  HDMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLI  964
             HDM I+L QEL++   KTID RGA VHI+ GAGIT+Q+V N+IIHG+H+HHI   +GGLI
Sbjct  196   HDMSIRLSQELMIASHKTIDARGANVHIAYGAGITMQYVHNIIIHGLHVHHIVSSSGGLI  255

Query  963   RDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDH  784
             RD +DHFG R ++DGDGISIFG++N+W+DH+SM  C DGLIDAI  STAITISN HFT H
Sbjct  256   RDSIDHFGQRGQADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTAITISNSHFTHH  315

Query  783   NDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGG  604
             NDVML GA D +  DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW +YAIGG
Sbjct  316   NDVMLLGAQDHNQDDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGG  375

Query  603   SSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDP  427
             S  PTI+  GNRFIAPP   H +E+TKR      EWK W WRS+ D ++ GA+F QSG+P
Sbjct  376   SQGPTILSHGNRFIAPPHKQHYREVTKRDYAPEAEWKNWNWRSEKDYFLNGAYFRQSGNP  435

Query  426   NFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             +F   H +    +       V+ LT++AGAL+CRVG  C
Sbjct  436   HFKCSHSR-QQMIKPKHGVAVSKLTKYAGALDCRVGKAC  473



>ref|XP_010476496.1| PREDICTED: probable pectate lyase 3 [Camelina sativa]
Length=455

 Score =   446 bits (1148),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 248/449 (55%), Positives = 305/449 (68%), Gaps = 22/449 (5%)
 Frame = -2

Query  1620  AIIPATVG-HIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
             AI+   VG H+A +D  W +R+ +A++    +Y+PNP N++    + V   +        
Sbjct  17    AIVAPQVGAHVAVFDSYWMQRKTDALKQTFGSYDPNPLNVTNHFNYHVNLAVDATE----  72

Query  1443  aeaEDVTRNDTTRHLLGSK------KYHGPCNATNPIDRCWRCHADWATNRKRLADCALG  1282
                   + NDT R L   +      K+ G C A NPID+CWRC  +WA NRK+LA+CALG
Sbjct  73    ------SINDTRRELTQVRSRRKLQKHGGKCVAYNPIDKCWRCDRNWANNRKKLAECALG  126

Query  1281  FGYKTKGGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIM  1105
             FG KT GGK G  Y VTD +D D  NPKPGTLR+AV +  PLWIIF+  M IKL QEL++
Sbjct  127   FGRKTTGGKDGPIYVVTDASDNDLINPKPGTLRYAVTRDGPLWIIFARSMIIKLQQELMI  186

Query  1104  QGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKs  925
               DKTIDGRGA+V+I +GAG+T+QFV NVIIH I++  I  GNGGLIRD   H GLRTKS
Sbjct  187   TSDKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKQIVTGNGGLIRDSEQHIGLRTKS  246

Query  924   dgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLST  745
             DGDGIS+FG++N+WIDHVSM  C DG+IDAI+ STA+TISN HFTDH +VMLFGA D   
Sbjct  247   DGDGISLFGATNIWIDHVSMTRCEDGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHV  306

Query  744   KDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRF  565
              DK MQIT+AFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+  PTII QGNRF
Sbjct  307   IDKKMQITVAFNHFGKRLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMDPTIISQGNRF  366

Query  564   IAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN-FMDKHHKLYDGV  388
             IAPP+   K+ITKR      EWK+W W+S+GD ++ GA+FVQSG  N +  K H      
Sbjct  367   IAPPNEQAKQITKREYTPFVEWKSWNWQSEGDYFLNGAYFVQSGKANAWSAKLHNPIPSK  426

Query  387   MTFKAEDVTW---LTRFAGALNCRVGSPC  310
                + +  T    LT  AG L C+ G  C
Sbjct  427   FAIRPKPGTMVRKLTMEAGVLGCKHGKEC  455



>gb|AAB69759.1| putative pectate lyase [Arabidopsis thaliana]
Length=459

 Score =   446 bits (1147),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 245/447 (55%), Positives = 304/447 (68%), Gaps = 21/447 (5%)
 Frame = -2

Query  1617  IIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeae  1438
             + P   G++A +D  W +R+++A++    +Y+P+P N++    + V   +  +       
Sbjct  23    VAPQVRGNVAVFDSYWTQRQSDALKQTIGSYDPHPLNVTNHFNYHVNIAVDASE------  76

Query  1437  aEDVTRNDTTRHLLGSK------KYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFG  1276
                 +RNDT R L   +      K  G C A NPID CWRC  +WA NRK+LADC LGFG
Sbjct  77    ----SRNDTRRELTQVRSGRKTHKSSGKCLAYNPIDNCWRCDRNWANNRKKLADCVLGFG  132

Query  1275  YKTKGGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQG  1099
              +T GGK G  Y V D +D D  NPKPGTLRHAV +  PLWIIF+  M IKL QEL++  
Sbjct  133   RRTTGGKDGPIYVVKDASDNDLINPKPGTLRHAVTRDGPLWIIFARSMIIKLQQELMITS  192

Query  1098  DKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdg  919
             DKTIDGRGA+V+I +GAG+T+QFV NVIIH I++ HI  GNGGLIRD   H GLRTKSDG
Sbjct  193   DKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKHIVPGNGGLIRDSEAHIGLRTKSDG  252

Query  918   dgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKD  739
             DGIS+ G++N+WIDHVSM  C DG+IDAI+ STA+TISN HFTDH +VMLFGA D    D
Sbjct  253   DGISLIGATNIWIDHVSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVID  312

Query  738   KIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIA  559
             K MQIT+AFNHFGKRL QRMPRCRYG IHVVNNDYTHW MYAIGG+ +PTII QGNRFIA
Sbjct  313   KKMQITVAFNHFGKRLEQRMPRCRYGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIA  372

Query  558   PPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN-FMDKHHKLYDGVMT  382
             PP+   K+ITKR      EWK+W W+S+GD ++ GA+FVQSG  N +  K         T
Sbjct  373   PPNEEAKQITKREYTPYGEWKSWNWQSEGDYFLNGAYFVQSGKANAWSSKPKTPLPNKFT  432

Query  381   FKAEDVTW---LTRFAGALNCRVGSPC  310
              + +  T    LT  AG L C++G  C
Sbjct  433   IRPKPGTMVRKLTMDAGVLGCKLGEAC  459



>ref|NP_172894.1| putative pectate lyase 3 [Arabidopsis thaliana]
 sp|Q9M9S2.1|PLY3_ARATH RecName: Full=Probable pectate lyase 3; AltName: Full=Pectate 
lyase A2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF43942.1|AC012188_19 Strong similarity to Pectate Lyase Precursor from Lilium longiflorum 
gi|730290 and contains a Pectate lyase PF|00544 domain. 
EST gb|AW004514 comes from this gene [Arabidopsis thaliana]
 gb|AAQ62871.1| At1g14420 [Arabidopsis thaliana]
 dbj|BAD43564.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43610.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43654.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43743.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43876.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43899.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29161.1| putative pectate lyase 3 [Arabidopsis thaliana]
Length=459

 Score =   446 bits (1147),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 246/447 (55%), Positives = 305/447 (68%), Gaps = 21/447 (5%)
 Frame = -2

Query  1617  IIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeae  1438
             + P   G++A +D  W +R+++A++    +Y+P+P N++    + V   +  +       
Sbjct  23    VAPQVRGNVAVFDSYWTQRQSDALKQTIGSYDPHPLNVTNHFNYHVNIAVDASE------  76

Query  1437  aEDVTRNDTTRHLLGSK------KYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFG  1276
                 +RNDT R L   +      K  G C A NPID CWRC  +WA NRK+LADC LGFG
Sbjct  77    ----SRNDTRRELTQVRSGRKTHKSSGKCLAYNPIDNCWRCDRNWANNRKKLADCVLGFG  132

Query  1275  YKTKGGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQG  1099
              +T GGK G  Y V D +D D  NPKPGTLRHAV +  PLWIIF+  M IKL QEL++  
Sbjct  133   RRTTGGKDGPIYVVKDASDNDLINPKPGTLRHAVTRDGPLWIIFARSMIIKLQQELMITS  192

Query  1098  DKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdg  919
             DKTIDGRGA+V+I +GAG+T+QFV NVIIH I++ HI  GNGGLIRD   H GLRTKSDG
Sbjct  193   DKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKHIVPGNGGLIRDSEAHIGLRTKSDG  252

Query  918   dgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKD  739
             DGIS+FG++N+WIDHVSM  C DG+IDAI+ STA+TISN HFTDH +VMLFGA D    D
Sbjct  253   DGISLFGATNIWIDHVSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVID  312

Query  738   KIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIA  559
             K MQIT+AFNHFGKRL QRMPRCRYG IHVVNNDYTHW MYAIGG+ +PTII QGNRFIA
Sbjct  313   KKMQITVAFNHFGKRLEQRMPRCRYGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIA  372

Query  558   PPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN-FMDKHHKLYDGVMT  382
             PP+   K+ITKR      EWK+W W+S+GD ++ GA+FVQSG  N +  K         T
Sbjct  373   PPNEEAKQITKREYTPYGEWKSWNWQSEGDYFLNGAYFVQSGKANAWSSKPKTPLPNKFT  432

Query  381   FKAEDVTW---LTRFAGALNCRVGSPC  310
              + +  T    LT  AG L C++G  C
Sbjct  433   IRPKPGTMVRKLTMDAGVLGCKLGEAC  459



>ref|XP_008786760.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=467

 Score =   446 bits (1146),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 250/437 (57%), Positives = 302/437 (69%), Gaps = 24/437 (5%)
 Frame = -2

Query  1599  GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTR  1420
              ++AE D+ W+++  EA   ++ AY P+P  ++      V   L++             R
Sbjct  48    ANVAELDDHWQKKAEEAFARSRAAYHPDPEGVTNHFNQAVHLALAQ------------AR  95

Query  1419  NDTTRHL---LGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLG  1249
             N T R L      K   G C A+NPIDRCWRC  DW  +RK+LA C  GFG    GG+ G
Sbjct  96    NSTRRGLKAVRADKFRQGQCVASNPIDRCWRCQKDWIKDRKKLASCGKGFGRNAVGGRDG  155

Query  1248  NFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGA  1072
             +FY VTD +D D  NPK GTLR  VIQ +PLWIIF+ DM I+L +ELI+  +KTID RGA
Sbjct  156   DFYVVTDPSDNDLVNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELIINSNKTIDARGA  215

Query  1071  QVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsS  892
              VHI+ GA I+IQFV+NVIIHG+HIH I  GNGG+IRD L H+G RTKSDGDGISI+GSS
Sbjct  216   NVHIAFGAQISIQFVQNVIIHGLHIHDIKPGNGGMIRDSLRHYGFRTKSDGDGISIYGSS  275

Query  891   NVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAF  712
             ++WIDH SMRNC DGLIDAIEASTAITISN HF  HNDV+LFGA+D + +D IMQ+T+AF
Sbjct  276   DIWIDHCSMRNCADGLIDAIEASTAITISNCHFARHNDVLLFGASDSNERDSIMQVTVAF  335

Query  711   NHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEI  532
             NHFGK L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII QGNRF+APP    KEI
Sbjct  336   NHFGKGLVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSQHPTIISQGNRFLAPPMRFAKEI  395

Query  531   TKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTW--  358
             TKR   T + WK WTWRS+GD+   GAFF +SG P   +     +D     KA+  TW  
Sbjct  396   TKRDYATEDVWKHWTWRSEGDLMQNGAFFRESGAPAKNN-----FDKKDFIKAKPGTWVK  450

Query  357   -LTRFAGALNCRVGSPC  310
              LTR+AG L CR G  C
Sbjct  451   RLTRYAGPLGCRAGRAC  467



>ref|XP_006439649.1| hypothetical protein CICLE_v10020193mg [Citrus clementina]
 gb|ESR52889.1| hypothetical protein CICLE_v10020193mg [Citrus clementina]
Length=437

 Score =   444 bits (1143),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 239/440 (54%), Positives = 297/440 (68%), Gaps = 20/440 (5%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
              +I P    +  ++DEVW++R   A  HA +AY PNP  + +S    V            
Sbjct  16    ASISPILKANTHDFDEVWQKRAENARRHALEAYHPNPEEVVSSFNKHVHMMFE-------  68

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                       +TR  L  + Y G C ATNPID+CWRC  +WA NRKRLADCA GFG  T 
Sbjct  69    -------NGSSTRRYLRGRPYTGRCAATNPIDQCWRCDRNWANNRKRLADCAQGFGRGTI  121

Query  1263  GGKLGNFYTVTDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTI  1087
             GGK G FY VT+ ADD   NPKPGTLRHAVIQ++PLWI F+HDM I+L +EL++  DKTI
Sbjct  122   GGKNGPFYVVTNPADDDLVNPKPGTLRHAVIQERPLWITFAHDMVIRLSEELLITSDKTI  181

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             D RG+ V I +GA IT+QFVKN+IIHG+HI     G GG+IRD + H G R+ SDGDGIS
Sbjct  182   DARGSNVQIYNGAQITMQFVKNIIIHGLHIRKTKAGKGGMIRDSVSHHGFRSSSDGDGIS  241

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             +FG+S++WIDHVSM  C DGLIDA+  STAIT+SN HFT  + VML GA+D   +D IMQ
Sbjct  242   MFGASHIWIDHVSMSGCQDGLIDAVMGSTAITVSNSHFTHQDHVMLLGASDSHPQDSIMQ  301

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             +T+AFNHFGK+L+QRMPR R+G+ HVVNNDYTHW MYAIGGS HPTI+ QGNRF+A    
Sbjct  302   VTVAFNHFGKQLVQRMPRVRFGFAHVVNNDYTHWLMYAIGGSQHPTILSQGNRFLASNSH  361

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSG-DPNFMDKHHKLYDGVMTFKAE  370
             H KE+TKR       WKTW WRS+ D+ M GAFFV+SG D   +++     D +     +
Sbjct  362   HSKEVTKRDSSPQSVWKTWNWRSEMDLMMNGAFFVESGSDVRNVNRQ----DVIPAKPGK  417

Query  369   DVTWLTRFAGALNCRVGSPC  310
               + +TRF+GALNC V  PC
Sbjct  418   FASQMTRFSGALNCYVNKPC  437



>ref|XP_010463548.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   446 bits (1146),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 246/459 (54%), Positives = 307/459 (67%), Gaps = 22/459 (5%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIH------------EV  1480
              ++IP    ++AE DE W  +  EA +H   AY P+P++I                  E 
Sbjct  16    ASLIPTIRANVAETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYDNSTDVEGTEE  75

Query  1479  RRTLSeavaeaeaeaEDVTRNDTTRHLLGSK-------KYHGPCNATNPIDRCWRCHADW  1321
              + +  A  E   E      N T R L G +       K  GPC A+NPID+CWRC  DW
Sbjct  76    DKAVDSAEDEDVIEMTSSPTNSTRRSLSGKRRGRGKWSKLKGPCTASNPIDKCWRCQPDW  135

Query  1320  ATNRKRLADCALGFGYKTKGGKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFS  1144
             A  RKRL  C  GFGY+T GGK G  Y VT   DD + NP+PGTLRHAVIQK+PLWIIF 
Sbjct  136   ARRRKRLVRCVRGFGYRTTGGKRGRIYVVTSPRDDDTVNPRPGTLRHAVIQKEPLWIIFK  195

Query  1143  HDMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLI  964
             HDM I+L QEL++   KTID RGA VHI+ GAGIT+Q+VKN+IIHG+H+HHI   +GGLI
Sbjct  196   HDMSIRLSQELMIASHKTIDARGANVHIAYGAGITMQYVKNIIIHGLHVHHIVTSSGGLI  255

Query  963   RDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDH  784
             RD +DHFG R ++DGDGISIFG++++W+DH+SM  C DGLIDAI  STAITISN HFT H
Sbjct  256   RDSIDHFGQRGQADGDGISIFGATDIWLDHISMSKCQDGLIDAIMGSTAITISNSHFTHH  315

Query  783   NDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGG  604
             NDVML GA D +  DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW +YAIGG
Sbjct  316   NDVMLLGAQDHNQDDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGG  375

Query  603   SSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDP  427
             S  PTI+  GNRFIAPP   H +E+TKR      EWK W WRS+ D ++ GA+F QSG+P
Sbjct  376   SQGPTILSHGNRFIAPPHKQHYREVTKRDYAPEAEWKNWNWRSEKDYFLNGAYFRQSGNP  435

Query  426   NFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             +F   H +    +       V+ LT++AGAL+CRVG  C
Sbjct  436   HFKCSHSR-QQMIKPKHGVAVSKLTKYAGALDCRVGKAC  473



>gb|AAQ62996.1| oil palm polygalacturonase allergen PEST361 [Elaeis guineensis]
Length=447

 Score =   445 bits (1144),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 255/444 (57%), Positives = 307/444 (69%), Gaps = 30/444 (7%)
 Frame = -2

Query  1599  GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTR  1420
              +I E+D+ W+++  EA+  ++ AY P+P  ++      V   LSEA          V R
Sbjct  26    ANIVEFDDHWQKKAEEALARSRAAYNPDPEAVTHDFNKAVHLALSEARNSTRRTLRSVHR  85

Query  1419  NDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFY  1240
             N          K+ GPC ATNPIDRCWRC  +W  +RK+LA CA GFG    GGK G+FY
Sbjct  86    N----------KFKGPCVATNPIDRCWRCQKNWINHRKKLATCAKGFGRNAIGGKNGDFY  135

Query  1239  TVTDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVH  1063
              VTD +DD   NPK GTLR  VIQ +PLWIIF+ DM I+L +EL++  +KTIDGRGA VH
Sbjct  136   VVTDPSDDDLVNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELMINSNKTIDGRGANVH  195

Query  1062  ISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVW  883
             I+ GA ITIQFV +VIIHGIHIH I   NGG+IRD L HFG+RTKSDGDGISI+GSS++W
Sbjct  196   IAFGAQITIQFVHDVIIHGIHIHDIRPSNGGIIRDSLQHFGIRTKSDGDGISIYGSSDIW  255

Query  882   IDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHF  703
             IDH S+RNC DGLIDAIEASTAITISN HFT HNDV+LFGA+D +  D +MQ T+AFNHF
Sbjct  256   IDHCSLRNCADGLIDAIEASTAITISNCHFTHHNDVLLFGASDSNEHDSMMQATVAFNHF  315

Query  702   GKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKR  523
             GK L+QRMPRCR+G+ HVVNNDYT W MYAIGGS HPTII QGNRF+AP  +  KE+TKR
Sbjct  316   GKGLVQRMPRCRWGFFHVVNNDYTQWIMYAIGGSQHPTIISQGNRFVAPRMLFSKEVTKR  375

Query  522   VKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTW---LT  352
                T + WK WTWRS+GD+   GAFF +SG+PN      + +D     KA+  TW   LT
Sbjct  376   DYATEDVWKQWTWRSEGDLMQNGAFFRESGNPN-----ARKFDRKDFIKAKPGTWVRRLT  430

Query  351   RFAGALNCRVGSPC*IALLHSRPA  280
             RFAG L            LHSRPA
Sbjct  431   RFAGPLG-----------LHSRPA  443



>ref|XP_010453638.1| PREDICTED: probable pectate lyase 19 [Camelina sativa]
Length=490

 Score =   446 bits (1148),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 251/476 (53%), Positives = 312/476 (66%), Gaps = 39/476 (8%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNI--------------------  1504
               +IP   G+I+E DE W RR  EA E   QAY  +P+ I                    
Sbjct  16    AGLIPTIRGNISELDEYWSRRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTDATETEE  75

Query  1503  -----------SASLIHEVRRTLSeavaeaeaeaEDVTRNDTTRHLLGS-----KKYHGP  1372
                         A +  E      E   E   +    + N T R L G       K  GP
Sbjct  76    DGAVQLEEEHVGAQVEEEHGGAKPEEEEEEGIKMVGNSTNSTRRSLRGKGKGKWSKLKGP  135

Query  1371  CNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVTDNAD-DPSNPKPG  1195
             C A+NPID+CWRC ++WA  RK+L  C  GFG++T GGK G  Y VT N D D  NPKPG
Sbjct  136   CTASNPIDKCWRCRSNWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPG  195

Query  1194  TLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNVi  1015
             TLRHAVIQK+PLWIIF +DM I+L+QEL++   KTID RGA VHI+ GAGIT+QFVKNVI
Sbjct  196   TLRHAVIQKEPLWIIFKNDMSIRLNQELLINSHKTIDARGANVHIAHGAGITMQFVKNVI  255

Query  1014  ihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDA  835
             IHG+HIHHI E +GG+IRD +DHFG+RT++DGDG+SI+GSSN+W+DH+SM  C DGLIDA
Sbjct  256   IHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISMSKCQDGLIDA  315

Query  834   IEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYI  655
             I  ST ITISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK L+QRMPR R+G++
Sbjct  316   IVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWGFV  375

Query  654   HVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRS  478
             HVVNNDYTHW +YAIGGS  PTI+  GNRFIAPP   H +E+TKR     +EWK W WRS
Sbjct  376   HVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYAPEDEWKHWNWRS  435

Query  477   QGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             + D++M GA+F QSG+P+F   H +    +       V+ LT++AGAL+CRVG  C
Sbjct  436   EKDVFMNGAYFRQSGNPHFKCTHTR-KQMIKHKNGMAVSKLTKYAGALDCRVGKRC  490



>emb|CDY53552.1| BnaA09g57110D [Brassica napus]
Length=495

 Score =   446 bits (1148),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 241/438 (55%), Positives = 304/438 (69%), Gaps = 17/438 (4%)
 Frame = -2

Query  1617  IIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeae  1438
             ++P    ++A +D  W +R+ +A++    +Y+PNP N++  L + V   +          
Sbjct  20    LVPHVQANVAVFDNYWTQRQGDALKQTIASYDPNPLNVTDHLNYHVALAVDATE------  73

Query  1437  aEDVTRNDTTRHLLGSKKYHGP--CNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                 + N+T R L+G K   G   C A NPID+CWRC  +W  NRK+LA+C LGFG KT 
Sbjct  74    ----STNNTRRELIGRKTQEGSGKCIAHNPIDKCWRCDPNWEKNRKKLAECVLGFGRKTT  129

Query  1263  GGKLGNFYTVTDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTI  1087
             GGK G  Y V D++DD   NPKPGTLRHAV +  PLWIIF++ M IKL QEL++  +KTI
Sbjct  130   GGKDGPIYVVNDSSDDDLVNPKPGTLRHAVTRDGPLWIIFANSMVIKLQQELMITSNKTI  189

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             DGRGA+V+I +G G+T+QFV NVII+ I++ HI  GNGGLIRD  +H GLRTKSDGDGIS
Sbjct  190   DGRGAKVYIMEGVGLTLQFVNNVIINNIYVKHIIPGNGGLIRDSEEHVGLRTKSDGDGIS  249

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             +FG++NVWIDHVSM  C DG+IDAIE STA+TISN HFTDH +VMLFGA D    DK MQ
Sbjct  250   LFGATNVWIDHVSMTRCTDGMIDAIEGSTAVTISNSHFTDHQEVMLFGAKDEHVIDKNMQ  309

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             IT+AFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+ +PTII QGNRFIAPP+ 
Sbjct  310   ITVAFNHFGKRLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNE  369

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN-FMDKHHKLYDGVMTFKAE  370
               KE+TKR   +  +WK+W W+S+GD ++ GA+FVQSG PN +  K           + +
Sbjct  370   QAKEVTKREYTSYTDWKSWNWQSEGDYFLNGAYFVQSGRPNAWSPKPKNPVPSKFAIRPK  429

Query  369   D---VTWLTRFAGALNCR  325
                 V  LT  AGAL C 
Sbjct  430   PGTMVRELTMDAGALGCE  447



>ref|XP_010523445.1| PREDICTED: probable pectate lyase 3 [Tarenaya hassleriana]
Length=464

 Score =   445 bits (1144),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 241/436 (55%), Positives = 300/436 (69%), Gaps = 8/436 (2%)
 Frame = -2

Query  1599  GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTR  1420
              H+A +DE W +R+A A+    + Y+PNP N++    H V   + EA   +     ++ +
Sbjct  31    AHVAVFDEYWTQRQAHALRQTLRFYDPNPFNVTDHFNHHVNLAVEEATEASNGTRRELWQ  90

Query  1419  -NDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNF  1243
                  +HL   ++  G C A NPIDRCWRC  +WA +RK+LADC LGFG +T GGK G +
Sbjct  91    VGSGGKHL--KRRNTGKCVAYNPIDRCWRCQPNWAKDRKKLADCVLGFGRRTTGGKAGRY  148

Query  1242  YTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQV  1066
             Y VTD +D D  NP+PGTLRHAV + +PLWI+F   M I+L QELI+  +KTIDGRG +V
Sbjct  149   YVVTDASDTDLINPRPGTLRHAVTRDEPLWIVFERSMVIRLAQELIITSNKTIDGRGVRV  208

Query  1065  HISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNV  886
             HI+ GAG+T+QFV NVIIH I+I  I  GNGGLIRD   HFGLRT+SDGDGI+IFG++NV
Sbjct  209   HITGGAGLTVQFVNNVIIHNIYIKDIVPGNGGLIRDSETHFGLRTRSDGDGINIFGATNV  268

Query  885   WIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNH  706
             WIDHVSM +C DG+IDAI+ ST ITISN H TDH +VMLFGA D    D  MQIT+AFNH
Sbjct  269   WIDHVSMAHCSDGMIDAIQGSTGITISNCHLTDHGEVMLFGATDKDEIDTKMQITVAFNH  328

Query  705   FGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITK  526
             FGKRL+QRMPRCRYG IHVVNNDYTHW MYAIGG+ +PTII QGNRFIAPP+   K++TK
Sbjct  329   FGKRLVQRMPRCRYGLIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQAKQVTK  388

Query  525   RVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK----LYDGVMTFKAEDVTW  358
             R      EWK+W W+S+GD ++ GA+FVQSG  N      K        +       V  
Sbjct  389   REYTPYPEWKSWNWQSEGDYFLNGAYFVQSGRANAWSVAPKNPVPSKFAIRPQPGTLVRK  448

Query  357   LTRFAGALNCRVGSPC  310
             LT  +G L C+ G PC
Sbjct  449   LTMNSGVLGCKKGKPC  464



>emb|CDX70590.1| BnaC03g06740D [Brassica napus]
Length=475

 Score =   445 bits (1144),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 248/466 (53%), Positives = 311/466 (67%), Gaps = 34/466 (7%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNI--------------------  1504
               +IP     ++E DE W +R  EA E   QAY  +P+ I                    
Sbjct  16    AGLIPTIQADMSELDEYWSQRADEAREFTLQAYHSDPYEIIDHFHERHYDNSTDITPTEE  75

Query  1503  -SASLIHEVRRTLSeavaeaeaeaEDVTRNDTTRHLLGS-----KKYHGPCNATNPIDRC  1342
              S +   EV   +          + D + N T R L G       K  GPC A+NPID+C
Sbjct  76    ASNAKPEEVENEV-----IEMVGSGDNSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDKC  130

Query  1341  WRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKK  1165
             WRC  +WA  RK+L  C  GFG+ T GGK G  Y VT N D D  NP+PGTLRHAVIQ++
Sbjct  131   WRCRKNWAKRRKKLVKCVRGFGHMTVGGKHGRIYVVTSNLDEDVVNPEPGTLRHAVIQEE  190

Query  1164  PLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIF  985
             PLWIIF +DM I+L+QEL++   KTID RGA VHI+ GAG+T+QFV++VIIHG+HIHHI 
Sbjct  191   PLWIIFKNDMSIRLNQELMINSFKTIDARGANVHIAHGAGVTMQFVRHVIIHGLHIHHIS  250

Query  984   EGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITIS  805
             E +GG+IRD  DHFG+RT++DGDG+SI+GSSN+W+DHVSM  C DGLIDAI  STAITIS
Sbjct  251   ESSGGMIRDSADHFGMRTRADGDGLSIYGSSNIWLDHVSMSQCQDGLIDAIVGSTAITIS  310

Query  804   NGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHW  625
             N HFT HNDVML GA +    DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW
Sbjct  311   NSHFTHHNDVMLLGAQNTYDLDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHW  370

Query  624   NMYAIGGSSHPTIICQGNRFIAPPDI-HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAF  448
              +YAIGGS  PTI+ QGNRFIAPP + H +E+TKR     EEWK W WRS+ DI+M GA+
Sbjct  371   ELYAIGGSQSPTILSQGNRFIAPPHLPHYREVTKRDYAPEEEWKHWNWRSEKDIFMNGAY  430

Query  447   FVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             F QSG+PN+ +  H   + +       V+ LT++AGAL+CRVG  C
Sbjct  431   FRQSGNPNY-ETDHTRRNMIKPKNGYAVSKLTKYAGALDCRVGRRC  475



>gb|KDO76053.1| hypothetical protein CISIN_1g013757mg [Citrus sinensis]
Length=437

 Score =   444 bits (1141),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 239/440 (54%), Positives = 297/440 (68%), Gaps = 20/440 (5%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
              +I P    +  ++DEVW++R   A  HA +AY PNP  + +S    V            
Sbjct  16    ASISPILKANTHDFDEVWQKRAENARRHALEAYHPNPEEVVSSFNKHVHMMFE-------  68

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                       +TR  L  + Y G C ATNPID+CWRC  +WA NRKRLADCA GFG  T 
Sbjct  69    -------NGSSTRRYLRGRPYTGRCAATNPIDQCWRCDRNWANNRKRLADCAQGFGRGTI  121

Query  1263  GGKLGNFYTVTDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTI  1087
             GGK G FY VT+ ADD   NPKPGTLRHAVIQ++PLWI F+HDM I+L +EL++  DKTI
Sbjct  122   GGKNGPFYVVTNPADDDLVNPKPGTLRHAVIQERPLWITFAHDMVIRLSEELLITSDKTI  181

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             D RG+ V I +GA IT+QFVKN+IIHG+HI     G GG+IRD + H G R+ SDGDGIS
Sbjct  182   DARGSNVQIYNGAQITMQFVKNIIIHGLHIRKTKAGKGGMIRDSVSHHGFRSSSDGDGIS  241

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             +FG+S++WIDHVSM  C DGLIDA+  STAIT+SN HFT  + VML GA+D   +D IMQ
Sbjct  242   MFGASHIWIDHVSMSGCQDGLIDAVMGSTAITVSNSHFTHQDHVMLLGASDGHPQDSIMQ  301

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             +T+AFNHFGK+L+QRMPR R+G+ HVVNNDYTHW MYAIGGS HPTI+ QGNRF+A    
Sbjct  302   VTVAFNHFGKQLVQRMPRVRFGFAHVVNNDYTHWLMYAIGGSQHPTILSQGNRFLASNSH  361

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSG-DPNFMDKHHKLYDGVMTFKAE  370
             H KE+TKR       WKTW WRS+ D+ M GAFFV+SG D   +++     D +     +
Sbjct  362   HSKEVTKRDSSPQSVWKTWNWRSEMDLMMNGAFFVESGSDVRNVNRQ----DVIPAKPGK  417

Query  369   DVTWLTRFAGALNCRVGSPC  310
               + +TRF+GALNC V  PC
Sbjct  418   FASQMTRFSGALNCYVNKPC  437



>ref|XP_009131435.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
 emb|CDX78607.1| BnaA03g05190D [Brassica napus]
Length=475

 Score =   445 bits (1144),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 251/461 (54%), Positives = 312/461 (68%), Gaps = 26/461 (6%)
 Frame = -2

Query  1620  AIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHE--------VRRTLS  1465
              +IP     ++E DE W  R  EA E   QAY  +P+ I     HE        V  T  
Sbjct  17    GLIPTIRADMSELDEYWSGRADEAREFTLQAYHSDPYEI-IDHFHERHYDNSTDVTPTEE  75

Query  1464  eavaeaeaeaEDV---------TRNDTTRHLLGS-----KKYHGPCNATNPIDRCWRCHA  1327
             +   + E    +V         + N T R L G       K  GPC A+NPID+CWRC  
Sbjct  76    DNNTKPEEVENEVIEMVGSGDNSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWRCRK  135

Query  1326  DWATNRKRLADCALGFGYKTKGGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWII  1150
             +W+  RK+L  C  GFG+ T GGK G  Y VT N D D  NP+PGTLRHAVIQK+PLWII
Sbjct  136   NWSKRRKKLVKCVRGFGHMTVGGKHGRIYVVTSNLDEDMVNPEPGTLRHAVIQKEPLWII  195

Query  1149  FSHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGG  970
             F +DM I+L+QEL++   KTID RGA VHI+ GAG+T+QFV++VIIHG+HIHHI E +GG
Sbjct  196   FKNDMSIRLNQELLINSFKTIDARGANVHIAHGAGVTMQFVRHVIIHGLHIHHISESSGG  255

Query  969   LIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFT  790
             +IRD  DHFG+RT++DGDG+SI+GSSN+W+DHVSM  C DGLIDAI  STAITISN HFT
Sbjct  256   MIRDSADHFGMRTRADGDGLSIYGSSNIWLDHVSMSQCQDGLIDAIVGSTAITISNSHFT  315

Query  789   DHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAI  610
              HNDVML GA +    DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW +YAI
Sbjct  316   HHNDVMLLGAQNTYDLDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAI  375

Query  609   GGSSHPTIICQGNRFIAPPDI-HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSG  433
             GGS  PTI+ QGNRFIAPP + H +E+TKR     EEWK W WRS+ DI+M GA+F QSG
Sbjct  376   GGSQSPTILSQGNRFIAPPHLPHYREVTKRDYAPEEEWKHWNWRSEKDIFMNGAYFRQSG  435

Query  432   DPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             DPN+ +  H   + +       V+ LT++AGAL+CRVG  C
Sbjct  436   DPNY-ETDHTRRNMIKPKNGYAVSKLTKYAGALDCRVGRRC  475



>emb|CDY66593.1| BnaCnng51570D [Brassica napus]
Length=499

 Score =   446 bits (1146),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 252/485 (52%), Positives = 319/485 (66%), Gaps = 48/485 (10%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNP-----------------------  1513
               +IP    +I+E DE W +R  EA E   QAY  +P                       
Sbjct  16    AGLIPTIRANISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTDDTTTEE  75

Query  1512  HNISASLIHEVRRTLSeavaeaeaeaEDVTRNDTTR----HLLGSKK-------------  1384
             H+ +++ +       S +      E +  T+ +  R     ++G+ K             
Sbjct  76    HSSNSADVTATAEDSSNSTDVTATEEDSSTKPEEERTEVIEMVGNSKNSTRRSLKGKGKG  135

Query  1383  ----YHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVTDNAD-  1219
                   GPC A+NPID+CWRC ++WA  RK+LA C  GFG+ T GGK G  Y VT N D 
Sbjct  136   KWSKLKGPCTASNPIDKCWRCRSNWANRRKKLAKCVRGFGHGTTGGKRGRIYVVTSNLDE  195

