BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25646_g2_i1 len=1192 path=[1:0-415 417:416-453 2493:454-501
2541:502-505 22744:506-525 2565:526-742 2782:743-1191]

Length=1192
                                                                      Score     E

ref|XP_009599825.1|  PREDICTED: probable pectate lyase P59 isofor...    459   7e-156   
ref|XP_009779191.1|  PREDICTED: probable pectate lyase P59              459   9e-156   
ref|XP_009599826.1|  PREDICTED: probable pectate lyase P59 isofor...    456   8e-155   
ref|XP_004234779.1|  PREDICTED: probable pectate lyase P59              453   3e-153   
ref|XP_006361835.1|  PREDICTED: probable pectate lyase P59-like         450   4e-152   
sp|P15722.1|PLY59_SOLLC  RecName: Full=Probable pectate lyase P59...    449   7e-152   Solanum lycopersicum
ref|XP_009587689.1|  PREDICTED: probable pectate lyase P59              446   2e-150   
ref|XP_009789921.1|  PREDICTED: probable pectate lyase P59              443   1e-149   
gb|EPS66620.1|  hypothetical protein M569_08154                         441   2e-148   
ref|XP_010033216.1|  PREDICTED: pectate lyase-like                      438   8e-148   
ref|XP_006357122.1|  PREDICTED: probable pectate lyase P59-like         437   5e-147   
ref|XP_011098575.1|  PREDICTED: probable pectate lyase P59              436   7e-147   
ref|XP_007046218.1|  Pectate lyase family protein, putative             432   2e-145   
ref|XP_002520133.1|  Pectate lyase precursor, putative                  429   3e-144   Ricinus communis
gb|KCW52797.1|  hypothetical protein EUGRSUZ_J02132                     430   3e-144   
ref|XP_002311599.2|  pectate lyase family protein                       427   3e-143   Populus trichocarpa [western balsam poplar]
ref|XP_007032453.1|  Pectate lyase family protein                       426   1e-142   
ref|XP_010112093.1|  putative pectate lyase 7                           424   3e-142   
ref|XP_011025954.1|  PREDICTED: probable pectate lyase P59              424   3e-142   
ref|XP_010066949.1|  PREDICTED: pectate lyase                           420   9e-141   
ref|XP_010256490.1|  PREDICTED: pectate lyase-like                      420   1e-140   
ref|XP_008357758.1|  PREDICTED: pectate lyase-like                      420   2e-140   
ref|XP_006338480.1|  PREDICTED: probable pectate lyase P59-like         419   3e-140   
ref|XP_004232242.1|  PREDICTED: probable pectate lyase P59              419   4e-140   
emb|CDP02198.1|  unnamed protein product                                419   1e-139   
ref|XP_009342871.1|  PREDICTED: pectate lyase-like                      418   2e-139   
ref|XP_010242445.1|  PREDICTED: pectate lyase                           416   4e-139   
ref|XP_008341537.1|  PREDICTED: pectate lyase-like                      416   6e-139   
ref|XP_002270089.1|  PREDICTED: pectate lyase                           414   3e-138   Vitis vinifera
gb|KGN59593.1|  hypothetical protein Csa_3G827350                       414   3e-138   
ref|XP_008374522.1|  PREDICTED: pectate lyase-like                      414   3e-138   
ref|XP_009617495.1|  PREDICTED: probable pectate lyase P59              413   9e-138   
ref|XP_011085780.1|  PREDICTED: probable pectate lyase P59              413   1e-137   
ref|XP_002282500.3|  PREDICTED: pectate lyase                           412   1e-137   Vitis vinifera
ref|XP_009369346.1|  PREDICTED: pectate lyase-like                      412   1e-137   
ref|XP_008443432.1|  PREDICTED: probable pectate lyase 19               412   2e-137   
emb|CAN79927.1|  hypothetical protein VITISV_042447                     412   2e-137   Vitis vinifera
emb|CBI22159.3|  unnamed protein product                                412   3e-137   
ref|XP_004147462.1|  PREDICTED: probable pectate lyase 7-like           410   1e-136   
ref|XP_009802165.1|  PREDICTED: probable pectate lyase P59              410   2e-136   
ref|XP_007037229.1|  Pectate lyase family protein                       408   5e-136   
ref|XP_011087217.1|  PREDICTED: pectate lyase-like                      407   2e-135   
ref|XP_007209148.1|  hypothetical protein PRUPE_ppa005859mg             406   5e-135   
ref|XP_010496063.1|  PREDICTED: probable pectate lyase 3                405   2e-134   
gb|KHG16093.1|  hypothetical protein F383_07683                         405   2e-134   
ref|XP_007153840.1|  hypothetical protein PHAVU_003G069100g             404   3e-134   
ref|XP_008239834.1|  PREDICTED: pectate lyase-like                      404   3e-134   
ref|XP_010476496.1|  PREDICTED: probable pectate lyase 3                404   4e-134   
ref|XP_011085777.1|  PREDICTED: probable pectate lyase P59              403   9e-134   
ref|XP_002270112.1|  PREDICTED: pectate lyase                           402   1e-133   Vitis vinifera
emb|CAN69904.1|  hypothetical protein VITISV_001006                     402   2e-133   Vitis vinifera
ref|XP_006306515.1|  hypothetical protein CARUB_v10012514mg             402   3e-133   
ref|XP_010678579.1|  PREDICTED: pectate lyase-like                      400   8e-133   
gb|AAQ62997.1|  oil palm polygalacturonase allergen PEST411             400   9e-133   Elaeis guineensis
emb|CDP14850.1|  unnamed protein product                                400   1e-132   
ref|XP_010925369.1|  PREDICTED: pectate lyase                           400   1e-132   
gb|EYU36839.1|  hypothetical protein MIMGU_mgv1a006379mg                400   1e-132   
ref|XP_003530685.1|  PREDICTED: probable pectate lyase 3-like           400   1e-132   
ref|XP_004162547.1|  PREDICTED: probable pectate lyase P59-like         399   2e-132   
ref|XP_004146792.1|  PREDICTED: probable pectate lyase P59-like         399   2e-132   
ref|XP_004165454.1|  PREDICTED: pectate lyase-like                      399   2e-132   
gb|EYU34111.1|  hypothetical protein MIMGU_mgv1a006386mg                399   2e-132   
ref|XP_004152537.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    399   2e-132   
ref|XP_004508770.1|  PREDICTED: probable pectate lyase P59-like         398   5e-132   
ref|XP_010317101.1|  PREDICTED: probable pectate lyase P59              396   6e-132   
ref|XP_009381244.1|  PREDICTED: pectate lyase-like                      397   1e-131   
ref|XP_004490003.1|  PREDICTED: probable pectate lyase 3-like iso...    397   1e-131   
ref|XP_006842121.1|  hypothetical protein AMTR_s00078p00106380          396   2e-131   
ref|XP_007227702.1|  hypothetical protein PRUPE_ppa005744mg             396   3e-131   
ref|XP_006374492.1|  hypothetical protein POPTR_0015s07590g             396   3e-131   
ref|XP_002892805.1|  hypothetical protein ARALYDRAFT_471616             397   4e-131   
ref|XP_010523445.1|  PREDICTED: probable pectate lyase 3                396   6e-131   
ref|NP_172894.1|  putative pectate lyase 3                              395   9e-131   Arabidopsis thaliana [mouse-ear cress]
gb|KHG08055.1|  putative pectate lyase P59                              395   1e-130   
gb|KHN08855.1|  Putative pectate lyase P59                              394   2e-130   
ref|XP_011013803.1|  PREDICTED: pectate lyase-like                      393   3e-130   
ref|XP_008456459.1|  PREDICTED: pectate lyase-like                      393   4e-130   
gb|AAB69759.1|  putative pectate lyase                                  393   8e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007138209.1|  hypothetical protein PHAVU_009G189800g             392   1e-129   
ref|XP_004135462.1|  PREDICTED: probable pectate lyase P59-like         391   2e-129   
ref|XP_004155392.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    391   2e-129   
gb|KHG07401.1|  putative pectate lyase P59                              391   3e-129   
ref|XP_009403112.1|  PREDICTED: pectate lyase-like                      391   3e-129   
ref|XP_010527872.1|  PREDICTED: probable pectate lyase 3 isoform X2     392   3e-129   
ref|XP_009389712.1|  PREDICTED: pectate lyase-like                      391   3e-129   
ref|XP_010068708.1|  PREDICTED: pectate lyase-like                      390   5e-129   
ref|XP_008446316.1|  PREDICTED: probable pectate lyase P59              389   2e-128   
ref|XP_009117903.1|  PREDICTED: probable pectate lyase 3                389   2e-128   
gb|KFK43687.1|  hypothetical protein AALP_AA1G160000                    389   2e-128   
ref|XP_009408830.1|  PREDICTED: pectate lyase-like                      388   3e-128   
ref|XP_008389523.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    389   4e-128   
ref|XP_011005067.1|  PREDICTED: probable pectate lyase P59              388   5e-128   
gb|AES91206.2|  pectate lyase P59-like protein                          388   5e-128   
emb|CDY53552.1|  BnaA09g57110D                                          389   7e-128   
ref|XP_008365507.1|  PREDICTED: pectate lyase-like                      386   8e-128   
ref|XP_003519771.2|  PREDICTED: probable pectate lyase 3-like           387   9e-128   
ref|XP_004514773.1|  PREDICTED: probable pectate lyase 3-like           387   2e-127   
gb|KHN08706.1|  Putative pectate lyase 3                                386   2e-127   
emb|CDX81636.1|  BnaC08g39650D                                          387   3e-127   
ref|XP_002323835.1|  hypothetical protein POPTR_0017s11450g             386   3e-127   Populus trichocarpa [western balsam poplar]
ref|XP_010463548.1|  PREDICTED: probable pectate lyase 7                387   3e-127   
ref|XP_009129128.1|  PREDICTED: probable pectate lyase 6                386   4e-127   
emb|CDY09356.1|  BnaA02g26540D                                          386   5e-127   
ref|XP_008339935.1|  PREDICTED: probable pectate lyase 3                386   5e-127   
ref|XP_006477525.1|  PREDICTED: pectate lyase-like                      385   6e-127   
ref|XP_008786760.1|  PREDICTED: pectate lyase-like                      386   7e-127   
emb|CDY39314.1|  BnaC05g10650D                                          385   7e-127   
ref|XP_004490004.1|  PREDICTED: probable pectate lyase 3-like iso...    383   7e-127   
ref|XP_006826355.1|  hypothetical protein AMTR_s00004p00123190          386   8e-127   
ref|XP_010513594.1|  PREDICTED: probable pectate lyase 7                386   8e-127   
ref|XP_010105747.1|  putative pectate lyase P59                         384   1e-126   
ref|XP_004951474.1|  PREDICTED: pectate lyase-like                      384   1e-126   
gb|KHN13652.1|  Pectate lyase                                           384   2e-126   
ref|XP_003552513.1|  PREDICTED: pectate lyase-like                      384   2e-126   
ref|XP_010514040.1|  PREDICTED: probable pectate lyase 6                384   2e-126   
ref|XP_008366366.1|  PREDICTED: pectate lyase-like                      384   4e-126   
ref|XP_009360393.1|  PREDICTED: probable pectate lyase 3                384   4e-126   
ref|XP_007157384.1|  hypothetical protein PHAVU_002G065800g             383   4e-126   
ref|XP_002272638.2|  PREDICTED: pectate lyase-like                      383   4e-126   Vitis vinifera
ref|XP_006573090.1|  PREDICTED: probable pectate lyase 3-like           383   5e-126   
ref|XP_006439649.1|  hypothetical protein CICLE_v10020193mg             382   6e-126   
ref|XP_008230729.1|  PREDICTED: pectate lyase                           383   7e-126   
ref|XP_009148818.1|  PREDICTED: probable pectate lyase 3                383   7e-126   