Query  1218  DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAGIT  1039
             D  NP PGTLRHAVIQK+PLWIIF +DM I+L QEL++  DKTID RGA VHI+ GAGIT
Sbjct  196   DMVNPIPGTLRHAVIQKEPLWIIFKNDMSIRLSQELLVNSDKTIDARGADVHIAHGAGIT  255

Query  1038  IQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRN  859
             +QFV+NVIIHG+HIHHI E NGG+IRD +DHFG+RT++DGDG+SI+GSSN+WIDHVSM  
Sbjct  256   MQFVRNVIIHGLHIHHISESNGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWIDHVSMSK  315

Query  858   CYDGLIDAIEASTAITISNGHFTDHNDVMLFGA-NDLSTKDKIMQITLAFNHFGKRLIQR  682
             C DGLIDAI  STAITISN HFT HNDVML GA N+++  D+ MQ+T+A+NHFGK L+QR
Sbjct  316   CQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNNMNEADQKMQVTVAYNHFGKGLVQR  375

Query  681   MPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI-HKKEITKRVKGTPE  505
             MPR R+G++HVVNNDYTHW +YAIGGS  PTI+  GNRFIAPP + + KE+TKR     +
Sbjct  376   MPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHLPYYKEVTKRDYALED  435

Query  504   EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCR  325
             EWK WTWRS+ DI+M GAFF QSGDP++   H +    +       V+ LT++AGAL+CR
Sbjct  436   EWKHWTWRSEKDIFMNGAFFRQSGDPHYKSAHTR-KQMIKPKNGYAVSKLTKYAGALDCR  494

Query  324   VGSPC  310
             VG  C
Sbjct  495   VGKRC  499



>ref|XP_006428983.1| hypothetical protein CICLE_v10013750mg [Citrus clementina]
 gb|ESR42223.1| hypothetical protein CICLE_v10013750mg [Citrus clementina]
Length=438

 Score =   443 bits (1140),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 238/439 (54%), Positives = 309/439 (70%), Gaps = 18/439 (4%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
              A+IP    +I+E DEVWRRR  EA++  +Q Y+PNP  I++ L  +V+           
Sbjct  17    AALIPCLSANISEVDEVWRRRAEEAMQTTEQYYDPNPVAIASHLNMKVQ-----------  65

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                 D+++    R  L + +  G C ATNPID CWRC  +WA NR+ LA CALGFG K  
Sbjct  66    ----DLSKQTAARRGLLNAE-SGQCEATNPIDNCWRCKENWAENRQALAGCALGFGIKAT  120

Query  1263  GGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTI  1087
             GGK G  Y VTD +D D  NPK GTLRHAVIQK+PLWIIF+ DM+IKL QELI+QG KTI
Sbjct  121   GGKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQELIVQGKKTI  180

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             DGRGA VHI++GAG  +QFV+NVIIHGIHIH+I   +GG+IRD +DH G R +SDGD +S
Sbjct  181   DGRGANVHIANGAGFMLQFVQNVIIHGIHIHNISPRSGGMIRDSVDHVGKRGQSDGDAVS  240

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             IFGSSN+W+DH+++   +DGLIDAI+ASTAITISN HF++H+  +L GA+D  T+DK MQ
Sbjct  241   IFGSSNIWLDHLTLSQAHDGLIDAIQASTAITISNCHFSNHDKAILLGASDTFTEDKKMQ  300

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             +T+AFN F K L+QRMP  R+G+ HVVNNDY  W MYAIGG   PTI+ QGNRF A  + 
Sbjct  301   VTVAFNRFDKGLVQRMPCVRFGFAHVVNNDYNQWEMYAIGGLKGPTILSQGNRFFASDNQ  360

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED  367
             + KE+TKR+  +PEE K+W WRS+GD+++ GA+F  SGDP      +++ D +      +
Sbjct  361   NTKEVTKRMNCSPEEGKSWIWRSEGDVFLNGAYFNSSGDPK-KQIEYQMDDVIKPKPGTE  419

Query  366   VTWLTRFAGALNCRVGSPC  310
             V  +T+FAGAL C+ G  C
Sbjct  420   VERITKFAGALVCKPGQKC  438



>ref|XP_011098576.1| PREDICTED: probable pectate lyase P56 [Sesamum indicum]
Length=465

 Score =   444 bits (1141),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 243/441 (55%), Positives = 291/441 (66%), Gaps = 12/441 (3%)
 Frame = -2

Query  1623  GAIIPAT-VGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaea  1447
              A IP +   +   +D  W+ R A A     QAY PNP  I      + +  L  +    
Sbjct  34    AAFIPTSGANYTDSHDVYWQERAALARARILQAYNPNPEAIVTDFNQKTKEALEHSQVNR  93

Query  1446  eaeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKT  1267
                      N T R+L   +KY GPC ATNPIDRCWRC+ +WA NR++LADCA GFG   
Sbjct  94    ------APHNGTRRNL--GRKYMGPCVATNPIDRCWRCNPNWALNRQKLADCAQGFGAAA  145

Query  1266  KGGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKT  1090
              GGK G  Y V D +D D  NPKPGTLRHAVIQ  PLWIIFSH M+IKL+QELIM  DKT
Sbjct  146   TGGKFGPIYVVRDPSDNDMMNPKPGTLRHAVIQPGPLWIIFSHSMNIKLNQELIMTSDKT  205

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             IDGRGA + I+ GAG+TIQFV N+II  + I +I    GG IRD ++HFG RT SDGD I
Sbjct  206   IDGRGALIQITGGAGLTIQFVHNIIITNLKITNIVPSPGGTIRDSVNHFGFRTGSDGDAI  265

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             +IFGS N+WIDH+SM    DGLIDA+  STAITISN HF  H+ V+LFG  D+   D  M
Sbjct  266   NIFGSHNIWIDHLSMSGGADGLIDAVMGSTAITISNCHFVRHDKVLLFGGRDMDEIDSKM  325

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             QITLAFNHFGK L+QRMPRCR G+ H+VNNDYTHW MYAIGGS H TII QGNR+IAPP 
Sbjct  326   QITLAFNHFGKHLVQRMPRCRRGFFHLVNNDYTHWLMYAIGGSHHATIISQGNRYIAPPL  385

Query  549   IHKKEITKRVKGTPE-EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKA  373
               K+++T R   +PE EW+ WTW +  D+++ GA+FV SGDPN    +  L + +     
Sbjct  386   PDKRQVTHREADSPESEWRKWTWVTDHDVFLNGAYFVPSGDPNGAATYLAL-EKIRPAPG  444

Query  372   EDVTWLTRFAGALNCRVGSPC  310
             E V  LTRFAGAL C V  PC
Sbjct  445   EQVYDLTRFAGALKCVVSLPC  465



>ref|XP_010683249.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=444

 Score =   443 bits (1139),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 253/431 (59%), Positives = 307/431 (71%), Gaps = 14/431 (3%)
 Frame = -2

Query  1599  GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTR  1420
              +IAE+DE W +R  EA+++ ++AY P P+N++    H+V              A ++ +
Sbjct  27    ANIAEFDEYWHKRRLEAVKYFEEAYHPEPYNVTNHFNHQVH-----------LHARNMKK  75

Query  1419  NDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFY  1240
              ++TR  L  K + GPC ATNPID CWRC  +WA NRKRLADCA+GFG  T GGK G  Y
Sbjct  76    LNSTRRGLLGKGHIGPCVATNPIDACWRCQPNWAENRKRLADCAIGFGKGTTGGKDGRIY  135

Query  1239  TVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVH  1063
              VTD++D D  NPKPGTLRHAVIQ +PLWIIF+  M+I+L QELIM GDKTID RGA VH
Sbjct  136   VVTDSSDNDMQNPKPGTLRHAVIQTEPLWIIFARSMNIRLTQELIMTGDKTIDARGANVH  195

Query  1062  ISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVW  883
             I+ GAGITIQF+KNVIIHG+HIH I+ G+GGLIRD  +HFGLRT+SDGD ISIFG+SN+W
Sbjct  196   IAHGAGITIQFIKNVIIHGLHIHQIYPGDGGLIRDSANHFGLRTRSDGDAISIFGASNIW  255

Query  882   IDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHF  703
             IDHVSM    DGLID I+ STAITISN H TDHN+V LFGA +  T D+ MQ+T+AFNHF
Sbjct  256   IDHVSMARGTDGLIDIIQGSTAITISNCHMTDHNEVFLFGATNDYTDDQKMQVTVAFNHF  315

Query  702   GKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKR  523
             GK L+QRMPR R+G+IHVVNNDYTHW MYAIGGS HPTII QGNRF+AP +   KE+TKR
Sbjct  316   GKGLVQRMPRARFGFIHVVNNDYTHWQMYAIGGSQHPTIISQGNRFVAPFNPFAKEVTKR  375

Query  522   VKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFA  343
              +    EWK+WTW S  D ++ GAFF  SG  N +D  +K            V  LTR +
Sbjct  376   -EAPESEWKSWTWLSDKDWFLNGAFFRDSGRGNAIDSKNKA-QMFSAMAGTKVGELTRCS  433

Query  342   GALNCRVGSPC  310
             G   C  G PC
Sbjct  434   GPRKCTPGKPC  444



>emb|CDX81636.1| BnaC08g39650D [Brassica napus]
Length=484

 Score =   444 bits (1143),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 231/401 (58%), Positives = 294/401 (73%), Gaps = 13/401 (3%)
 Frame = -2

Query  1617  IIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeae  1438
             ++P    ++A +D  W++R+ +A++    +Y+PNP N++  L + V   +          
Sbjct  20    LVPHVQANVAIFDNYWKQRQGDALKQTIASYDPNPLNVTDHLNYHVALAVDATE------  73

Query  1437  aEDVTRNDTTRHLLG--SKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                 + N+T R L+G  +++  G C A NPID+CWRC  +W  NRK+L +C LGFG KT 
Sbjct  74    ----STNNTRRELIGRETQEGSGKCIAYNPIDKCWRCDPNWEKNRKKLVECVLGFGRKTT  129

Query  1263  GGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTI  1087
             GGK G  Y V D++D D  NPKPGTLRHAV +  PLWIIF++ M IKL QEL++  +KTI
Sbjct  130   GGKDGPIYVVNDSSDEDLVNPKPGTLRHAVTRDGPLWIIFANSMVIKLQQELMITSNKTI  189

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             DGRGA+V+I +GAG+T QFV NVII+ I++ HI  GNGGLIRD  +H GLRTKSDGDGIS
Sbjct  190   DGRGARVYIMEGAGLTQQFVNNVIINNIYVKHIIPGNGGLIRDSEEHVGLRTKSDGDGIS  249

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             +FG++NVWIDHVSM  C DG+IDAIE STA+TISN HFTDH +VMLFGA D    DK MQ
Sbjct  250   LFGATNVWIDHVSMTRCTDGMIDAIEGSTAVTISNSHFTDHQEVMLFGAKDEHVIDKNMQ  309

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             IT+AFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+ +PTII QGNRFIAPP+ 
Sbjct  310   ITVAFNHFGKRLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNE  369

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN  424
               KE+TKR   +  +WK+W W+S+GD ++ GA+FVQSG PN
Sbjct  370   QAKEVTKREYTSYTDWKSWNWQSEGDYFLNGAYFVQSGRPN  410



>ref|XP_006480843.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=436

 Score =   442 bits (1137),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 238/439 (54%), Positives = 308/439 (70%), Gaps = 18/439 (4%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
              A+IP    +I+E DEVWRRR  EA++  +Q Y+PNP  I++ L  +V+           
Sbjct  15    AALIPCLSANISEVDEVWRRRAEEAMQTTEQYYDPNPVAIASHLNMKVQ-----------  63

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                 D+++    R  L + +  G C ATNPID CWRC  +WA NR+ LA CALGFG K  
Sbjct  64    ----DLSKQTAARRGLLNAE-SGQCEATNPIDNCWRCKENWAENRQALAGCALGFGIKAT  118

Query  1263  GGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTI  1087
             GGK G  Y VTD +D D  NPK GTLRHAVIQK+PLWIIF+ DM+IKL QELI+QG KTI
Sbjct  119   GGKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQELIVQGKKTI  178

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             DGRGA VHI++GAG  +QFV+NVIIHGIHIH+I   +GG+IRD +DH G R +SDGD +S
Sbjct  179   DGRGANVHIANGAGFMLQFVQNVIIHGIHIHNISPRSGGMIRDSVDHVGKRGQSDGDAVS  238

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             IFGSSN+W+DH+++   +DGLIDAI+ASTAITISN HF++H+  +L GA+D  T+DK MQ
Sbjct  239   IFGSSNIWLDHLTLSQAHDGLIDAIQASTAITISNCHFSNHDKAILLGASDTFTEDKKMQ  298

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             +T+AFN F K L+QRMP  R+G+ HVVNNDY  W MYAIGG   PTI+ QGNRF A  + 
Sbjct  299   VTVAFNRFDKGLVQRMPCVRFGFAHVVNNDYNQWEMYAIGGLKGPTILSQGNRFFASDNQ  358

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED  367
             + KE+TKR+  +PEE K W WRS+GD+++ GA+F  SGDP      +++ D +      +
Sbjct  359   NTKEVTKRMNCSPEEGKNWIWRSEGDVFLNGAYFNSSGDPK-KQIEYQMDDVIKPKPGTE  417

Query  366   VTWLTRFAGALNCRVGSPC  310
             V  +T+FAGAL C+ G  C
Sbjct  418   VERITKFAGALVCKPGQKC  436



>ref|XP_010485518.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   443 bits (1140),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 246/459 (54%), Positives = 304/459 (66%), Gaps = 22/459 (5%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIH------------EV  1480
              ++IP    ++AE DE W  +  EA +H   AY P+P++I                  E 
Sbjct  16    ASLIPTIRANVAETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYDNSTDVEGTEE  75

Query  1479  RRTLSeavaeaeaeaEDVTRNDTTRHLLGSK-------KYHGPCNATNPIDRCWRCHADW  1321
                +  A  E   E      N T R L G +       K  GPC A+NPID+CWRC  DW
Sbjct  76    DTAVDSAEDEDVIEMTSSPTNSTRRSLSGKRRGRGKWSKLKGPCTASNPIDKCWRCQPDW  135

Query  1320  ATNRKRLADCALGFGYKTKGGKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFS  1144
             A  RKRL  C  GFGY+T GGK G  Y VT   DD + NP+PGTLRHAVIQK+PLWIIF 
Sbjct  136   AKRRKRLVRCVRGFGYRTTGGKRGRIYVVTSPRDDDTVNPRPGTLRHAVIQKEPLWIIFK  195

Query  1143  HDMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLI  964
             HDM I+L QEL++   KTID RGA VHI+ GAGIT+Q+V N+IIHG+H+HHI   +GGLI
Sbjct  196   HDMSIRLSQELMIASHKTIDARGANVHIAYGAGITMQYVHNIIIHGLHVHHIVTSSGGLI  255

Query  963   RDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDH  784
             RD +DHFG R ++DGDGISIFG++N+W+DH+SM  C DGLIDAI  STAITISN HFT H
Sbjct  256   RDSIDHFGQRGQADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTAITISNSHFTHH  315

Query  783   NDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGG  604
             NDVML GA D +  DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW +YAIGG
Sbjct  316   NDVMLLGAQDHNQDDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGG  375

Query  603   SSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDP  427
             S  PTI+  GNRFIAPP   H +E+TKR      EWK W WRS  D ++ GA+F QSG+P
Sbjct  376   SQGPTILSHGNRFIAPPHKQHYREVTKRDYAPEAEWKNWNWRSDKDYFLNGAYFRQSGNP  435

Query  426   NFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             +F   H +    +       V+ LT++AGAL+CRVG  C
Sbjct  436   HFKCSHSR-QQMIKPKHGVAVSKLTKYAGALDCRVGKAC  473



>ref|XP_003552513.1| PREDICTED: pectate lyase-like [Glycine max]
Length=440

 Score =   442 bits (1136),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 241/438 (55%), Positives = 298/438 (68%), Gaps = 20/438 (5%)
 Frame = -2

Query  1614  IPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaea  1435
             IP     IAE+D+  + +  EA E A ++YEP+P N++A     V R L E         
Sbjct  20    IPCLEAGIAEFDDFLKAQADEAHEIALRSYEPDPINVTAEFNIHVHRALMEES-------  72

Query  1434  EDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGK  1255
                  NDT R L   +KY GPC ATNPIDRCWRC  DWA +R RLA C  GFG +  GG 
Sbjct  73    -----NDTRREL--KQKYRGPCLATNPIDRCWRCRKDWAQDRYRLASCGKGFGRRAVGGL  125

Query  1254  LGNFYTVTDNADD-PSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGR  1078
              G  Y VTD++DD P NP+PGTLR+ V+Q++PLWIIF+  M I L  EL++  DKTIDGR
Sbjct  126   HGKIYVVTDSSDDEPINPRPGTLRYGVLQREPLWIIFAQSMVITLKFELLISSDKTIDGR  185

Query  1077  GAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifg  898
             GA V I  GAG+ +QFV N+IIHGI I+ I    G ++RD  +H G+RT+ DGD +SIFG
Sbjct  186   GANVVIKGGAGLAMQFVNNIIIHGIRINKIKSMEGTMLRDLWNHVGIRTRCDGDAVSIFG  245

Query  897   sSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITL  718
             SSN+W+DH+S+  C DGLID ++ ST ITISN H T HNDVMLFGA+D    DKIMQ+T+
Sbjct  246   SSNIWLDHLSLSECEDGLIDIVQGSTGITISNCHMTKHNDVMLFGASDTYAGDKIMQVTV  305

Query  717   AFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKK  538
             AFNHFG+ LIQRMPRCR+G++HV+NNDYTHW MYAIGGSS PTI+ QGNRFIAP +   K
Sbjct  306   AFNHFGQGLIQRMPRCRWGFVHVINNDYTHWLMYAIGGSSEPTILSQGNRFIAPNNNAAK  365

Query  537   EITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMT--FKAEDV  364
             EIT R    PEEW  W W+S+ D++M GA F+QSG P      +K   G+M       + 
Sbjct  366   EITHRDYAPPEEWSKWQWKSENDLFMNGATFLQSGSPLGKLPFNK---GLMMKPRPGAEA  422

Query  363   TWLTRFAGALNCRVGSPC  310
               LTRFAGALNC+VG PC
Sbjct  423   NRLTRFAGALNCKVGKPC  440



>gb|KHN13652.1| Pectate lyase [Glycine soja]
Length=440

 Score =   441 bits (1135),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 241/438 (55%), Positives = 298/438 (68%), Gaps = 20/438 (5%)
 Frame = -2

Query  1614  IPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaea  1435
             IP     IAE+D+  + +  EA E A ++YEP+P N++A     V R L E         
Sbjct  20    IPCLEAGIAEFDDFLKAQADEAHEIALRSYEPDPINVTAEFNIHVHRALMEES-------  72

Query  1434  EDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGK  1255
                  NDT R L   +KY GPC ATNPIDRCWRC  DWA +R RLA C  GFG +  GG 
Sbjct  73    -----NDTRREL--KQKYRGPCLATNPIDRCWRCRKDWAQDRYRLASCGKGFGRRAVGGL  125

Query  1254  LGNFYTVTDNADD-PSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGR  1078
              G  Y VTD++DD P NP+PGTLR+ V+Q++PLWIIF+  M I L  EL++  DKTIDGR
Sbjct  126   HGKIYVVTDSSDDEPINPRPGTLRYGVLQREPLWIIFAQSMVITLKFELLISSDKTIDGR  185

Query  1077  GAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifg  898
             GA V I  GAG+ +QFV N+IIHGI I+ I    G ++RD  +H G+RT+ DGD +SIFG
Sbjct  186   GANVVIKGGAGLAMQFVNNIIIHGIRINKIKSMEGTMLRDLWNHVGIRTRCDGDAVSIFG  245

Query  897   sSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITL  718
             SSN+W+DH+S+  C DGLID ++ ST ITISN H T HNDVMLFGA+D    DKIMQ+T+
Sbjct  246   SSNIWLDHLSLSECEDGLIDIVQGSTGITISNCHMTKHNDVMLFGASDTYAGDKIMQVTV  305

Query  717   AFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKK  538
             AFNHFG+ LIQRMPRCR+G++HV+NNDYTHW MYAIGGSS PTI+ QGNRFIAP +   K
Sbjct  306   AFNHFGQGLIQRMPRCRWGFVHVINNDYTHWLMYAIGGSSEPTILSQGNRFIAPNNNAAK  365

Query  537   EITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMT--FKAEDV  364
             EIT R    PEEW  W W+S+ D++M GA F+QSG P      +K   G+M       + 
Sbjct  366   EITHRDYAPPEEWSKWQWKSENDLFMNGATFLQSGAPLGKLPFNK---GLMMKPRPGAEA  422

Query  363   TWLTRFAGALNCRVGSPC  310
               LTRFAGALNC+VG PC
Sbjct  423   NRLTRFAGALNCKVGKPC  440



>ref|XP_010670318.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=450

 Score =   441 bits (1134),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 244/440 (55%), Positives = 298/440 (68%), Gaps = 26/440 (6%)
 Frame = -2

Query  1605  TVGHIA-------EYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaea  1447
             T+GH+        E+DE ++R+ AEA   +  AY  +P  +     + V R L       
Sbjct  29    TIGHVGNHTTKDTEHDEWFQRKLAEAYNASLLAYHHDPIEVMNHFNYHVHRALEGT----  84

Query  1446  eaeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKT  1267
                      N T R   G  KY G C A NPIDRCWRC ADWA +RK+LADC  GFG +T
Sbjct  85    ---------NSTRR---GLNKYQGECKAQNPIDRCWRCKADWAVDRKKLADCVKGFGRQT  132

Query  1266  KGGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKT  1090
              GGK G +YTVTD +D D  NPKPGTLR AV+Q +PLWIIF+ DM IKL  EL++  DKT
Sbjct  133   TGGKKGAYYTVTDPSDNDVVNPKPGTLRFAVLQPQPLWIIFAKDMTIKLKAELMITSDKT  192

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             IDGRGAQV I+DGAGITIQF  NVIIH I IH I    GG+IRD  +H G+R   DGDGI
Sbjct  193   IDGRGAQVQIADGAGITIQFANNVIIHNIKIHDIVPSTGGMIRDTNNHVGIRGADDGDGI  252

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             ++F SSN+W+DH+SM NC DGLID ++ASTAIT+SN HFT H+ V+LFGA+D    D+IM
Sbjct  253   NVFASSNIWLDHLSMWNCKDGLIDIVKASTAITLSNNHFTRHDHVLLFGADDKDPADEIM  312

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             QI+LAFNHFGK L+QRMPRCR+G+ HV+NNDYTHW MYAIGG+SHPTII QGNRFIAPP+
Sbjct  313   QISLAFNHFGKGLVQRMPRCRFGFFHVLNNDYTHWIMYAIGGTSHPTIISQGNRFIAPPN  372

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAE  370
                K IT R     ++WK W WRS+ D ++ GA+FV+SG P  +D+     D +      
Sbjct  373   PTAKMITNRNNVVGDDWKKWIWRSENDQFVNGAYFVESGHP--LDETRFKKDFIKAKPGT  430

Query  369   DVTWLTRFAGALNCRVGSPC  310
              V  LTRF+G L CRVG  C
Sbjct  431   YVRRLTRFSGQLRCRVGQSC  450



>emb|CDX91953.1| BnaC03g32550D [Brassica napus]
Length=471

 Score =   442 bits (1136),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 244/458 (53%), Positives = 305/458 (67%), Gaps = 22/458 (5%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHE--------VRRTL  1468
              ++IP    ++AE D+ W +   EA +    AY P+P+ I     HE        V  T 
Sbjct  16    ASLIPTLRANVAETDDYWVKMANEARKRTLMAYHPDPYQI-VDHFHERHYDNSTDVEETE  74

Query  1467  SeavaeaeaeaEDVTRNDTTRHLLGS----------KKYHGPCNATNPIDRCWRCHADWA  1318
               A  E +      +  ++TR  L             K  GPC A+NPID+CWRC  DWA
Sbjct  75    EHASEEEDDIEMSSSPTNSTRRSLRGRGKGKGRGKWSKLKGPCTASNPIDKCWRCQPDWA  134

Query  1317  TNRKRLADCALGFGYKTKGGKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSH  1141
               RK+L  C  GFGY+T GGK G  Y VT N DD + NP+PGTLRHAVIQ +PLWIIF H
Sbjct  135   RRRKKLVKCVRGFGYRTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQNEPLWIIFKH  194

Query  1140  DMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIR  961
             DM I+L QEL++   KTID RG  VHI+ GAGIT+Q+V+N+IIHG+H+HHI  G+GG+IR
Sbjct  195   DMSIRLSQELMINSHKTIDARGTNVHIAYGAGITMQYVRNIIIHGLHVHHIVPGSGGMIR  254

Query  960   DGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHN  781
             +  DHFG R ++DGDGISIFG++N+W+DH+SM  C DGLIDAI  ST ITISN HFT HN
Sbjct  255   NSNDHFGFRGQADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTGITISNSHFTHHN  314

Query  780   DVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGS  601
             DVML GA + +  DK MQ+T+AFNHFGK L+QRMPR R+G++HVVNNDYTHW +YAIGGS
Sbjct  315   DVMLLGAQNDNHADKKMQVTVAFNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGS  374

Query  600   SHPTIICQGNRFIAPPDI-HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN  424
               PTI+  GNRFIAPP I H +E+TKR      EWK W WRS  DI+M  A+F QSG+P 
Sbjct  375   QSPTILSHGNRFIAPPHIQHYREVTKRDYAPESEWKNWNWRSDKDIFMNNAYFRQSGNPK  434

Query  423   FMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             FM  H +    +       V+ LT++AGAL+CRVG PC
Sbjct  435   FMCSHSR-QQMIKPKHGSAVSKLTKYAGALDCRVGKPC  471



>emb|CDX74293.1| BnaA03g27540D [Brassica napus]
Length=471

 Score =   441 bits (1135),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 244/458 (53%), Positives = 305/458 (67%), Gaps = 22/458 (5%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHE--------VRRTL  1468
              ++IP    ++AE D+ W +   EA +    AY P+P+ I     HE        V  T 
Sbjct  16    ASLIPTLRANVAETDDYWVKMANEARKRTLMAYHPDPYQI-VDHFHERHYDNSTDVEETE  74

Query  1467  SeavaeaeaeaEDVTRNDTTRHLLGS----------KKYHGPCNATNPIDRCWRCHADWA  1318
               A  E +      +  ++TR  L             K  GPC A+NPID+CWRC  DWA
Sbjct  75    EHASEEEDDIEMSSSLTNSTRRSLRGRGKGKGRGKWSKLKGPCTASNPIDKCWRCQPDWA  134

Query  1317  TNRKRLADCALGFGYKTKGGKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSH  1141
               RK+L  C  GFGY+T GGK G  Y VT N DD + NP+PGTLRHAVIQ +PLWIIF H
Sbjct  135   RRRKKLVKCVRGFGYRTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQNEPLWIIFKH  194

Query  1140  DMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIR  961
             DM I+L QEL++   KTID RG  VHI+ GAGIT+Q+V+N+IIHG+H+HHI  G+GG+IR
Sbjct  195   DMSIRLSQELMINSHKTIDARGTNVHIAYGAGITMQYVRNIIIHGLHVHHIVPGSGGMIR  254

Query  960   DGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHN  781
             +  DHFG R ++DGDGISIFG++N+W+DH+SM  C DGLIDAI  ST ITISN HFT HN
Sbjct  255   NSNDHFGFRGQADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTGITISNSHFTHHN  314

Query  780   DVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGS  601
             DVML GA + +  DK MQ+T+AFNHFGK L+QRMPR R+G++HVVNNDYTHW +YAIGGS
Sbjct  315   DVMLLGAQNDNHADKKMQVTVAFNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGS  374

Query  600   SHPTIICQGNRFIAPPDI-HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN  424
               PTI+  GNRFIAPP I H +E+TKR      EWK W WRS  DI+M  A+F QSG+P 
Sbjct  375   QSPTILSHGNRFIAPPHIQHYREVTKRDYAPESEWKNWNWRSDKDIFMNNAYFRQSGNPK  434

Query  423   FMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             FM  H +    +       V+ LT++AGAL+CRVG PC
Sbjct  435   FMCSHSR-QQMIKPKHGSAVSKLTKYAGALDCRVGKPC  471



>ref|XP_006826355.1| hypothetical protein AMTR_s00004p00123190 [Amborella trichopoda]
 gb|ERM93592.1| hypothetical protein AMTR_s00004p00123190 [Amborella trichopoda]
Length=479

 Score =   441 bits (1135),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 241/428 (56%), Positives = 303/428 (71%), Gaps = 27/428 (6%)
 Frame = -2

Query  1581  DEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRNDTTRH  1402
             D V   R  ++   AQ AYEP+P  +S +L H V   L              + N   R 
Sbjct  75    DSVLEARAHQSWLEAQAAYEPDPEAVSRNLTHLVHMELP-------------SGNHMRRQ  121

Query  1401  LLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVTDNA  1222
             L   +++HGPC ATNPIDRCWRC   W TNRK+LADCA+GFG +  GGK G +Y VTD +
Sbjct  122   L--GRRWHGPCVATNPIDRCWRCDQKWHTNRKKLADCAMGFGQQALGGKYGRYYVVTDPS  179

Query  1221  D-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAG  1045
             D D  NPKPGTLRHAVIQ +PLWIIF  DM IKL +EL++   KT+DGRGA VHI+ GA 
Sbjct  180   DNDLLNPKPGTLRHAVIQNEPLWIIFQRDMVIKLTEELMVNSFKTVDGRGANVHIAYGAC  239

Query  1044  ITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSM  865
             ITIQ+VKNVIIHG+HIH    GNGG+IRD  DHFG+RT+SDGDGISI+GS+NVW+DH ++
Sbjct  240   ITIQYVKNVIIHGLHIHDCKAGNGGMIRDSEDHFGIRTRSDGDGISIYGSTNVWVDHNTL  299

Query  864   RNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQ  685
               C DGL+DAI  STAITISN HF+ H++V+L G +DL   DK+MQ+T+AFNHFGK L Q
Sbjct  300   SKCQDGLVDAIMGSTAITISNNHFSKHDEVLLLGGSDLYPMDKVMQVTVAFNHFGKGLSQ  359

Query  684   RMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPE  505
             RMPRCR+GY HVVNNDYTHW  YAIGGS +PTI+ QGNRF+AP D + KEITKR  G   
Sbjct  360   RMPRCRFGYFHVVNNDYTHWGKYAIGGSMNPTILSQGNRFVAPLDPYFKEITKRF-GPDL  418

Query  504   EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTW---LTRFAGAL  334
             +W +W W+S+GD++  GA F QSG+        + Y+  ++ +A+  ++   LTRF+GAL
Sbjct  419   DWGSWNWKSEGDLFKNGAIFTQSGNG-------RKYERKISIRAKPGSYVGILTRFSGAL  471

Query  333   NCRVGSPC  310
              C+ G+PC
Sbjct  472   KCKTGTPC  479



>emb|CDX85564.1| BnaA02g02490D [Brassica napus]
Length=473

 Score =   441 bits (1134),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 252/460 (55%), Positives = 309/460 (67%), Gaps = 24/460 (5%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHE--------VRRTL  1468
               +IP    +++E DE W +R  EA E   QAY  NP+ +     HE        V+ T 
Sbjct  16    AGLIPTIRANLSELDEYWSKRAGEAREFTLQAYHSNPYEV-VDHFHERHYDNSTDVKETE  74

Query  1467  SeavaeaeaeaEDVT-------RNDTTRHLLGSKK-----YHGPCNATNPIDRCWRCHAD  1324
              ++  E   E ED          N T R L G +K       GPC A+NPID+CWRC ++
Sbjct  75    EDSDDEKPEEVEDDVIEMVGNEMNSTRRILRGKRKGKWSKLKGPCTASNPIDKCWRCRSN  134

Query  1323  WATNRKRLADCALGFGYKTKGGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIF  1147
             WA  RK L  C  GFG+ T GGK G  Y VT N D D  NPKPGTLRHAVIQK+PLWIIF
Sbjct  135   WAKRRKNLVKCVRGFGHSTIGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEPLWIIF  194

Query  1146  SHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGL  967
              +DM I+L QEL++   KTID RG  VHI+ GAGITIQFV++VIIHG+ IHHI + NGG+
Sbjct  195   KNDMHIRLSQELMICSFKTIDARGTDVHIAHGAGITIQFVRHVIIHGLRIHHICQSNGGM  254

Query  966   IRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTD  787
             IRD  DHFG+RTK+DGDGISI+GSS +W+DH+SM  C DGLIDAI  STAITISN HFT 
Sbjct  255   IRDSTDHFGMRTKADGDGISIYGSSMIWLDHISMSKCQDGLIDAIVGSTAITISNSHFTH  314

Query  786   HNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIG  607
             HNDVML GA + +  DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW +YAIG
Sbjct  315   HNDVMLLGAQNDNQGDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIG  374

Query  606   GSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGD  430
             GS  PTI+  GNRFIAPP   H +E+TKR   +  EWK W WRS  D++M GA+F QSG+
Sbjct  375   GSQAPTILSHGNRFIAPPHKPHYREVTKRDYASEHEWKHWNWRSDKDMFMNGAYFRQSGN  434

Query  429   PNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             P+F   HH     +       V+ LT++AGAL+CRVG  C
Sbjct  435   PHF-KCHHTRKQMIKPKHGIAVSMLTKYAGALDCRVGKRC  473



>gb|AAQ62997.1| oil palm polygalacturonase allergen PEST411 [Elaeis guineensis]
Length=447

 Score =   440 bits (1132),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 254/438 (58%), Positives = 300/438 (68%), Gaps = 28/438 (6%)
 Frame = -2

Query  1593  IAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRND  1414
             I E D+ W+++  EA+  ++ AY P+P  ++      V   L+E             RN 
Sbjct  28    IPELDDHWQKKAEEALARSRAAYHPDPEAVTNHFNKAVHLALAE------------ARNS  75

Query  1413  TTRHL--LGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFY  1240
             T R L  +G KK+ G C ATNPIDRCWRC  +W  +RK+LA C  GFG    GGK G+FY
Sbjct  76    TRRSLRAVGVKKFKGKCVATNPIDRCWRCQKNWIKHRKKLATCGKGFGRHATGGKAGDFY  135

Query  1239  TVTDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVH  1063
              VTD +DD   NPK GTLR  VIQ +PLWI+F+ DM I+L +EL++  +KTID RGA VH
Sbjct  136   VVTDPSDDDLVNPKFGTLRWGVIQDRPLWIVFARDMIIRLSEELMINSNKTIDARGANVH  195

Query  1062  ISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVW  883
             I+ GA ITIQFV NVIIHG+HIH I   NGG+IRD L HFGLRTKSDGDGISI+GSS+VW
Sbjct  196   IAYGAQITIQFVNNVIIHGLHIHDIKPSNGGMIRDSLHHFGLRTKSDGDGISIYGSSDVW  255

Query  882   IDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHF  703
             IDH SMRNC DGLIDAIE STAITISN HFT HNDV+LFGA+D +  D IMQ T+AFNHF
Sbjct  256   IDHCSMRNCADGLIDAIEGSTAITISNCHFTHHNDVLLFGASDSNENDSIMQATVAFNHF  315

Query  702   GKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKR  523
             GK L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS HPTII QGNRFIAPP    KE+TK 
Sbjct  316   GKGLVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSKHPTIISQGNRFIAPPLRFAKEVTKE  375

Query  522   VK----GTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTW-  358
             V      T + WK WTWRS+GD+   GAFF  S      D H K +      +A+  TW 
Sbjct  376   VTKRDYATEDVWKQWTWRSEGDLMQNGAFFA-SLVLKHKDVHRKDF-----IRAKPGTWV  429

Query  357   --LTRFAGALNCRVGSPC  310
               LTRFAG L C+ G  C
Sbjct  430   RRLTRFAGPLGCKAGRAC  447



>gb|KDO49230.1| hypothetical protein CISIN_1g036607mg [Citrus sinensis]
Length=436

 Score =   439 bits (1130),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 237/438 (54%), Positives = 309/438 (71%), Gaps = 20/438 (5%)
 Frame = -2

Query  1617  IIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeae  1438
             ++P    HIAE +EVWRRR  EA++  +Q Y+PNP  ++  L  +V+             
Sbjct  17    LMPCLSAHIAEVNEVWRRRAEEAMQTTEQYYDPNPVAVANHLNMKVQ-------------  63

Query  1437  aEDVTRNDTT-RHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKG  1261
               D+++     R LL ++   G C ATNPID+CWRC  +WA +R+ LA CALGFG K  G
Sbjct  64    --DLSKQAIAKRGLLNAES--GQCAATNPIDKCWRCKENWAEDRQALAGCALGFGSKATG  119

Query  1260  GKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GK G  Y VTD +D D  NPK GTLRHAVIQK+PLWIIF+ DM+IKL QELI+QG KTID
Sbjct  120   GKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQELIVQGSKTID  179

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
             GRGA+VHI++GAGI +QFVKNVIIHGIHIH+I   +GG+IRD +DH G R +SDGD +SI
Sbjct  180   GRGAKVHIANGAGIMLQFVKNVIIHGIHIHNISPCSGGMIRDSVDHVGKRGQSDGDAVSI  239

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FGSSN+W+DH+++   +DGLIDAI+ASTAITISN H ++H+  +L GA+D  T+DK MQ+
Sbjct  240   FGSSNIWLDHLTLSQAHDGLIDAIQASTAITISNCHLSNHDKAILLGASDTFTEDKKMQV  299

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             T+AFN F K L+QRMP  R+G+ HVVNNDY  W MYAIGG   PTI+ QGNRF A  + +
Sbjct  300   TVAFNRFDKGLVQRMPCVRFGFAHVVNNDYNQWEMYAIGGLQGPTILSQGNRFFASNNQN  359

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDV  364
              KE+TKR+  +PEE K+W WRS+GD+ + GA+F  SGDP      +++ D +      +V
Sbjct  360   AKEVTKRMNCSPEEGKSWIWRSEGDVLLNGAYFNSSGDPK-KQIQYQMDDVIKPESGTEV  418

Query  363   TWLTRFAGALNCRVGSPC  310
               +T+FAGAL C+ G  C
Sbjct  419   ERITKFAGALVCKPGQEC  436



>ref|XP_006484673.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=436

 Score =   439 bits (1130),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 236/438 (54%), Positives = 310/438 (71%), Gaps = 20/438 (5%)
 Frame = -2

Query  1617  IIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeae  1438
             ++P    HIAE +EVWRRR  EA++  +Q Y+PNP  ++  L  +V+             
Sbjct  17    LMPCLSAHIAEVNEVWRRRAEEAMQTTEQYYDPNPVAVANHLNMKVQ-------------  63

Query  1437  aEDVTRNDTT-RHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKG  1261
               D+++     R LL ++   G C ATNPID+CWRC  +WA +R+ LA CALGFG K  G
Sbjct  64    --DLSKQAIAKRGLLNAES--GQCEATNPIDKCWRCKENWAEDRQALAGCALGFGSKATG  119

Query  1260  GKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GK G  Y VTD +D D  NPK GTLRHAVIQK+PLWIIF+ DM+IKL QELI+QG KTID
Sbjct  120   GKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQELIVQGSKTID  179

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
             GRGA+VHI++GAGI +QFVKNVIIHGIHIH+I   +GG+IRD +DH G R +SDGD +SI
Sbjct  180   GRGAKVHIANGAGIMLQFVKNVIIHGIHIHNISPCSGGMIRDSVDHVGKRGQSDGDAVSI  239

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FGSSN+W+DH+++   +DGLIDAI+ASTAITISN H ++H+  +L GA+D  T+DK MQ+
Sbjct  240   FGSSNIWLDHLTLSQAHDGLIDAIQASTAITISNCHLSNHDKAILLGASDTFTEDKKMQV  299

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             T+AFN F K L+QRMP  R+G+ HVVNNDY  W MYAIGG   PTI+ QGNRF A  + +
Sbjct  300   TVAFNRFDKGLVQRMPCVRFGFAHVVNNDYNQWEMYAIGGLQGPTILSQGNRFFASNNQN  359

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDV  364
              KE+TKR+  +PEE K+W WRS+GD+++ GA+F  SGDP      +++ + +      +V
Sbjct  360   TKEVTKRMNCSPEEGKSWIWRSEGDVFLNGAYFNSSGDPK-KQIQYQMDNVIKPESGTEV  418

Query  363   TWLTRFAGALNCRVGSPC  310
               +T+FAGAL C+ G  C
Sbjct  419   ERITKFAGALVCKPGQEC  436



>ref|XP_003613595.1| Pectate lyase [Medicago truncatula]
 gb|AES96553.1| pectate lyase P59-like protein [Medicago truncatula]
Length=449

 Score =   440 bits (1131),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 251/422 (59%), Positives = 295/422 (70%), Gaps = 17/422 (4%)
 Frame = -2

Query  1572  WRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRNDTTRHLLG  1393
             W+++ + A     +AY P+P+ +S +L H V                 +  N   R+L G
Sbjct  44    WQQKASAAAMKNDKAYTPDPYAVSGNLSHSVSEM--------------IIGNQGRRNLAG  89

Query  1392  SKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVTDNAD-D  1216
              K   GPC ATNPIDRCWRC  +WA NR++LADC  GFG KT GGK G  Y VTD +D D
Sbjct  90    GKA-RGPCMATNPIDRCWRCDPNWANNRQKLADCVKGFGRKTTGGKGGPIYVVTDPSDSD  148

Query  1215  PSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITI  1036
               NP+PGTLR  V +  PLWI F+  M I+L+QELIM   KTIDGRGA V I+ GAGITI
Sbjct  149   MVNPRPGTLRFGVTRNGPLWITFARSMTIRLNQELIMTSHKTIDGRGADVTIASGAGITI  208

Query  1035  QFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNC  856
             QF++NVIIHGI I  I  G+GGLIRDG DHFG RT SDGDGISIFGSSN+WIDHVSMRNC
Sbjct  209   QFIENVIIHGIKIFDIVVGSGGLIRDGQDHFGQRTMSDGDGISIFGSSNIWIDHVSMRNC  268

Query  855   YDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMP  676
              DGL+DAI  STAITISN HFTDHN+VMLFGA+D    D+ MQIT+AFNHFGKRLIQRMP
Sbjct  269   RDGLVDAIMGSTAITISNSHFTDHNEVMLFGASDGYGGDEKMQITVAFNHFGKRLIQRMP  328

Query  675   RCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEEWK  496
             RCR+G+IHV+NNDYTHW MYAIGGS HPTII +GNRFIAP + H KEITKR       WK
Sbjct  329   RCRFGFIHVLNNDYTHWEMYAIGGSMHPTIISEGNRFIAPNNGHAKEITKREYVDESVWK  388

Query  495   TWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGS  316
             +W WRS  D+Y+ GAFF Q G P   D+     D + +     V  LTR++G+L C VG 
Sbjct  389   SWQWRSINDVYLNGAFFRQGG-PELKDRPFSRKDMIKSRPGTYVGRLTRYSGSLRCIVGK  447

Query  315   PC  310
             PC
Sbjct  448   PC  449



>ref|XP_006437462.1| hypothetical protein CICLE_v10031653mg [Citrus clementina]
 gb|ESR50702.1| hypothetical protein CICLE_v10031653mg [Citrus clementina]
Length=419

 Score =   439 bits (1128),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 237/437 (54%), Positives = 308/437 (70%), Gaps = 20/437 (5%)
 Frame = -2

Query  1614  IPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaea  1435
             +P    HIAE DEVWRRR  EA++  +Q Y+PNP  ++  L  +V+              
Sbjct  1     MPCLSAHIAEVDEVWRRRAEEAMQTTEQYYDPNPVAVANHLNMKVQ--------------  46

Query  1434  EDVTRNDTT-RHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGG  1258
              D+++     R LL ++   G C ATNPID+CWRC  +WA +R+ LA CALGFG K  GG
Sbjct  47    -DLSKQAIAKRGLLNAES--GQCEATNPIDKCWRCKENWAEDRQALAGCALGFGSKATGG  103

Query  1257  KLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDG  1081
             K G  Y VTD +D D  NPK GTLRHAVIQK+PLWIIF+ DM+IKL QELI+QG KTIDG
Sbjct  104   KGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQELIVQGSKTIDG  163

Query  1080  RGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisif  901
             RGA+VHI++GAGI +QFVKNVIIHGIHIH+I   +GG+IRD +DH G R +SDGD +SIF
Sbjct  164   RGAKVHIANGAGIMLQFVKNVIIHGIHIHNISPCSGGMIRDSVDHVGKRGQSDGDAVSIF  223

Query  900   gsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQIT  721
             GSSN+W+DH+++   +DGLIDAI+ASTAITISN H ++H+  +L GA+D  T+DK MQ+T
Sbjct  224   GSSNIWLDHLTLSQAHDGLIDAIQASTAITISNCHLSNHDKAILLGASDTFTEDKKMQVT  283

Query  720   LAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHK  541
             +AFN F K L+QRMP  R+G+ HVVNNDY  W MYAIGG   PTI+ QGNRF A  + + 
Sbjct  284   VAFNRFDKGLVQRMPCVRFGFAHVVNNDYNQWEMYAIGGLQGPTILSQGNRFFASNNQNA  343

Query  540   KEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVT  361
             KE+TKR+  +PEE K+W WRS+GD+ + GA+F  SGDP      +++ + +      +V 
Sbjct  344   KEVTKRMNCSPEEGKSWIWRSEGDVLLNGAYFNSSGDPK-KQIQYQMDNVIKPESGTEVE  402

Query  360   WLTRFAGALNCRVGSPC  310
              +T+FAGAL C+ G  C
Sbjct  403   RITKFAGALVCKPGQEC  419



>gb|ACU23277.1| unknown [Glycine max]
Length=443

 Score =   439 bits (1130),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 246/442 (56%), Positives = 295/442 (67%), Gaps = 27/442 (6%)
 Frame = -2

Query  1617  IIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeae  1438
             +IP     IAE+D+  + +  EA + A  +Y P PH+++  L   V   L          
Sbjct  23    VIPCLEAGIAEFDDFLKAQADEAHKIALDSYVPEPHDVAHELNFHVHMALE---------  73

Query  1437  aEDVTRNDTTRHLLGSKKYHG--PCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                    ++TR  L  +K  G   C A+NPID CWRC+ DWA +R RLA C  GFG +  
Sbjct  74    -------NSTRRELRQRKLRGGGKCQASNPIDACWRCNKDWANDRFRLAKCGKGFGRRAT  126

Query  1263  GGKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTI  1087
             GG  G  Y VTDN+DD   NPKPGT+RHAV QK PLWIIF H M I L QEL++  DKTI
Sbjct  127   GGLGGPIYAVTDNSDDDMVNPKPGTIRHAVTQKGPLWIIFGHSMIISLRQELMISSDKTI  186

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             DGRGA V    GAG+TIQFV NVIIHG+ I  I   +GG+IRD  DH+GLRT+SDGD IS
Sbjct  187   DGRGANVQFRGGAGLTIQFVNNVIIHGVRIKDIVPKDGGMIRDSADHYGLRTRSDGDAIS  246

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             IFGS+N+WIDHVS+ NC DGLID I+ STAITISN H T HNDV LFGA+D    DKIMQ
Sbjct  247   IFGSTNIWIDHVSLSNCADGLIDIIQGSTAITISNCHMTKHNDVFLFGASDSYNGDKIMQ  306

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             IT+AFNHFG+ L+QRMPRCR+G++HV+NNDYTHW MYAIGGSS PTI+ QGNRFIAP + 
Sbjct  307   ITVAFNHFGQGLVQRMPRCRWGFVHVLNNDYTHWLMYAIGGSSGPTILSQGNRFIAPNND  366

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED  367
             + KEIT R    P+ WK W W+S+ D++M GA FV SG P  M      Y   +  K  D
Sbjct  367   NAKEITHRDYAGPDVWKNWQWQSEMDLFMNGAKFVTSGSPIKM-----TYKKGLIMKPRD  421

Query  366   ---VTWLTRFAGALNCRVGSPC  310
                V+ LTR AGALNC VG PC
Sbjct  422   GTHVSRLTRHAGALNCFVGKPC  443



>ref|XP_003543726.1| PREDICTED: pectate lyase [Glycine max]
Length=443

 Score =   439 bits (1130),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 247/441 (56%), Positives = 294/441 (67%), Gaps = 25/441 (6%)
 Frame = -2

Query  1617  IIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeae  1438
             +IP     IAE+D+  + +  EA + A  +Y P PH+++  L   V   L          
Sbjct  23    VIPCLEAGIAEFDDFLKAQADEAHKIALDSYVPEPHDVAHELNFHVHMAL----------  72

Query  1437  aEDVTRNDTTRHLLGSK-KYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKG  1261
                   N T R L   K +  G C A+NPID CWRC+ DWA +R RLA C  GFG +  G
Sbjct  73    -----ENSTRRELRQRKLRGGGKCQASNPIDACWRCNKDWANDRFRLAKCGKGFGRRATG  127

Query  1260  GKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             G  G  Y VTDN+DD   NPKPGT+RHAV QK PLWIIF H M I L QEL++  DKTID
Sbjct  128   GLGGPIYVVTDNSDDDMVNPKPGTIRHAVTQKGPLWIIFGHSMIISLRQELMISSDKTID  187

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
             GRGA V    GAG+TIQFV NVIIHG+ I  I   +GG+IRD  DH+GLRT+SDGD ISI
Sbjct  188   GRGANVQFRGGAGLTIQFVNNVIIHGVRIKDIVPKDGGMIRDSADHYGLRTRSDGDAISI  247

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FGS+N+WIDHVS+ NC DGLID I+ STAITISN H T HNDV LFGA+D    DKIMQI
Sbjct  248   FGSTNIWIDHVSLSNCADGLIDIIQGSTAITISNCHMTKHNDVFLFGASDSYNGDKIMQI  307

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             T+AFNHFG+ L+QRMPRCR+G++HV+NNDYTHW MYAIGGSS PTI+ QGNRFIAP + +
Sbjct  308   TVAFNHFGQGLVQRMPRCRWGFVHVLNNDYTHWLMYAIGGSSGPTILSQGNRFIAPNNDN  367

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED-  367
              KEIT R    P+ WK W W+S+ D++M GA FV SG P  M      Y   +  K  D 
Sbjct  368   AKEITHRDYAGPDVWKNWQWQSEMDLFMNGAKFVTSGSPIKM-----TYKKGLIMKPRDG  422

Query  366   --VTWLTRFAGALNCRVGSPC  310
               V+ LTR AGALNC VG PC
Sbjct  423   THVSRLTRHAGALNCFVGKPC  443



>emb|CDP00293.1| unnamed protein product [Coffea canephora]
Length=445

 Score =   439 bits (1129),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 240/432 (56%), Positives = 299/432 (69%), Gaps = 22/432 (5%)
 Frame = -2

Query  1599  GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTR  1420
              HI E+D+  R+R  +A++ + +AY P+P  ++ +   +V + L                
Sbjct  34    AHIGEFDDFLRKRAEDALQASLRAYNPDPEAVTDNFTRQVGKMLEGG-------------  80

Query  1419  NDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFY  1240
             N+T R L       G C ATNPIDRCWRC  +WA NRKRLA CA GFG +TKGG  G +Y
Sbjct  81    NETRRQLKA-----GGCVATNPIDRCWRCDPNWAKNRKRLAKCARGFGRQTKGGMHGKYY  135

Query  1239  TVTDNADD-PSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVH  1063
              V D +DD   +P+PGTLRHAVIQ++PLWIIF   M IKL+QEL++  DKTIDGRG +VH
Sbjct  136   VVVDPSDDNVQDPEPGTLRHAVIQQEPLWIIFDTSMVIKLNQELLINSDKTIDGRGVEVH  195

Query  1062  ISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVW  883
             I+ GAG++IQFV+NVIIH I IHHI   NGGL+RD   H GLRT+SDGDGISIFGS++VW
Sbjct  196   IAYGAGLSIQFVQNVIIHNIKIHHIVPKNGGLVRDSTSHIGLRTRSDGDGISIFGSNHVW  255

Query  882   IDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHF  703
             IDHVS+  C DGLIDAI ASTAITISN  F +HNDV+L GA+D  ++D IMQ+T+AFN F
Sbjct  256   IDHVSLSKCSDGLIDAIMASTAITISNCKFNNHNDVILLGASDEHSEDAIMQVTVAFNRF  315

Query  702   GKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKR  523
             GK L+QRMPRCR+G+ H+VNNDY+ W MYAIGGS+HPTII QGNRF A  +   KE+TKR
Sbjct  316   GKGLVQRMPRCRWGFFHIVNNDYSQWQMYAIGGSAHPTIISQGNRFKASKNQFTKEVTKR  375

Query  522   VKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTW-LTRF  346
                   +W  W WRS+GD ++ GAFFV+SG P  + K        + FK       LTR+
Sbjct  376   DYAEKSQWMGWQWRSEGDKFLNGAFFVESGPP--LKKSPFTGKNKLQFKPGSYAGRLTRY  433

Query  345   AGALNCRVGSPC  310
             AGAL CR G PC
Sbjct  434   AGALKCREGKPC  445



>ref|XP_003613596.1| Pectate lyase [Medicago truncatula]
 gb|AES96554.1| pectate lyase P59-like protein [Medicago truncatula]
Length=449

 Score =   439 bits (1129),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 242/422 (57%), Positives = 298/422 (71%), Gaps = 17/422 (4%)
 Frame = -2

Query  1572  WRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRNDTTRHLLG  1393
             W+++ + A +   +AY P+P+ +S +L   V   +             +   +  R+L+G
Sbjct  44    WQKKASIAAKANDKAYTPDPYAVSGNLSSTVSEMI-------------IGGINGRRNLVG  90

Query  1392  SKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVTDNAD-D  1216
                 +  C ATNPIDRCWRC  +WA NRK+LADC  GFG KT GGK G  Y VTD +D D
Sbjct  91    LG--NSSCMATNPIDRCWRCDPNWANNRKKLADCVQGFGRKTTGGKDGPIYVVTDPSDSD  148

Query  1215  PSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITI  1036
               NP+PGTLRHAV +  PLWIIF+  M I+L+QELIM G+KTIDGRGA V I++GAGITI
Sbjct  149   LVNPRPGTLRHAVTRNGPLWIIFARSMKIRLNQELIMAGNKTIDGRGADVTIANGAGITI  208

Query  1035  QFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNC  856
             QF++NVIIHGI I+ I  G+GGL+RD  DH+GLRT SDGDGISIFGSS++WIDHVSMRNC
Sbjct  209   QFIENVIIHGIKIYDIMVGSGGLVRDSEDHYGLRTISDGDGISIFGSSHIWIDHVSMRNC  268

Query  855   YDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMP  676
              DGLIDAI  STAITISN HFTDHN+VMLFGA+D    D+ MQIT+ FN FGK+LIQRMP
Sbjct  269   RDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDTYDGDQKMQITVVFNRFGKKLIQRMP  328

Query  675   RCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEEWK  496
             RCR+G+IHV+NN Y  W MYAIGG+ HPTII +GN+FIAP + H KEITKR      EWK
Sbjct  329   RCRFGFIHVLNNFYNRWEMYAIGGTMHPTIISEGNKFIAPNNGHAKEITKRTLVPEAEWK  388

Query  495   TWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGS  316
             TW WRS  D+Y+ GAFF QSG    +++     D +       V  LTR++ +L CRVG 
Sbjct  389   TWQWRSINDLYLNGAFFRQSG-AELINRPFSNKDMIKAKPGSYVGRLTRYSRSLRCRVGK  447

Query  315   PC  310
             PC
Sbjct  448   PC  449



>dbj|BAK06965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   439 bits (1128),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 245/459 (53%), Positives = 306/459 (67%), Gaps = 19/459 (4%)
 Frame = -2

Query  1674  MEGFNKNNcllllvvcVGAIIPATV--GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNIS  1501
             MEGF  +  + LL+  V  +  A V   +I E+DE W+RR+ EA   A+  Y PNP  ++
Sbjct  1     MEGFQWSRPVSLLLYAVLFLSAAAVSEANIGEFDEHWQRRKLEARARAEATYHPNPIEVA  60

Query  1500  ASLIHEVRRTLSeavaeaeaeaEDVTRNDTTRHLLG-SKKYHGPCNATNPIDRCWRCHAD  1324
              SL   V R+L                + + R LLG  KK+ GPC ATNPIDRCWRC  D
Sbjct  61    NSLNRAVHRSLR-------------DESGSRRKLLGLHKKFAGPCTATNPIDRCWRCRKD  107

Query  1323  WATNRKRLADCALGFGYKTKGGKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIF  1147
             WAT+R RLA CA GFG    GG  G  Y VTD  DD    P+PGTLR  VIQ +PLWIIF
Sbjct  108   WATDRMRLARCAQGFGRNATGGLGGKIYIVTDGTDDDVLEPRPGTLRWGVIQNEPLWIIF  167

Query  1146  SHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGL  967
             +  M IKL +EL++  DKTIDGRGAQV I+DGA +T+Q+  NVIIH IH++ +  G GG 
Sbjct  168   ARPMLIKLKEELLVGSDKTIDGRGAQVRIADGAQVTVQYSHNVIIHNIHVNDLIVGKGGR  227

Query  966   IRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTD  787
             IRD   H G RT+SDGDG+S+FGS+NVW+DH+S+  C DGLID I  +T +TISN H T+
Sbjct  228   IRDSPQHAGFRTQSDGDGVSVFGSTNVWLDHLSLATCQDGLIDVIAEATGVTISNCHLTN  287

Query  786   HNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIG  607
             HNDVMLFG++D + KD+IMQ+T+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIG
Sbjct  288   HNDVMLFGSSDSNPKDQIMQVTVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIG  347

Query  606   GSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDP  427
             GS +PTII QGNR+IAPP++  K ITKR+  +  EWK W W SQ D+ +  A F  SG  
Sbjct  348   GSKNPTIISQGNRYIAPPNLAAKLITKRLGASEAEWKNWVWHSQDDLLLNDAVFADSGGA  407

Query  426   NFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             N  ++     D +       VT LTRFAG L C+ G PC
Sbjct  408   N--ERKFDKDDLITPKPGSYVTRLTRFAGCLPCKPGKPC  444



>emb|CDY68729.1| BnaCnng60280D [Brassica napus]
Length=458

 Score =   439 bits (1129),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 244/445 (55%), Positives = 302/445 (68%), Gaps = 14/445 (3%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               + P    ++A +D  W +R+ +A++    +++PNP N++  L + V   +    +   
Sbjct  21    ATLTPHVGANVAVFDNYWLQRQGDALKQTIASFDPNPLNVTDHLNYHVALAVGATESI--  78

Query  1443  aeaEDVTRNDTTRHLLGSK-KYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKT  1267
                 + TR + ++   G K K  G C A NPIDRCWRCH DW  NRK+LADC LGFG +T
Sbjct  79    ----NSTRRELSQVRNGRKLKRSGKCVAYNPIDRCWRCHGDWEKNRKKLADCVLGFGRRT  134

Query  1266  KGGKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKT  1090
              GGK G  Y V D +DD   NPKPGTLRHAV +  PLWIIF   M I L QELI+  DKT
Sbjct  135   TGGKDGPIYVVNDASDDDLINPKPGTLRHAVTRDGPLWIIFGSSMIINLQQELIITSDKT  194

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             IDGRGA+V+I +GAG+T+QFV NVIIH I+I H+   +GGLIRD   H GLRT SDGDGI
Sbjct  195   IDGRGARVYIMEGAGLTLQFVNNVIIHNIYIKHVVPKSGGLIRDSEQHIGLRTVSDGDGI  254

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             S+FG++NVWIDHVSM  C DG+IDAI  STAITISN HFTDH +VMLFGAND    DK M
Sbjct  255   SLFGATNVWIDHVSMTRCSDGMIDAILGSTAITISNSHFTDHEEVMLFGANDKHVIDKKM  314

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             QIT+AFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+ +PTII QGNRFIAPP+
Sbjct  315   QITVAFNHFGKRLDQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPN  374

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSG-----DPNFMDKHHKLYDGVM  385
                K+ITKR      +WK W W+S+GD ++ GA+FVQSG      P  ++   + +  + 
Sbjct  375   EQAKQITKREYTPYVDWKMWNWQSEGDYFLNGAYFVQSGKQNAWSPKPVNPVPRKF-AIR  433

Query  384   TFKAEDVTWLTRFAGALNCRVGSPC  310
                   V  LT  AGAL C+ G+PC
Sbjct  434   PQPGTMVRKLTMDAGALGCKPGTPC  458



>gb|KFK43687.1| hypothetical protein AALP_AA1G160000 [Arabis alpina]
Length=460

 Score =   438 bits (1127),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 242/442 (55%), Positives = 300/442 (68%), Gaps = 14/442 (3%)
 Frame = -2

Query  1611  PATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaE  1432
             P +  H+A +D  W +R+ +A+     +Y+PNP N++    H V   +    +       
Sbjct  25    PESRAHVAVFDNYWTQRQTDALRQTMNSYDPNPLNVTDHFNHHVSLAMDATESN------  78

Query  1431  DVTRNDTTRHLLGSKKYH---GPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKG  1261
             + TR + T+     +K H   G C A N ID+CWRC  +WA NRK+L DC LGFG KT G
Sbjct  79    NGTRRELTQVRKSGRKIHKSSGKCLAYNAIDKCWRCDRNWAKNRKKLTDCVLGFGRKTTG  138

Query  1260  GKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GK G  Y V D +D D  NPKPGTLR+AV +  PLWIIF+  M IKL QEL++  DKTID
Sbjct  139   GKDGPIYVVNDASDNDLVNPKPGTLRYAVTRDGPLWIIFARSMIIKLQQELMITSDKTID  198

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
             GRGA+++I +GAG+T+Q+V NVIIH I++ HI  GNGGLIRD   H GLRTKSDGDGIS+
Sbjct  199   GRGARIYIMEGAGLTLQYVNNVIIHNIYVKHIVPGNGGLIRDSEHHLGLRTKSDGDGISL  258

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FG++NVWIDHVSM  C DG+IDAI+ STA+TISN HFTDH +VMLFGA D    DK MQI
Sbjct  259   FGATNVWIDHVSMTRCADGMIDAIQGSTAVTISNSHFTDHQEVMLFGARDEDVIDKKMQI  318

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             T+AFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+ +PTII QGNRFIAPP+  
Sbjct  319   TVAFNHFGKRLEQRMPRCRFGLIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQ  378

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN-FMDKHHKLYDGVMTFKAED  367
              K+ITKR      EWK+W W+S+GD ++ GA+FVQSG  N +  K           + + 
Sbjct  379   AKQITKREYTPFIEWKSWNWQSEGDYFLNGAYFVQSGKANAWSPKPVNPLPNKFRIRPKP  438

Query  366   VTW---LTRFAGALNCRVGSPC  310
              T    LT  AGAL C+ G  C
Sbjct  439   GTMVRKLTMDAGALGCKHGKAC  460



>gb|KHN13490.1| Putative pectate lyase 3, partial [Glycine soja]
Length=364

 Score =   435 bits (1118),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 236/364 (65%), Positives = 267/364 (73%), Gaps = 3/364 (1%)
 Frame = -2

Query  1395  GSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVTDNADD  1216
             G  +  GPC ATNPIDRCWRC  +WA NR++LADC  GFG  T GGK G FY VTD +DD
Sbjct  2     GKYRGDGPCIATNPIDRCWRCDPNWANNRQKLADCVQGFGRNTVGGKGGPFYVVTDPSDD  61

Query  1215  PS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAGIT  1039
                NPKPGTLRHAV +  PLWIIF+  M I L QELIM  +KTIDGRG  V+I+ GAGIT
Sbjct  62    DMVNPKPGTLRHAVTRDGPLWIIFARSMFITLQQELIMNSNKTIDGRGVDVYIAKGAGIT  121

Query  1038  IQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRN  859
             +QFVKN+IIHGI +  I    GG+IRD   H+G RTKSDGDGISIFGSSN+WIDHVSMRN
Sbjct  122   VQFVKNIIIHGIKVFDIVIREGGMIRDSETHYGFRTKSDGDGISIFGSSNIWIDHVSMRN  181

Query  858   CYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRM  679
             C DGLIDAI  STAITISN HFTDHN+VMLFGA+D  + DKIMQITLAFNHFGKRL+QRM
Sbjct  182   CSDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDSYSDDKIMQITLAFNHFGKRLVQRM  241

Query  678   PRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPEEW  499
             PR RYG++H VNNDYTHW MYAIGGS +PTII +GNRFIAP +   K+ITKR       W
Sbjct  242   PRVRYGFVHSVNNDYTHWEMYAIGGSKNPTIISEGNRFIAPDNQFAKQITKREYAPENVW  301

Query  498   KTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAG-ALNCRV  322
               W WRS  D+YM GAFFVQSG P    +     D +       V  LTR++G  L CRV
Sbjct  302   ANWQWRSINDVYMNGAFFVQSG-PELASRPFSREDMITAKVGNYVGRLTRYSGNLLKCRV  360

Query  321   GSPC  310
             G PC
Sbjct  361   GRPC  364



>gb|KFK33456.1| hypothetical protein AALP_AA5G015800 [Arabis alpina]
Length=460

 Score =   438 bits (1126),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 250/448 (56%), Positives = 300/448 (67%), Gaps = 22/448 (5%)
 Frame = -2

Query  1617  IIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeae  1438
             I P+   HIA YDE W +R+ EA+    ++YEP+P N++    +     +    A     
Sbjct  23    IAPSVQAHIAVYDEYWTQRQTEALRRTLESYEPDPLNVTDHFNYHSALAMETTEAV----  78

Query  1437  aEDVTRNDTTRHL--LGS-----KKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGF  1279
                   N T R L  +G      KK  G   + N ID+CWR   +WA NRK+LADC LGF
Sbjct  79    ------NGTRRELRVVGGGRKTIKKRGGRFQSLNAIDKCWRGDKNWAKNRKKLADCVLGF  132

Query  1278  GYKTKGGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQ  1102
             G KT GGK G  Y VTD +D D  NP+PGTLRHAV + +PLWIIF+  M IKL QELI+ 
Sbjct  133   GRKTTGGKAGPIYEVTDASDNDVMNPRPGTLRHAVTRDRPLWIIFAKSMVIKLQQELIIT  192

Query  1101  GDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsd  922
              DKTIDGRG  VHI+ GAG+TIQFVKNVIIH IH+  I    GG+IRD  +HFGLRT+SD
Sbjct  193   NDKTIDGRGVSVHITGGAGLTIQFVKNVIIHNIHMKFIERRAGGMIRDSENHFGLRTESD  252

Query  921   gdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTK  742
             GDGI+IFG++NVWIDHVSMRNC DG+IDAI  STAITISN HFTDH +VMLFGA +    
Sbjct  253   GDGINIFGATNVWIDHVSMRNCSDGMIDAIMGSTAITISNCHFTDHEEVMLFGAKNGDVI  312

Query  741   DKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFI  562
             DK MQIT+AFNHFGKRL QRMPR RYG +HVVNNDYTHW MYAIGG+ +PTII QGNRFI
Sbjct  313   DKKMQITVAFNHFGKRLDQRMPRVRYGMVHVVNNDYTHWQMYAIGGNMNPTIISQGNRFI  372

Query  561   APPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK-LYDGVM  385
             APP+  KK+ITKR      EWK+W W+S+ D ++ GA+FVQSG  N      K       
Sbjct  373   APPEEDKKQITKREYTPYPEWKSWNWQSERDYFLNGAYFVQSGKSNAWSSTPKNPIPRKF  432

Query  384   TFKAE---DVTWLTRFAGALNCRVGSPC  310
             T + +    V  LT+ AG L C+ G  C
Sbjct  433   TIRPQPGTKVRRLTKDAGTLGCKPGKSC  460



>ref|XP_010420163.1| PREDICTED: probable pectate lyase 19 isoform X1 [Camelina sativa]
Length=499

 Score =   439 bits (1129),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 250/485 (52%), Positives = 308/485 (64%), Gaps = 48/485 (10%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAY---------------------------  1525
               +IP   G+I+E DE W RR  EA E   QAY                           
Sbjct  16    AGLIPTIRGNISELDEYWSRRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTDATETEE  75

Query  1524  -------------EPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRNDTTRHLLGS--  1390
                          +P   +  A L  E      E   E   +    +   T R L G   
Sbjct  76    DGAVQLEEEHGGAQPEEEHSGAQLEEEHGGAKPEEEEEEGIKMVGNSTKSTRRSLRGKGK  135

Query  1389  ---KKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVTDNAD  1219
                 K  GPC A+NPID+CWRC  +WA  RK+L  C  GFG++T GGK G  Y VT N D
Sbjct  136   GKWSKLKGPCTASNPIDKCWRCRTNWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLD  195

Query  1218  -DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAGI  1042
              D  NPKPGTLRHAVIQK+PLWIIF +DM I+L QEL++   KTID RGA VHI+ GAGI
Sbjct  196   EDMVNPKPGTLRHAVIQKEPLWIIFKNDMSIRLSQELLINSHKTIDARGANVHIAHGAGI  255

Query  1041  TIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMR  862
             T+QFVKNVIIHG+HIHHI E +GG+IRD +DHFG+RT++DGDG+SI+GSSN+W+DH+SM 
Sbjct  256   TMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISMS  315

Query  861   NCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQR  682
              C DGLIDAI  ST ITISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK L+QR
Sbjct  316   KCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQR  375