ref|XP_007137422.1|  hypothetical protein PHAVU_009G125800g             382   8e-126   
emb|CDY45254.1|  BnaA06g09240D                                          383   1e-125   
gb|KDO76053.1|  hypothetical protein CISIN_1g013757mg                   382   1e-125   
ref|XP_010485518.1|  PREDICTED: probable pectate lyase 7                383   1e-125   
emb|CDY41679.1|  BnaC02g34750D                                          382   1e-125   
dbj|BAK06965.1|  predicted protein                                      382   2e-125   
ref|NP_001046281.1|  Os02g0214400                                       381   4e-125   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008339934.1|  PREDICTED: probable pectate lyase 3                381   4e-125   
ref|XP_006292606.1|  hypothetical protein CARUB_v10018855mg             381   4e-125   
ref|XP_009788285.1|  PREDICTED: pectate lyase-like                      380   5e-125   
gb|KFK33456.1|  hypothetical protein AALP_AA5G015800                    381   6e-125   
ref|XP_003563707.1|  PREDICTED: pectate lyase-like                      380   6e-125   
ref|XP_004228388.1|  PREDICTED: pectate lyase                           380   7e-125   
ref|XP_007215366.1|  hypothetical protein PRUPE_ppa005602mg             380   1e-124   
ref|XP_003609009.1|  Pectate lyase                                      379   2e-124   
gb|KDP45476.1|  hypothetical protein JCGZ_09725                         380   2e-124   
gb|ACU23277.1|  unknown                                                 379   2e-124   Glycine max [soybeans]
ref|XP_008221658.1|  PREDICTED: pectate lyase-like                      379   2e-124   
ref|XP_007224275.1|  hypothetical protein PRUPE_ppa019055mg             379   2e-124   
gb|KHN01171.1|  Putative pectate lyase 3                                378   2e-124   
ref|XP_010425041.1|  PREDICTED: probable pectate lyase 6                379   2e-124   
ref|XP_003543726.1|  PREDICTED: pectate lyase                           379   2e-124   
ref|XP_002306040.1|  hypothetical protein POPTR_0004s12300g             378   3e-124   Populus trichocarpa [western balsam poplar]
ref|XP_006363934.1|  PREDICTED: pectate lyase-like                      378   3e-124   
ref|XP_008793504.1|  PREDICTED: pectate lyase-like                      378   4e-124   
gb|ABK28696.1|  unknown                                                 379   4e-124   Arabidopsis thaliana [mouse-ear cress]
gb|KEH19822.1|  pectate lyase-like protein                              378   5e-124   
gb|KHG23093.1|  hypothetical protein F383_29772                         376   5e-124   
ref|NP_197015.4|  putative pectate lyase 19                             379   5e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009598230.1|  PREDICTED: pectate lyase-like                      377   5e-124   
ref|XP_009615547.1|  PREDICTED: probable pectate lyase P59              377   5e-124   
ref|XP_003554335.1|  PREDICTED: pectate lyase-like                      378   6e-124   
ref|XP_010502279.1|  PREDICTED: probable pectate lyase 6                378   7e-124   
ref|XP_008679844.1|  PREDICTED: pectate lyase                           377   1e-123   
gb|KHN13490.1|  Putative pectate lyase 3                                374   1e-123   
ref|XP_003613595.1|  Pectate lyase                                      377   2e-123   
ref|XP_006354795.1|  PREDICTED: pectate lyase-like                      376   2e-123   
gb|AAQ62996.1|  oil palm polygalacturonase allergen PEST361             376   2e-123   Elaeis guineensis
ref|XP_010915114.1|  PREDICTED: LOW QUALITY PROTEIN: pectate lyas...    376   2e-123   
ref|XP_008221660.1|  PREDICTED: probable pectate lyase 3                376   2e-123   
ref|XP_011009454.1|  PREDICTED: pectate lyase-like                      377   3e-123   
gb|ACF87417.1|  unknown                                                 375   4e-123   Zea mays [maize]
ref|XP_006357289.1|  PREDICTED: probable pectate lyase 3-like           376   4e-123   
ref|XP_010683249.1|  PREDICTED: pectate lyase-like                      375   4e-123   
gb|KHG05193.1|  hypothetical protein F383_30875                         373   5e-123   
ref|XP_002453531.1|  hypothetical protein SORBIDRAFT_04g007450          375   8e-123   Sorghum bicolor [broomcorn]
ref|XP_010320663.1|  PREDICTED: probable pectate lyase 3                372   2e-122   
gb|EAY85003.1|  hypothetical protein OsI_06363                          373   3e-122   Oryza sativa Indica Group [Indian rice]
ref|XP_009758350.1|  PREDICTED: pectate lyase-like                      373   3e-122   
ref|XP_007139601.1|  hypothetical protein PHAVU_008G043600g             373   3e-122   
ref|XP_009599232.1|  PREDICTED: pectate lyase-like                      373   5e-122   
ref|XP_009110541.1|  PREDICTED: probable pectate lyase 3                373   5e-122   
ref|XP_010670318.1|  PREDICTED: pectate lyase-like                      372   9e-122   
ref|XP_004489168.1|  PREDICTED: pectate lyase-like                      372   1e-121   
emb|CDX96854.1|  BnaA08g23970D                                          372   1e-121   
ref|XP_011086389.1|  PREDICTED: pectate lyase-like                      371   2e-121   
ref|XP_009761969.1|  PREDICTED: probable pectate lyase P59              371   2e-121   
ref|NP_178375.1|  putative pectate lyase 6                              372   2e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002875142.1|  pectate lyase family protein                       370   6e-121   
gb|KFK37588.1|  hypothetical protein AALP_AA3G002600                    370   1e-120   
ref|XP_003613596.1|  Pectate lyase                                      369   2e-120   
ref|XP_009114192.1|  PREDICTED: probable pectate lyase 6                369   2e-120   
emb|CDY04133.1|  BnaA09g19110D                                          369   2e-120   
emb|CDY68729.1|  BnaCnng60280D                                          369   2e-120   
emb|CDX74293.1|  BnaA03g27540D                                          369   4e-120   
ref|XP_011098576.1|  PREDICTED: probable pectate lyase P56              369   4e-120   
emb|CDX91953.1|  BnaC03g32550D                                          369   5e-120   
emb|CDY17432.1|  BnaC09g21050D                                          368   6e-120   
gb|KHN13240.1|  Putative pectate lyase 3                                367   7e-120   
ref|XP_006656188.1|  PREDICTED: pectate lyase-like                      366   2e-119   
ref|XP_009134622.1|  PREDICTED: probable pectate lyase 7                367   3e-119   
ref|XP_010550068.1|  PREDICTED: probable pectate lyase 19               367   3e-119   
ref|XP_006579282.1|  PREDICTED: probable pectate lyase P59-like         365   4e-119   
gb|AAM60924.1|  putative pectate lyase                                  366   4e-119   Arabidopsis thaliana [mouse-ear cress]
ref|NP_186776.1|  putative pectate lyase 7                              366   5e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010528323.1|  PREDICTED: probable pectate lyase 19               365   6e-119   
emb|CDP02199.1|  unnamed protein product                                361   7e-119   
ref|XP_002437204.1|  hypothetical protein SORBIDRAFT_10g022830          365   8e-119   Sorghum bicolor [broomcorn]
ref|XP_002871648.1|  pectate lyase family protein                       365   8e-119   
ref|XP_008446067.1|  PREDICTED: pectate lyase-like                      362   1e-118   
ref|XP_004236194.1|  PREDICTED: probable pectate lyase P59              363   3e-118   
ref|XP_010420164.1|  PREDICTED: probable pectate lyase 19 isoform X2    363   5e-118   
ref|XP_007151201.1|  hypothetical protein PHAVU_004G026400g             362   6e-118   
gb|KHN45481.1|  Putative pectate lyase 3                                360   8e-118   
emb|CDX85564.1|  BnaA02g02490D                                          363   9e-118   
sp|Q9LFP5.1|PLY19_ARATH  RecName: Full=Probable pectate lyase 19;...    362   1e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002511525.1|  Pectate lyase precursor, putative                  361   2e-117   Ricinus communis
ref|XP_009380431.1|  PREDICTED: pectate lyase-like                      361   2e-117   
gb|AAB69758.1|  putative pectate lyase Nt59                             355   2e-117   Nicotiana tabacum [American tobacco]
ref|XP_010527871.1|  PREDICTED: probable pectate lyase 3 isoform X1     368   5e-117   
ref|XP_004301165.1|  PREDICTED: probable pectate lyase P59-like         359   1e-116   
ref|XP_004233352.1|  PREDICTED: pectate lyase-like                      357   1e-116   
ref|XP_011087066.1|  PREDICTED: pectate lyase                           358   2e-116   
ref|XP_006344502.1|  PREDICTED: probable pectate lyase P59-like         358   2e-116   
ref|XP_009126031.1|  PREDICTED: probable pectate lyase 19               360   2e-116   
emb|CDP00293.1|  unnamed protein product                                358   2e-116   
ref|XP_006357121.1|  PREDICTED: pectate lyase-like                      356   3e-116   
ref|XP_006299938.1|  hypothetical protein CARUB_v10016149mg             358   5e-116   
gb|KEH24975.1|  pectate lyase P59-like protein                          357   6e-116   
ref|XP_009101245.1|  PREDICTED: probable pectate lyase 6                357   9e-116   
ref|XP_004489374.1|  PREDICTED: pectate lyase-like                      357   9e-116   
gb|EYU28712.1|  hypothetical protein MIMGU_mgv1a006498mg                356   1e-115   
gb|AAA16476.1|  pectate lyase homolog                                   356   2e-115   Zea mays [maize]
ref|XP_004302354.1|  PREDICTED: probable pectate lyase P59-like         356   2e-115   
gb|EAY99621.1|  hypothetical protein OsI_21600                          356   2e-115   Oryza sativa Indica Group [Indian rice]
ref|NP_001056784.1|  Os06g0144900                                       355   3e-115   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010453638.1|  PREDICTED: probable pectate lyase 19               357   4e-115   
emb|CDY45202.1|  BnaA06g34060D                                          355   5e-115   
gb|EYU22437.1|  hypothetical protein MIMGU_mgv1a006496mg                353   2e-114   
ref|XP_010420163.1|  PREDICTED: probable pectate lyase 19 isoform X1    354   5e-114   
ref|XP_002437815.1|  hypothetical protein SORBIDRAFT_10g003090          351   1e-113   Sorghum bicolor [broomcorn]
ref|NP_001057945.1|  Os06g0583900                                       351   1e-113   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010492335.1|  PREDICTED: probable pectate lyase 19               353   2e-113   
emb|CAN77957.1|  hypothetical protein VITISV_021245                     350   2e-113   Vitis vinifera
emb|CDY03043.1|  BnaC07g21840D                                          351   2e-113   
ref|XP_006482544.1|  PREDICTED: probable pectate lyase 19-like          350   3e-113   
ref|XP_002436463.1|  hypothetical protein SORBIDRAFT_10g003080          351   3e-113   Sorghum bicolor [broomcorn]
ref|XP_006428983.1|  hypothetical protein CICLE_v10013750mg             350   4e-113   
gb|AAA86241.1|  pectate lyase homolog                                   350   5e-113   Medicago sativa [alfalfa]
ref|XP_006480843.1|  PREDICTED: probable pectate lyase 19-like          349   6e-113   
ref|XP_010551866.1|  PREDICTED: probable pectate lyase 19               350   8e-113   