Query  681   MPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPE  505
             MPR R+G++HVVNNDYTHW +YAIGGS  PTI+  GNRFIAPP   H +E+TKR     +
Sbjct  376   MPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYAPED  435

Query  504   EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCR  325
             EWK W WRS+ D++M GA+F QSG+P+F   H +    +       V+ LT++AGAL+CR
Sbjct  436   EWKHWIWRSEKDVFMNGAYFRQSGNPHFKCAHTR-KQMIKPKNGMAVSKLTKYAGALDCR  494

Query  324   VGSPC  310
             VG  C
Sbjct  495   VGKRC  499



>emb|CDX96854.1| BnaA08g23970D [Brassica napus]
Length=458

 Score =   437 bits (1125),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 243/445 (55%), Positives = 302/445 (68%), Gaps = 14/445 (3%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               + P    ++A +D  W +R+ +A++    +++PNP N++  L + V   +    +   
Sbjct  21    ATLTPHVGANVAVFDNYWLQRQGDALKQTIASFDPNPLNVTDHLNYHVALAVDATESI--  78

Query  1443  aeaEDVTRNDTTRHLLGSK-KYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKT  1267
                 + TR + ++   G K K  G C A NPIDRCWRC+ DW  NRK+LADC LGFG +T
Sbjct  79    ----NSTRRELSQVRNGRKLKRSGKCVAYNPIDRCWRCNGDWEKNRKKLADCVLGFGRRT  134

Query  1266  KGGKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKT  1090
              GGK G  Y V D +DD   NPKPGTLRHAV +  PLWIIF   M I L QELI+  DKT
Sbjct  135   TGGKDGPIYVVNDASDDDLINPKPGTLRHAVTRDGPLWIIFGSSMIINLQQELIITSDKT  194

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             IDGRGA+V+I +GAG+T+QFV NVIIH I++ H+   +GGLIRD   H GLRT SDGDGI
Sbjct  195   IDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKHVVPKSGGLIRDSEQHIGLRTVSDGDGI  254

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             S+FG++NVWIDHVSM  C DG+IDAI  STAITISN HFTDH +VMLFGAND    DK M
Sbjct  255   SLFGATNVWIDHVSMTRCSDGMIDAILGSTAITISNSHFTDHEEVMLFGANDKHVIDKKM  314

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             QIT+AFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+ +PTII QGNRFIAPP+
Sbjct  315   QITVAFNHFGKRLDQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPN  374

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSG-----DPNFMDKHHKLYDGVM  385
                K+ITKR      +WK W W+S+GD ++ GA+FVQSG      P  ++   K +  + 
Sbjct  375   EQAKQITKREYTPYVDWKMWNWQSEGDYFLNGAYFVQSGKQNAWSPKPVNPVPKKF-AIR  433

Query  384   TFKAEDVTWLTRFAGALNCRVGSPC  310
                   V  LT  AGAL C+ G+PC
Sbjct  434   PQPGTMVRKLTMDAGALGCKPGTPC  458



>ref|XP_006656188.1| PREDICTED: pectate lyase-like [Oryza brachyantha]
Length=446

 Score =   437 bits (1123),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 236/433 (55%), Positives = 298/433 (69%), Gaps = 19/433 (4%)
 Frame = -2

Query  1599  GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTR  1420
              +I +YDE W++R+  A   A+  Y+ +P  ++      V R+                +
Sbjct  30    ANIGDYDEHWQKRKLMADAAAEATYKRDPFEVTNDFNRAVHRSEE--------------K  75

Query  1419  NDTTRHLLGSK--KYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGN  1246
                 R L+ SK  K+ GPC ATNPIDRCWRC  DWAT+RKRLA CA GFG  T GG  G 
Sbjct  76    ETARRSLMLSKRKKFAGPCKATNPIDRCWRCRDDWATDRKRLARCAQGFGRNTTGGLAGK  135

Query  1245  FYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQ  1069
             FY VTD  DD   NP+PGTLR  VIQ +PLWIIF  +M I L +EL++  DKT+DGRGAQ
Sbjct  136   FYVVTDGTDDDVVNPRPGTLRWGVIQDEPLWIIFGKNMIINLKEELMIGNDKTVDGRGAQ  195

Query  1068  VHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSN  889
             V I++GA +T+Q   NVIIH IH+H I  G GG+IRD  +HFG RT+SDGDGI+IFGS+N
Sbjct  196   VRITNGAQVTVQNSNNVIIHNIHVHDIVLGKGGMIRDSPEHFGFRTQSDGDGITIFGSTN  255

Query  888   VWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFN  709
             VW+DH+S+ NC DGLID I  ST +TISN H T+HNDVMLFG++D  ++D+IMQIT+AFN
Sbjct  256   VWLDHLSLSNCQDGLIDVIAKSTGVTISNCHLTNHNDVMLFGSSDSFSEDQIMQITVAFN  315

Query  708   HFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEIT  529
             HFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS +PTII QGNR+IAPP++  K+IT
Sbjct  316   HFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKNPTIISQGNRYIAPPNLAAKQIT  375

Query  528   KRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTR  349
             K++     EWK W W S+ D++MEGA+F  SG       + K  D +       VT LTR
Sbjct  376   KQLGAEESEWKNWVWHSEEDLFMEGAYFTTSGGAIRTSINKK--DLIKPKPGSYVTRLTR  433

Query  348   FAGALNCRVGSPC  310
             FAG++ CR G PC
Sbjct  434   FAGSIPCRPGKPC  446



>ref|XP_009134622.1| PREDICTED: probable pectate lyase 7 [Brassica rapa]
Length=471

 Score =   437 bits (1125),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 240/458 (52%), Positives = 304/458 (66%), Gaps = 22/458 (5%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHE--------VRRTL  1468
              ++IP    ++AE D+ W +   EA +    AY P+P+ I     HE        V  T 
Sbjct  16    ASLIPTLRANVAETDDYWVKMANEARKRTLMAYHPDPYQI-VDHFHERHYDNSTDVEETE  74

Query  1467  SeavaeaeaeaEDVTRNDTTRHLLGS----------KKYHGPCNATNPIDRCWRCHADWA  1318
               A  E +      +  ++TR  L             K  GPC A+NPID+CWRC  DWA
Sbjct  75    EHASEEEDDIEMSSSLTNSTRRSLRGRGKGKGRGKWSKLKGPCTASNPIDKCWRCQPDWA  134

Query  1317  TNRKRLADCALGFGYKTKGGKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSH  1141
               RK+L  C  GFGY+T GGK G  Y VT N DD + NP+PGTLRHAVIQ +PLWIIF H
Sbjct  135   RRRKKLVKCVRGFGYRTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQNEPLWIIFKH  194

Query  1140  DMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIR  961
             DM I+L QEL++   KTID RG  VHI+ GAGIT+Q+V+N+IIHG+H+HHI  G+GG+IR
Sbjct  195   DMSIRLSQELMINSHKTIDARGTNVHIAYGAGITMQYVRNIIIHGLHVHHIVPGSGGMIR  254

Query  960   DGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHN  781
             +  DHFG R ++DGDGIS+FG++N+W+DH+SM  C DGLIDAI  S  IT+SN HFT HN
Sbjct  255   NSNDHFGFRGQADGDGISLFGATNIWLDHISMSKCQDGLIDAIMGSPGITLSNSHFTHHN  314

Query  780   DVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGS  601
             DVML GA + +  DK MQ+T+AFNHFGK L+QRMPR R+G++HVVNNDYTHW +YAIGGS
Sbjct  315   DVMLLGAQNDNHADKKMQVTVAFNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGS  374

Query  600   SHPTIICQGNRFIAPPDI-HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN  424
               PTI+  GNRFIAPP + H +E+TKR      EWK W WRS  DI+M  A+F QSG+P 
Sbjct  375   QSPTILSHGNRFIAPPHLQHYREVTKRDYAPESEWKNWNWRSDKDIFMNNAYFRQSGNPK  434

Query  423   FMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             FM  H +    +       V+ LT++AGAL+CRVG PC
Sbjct  435   FMCSHSR-QQMIKPKHGSAVSTLTKYAGALDCRVGKPC  471



>ref|XP_009110541.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=458

 Score =   437 bits (1124),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 243/445 (55%), Positives = 301/445 (68%), Gaps = 14/445 (3%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               + P    ++A +D  W +R+ +A++    +++PNP N++  L + V   +    +   
Sbjct  21    ATLTPHVGANVAVFDNYWLQRQGDALKQTIASFDPNPLNVTDHLNYHVALAVDATEST--  78

Query  1443  aeaEDVTRNDTTRHLLGSK-KYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKT  1267
                 + TR + ++   G K K  G C A NPIDRCWRC+ DW  NRK+LADC LGFG +T
Sbjct  79    ----NSTRRELSQVRNGRKLKRSGKCVAYNPIDRCWRCNGDWEKNRKKLADCVLGFGRRT  134

Query  1266  KGGKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKT  1090
              GGK G  Y V D +DD   NPKPGTLRHAV +  PLWIIF   M I L QELI+  DKT
Sbjct  135   TGGKDGPIYVVNDASDDDLINPKPGTLRHAVTRDGPLWIIFGSSMIINLQQELIITSDKT  194

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             IDGRGA+V+I +GAG+T+QFV NVIIH I++ H+   +GGLIRD   H GLRT SDGDGI
Sbjct  195   IDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKHVVPKSGGLIRDSEQHIGLRTVSDGDGI  254

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             S+FG++NVWIDHVSM  C DG+IDAI  STAITISN HFTDH +VMLFGAND    DK M
Sbjct  255   SLFGATNVWIDHVSMTRCSDGMIDAILGSTAITISNSHFTDHEEVMLFGANDKHVIDKKM  314

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             QIT+AFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+ +PTII QGNRFIAPP+
Sbjct  315   QITVAFNHFGKRLDQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPN  374

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSG-----DPNFMDKHHKLYDGVM  385
                K+ITKR       WK W W+S+GD ++ GA+FVQSG      P  ++   K +  + 
Sbjct  375   EQAKQITKREYTPYVNWKMWNWQSEGDYFLNGAYFVQSGKQNAWSPKPINPVPKKF-AIR  433

Query  384   TFKAEDVTWLTRFAGALNCRVGSPC  310
                   V  LT  AGAL C+ G+PC
Sbjct  434   PQPGTMVRKLTMDAGALGCKPGTPC  458



>ref|NP_186776.1| putative pectate lyase 7 [Arabidopsis thaliana]
 sp|Q9SRH4.1|PLY7_ARATH RecName: Full=Probable pectate lyase 7; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF03499.1|AC010676_9 putative pectate lyase [Arabidopsis thaliana]
 gb|AAF26147.1|AC008261_4 putative pectate lyase [Arabidopsis thaliana]
 gb|ABI93918.1| At3g01270 [Arabidopsis thaliana]
 gb|AEE73631.1| putative pectate lyase 7 [Arabidopsis thaliana]
Length=475

 Score =   437 bits (1125),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 246/462 (53%), Positives = 308/462 (67%), Gaps = 26/462 (6%)
 Frame = -2

Query  1623  GAIIPATVGHIA-EYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSe-----  1462
              ++IP    ++A E DE W  +  EA +H   AY P+P+ I     HE     S      
Sbjct  16    ASLIPTIRANVADETDEYWVNKANEARKHTLMAYHPDPYEI-VDHFHERHYDNSTDVEGT  74

Query  1461  -avaeaeaeaEDVTR------NDTTRHLLGS---------KKYHGPCNATNPIDRCWRCH  1330
                    +E EDV        N T R L G           K  GPC A+NPID+CWRC 
Sbjct  75    EEEKAVASEEEDVIEMISSPTNSTRRSLTGRGKGKGKGKWSKLTGPCTASNPIDKCWRCQ  134

Query  1329  ADWATNRKRLADCALGFGYKTKGGKLGNFYTVTD-NADDPSNPKPGTLRHAVIQKKPLWI  1153
              DWA  RK+L  C  GFGY+T GGK G  Y VT    DD  NP+PGTLRHAVIQK+PLWI
Sbjct  135   PDWARRRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDMVNPRPGTLRHAVIQKEPLWI  194

Query  1152  IFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNG  973
             +F HDM I+L QEL++  DKTID RGA VHI+ GAGIT+Q+V N+IIHG+H+HHI + +G
Sbjct  195   VFKHDMSIRLSQELMITSDKTIDARGANVHIAYGAGITMQYVHNIIIHGLHVHHIVKSSG  254

Query  972   GLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHF  793
             GLIRD ++HFG R ++DGDGISIFG++N+W+DH+SM  C DGLIDAI  STAITISN HF
Sbjct  255   GLIRDSINHFGHRGEADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTAITISNSHF  314

Query  792   TDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYA  613
             T HNDVML GA + +  DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW +YA
Sbjct  315   THHNDVMLLGAQNNNMDDKKMQVTVAYNHFGKGLVQRMPRVRWGFVHVVNNDYTHWELYA  374

Query  612   IGGSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQS  436
             IGGS  PTI+  GNRFIAPP   H +E+TKR   +  EWK W WRS+ D++M  A+F QS
Sbjct  375   IGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYASESEWKNWNWRSEKDVFMNNAYFRQS  434

Query  435   GDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             G+P+F   H +    +       V+ LT++AGAL+CRVG  C
Sbjct  435   GNPHFKCSHSR-QQMIKPKNGMAVSKLTKYAGALDCRVGKAC  475



>ref|XP_010514040.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   437 bits (1123),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 239/443 (54%), Positives = 295/443 (67%), Gaps = 11/443 (2%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               ++P    H+AEYDE W +R+ EA+    ++Y+P P N++    +     +        
Sbjct  17    AVVVPTVHAHVAEYDEYWTQRQTEALHQTLESYDPEPLNVTDHFNYHAALAMETTGIA--  74

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                 + TR D  +   G K+  G   + N ID+CWR   +W  NRK+LADC LGFG KT 
Sbjct  75    ----NETRRDLRQVKSGKKRRGGRYESLNAIDKCWRGDKNWDKNRKKLADCVLGFGRKTT  130

Query  1263  GGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTI  1087
             GGK G  Y VTD +D D  NPKPGTLRHAV + +PLWIIF+  M IKL QELI+  DKTI
Sbjct  131   GGKNGPIYVVTDPSDNDLLNPKPGTLRHAVTRDRPLWIIFARHMIIKLQQELIITNDKTI  190

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             DGRG  V+I+ GAG+T+Q+V+NVIIH I+I  I +G GGLIRD   HFGLRT SDGDGIS
Sbjct  191   DGRGVSVYITGGAGLTLQYVRNVIIHNIYIKQIKKGPGGLIRDSEHHFGLRTMSDGDGIS  250

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             IFG++N+WIDHVSM +C DG+IDAI  STAITISN HFTDH++VMLFG  +    DK MQ
Sbjct  251   IFGATNIWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGKNTDVIDKKMQ  310

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             IT+AFNHFGKRL QRMPR RYG +HVVNNDYTHW MYAIGG+ +PTII QGNRFIAPP+ 
Sbjct  311   ITVAFNHFGKRLKQRMPRARYGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNE  370

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK----LYDGVMTF  379
               K++TKR      EWKTW W+S+ D ++ GA+FVQSG  N      K        +   
Sbjct  371   DSKQVTKREYTPYPEWKTWNWQSEKDYFLNGAYFVQSGKANAWSTAPKNPIPRKFAIRPQ  430

Query  378   KAEDVTWLTRFAGALNCRVGSPC  310
                 V  LT+ AGAL C+ G  C
Sbjct  431   PGTKVRRLTKDAGALGCKAGKSC  453



>ref|XP_009126031.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
Length=481

 Score =   438 bits (1126),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 251/468 (54%), Positives = 310/468 (66%), Gaps = 32/468 (7%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHE--------VRRTL  1468
               +IP    +++E DE W +R  EA E   QAY  NP+ +     HE        V+ T 
Sbjct  16    AGLIPTIRANLSELDEYWSKRAGEAREFTLQAYHSNPYEV-VDHFHERHYDNSTDVKETE  74

Query  1467  SeavaeaeaeaEDVT------RNDTTRHLLGS--------------KKYHGPCNATNPID  1348
              ++  E   E ED          ++TR +L                 K  GPC A+NPID
Sbjct  75    EDSDDEKPEEVEDDVIEMVGNEMNSTRRILRGKPKGKGKGKRKGKWSKLKGPCTASNPID  134

Query  1347  RCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQ  1171
             +CWRC ++WA  RK L  C  GFG+ T GGK G  Y VT N D D  NPKPGTLRHAVIQ
Sbjct  135   KCWRCRSNWAKRRKNLVKCVRGFGHSTIGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQ  194

Query  1170  KKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihh  991
             K+PLWIIF +DM I+L QEL++   KTID RGA VHI+ GAGITIQFV++VIIHG+ IHH
Sbjct  195   KEPLWIIFKNDMHIRLSQELMICSFKTIDARGADVHIAHGAGITIQFVRHVIIHGLRIHH  254

Query  990   IFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAIT  811
             I + NGG+IRD  DHFG+RTK+DGDGISI+GSS +W+DH+SM  C DGLIDAI  STAIT
Sbjct  255   ICQSNGGMIRDSTDHFGMRTKADGDGISIYGSSMIWLDHISMSKCQDGLIDAIVGSTAIT  314

Query  810   ISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYT  631
             ISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYT
Sbjct  315   ISNSHFTHHNDVMLLGAQNDNQGDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYT  374

Query  630   HWNMYAIGGSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEG  454
             HW +YAIGGS  PTI+  GNRFIAPP   H +E+TKR   +  EWK W WRS  D++M G
Sbjct  375   HWELYAIGGSQAPTILSHGNRFIAPPHKPHYREVTKRDYASEHEWKHWNWRSDKDMFMNG  434

Query  453   AFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             A+F QSG+P+F   HH     +       V+ LT++AGAL+CRVG  C
Sbjct  435   AYFRQSGNPHF-KCHHTRKQMIKPKHGIAVSMLTKYAGALDCRVGKRC  481



>emb|CDY28691.1| BnaCnng05770D [Brassica napus]
Length=469

 Score =   437 bits (1124),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 245/458 (53%), Positives = 302/458 (66%), Gaps = 22/458 (5%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHE--------VRRTL  1468
              ++IP    ++AE DE W  +  EA      AY P+P+ I     HE        V    
Sbjct  14    ASLIPTLRANVAETDEYWVTKANEARRRTLMAYHPDPYQI-VDHFHERHYDNSTDVEEME  72

Query  1467  SeavaeaeaeaEDVTRNDTTRHLLGS----------KKYHGPCNATNPIDRCWRCHADWA  1318
               A  E +      +  ++TR  L             K  GPC A+NPID+CWRC  DWA
Sbjct  73    ENASEEEDDIEMISSATNSTRRSLRGRGKGKGRGKWSKLKGPCTASNPIDKCWRCQPDWA  132

Query  1317  TNRKRLADCALGFGYKTKGGKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSH  1141
               RK+L  C  GFGYKT GGK G  Y VT N DD + NP+PGTLRHAVIQ +PLWIIF H
Sbjct  133   RRRKKLVKCVRGFGYKTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQNEPLWIIFKH  192

Query  1140  DMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIR  961
             DM I+L QEL++   KTID RG  VHI+ GAGIT+Q+V N+IIHG+HIHHI +G GG+IR
Sbjct  193   DMSIRLCQELMINSHKTIDARGTNVHIAYGAGITMQYVHNIIIHGLHIHHIVQGRGGMIR  252

Query  960   DGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHN  781
             +  DHFG R  +DGDGISIFG++N+W+DH+SM  C DGLIDAI  ST ITISN HFT HN
Sbjct  253   NSNDHFGFRGVADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTGITISNSHFTHHN  312

Query  780   DVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGS  601
             DVML GA + +  DK MQ+T+AFNHFGK L+QRMPR R+G++HVVNNDYTHW +YAIGGS
Sbjct  313   DVMLLGAQNDNHADKKMQVTVAFNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGS  372

Query  600   SHPTIICQGNRFIAPPDI-HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN  424
               PTI+  GNRFIAPP + H +E+TKR      EWK W WRS+ DI+M  A+F QSG+P 
Sbjct  373   QSPTILSHGNRFIAPPHLQHYREVTKRDSAPESEWKNWNWRSEKDIFMNNAYFRQSGNPK  432

Query  423   FMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             FM  H +    +       V+ LT++AGAL+CRVG PC
Sbjct  433   FMCSHSR-QQMIKPKHGVAVSKLTKYAGALDCRVGKPC  469



>gb|AAM60924.1| putative pectate lyase [Arabidopsis thaliana]
Length=475

 Score =   437 bits (1125),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 246/462 (53%), Positives = 308/462 (67%), Gaps = 26/462 (6%)
 Frame = -2

Query  1623  GAIIPATVGHIAE-YDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSe-----  1462
              ++IP    ++AE  DE W  +  EA +H   AY P+P+ I     HE     S      
Sbjct  16    ASLIPTIRANVAEETDEYWVNKANEARKHTLMAYHPDPYEI-VDHFHERHYDNSTDVEGT  74

Query  1461  -avaeaeaeaEDVTR------NDTTRHLLGS---------KKYHGPCNATNPIDRCWRCH  1330
                    +E EDV        N T R L G           K  GPC A+NPID+CWRC 
Sbjct  75    EEEKAIASEEEDVIEMISSPTNSTRRSLTGRGKGKGKGKWSKLTGPCTASNPIDKCWRCQ  134

Query  1329  ADWATNRKRLADCALGFGYKTKGGKLGNFYTVTD-NADDPSNPKPGTLRHAVIQKKPLWI  1153
              DWA  RK+L  C  GFGY+T GGK G  Y VT    DD  NP+PGTLRHAVIQK+PLWI
Sbjct  135   PDWARRRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDMVNPRPGTLRHAVIQKEPLWI  194

Query  1152  IFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNG  973
             +F HDM I+L QEL++  DKTID RGA VHI+ GAGIT+Q+V N+IIHG+H+HHI + +G
Sbjct  195   VFKHDMSIRLSQELMITSDKTIDARGANVHIAYGAGITMQYVHNIIIHGLHVHHIVKSSG  254

Query  972   GLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHF  793
             GLIRD ++HFG R ++DGDGISIFG++N+W+DH+SM  C DGLIDAI  STAITISN HF
Sbjct  255   GLIRDSINHFGHRGEADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTAITISNSHF  314

Query  792   TDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYA  613
             T HNDVML GA + +  DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW +YA
Sbjct  315   THHNDVMLLGAQNNNMDDKKMQVTVAYNHFGKGLVQRMPRVRWGFVHVVNNDYTHWELYA  374

Query  612   IGGSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQS  436
             IGGS  PTI+  GNRFIAPP   H +E+TKR   +  EWK W WRS+ D++M  A+F QS
Sbjct  375   IGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYASESEWKNWNWRSEKDVFMNNAYFRQS  434

Query  435   GDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             G+P+F   H +    +       V+ LT++AGAL+CRVG  C
Sbjct  435   GNPHFKCSHSR-QQMIKPKNGMAVSKLTKYAGALDCRVGKAC  475



>ref|XP_009125036.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 7 [Brassica 
rapa]
Length=470

 Score =   437 bits (1124),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 249/459 (54%), Positives = 301/459 (66%), Gaps = 23/459 (5%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
              ++IP    ++AE DE W  +  EA      AY P+P+ I     HE     S  V E E
Sbjct  14    ASLIPTLRANVAETDEYWVTKANEARRRTLMAYHPDPYQI-VDHFHERHYDNSTDVEEME  72

Query  1443  a---------eaEDVTRNDTTRHLLGS----------KKYHGPCNATNPIDRCWRCHADW  1321
                       E      N T R  L             K  GPC A+NPID+CWRC  DW
Sbjct  73    ENASEEEDDIEMISSATNSTRRSYLRGRGKGKGRGKWSKLKGPCTASNPIDKCWRCQPDW  132

Query  1320  ATNRKRLADCALGFGYKTKGGKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFS  1144
             A  RK+L  C  GFGYKT GGK G  Y VT N DD + NP+PGTLRHAVIQ +PLWIIF 
Sbjct  133   ARRRKKLVKCVRGFGYKTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQNEPLWIIFK  192

Query  1143  HDMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLI  964
             HDM I+L QEL++   KTID RG  VHI+ GAGIT+Q+V N+IIHG+HIHHI +G GG+I
Sbjct  193   HDMSIRLCQELMINSHKTIDARGTNVHIAYGAGITMQYVHNIIIHGLHIHHIVQGRGGMI  252

Query  963   RDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDH  784
             R+  DHFG R  +DGDGISIFG++N+W+DH+SM  C DGLIDAI  ST ITISN HFT H
Sbjct  253   RNSNDHFGFRGVADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTGITISNSHFTHH  312

Query  783   NDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGG  604
             NDVML GA + +  DK MQ+T+AFNHFGK L+QRMPR R+G++HVVNNDYTHW +YAIGG
Sbjct  313   NDVMLLGAQNDNHADKKMQVTVAFNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGG  372

Query  603   SSHPTIICQGNRFIAPPDI-HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDP  427
             S  PTI+  GNRFIAPP I H +E+TKR      EWK W WRS+ DI+M  A+F QSG+P
Sbjct  373   SQSPTILSHGNRFIAPPHIQHYREVTKRDSAPESEWKNWNWRSEKDIFMNNAYFRQSGNP  432

Query  426   NFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
              FM  H +    +       V+ LT++AGAL+CRVG PC
Sbjct  433   KFMCSHSR-QQMIKPKHGVAVSKLTKYAGALDCRVGKPC  470



>ref|XP_003563707.1| PREDICTED: pectate lyase-like [Brachypodium distachyon]
Length=448

 Score =   436 bits (1121),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 238/442 (54%), Positives = 302/442 (68%), Gaps = 22/442 (5%)
 Frame = -2

Query  1620  AIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaea  1441
             A  P +  +I ++DE W++R+A A   A+  Y+ +P  ++ SL   V R           
Sbjct  24    ASAPVSQANIGDFDEHWQQRKAAARAAAEAIYQSDPLEVANSLNRAVHRA----------  73

Query  1440  eaEDVTRND---TTRHLLGS-KKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGY  1273
                  T+ D   T R +LG  KK+ GPC ATNPIDRCWRC  DWAT+RKRLA CA GFG 
Sbjct  74    -----TKEDDAGTRRSMLGKHKKFAGPCRATNPIDRCWRCRKDWATDRKRLARCAQGFGR  128

Query  1272  KTKGGKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGD  1096
                GG  G FY VTD +DD    P+PGTLR AVIQ +PLWIIF+  M IKL +EL++  D
Sbjct  129   NATGGLAGKFYIVTDGSDDDVLAPRPGTLRWAVIQAEPLWIIFARSMLIKLKEELLIGSD  188

Query  1095  KTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgd  916
             KTIDGRGAQV I+DGA +T+Q+  NVIIH IHI+ +  G GG+IRD   HFG RT+SDGD
Sbjct  189   KTIDGRGAQVRIADGAQVTVQYAHNVIIHNIHINDLIVGKGGMIRDSPAHFGFRTQSDGD  248

Query  915   gisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDK  736
             G+++FGS++VW+DH+S+  C DGLID I  ST +TISN H T+HNDVMLFG++D + KD 
Sbjct  249   GVNVFGSTSVWLDHLSLATCQDGLIDVIAESTGVTISNCHLTNHNDVMLFGSSDSNPKDV  308

Query  735   IMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAP  556
             IMQIT+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTI+ QGNR+IAP
Sbjct  309   IMQITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKDPTILSQGNRYIAP  368

Query  555   PDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFK  376
             P++  K+ITK++     EWK W W SQ D+ M GAFF ++G    + +     D +    
Sbjct  369   PNLAAKQITKQIGAAEPEWKNWVWHSQEDLLMNGAFFTETGGD--IKRKFDKDDLIKPKP  426

Query  375   AEDVTWLTRFAGALNCRVGSPC  310
                VT LTR+AG + CR G PC
Sbjct  427   GTYVTRLTRYAGCIPCRPGKPC  448



>ref|XP_006286712.1| hypothetical protein CARUB_v10002862mg [Capsella rubella]
 gb|EOA19610.1| hypothetical protein CARUB_v10002862mg [Capsella rubella]
Length=512

 Score =   438 bits (1127),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 231/377 (61%), Positives = 282/377 (75%), Gaps = 8/377 (2%)
 Frame = -2

Query  1419  NDTTRHLLGS-----KKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGK  1255
             N T R L G       K  GPC A+NPID+CWRC +DWA  RK+L  C  GFG++T GGK
Sbjct  137   NSTRRSLRGKGKGKWSKLRGPCTASNPIDKCWRCRSDWAKRRKKLTRCVRGFGHRTTGGK  196

Query  1254  LGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGR  1078
              G  Y VT N D D  NPKPGTLRHAVIQK+PLWIIF +DM I+L QEL++   KTID R
Sbjct  197   RGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEPLWIIFKNDMHIRLSQELLINSHKTIDAR  256

Query  1077  GAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifg  898
             GA VHI+ GAGIT+QFV+NVIIHG+HIHHIFE +GG+IRD +DHFG+RT++DGDGISI+G
Sbjct  257   GADVHIAHGAGITMQFVRNVIIHGLHIHHIFESSGGMIRDSVDHFGMRTRADGDGISIYG  316

Query  897   sSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITL  718
             SS +W+DH+SM  C DGLIDAI  STAITISN HFT HNDVML GA + +  DK MQ+T+
Sbjct  317   SSKIWLDHISMSKCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNTNEADKHMQVTV  376

Query  717   AFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP-DIHK  541
             A+NHFGK L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+  GNRFIAPP   H 
Sbjct  377   AYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHY  436

Query  540   KEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVT  361
             +E+TKR   + +EWK W WRS+ D++M GA+F QSGDP +   H +    +       V+
Sbjct  437   REVTKRDYASEDEWKHWNWRSEKDVFMNGAYFRQSGDPKYKCAHTR-QQMIKPKHGLAVS  495

Query  360   WLTRFAGALNCRVGSPC  310
              LT++AGAL+CRVG  C
Sbjct  496   KLTKYAGALDCRVGKRC  512



>ref|XP_010492335.1| PREDICTED: probable pectate lyase 19 [Camelina sativa]
Length=499

 Score =   437 bits (1125),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 230/377 (61%), Positives = 282/377 (75%), Gaps = 8/377 (2%)
 Frame = -2

Query  1419  NDTTRHLLGS-----KKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGK  1255
             N T R L G       K  GPC A+NPID+CWRC  +WA  RK+L  C  GFG++T GGK
Sbjct  124   NSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWRCRTNWAKRRKKLTRCVRGFGHRTTGGK  183

Query  1254  LGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGR  1078
              G  Y VT N D D  NPKPGTLRHAVIQK+PLWIIF +DM I+L+QEL++   KTID R
Sbjct  184   RGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEPLWIIFKNDMSIRLNQELLINSHKTIDAR  243

Query  1077  GAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifg  898
             GA VHI+ GAGIT+QFVKNVIIHG+HIHHI E +GG+IRD +DHFG+RT++DGDG+SI+G
Sbjct  244   GANVHIAHGAGITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYG  303

Query  897   sSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITL  718
             SSN+W+DH+SM  C DGLIDAI  ST ITISN HFT HNDVML GA + +  DK MQ+T+
Sbjct  304   SSNIWLDHISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVTV  363

Query  717   AFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP-DIHK  541
             A+NHFGK L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+  GNRFIAPP   H 
Sbjct  364   AYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHY  423

Query  540   KEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVT  361
             +E+TKR     +EWK WTWRS+ D++M GA+F QSG+P+F   H +    +       V+
Sbjct  424   REVTKRDYAPEDEWKHWTWRSEKDVFMNGAYFRQSGNPHFKSAHTR-KQMIKPKNGMAVS  482

Query  360   WLTRFAGALNCRVGSPC  310
              LT++AGAL+CRVG  C
Sbjct  483   KLTKYAGALDCRVGKRC  499



>emb|CDY09356.1| BnaA02g26540D [Brassica napus]
Length=457

 Score =   436 bits (1121),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 243/441 (55%), Positives = 298/441 (68%), Gaps = 11/441 (2%)
 Frame = -2

Query  1617  IIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeae  1438
             + P+   HIA +D+ W +R+A A+    ++YEPNP N++    +     +    A+    
Sbjct  23    VAPSVQAHIAVFDDYWTQRQANALRQTMESYEPNPLNVTNHFNYHAALAMETTGAD----  78

Query  1437  aEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGG  1258
               + TR +  +   G K   G   + N IDRCWR   +WA NRK+LADC LGFG KT GG
Sbjct  79    --NGTRRELGQVKAGQKARGGRFKSLNAIDRCWRGDKNWAKNRKKLADCVLGFGLKTTGG  136

Query  1257  KLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDG  1081
             K G  Y VTD +DD   +PKPGTLRHAV + +PLWIIF+  M IKL QEL++  DKTIDG
Sbjct  137   KNGPIYVVTDASDDDLLSPKPGTLRHAVTRDRPLWIIFARTMVIKLQQELMITNDKTIDG  196

Query  1080  RGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisif  901
             RG  V+I+ GAG T+QFVKNVIIH IH+  I  G GGLIRD  +HFGLRT SDGDGI+IF
Sbjct  197   RGVSVYITGGAGFTLQFVKNVIIHNIHMKFIKRGFGGLIRDSEEHFGLRTISDGDGINIF  256

Query  900   gsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQIT  721
             G++N+WIDHVSMRNC DG+IDAI  STAITISN HFTDH +VMLFGA +    DK MQIT
Sbjct  257   GATNIWIDHVSMRNCSDGMIDAIMGSTAITISNSHFTDHKEVMLFGAKNGDEFDKKMQIT  316

Query  720   LAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHK  541
             +AFNHFGKRL QRMPR RYG +HVVNNDYTHW MYAIGG+ +PTII QGNRFIAPP    
Sbjct  317   VAFNHFGKRLNQRMPRVRYGMVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPKEDC  376

Query  540   KEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK-LYDGVMTFKAE--  370
             K++TKR      EWK+W W+S+ D ++ GA+FVQSG  N      K       T + +  
Sbjct  377   KQVTKREYTAYPEWKSWNWQSERDYFLNGAYFVQSGKSNAWSAAPKNPIPKEFTIRPQPG  436

Query  369   -DVTWLTRFAGALNCRVGSPC  310
               V  LT+ AG L+CR G  C
Sbjct  437   TKVRSLTKDAGTLDCRPGKSC  457



>ref|XP_004966014.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=486

 Score =   437 bits (1124),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 238/435 (55%), Positives = 301/435 (69%), Gaps = 19/435 (4%)
 Frame = -2

Query  1599  GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTR  1420
              +I E+D+ WR+R+  A   A+  Y+ +P  +   L   V R++ +          D++ 
Sbjct  66    ANIGEFDDYWRQRKLMADAAAEATYQHDPIEVPNQLNRAVHRSIKKE---------DIS-  115

Query  1419  NDTTRHLLGSKK--YHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGN  1246
               T R +LG KK   +GPC ATNPIDRCWRC  DWAT+RKRLA CA GFG  T GG  G 
Sbjct  116   --TRREMLGQKKGKMNGPCKATNPIDRCWRCRKDWATDRKRLARCAQGFGRNTTGGLAGK  173