ref|XP_003571658.1|  PREDICTED: pectate lyase-like                      348   1e-112   
ref|XP_006431087.1|  hypothetical protein CICLE_v10011762mg             348   2e-112   
dbj|BAH20311.1|  AT3G01270                                              345   2e-112   Arabidopsis thaliana [mouse-ear cress]
gb|AFW87059.1|  pectate lyase                                           348   3e-112   
ref|NP_001150723.1|  pectate lyase precursor                            348   3e-112   Zea mays [maize]
ref|XP_006484673.1|  PREDICTED: probable pectate lyase 19-like          347   3e-112   
ref|XP_002882189.1|  pectate lyase family protein                       348   4e-112   
gb|KDO49230.1|  hypothetical protein CISIN_1g036607mg                   347   4e-112   
gb|AGT16687.1|  pectate lyase                                           347   5e-112   
gb|EMS45831.1|  Pectate lyase                                           350   5e-112   
ref|XP_004298448.1|  PREDICTED: probable pectate lyase 3-like           347   6e-112   
ref|XP_004964534.1|  PREDICTED: pectate lyase-like                      347   6e-112   
ref|XP_009797403.1|  PREDICTED: pectate lyase-like                      347   7e-112   
ref|XP_003621115.1|  Pectate lyase                                      346   1e-111   
gb|EAY99626.1|  hypothetical protein OsI_21605                          345   2e-111   Oryza sativa Indica Group [Indian rice]
ref|XP_009757256.1|  PREDICTED: pectate lyase                           344   2e-111   
ref|XP_009627245.1|  PREDICTED: pectate lyase-like                      345   3e-111   
gb|EYU30593.1|  hypothetical protein MIMGU_mgv1a007569mg                343   4e-111   
ref|XP_006437462.1|  hypothetical protein CICLE_v10031653mg             342   1e-110   
emb|CDY28691.1|  BnaCnng05770D                                          343   3e-110   
ref|XP_010320956.1|  PREDICTED: probable pectate lyase 5                340   6e-110   
ref|NP_001150425.1|  LOC100284055 precursor                             342   6e-110   Zea mays [maize]
emb|CDP13269.1|  unnamed protein product                                340   7e-110   
gb|EPS73633.1|  hypothetical protein M569_01123                         342   7e-110   
ref|XP_004966014.1|  PREDICTED: pectate lyase-like                      343   8e-110   
emb|CDX70590.1|  BnaC03g06740D                                          342   8e-110   
sp|P40973.1|PLY_LILLO  RecName: Full=Pectate lyase; Flags: Precursor    340   1e-109   Lilium longiflorum [Easter lily]
gb|KGN47799.1|  hypothetical protein Csa_6G404140                       340   1e-109   
emb|CAN69905.1|  hypothetical protein VITISV_001007                     338   1e-109   Vitis vinifera
ref|XP_006341783.1|  PREDICTED: probable pectate lyase 5-like           339   2e-109   
ref|XP_009586995.1|  PREDICTED: probable pectate lyase 5                339   2e-109   
ref|XP_011086987.1|  PREDICTED: probable pectate lyase 22               339   2e-109   
gb|EPS62426.1|  hypothetical protein M569_12361                         339   2e-109   
ref|XP_010023768.1|  PREDICTED: probable pectate lyase 1 isoform X2     340   2e-109   
gb|ACB12931.1|  pectate lyase 1-27                                      340   3e-109   Populus tremula x Populus tremuloides
ref|XP_011040439.1|  PREDICTED: probable pectate lyase 18               339   3e-109   
ref|XP_009131435.1|  PREDICTED: probable pectate lyase 19               341   3e-109   
ref|XP_002318694.1|  pectate lyase 22 precursor family protein          338   3e-109   
ref|XP_009125036.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    340   5e-109   
ref|XP_010100325.1|  hypothetical protein L484_027633                   338   5e-109   
gb|KHG22755.1|  hypothetical protein F383_29653                         338   6e-109   
ref|XP_009587688.1|  PREDICTED: pectate lyase-like                      337   7e-109   
ref|XP_007037815.1|  Pectin lyase-like superfamily protein isoform 1    337   8e-109   
ref|XP_002304700.1|  pectate lyase family protein                       339   8e-109   
gb|KHN34377.1|  Putative pectate lyase 22                               337   9e-109   
ref|XP_004234780.1|  PREDICTED: probable pectate lyase P56              337   1e-108   
ref|XP_010545988.1|  PREDICTED: probable pectate lyase 22               337   1e-108   
ref|XP_011005597.1|  PREDICTED: probable pectate lyase 18               337   2e-108   
ref|XP_004299169.1|  PREDICTED: probable pectate lyase 18-like          337   2e-108   
ref|XP_011086701.1|  PREDICTED: probable pectate lyase 5                336   2e-108   
ref|XP_002322215.1|  pectate lyase 22 precursor family protein          336   2e-108   
emb|CDY66593.1|  BnaCnng51570D                                          339   3e-108   
ref|XP_009804979.1|  PREDICTED: probable pectate lyase 5                336   3e-108   
ref|XP_009359518.1|  PREDICTED: probable pectate lyase 18               336   3e-108   
gb|KHG22990.1|  hypothetical protein F383_28754                         336   4e-108   
ref|XP_009789922.1|  PREDICTED: pectate lyase-like                      335   4e-108   
ref|XP_009121613.1|  PREDICTED: probable pectate lyase 19               339   4e-108   
gb|KHG08946.1|  Pectate lyase                                           336   4e-108   
ref|XP_009359258.1|  PREDICTED: probable pectate lyase 5                335   5e-108   
dbj|BAI94495.1|  pectate lyase                                          335   5e-108   
ref|XP_011020694.1|  PREDICTED: probable pectate lyase 8                337   5e-108   
gb|AEN70965.1|  pectate lyase                                           335   5e-108   
ref|XP_010435229.1|  PREDICTED: probable pectate lyase 15               337   5e-108   
gb|KDO69409.1|  hypothetical protein CISIN_1g015569mg                   333   6e-108   
ref|XP_003549832.1|  PREDICTED: probable pectate lyase 18 isoform 1     335   6e-108   
ref|XP_010023767.1|  PREDICTED: probable pectate lyase 8 isoform X1     337   7e-108   
ref|XP_008389758.1|  PREDICTED: probable pectate lyase 5                335   8e-108   
ref|XP_010450167.1|  PREDICTED: probable pectate lyase 15 isoform X1    337   8e-108   
ref|XP_008350945.1|  PREDICTED: probable pectate lyase 5                335   8e-108   
ref|XP_008340139.1|  PREDICTED: probable pectate lyase 5                335   8e-108   
ref|NP_001242543.1|  uncharacterized protein LOC100779940 precursor     335   9e-108   
ref|XP_010440536.1|  PREDICTED: probable pectate lyase 15 isoform X2    337   9e-108   
ref|XP_010450168.1|  PREDICTED: probable pectate lyase 15 isoform X2    337   9e-108   
gb|KHG06252.1|  hypothetical protein F383_10745                         335   1e-107   
gb|KHG30349.1|  hypothetical protein F383_15991                         337   1e-107   
ref|XP_007155507.1|  hypothetical protein PHAVU_003G207400g             335   1e-107   
ref|XP_010440534.1|  PREDICTED: probable pectate lyase 15 isoform X1    337   1e-107   
gb|AEN70981.1|  pectate lyase                                           335   1e-107   
gb|AAF19195.1|AF206319_1  pectate lyase 1                               334   1e-107   
gb|ADB90478.1|  pectate lyase                                           335   1e-107   
gb|ADB90475.1|  pectate lyase                                           335   1e-107   
gb|AEN70968.1|  pectate lyase                                           335   1e-107   
gb|AEN70964.1|  pectate lyase                                           335   1e-107   
gb|AEN70963.1|  pectate lyase                                           335   1e-107   
gb|ADB90477.1|  pectate lyase                                           334   2e-107   
gb|AEN70985.1|  pectate lyase                                           334   2e-107   
gb|AFZ78654.1|  pectate lyase                                           336   2e-107   
gb|KHG19997.1|  hypothetical protein F383_02891                         334   2e-107   
gb|AEN70977.1|  pectate lyase                                           334   2e-107   
ref|XP_009628975.1|  PREDICTED: probable pectate lyase 18               334   2e-107   
gb|ADB90479.1|  pectate lyase                                           334   2e-107   
dbj|BAD68402.1|  putative pectate lyase homolog                         335   2e-107   
gb|EPS58564.1|  hypothetical protein M569_16249                         332   2e-107   
ref|XP_009406385.1|  PREDICTED: probable pectate lyase 18               334   2e-107   
ref|NP_001280201.1|  probable pectate lyase 18 precursor                334   2e-107   
ref|XP_010106682.1|  hypothetical protein L484_004616                   333   2e-107   
gb|AFK44189.1|  unknown                                                 334   2e-107   
ref|NP_001056781.1|  Os06g0144200                                       335   2e-107   
ref|XP_002966181.1|  hypothetical protein SELMODRAFT_407495             334   3e-107   
ref|XP_004515847.1|  PREDICTED: probable pectate lyase 22-like          334   3e-107   
gb|KDP30994.1|  hypothetical protein JCGZ_11370                         334   3e-107   
ref|XP_010102919.1|  hypothetical protein L484_018936                   334   3e-107   
gb|ABO28477.1|  pectate lyase precursor                                 330   3e-107   
ref|XP_003608909.1|  Pectate lyase                                      333   3e-107   
ref|XP_009105097.1|  PREDICTED: probable pectate lyase 5                333   3e-107   
ref|XP_010023435.1|  PREDICTED: probable pectate lyase 5                333   3e-107   
gb|AEN70984.1|  pectate lyase                                           333   3e-107   
ref|XP_011097349.1|  PREDICTED: pectate lyase-like                      333   3e-107   
ref|XP_011029589.1|  PREDICTED: probable pectate lyase 5                333   3e-107   
emb|CDY63769.1|  BnaCnng42620D                                          336   3e-107   
gb|EPS63108.1|  hypothetical protein M569_11679                         332   4e-107   
ref|XP_011097774.1|  PREDICTED: pectate lyase-like                      334   4e-107   
ref|XP_011002172.1|  PREDICTED: probable pectate lyase 8                335   5e-107   
ref|XP_010038352.1|  PREDICTED: probable pectate lyase 8                334   5e-107   
ref|NP_001289258.1|  probable pectate lyase 18 precursor                333   5e-107   
ref|XP_006286712.1|  hypothetical protein CARUB_v10002862mg             337   5e-107   
gb|KDO69407.1|  hypothetical protein CISIN_1g015569mg                   333   5e-107   
ref|XP_010672089.1|  PREDICTED: probable pectate lyase 1                334   6e-107   
ref|XP_007209185.1|  hypothetical protein PRUPE_ppa006392mg             333   6e-107   
gb|AAY85180.1|  pectate lyase                                           333   6e-107   
ref|XP_010683248.1|  PREDICTED: pectate lyase-like                      334   6e-107   
gb|AAK66161.1|  pectate lyase                                           331   6e-107   
gb|EYU34765.1|  hypothetical protein MIMGU_mgv1a023431mg                332   6e-107   
ref|XP_010250930.1|  PREDICTED: probable pectate lyase 5                333   7e-107   
gb|ADB90476.1|  pectate lyase                                           333   7e-107   
ref|XP_002518146.1|  Pectate lyase precursor, putative                  331   8e-107   
ref|XP_010248740.1|  PREDICTED: probable pectate lyase 18               332   8e-107   
ref|XP_007145412.1|  hypothetical protein PHAVU_007G236800g             334   9e-107   
ref|XP_007137977.1|  hypothetical protein PHAVU_009G170500g             332   9e-107   
ref|XP_006476937.1|  PREDICTED: probable pectate lyase 18-like          334   9e-107   
ref|XP_010682362.1|  PREDICTED: probable pectate lyase 5                332   1e-106   
ref|XP_010096345.1|  putative pectate lyase 7                           332   1e-106   
ref|XP_006361836.1|  PREDICTED: probable pectate lyase P56-like         332   1e-106   
emb|CDY18738.1|  BnaC08g08780D                                          334   1e-106   
ref|XP_007034463.1|  Pectin lyase-like superfamily protein              333   1e-106   
ref|XP_003535958.1|  PREDICTED: probable pectate lyase 1-like           333   1e-106   
ref|XP_008351757.1|  PREDICTED: probable pectate lyase 18               332   1e-106   
ref|XP_008221954.1|  PREDICTED: probable pectate lyase 5                332   2e-106   
ref|XP_003523121.1|  PREDICTED: probable pectate lyase 18-like          332   2e-106   
ref|XP_010531484.1|  PREDICTED: probable pectate lyase 5                332   2e-106   
ref|XP_004138973.1|  PREDICTED: probable pectate lyase 15-like          333   2e-106   
ref|XP_004171543.1|  PREDICTED: probable pectate lyase 15-like          333   2e-106   
ref|XP_004310004.1|  PREDICTED: probable pectate lyase 5-like           331   2e-106   
ref|XP_008460726.1|  PREDICTED: probable pectate lyase 8 isoform X1     333   2e-106   
gb|KDP33375.1|  hypothetical protein JCGZ_12924                         333   2e-106   
gb|KFK25747.1|  hypothetical protein AALP_AA8G154300                    335   2e-106   
ref|XP_006439991.1|  hypothetical protein CICLE_v10020423mg             331   2e-106   
ref|XP_003555714.2|  PREDICTED: probable pectate lyase 1-like           334   3e-106   
ref|XP_009107745.1|  PREDICTED: probable pectate lyase 15               332   3e-106   
ref|XP_008460728.1|  PREDICTED: probable pectate lyase 1 isoform X3     330   3e-106   
gb|AAL06861.1|  At1g04680/T1G11_6                                       329   3e-106   
emb|CDP03845.1|  unnamed protein product                                332   3e-106   
ref|XP_002297822.1|  pectate lyase family protein                       332   3e-106   
ref|XP_007222794.1|  hypothetical protein PRUPE_ppa006665mg             331   3e-106   
ref|XP_010527219.1|  PREDICTED: probable pectate lyase 10               330   3e-106   
ref|XP_004501839.1|  PREDICTED: probable pectate lyase 5-like           331   4e-106   
ref|XP_008460727.1|  PREDICTED: probable pectate lyase 1 isoform X2     332   4e-106   
ref|XP_002285340.1|  PREDICTED: probable pectate lyase 5                330   5e-106   
ref|XP_010532870.1|  PREDICTED: putative pectate lyase 14               332   5e-106   
ref|XP_009400922.1|  PREDICTED: probable pectate lyase 8 isoform X1     332   5e-106   
ref|XP_004289729.1|  PREDICTED: probable pectate lyase 15-like          332   5e-106   
ref|XP_009400924.1|  PREDICTED: probable pectate lyase 8 isoform X2     332   5e-106   
emb|CDY01846.1|  BnaC06g28860D                                          330   6e-106   
ref|XP_009362042.1|  PREDICTED: probable pectate lyase 8                331   7e-106   
ref|XP_006854398.1|  hypothetical protein AMTR_s00039p00189000          332   7e-106   
gb|KFK39718.1|  hypothetical protein AALP_AA3G279700                    329   8e-106   
dbj|BAB59066.1|  pectate lyase                                          330   8e-106   
ref|XP_002982255.1|  hypothetical protein SELMODRAFT_421674             330   9e-106   
ref|XP_004134015.1|  PREDICTED: probable pectate lyase 15-like          331   9e-106   
ref|NP_001280839.1|  probable pectate lyase 18 precursor                330   9e-106   
ref|XP_008438392.1|  PREDICTED: probable pectate lyase 8                331   1e-105   
gb|AGC94753.1|  putative pectate lyase                                  329   1e-105   
ref|XP_010420165.1|  PREDICTED: probable pectate lyase 19 isoform X3    333   1e-105   
ref|XP_008391438.1|  PREDICTED: probable pectate lyase 8                331   1e-105   
ref|XP_004497757.1|  PREDICTED: probable pectate lyase 15-like          331   1e-105   
ref|XP_008360481.1|  PREDICTED: probable pectate lyase 8                331   1e-105   
gb|EYU46355.1|  hypothetical protein MIMGU_mgv1a007094mg                330   1e-105   
ref|XP_006360328.1|  PREDICTED: probable pectate lyase 15-like          331   1e-105   
ref|XP_010026892.1|  PREDICTED: probable pectate lyase 18               329   2e-105   
ref|XP_006282594.1|  hypothetical protein CARUB_v10004736mg             331   2e-105   
gb|KFK39719.1|  hypothetical protein AALP_AA3G279700                    329   2e-105   
emb|CDY41506.1|  BnaA06g22590D                                          329   2e-105   
ref|XP_004247823.1|  PREDICTED: probable pectate lyase 8                330   2e-105   
gb|KCW83228.1|  hypothetical protein EUGRSUZ_B00168                     331   2e-105   
ref|XP_009150377.1|  PREDICTED: probable pectate lyase 22               329   2e-105   
gb|EYU22243.1|  hypothetical protein MIMGU_mgv1a007460mg                328   2e-105   
ref|XP_011080166.1|  PREDICTED: probable pectate lyase 8                328   2e-105   
ref|XP_002870357.1|  pectate lyase family protein                       331   2e-105   
ref|XP_002887143.1|  pectate lyase family protein                       328   3e-105   
emb|CDX89799.1|  BnaA10g02830D                                          329   3e-105   
ref|NP_563715.1|  putative pectate lyase 1                              329   3e-105   
emb|CDY16732.1|  BnaA09g06500D                                          329   3e-105   
ref|XP_002866540.1|  pectate lyase                                      328   3e-105   
gb|AAX88800.1|  ripening-related pectate lyase                          329   3e-105   
ref|NP_564906.1|  putative pectate lyase 5                              328   3e-105   
ref|XP_009112069.1|  PREDICTED: probable pectate lyase 22               329   4e-105   
gb|AAG28907.1|AC008113_23  F12A21.12                                    328   4e-105   
emb|CAN76500.1|  hypothetical protein VITISV_004734                     328   4e-105   
emb|CDY56220.1|  BnaAnng14170D                                          328   4e-105   
gb|KFK41187.1|  hypothetical protein AALP_AA2G097000                    328   4e-105   
ref|XP_010663062.1|  PREDICTED: probable pectate lyase 5                328   4e-105   
gb|AAM67091.1|  putative pectate lyase                                  328   5e-105   
ref|XP_010935686.1|  PREDICTED: probable pectate lyase 8 isoform X2     328   5e-105   
ref|XP_004152502.1|  PREDICTED: probable pectate lyase 22-like          328   5e-105   
emb|CDY61137.1|  BnaC05g48970D                                          328   5e-105   
ref|XP_004157771.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    328   5e-105   
ref|XP_008223974.1|  PREDICTED: probable pectate lyase 8                329   6e-105   
ref|XP_010935685.1|  PREDICTED: probable pectate lyase 8 isoform X1     329   6e-105   
ref|XP_009119265.1|  PREDICTED: probable pectate lyase 1                328   6e-105   
ref|XP_002446075.1|  hypothetical protein SORBIDRAFT_06g001410          327   7e-105   
ref|XP_006487597.1|  PREDICTED: probable pectate lyase 1-like           329   7e-105   
emb|CDY03419.1|  BnaC01g16630D                                          327   7e-105   
ref|XP_010239620.1|  PREDICTED: probable pectate lyase 8 isoform X2     328   7e-105   
ref|XP_006302330.1|  hypothetical protein CARUB_v10020387mg             327   7e-105   
ref|NP_568967.1|  putative pectate lyase 22                             328   8e-105   
emb|CDY53564.1|  BnaC04g55760D                                          329   8e-105   
ref|XP_009382167.1|  PREDICTED: probable pectate lyase 8                328   8e-105   
ref|NP_001141589.1|  uncharacterized protein LOC100273705               329   9e-105   
gb|KFK28033.1|  hypothetical protein AALP_AA8G463100                    327   9e-105   
dbj|BAB10560.1|  pectate lyase                                          327   9e-105   
ref|XP_006352706.1|  PREDICTED: probable pectate lyase 10-like          328   1e-104   
gb|KEH42160.1|  pectate lyase-like protein                              329   1e-104   
ref|XP_008789532.1|  PREDICTED: probable pectate lyase 8                324   1e-104   
ref|XP_010556943.1|  PREDICTED: probable pectate lyase 1                327   1e-104   
dbj|BAF43573.1|  pectate lyase                                          327   1e-104   
ref|XP_010940647.1|  PREDICTED: probable pectate lyase 8                328   2e-104   
ref|XP_010264036.1|  PREDICTED: probable pectate lyase 8                328   2e-104   
ref|XP_008812405.1|  PREDICTED: probable pectate lyase 8                328   2e-104   
dbj|BAK06362.1|  predicted protein                                      328   2e-104   
emb|CDY65626.1|  BnaC03g74840D                                          328   2e-104   
gb|EPS68938.1|  hypothetical protein M569_05827                         326   2e-104   
ref|XP_009139602.1|  PREDICTED: probable pectate lyase 15               328   2e-104   
ref|XP_007222160.1|  hypothetical protein PRUPE_ppa005761mg             328   2e-104   
ref|XP_009411363.1|  PREDICTED: probable pectate lyase 8                328   2e-104   
ref|XP_006420566.1|  hypothetical protein CICLE_v10004783mg             329   2e-104   
emb|CAB36835.1|  putative pectate lyase A11 (fragment)                  325   2e-104   
ref|XP_009593549.1|  PREDICTED: probable pectate lyase 8                328   2e-104   
ref|XP_010239619.1|  PREDICTED: probable pectate lyase 8 isoform X1     328   2e-104   
emb|CDX92652.1|  BnaC07g39100D                                          326   2e-104   
ref|NP_567409.1|  probable pectate lyase 15                             328   2e-104   
dbj|BAK05605.1|  predicted protein                                      327   2e-104   
ref|XP_009370039.1|  PREDICTED: probable pectate lyase 8                327   3e-104   
ref|NP_001190720.1|  probable pectate lyase 15                          327   3e-104   
emb|CDY01151.1|  BnaA04g06680D                                          327   3e-104   
emb|CDY11033.1|  BnaA03g46920D                                          326   3e-104   
ref|XP_009599824.1|  PREDICTED: pectate lyase                           325   3e-104   
ref|XP_008439105.1|  PREDICTED: probable pectate lyase 22               326   3e-104   
ref|XP_010918897.1|  PREDICTED: probable pectate lyase 8 isoform X2     327   3e-104   
gb|ABR18471.1|  unknown                                                 328   3e-104   
gb|KFK42808.1|  hypothetical protein AALP_AA1G041400                    327   3e-104   
emb|CBI33346.3|  unnamed protein product                                326   4e-104   
emb|CDY48132.1|  BnaCnng15740D                                          326   4e-104   
ref|XP_010444201.1|  PREDICTED: probable pectate lyase 22 isoform X3    324   4e-104   
ref|XP_006653139.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    328   5e-104   
ref|XP_010918895.1|  PREDICTED: probable pectate lyase 8 isoform X1     327   5e-104   
ref|XP_010484044.1|  PREDICTED: probable pectate lyase 22               325   5e-104   