Query  1245  FYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQ  1069
             FY VTD  DD   NP+PGTLR AVIQ +PLWI F+  M I L +ELI++GDKTIDGRG Q
Sbjct  174   FYVVTDGTDDDVVNPRPGTLRWAVIQIEPLWITFAKTMIITLKEELIIRGDKTIDGRGVQ  233

Query  1068  VHISDGAGITIQFVKNViihgihihhIFEGN--GGLIRDGLDHFGLRTKsdgdgisifgs  895
             V I++GA +T+QF  NVIIH IHI+ I   N  GG IRD  DHFG RT SDGDGI++FGS
Sbjct  234   VRIANGAQLTVQFANNVIIHNIHINDIISSNKNGGNIRDSPDHFGWRTVSDGDGITVFGS  293

Query  894   SNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLA  715
             +NVW+DH+S+ NC DGLID I  ST +TISN H T+HNDVMLF ++D   +D+IMQIT+A
Sbjct  294   TNVWLDHLSLSNCQDGLIDVIAKSTGVTISNCHMTNHNDVMLFSSSDKHPEDQIMQITVA  353

Query  714   FNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKE  535
             FNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTII QGNR+IAPP++  K+
Sbjct  354   FNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKAPTIISQGNRYIAPPNLAAKQ  413

Query  534   ITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWL  355
             +TK+      EWK W W S+ D++MEGA+F  +G    +++     D +       VT L
Sbjct  414   VTKQHDAPESEWKNWVWHSEDDLFMEGAYFTVTGGQ--INRQFNKKDLIKPKPGSYVTRL  471

Query  354   TRFAGALNCRVGSPC  310
             TRFAG+L+C+ G PC
Sbjct  472   TRFAGSLDCKPGKPC  486



>ref|XP_009129128.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=457

 Score =   436 bits (1120),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 243/441 (55%), Positives = 298/441 (68%), Gaps = 11/441 (2%)
 Frame = -2

Query  1617  IIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeae  1438
             + P+   HIA +D+ W +R+A A+    ++YEPNP N++    +     +    A+    
Sbjct  23    VAPSVQAHIAVFDDYWTQRQANALRQTMESYEPNPLNVTNHFNYHAALAMETTGAD----  78

Query  1437  aEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGG  1258
               + TR +  +   G K   G   + N IDRCWR   +WA NRK+LADC LGFG KT GG
Sbjct  79    --NGTRRELGQVKAGQKARGGRFKSLNAIDRCWRGDKNWAKNRKKLADCVLGFGLKTTGG  136

Query  1257  KLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDG  1081
             K G  Y VTD +DD   +PKPGTLRHAV + +PLWIIF+  M IKL QEL++  DKTIDG
Sbjct  137   KNGPIYVVTDASDDDLLSPKPGTLRHAVTRDRPLWIIFARTMVIKLQQELMITNDKTIDG  196

Query  1080  RGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisif  901
             RG  V+I+ GAG T+QFVKNVIIH IH+  I  G GGLIRD  +HFGLRT SDGDGI+IF
Sbjct  197   RGVSVYITGGAGFTLQFVKNVIIHNIHMKFIKRGFGGLIRDSEEHFGLRTISDGDGINIF  256

Query  900   gsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQIT  721
             G++N+WIDHVSMRNC DG+IDAI  STAITISN HFTDH +VMLFGA +    DK MQIT
Sbjct  257   GATNIWIDHVSMRNCSDGMIDAIMGSTAITISNSHFTDHKEVMLFGAKNGDEFDKKMQIT  316

Query  720   LAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHK  541
             +AFNHFGKRL QRMPR RYG +HVVNNDYTHW MYAIGG+ +PTII QGNRFIAPP    
Sbjct  317   VAFNHFGKRLNQRMPRVRYGMVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPKEDC  376

Query  540   KEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK-LYDGVMTFKAE--  370
             K++TKR      EWK+W W+S+ D ++ GA+FVQSG  N      K       T + +  
Sbjct  377   KQVTKREYTAYPEWKSWNWQSERDYFLNGAYFVQSGKSNAWSAAPKNPIPKEFTIRPQPG  436

Query  369   -DVTWLTRFAGALNCRVGSPC  310
               V  LT+ AG L+CR G  C
Sbjct  437   TKVRSLTKDAGTLDCRPGKSC  457



>ref|XP_007139601.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
 gb|ESW11595.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
Length=444

 Score =   434 bits (1117),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 244/437 (56%), Positives = 297/437 (68%), Gaps = 14/437 (3%)
 Frame = -2

Query  1614  IPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaea  1435
             IP   G I E+D+  + +  EA E A ++Y P+P N++  L   V   L+E   E     
Sbjct  20    IPCLEGGIGEFDDFLKGQALEAHEIALESYVPDPVNMTDDLNINVHGALTEVFKEES---  76

Query  1434  EDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGK  1255
                  N T R L   +KY GPC A NPIDRCWRC   WA NR +LA CA GFG K  GG 
Sbjct  77    -----NHTRREL--KQKYGGPCLALNPIDRCWRCKKGWAKNRFKLAHCAKGFGRKATGGL  129

Query  1254  LGNFYTVTDNADD-PSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGR  1078
              G  Y V D +DD P NPKPGTLR  V+QK+PLWIIF+  M IKL+ EL++  DKTIDGR
Sbjct  130   EGKMYIVNDPSDDDPINPKPGTLRFGVLQKEPLWIIFARSMIIKLNYELLISSDKTIDGR  189

Query  1077  GAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifg  898
             GA V I DG+G+T+QFV NVIIHG+ + +I    GG IRD  +H G+RTK+DGD ISIFG
Sbjct  190   GANVMIKDGSGLTMQFVNNVIIHGLRLQNIKSTPGGTIRDSWNHVGIRTKADGDAISIFG  249

Query  897   sSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITL  718
             SSN+WIDH+S+ +C DGL+D I+ ST ITISN H T HNDVMLFGA+D  T DKIMQ+T+
Sbjct  250   SSNIWIDHLSLSDCEDGLVDIIQGSTGITISNCHMTKHNDVMLFGASDTFTGDKIMQVTV  309

Query  717   AFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKK  538
             AFNHFG+ LIQRMPRCR+G+ HV+NNDYTHW MYAIGGSS PTI+ QGNRFIAP +   K
Sbjct  310   AFNHFGQGLIQRMPRCRWGFFHVLNNDYTHWLMYAIGGSSAPTILSQGNRFIAPNNNAAK  369

Query  537   EITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFK-AEDVT  361
             E+T R    P  W+ W WRS+ D++M GA FVQSG P      +K +  +M  +      
Sbjct  370   EVTHRDYAEPSVWEKWQWRSENDVFMNGANFVQSGPPLGKLPFNKGF--LMKPRHGSQAN  427

Query  360   WLTRFAGALNCRVGSPC  310
              LTRFAGALNC+  SPC
Sbjct  428   RLTRFAGALNCKANSPC  444



>ref|XP_010425041.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   434 bits (1117),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 238/443 (54%), Positives = 297/443 (67%), Gaps = 11/443 (2%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               ++P+   H+AEYDE W +R+ EA+    ++Y+P P N++    +     +        
Sbjct  17    AVVVPSVHAHVAEYDEYWTQRQTEALHQTLESYDPEPLNVTDHFNYHAALAMETTGIS--  74

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                 + TR D  +   G K+  G   + N ID+CWR + +W  NRK+LADC LGFG KT 
Sbjct  75    ----NETRRDLRQVKSGKKRRGGRYESLNAIDKCWRGNKNWDKNRKKLADCVLGFGRKTT  130

Query  1263  GGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTI  1087
             GGK G  Y VTD +D D  NPKPGTLR+AV + +PLWIIF+  M IKL QELI+  DKTI
Sbjct  131   GGKNGPIYVVTDPSDNDLLNPKPGTLRYAVTRDRPLWIIFARHMIIKLQQELIITNDKTI  190

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             DGRG  V+I+ GAG+T+Q+V+NVIIH I+I  I +G GGLIRD   HFGLRT SDGDGIS
Sbjct  191   DGRGVSVYITGGAGLTLQYVRNVIIHNIYIKQIKKGPGGLIRDSEHHFGLRTMSDGDGIS  250

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             IFG++NVWIDHVSM +C DG+IDAI  STAITISN HFTDH++VMLFG  +    DK MQ
Sbjct  251   IFGATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGKNTDVIDKKMQ  310

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             IT+AFNHFGKRL QRMPR RYG +HVVNNDYTHW MYAIGG+ +PTII QGNRFIAPP+ 
Sbjct  311   ITVAFNHFGKRLKQRMPRARYGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNE  370

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK----LYDGVMTF  379
               K++TKR      EWK+W W+S+ D ++ GA+FVQSG  N      K        +   
Sbjct  371   DSKQVTKREYTPYPEWKSWNWQSEKDYFLNGAYFVQSGKANAWSTAPKNPIPRKFAIRPQ  430

Query  378   KAEDVTWLTRFAGALNCRVGSPC  310
                 V  LT+ AGAL C+ G  C
Sbjct  431   PGTKVRRLTKDAGALGCKPGKSC  453



>ref|XP_006299938.1| hypothetical protein CARUB_v10016149mg [Capsella rubella]
 gb|EOA32836.1| hypothetical protein CARUB_v10016149mg [Capsella rubella]
Length=472

 Score =   435 bits (1118),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 242/458 (53%), Positives = 308/458 (67%), Gaps = 21/458 (5%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNI----------SASLIHEVRR  1474
              + IP    ++ E DE W  +  EA +H   AY P+P++I          +++ + E   
Sbjct  16    ASFIPTIRANVPETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYDNSTDVEETEE  75

Query  1473  TLSeavaeaeaeaEDVTRNDTTRHLLGSK--------KYHGPCNATNPIDRCWRCHADWA  1318
               +   AE E      +  ++TR  L  K        K  GPC A+NPID+CWRC  DWA
Sbjct  76    DKAVDSAEEEDIEMISSPTNSTRRSLSGKRRGRGKWSKLRGPCTASNPIDKCWRCQPDWA  135

Query  1317  TNRKRLADCALGFGYKTKGGKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSH  1141
               RK+L  C  GFGYK  GGK G  Y VT   DD + NP+PGTLRHAVIQK+PLWIIF H
Sbjct  136   KRRKKLVHCVRGFGYKVTGGKRGRIYVVTSPRDDDTVNPRPGTLRHAVIQKEPLWIIFKH  195

Query  1140  DMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIR  961
             DM I+L QEL++   KTID RG+ VHI+ GAGITIQ+V N+IIHG+HIHHI + +GGLIR
Sbjct  196   DMSIRLSQELMIASHKTIDARGSNVHIAYGAGITIQYVHNIIIHGLHIHHIVKSSGGLIR  255

Query  960   DGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHN  781
             D ++HFG R ++DGDGISIFG++N+W+DH+SM  C DGLIDAI  STAITISN HFT HN
Sbjct  256   DSINHFGQRGQADGDGISIFGATNIWLDHISMSRCQDGLIDAIMGSTAITISNSHFTHHN  315

Query  780   DVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGS  601
             DVML GA D +  DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW +YAIGGS
Sbjct  316   DVMLLGAQDNNQDDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGS  375

Query  600   SHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN  424
               PTI+  GNRFIAPP   H +E+TKR   +  EWK W WRS+ D ++ GA F +SG+P+
Sbjct  376   QGPTILSHGNRFIAPPHKPHYREVTKRDYASEGEWKHWNWRSEKDYFLNGAHFRESGNPH  435

Query  423   FMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             F   H +    +       V+ LT++AGAL+CRVG  C
Sbjct  436   FKCSHSR-QQMIKPKHGVAVSKLTKYAGALDCRVGKAC  472



>gb|KHN13240.1| Putative pectate lyase 3 [Glycine soja]
Length=446

 Score =   433 bits (1114),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 247/449 (55%), Positives = 296/449 (66%), Gaps = 34/449 (8%)
 Frame = -2

Query  1617  IIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeae  1438
             +IP     IAE+D+  + +  EA + A  +Y P PH+++  L   V   L          
Sbjct  19    VIPCLEAGIAEFDDFLKAQADEAHKIALDSYVPEPHDVAHELNFHVHMALE---------  69

Query  1437  aEDVTRNDTTRHLLGSKKYHG--PCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                    ++TR  L  +K  G   C A+NPID CWRC+ DWA +R RLA C  GFG +  
Sbjct  70    -------NSTRRELRQRKLRGGGKCQASNPIDACWRCNKDWANDRFRLAKCGKGFGRRAT  122

Query  1263  GGKLGNFYTVTDNADDPS-NPKPGTLRHA-------VIQKKPLWIIFSHDMDIKLHQELI  1108
             GG  G  Y VTDN+DD   NPKPGT+RHA       V QK PLWIIF H M I L QEL+
Sbjct  123   GGLGGPIYVVTDNSDDDMVNPKPGTIRHAPGTIRHAVTQKGPLWIIFGHSMIISLRQELM  182

Query  1107  MQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTK  928
             +  DKTIDGRGA V   DGAG+TIQFV NVIIHG+ I  I   +GG+IRD  DH+GLRT+
Sbjct  183   ISSDKTIDGRGANVVFRDGAGLTIQFVNNVIIHGVRIKDIVPKDGGMIRDSADHYGLRTR  242

Query  927   sdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLS  748
             SDGD ISIFGS+N+WIDHVS+ NC DGLID I+ STAITISN H T HNDV LFGA+D  
Sbjct  243   SDGDAISIFGSTNIWIDHVSLSNCADGLIDIIQGSTAITISNCHMTKHNDVFLFGASDSY  302

Query  747   TKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNR  568
               DKIMQIT+AFNHFG+ L+QRMPRCR+G++HV+NNDYTHW MYAIGGSS PTI+ QGNR
Sbjct  303   NGDKIMQITVAFNHFGQGLVQRMPRCRWGFVHVLNNDYTHWLMYAIGGSSGPTILSQGNR  362

Query  567   FIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGV  388
             FIAP + + KEIT R    P+ WK W W+S+ D++M GA FV SG P  M      Y   
Sbjct  363   FIAPNNDNAKEITHRDYAGPDVWKNWQWQSEMDLFMNGAKFVTSGSPIKM-----TYKKG  417

Query  387   MTFKAED---VTWLTRFAGALNCRVGSPC  310
             +  K  D   V+ LTR AGALNC VG PC
Sbjct  418   LIMKPRDGTHVSRLTRHAGALNCFVGKPC  446



>ref|XP_010502279.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   433 bits (1114),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 238/440 (54%), Positives = 294/440 (67%), Gaps = 11/440 (3%)
 Frame = -2

Query  1614  IPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaea  1435
             +P+   H+AEYDE W +R+ EA+    ++Y+P P N++    +     +           
Sbjct  20    VPSVHAHVAEYDEYWTQRQTEALHQTLESYDPEPLNVTDHFNYHAALAMETTGTA-----  74

Query  1434  EDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGK  1255
              + TR D  +   G K+  G   + N ID+CWR   +W  NRK+LADC LGFG KT GGK
Sbjct  75    -NETRRDLRQVKSGKKRRGGRYESLNAIDKCWRGDKNWDKNRKKLADCVLGFGRKTTGGK  133

Query  1254  LGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGR  1078
              G  Y VTD +D D  +PKPGTLRHAV + +PLWIIF+  M IKL QELI+  DKTIDGR
Sbjct  134   NGPIYVVTDPSDNDLLDPKPGTLRHAVTRDRPLWIIFARHMIIKLQQELIITNDKTIDGR  193

Query  1077  GAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifg  898
             G  V+I+ GAG+T+Q+V+NVIIH I+I  I  G GGLIRD   HFGLRT SDGDGI+IFG
Sbjct  194   GVSVYITGGAGLTLQYVRNVIIHNIYIKQIKRGPGGLIRDSEHHFGLRTMSDGDGINIFG  253

Query  897   sSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITL  718
             ++NVWIDHVSM +C DG+IDAI  STAITISN HFTDH++VMLFG  +    DK MQIT+
Sbjct  254   ATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGKNTDVIDKKMQITV  313

Query  717   AFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKK  538
             AFNHFGKRL QRMPR RYG +HVVNNDYTHW MYAIGG+ +PTII QGNRFIAPP+   K
Sbjct  314   AFNHFGKRLKQRMPRARYGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEDSK  373

Query  537   EITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK----LYDGVMTFKAE  370
             ++TKR      EWKTW W+S+ D ++ GA+FVQSG  N      K        +      
Sbjct  374   QVTKREYTPYPEWKTWNWQSEKDYFLNGAYFVQSGKANAWSTAPKNPIPRKFAIRPQPGT  433

Query  369   DVTWLTRFAGALNCRVGSPC  310
              V  LT+ AGAL C+ G  C
Sbjct  434   KVRRLTKDAGALGCKPGKSC  453



>ref|XP_009114192.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=459

 Score =   433 bits (1114),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 241/450 (54%), Positives = 299/450 (66%), Gaps = 23/450 (5%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               + P+   H+A +DE W +R+A A+    ++Y+PNP N++  L +     +    A   
Sbjct  21    AVVAPSIQAHVAVFDEYWTQRQAAALRQTIESYDPNPFNVTDHLNYHAALAMETTGA---  77

Query  1443  aeaEDVTRNDTTRHLLG-------SKKYHGPCNATNPIDRCWRCHADWATNRKRLADCAL  1285
                     ++ TR  LG       +K+  G  ++ N ID+CWR H +W  NRK+LADC L
Sbjct  78    --------DNGTRRELGQVGGGRKTKRRGGRYHSLNAIDKCWRGHRNWHKNRKKLADCVL  129

Query  1284  GFGYKTKGGKLGNFYTVTDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELI  1108
             GFG KT GGK G  Y VTD +DD   NPKPGTLR+AV + +PLWIIF   M IKL QELI
Sbjct  130   GFGRKTTGGKKGPMYVVTDASDDDLMNPKPGTLRYAVTRDRPLWIIFGRSMIIKLQQELI  189

Query  1107  MQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTK  928
             +  DKTIDGRGA +HI+ GAG+T+QFVKNVIIH IHI  I  GNGG+IRD   HFG RT 
Sbjct  190   INSDKTIDGRGANIHITGGAGLTLQFVKNVIIHNIHIKTIVPGNGGMIRDSEHHFGHRTT  249

Query  927   sdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLS  748
             SDGDGI+IFGS+NVWIDHVSM NC DG+ID I  STAITISN H TDHN+VMLFGA +  
Sbjct  250   SDGDGINIFGSTNVWIDHVSMTNCTDGMIDVIMGSTAITISNCHLTDHNEVMLFGAREED  309

Query  747   TKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNR  568
               DK MQIT+AFNHFGKRL+QRMPR R+G +HVVNNDYTHW MYAIGG+ +PTII QGNR
Sbjct  310   VVDKKMQITVAFNHFGKRLVQRMPRARFGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNR  369

Query  567   FIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK----L  400
             FIAPP  + K++TKR      EWK+W W+S+ D ++ GA+FV+SG  N      +     
Sbjct  370   FIAPPKENSKQVTKREYAKYSEWKSWNWQSERDYFLNGAYFVKSGRANAWSPAPENPIPR  429

Query  399   YDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             +  +       V  LT+ AG L CR G  C
Sbjct  430   HFAIQPQPGTGVRRLTKDAGTLGCRPGKSC  459



>emb|CDY04133.1| BnaA09g19110D [Brassica napus]
 gb|AIS67292.1| pectate lyase-like protein 9 [Brassica rapa subsp. chinensis]
Length=459

 Score =   433 bits (1113),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 241/450 (54%), Positives = 299/450 (66%), Gaps = 23/450 (5%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               + P+   H+A +DE W +R+A A+    ++Y+PNP N++  L +     +    A   
Sbjct  21    AVVAPSIQAHVAVFDEYWTQRQAAALRQTIESYDPNPFNVTDHLNYHAALAMETTGA---  77

Query  1443  aeaEDVTRNDTTRHLLG-------SKKYHGPCNATNPIDRCWRCHADWATNRKRLADCAL  1285
                     ++ TR  LG       +K+  G  ++ N ID+CWR H +W  NRK+LADC L
Sbjct  78    --------DNGTRRELGQVGGGRKTKRRGGRYHSLNAIDKCWRGHRNWHKNRKKLADCVL  129

Query  1284  GFGYKTKGGKLGNFYTVTDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELI  1108
             GFG KT GGK G  Y VTD +DD   NPKPGTLR+AV + +PLWIIF   M IKL QELI
Sbjct  130   GFGRKTTGGKKGPMYVVTDASDDDLMNPKPGTLRYAVTRDRPLWIIFGRSMIIKLQQELI  189

Query  1107  MQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTK  928
             +  DKTIDGRGA +HI+ GAG+T+QFVKNVIIH IHI  I  GNGG+IRD   HFG RT 
Sbjct  190   INSDKTIDGRGANIHITGGAGLTLQFVKNVIIHNIHIKTIVPGNGGMIRDSEHHFGHRTT  249

Query  927   sdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLS  748
             SDGDGI+IFGS+NVWIDHVSM NC DG+ID I  STAITISN H TDHN+VMLFGA +  
Sbjct  250   SDGDGINIFGSTNVWIDHVSMTNCTDGMIDVIMGSTAITISNCHLTDHNEVMLFGAREED  309

Query  747   TKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNR  568
               DK MQIT+AFNHFGKRL+QRMPR R+G +HVVNNDYTHW MYAIGG+ +PTII QGNR
Sbjct  310   VIDKKMQITVAFNHFGKRLVQRMPRARFGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNR  369

Query  567   FIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK----L  400
             FIAPP  + K++TKR      EWK+W W+S+ D ++ GA+FV+SG  N      +     
Sbjct  370   FIAPPKENSKQVTKREYAKYSEWKSWNWQSERDYFLNGAYFVKSGRANAWSPAPENPIPR  429

Query  399   YDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             +  +       V  LT+ AG L CR G  C
Sbjct  430   HFAIQPQPGTGVRRLTKDAGTLGCRPGKSC  459



>ref|XP_002437204.1| hypothetical protein SORBIDRAFT_10g022830 [Sorghum bicolor]
 gb|EER88571.1| hypothetical protein SORBIDRAFT_10g022830 [Sorghum bicolor]
Length=454

 Score =   432 bits (1112),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 241/439 (55%), Positives = 298/439 (68%), Gaps = 18/439 (4%)
 Frame = -2

Query  1608  ATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaED  1429
             ++  +I ++D+ WR+R+  A   A+  Y+ +P  ++  L   V R++ +           
Sbjct  28    SSEANIGDFDDYWRQRKLMADAAAEATYKHDPLEVTNQLNRAVHRSVEKEDMS-------  80

Query  1428  VTRNDTTRHLLGSKK---YHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGG  1258
              TR    R ++G KK    +GPC ATNPIDRCWRC  DWAT+RKRLA CA GFG  T GG
Sbjct  81    -TRR---RAMMGHKKGKLNNGPCEATNPIDRCWRCRQDWATDRKRLARCAQGFGRNTTGG  136

Query  1257  KLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDG  1081
               G FY VTD  DD   NP+PGTLR AVIQ +PLWI F+  M I L +ELI+QGDKTIDG
Sbjct  137   LAGKFYVVTDGTDDDVVNPRPGTLRWAVIQIEPLWITFARTMIITLKEELIIQGDKTIDG  196

Query  1080  RGAQVHISDGAGITIQFVKNViihgihihhIFEGN--GGLIRDGLDHFGLRTKsdgdgis  907
             RGAQV I++GA +T+QF  NVIIH +HI+ I   N  GG IRD  DHFG RT SDGDGI+
Sbjct  197   RGAQVRIANGAQLTVQFANNVIIHNVHINDIMSSNKNGGNIRDSPDHFGWRTVSDGDGIT  256

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             +FGS+NVW+DH+S+ NC DGLID I  ST +TISN H T+HNDVMLF ++D   +D+IMQ
Sbjct  257   LFGSTNVWLDHLSLSNCQDGLIDVIVKSTGVTISNCHMTNHNDVMLFSSSDKHPEDQIMQ  316

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             IT+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTII QGNR+IAPP++
Sbjct  317   ITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKAPTIISQGNRYIAPPNL  376

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED  367
               K +TK       EWK W W S+ D++MEGA F  SG        HK  D +       
Sbjct  377   AAKLVTKHHDAPESEWKNWVWHSENDLFMEGANFTVSGGQKINRNFHK-KDLIKPKNGSY  435

Query  366   VTWLTRFAGALNCRVGSPC  310
             VT LTR+AGAL CR G PC
Sbjct  436   VTRLTRYAGALACRPGKPC  454



>ref|XP_007151201.1| hypothetical protein PHAVU_004G026400g [Phaseolus vulgaris]
 gb|ESW23195.1| hypothetical protein PHAVU_004G026400g [Phaseolus vulgaris]
Length=441

 Score =   432 bits (1110),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 246/439 (56%), Positives = 288/439 (66%), Gaps = 23/439 (5%)
 Frame = -2

Query  1614  IPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaea  1435
             IP     IAE+DE  R +  +A E A Q+Y P P  ++  L + V  ++           
Sbjct  22    IPCLEAGIAEFDEFLRAQSEKAHEIALQSYVPTPEFVTNDLNYHVHLSMQ----------  71

Query  1434  EDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGK  1255
              +VTR        G+     PC ++NPID CWRC+ DWA +R RLA C  GFG +  GG 
Sbjct  72    -NVTRRGLKE---GNNAIGKPCESSNPIDNCWRCNKDWAKDRYRLAKCGKGFGRRAVGGL  127

Query  1254  LGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGR  1078
              G  Y VTDN+D D  NPKPGTLR+AV QK PLWI F   M I L QEL++  DKTIDGR
Sbjct  128   GGPIYVVTDNSDEDMINPKPGTLRYAVTQKGPLWITFERSMIISLQQELMISSDKTIDGR  187

Query  1077  GAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifg  898
             GA V I DG G+T+QFV NVIIHGI +  I    GGLIRD  +H G RT+SDGD IS+FG
Sbjct  188   GANVQIRDGGGLTMQFVNNVIIHGIRVKDIVPKEGGLIRDSYNHIGQRTRSDGDAISVFG  247

Query  897   sSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITL  718
             +SN+WIDHVS+ N  DGLID I+ STAITISN H T HNDVMLFGA D  T DKIMQIT+
Sbjct  248   ASNIWIDHVSLSNSADGLIDVIQGSTAITISNCHMTRHNDVMLFGAADSYTGDKIMQITV  307

Query  717   AFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKK  538
             AFNHFG+ LIQRMPRCR G+ HV+NNDYTHW MYAIGGS+ PTI+ QGNRFIAP +   K
Sbjct  308   AFNHFGQGLIQRMPRCRMGFFHVLNNDYTHWMMYAIGGSAGPTILSQGNRFIAPNNDAAK  367

Query  537   EITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED---  367
             EIT R   TPEEWK W W+S  D+ M GA F  SG P  M KH K +      K  D   
Sbjct  368   EITHRDYATPEEWKNWQWQSDMDLLMNGATFNSSGSPIAM-KHKKGF----IMKPRDGTH  422

Query  366   VTWLTRFAGALNCRVGSPC  310
             V+ LTR +GALNC VG PC
Sbjct  423   VSRLTRHSGALNCFVGLPC  441



>gb|KEH24975.1| pectate lyase P59-like protein [Medicago truncatula]
Length=453

 Score =   432 bits (1111),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 242/429 (56%), Positives = 289/429 (67%), Gaps = 15/429 (3%)
 Frame = -2

Query  1590  AEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRNDT  1411
             AE D+  + R  EA + A + Y P P  ++  L   V  ++            +   N+T
Sbjct  38    AEIDDFVKARAEEAHKVAVETYVPIPEGVAHDLNVAVHMSM------------EAEENNT  85

Query  1410  TRHL-LGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTV  1234
              R +    KK+ GPC ATNPID CWRC ADWA NR +LA C+ GFG KT GG  G  Y V
Sbjct  86    RREMRQKGKKHDGPCEATNPIDSCWRCKADWAANRFQLAKCSKGFGRKTTGGLGGPIYVV  145

Query  1233  TDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHIS  1057
             TD +D D  NPKPGTLR   +QK PLWI F+  M I+L+QEL++  DKTIDGRGA V I 
Sbjct  146   TDESDNDMVNPKPGTLRFGAVQKGPLWITFARSMVIRLNQELMVSSDKTIDGRGANVQIR  205

Query  1056  DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWID  877
             DGAGIT+QFV NVIIHG+HI +I    GGLIRD  DH G RT+SDGD ISI+GSSN+WID
Sbjct  206   DGAGITMQFVNNVIIHGLHIQNIKAKPGGLIRDSFDHTGQRTRSDGDAISIYGSSNIWID  265

Query  876   HVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGK  697
             H+S+  C DGL+D I+ ST ITISN H T HNDVMLFGA+D  T DK+MQIT+AFNHFG+
Sbjct  266   HLSLSECEDGLVDIIQGSTGITISNCHMTKHNDVMLFGASDSYTGDKLMQITVAFNHFGQ  325

Query  696   RLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVK  517
              LIQRMPRCRYG++HV+NNDYTHW MYAIGGSS PTI+ QGNRFIAP +   KE+T R  
Sbjct  326   GLIQRMPRCRYGFVHVLNNDYTHWIMYAIGGSSSPTILSQGNRFIAPDNGAAKEVTHRDY  385

Query  516   GTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGA  337
               P+ WK W W S+ D++M GA FV SG P       K Y  +       V+ LTR AGA
Sbjct  386   APPDVWKNWQWSSELDVFMNGAKFVPSGAPINRKPFKKAY-MMQPRDGSHVSRLTRNAGA  444

Query  336   LNCRVGSPC  310
             LNC VG PC
Sbjct  445   LNCVVGKPC  453



>gb|EAY99626.1| hypothetical protein OsI_21605 [Oryza sativa Indica Group]
Length=441

 Score =   431 bits (1109),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 239/425 (56%), Positives = 295/425 (69%), Gaps = 25/425 (6%)
 Frame = -2

Query  1581  DEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRNDTTRH  1402
             +E W +R  EA    + AY  +P    A+L                    DV R  T R 
Sbjct  41    EEYWEKRAEEARSFNRAAYVSDP---VATL---------------NRFNADVLRATTRRS  82

Query  1401  LLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVTDNA  1222
             L    +Y GPC ATNPIDRCWRC  DWAT+RKRLA C  GFG++T GG  G  Y VTD +
Sbjct  83    L---ARYTGPCMATNPIDRCWRCRDDWATDRKRLARCVRGFGHRTVGGAAGKIYVVTDAS  139

Query  1221  DDPSN-PKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAG  1045
             DD    P+ GTLR+ VIQ +P+WI+F+ DM I+L QELI+  +KTIDGRGAQVHI+ GA 
Sbjct  140   DDEMVIPRKGTLRYGVIQDRPMWIVFARDMIIQLRQELIVNHNKTIDGRGAQVHIT-GAQ  198

Query  1044  ITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSM  865
             IT+Q V++VIIH +HIHH     GG+IRD   H+GLRT+SDGDGISI  SSN+WIDHVSM
Sbjct  199   ITLQGVQHVIIHNVHIHHSVPHGGGMIRDSKRHYGLRTRSDGDGISIMSSSNIWIDHVSM  258

Query  864   RNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQ  685
              NC DGLIDA+  STAITISNGHFT H+ VMLFGA++   +D++MQIT+AFNHFGK L+Q
Sbjct  259   SNCSDGLIDAVSGSTAITISNGHFTKHDHVMLFGASNSDAQDEVMQITVAFNHFGKGLVQ  318

Query  684   RMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPE  505
             R+PRCR+G+ HVVNNDY HW MYAIGG+ +PTII QGNRFIAP D++ KE+TKR     +
Sbjct  319   RLPRCRFGFFHVVNNDYMHWLMYAIGGNMNPTIISQGNRFIAPDDVNAKEVTKREYTPYD  378

Query  504   EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCR  325
             E+K W W+SQGD+ M GAFF +SG  N  ++ +   D +     + V  LT+FAGALNC 
Sbjct  379   EYKEWVWKSQGDVMMNGAFFNESGGQN--ERSYDQLDFIPAKHGKYVGQLTKFAGALNCH  436

Query  324   VGSPC  310
             VG PC
Sbjct  437   VGMPC  441



>ref|XP_006431087.1| hypothetical protein CICLE_v10011762mg [Citrus clementina]
 ref|XP_006431088.1| hypothetical protein CICLE_v10011763mg [Citrus clementina]
 gb|ESR44327.1| hypothetical protein CICLE_v10011762mg [Citrus clementina]
 gb|ESR44328.1| hypothetical protein CICLE_v10011763mg [Citrus clementina]
Length=435

 Score =   431 bits (1109),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 230/437 (53%), Positives = 305/437 (70%), Gaps = 18/437 (4%)
 Frame = -2

Query  1617  IIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeae  1438
             I+   +  IAE DEVWRRR  EA++  +Q Y+P+P  ++++L  +V+             
Sbjct  16    ILIPCLSAIAEADEVWRRRAEEAMQTTEQYYDPDPVAVASNLNMKVQ-------------  62

Query  1437  aEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGG  1258
               D+++    R  L + +  G C ATNPID+CWRC  +WA +R+ LA CALGFG K  GG
Sbjct  63    --DLSKQTAARRGLLNAE-SGQCEATNPIDKCWRCKENWAEDRQALAGCALGFGSKATGG  119

Query  1257  KLGNFYTVTDNADD-PSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDG  1081
             K G  Y VTD++D+   NPK GTLRHAVIQK+PLWIIF+ DM+IKL QEL++QG+KTIDG
Sbjct  120   KGGKIYEVTDSSDNNMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQELVVQGNKTIDG  179

Query  1080  RGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisif  901
             RGA VHI++GAGI +QFV+NVIIHGIHIH+I   +GG+IRD +DH G R  SDGD +S+F
Sbjct  180   RGANVHIANGAGIRLQFVQNVIIHGIHIHNISPASGGMIRDSVDHVGNRGPSDGDAVSVF  239

Query  900   gsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQIT  721
              SSN+W+DH+++    DGLIDAI+ STAITISN H ++H+  +L GA D  T+DK MQ+T
Sbjct  240   SSSNIWLDHLTLSKAQDGLIDAIQGSTAITISNCHLSNHDKAILLGATDTFTEDKKMQVT  299

Query  720   LAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHK  541
             +AFN F K L+QRMP  R+G+ HVVNNDY  W MYAIGG   PTI+ QGNRF A  + + 
Sbjct  300   VAFNRFDKGLVQRMPCIRFGFAHVVNNDYNQWEMYAIGGLKGPTILSQGNRFFASDNKNA  359

Query  540   KEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVT  361
             KE+TKR+  +PEE   W WRS+GD+++ GA+F  SGDP    K ++L D +      +V 
Sbjct  360   KEVTKRMDCSPEEGNGWIWRSEGDVFLNGAYFNASGDPKKQIK-YELNDVIKPAPGTEVQ  418