>ref|XP_009599825.1| PREDICTED: probable pectate lyase P59 isoform X1 [Nicotiana tomentosiformis]
Length=445

 Score =   459 bits (1182),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 218/331 (66%), Positives = 263/331 (79%), Gaps = 8/331 (2%)
 Frame = -1

Query  994  LLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVIL  815
             LF+ + A IIP  + HI +FD+VW+ R EEA  +A + YEP+P NVT   N  V     
Sbjct  12   FLFI-IFATIIPCLMAHIGDFDEVWRRRAEEAREYARQIYEPNPENVTLAFNQKV-----  65

Query  814  DYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFG  635
              R++  E     NSTRR LG KKY+GPC  TNPIDRCWRCDPNWA+ RKRLADC++GFG
Sbjct  66   --RDSMKEVTVSNNSTRRGLGTKKYKGPCMVTNPIDRCWRCDPNWADNRKRLADCAMGFG  123

Query  634  YKAKGGKNGDFYTVTDNSDHPLNPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSH  455
             KA GGK+G+ Y VTDNSD    PK GTLR+AVIQ +PLWIIF RSM I+L QEL++QS 
Sbjct  124  SKATGGKDGEIYIVTDNSDDYAEPKPGTLRYAVIQKEPLWIIFERSMTIRLHQELIMQSD  183

Query  454  KTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGD  275
            KTID RGA VHI+ GAGITLQ++KNVIIHG+ +HDIV G GGM+RD+++H G+RT SDGD
Sbjct  184  KTIDARGANVHIAKGAGITLQYIKNVIIHGLHIHDIVEGSGGMVRDAVDHIGIRTVSDGD  243

Query  274  GISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDK  95
            GIS+FGA++IW+DH+SMRKC DG+IDA+E STAITISN HFTDHNEVMLFGA+D S  D+
Sbjct  244  GISIFGASNIWIDHVSMRKCYDGIIDAVEGSTAITISNGHFTDHNEVMLFGASDSSSIDQ  303

Query  94   IMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            +MQ+T+AFNHFGKRLVQRMPRCR+GY HVVN
Sbjct  304  VMQITLAFNHFGKRLVQRMPRCRWGYIHVVN  334



>ref|XP_009779191.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score =   459 bits (1181),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 214/341 (63%), Positives = 262/341 (77%), Gaps = 5/341 (1%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             M G ++K        + A II   + HI +FD+VW+ R EEA  +A + YEP+P NVT  
Sbjct  1     MGGPKLKYSFFFLFIIFATIIRNLMAHIGDFDEVWRRRAEEAREYARQIYEPNPENVTLA  60

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRK  665
              N  V   + + R           STRR LG KKY+GPC  TNPIDRCWRCDPNWA+ RK
Sbjct  61    FNQKVRDTMKELRQVTVSN-----STRRGLGTKKYKGPCMVTNPIDRCWRCDPNWADNRK  115

Query  664   RLADCSLGFGYKAKGGKNGDFYTVTDNSDHPLNPKRGTLRHAVIQIKPLWIIFARSMNIK  485
             RLADC++GFGYKA GGK+G+ Y VTDNSD    PK GTLR+AVIQ +PLWIIF RSM I+
Sbjct  116   RLADCAMGFGYKATGGKDGEIYIVTDNSDDYAEPKPGTLRYAVIQKEPLWIIFERSMTIR  175

Query  484   LKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINH  305
             L QE+++QS KTID RGA VHI+ GAGITLQ++KNVIIHG+ +HDIV G GGM+RD+++H
Sbjct  176   LHQEMIMQSDKTIDARGANVHIAKGAGITLQYIKNVIIHGLHIHDIVEGSGGMVRDAVDH  235

Query  304   FGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLF  125
              G+RT SDGDGIS+FGA++IW+DH+SM+KC DG+IDA+E ST ITISN HFTDHNEVMLF
Sbjct  236   IGIRTVSDGDGISIFGASNIWIDHVSMKKCYDGIIDAVEGSTGITISNGHFTDHNEVMLF  295