Query  360   WLTRFAGALNCRVGSPC  310
              +T+FAGAL C+ G  C
Sbjct  419   RITKFAGALVCKPGQQC  435



>emb|CDY41679.1| BnaC02g34750D [Brassica napus]
Length=457

 Score =   432 bits (1110),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 242/441 (55%), Positives = 297/441 (67%), Gaps = 11/441 (2%)
 Frame = -2

Query  1617  IIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeae  1438
             + P+   HIA +D+ W +R+A A+    ++YEPNP N++    +     +    A+    
Sbjct  23    VAPSVQAHIAVFDDYWTQRQANALRQTMESYEPNPLNVTNHFNYHAALAMETTGAD----  78

Query  1437  aEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGG  1258
               +  R +  +   G K   G   + N IDRCWR   +WA NRK+LADC LGFG KT GG
Sbjct  79    --NGPRRELGQVKAGQKTRGGRFRSLNAIDRCWRGDKNWAKNRKKLADCVLGFGLKTIGG  136

Query  1257  KLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDG  1081
             K G  Y VTD +DD   +PKPGTLRHAV + +PLWIIF+  M IKL QEL++  DKTIDG
Sbjct  137   KNGPIYVVTDASDDDLLSPKPGTLRHAVTRDRPLWIIFARTMVIKLQQELMITNDKTIDG  196

Query  1080  RGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisif  901
             RG  V+I+ GAG T+QFVKNVIIH IH+  I  G GGLIRD  +HFGLRT SDGDGI+IF
Sbjct  197   RGVSVYITGGAGFTLQFVKNVIIHNIHMKFIKRGFGGLIRDSEEHFGLRTISDGDGINIF  256

Query  900   gsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQIT  721
             G++N+WIDHVSMRNC DG+IDAI  STAITISN HFTDH +VMLFGA +    DK MQIT
Sbjct  257   GATNIWIDHVSMRNCSDGMIDAIMGSTAITISNSHFTDHKEVMLFGAKNGDEFDKKMQIT  316

Query  720   LAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHK  541
             +AFNHFGKRL QRMPR RYG +HVVNNDYTHW MYAIGG+ +PTII QGNRFIAPP    
Sbjct  317   VAFNHFGKRLNQRMPRVRYGMVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPKEDC  376

Query  540   KEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK-LYDGVMTFKAE--  370
             K++TKR      EWK+W W+S+ D ++ GA+FVQSG  N      K       T + +  
Sbjct  377   KQVTKREYTPYPEWKSWNWQSERDYFLNGAYFVQSGKSNAWSAAPKNPIPKEFTIRPQPG  436

Query  369   -DVTWLTRFAGALNCRVGSPC  310
               V  LT+ AG L+CR G  C
Sbjct  437   TKVRSLTKDAGTLDCRPGKSC  457



>emb|CDY45254.1| BnaA06g09240D [Brassica napus]
Length=458

 Score =   431 bits (1109),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 237/444 (53%), Positives = 299/444 (67%), Gaps = 12/444 (3%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               + P    +IA +D+ W +R+ +A++    +++P P N++  L + V   L    +   
Sbjct  21    ATLAPQVQANIAVFDDYWTQRQGDALKQTLASFDPYPLNVTNHLNYHVALALDTTESI--  78

Query  1443  aeaEDVTRNDTTRHLLGSK-KYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKT  1267
                 + TR + ++   G K +  G C A NPID+CWRC  DW  NRK+LA CALGFG +T
Sbjct  79    ----NSTRRELSQARRGRKMQNRGKCVAHNPIDKCWRCDRDWEKNRKKLAVCALGFGRRT  134

Query  1266  KGGKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKT  1090
              GGK G  Y VTD +DD   +P+PGTLRHAV +  PLWIIF+  M IKL QEL+M  DKT
Sbjct  135   TGGKDGPIYVVTDASDDELISPRPGTLRHAVTRDGPLWIIFARSMVIKLQQELMMTSDKT  194

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             IDGRGA+V+I  G+G+T+QFV NVIIH I+I  I   NGGLIRD   H GLRT+SDGDGI
Sbjct  195   IDGRGARVYIMGGSGLTLQFVNNVIIHNIYIKQIVPANGGLIRDSEQHIGLRTRSDGDGI  254

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             ++FG++NVWIDHVSM  C DG+IDAI  STA+T+SN HFTDH +VMLFGAND    DK M
Sbjct  255   NLFGATNVWIDHVSMTRCSDGMIDAILGSTAVTVSNSHFTDHQEVMLFGANDKHEIDKKM  314

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             QIT+AFNHFGKRL QRMPR R+G IHVVNNDYTHW MYAIGG+ +PTII  GNRFIAPP+
Sbjct  315   QITVAFNHFGKRLEQRMPRVRFGTIHVVNNDYTHWEMYAIGGNMNPTIISHGNRFIAPPN  374

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN-FMDKHHKLYDGVMTFKA  373
                K+ITKR   +  +WK W W+S+GD ++ GA+FVQSG PN +  K           + 
Sbjct  375   EQAKQITKREYTSYVDWKLWNWQSEGDYFLNGAYFVQSGKPNAWSPKPKNPIPNKFAIRP  434

Query  372   EDVTW---LTRFAGALNCRVGSPC  310
             +  T    LT  AG L C+ G  C
Sbjct  435   KPGTMVRKLTMDAGVLGCKQGQAC  458



>ref|XP_006482544.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=435

 Score =   431 bits (1107),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 231/437 (53%), Positives = 306/437 (70%), Gaps = 18/437 (4%)
 Frame = -2

Query  1617  IIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeae  1438
             I+   +  IAE DEVWRRR  EA++  +Q Y+P+P  ++++L  +V+             
Sbjct  16    ILIPCLSAIAEADEVWRRRAEEAMQTTEQYYDPDPVAVASNLNMKVQ-------------  62

Query  1437  aEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGG  1258
               D+++    R  L + +  G C ATNPID+CWRC  +WA +R+ LA CALGFG K  GG
Sbjct  63    --DLSKQTAARRGLLNAE-SGQCEATNPIDKCWRCKENWAEDRQALAGCALGFGSKATGG  119

Query  1257  KLGNFYTVTDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDG  1081
             K G  Y VTD++D+   NPK GTLRHAVIQK+PLWIIF+ DM+IKL QEL++QG+KTIDG
Sbjct  120   KGGKIYEVTDSSDNNMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQELVVQGNKTIDG  179

Query  1080  RGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisif  901
             RGA VHI++GAGI +QFV+NVIIHGIHIH+I   +GG+IRD +DH G R  SDGD +S+F
Sbjct  180   RGANVHIANGAGIRLQFVQNVIIHGIHIHNISPASGGMIRDSVDHVGNRGPSDGDAVSVF  239

Query  900   gsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQIT  721
             GSSN+W+DH+++    DGLIDAI+ STAITISN H ++H+  +L GA D  T+DK MQ+T
Sbjct  240   GSSNIWLDHLTLSKAQDGLIDAIQGSTAITISNCHLSNHDKAILLGATDTFTEDKKMQVT  299

Query  720   LAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHK  541
             +AFN F K L+QRMP  R+G+ HVVNNDY  W MYAIGG   PTI+ QGNRF A  + + 
Sbjct  300   VAFNRFDKGLVQRMPCIRFGFAHVVNNDYNQWEMYAIGGLKGPTILSQGNRFFASDNKNA  359

Query  540   KEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVT  361
             KE+TKR+  +PEE   W WRS+GD+++ GA+F  SGDP    K ++L D +      +V 
Sbjct  360   KEVTKRMDCSPEEGNGWIWRSEGDVFLNGAYFNASGDPKKQIK-YELNDVIKPAPGTEVQ  418

Query  360   WLTRFAGALNCRVGSPC  310
              +T+FAGAL C+ G  C
Sbjct  419   RITKFAGALVCKPGQQC  435



>ref|XP_006292606.1| hypothetical protein CARUB_v10018855mg [Capsella rubella]
 gb|EOA25504.1| hypothetical protein CARUB_v10018855mg [Capsella rubella]
Length=455

 Score =   431 bits (1108),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 241/445 (54%), Positives = 297/445 (67%), Gaps = 13/445 (3%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               ++P+   HIA +DE W +R+ EA++   +AY+P P N++    H+    +        
Sbjct  17    AVVVPSVQAHIAVHDEYWTQRQTEALQQTLEAYDPEPLNVTDHFNHQAALAM------VP  70

Query  1443  aeaEDVTRNDTTRHLLGSKKYHG--PCNATNPIDRCWRCHADWATNRKRLADCALGFGYK  1270
                 + TR +  +   G+KK        + N ID+CWR   +W  NRK+LADC LGFG K
Sbjct  71    TGIVNETRRELRQVGRGNKKPRRGRRYESLNAIDKCWRGDKNWDKNRKKLADCVLGFGRK  130

Query  1269  TKGGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDK  1093
             T GGK G FY VTD +D D  NPKPGTLR+AV + +PLWIIF+  M IKL QELI+  DK
Sbjct  131   TTGGKNGPFYVVTDPSDTDLMNPKPGTLRYAVTRDRPLWIIFARSMIIKLQQELIITNDK  190

Query  1092  TIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdg  913
             TIDGRGA VHI+ GAG+T+QFV+NVIIH I+I  I +G GGLIRD   HFGLRT SDGDG
Sbjct  191   TIDGRGANVHITGGAGLTLQFVRNVIIHNIYIKQIKKGAGGLIRDSEHHFGLRTVSDGDG  250

Query  912   isifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKI  733
             I+IFG++NVWIDHVSM +C DG+IDAI  STAITISN HFTDH++VMLFG  +    DK 
Sbjct  251   INIFGATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGTNKDVIDKK  310

Query  732   MQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP  553
             MQIT+AFNHFGKRL QRMPR RYG +HVVNNDYTHW MYAIGG+ +PTII QGNRFIAPP
Sbjct  311   MQITVAFNHFGKRLKQRMPRVRYGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPP  370

Query  552   DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK----LYDGVM  385
                 K++TKR      EWKTW W+S+ D ++ GA+FVQSG  N      K        + 
Sbjct  371   IEDSKQVTKREYTPYPEWKTWNWQSEKDYFLNGAYFVQSGKANAWSTAPKNPIPRKFAIR  430

Query  384   TFKAEDVTWLTRFAGALNCRVGSPC  310
                   V  LT+ AG L C+ G  C
Sbjct  431   PQPGTKVRRLTKDAGTLGCKPGKSC  455



>ref|XP_009148818.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=458

 Score =   431 bits (1109),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 237/444 (53%), Positives = 299/444 (67%), Gaps = 12/444 (3%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               + P    +IA +D+ W +R+ +A++    +++P P N++  L + V   L    +   
Sbjct  21    ATLAPQVQANIAVFDDYWTQRQGDALKQTLASFDPYPLNVTNHLNYHVALALDTTEST--  78

Query  1443  aeaEDVTRNDTTRHLLGSK-KYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKT  1267
                 + TR + ++   G K +  G C A NPID+CWRC  DW  NRK+LA CALGFG +T
Sbjct  79    ----NSTRRELSQARRGRKMQNRGKCVAHNPIDKCWRCDRDWEKNRKKLAVCALGFGRRT  134

Query  1266  KGGKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKT  1090
              GGK G  Y VTD +DD   +P+PGTLRHAV +  PLWIIF+  M IKL QEL+M  DKT
Sbjct  135   TGGKDGPIYVVTDASDDELISPRPGTLRHAVTRDGPLWIIFARSMVIKLQQELMMTSDKT  194

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             IDGRGA+V+I  G+G+T+QFV NVIIH I+I  I   NGGLIRD   H GLRT+SDGDGI
Sbjct  195   IDGRGARVYIMGGSGLTLQFVNNVIIHNIYIKQIVPANGGLIRDSEQHIGLRTRSDGDGI  254

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             ++FG++NVWIDHVSM  C DG+IDAI  STA+T+SN HFTDH +VMLFGAND    DK M
Sbjct  255   NLFGATNVWIDHVSMTRCSDGMIDAILGSTAVTVSNSHFTDHQEVMLFGANDKHEIDKKM  314

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             QIT+AFNHFGKRL QRMPR R+G IHVVNNDYTHW MYAIGG+ +PTII  GNRFIAPP+
Sbjct  315   QITVAFNHFGKRLEQRMPRVRFGTIHVVNNDYTHWEMYAIGGNMNPTIISHGNRFIAPPN  374

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN-FMDKHHKLYDGVMTFKA  373
                K+ITKR   +  +WK W W+S+GD ++ GA+FVQSG PN +  K           + 
Sbjct  375   EQAKQITKREYTSYVDWKLWNWQSEGDYFLNGAYFVQSGKPNAWSPKPKNPIPNKFAIRP  434

Query  372   EDVTW---LTRFAGALNCRVGSPC  310
             +  T    LT  AG L C+ G  C
Sbjct  435   KPGTMVRKLTMDAGVLGCKQGQAC  458



>emb|CDY17432.1| BnaC09g21050D [Brassica napus]
Length=459

 Score =   431 bits (1109),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 241/450 (54%), Positives = 299/450 (66%), Gaps = 23/450 (5%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               + P+   H+A +DE W +R+++A+    ++Y+PNP N++  L +     +    A   
Sbjct  21    AVVAPSVQAHVAVFDEYWTQRQSDALRQTIESYDPNPFNVTDHLNYHAALAMETTGA---  77

Query  1443  aeaEDVTRNDTTRHLLG-------SKKYHGPCNATNPIDRCWRCHADWATNRKRLADCAL  1285
                     ++ TR  LG       +K+  G  ++ N ID+CWR H +W  NRK+LADC L
Sbjct  78    --------DNGTRRKLGQVGDGRKTKRRGGRYHSLNAIDKCWRGHRNWHKNRKKLADCVL  129

Query  1284  GFGYKTKGGKLGNFYTVTDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELI  1108
             GFG KT GGK G  Y VTD ADD   NPKPGTLR+AV + +PLWIIF   M IKL QELI
Sbjct  130   GFGRKTTGGKKGPIYVVTDAADDDLMNPKPGTLRYAVTRDRPLWIIFGRSMIIKLQQELI  189

Query  1107  MQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTK  928
             +  DKTIDGRGA VHI+ GAG+T+QFVKNVIIH IHI  I  GNGG+IRD   HFG RT 
Sbjct  190   INSDKTIDGRGANVHITGGAGLTLQFVKNVIIHNIHIKTIIPGNGGMIRDSEHHFGHRTT  249

Query  927   sdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLS  748
             SDGDGI+IFGS+NVWIDHVSM NC DG+ID I  STAITISN H TDHN+VMLFGA +  
Sbjct  250   SDGDGINIFGSTNVWIDHVSMTNCTDGMIDVIMGSTAITISNCHLTDHNEVMLFGAREED  309

Query  747   TKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNR  568
               DK MQIT+AFNHFGKRL+QRMPR R+G +HVVNNDYTHW MYAIGG+ +PTII QGNR
Sbjct  310   VIDKKMQITVAFNHFGKRLVQRMPRARFGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNR  369

Query  567   FIAPPDIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK----L  400
             F APP  + K++TKR      EWK+W W+S+ D ++ GA+FV+SG  N      +     
Sbjct  370   FTAPPKENCKQVTKREYAKYSEWKSWNWQSERDYFLNGAYFVKSGRANAWSPAPENPIPR  429

Query  399   YDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             +  +       V  LT+ AG L CR G  C
Sbjct  430   HFAIQPQPGTGVRRLTKDAGTLGCRPGKSC  459



>gb|EYU22437.1| hypothetical protein MIMGU_mgv1a006496mg [Erythranthe guttata]
Length=442

 Score =   431 bits (1107),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 240/438 (55%), Positives = 292/438 (67%), Gaps = 21/438 (5%)
 Frame = -2

Query  1614  IPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaea  1435
             +P      A  DE  +++  EA + + QAY P+P  ++      V  TL           
Sbjct  23    LPRAHAQNATMDEYLQKKAEEAYQESLQAYNPHPEELTEEFNELVGETL-----------  71

Query  1434  EDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGK  1255
               + +N T R L    K  G C ATNPIDRCWRC  +WA NRK+LADCA GFG++T GGK
Sbjct  72    --IGQNATRRQL----KQTGECMATNPIDRCWRCDRNWAKNRKKLADCARGFGHQTTGGK  125

Query  1254  LGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGR  1078
              G +Y VTD +D D  +PKPGTLRHAVIQ +PLWIIF+H M I+L QELI   DKT+DGR
Sbjct  126   KGRYYLVTDPSDNDMDHPKPGTLRHAVIQTEPLWIIFAHSMVIRLKQELIFTSDKTVDGR  185

Query  1077  GAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifg  898
             G QVHI+ GAG+T+QFV NVIIH I IH+I   NGGLIRD ++H G RT+SDGD ISI+ 
Sbjct  186   GVQVHIAYGAGLTLQFVHNVIIHNIWIHNIIPRNGGLIRDAINHLGFRTQSDGDAISIYS  245

Query  897   sSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITL  718
             S+ +WIDHVS+    DGLID IE STAITISN     HNDVML GA+D  ++D IMQ+T+
Sbjct  246   SNRIWIDHVSLSRATDGLIDIIEGSTAITISNCKLNHHNDVMLLGAHDAQSRDAIMQVTV  305

Query  717   AFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKK  538
             AFN FG  LIQRMPRCR+G+ HVVNNDY HW +YAIGGS+HPTII QGNRF A    + K
Sbjct  306   AFNRFGIGLIQRMPRCRWGFFHVVNNDYQHWELYAIGGSAHPTIISQGNRFRAADYQYTK  365

Query  537   EITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYD-GVMTFK-AEDV  364
             E+TKR   T +EW  W WRS+GD++M GAFF +SG P        L    ++ FK    V
Sbjct  366   EVTKRDYATKDEWMKWQWRSEGDLFMNGAFFTESG-PAIKHVRSPLNGRNMIKFKHGSFV  424

Query  363   TWLTRFAGALNCRVGSPC  310
               LTR AGA+ CR G  C
Sbjct  425   GRLTRSAGAIKCRPGKLC  442



>emb|CDY39314.1| BnaC05g10650D [Brassica napus]
Length=459

 Score =   431 bits (1107),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 236/445 (53%), Positives = 299/445 (67%), Gaps = 13/445 (3%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
               + P    +IA +D+ W +R+ +A++    +++P P N++  L + V   L    +   
Sbjct  21    ATLAPQVQANIAVFDDYWTQRQGDALKQTLASFDPYPLNVTNHLNYHVALALDTTGSI--  78

Query  1443  aeaEDVTRNDTTRHLLGSKKYH--GPCNATNPIDRCWRCHADWATNRKRLADCALGFGYK  1270
                 + TR + ++   G K  +  G C A NPID+CWRC  DW  NRK+LA CALGFG +
Sbjct  79    ----NSTRRELSQARRGRKMQNRRGKCVAHNPIDKCWRCDRDWEKNRKKLAVCALGFGRR  134

Query  1269  TKGGKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDK  1093
             T GGK G  Y VTD +DD   +P+PGTLRHAV +  PLWIIF+  M IKL QEL+M  DK
Sbjct  135   TSGGKDGPIYVVTDASDDELISPRPGTLRHAVTRDGPLWIIFARSMVIKLQQELMMTSDK  194

Query  1092  TIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdg  913
             TIDGRGA+V+I  G+G+T+QFV NVI+H I+I  I   NGGLIRD   H GLRT+SDGDG
Sbjct  195   TIDGRGARVYIMGGSGLTLQFVNNVIVHNIYIKQIVPANGGLIRDSEQHIGLRTRSDGDG  254

Query  912   isifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKI  733
             I++FG++NVWIDHVSM  C DG+IDAI  STA+T+SN HFTDH +VMLFGAND    DK 
Sbjct  255   INLFGATNVWIDHVSMTRCSDGMIDAILGSTAVTVSNSHFTDHQEVMLFGANDKHEIDKK  314

Query  732   MQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP  553
             MQIT+AFNHFGKRL QRMPR R+G IHVVNNDYTHW MYAIGG+ +PTII  GNRFIAPP
Sbjct  315   MQITVAFNHFGKRLEQRMPRVRFGTIHVVNNDYTHWEMYAIGGNMNPTIISHGNRFIAPP  374

Query  552   DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN-FMDKHHKLYDGVMTFK  376
             +   K+ITKR   +  +WK W W+S+GD ++ GA+FVQSG PN +  K           +
Sbjct  375   NEQAKQITKREYTSYVDWKLWNWQSEGDYFLNGAYFVQSGKPNAWSPKPKNPIPNKFAIR  434

Query  375   AEDVTW---LTRFAGALNCRVGSPC  310
              +  T    LT  AG L C+ G  C
Sbjct  435   PKPGTMVRKLTMDAGVLGCKQGQAC  459



>ref|XP_010420165.1| PREDICTED: probable pectate lyase 19 isoform X3 [Camelina sativa]
Length=506

 Score =   432 bits (1110),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 223/358 (62%), Positives = 274/358 (77%), Gaps = 3/358 (1%)
 Frame = -2

Query  1377  GPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVTDNAD-DPSNPK  1201
             GPC A+NPID+CWRC  +WA  RK+L  C  GFG++T GGK G  Y VT N D D  NPK
Sbjct  150   GPCTASNPIDKCWRCRTNWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPK  209

Query  1200  PGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKN  1021
             PGTLRHAVIQK+PLWIIF +DM I+L QEL++   KTID RGA VHI+ GAGIT+QFVKN
Sbjct  210   PGTLRHAVIQKEPLWIIFKNDMSIRLSQELLINSHKTIDARGANVHIAHGAGITMQFVKN  269

Query  1020  ViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLI  841
             VIIHG+HIHHI E +GG+IRD +DHFG+RT++DGDG+SI+GSSN+W+DH+SM  C DGLI
Sbjct  270   VIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISMSKCQDGLI  329

Query  840   DAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYG  661
             DAI  ST ITISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK L+QRMPR R+G
Sbjct  330   DAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWG  389

Query  660   YIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTW  484
             ++HVVNNDYTHW +YAIGGS  PTI+  GNRFIAPP   H +E+TKR     +EWK W W
Sbjct  390   FVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHYREVTKRDYAPEDEWKHWIW  449

Query  483   RSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             RS+ D++M GA+F QSG+P+F   H +    +       V+ LT++AGAL+CRVG  C
Sbjct  450   RSEKDVFMNGAYFRQSGNPHFKCAHTR-KQMIKPKNGMAVSKLTKYAGALDCRVGKRC  506



>gb|KFK25747.1| hypothetical protein AALP_AA8G154300 [Arabis alpina]
Length=504

 Score =   432 bits (1110),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 228/377 (60%), Positives = 280/377 (74%), Gaps = 8/377 (2%)
 Frame = -2

Query  1419  NDTTRHLLGS-----KKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGK  1255
             N T R L G       K  GPC A+NPID+CWRC  DWA  RKRL  C  GFG++T GGK
Sbjct  129   NSTRRSLRGKGRGKWSKLKGPCTASNPIDKCWRCRPDWARRRKRLVKCVRGFGHRTTGGK  188

Query  1254  LGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGR  1078
              G  Y VT N D D  NP PGTLRHAVIQK+PLWIIF +DM I+L+QEL++   KTID R
Sbjct  189   RGRIYVVTSNLDEDMVNPVPGTLRHAVIQKEPLWIIFKNDMSIRLNQELLINSHKTIDAR  248

Query  1077  GAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifg  898
             GA VHI+ GAGIT+QFV+NVIIHG+HIHHI E +GG+IRD +DH+G+RT++DGDG+SI+G
Sbjct  249   GADVHIAHGAGITMQFVRNVIIHGLHIHHISESSGGMIRDSVDHYGMRTRADGDGLSIYG  308

Query  897   sSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITL  718
             SSN+W+DH+SM  C DGLIDAI  ST ITISN HFT HNDVML GA + + +DK MQ+T+
Sbjct  309   SSNIWLDHISMSKCQDGLIDAICGSTGITISNSHFTHHNDVMLLGAQNTNEEDKKMQVTV  368

Query  717   AFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP-DIHK  541
             A+NHFGK L+QRMPR R+G++HVVNNDYTHW +YAIGGS  PTI+  GNRFIAPP   H 
Sbjct  369   AYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPHY  428

Query  540   KEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVT  361
             +E+TKR   + +EWK W WRS+ DI+M GA+F QSG P +   H +    +       V+
Sbjct  429   REVTKRDYASEDEWKHWNWRSEKDIFMNGAYFRQSGTPGYKCAHTR-KQMIKPKNGMAVS  487

Query  360   WLTRFAGALNCRVGSPC  310
              LT++AGAL+CRVG  C
Sbjct  488   KLTKYAGALDCRVGKRC  504



>ref|XP_003554335.1| PREDICTED: pectate lyase-like [Glycine max]
Length=443

 Score =   429 bits (1104),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 242/441 (55%), Positives = 293/441 (66%), Gaps = 25/441 (6%)
 Frame = -2

Query  1617  IIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeae  1438
             +IP     IAE+D+  + +  EA + A +AY P P +++  L   V  +L          
Sbjct  23    VIPCLEAGIAEFDDFLKAQADEAQKIALEAYVPVPEDVTDELNFHVHLSL----------  72

Query  1437  aEDVTRNDTTRHLLGSKKYHGP-CNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKG  1261
                   N T R L   K   G  C A+NPID CWRC+ +WA +R RLA C  GFG +  G
Sbjct  73    -----ENSTRRELRQRKGRSGKKCVASNPIDTCWRCNKNWANDRYRLAKCGKGFGRRATG  127

Query  1260  GKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             G  G  Y VTDN+DD   NPKPGT+RHAV Q+ PLWIIF   M IKL+QEL++  DKTID
Sbjct  128   GLGGPIYVVTDNSDDDMVNPKPGTIRHAVTQRGPLWIIFQRSMMIKLNQELMISSDKTID  187

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
             GRGA V   DGAG+TIQFV NVIIHG+ I +I    GG+IRD  +H GLRTKSDGD ISI
Sbjct  188   GRGANVVFRDGAGLTIQFVNNVIIHGVRIKNIVPKEGGMIRDSYNHVGLRTKSDGDAISI  247

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FG+SNVWIDHVS+ NC DGLID I+ STAITISN H T HNDVMLFGA+D  + DKIMQI
Sbjct  248   FGASNVWIDHVSLSNCADGLIDVIQGSTAITISNCHMTKHNDVMLFGASDSYSGDKIMQI  307

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             T+AFNHFG+ L+QRMPRCR+G++HV+NNDYTHW MYAIGGSS PTI+ QGNRFIAP +  
Sbjct  308   TVAFNHFGQGLVQRMPRCRWGFVHVLNNDYTHWMMYAIGGSSGPTILSQGNRFIAPNNNA  367

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED-  367
              K IT R    P+ WK W W+S+ D+++ GA F+ SG P         Y   +  K  D 
Sbjct  368   AKLITHRDYAEPQVWKNWQWQSEMDLFINGAQFIPSGSP-----IKTTYKKGLLMKPRDG  422

Query  366   --VTWLTRFAGALNCRVGSPC  310
                + LTR +GALNC VG PC
Sbjct  423   THASRLTRNSGALNCIVGRPC  443



>emb|CDY63769.1| BnaCnng42620D [Brassica napus]
Length=479

 Score =   430 bits (1105),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 249/466 (53%), Positives = 309/466 (66%), Gaps = 30/466 (6%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHE--------VRRTL  1468
               +IP    + +E DE W +R  EA E   QAY  NP+ +     HE        V+ T 
Sbjct  16    AGLIPTIRANFSELDEYWSKRAGEAREFTLQAYHSNPYEV-VDHFHERHYDNSTDVKETE  74

Query  1467  SeavaeaeaeaEDVT------RNDTTRHLLGSKK------------YHGPCNATNPIDRC  1342
              ++  E   E ED          ++TR +L  K               GPC A+NPID+C
Sbjct  75    EDSDDEKPEEVEDDVIEMVGNEMNSTRRILRGKSKGKGKRKGKWSKLKGPCTASNPIDKC  134

Query  1341  WRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKK  1165
             WRC ++WA  RK L  C  GFG+ T GGK G  Y VT N DD   NPKPGTLRHAVIQK+
Sbjct  135   WRCRSNWAKRRKNLVKCVRGFGHSTIGGKRGRIYVVTSNRDDDMVNPKPGTLRHAVIQKE  194

Query  1164  PLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIF  985
             PLWIIF +DM I+L QEL++   KTID RGA VHI+ GAGITIQFV++VIIHG+HIHHI 
Sbjct  195   PLWIIFKNDMHIRLSQELMICSFKTIDARGANVHIAHGAGITIQFVRHVIIHGLHIHHIC  254

Query  984   EGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITIS  805
             + NGG+IRD   HFG+RT++DGDGISI+GSS +W+DH+SM  C DGLIDAI  STAITIS
Sbjct  255   QSNGGMIRDSEGHFGMRTRADGDGISIYGSSMIWLDHISMSKCQDGLIDAIVGSTAITIS  314

Query  804   NGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHW  625
             N HFT HNDVML GA + +  DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW
Sbjct  315   NSHFTHHNDVMLLGAQNDNQGDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHW  374

Query  624   NMYAIGGSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAF  448
              +YAIGGS  PTI+  GNRF+APP   H +E+TKR   +  EWK W WRS  D++M GA+
Sbjct  375   ELYAIGGSQAPTILSHGNRFVAPPHKPHYREVTKRDYASEHEWKHWNWRSDKDMFMNGAY  434

Query  447   FVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             F QSG+P+F   HH     +       V+ LT++AGAL+CRVG  C
Sbjct  435   FRQSGNPHF-KCHHTRKQMIKPKHGIAVSMLTKYAGALDCRVGKRC  479



>ref|XP_002882189.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58448.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=475

 Score =   429 bits (1104),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 237/461 (51%), Positives = 304/461 (66%), Gaps = 24/461 (5%)
 Frame = -2

Query  1623  GAIIPATVGHIA-EYDEVWRRREAEAIEHAQQAYEPNPHNI-------------------  1504
              ++IP    ++A E D+ W  +  EA +H   AY P+P+ I                   
Sbjct  16    ASLIPTIRANVADETDDYWVNKANEARKHTLMAYHPDPYEIVDHFHERHYDNSTDVEGTE  75

Query  1503  -SASLIHEVRRTLSeavaeaeaeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHA  1327
                ++  E    +    +   +    +T     +      K  GPC A+NPID+CWRC  
Sbjct  76    EEKAVASEEEDVIEMISSPTNSTRRSLTGRGKGKGKGKWSKLKGPCTASNPIDKCWRCQP  135

Query  1326  DWATNRKRLADCALGFGYKTKGGKLGNFYTVTD-NADDPSNPKPGTLRHAVIQKKPLWII  1150
             DWA  RK+L  C  GFGY+T GGK G  Y VT    DD  NP+PGTLRHAVIQK+PLWII
Sbjct  136   DWARRRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDMVNPRPGTLRHAVIQKEPLWII  195

Query  1149  FSHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGG  970
             F HDM I+L+QEL++   KTID RGA VHI+ GAGIT+Q+V N+IIHG+HIHHI + +GG
Sbjct  196   FKHDMSIRLNQELMIASHKTIDARGANVHIAYGAGITMQYVHNIIIHGLHIHHIVQSSGG  255

Query  969   LIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFT  790
             +IRD +DHFG R ++DGDGISIFG++N+W+DH+SM  C DGLIDAI  STAITISN HFT
Sbjct  256   MIRDSIDHFGQRGRADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTAITISNSHFT  315

Query  789   DHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAI  610
              HNDVML GA D +  DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW +YAI
Sbjct  316   HHNDVMLLGAQDNNMDDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAI  375

Query  609   GGSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSG  433
             GGS  PTI+  GNRFIAPP   H +E+TKR   +  EWK W WRS+ D++M  A+F QSG
Sbjct  376   GGSQGPTILSHGNRFIAPPHKQHYREVTKRDYASESEWKNWNWRSEKDVFMNNAYFRQSG  435

Query  432   DPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             +P+F   H +    +       V+ LT++AGAL+CRVG  C
Sbjct  436   NPHFKCSHSR-QQMIKPKHGVAVSKLTKYAGALDCRVGKAC  475



>sp|P40973.1|PLY_LILLO RecName: Full=Pectate lyase; Flags: Precursor [Lilium longiflorum]
 emb|CAA78976.1| pectate lyase [Lilium longiflorum]
 gb|AAA33398.1| pectate lyase [Lilium longiflorum]
Length=434

 Score =   427 bits (1099),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 243/431 (56%), Positives = 295/431 (68%), Gaps = 19/431 (4%)
 Frame = -2

Query  1599  GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTR  1420
              +IAE+DE W+++   A   A++AY P+P  ++      V  +                 
Sbjct  22    ANIAEFDEYWQKKSKVAQAKAKKAYTPHPEEVTNHFNKAVHSSFEG--------------  67

Query  1419  NDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFY  1240
             N T R+L  +K   G C ATNPIDRCWRC  +W+ NRK L  C  GFG KT GG  G  Y
Sbjct  68    NSTRRNLRTNKL--GQCLATNPIDRCWRCKKNWSANRKDLVKCVKGFGRKTTGGAAGEIY  125

Query  1239  TVTDNADDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVH  1063
              VTD +DD  ++PK GTLR  VIQ +PLWIIF   M I+L QELI+  DKTIDGRGA V 
Sbjct  126   VVTDPSDDSLTDPKFGTLRWGVIQDRPLWIIFGKSMVIRLKQELIINNDKTIDGRGANVQ  185

Query  1062  ISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVW  883
             I+ GA +T+QFV NVIIHGIHIH I  G GGLIRD   H G+RT+SDGDGISI GSSN+W
Sbjct  186   IAGGAQLTVQFVHNVIIHGIHIHDIKPGEGGLIRDSEKHSGIRTRSDGDGISIIGSSNIW  245

Query  882   IDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHF  703
             IDHVS+  C DGLID I  STAITISN H T+H+DVML GA+D  T+D+IMQ+T+AFNHF
Sbjct  246   IDHVSLARCSDGLIDVILGSTAITISNCHLTEHDDVMLLGASDTYTQDEIMQVTVAFNHF  305

Query  702   GKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKR  523
             G+ L+QRMPRCRYG++HVVNNDYTHW MYA+GGS HPTII QGNR+IAP     KE+TKR
Sbjct  306   GRGLVQRMPRCRYGFVHVVNNDYTHWIMYAVGGSQHPTIISQGNRYIAPHIEAAKEVTKR  365

Query  522   VKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFA  343
                 P EW  WTW+SQGD+++ GAFFV+SG P F +K+ K  D +       V  LTRF+
Sbjct  366   DYAEPAEWSKWTWKSQGDLFVSGAFFVESGGP-FENKYSK-KDLIKAKPGTFVQRLTRFS  423