Query  124   GANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             GA+D S  D++MQ+T+AFNHFGKRLVQRMPRCR+GY HVVN
Sbjct  296   GASDSSSIDQVMQITLAFNHFGKRLVQRMPRCRWGYIHVVN  336



>ref|XP_009599826.1| PREDICTED: probable pectate lyase P59 isoform X2 [Nicotiana tomentosiformis]
Length=444

 Score =   456 bits (1174),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 217/331 (66%), Positives = 261/331 (79%), Gaps = 9/331 (3%)
 Frame = -1

Query  994  LLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVIL  815
             LF+ + A IIP  + HI +FD+VW+ R EEA  +A + YEP+P NVT   N  V  +  
Sbjct  12   FLFI-IFATIIPCLMAHIGDFDEVWRRRAEEAREYARQIYEPNPENVTLAFNQKVRDM--  68

Query  814  DYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFG  635
                   E     NSTRR LG KKY+GPC  TNPIDRCWRCDPNWA+ RKRLADC++GFG
Sbjct  69   ------KEVTVSNNSTRRGLGTKKYKGPCMVTNPIDRCWRCDPNWADNRKRLADCAMGFG  122

Query  634  YKAKGGKNGDFYTVTDNSDHPLNPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSH  455
             KA GGK+G+ Y VTDNSD    PK GTLR+AVIQ +PLWIIF RSM I+L QEL++QS 
Sbjct  123  SKATGGKDGEIYIVTDNSDDYAEPKPGTLRYAVIQKEPLWIIFERSMTIRLHQELIMQSD  182

Query  454  KTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGD  275
            KTID RGA VHI+ GAGITLQ++KNVIIHG+ +HDIV G GGM+RD+++H G+RT SDGD
Sbjct  183  KTIDARGANVHIAKGAGITLQYIKNVIIHGLHIHDIVEGSGGMVRDAVDHIGIRTVSDGD  242

Query  274  GISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDK  95
            GIS+FGA++IW+DH+SMRKC DG+IDA+E STAITISN HFTDHNEVMLFGA+D S  D+
Sbjct  243  GISIFGASNIWIDHVSMRKCYDGIIDAVEGSTAITISNGHFTDHNEVMLFGASDSSSIDQ  302

Query  94   IMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            +MQ+T+AFNHFGKRLVQRMPRCR+GY HVVN
Sbjct  303  VMQITLAFNHFGKRLVQRMPRCRWGYIHVVN  333



>ref|XP_004234779.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=449

 Score =   453 bits (1165),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 211/341 (62%), Positives = 263/341 (77%), Gaps = 3/341 (1%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             M G +IK   L      A IIP+ + HI  +D+VW+ R EEA  +A K YEP P NVT  
Sbjct  1     MGGPKIKYSFLFLCITFATIIPSLMAHIGHYDEVWRRRAEEAKEYARKIYEPHPENVTLA  60

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRK  665
              N  +   + + +           STRR LG KKY GPC  TNPID+CWRCDPNWA+ RK
Sbjct  61    FNQKLRDTMKELKKVKGTHNN---STRRGLGTKKYTGPCMVTNPIDKCWRCDPNWADNRK  117

Query  664   RLADCSLGFGYKAKGGKNGDFYTVTDNSDHPLNPKRGTLRHAVIQIKPLWIIFARSMNIK  485
             +LADC++GFG KA GGK+G+FY VTDNSD   +PK GTLRHAVIQ +PLWIIF R MNI+
Sbjct  118   KLADCAMGFGSKAIGGKDGEFYVVTDNSDDYNDPKPGTLRHAVIQKEPLWIIFKRGMNIR  177

Query  484   LKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINH  305
             L QE+++QS KTID RG  VHI+ GAGITLQ++KNVIIHG+ +HDIV G+GGM+RD+++H
Sbjct  178   LHQEMIMQSDKTIDARGVNVHITKGAGITLQYIKNVIIHGLHIHDIVEGNGGMVRDAVDH  237

Query  304   FGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLF  125
              G+RT+SDGDGIS+FGA++IW+DH+SM++C DG+IDA+E ST ITISN HFTDHNEVMLF
Sbjct  238   IGIRTKSDGDGISIFGASNIWIDHVSMQRCYDGLIDAVEGSTGITISNGHFTDHNEVMLF  297

Query  124   GANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             GA+D S  D++MQ+T+AFNHFGKRL+QRMPRCR+GY HVVN
Sbjct  298   GASDSSSIDQVMQITLAFNHFGKRLIQRMPRCRWGYIHVVN  338



>ref|XP_006361835.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=447

 Score =   450 bits (1157),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 211/341 (62%), Positives = 261/341 (77%), Gaps = 5/341 (1%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             M G +IK   L      A IIP+ + HI  +D+VW+ R EEA  +A + YE  P NVT  
Sbjct  1     MGGPKIKYTFLFLCITFATIIPSLMAHIGHYDEVWRRRAEEAKEYARQIYERHPENVTLA  60

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRK  665
              N  +   + + +           STRR LG KKY GPC  TNPIDRCWRCDPNWA+ RK
Sbjct  61    FNQKLRNTMKELKEVKGTN-----STRRGLGTKKYCGPCIVTNPIDRCWRCDPNWADNRK  115

Query  664   RLADCSLGFGYKAKGGKNGDFYTVTDNSDHPLNPKRGTLRHAVIQIKPLWIIFARSMNIK  485
             RLADC++GFG K  GGKNG+FY VTDNSD   +PK GTLR+AVIQ +PLWIIF R MNI+
Sbjct  116   RLADCAMGFGSKVTGGKNGEFYVVTDNSDDYNDPKPGTLRYAVIQKEPLWIIFKRGMNIR  175

Query  484   LKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINH  305
             L QE+++QS KTID RG  VHI+ GAGITLQ++KNVIIHG+ +HDIV G+GGM+RD+++H
Sbjct  176   LHQEMIMQSDKTIDARGVNVHITKGAGITLQYIKNVIIHGLHIHDIVEGNGGMVRDAVDH  235

Query  304   FGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLF  125
              G+RT+SDGDGIS+FGA++IW+DH+SM++C DG+IDA+E ST ITISN HFTDHNEVMLF
Sbjct  236   IGIRTKSDGDGISIFGASNIWIDHVSMQRCYDGLIDAVEGSTGITISNGHFTDHNEVMLF  295

Query  124   GANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             GA+D S  D++MQ+T+AFNHFGKRLVQRMPRCR+GY HVVN
Sbjct  296   GASDSSSIDQVMQITLAFNHFGKRLVQRMPRCRWGYIHVVN  336



>sp|P15722.1|PLY59_SOLLC RecName: Full=Probable pectate lyase P59; Flags: Precursor [Solanum 
lycopersicum]
 emb|CAA33523.1| P59 protein [Solanum lycopersicum]
Length=449

 Score =   449 bits (1155),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 210/341 (62%), Positives = 261/341 (77%), Gaps = 3/341 (1%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             M G +IK   L      A IIP+ + HI  +D+VW+ R EEA  +A   YEP P NVT  
Sbjct  1     MGGPKIKYSFLFLCITFATIIPSLMAHIGHYDEVWRRRAEEAKEYARNIYEPHPENVTLA  60

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRK  665
              N  +   + + +           STRR LG KKY GPC  TNPID+CWRCDPNWA+ RK
Sbjct  61    FNQKLRDTMKELKKVKGTHNN---STRRGLGTKKYTGPCMVTNPIDKCWRCDPNWADNRK  117

Query  664   RLADCSLGFGYKAKGGKNGDFYTVTDNSDHPLNPKRGTLRHAVIQIKPLWIIFARSMNIK  485
             +LADC++GFG KA GGK+G+FY VTDNSD   +PK GTLRHAVIQ +PLWIIF R MNI+
Sbjct  118   KLADCAMGFGSKAIGGKDGEFYVVTDNSDDYNDPKPGTLRHAVIQKEPLWIIFKRGMNIR  177

Query  484   LKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINH  305
             L QE+++QS KTID RG  VHI+ GAGITLQ++KNVIIHG+ +HDIV G+GGM+RD+++H
Sbjct  178   LHQEMIMQSDKTIDARGVNVHITKGAGITLQYIKNVIIHGLHIHDIVEGNGGMVRDAVDH  237

Query  304   FGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLF  125
              G+RT+SDGDGIS+FGA+ IW+DH+SM++C DG+IDA+E ST ITISN HFTDHNEVMLF
Sbjct  238   IGIRTKSDGDGISIFGASYIWIDHVSMQRCYDGLIDAVEGSTGITISNGHFTDHNEVMLF  297

Query  124   GANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             GA+D S  D++MQ+T+AFNHFGKRL+QRMPRCR+GY HVVN
Sbjct  298   GASDSSSIDQVMQITLAFNHFGKRLIQRMPRCRWGYIHVVN  338



>ref|XP_009587689.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=447

 Score =   446 bits (1146),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 213/341 (62%), Positives = 256/341 (75%), Gaps = 5/341 (1%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             M+G ++     +   + A IIP+ L HI EFD+VW+ R EEA   AL+TYE +P NVT  
Sbjct  1     MKGSKVTHSFFVLFFIFAAIIPSFLAHIGEFDEVWRRRAEEARKVALQTYESEPENVTLA  60

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRK  665
              N  V   + +            N TRR LG KKY GPC  TNPID+CWRCDPNWA+ RK
Sbjct  61    FNKQVRDAMKEL-----SEVIPKNDTRRELGTKKYTGPCMVTNPIDKCWRCDPNWADNRK  115

Query  664   RLADCSLGFGYKAKGGKNGDFYTVTDNSDHPLNPKRGTLRHAVIQIKPLWIIFARSMNIK  485
             +LADC++GFG KA GGK G FY V D SD   +PK GTLRHAVIQ +PLWIIF R M I+
Sbjct  116   KLADCAMGFGSKATGGKAGRFYVVNDPSDDYTDPKPGTLRHAVIQKEPLWIIFDRGMTIR  175