Query  342   GALNCRVGSPC  310
             GALNC+    C
Sbjct  424   GALNCKENMEC  434



>ref|NP_001046281.1| Os02g0214400 [Oryza sativa Japonica Group]
 dbj|BAD25039.1| putative pectate lyase precursor [Oryza sativa Japonica Group]
 dbj|BAF08195.1| Os02g0214400 [Oryza sativa Japonica Group]
 dbj|BAG94880.1| unnamed protein product [Oryza sativa Japonica Group]
Length=446

 Score =   427 bits (1099),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 235/432 (54%), Positives = 292/432 (68%), Gaps = 22/432 (5%)
 Frame = -2

Query  1593  IAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRND  1414
             I E+DE W +R A A   A++ Y+P+P N++    H V R+                R  
Sbjct  33    IGEFDEHWEKRRAAAEAAAEEVYKPDPFNVTNEFNHAVIRS--------------TERGV  78

Query  1413  TTRHLLG-SKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYT  1237
               R L G + KY GPC ATNPIDRCWRC  DWAT+RKRLA CA+GFG    GG  G  Y 
Sbjct  79    LRRELSGKNSKYKGPCLATNPIDRCWRCRKDWATDRKRLARCAMGFGRGATGGVRGKIYV  138

Query  1236  VTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHI  1060
             VTD  D D +NP+ GTLR   +Q  PLWI F+  M I+L QEL++  DKTIDGRGAQVHI
Sbjct  139   VTDPGDGDAANPRYGTLRWGAMQAAPLWITFAKSMVIRLTQELLVASDKTIDGRGAQVHI  198

Query  1059  S-DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVW  883
             +  GAGIT+QF +NVII  +H+H +   +GG +RD   H G RT++DGDGIS+F +++VW
Sbjct  199   ARGGAGITVQFARNVIITSLHVHDVKHSDGGAVRDSPTHIGPRTRADGDGISLFAATDVW  258

Query  882   IDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHF  703
             +DHVSM  C DGLID ++ ST +TISN HFT+HNDVMLFGA+D   +DK+MQIT+AFNHF
Sbjct  259   VDHVSMSMCEDGLIDVVQGSTGVTISNSHFTNHNDVMLFGASDSYPQDKVMQITVAFNHF  318

Query  702   GKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKR  523
             G+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGG   PTI+ QGNR+IAPP+I  K IT+ 
Sbjct  319   GRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGGMSPTILSQGNRYIAPPNIAAKLITRH  378

Query  522   VKGTPE-EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRF  346
                 PE EWK W WRS GD++M GA+F  S     +++  K  D V       V  LTRF
Sbjct  379   Y--APEWEWKNWAWRSDGDLFMNGAYFQASNGA--INRKVKGSDMVKPKPGSYVRRLTRF  434

Query  345   AGALNCRVGSPC  310
             AGAL+CR G PC
Sbjct  435   AGALSCRPGEPC  446



>gb|KFK37588.1| hypothetical protein AALP_AA3G002600 [Arabis alpina]
Length=472

 Score =   428 bits (1101),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 239/460 (52%), Positives = 302/460 (66%), Gaps = 25/460 (5%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
              ++IP    ++AE D+ W  +  EA +     Y P+P+ I            ++     E
Sbjct  16    ASLIPTLRANVAETDDYWVNKANEARKRTLSVYHPDPYAIVDHFHERHYDNSTDVEEREE  75

Query  1443  aeaEDVTRNDTTR-----------HLLGSK-------KYHGPCNATNPIDRCWRCHADWA  1318
              EA      D T             L G++       K  GPC A+NPID+CWRC ADWA
Sbjct  76    HEATAFAEEDDTEMISSSTNSTRRSLSGNRGKRGKWSKLKGPCTASNPIDKCWRCQADWA  135

Query  1317  TNRKRLADCALGFGYKTKGGKLGNFYTVTD-NADDPSNPKPGTLRHAVIQKKPLWIIFSH  1141
               RK+L  C  GFGY+T GGK G  Y VT    DD  NPKPGTLRHAVIQK+PLWIIF H
Sbjct  136   KRRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDVVNPKPGTLRHAVIQKEPLWIIFKH  195

Query  1140  DMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIR  961
             DM I+L QEL++   KTID RGA VH++ GAGIT+Q+V N+IIHG+H+HHI EG+GG++R
Sbjct  196   DMSIRLKQELMINSHKTIDARGANVHVAYGAGITMQYVHNIIIHGLHVHHIIEGSGGMVR  255

Query  960   DGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHN  781
             + +DHFG R K+DGDGISIFG++N+W+DH+SM  C DGLIDAI  ST ITISN HFT HN
Sbjct  256   NSVDHFGFRGKADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTGITISNSHFTHHN  315

Query  780   DVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGS  601
             DVML GA+D +  DK MQ+T+A+NHFGK L+QRMPR R+G++HVVNNDYTHW +YAIGGS
Sbjct  316   DVMLLGAHDSNKDDKKMQVTVAYNHFGKGLVQRMPRVRWGFVHVVNNDYTHWELYAIGGS  375

Query  600   SHPTIICQGNRFIAPPDIHK---KEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGD  430
               PTI+  GNRFIA   +HK    E+TKR   +  EWK W WRS  D++M  A+F QSG+
Sbjct  376   QGPTILSHGNRFIA--SLHKPQYNEVTKRDYASESEWKNWNWRSDRDVFMNRAYFRQSGN  433

Query  429   PNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSPC  310
             P F   H +    +        + LT++AGAL+CRVG PC
Sbjct  434   PKFKCTHTR-QQMIKPKHGVAASMLTKYAGALDCRVGKPC  472



>gb|AAA16476.1| pectate lyase homolog [Zea mays]
 gb|AFW85884.1| hypothetical protein ZEAMMB73_308319 [Zea mays]
Length=438

 Score =   427 bits (1098),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 227/375 (61%), Positives = 277/375 (74%), Gaps = 7/375 (2%)
 Frame = -2

Query  1431  DVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKL  1252
             DV R  T R L    +Y GPC ATNPIDRCWRC ADWAT+RKRLA CA GFG++T GG  
Sbjct  70    DVLRATTRRAL---ARYDGPCMATNPIDRCWRCRADWATDRKRLAQCARGFGHRTVGGAA  126

Query  1251  GNFYTVTDNADDPSN-PKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRG  1075
             G  Y V D +DD    P+ GTLRHAVIQ +PLWI+F+ DM I+L QELI+  +KTIDGRG
Sbjct  127   GKLYVVRDPSDDEMIIPRKGTLRHAVIQDRPLWIVFARDMVIELRQELIVNHNKTIDGRG  186

Query  1074  AQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgs  895
             AQVHI   A IT+Q V+NVI+H +HIH     +GG+IRD   H+GLRT+SDGDG+S+  S
Sbjct  187   AQVHIM-FAQITLQNVQNVILHNLHIHDSKAHSGGMIRDSKRHYGLRTRSDGDGVSVLSS  245

Query  894   SNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLA  715
             SNVWIDHVSM +C DGLID +  STAIT+SN HFTDH+ VMLFGA++ S +D +MQ+T+A
Sbjct  246   SNVWIDHVSMSSCSDGLIDVVNGSTAITVSNSHFTDHDHVMLFGASNDSPQDAVMQVTVA  305

Query  714   FNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKE  535
             FNHFG+ L+QRMPRCRYG+ HVVNNDYTHW MYAIGG+ +PTII QGNRFIAP D + KE
Sbjct  306   FNHFGRGLVQRMPRCRYGFFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIAPDDPNAKE  365

Query  534   ITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWL  355
             +TKR     +++K W W+SQGD+ M GAFF +SG  N  ++ +  +D +       V  L
Sbjct  366   VTKREYTPYKDYKEWVWKSQGDVMMNGAFFNESGGQN--ERKYDRFDFIPAKHGRYVGQL  423

Query  354   TRFAGALNCRVGSPC  310
             TRFAG L C VG PC
Sbjct  424   TRFAGPLKCIVGQPC  438



>ref|NP_001150723.1| pectate lyase precursor [Zea mays]
 gb|ACG40127.1| pectate lyase precursor [Zea mays]
Length=451

 Score =   427 bits (1099),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 236/440 (54%), Positives = 301/440 (68%), Gaps = 27/440 (6%)
 Frame = -2

Query  1599  GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTR  1420
              +I ++DE W++R+  A   A+  Y+ +P  ++  L   V R+              V +
Sbjct  29    ANIGDFDEYWQQRKLMADAAAEATYKHDPVEVANQLNRAVHRS--------------VEK  74

Query  1419  ND--TTRHLLGS----KKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGG  1258
             +D  T R ++G+     K+ GPC ATNPIDRCWRC  DWAT+RKRLA CA GFG  T GG
Sbjct  75    DDIGTRREMMGTTTRKSKFSGPCRATNPIDRCWRCRQDWATDRKRLARCAKGFGRNTTGG  134

Query  1257  KLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDG  1081
               G FY VTD  DD   NP+PGTLR  VIQ +PLWI F+  M I L +ELI++GDKTIDG
Sbjct  135   LAGKFYVVTDGTDDDVVNPRPGTLRWGVIQIEPLWITFAKTMIITLKEELIIRGDKTIDG  194

Query  1080  RGAQVHISDGAGITIQFVKNViihgihihhIFEGN--GGLIRDGLDHFGLRTKsdgdgis  907
             RG QV I++GA +T+QFV NVIIH IHI+ I   N  GG +RD  DHFG RT SDGDGI+
Sbjct  195   RGVQVRITNGAQLTLQFVNNVIIHNIHINDIVSSNKDGGYVRDSPDHFGWRTVSDGDGIT  254

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             +FGS+NVW+DH+S+ NC DGLID I  ST +TISN H T+HNDVMLF ++D   +D+IMQ
Sbjct  255   VFGSTNVWLDHLSLSNCQDGLIDVIAKSTGVTISNCHLTNHNDVMLFSSSDKHPEDQIMQ  314

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             IT+AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTII QGNR+IAPP++
Sbjct  315   ITVAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKAPTIISQGNRYIAPPNL  374

Query  546   HKKEITKRVKGTPEE-WKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAE  370
               K++TK+   TPE  WK W W S+ D++MEGA+F  +G    +++     D +      
Sbjct  375   AAKQVTKQ-HDTPESVWKNWVWHSENDLFMEGAYFTVTGGQ--INRQFNKKDLIKPRNGS  431

Query  369   DVTWLTRFAGALNCRVGSPC  310
              VT LTR+AG+L C  G PC
Sbjct  432   YVTRLTRYAGSLACTPGKPC  451



>gb|AFW87059.1| pectate lyase [Zea mays]
Length=451

 Score =   427 bits (1098),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 234/438 (53%), Positives = 299/438 (68%), Gaps = 23/438 (5%)
 Frame = -2

Query  1599  GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTR  1420
              +I ++DE W++R+  A   A+  Y+ +P  ++  L   V R++ +              
Sbjct  29    ANIGDFDEYWQQRKLMADAAAEATYKHDPVEVANQLNRAVHRSVEKEDIG----------  78

Query  1419  NDTTRHLLGS----KKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKL  1252
               T R ++G+     K+ GPC ATNPIDRCWRC  DWAT+RKRLA CA GFG  T GG  
Sbjct  79    --TRREMMGTTTRKSKFSGPCRATNPIDRCWRCRQDWATDRKRLARCAKGFGRNTTGGLA  136

Query  1251  GNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRG  1075
             G FY VTD  DD   NP+PGTLR  VIQ +PLWI F+  M I L +ELI++GDKTIDGRG
Sbjct  137   GKFYVVTDGTDDDVVNPRPGTLRWGVIQIEPLWITFAKTMIITLKEELIIRGDKTIDGRG  196

Query  1074  AQVHISDGAGITIQFVKNViihgihihhIFEGN--GGLIRDGLDHFGLRTKsdgdgisif  901
              QV I++GA +T+QFV NVIIH IHI+ I   N  GG +RD  DHFG RT SDGDGI++F
Sbjct  197   VQVRITNGAQLTLQFVNNVIIHNIHINDIVSSNKDGGYVRDSPDHFGWRTVSDGDGITVF  256

Query  900   gsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQIT  721
             GS+NVW+DH+S+ NC DGLID I  ST +TISN H T+HNDVMLF ++D   +D+IMQIT
Sbjct  257   GSTNVWLDHLSLSNCQDGLIDVIAKSTGVTISNCHLTNHNDVMLFSSSDKHPEDQIMQIT  316

Query  720   LAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHK  541
             +AFNHFG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTII QGNR+IAPP++  
Sbjct  317   VAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKAPTIISQGNRYIAPPNLAA  376

Query  540   KEITKRVKGTPEE-WKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDV  364
             K++TK+   TPE  WK W W S+ D++MEGA+F  +G    +++     D +       V
Sbjct  377   KQVTKQ-HDTPESVWKNWVWHSENDLFMEGAYFTVTGGQ--INRQFNKKDLIKPRNGSYV  433

Query  363   TWLTRFAGALNCRVGSPC  310
             T LTR+AG+L C  G PC
Sbjct  434   TRLTRYAGSLACTPGKPC  451



>gb|EYU28712.1| hypothetical protein MIMGU_mgv1a006498mg [Erythranthe guttata]
Length=442

 Score =   427 bits (1097),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 237/439 (54%), Positives = 299/439 (68%), Gaps = 22/439 (5%)
 Frame = -2

Query  1617  IIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeae  1438
             +IP +   IA+YD+  R++  E+   + +A++PNP  ++  L  +V  TL          
Sbjct  23    LIPKSHAAIAKYDDYLRKKANESFAESLKAFDPNPEKVADELNEQVGETL----------  72

Query  1437  aEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGG  1258
                V  N + RHL    K    C ATNPIDRCWRC  DW+ NRK+LA+C  GFG++T GG
Sbjct  73    ---VHENLSRRHL----KEENDCKATNPIDRCWRCDGDWSKNRKKLAECVRGFGHRTTGG  125

Query  1257  KLGNFYTVTDNADDPSN-PKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDG  1081
             K G +Y VTD +DD  + PK GTLRHAVIQ +PLWIIF+  M I+L QELI   DKT+DG
Sbjct  126   KDGRYYLVTDPSDDDMDKPKNGTLRHAVIQSEPLWIIFARSMVIRLKQELIFASDKTVDG  185

Query  1080  RGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisif  901
             RG +V I+ GAG+T+QFV NVIIH I IH+I    GG+IRD +DH GLRT SDGDGI++F
Sbjct  186   RGVRVRIAYGAGLTLQFVHNVIIHNIRIHNIVSTPGGMIRDAVDHIGLRTVSDGDGINVF  245

Query  900   gsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQIT  721
              S+N+WIDHVS+    DGLID IE STAITISN  F +HN VML GA+D STKD IMQ+T
Sbjct  246   SSNNIWIDHVSLSKGTDGLIDVIEGSTAITISNCKFNNHNTVMLLGAHDNSTKDTIMQVT  305

Query  720   LAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHK  541
             +AFN FGK L+QRMPRCR+G+ HV+NNDY+ W MYAIGGSS+PTII QGNRF A  +   
Sbjct  306   VAFNRFGKGLVQRMPRCRWGFFHVINNDYSKWLMYAIGGSSNPTIISQGNRFKASDNPFT  365

Query  540   KEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYD-GVMTFKAEDV  364
             K++TKR + T  EWK W WRS+GD ++ GA+F +SG P        L +  ++ FK    
Sbjct  366   KQVTKR-ESTESEWKKWQWRSEGDKFVNGAYFRESG-PKVKHTISPLKEKNLIKFKPGSY  423

Query  363   TW-LTRFAGALNCRVGSPC  310
                LTR+AGALNC  G  C
Sbjct  424   AGRLTRYAGALNCVAGKSC  442



>ref|XP_002453531.1| hypothetical protein SORBIDRAFT_04g007450 [Sorghum bicolor]
 gb|EES06507.1| hypothetical protein SORBIDRAFT_04g007450 [Sorghum bicolor]
Length=445

 Score =   426 bits (1096),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 231/431 (54%), Positives = 290/431 (67%), Gaps = 18/431 (4%)
 Frame = -2

Query  1599  GHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTR  1420
              +IA++DE W++R+  A    ++ Y P+P+N++ S    V R  S               
Sbjct  32    ANIADFDEHWQKRKELAEASVRETYRPDPYNVTNSFNVAVHRATSLRR------------  79

Query  1419  NDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFY  1240
               T R +    K  GPC ATNPID+CWRC  DWAT+R RLA CA GFG  T GG  G  Y
Sbjct  80    --TMREMPRKHKKKGPCRATNPIDKCWRCKNDWATDRFRLARCARGFGQATTGGLGGPIY  137

Query  1239  TVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVH  1063
              VTD +D D  NP+PGTLR  VIQ  PLWIIF+  M I+L QEL++  DKTIDGRGAQVH
Sbjct  138   IVTDPSDGDVVNPRPGTLRWGVIQPGPLWIIFAKSMIIQLSQELLVSSDKTIDGRGAQVH  197

Query  1062  ISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVW  883
             I++GAGIT+Q  +NVIIH +H+H +    GGL+RD   H G RTK+DGDGIS+F ++NVW
Sbjct  198   IANGAGITVQLARNVIIHNLHVHDVLHSMGGLMRDSPTHVGSRTKADGDGISLFQATNVW  257

Query  882   IDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHF  703
             IDH+SM NC DGLID +++ST ITISN HFT+HNDVMLFGA+D   +D++MQIT+AFNHF
Sbjct  258   IDHISMSNCEDGLIDVVQSSTGITISNCHFTNHNDVMLFGASDSYPQDQMMQITVAFNHF  317

Query  702   GKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKR  523
             G+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGG   PTII QGNR+IAPP+I  K ITK 
Sbjct  318   GRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGGKAPTIISQGNRYIAPPNIAAKVITKH  377

Query  522   VKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFA  343
                   EWK W W ++ D++M GA F  SG    + +     + V       VT LTRF+
Sbjct  378   Y-AEEGEWKNWVWHTEDDLFMNGAIFEPSG--GAVQRQINSNEWVKPKPGTYVTRLTRFS  434

Query  342   GALNCRVGSPC  310
             G L+C +  PC
Sbjct  435   GTLSCCMSKPC  445



>ref|XP_011086389.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=442

 Score =   426 bits (1096),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 236/441 (54%), Positives = 298/441 (68%), Gaps = 27/441 (6%)
 Frame = -2

Query  1617  IIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeae  1438
             ++P +   IA+YDE  ++R   ++E +++A+ PNP  ++  L  +V  TL          
Sbjct  24    LLPKSGAAIAKYDEYLKKRAQASLEESRKAFNPNPEELADDLNDQVSETL----------  73

Query  1437  aEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGG  1258
                 TR    R+L       G C ATNPIDRCWRC  +W  NRK+LA+CA GFG++  GG
Sbjct  74    ----TREGGKRNL-----RQGGCKATNPIDRCWRCDPNWDKNRKQLAECARGFGHRATGG  124

Query  1257  KLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDG  1081
             K G +Y VTD +D D   PKPGTLRHAVIQ +PLWIIF  +M I L +ELI   DKT+DG
Sbjct  125   KSGRYYVVTDPSDNDMDKPKPGTLRHAVIQPQPLWIIFGRNMVITLKEELIFASDKTVDG  184

Query  1080  RGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisif  901
             RGA+VHI+ GAGIT+QFV NVIIH I IH I    GG+IRD +DH GLRT+SDGDGIS+F
Sbjct  185   RGAEVHIAYGAGITLQFVHNVIIHNIWIHDIVPEPGGMIRDAVDHIGLRTQSDGDGISVF  244

Query  900   gsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQIT  721
             GS+N+WIDHVS+    DGLID IE STA+TISN  F +HNDVML GA+D S KD IMQ+T
Sbjct  245   GSNNIWIDHVSLSKGTDGLIDVIEGSTAVTISNCKFNNHNDVMLLGAHDGSNKDSIMQVT  304

Query  720   LAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHK  541
             +AFN FG+ LIQRMPRCR G++HV+NNDY  W +YAIGGS+H TII QGNRF A  +   
Sbjct  305   VAFNQFGEGLIQRMPRCRLGFVHVINNDYDSWGLYAIGGSAHSTIISQGNRFKASNNPDT  364

Query  540   KEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKL---YDGVMTFKAE  370
             K++T+R   +  EWK W WRS+GD+++ GA+FV+SG P    KH KL       + F+  
Sbjct  365   KQVTRRAYASESEWKKWQWRSEGDMFLNGAYFVESGPP---IKHTKLPLRKKNSIKFRPG  421

Query  369   DVTW-LTRFAGALNCRVGSPC  310
                  LTR+AGA  C  G  C
Sbjct  422   SFAGRLTRYAGARMCFPGKLC  442



>ref|XP_004228388.1| PREDICTED: pectate lyase [Solanum lycopersicum]
Length=439

 Score =   426 bits (1095),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 240/444 (54%), Positives = 293/444 (66%), Gaps = 28/444 (6%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
              +++P     IAE+D    ++  EA+  + +AY  NP  I+ +   EV   L        
Sbjct  18    ASLVPHLHARIAEFDPYLEKQALEALNSSLEAYTNNPEEITNAFNKEVGNAL--------  69

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                  +      RHL    K    C ATNPIDRCWRC  +WA NR  L +CA GFG+KT 
Sbjct  70    -----LKYKSLRRHL----KEKDKCMATNPIDRCWRCDKNWAENRMDLEECARGFGHKTT  120

Query  1263  GGKLGNFYTVTDNADD-PSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTI  1087
             GGK G +Y VTD +DD    PKPGTLRHAVIQ++PLWIIF   M IKL QEL++  DKTI
Sbjct  121   GGKNGKYYVVTDESDDNVQEPKPGTLRHAVIQEEPLWIIFEKSMVIKLRQELMITSDKTI  180

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             DGRG  VHI+ GAG+ IQFV NVIIH I I +I   NGG+IRD ++H GLRT SDGDGIS
Sbjct  181   DGRGVAVHIAYGAGLMIQFVHNVIIHNIRIQNIISTNGGMIRDSINHIGLRTVSDGDGIS  240

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             IFGS+++WIDH ++  C DGLIDAI ASTAITISN  F  HNDVML GA D   +D IMQ
Sbjct  241   IFGSNHIWIDHCTLSECTDGLIDAIMASTAITISNCKFNYHNDVMLLGATDAFPQDAIMQ  300

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             +T+AFN FG+ LIQRMPRCR+G+ HVVNNDYTHW MYAIGGS+HPTII QGNRF A  + 
Sbjct  301   VTVAFNRFGEGLIQRMPRCRWGFFHVVNNDYTHWQMYAIGGSAHPTIISQGNRFKASDNP  360

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN----FMDKHHKLYDGVMTF  379
             + K++TKR   T  EWK W W S+GD ++ GA+FV+SG  +     + K+HK+      F
Sbjct  361   NTKQVTKRDYATESEWKKWQWVSEGDSFLNGAYFVESGPQDKKKTALTKNHKI-----KF  415

Query  378   K-AEDVTWLTRFAGALNCRVGSPC  310
             K       LTRFAG L C+ G PC
Sbjct  416   KPGSHAGRLTRFAGVLKCKPGIPC  439



>dbj|BAH20311.1| AT3G01270 [Arabidopsis thaliana]
Length=365

 Score =   422 bits (1086),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 219/361 (61%), Positives = 272/361 (75%), Gaps = 3/361 (1%)
 Frame = -2

Query  1386  KYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVTD-NADDPS  1210
             K  GPC A+NPID+CWRC  DWA  RK+L  C  GFGY+T GGK G  Y VT    DD  
Sbjct  6     KLTGPCTASNPIDKCWRCQPDWARRRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDMV  65

Query  1209  NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAGITIQF  1030
             NP+PGTLRHAVIQK+PLWI+F HDM I+L QEL++  DKTID RGA VHI+ GAGIT+Q+
Sbjct  66    NPRPGTLRHAVIQKEPLWIVFKHDMSIRLSQELMITSDKTIDARGANVHIAYGAGITMQY  125

Query  1029  VKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSMRNCYD  850
             V N+IIHG+H+HHI + +GGLIRD ++HFG R ++DGDGISIFG++N+W+DH+SM  C D
Sbjct  126   VHNIIIHGLHVHHIVKSSGGLIRDSINHFGHRGEADGDGISIFGATNIWLDHISMSKCQD  185

Query  849   GLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQRMPRC  670
             GLIDAI  STAITISN HFT HNDVML GA + +  DK MQ+T+A+NHFGK L+QRMPR 
Sbjct  186   GLIDAIMGSTAITISNSHFTHHNDVMLLGAQNNNMDDKKMQVTVAYNHFGKGLVQRMPRV  245

Query  669   RYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPP-DIHKKEITKRVKGTPEEWKT  493
             R+G++HVVNNDYTHW +YAIGGS  PTI+  GNRFIAPP   H +E+TKR   +  EWK 
Sbjct  246   RWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKQHYREVTKRDYASESEWKN  305

Query  492   WTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCRVGSP  313
             W WRS+ D++M  A+F QSG+P+F   H +    +       V+ LT++AGAL+CRVG  
Sbjct  306   WNWRSEKDVFMNNAYFRQSGNPHFKCSHSR-QQMIKPKNGMAVSKLTKYAGALDCRVGKA  364

Query  312   C  310
             C
Sbjct  365   C  365



>ref|XP_004489168.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=444

 Score =   426 bits (1094),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 237/439 (54%), Positives = 295/439 (67%), Gaps = 17/439 (4%)
 Frame = -2

Query  1614  IPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaea  1435
             IP     IAE+D+  + +   A + A ++Y PNP NI+  L   V   +           
Sbjct  19    IPCLEAGIAEFDDYLKEQADLARQIALKSYVPNPENITTELNLHVNMAME----------  68

Query  1434  EDVTRNDTTRHLLGSKKYHG--PCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKG  1261
              +   N T R L   +K+ G   C ++NPID CWRC  DWA NR++LA C  GFG K  G
Sbjct  69    -EAYSNSTRRELRQRQKHGGSSACMSSNPIDNCWRCKKDWAQNRQQLAQCGKGFGRKAVG  127

Query  1260  GKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             G  G FY VTD +D D   PK GTLR+  +QK PLWIIF+  M I+L+QEL++  DKTID
Sbjct  128   GLGGKFYVVTDESDNDLVTPKFGTLRYGAVQKGPLWIIFARSMIIRLNQELLVSSDKTID  187

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
             GRGA VHI DGAGIT+QFV NVIIHG+HI +I   +GG+IRD  +H GLRT+SDGD +S+
Sbjct  188   GRGANVHIRDGAGITMQFVNNVIIHGLHIRNIKARSGGMIRDSYNHVGLRTRSDGDALSV  247

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             FGSSN+WIDH+S+    DGLID I+ STAITISN H T HNDVMLFGA+D  + DKIMQI
Sbjct  248   FGSSNIWIDHISLSESEDGLIDVIQGSTAITISNCHMTKHNDVMLFGASDSYSDDKIMQI  307

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             T+AFNHFG+ LIQRMPRCR+G+ HV+NNDYTHW MYAIGGSS PTI+ QGNRFIAP +  
Sbjct  308   TVAFNHFGQGLIQRMPRCRWGFFHVLNNDYTHWLMYAIGGSSGPTILSQGNRFIAPNNNA  367

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFK-AED  367
              K IT R   + + W  W WRS+ D++M GA F++SG P       K Y  +M  +    
Sbjct  368   AKTITHRDYASQDVWSKWQWRSENDLFMNGATFIESGAPIKNLPFKKGY--LMKPRPGTQ  425

Query  366   VTWLTRFAGALNCRVGSPC  310
                LTR+AGALNC++G PC
Sbjct  426   ANRLTRYAGALNCQIGRPC  444



>ref|XP_004489374.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=447

 Score =   425 bits (1092),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 241/439 (55%), Positives = 286/439 (65%), Gaps = 21/439 (5%)
 Frame = -2

Query  1614  IPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaea  1435
             IP     IAE+D+  R +  EA + A  +Y P P +++  L   V   L  A        
Sbjct  26    IPCLEAGIAEFDDFLRAQAEEAHKLALASYVPIPGDVAHDLNFHVHLALEGA--------  77

Query  1434  EDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGK  1255
                  NDT R L         C ATNPID CWRC  DWA +R +LA C+ GFG +  GG 
Sbjct  78    -----NDTRRELKQKHAAGEACEATNPIDSCWRCQKDWANDRFKLAKCSKGFGRRATGGL  132

Query  1254  LGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGR  1078
              G  Y VTD +D D  NPKPGTLR+  +QK PLWI F   M I+L+QEL++  DKTIDGR
Sbjct  133   GGPIYVVTDESDNDMQNPKPGTLRYGAVQKGPLWITFQRSMIIRLNQELLVSSDKTIDGR  192

Query  1077  GAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifg  898
             GA V I DG GIT+QFV NVIIHG+HI +I    G +IRD  +H G RT+SDGD +SIFG
Sbjct  193   GANVQIRDGGGITMQFVNNVIIHGLHISNIKSKPGAMIRDSYNHVGQRTRSDGDALSIFG  252

Query  897   sSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITL  718
             SSN+WIDHVS+  C DGLID I+ STAITISN H T HNDVMLFGA+D    DK+MQIT+
Sbjct  253   SSNIWIDHVSLSQCEDGLIDVIQGSTAITISNCHMTKHNDVMLFGASDTYNGDKLMQITV  312

Query  717   AFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKK  538
             AFNHFG+ LIQRMPRCR+G++HVVNNDYTHW MYAIGGSS PTI+ QGNRFIAP +   K
Sbjct  313   AFNHFGQGLIQRMPRCRFGFVHVVNNDYTHWQMYAIGGSSGPTILSQGNRFIAPDNDAAK  372

Query  537   EITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED---  367
             EIT R    PE WK W W+S+ D++M GA FV SG P       K +      K  D   
Sbjct  373   EITHRDYAEPEVWKNWQWQSEMDLFMNGAKFVTSGSPINKAPFKKGF----IMKPRDGSH  428

Query  366   VTWLTRFAGALNCRVGSPC  310
             V+ LTR +GALNC VG PC
Sbjct  429   VSRLTRHSGALNCVVGKPC  447



>ref|XP_004298448.1| PREDICTED: probable pectate lyase 3-like [Fragaria vesca subsp. 
vesca]
Length=443

 Score =   425 bits (1092),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 238/426 (56%), Positives = 293/426 (69%), Gaps = 18/426 (4%)
 Frame = -2

Query  1581  DEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRNDTTRH  1402
             DE W++R A+A+  A  +  P+P N++     +V   +             + +N T R 
Sbjct  34    DEYWKQRAADAMRIANASVHPDPENVTEEFNAKVHEHI-------------MGQNRTRRT  80

Query  1401  LLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVTDNA  1222
             L G K+Y GPC ATNPID CWRC  +WA NR++L DC++GFG KT GGK G  Y VTD +
Sbjct  81    LRGFKRYEGPCRATNPIDACWRCDPEWADNRQKLVDCSMGFGKKTTGGKGGPIYVVTDGS  140

Query  1221  DDP-SNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAG  1045
             DD   NPK GTLR+AV +K+PLWIIF+H M I+L QEL++  DKTIDGRGA + I+ G G
Sbjct  141   DDDIVNPKEGTLRYAVTRKRPLWIIFAHSMVIRLQQELMVTCDKTIDGRGANIVIAYGGG  200

Query  1044  ITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSM  865
             IT+Q+V NVII  I +  I    GG++RD  DH GLRT+SDGDGIS+F +SN+WIDHVSM
Sbjct  201   ITLQYVNNVIITNIKVKDIQSLPGGMLRDAEDHVGLRTRSDGDGISLFSASNIWIDHVSM  260

Query  864   RNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQ  685
                 DGLID I  STA+TISNGHFTDHN+ MLFGA +  T+DK MQITLAFNHFG+ L+Q
Sbjct  261   ARTADGLIDCIMGSTAVTISNGHFTDHNEAMLFGAKNTHTQDKNMQITLAFNHFGQGLVQ  320

Query  684   RMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPE  505
             RMPRCR+G+ HVVNNDYT W MYAIGG+ +PTII QGNRFIAP     KE+TKR      
Sbjct  321   RMPRCRFGFFHVVNNDYTQWIMYAIGGNMNPTIISQGNRFIAPESHVAKEVTKREYTDES  380

Query  504   EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVT-WLTRFAGALNC  328
             EWK W WRS+GD+   GAFFV+SG+PN     +     +M FK   +   LT FAGAL C
Sbjct  381   EWKNWNWRSEGDVMENGAFFVESGNPNCAKSTNI---EMMPFKPGKLAPQLTSFAGALEC  437

Query  327   RVGSPC  310
              VG PC
Sbjct  438   FVGRPC  443



>gb|EPS73633.1| hypothetical protein M569_01123, partial [Genlisea aurea]
Length=455

 Score =   425 bits (1093),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 245/452 (54%), Positives = 292/452 (65%), Gaps = 41/452 (9%)
 Frame = -2

Query  1590  AEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRNDT  1411
             A+ DE  + R  EA   + +AY+ NP +++      V  +L             +  N T
Sbjct  20    AQLDEYMKSRAEEARRESLKAYKDNPEDVAEQFNQLVSDSL-------------IGANST  66

Query  1410  TRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVT  1231
              R L G     G C ATNPIDRCWRC  DWA NRK+LADC  GFG+ T GGK G +Y VT
Sbjct  67    RRDLRG---VGGGCRATNPIDRCWRCDNDWAKNRKKLADCVRGFGHDTTGGKNGRYYLVT  123

Query  1230  DNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISD  1054
             D +D D +NPKPGTLRHAVIQK+PLWIIF+H M I+L+QELI    KTIDGRG QVHI++
Sbjct  124   DPSDNDMANPKPGTLRHAVIQKEPLWIIFAHSMIIRLNQELIFTSHKTIDGRGVQVHIAN  183

Query  1053  GAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDH  874
             GAG+TIQFV NVIIH I IH+I    GG+IRD +DH GLRT SDGD ISI+GSS VWIDH
Sbjct  184   GAGLTIQFVTNVIIHNIWIHNIAPAGGGMIRDSIDHIGLRTMSDGDAISIYGSSRVWIDH  243

Query  873   VSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKR  694
             VS+   YDGLIDAI+ STAITISN  F  HNDVML GA+D +  D IMQ+T+AFN FG  
Sbjct  244   VSLSKAYDGLIDAIQGSTAITISNCKFNHHNDVMLLGAHDDNPGDAIMQVTVAFNRFGIG  303

Query  693   LIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIA---------------  559
              IQRMPR R+G++HVVNNDY HW +YAIGGS+HPTII QGNR+ A               
Sbjct  304   CIQRMPRVRWGFVHVVNNDYQHWELYAIGGSAHPTIISQGNRYRASDYRYTKEVRNPNYS  363

Query  558   ----PPDIHKK----EITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK  403
                 PP  H+K    ++TKR      EW  W WRS+GD +M GAFF QSG P  +     
Sbjct  364   LSPLPPKSHRKTQNLQVTKRDYAPKSEWSKWKWRSEGDFFMNGAFFTQSGSPFSVGTKPL  423

Query  402   LYDGVMTFK-AEDVTWLTRFAGALNCRVGSPC  310
                 V+ +K    V  LTR AGA+ CR GS C
Sbjct  424   TKRNVIKYKPGTYVGRLTRNAGAMKCRKGSYC  455



>ref|NP_178375.1| putative pectate lyase 6 [Arabidopsis thaliana]
 sp|O64510.1|PLY6_ARATH RecName: Full=Probable pectate lyase 6; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC05350.1| putative pectate lyase [Arabidopsis thaliana]
 gb|AAO64162.1| putative pectate lyase [Arabidopsis thaliana]
 gb|AAV34776.1| At2g02720 [Arabidopsis thaliana]
 gb|AEC05615.1| putative pectate lyase 6 [Arabidopsis thaliana]
Length=455

 Score =   424 bits (1091),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 236/444 (53%), Positives = 293/444 (66%), Gaps = 13/444 (3%)
 Frame = -2

Query  1620  AIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaea  1441
              ++P+   HIAEYDE W +R+  A+    ++Y+PNP N++    +     +         
Sbjct  18    VVVPSVQAHIAEYDEYWTQRQTNALRETLESYDPNPENVTDHFNYHAALAMETTGIV---  74

Query  1440  eaEDVTRNDTTRHLLGSK--KYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKT  1267
                + TR D  +   G K  +  G   + N ID+CWR   +W  NRK+LADC LGFG KT
Sbjct  75    ---NETRRDLRQVGRGKKTTRRGGRFESLNAIDKCWRGDKNWDKNRKKLADCVLGFGRKT  131

Query  1266  KGGKLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKT  1090
              GGK G  Y VTD +D D   PKPGT+RHAV + +PLWIIF+  M IKL QELI+  DKT
Sbjct  132   TGGKNGPIYVVTDPSDNDLLKPKPGTIRHAVTRDRPLWIIFARSMIIKLQQELIITNDKT  191

Query  1089  IDGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgi  910
             IDGRGA+++I+ GAG+T+QFV+NVIIH IHI  I  G GGLI D   HFGLRT SDGDGI
Sbjct  192   IDGRGAKIYITGGAGLTLQFVRNVIIHNIHIKQIKRGAGGLIIDSEQHFGLRTVSDGDGI  251

Query  909   sifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIM  730
             +IFG++NVWIDHVSM +C DG+IDAI  STAITISN HFTDH++VMLFG  +    DK M
Sbjct  252   NIFGATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGTNKDVIDKKM  311

Query  729   QITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPD  550
             QIT+AFNHFGKRL QRMPR R+G +HVVNNDYTHW MYAIGG+ +PTII QGNRFIAPP 
Sbjct  312   QITVAFNHFGKRLKQRMPRVRFGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPI  371

Query  549   IHKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHK----LYDGVMT  382
                K++TKR      EWK+W W+S+ D ++ GA+FVQSG  N      K        +  
Sbjct  372   EDSKQVTKREYTPYPEWKSWNWQSEKDYFLNGAYFVQSGKANAWSATPKNPIPRKFAIRP  431

Query  381   FKAEDVTWLTRFAGALNCRVGSPC  310
                  V  LT+ AG L C+ G  C
Sbjct  432   QPGTKVRRLTKDAGTLGCKPGKSC  455



>ref|XP_011087066.1| PREDICTED: pectate lyase [Sesamum indicum]
Length=431

 Score =   423 bits (1088),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 235/437 (54%), Positives = 294/437 (67%), Gaps = 34/437 (8%)
 Frame = -2

Query  1611  PATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaE  1432
             P +   IA+YDE  +++   A E A +A++PNP  ++  L ++V  T             
Sbjct  26    PESRAAIAKYDEYLQKKAEVASEEALKAFDPNPEKLADDLNYQVSET-------------  72

Query  1431  DVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKL  1252
                                   ATNPIDRCWRC  +WA NR++LADCA GFG++  GGK 
Sbjct  73    -----------------EDDFKATNPIDRCWRCDRNWAQNRQKLADCARGFGHRATGGKG  115

Query  1251  GNFYTVTDNADDPSN-PKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRG  1075
             G +Y VTD +DD  + PKPGTLRHA IQK+PLWIIF++ M IKL +EL+   +KT+DGRG
Sbjct  116   GRYYVVTDPSDDDMDKPKPGTLRHAAIQKEPLWIIFANHMVIKLKEELLFASNKTLDGRG  175

Query  1074  AQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgs  895
             A+VHI+ GAGIT+QFV NVIIH I IH I    GG+IRD +DH GLRT+SDGDGIS+F S
Sbjct  176   AKVHIAYGAGITLQFVHNVIIHNIRIHDIHPAPGGMIRDAVDHIGLRTRSDGDGISVFNS  235

Query  894   SNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLA  715
             +N+WIDHVS+    DGLID IE STAITISN  F  HNDVML GA+D + KD IMQIT+A
Sbjct  236   NNIWIDHVSLSKGTDGLIDVIEGSTAITISNCKFNHHNDVMLLGAHDSTAKDSIMQITVA  295

Query  714   FNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKE  535
             FN FGK LIQRMPR R+G++HV+NNDY+HW MYAIGGS+HPTII QGNRF A  + H KE
Sbjct  296   FNRFGKGLIQRMPRIRWGFVHVINNDYSHWEMYAIGGSAHPTIISQGNRFKAANNQHTKE  355

Query  534   ITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYD-GVMTFKAEDVTW  358
             +TKR+     EW+ W WRS+GD +  GA+FV+SG P     +  L +  ++ FK      
Sbjct  356   VTKRMFAEKSEWEKWQWRSEGDKFTNGAYFVESG-PAIRRTNLPLTEKSLIKFKPGSFAG  414

Query  357   -LTRFAGALNCRVGSPC  310
              LTR+AGAL CR G  C
Sbjct  415   RLTRYAGALKCREGKLC  431



>ref|XP_008679844.1| PREDICTED: pectate lyase [Zea mays]
 gb|AFW66064.1| pectate lyase-like protein [Zea mays]
Length=444

 Score =   424 bits (1090),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 235/433 (54%), Positives = 298/433 (69%), Gaps = 24/433 (6%)
 Frame = -2

Query  1596  HIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRN  1417
             ++ ++D+  ++R+  A   A++AY P+P+N++ S    V R +S +  E         R 
Sbjct  32    NVGQFDDHLQKRKELAEASAREAYRPDPYNVTNSFNAAVHRAVSSSRREM--------RE  83

Query  1416  DTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYT  1237
                +H     K  GPC ATNPID+CWRC  DWAT+R+RLA CA GFG+ T GG  G  Y 
Sbjct  84    RPRKH-----KKRGPCRATNPIDKCWRCRRDWATDRQRLARCARGFGHATTGGLGGKIYV  138

Query  1236  VTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHI  1060
             VTD  D D  NP+PGTLR  VIQ  PLWIIF+  M I+L QEL+M  DKTIDGRGAQVHI
Sbjct  139   VTDPTDLDVVNPRPGTLRWGVIQPGPLWIIFARSMIIQLSQELLMSSDKTIDGRGAQVHI  198

Query  1059  SDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWI  880
             ++GAGIT+Q  +NVIIH +H+H +    GGL+RD   H G RT++DGDGIS+F ++NVWI
Sbjct  199   ANGAGITVQLAQNVIIHNLHVHDVKHTMGGLMRDSPTHIGSRTRADGDGISLFSATNVWI  258

Query  879   DHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFG  700
             DH+SM NC DGLID +++ST ITISN HFT+HNDVMLFGA+D   +D+IMQIT+AFNHFG
Sbjct  259   DHISMSNCEDGLIDVVQSSTGITISNCHFTNHNDVMLFGASDSWPQDQIMQITVAFNHFG  318

Query  699   KRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRV  520
             + L+QRMPRCR+G+ HVVNNDYTHW MYAIGG   PTII QGNR+IAPP+I  K ITK  
Sbjct  319   RGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGGDAPTIISQGNRYIAPPNIAAKVITKHY  378

Query  519   KGTPEE--WKTWTWRSQGDIYMEGAFFVQSGD-PNFMDKHHKLYDGVMTFKAEDVTWLTR  349
                 EE  WK W W ++ D++M GA F  SG  P  +D +  +     T+    VT LTR
Sbjct  379   A---EEGVWKNWVWHTEDDLFMNGAIFNPSGGAPKQVDTNEWVKPKPGTY----VTRLTR  431

Query  348   FAGALNCRVGSPC  310
             F+G L+C  G PC
Sbjct  432   FSGTLSCCTGKPC  444



>ref|XP_007137422.1| hypothetical protein PHAVU_009G125800g [Phaseolus vulgaris]
 gb|ESW09416.1| hypothetical protein PHAVU_009G125800g [Phaseolus vulgaris]
Length=439

 Score =   424 bits (1089),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 238/440 (54%), Positives = 288/440 (65%), Gaps = 25/440 (6%)
 Frame = -2

Query  1614  IPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaea  1435
             IP     IAE+D+  + +  +A + A ++Y P P  +++ L + V  ++           
Sbjct  20    IPCLEAGIAEFDDFLKAQSEKAHKIALESYVPTPEFVASELNYHVHLSM-----------  68

Query  1434  EDVTRNDTTRHL-LGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGG  1258
                  N T R L  G+     PC+++NPID CWRC+ DWA +R RLA C  GFG +  GG
Sbjct  69    ----LNSTRRGLKAGNNDAGAPCDSSNPIDNCWRCNKDWANDRYRLAKCGKGFGRRAVGG  124

Query  1257  KLGNFYTVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDG  1081
               G  Y VTDN+D D  NPK GTLR+ V QK PLWI F+  M I L QEL++  DKTIDG
Sbjct  125   LGGPIYVVTDNSDEDMVNPKEGTLRYGVTQKGPLWITFARSMIITLQQELLISSDKTIDG  184

Query  1080  RGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisif  901
             RGA V I DGAG+T+QFV NVIIHGI + +I    GG+IRD  +H GLRT+SDGD IS+F
Sbjct  185   RGANVQIRDGAGLTMQFVNNVIIHGIRVKNIVSKEGGMIRDSYNHVGLRTRSDGDAISVF  244

Query  900   gsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQIT  721
             G+SN+WIDHVS+ N  DGLID I+ STAITISN H T HNDVMLFGA D  + DKIMQIT
Sbjct  245   GASNIWIDHVSLSNSDDGLIDVIQGSTAITISNCHMTRHNDVMLFGATDTYSGDKIMQIT  304

Query  720   LAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHK  541
             +AFNHFG+ LIQRMPRCR G+ HV+NNDYTHW MYAIGGS+ PTI+ QGNRFIAP +   
Sbjct  305   VAFNHFGQGLIQRMPRCRMGFFHVLNNDYTHWMMYAIGGSAAPTILSQGNRFIAPNNDAA  364

Query  540   KEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED--  367
             KEIT RV   PE WK W W+S  D+ M GA F  SG P         Y   +  K  D  
Sbjct  365   KEITHRVDAEPEVWKNWQWQSDMDLLMNGATFNTSGSPITTQ-----YKKGLLMKPRDGT  419

Query  366   -VTWLTRFAGALNCRVGSPC  310
              V+ LTR AGALNC VG PC
Sbjct  420   HVSRLTRHAGALNCFVGLPC  439



>ref|XP_010096345.1| putative pectate lyase 7 [Morus notabilis]
 gb|EXB63820.1| putative pectate lyase 7 [Morus notabilis]
Length=399

 Score =   422 bits (1084),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 250/431 (58%), Positives = 283/431 (66%), Gaps = 38/431 (9%)
 Frame = -2

Query  1596  HIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRN  1417
             HIAE+D+ W+ R  EA + A QAY P+PH ++  L ++V+  L+              +N
Sbjct  5     HIAEFDDYWKSRAEEARKDALQAYSPHPHEVTDQLNYDVQEALT-------------AKN  51

Query  1416  DTTRHLLGSK-KYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFY  1240
             +T R L G K K  GPC ATNPIDRCWRC  +WA NRKRLADC LGFG  T GGK G +Y
Sbjct  52    NTRRQLRGRKNKKGGPCMATNPIDRCWRCDPNWANNRKRLADCTLGFGRNTVGGKFGPYY  111

Query  1239  TVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVH  1063
              VTD +D D  NPKPGTLRHAVIQKKPLWIIF+  M I+L +ELIM GDKTID RGA V 
Sbjct  112   IVTDPSDTDLINPKPGTLRHAVIQKKPLWIIFARSMIIRLSEELIMTGDKTIDARGANVR  171

Query  1062  ISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVW  883
             I+ GAGITIQFVKNVIIH +HIH I    GG IRD  DH G RTKSDGDGISIFGSSNVW
Sbjct  172   IAYGAGITIQFVKNVIIHNLHIHDIVASGGGNIRDSADHVGFRTKSDGDGISIFGSSNVW  231

Query  882   IDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHF  703
             IDHVSM NC DGLIDAI  STAITISN HFT HN+    G N + T     QI       
Sbjct  232   IDHVSMSNCQDGLIDAIMGSTAITISNCHFTHHNES---GFNSMHTSKFRGQI-------  281

Query  702   GKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKR  523
                         +G+ HVVNNDYTHW MYAIGGS HPTII QGNRFIAPP+   K++TKR
Sbjct  282   ------------WGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPPNDAAKQVTKR  329

Query  522   VKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFA  343
                   EWK W WRS+GD+ M GAFFVQSG      +     D +       VT LTR+A
Sbjct  330   DYAPESEWKNWQWRSEGDLLMNGAFFVQSGK-RLSKRRFSRLDMIKYKPGTFVTRLTRYA  388

Query  342   GALNCRVGSPC  310
             G L C VG PC
Sbjct  389   GTLLCGVGRPC  399



>ref|XP_002437815.1| hypothetical protein SORBIDRAFT_10g003090 [Sorghum bicolor]
 gb|EER89182.1| hypothetical protein SORBIDRAFT_10g003090 [Sorghum bicolor]
Length=444

 Score =   423 bits (1087),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 224/375 (60%), Positives = 274/375 (73%), Gaps = 7/375 (2%)
 Frame = -2

Query  1431  DVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKL  1252
             DV R  T R L    +Y GPC ATNPIDRCWRC +DWA +RKRLA CA GFG++T GG  
Sbjct  76    DVLRATTRRAL---ARYSGPCMATNPIDRCWRCRSDWAADRKRLARCARGFGHRTTGGAA  132

Query  1251  GNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRG  1075
             G  Y VTD +DD    P+ GTLRHAVIQ +PLWI+F+ DM I+L QELI+  DKTIDGRG
Sbjct  133   GKLYVVTDPSDDEMIVPRKGTLRHAVIQDRPLWIVFARDMVIRLRQELIVTSDKTIDGRG  192

Query  1074  AQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgs  895
             AQVH+  GA +T+Q V +VI+H +HIH     +GG+IRD   H G+RT+SDGDGIS+  S
Sbjct  193   AQVHVV-GAQVTLQSVHDVILHNLHIHDAVAHSGGMIRDSKRHTGMRTRSDGDGISVLSS  251

Query  894   SNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLA  715
             SNVWIDHVSM  C DGLID +  STAIT+SN HFT H+ VMLFGA++ + +D++MQIT+A
Sbjct  252   SNVWIDHVSMSRCADGLIDVVNGSTAITVSNSHFTHHDHVMLFGASNDNPQDEVMQITVA  311

Query  714   FNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKE  535
             FNHFG+ L+QRMPRCRYG+ HVVNNDYTHW MYAIGG+ +PTII QGNRFIAP D + KE
Sbjct  312   FNHFGRGLVQRMPRCRYGFFHVVNNDYTHWIMYAIGGNKNPTIISQGNRFIAPDDPNAKE  371

Query  534   ITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWL  355
             +TKR     +++K W W+SQGD+ M GAFF +SG  N  ++ +   D +       V  L
Sbjct  372   VTKREYTAYKDYKEWVWKSQGDVMMNGAFFNESGGQN--ERKYDELDFIPAKHGRYVGQL  429

Query  354   TRFAGALNCRVGSPC  310
             TRFAG L C VG PC
Sbjct  430   TRFAGPLKCIVGQPC  444



>ref|XP_004964534.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=438

 Score =   423 bits (1087),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 234/425 (55%), Positives = 288/425 (68%), Gaps = 25/425 (6%)
 Frame = -2

Query  1581  DEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRNDTTRH  1402
             +E W  R  EA  + + AY  +P         E  R                    TTR 
Sbjct  38    EEYWAERAEEARANNRAAYVSDPIAAMNRFNTETLRA-------------------TTRR  78

Query  1401  LLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYTVTDNA  1222
              L  ++Y GPC ATNPID CWRC ADWAT+R+RLA CA GFG+KT GG  G  Y VTD +
Sbjct  79    SL--RRYQGPCAATNPIDSCWRCRADWATDRQRLALCARGFGHKTTGGAGGKIYIVTDAS  136

Query  1221  DDPSN-PKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHISDGAG  1045
             DD    P+ GTLR+ VIQ +PLWI+F+ DM ++L QELI+  +KTIDGRGAQVHI+ GA 
Sbjct  137   DDEMIIPRKGTLRYGVIQGRPLWIVFARDMVVRLRQELIVSDNKTIDGRGAQVHIT-GAQ  195

Query  1044  ITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWIDHVSM  865
             IT+Q V +VIIH +HIHH    +GG+IRD   H+GLRT+SDGDGIS+  SSNVWIDHVSM
Sbjct  196   ITLQSVSHVIIHNVHIHHSAPHSGGIIRDSKRHYGLRTRSDGDGISVLSSSNVWIDHVSM  255

Query  864   RNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFGKRLIQ  685
               C DGLID +  ST IT+SN HFT H+ VMLFGA++ + +D++MQ+T+AFNHFGK L+Q
Sbjct  256   YRCSDGLIDVVNGSTGITVSNSHFTKHDHVMLFGASNDNPQDRMMQVTVAFNHFGKGLVQ  315

Query  684   RMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRVKGTPE  505
             RMPRCRYG+ HVVNNDYTHW MYAIGG+ +PTII QGNRFIAP D + KE+TKR      
Sbjct  316   RMPRCRYGFFHVVNNDYTHWQMYAIGGNKNPTIISQGNRFIAPDDPNAKEVTKREYTPYS  375

Query  504   EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFAGALNCR  325
             E+K W W+SQGD+ M GAFF +SG  N  ++ +   D +       V  LT+FAG LNCR
Sbjct  376   EYKDWVWKSQGDVMMNGAFFNESGGQN--ERKYDQLDFIPARHGSYVGELTKFAGTLNCR  433

Query  324   VGSPC  310
              G PC
Sbjct  434   AGKPC  438



>ref|XP_009380431.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=436

 Score =   422 bits (1086),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 234/431 (54%), Positives = 291/431 (68%), Gaps = 22/431 (5%)
 Frame = -2

Query  1593  IAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTR--  1420
             I +YDE W +REAEA+ +  QAY   P ++                        D+ +  
Sbjct  25    ITDYDEYWVKREAEALSNIMQAYVSEPESVVNHF-----------------NTPDIFQVF  67

Query  1419  NDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFY  1240
             N T R L   K     C ATNPIDRCWRC +DWA+NRK LA CA GFG   +GG  G+ Y
Sbjct  68    NSTRRSLRHGKGKGRKCVATNPIDRCWRCRSDWASNRKLLAKCAKGFGRHAEGGLSGSIY  127

Query  1239  TVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVH  1063
              VT+ +DD   +P+PGTLR+ V + +PLWIIF+ DM IKL QEL++   KTIDGRGA VH
Sbjct  128   VVTNPSDDNLLDPRPGTLRYGVTRDRPLWIIFARDMVIKLQQELMINNYKTIDGRGANVH  187

Query  1062  ISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVW  883
             I+ GAG+TIQFVK+VI+H +HIH I  G GG IRD   H+G+RT+SDGDG+SIFG+S+VW
Sbjct  188   IAYGAGLTIQFVKHVIVHNLHIHDIKPGAGGNIRDSEGHWGIRTRSDGDGVSIFGASHVW  247

Query  882   IDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHF  703
             +DH+SM NC DGLIDA++ASTAITISN H T HNDV+L GA+D S +D +MQ+T+A+NHF
Sbjct  248   VDHLSMSNCADGLIDAVKASTAITISNCHLTRHNDVILLGASDKSQEDAVMQVTVAYNHF  307

Query  702   GKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKR  523
             GK L+QRMPRCR+G+ HVVNNDYTHW MYA+GGS HPTII QGNRF+ PP    KE+T R
Sbjct  308   GKGLVQRMPRCRWGFFHVVNNDYTHWMMYAVGGSQHPTIISQGNRFVGPPIQFAKEVTHR  367

Query  522   VKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTRFA  343
                   EWK W W S+ D +  GAFF+QSG   +  KH + YD +          LTRF+
Sbjct  368   EYAPESEWKNWIWTSEDDEFKSGAFFIQSGH-KYQGKHSR-YDVIKAKPGSIAGRLTRFS  425

Query  342   GALNCRVGSPC  310
             GAL C    PC
Sbjct  426   GALQCSPNRPC  436



>gb|ACF87417.1| unknown [Zea mays]
Length=444

 Score =   422 bits (1086),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 234/433 (54%), Positives = 297/433 (69%), Gaps = 24/433 (6%)
 Frame = -2

Query  1596  HIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaEDVTRN  1417
             ++ ++D+  ++R+  A   A++AY P+P+N++ S    V R +S             +R 
Sbjct  32    NVGQFDDHLQKRKELAEASAREAYRPDPYNVTNSFNAAVHRAVSS------------SRR  79

Query  1416  DTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFYT  1237
             +        KK  GPC ATNPID+CWRC  DWAT+R+RLA CA GFG+ T GG  G  Y 
Sbjct  80    EMWERPRKHKK-RGPCRATNPIDKCWRCRRDWATDRQRLARCARGFGHATTGGLGGKIYV  138

Query  1236  VTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVHI  1060
             VTD  D D  NP+PGTLR  VIQ  PLWIIF+  M I+L QEL+M  DKTIDGRGAQVHI
Sbjct  139   VTDPTDLDVVNPRPGTLRWGVIQPGPLWIIFARSMIIQLSQELLMSSDKTIDGRGAQVHI  198

Query  1059  SDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNVWI  880
             ++GAGIT+Q  +NVIIH +H+H +    GGL+RD   H G RT++DGDGIS+F ++NVWI
Sbjct  199   ANGAGITVQLAQNVIIHNLHVHDVKHTMGGLMRDSPTHIGSRTRADGDGISLFSATNVWI  258

Query  879   DHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNHFG  700
             DH+SM NC DGLID +++ST ITISN HFT+HNDVMLFGA+D   +D+IMQIT+AFNHFG
Sbjct  259   DHISMSNCEDGLIDVVQSSTGITISNCHFTNHNDVMLFGASDSWPQDQIMQITVAFNHFG  318

Query  699   KRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITKRV  520
             + L+QRMPRCR+G+ HVVNNDYTHW MYAIGG   PTII QGNR+IAPP+I  K ITK  
Sbjct  319   RGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGGDAPTIISQGNRYIAPPNIAAKVITKHY  378

Query  519   KGTPEE--WKTWTWRSQGDIYMEGAFFVQSGD-PNFMDKHHKLYDGVMTFKAEDVTWLTR  349
                 EE  WK W W ++ D++M GA F  SG  P  +D +  +     T+    VT LTR
Sbjct  379   A---EEGVWKNWVWHTEDDLFMNGAIFNPSGGAPKQVDTNEWVKPKPGTY----VTRLTR  431

Query  348   FAGALNCRVGSPC  310
             F+G L+C  G PC
Sbjct  432   FSGTLSCCTGKPC  444



>ref|XP_006363934.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=439

 Score =   422 bits (1085),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 235/444 (53%), Positives = 293/444 (66%), Gaps = 28/444 (6%)
 Frame = -2

Query  1623  GAIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeae  1444
              +++P     IAE+D    ++  E +  + +AY  NP  ++ +   EV   L +      
Sbjct  18    ASLVPHIHARIAEFDAYLEKQALEDLNSSLEAYTHNPEEVTNAFNKEVGNALLKY-----  72

Query  1443  aeaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTK  1264
                         + L  + K    C ATNPIDRCWRC  +WA NR  L +CA GFG+KT 
Sbjct  73    ------------KSLRRNLKEKNKCMATNPIDRCWRCDKNWAENRMDLEECARGFGHKTT  120

Query  1263  GGKLGNFYTVTDNADD-PSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTI  1087
             GGK G +Y VTD +DD    PKPGTLRHAVIQ++PLWIIF   M IKL QEL++  DKTI
Sbjct  121   GGKNGKYYVVTDESDDNVQEPKPGTLRHAVIQEEPLWIIFEKSMVIKLQQELMITSDKTI  180

Query  1086  DGRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgis  907
             DGRG  VHI++GAG+TIQFV NVIIH I I +I   NGG+IRD ++H GLRT SDGDGIS
Sbjct  181   DGRGVAVHIANGAGLTIQFVHNVIIHNIRIQNIISTNGGMIRDSVNHIGLRTVSDGDGIS  240

Query  906   ifgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQ  727
             IFGS+++WIDH ++  C DGL+DAI ASTAITISN  F  HNDVML GA D   +D IMQ
Sbjct  241   IFGSNHIWIDHCTLSECTDGLVDAIMASTAITISNCKFNHHNDVMLLGATDAFPQDSIMQ  300

Query  726   ITLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDI  547
             +T+AFN FG+ LIQRMPRCR+G+ HVVNNDYTHW MYAIGGS+HPTII QGNRF A  + 
Sbjct  301   VTVAFNRFGEGLIQRMPRCRWGFFHVVNNDYTHWQMYAIGGSAHPTIISQGNRFKAADNP  360

Query  546   HKKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPN----FMDKHHKLYDGVMTF  379
             + K++TKR      EWK W W S+GD ++ GA+FV+SG  +     + K+HK+      F
Sbjct  361   NTKQVTKRDYAPESEWKKWQWVSEGDSFLNGAYFVESGPQDKKKTALTKNHKI-----KF  415

Query  378   K-AEDVTWLTRFAGALNCRVGSPC  310
             K       LTRFAG L C+ G PC
Sbjct  416   KPGSHAGRLTRFAGVLKCKPGIPC  439



>ref|XP_002436463.1| hypothetical protein SORBIDRAFT_10g003080 [Sorghum bicolor]
 gb|EER87830.1| hypothetical protein SORBIDRAFT_10g003080 [Sorghum bicolor]
Length=465

 Score =   423 bits (1087),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 231/436 (53%), Positives = 292/436 (67%), Gaps = 17/436 (4%)
 Frame = -2

Query  1608  ATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaeaeaED  1429
             A + ++    E W  R   A  + + AYE +P  +       VRR +  +          
Sbjct  44    AQLVNVTANQEYWAERAEVAHAYNRAAYESDPVGVMDRFNDGVRRAMETS----------  93

Query  1428  VTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLG  1249
              T   +    L  K   GPC ATNPID+CWRC  DWA NRKRLA C +GFG++T GG  G
Sbjct  94    -TPTRSRSRSLAHKARGGPCTATNPIDQCWRCRGDWARNRKRLARCGMGFGHRTTGGLAG  152

Query  1248  NFYTVTDNADDPSN---PKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGR  1078
               Y VTD +D+P+N   P+ GTLR+AVIQ +PLWI F+ DM I L +EL++  DKTIDGR
Sbjct  153   RIYVVTDPSDEPANLVVPRKGTLRYAVIQDRPLWITFARDMVINLCRELLVTSDKTIDGR  212

Query  1077  GAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifg  898
             GAQVH+  GA IT+Q V+NVI+H +HIH      GG+IRD   H+GLR +SDGDG+S+ G
Sbjct  213   GAQVHVV-GAQITLQNVRNVILHNLHIHDAAPRGGGVIRDSKHHWGLRGESDGDGVSVMG  271

Query  897   sSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITL  718
             SS++WIDHVSMR+C DGL+D ++ STA+TISNGHFT H+ VMLFGA+D + KDK MQ+T+
Sbjct  272   SSDIWIDHVSMRSCADGLVDVVDGSTAVTISNGHFTRHDHVMLFGASDAAVKDKAMQVTV  331

Query  717   AFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKK  538
             AFNHFGK L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS +PTII QGNRF A  D   K
Sbjct  332   AFNHFGKGLVQRMPRCRHGFFHVVNNDYTHWLMYAIGGSQNPTIISQGNRFRAVDDGRFK  391

Query  537   EITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTW  358
             E+TKR      E+K W W+SQ D+++ GAFF QSG  N  ++     D +     +    
Sbjct  392   EVTKREYTPYSEYKDWVWKSQDDLFLNGAFFNQSGGEN--ERRFDRLDLIQAKGGQYAEL  449

Query  357   LTRFAGALNCRVGSPC  310
             LTR+AGALNCRVG  C
Sbjct  450   LTRYAGALNCRVGKKC  465



>ref|XP_011071024.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=441

 Score =   422 bits (1084),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 238/439 (54%), Positives = 292/439 (67%), Gaps = 20/439 (5%)
 Frame = -2

Query  1620  AIIPATVGHIAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHEVRRTLSeavaeaea  1441
             A +P     IA +DE  ++R AE+ + + Q Y PNP +++      V +TL         
Sbjct  21    ATLPKACAKIATFDEDLQKRAAESYQESLQEYNPNPQDLTDEFNELVGKTL---------  71

Query  1440  eaEDVTRNDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKG  1261
                     + TR  LG       C ATNPIDRCWRC  DWA +RKRLADC  GFG+ T G
Sbjct  72    -----MNENVTRRNLGEDD----CKATNPIDRCWRCDRDWAKHRKRLADCVRGFGHLTTG  122

Query  1260  GKLGNFYTVTDNADDPS-NPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTID  1084
             GK G +Y V D +DD   +PKPGTLRHA++Q +PLWIIF H M IKL  ELIM  DKTID
Sbjct  123   GKAGRYYLVDDPSDDDMDHPKPGTLRHAILQTEPLWIIFKHSMVIKLKNELIMTSDKTID  182

Query  1083  GRGAQVHISDGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisi  904
             GRG  VHI+ GAGITIQFV N+IIH I IH+I   +GG+IRD L H GLRTKSDGD I+I
Sbjct  183   GRGVLVHIAYGAGITIQFVHNIIIHNIWIHNIVPTSGGMIRDTLSHIGLRTKSDGDAINI  242

Query  903   fgsSNVWIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQI  724
             + S+ +WIDHVS+   YDGLID IE STAITISN  F  HNDVML GA+D  + D IMQ+
Sbjct  243   YSSNRIWIDHVSLSKGYDGLIDVIEGSTAITISNCKFNHHNDVMLLGAHDSHSIDAIMQV  302

Query  723   TLAFNHFGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIH  544
             T+AFN FGK LIQRMPR R+G+ HVVNNDY+HW +YAIGGS+HPTII QGNRF A    +
Sbjct  303   TVAFNRFGKGLIQRMPRVRWGFAHVVNNDYSHWELYAIGGSAHPTIISQGNRFRASNYRY  362

Query  543   KKEITKRVKGTPEEWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAED-  367
              KE+TKR   T ++W  W WRS+GD++  GAFF +SG P    K   +   ++ ++    
Sbjct  363   TKEVTKRDYATKDQWMKWQWRSEGDLFKNGAFFTESGQPLEHSKSPLVGMNLIRYRPGSF  422

Query  366   VTWLTRFAGALNCRVGSPC  310
             V  LT++AGAL CR G  C
Sbjct  423   VGTLTKYAGALKCRKGKLC  441



>gb|EAY85003.1| hypothetical protein OsI_06363 [Oryza sativa Indica Group]
Length=439

 Score =   421 bits (1082),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 232/433 (54%), Positives = 289/433 (67%), Gaps = 31/433 (7%)
 Frame = -2

Query  1593  IAEYDEVWRRREAEAIEHAQQAYEPNPHNISASLIHE--VRRTLSeavaeaeaeaEDVTR  1420
             I E+DE W +R A A   A++ Y+P+P N++        +RR LS               
Sbjct  33    IGEFDEHWEKRRAAAEAAAEEVYKPDPFNVTNESTERGVLRRELSGK-------------  79

Query  1419  NDTTRHLLGSKKYHGPCNATNPIDRCWRCHADWATNRKRLADCALGFGYKTKGGKLGNFY  1240
                      + KY GPC ATNPIDRCWRC  DWAT+RKRLA CA+GFG    GG  G  Y
Sbjct  80    ---------NSKYKGPCLATNPIDRCWRCRKDWATDRKRLARCAMGFGRGATGGVRGKIY  130

Query  1239  TVTDNAD-DPSNPKPGTLRHAVIQKKPLWIIFSHDMDIKLHQELIMQGDKTIDGRGAQVH  1063
              VTD  D D +NP+ GTLR   +Q  PLWI F+  M I+L QEL++  DKTIDGRGAQVH
Sbjct  131   VVTDPGDGDAANPRYGTLRWGAMQAAPLWITFAKSMVIRLTQELLVASDKTIDGRGAQVH  190

Query  1062  IS-DGAGITIQFVKNViihgihihhIFEGNGGLIRDGLDHFGLRTKsdgdgisifgsSNV  886
             I+  GAGIT+QF +NVII  +H+H +   +GG +RD   H G RT++DGDGIS+F +++V
Sbjct  191   IARGGAGITVQFARNVIITSLHVHDVKHSDGGAVRDSPTHIGPRTRADGDGISLFAATDV  250

Query  885   WIDHVSMRNCYDGLIDAIEASTAITISNGHFTDHNDVMLFGANDLSTKDKIMQITLAFNH  706
             W+DHVSM  C DGLID ++ ST +TISN HFT+HNDVMLFGA+D   +DK+MQIT+AFNH
Sbjct  251   WVDHVSMSMCEDGLIDVVQGSTGVTISNSHFTNHNDVMLFGASDSYPQDKVMQITVAFNH  310

Query  705   FGKRLIQRMPRCRYGYIHVVNNDYTHWNMYAIGGSSHPTIICQGNRFIAPPDIHKKEITK  526
             FG+ L+QRMPRCR+G+ HVVNNDYTHW MYAIGG   PTI+ QGNR+IAPP+I  K IT+
Sbjct  311   FGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGGMSPTILSQGNRYIAPPNIAAKLITR  370

Query  525   RVKGTPE-EWKTWTWRSQGDIYMEGAFFVQSGDPNFMDKHHKLYDGVMTFKAEDVTWLTR  349
                  PE EWK W WRS GD++M GA+F  S     +++  K  D V       V  LTR
Sbjct  371   HY--APEWEWKNWAWRSDGDLFMNGAYFQASN--GAINRKVKGSDMVKPKPGSYVRRLTR  426

Query  348   FAGALNCRVGSPC  310
             FAGAL+CR G PC
Sbjct  427   FAGALSCRPGEPC  439



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5297892630300