Query  484   LKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINH  305
             L QEL++QS KTID RGA VHISGGAGI +Q+ KNVIIHG+ +HDIV G+GGM+RD+++H
Sbjct  176   LHQELIMQSDKTIDARGANVHISGGAGIMIQYTKNVIIHGLHIHDIVQGNGGMVRDAVDH  235

Query  304   FGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLF  125
              GLRT SDGDGIS+FGA++IW+DH+SM  C DG+IDA+E ST ITISN HFTDHNEVMLF
Sbjct  236   IGLRTMSDGDGISIFGASNIWIDHVSMWNCYDGIIDAVEGSTGITISNGHFTDHNEVMLF  295

Query  124   GANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             GA+D S  D+ MQ+T+AFNHFGKRLVQRMPRCR+GY HVVN
Sbjct  296   GASDSSSIDQQMQITLAFNHFGKRLVQRMPRCRWGYIHVVN  336



>ref|XP_009789921.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score =   443 bits (1140),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 212/331 (64%), Positives = 253/331 (76%), Gaps = 7/331 (2%)
 Frame = -1

Query  994  LLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVIL  815
            L F+  A  IIP+ L HI EFD+VW+ R EEA   AL+TYE +P NVT   N  V   + 
Sbjct  13   LFFIFTA--IIPSFLAHIGEFDEVWRRRAEEARKVALQTYESEPENVTLAFNKQVRDAMK  70

Query  814  DYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFG  635
            +            N TRR LG KKY GPC  TNPID+CWRCDPNWA+ RK+LADC++GFG
Sbjct  71   EL-----SEVIPKNDTRRELGTKKYTGPCMVTNPIDKCWRCDPNWADNRKKLADCAMGFG  125

Query  634  YKAKGGKNGDFYTVTDNSDHPLNPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSH  455
             KA GGK G FY V D+SD   +PK GTLRHAVIQ +PLWIIF R M I+L QEL++QS 
Sbjct  126  SKATGGKAGRFYVVNDSSDDYTDPKPGTLRHAVIQKEPLWIIFDRGMTIRLHQELIMQSD  185

Query  454  KTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGD  275
            KTID RGA VHI+GGAGI +Q+ KNVIIHG+ +HDIV G+GGM+RD+++H GLRT SDGD
Sbjct  186  KTIDARGANVHIAGGAGIMIQYTKNVIIHGLHIHDIVQGNGGMVRDAVDHIGLRTMSDGD  245

Query  274  GISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDK  95
            GIS+FGA++IW+DH+SM  C DG+IDA+E ST ITISN HFTDHNEVMLFGA+D S  D+
Sbjct  246  GISIFGASNIWIDHVSMWNCYDGIIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQ  305

Query  94   IMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             MQ+T+AFNHFGKRLVQRMPRCR+GY HVVN
Sbjct  306  QMQITLAFNHFGKRLVQRMPRCRWGYIHVVN  336



>gb|EPS66620.1| hypothetical protein M569_08154, partial [Genlisea aurea]
Length=451

 Score =   441 bits (1133),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 208/334 (62%), Positives = 261/334 (78%), Gaps = 2/334 (1%)
 Frame = -1

Query  1000 LSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKV  821
            L+L  V++++ ++PTS   I+E+DD W+ R+ EAW   L +YEP+P+ + + LN +  ++
Sbjct  5    LALSVVAISSCLVPTSDARIAEYDDFWKKRRAEAWNRTLLSYEPNPAKIVTHLNLHSHRL  64

Query  820  ILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLG  641
            + +    ++      + TRR L  ++Y GPC  TNPIDRCWRC  +WA  R RLADC LG
Sbjct  65   LHELNATDHFHLVGNH-TRRSLRGRRYNGPCTVTNPIDRCWRCRSDWATNRFRLADCGLG  123

Query  640  FGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMV  464
            FGYKAKGGKNG  Y VTD+SD+ + NPK GTLRHAVIQ  PLWI+FARSM I+L QEL+V
Sbjct  124  FGYKAKGGKNGPIYVVTDSSDNDMVNPKPGTLRHAVIQPGPLWIVFARSMVIRLSQELLV  183

Query  463  QSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRS  284
             S KTIDGRGA+VH++ GAGITLQFV NVIIHG+ +HDIV G GGMIRDS++H+G RTRS
Sbjct  184  TSDKTIDGRGARVHVAYGAGITLQFVSNVIIHGLHIHDIVQGSGGMIRDSVDHYGFRTRS  243

Query  283  DGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSP  104
            DGDGIS+FG+ D+W+DH+SMR+C DG+IDAI  ST ITISNSHFTDHNEVMLFGA+D   
Sbjct  244  DGDGISIFGSQDLWIDHVSMRRCYDGLIDAIMGSTGITISNSHFTDHNEVMLFGASDGYS  303

Query  103  KDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             D  MQ+T+AFNHFGKRL+QRMPRCR+GY HVVN
Sbjct  304  PDAKMQMTVAFNHFGKRLIQRMPRCRWGYIHVVN  337



>ref|XP_010033216.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
Length=435

 Score =   438 bits (1127),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 212/337 (63%), Positives = 256/337 (76%), Gaps = 12/337 (4%)
 Frame = -1

Query  1009  IKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNV  830
             +K++  +     A+++P+   HI EFD+ WQ R EEA   AL+ + P+P NVT+  N NV
Sbjct  1     MKLVGFILALSLAVLVPSLEAHIKEFDEYWQKRAEEASQAALEAFNPEPENVTAQFNANV  60

Query  829   VKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADC  650
              KV+              NSTRR L   KY GPC ATNPIDRCWRC  NWA  RKRLA C
Sbjct  61    NKVL-----------DGNNSTRRQLHMHKYSGPCLATNPIDRCWRCRKNWAKDRKRLAKC  109

Query  649   SLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQE  473
              LGFG K  GG  G +Y V D SD+ + NPK GTLRHAVIQ +PLWIIFARSM I+L QE
Sbjct  110   VLGFGRKTTGGLKGKYYVVYDCSDNDVVNPKPGTLRHAVIQKRPLWIIFARSMVIRLNQE  169

Query  472   LMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLR  293
             LMV SHKTIDGRGA VHI+ GAGIT+QFV+NVIIH IR+HDIV   GG+IRD+++H G+R
Sbjct  170   LMVASHKTIDGRGANVHIAFGAGITIQFVRNVIIHNIRIHDIVTRPGGIIRDAVDHVGIR  229

Query  292   TRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGAND  113
             T SDGDGIS+FG+T+IW+DH+SM++C DG+IDAIE STAITISN H+T HN+VMLFGA+D
Sbjct  230   TMSDGDGISIFGSTNIWIDHVSMKRCQDGLIDAIEGSTAITISNGHYTHHNDVMLFGASD  289

Query  112   HSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
               P+DKIMQVT+AFNHFGK L+QRMPRCR+G+FHVVN
Sbjct  290   LYPRDKIMQVTVAFNHFGKGLIQRMPRCRWGFFHVVN  326



>ref|XP_006357122.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=448

 Score =   437 bits (1123),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 201/333 (60%), Positives = 251/333 (75%), Gaps = 6/333 (2%)
 Frame = -1

Query  1000 LSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKV  821
            L +LF    AII P    HI +FD+VW+ R EEA    ++TYE +P+N+T   N      
Sbjct  11   LFVLFFVFGAII-PAFNAHIGDFDEVWRRRAEEAMKFTIQTYESEPANITLAFNQKTRDS  69

Query  820  ILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLG  641
            + +            N TRR LG KKY GPC  TNPID+CWRCDPNWA+ RK+L +CS+G
Sbjct  70   VKEL-----SAVVSKNETRRELGTKKYEGPCTVTNPIDKCWRCDPNWADNRKKLVECSMG  124

Query  640  FGYKAKGGKNGDFYTVTDNSDHPLNPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQ  461
            FGYK  GG++G +Y V+D+SD    PK GTLRHAVIQ +PLWIIF R+M IKL QEL++Q
Sbjct  125  FGYKTTGGRDGKYYVVSDSSDDYTTPKPGTLRHAVIQKEPLWIIFDRNMKIKLHQELIMQ  184

Query  460  SHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSD  281
              KTIDGRGA VHI+GGA I +Q+ KNVIIHG+ +HDIV G+GGM+RD+++H G RT+SD
Sbjct  185  GDKTIDGRGATVHITGGASIMIQYTKNVIIHGLHIHDIVEGNGGMVRDAVDHIGFRTKSD  244

Query  280  GDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPK  101
            GDGIS+FG+++IW+DH+SM  C DG+IDA+E ST ITISN H+TDHNEVMLFGA+D S  
Sbjct  245  GDGISIFGSSNIWIDHMSMENCYDGIIDAVEGSTGITISNGHYTDHNEVMLFGASDSSSI  304

Query  100  DKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            D+ MQ+T+AFNHFGKRLVQRMPRCR+GY HVVN
Sbjct  305  DQKMQITLAFNHFGKRLVQRMPRCRWGYIHVVN  337



>ref|XP_011098575.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=449

 Score =   436 bits (1122),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 213/335 (64%), Positives = 254/335 (76%), Gaps = 7/335 (2%)
 Frame = -1

Query  1000 LSLLFVSLAAIIIPTSL-GHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVK  824
            LS+LF+   A  +P ++  HI+EFD+VWQ R EEAW   L++YEP P+ + S LN NV +
Sbjct  8    LSVLFLFAFASTLPGAVRAHIAEFDEVWQRRAEEAWNRTLESYEPAPAKIVSHLNLNVHR  67

Query  823  VILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSL  644
             + + +           STRR L    Y GPC  TNPIDRCWRC  NWA  R RLADC L
Sbjct  68   ALKEVKEEELSLN----STRRQL-SHGYDGPCRVTNPIDRCWRCQANWAQNRFRLADCVL  122

Query  643  GFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELM  467
            GFGYKAKGGKNG  Y VTD SD+ + NPK GTLRHAVIQ +PLWIIF R M I+L QEL+
Sbjct  123  GFGYKAKGGKNGKIYVVTDPSDNDMVNPKPGTLRHAVIQKEPLWIIFQRDMLIRLSQELI  182

Query  466  VQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTR  287
            VQS KTIDGRGA+V I+ GAGITLQFVKNVIIHGI++++I  G GGMIRD+++H+GLRTR
Sbjct  183  VQSDKTIDGRGARVLIANGAGITLQFVKNVIIHGIKIYNISPGQGGMIRDAVDHYGLRTR  242

Query  286  SDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHS  107
            SDGDGIS+FG+ DIW+DH+SM  C DG+ID I  ST +T+SNSHFTDHNE MLFGA+D  
Sbjct  243  SDGDGISIFGSQDIWIDHVSMLNCADGLIDVIMGSTGVTVSNSHFTDHNEAMLFGASDSH  302

Query  106  PKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             +D  MQVT+AFNHFGKR+VQRMPR RYGY HVVN
Sbjct  303  TQDVKMQVTVAFNHFGKRMVQRMPRARYGYIHVVN  337



>ref|XP_007046218.1| Pectate lyase family protein, putative [Theobroma cacao]
 gb|EOY02050.1| Pectate lyase family protein, putative [Theobroma cacao]
Length=441

 Score =   432 bits (1111),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 206/324 (64%), Positives = 248/324 (77%), Gaps = 12/324 (4%)
 Frame = -1

Query  970  IIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnne  791
            +IIPT   HI+E+DD W+ R+ EA  H  K Y P+P  VT   NH+V + ++ +      
Sbjct  19   VIIPTLHAHIAEYDDYWRQREAEAKEHFNKAYNPNPEEVTQHFNHHVARTLMGFN-----  73

Query  790  tetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKN  611
                  STRR L  K+  GPC ATNPID+CWRCDPNW   RKRLADCSLGFG    GGKN
Sbjct  74   ------STRRSLRGKRRTGPCQATNPIDQCWRCDPNWHRNRKRLADCSLGFGRGTIGGKN  127

Query  610  GDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRG  434
            G +Y VTD SD+ + NPK GTLRHAVIQ +PLWIIFARSM IKL QEL++ S KTID RG
Sbjct  128  GRYYIVTDPSDNDMVNPKPGTLRHAVIQKRPLWIIFARSMIIKLNQELIMTSDKTIDARG  187

Query  433  AQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGA  254
            A VH++ GAGIT+QF +N+IIHG+ +HDIV G GGMIRDS++H+G RT+SDGDG+SLFGA
Sbjct  188  ANVHVAYGAGITIQFARNIIIHGLHIHDIVQGSGGMIRDSVDHYGFRTKSDGDGVSLFGA  247

Query  253  TDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIA  74
            T+IWLDHLSM  C DG+IDAI+ STAITISN HFT+HNEVMLFGA+D   +D+ MQ+T+A
Sbjct  248  TNIWLDHLSMYNCYDGLIDAIQGSTAITISNCHFTNHNEVMLFGASDSYSEDQKMQITVA  307

Query  73   FNHFGKRLVQRMPRCRYGYFHVVN  2
            F HFGK LVQRMPRCR+G+ HVVN
Sbjct  308  FTHFGKGLVQRMPRCRWGFIHVVN  331



>ref|XP_002520133.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF42188.1| Pectate lyase precursor, putative [Ricinus communis]
Length=440

 Score =   429 bits (1104),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 206/332 (62%), Positives = 259/332 (78%), Gaps = 13/332 (4%)
 Frame = -1

Query  994  LLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVIL  815
            +LF S A +I PT   +I +FD+ W+ + + A   A ++Y P+P NV++ LN+ V K + 
Sbjct  12   VLFASFA-VIFPTLHANIGDFDEYWKQKADIAREAAYRSYNPNPFNVSNQLNYQVNKAV-  69

Query  814  DYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFG  635
                      + TNSTRR+L ++K  GPC ATNPIDRCWRCDP WA  RKRL +C LGFG
Sbjct  70   ----------SGTNSTRRNLMRRKGGGPCKATNPIDRCWRCDPKWALNRKRLVECVLGFG  119

Query  634  YKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQS  458
            +   GGK+G FY VTD SD+ + NPK GTLRHAVIQ +PLWIIFARSM I+L QELM+ S
Sbjct  120  HSTTGGKDGKFYIVTDPSDNDMVNPKPGTLRHAVIQNEPLWIIFARSMIIRLNQELMISS  179

Query  457  HKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDG  278
            +KTID RGA VHI+GGAG+TLQFV+NVIIHGIR+HDIV G GG++RDS++H+G RT+SDG
Sbjct  180  NKTIDARGANVHIAGGAGLTLQFVQNVIIHGIRIHDIVSGSGGLVRDSVDHYGFRTKSDG  239

Query  277  DGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKD  98
            DGIS+FG+++IW+DH+SM  C DG+IDAI  ST+ITISN HFT+HNEVMLFGA+D    D
Sbjct  240  DGISIFGSSNIWIDHVSMSNCQDGLIDAIMGSTSITISNCHFTNHNEVMLFGASDGYSAD  299

Query  97   KIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             IMQ+T+AFNHFG+ LVQRMPRCR+G+FHVVN
Sbjct  300  TIMQITVAFNHFGRGLVQRMPRCRWGFFHVVN  331



>gb|KCW52797.1| hypothetical protein EUGRSUZ_J02132 [Eucalyptus grandis]
Length=451

 Score =   430 bits (1105),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 212/350 (61%), Positives = 256/350 (73%), Gaps = 25/350 (7%)
 Frame = -1

Query  1009  IKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNV  830
             +K++  +     A+++P+   HI EFD+ WQ R EEA   AL+ + P+P NVT+  N NV
Sbjct  4     MKLVGFILALSLAVLVPSLEAHIKEFDEYWQKRAEEASQAALEAFNPEPENVTAQFNANV  63

Query  829   VKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADC  650
              KV+              NSTRR L   KY GPC ATNPIDRCWRC  NWA  RKRLA C
Sbjct  64    NKVL-----------DGNNSTRRQLHMHKYSGPCLATNPIDRCWRCRKNWAKDRKRLAKC  112

Query  649   SLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQE  473
              LGFG K  GG  G +Y V D SD+ + NPK GTLRHAVIQ +PLWIIFARSM I+L QE
Sbjct  113   VLGFGRKTTGGLKGKYYVVYDCSDNDVVNPKPGTLRHAVIQKRPLWIIFARSMVIRLNQE  172

Query  472   LMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLR  293
             LMV SHKTIDGRGA VHI+ GAGIT+QFV+NVIIH IR+HDIV   GG+IRD+++H G+R
Sbjct  173   LMVASHKTIDGRGANVHIAFGAGITIQFVRNVIIHNIRIHDIVTRPGGIIRDAVDHVGIR  232

Query  292   TRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHN---------  140
             T SDGDGIS+FG+T+IW+DH+SM++C DG+IDAIE STAITISN H+T HN         
Sbjct  233   TMSDGDGISIFGSTNIWIDHVSMKRCQDGLIDAIEGSTAITISNGHYTHHNDTLMFNLHP  292

Query  139   ----EVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
                 +VMLFGA+D  P+DKIMQVT+AFNHFGK L+QRMPRCR+G+FHVVN
Sbjct  293   GTYVQVMLFGASDLYPRDKIMQVTVAFNHFGKGLIQRMPRCRWGFFHVVN  342



>ref|XP_002311599.2| pectate lyase family protein [Populus trichocarpa]
 gb|EEE88966.2| pectate lyase family protein [Populus trichocarpa]
Length=441

 Score =   427 bits (1097),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 212/331 (64%), Positives = 256/331 (77%), Gaps = 14/331 (4%)
 Frame = -1

Query  991  LFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILD  812
            LFVSLAA + PT  GHI EFD+ W+ + +EA   A + + PDP NVT+  N  V KV+ +
Sbjct  13   LFVSLAAFV-PTLQGHIGEFDEYWKKKADEALKAAQEAFYPDPMNVTNQFNFQVNKVMTE  71

Query  811  YRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGY  632
                       TNSTRR L  K+  G C ATNPIDRCWRCDPNWA+ R++LADC LGFG+
Sbjct  72   -----------TNSTRRSLVSKR-GGRCMATNPIDRCWRCDPNWASHRQKLADCVLGFGH  119

Query  631  KAKGGKNGDFYTVTDNSDHP-LNPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSH  455
            K  GGK G  Y VTD SD+  LNPK GTLRHAVIQ +PLWIIF+ SM I+L QELMV S+
Sbjct  120  KTVGGKYGKIYVVTDASDNDMLNPKPGTLRHAVIQKEPLWIIFSGSMVIRLNQELMVASN  179

Query  454  KTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGD  275
            KTID RGA+VHI+ GAGITLQFV+NVIIHG+R+HDIV G GG++RDS++H+G RT+SDGD
Sbjct  180  KTIDSRGAKVHIAYGAGITLQFVQNVIIHGLRIHDIVIGSGGLVRDSVDHYGFRTKSDGD  239

Query  274  GISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDK  95
            GIS+FG+++IW+DH+SM  C DG+ID I  S AITISNSHFT HNEVMLFGA+D    D 
Sbjct  240  GISIFGSSNIWIDHVSMSNCQDGLIDVIMGSNAITISNSHFTRHNEVMLFGASDSYSGDS  299

Query  94   IMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            IMQ+T+AFNHFG+ LVQRMPRCR+G+FHVVN
Sbjct  300  IMQITVAFNHFGRGLVQRMPRCRWGFFHVVN  330



>ref|XP_007032453.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY03379.1| Pectate lyase family protein [Theobroma cacao]
Length=454

 Score =   426 bits (1095),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 217/336 (65%), Positives = 262/336 (78%), Gaps = 5/336 (1%)
 Frame = -1

Query  994  LLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVIL  815
            L+F+   A +IP+    I+EFD+VW+ R E+AW +AL+ YEP P NVTS LN+NV K +L
Sbjct  8    LVFLFSFAALIPSLWADIAEFDEVWKQRAEQAWKNALEAYEPMPENVTSNLNYNVNKALL  67

Query  814  DYRnnnnetet--etNSTRRHL--GKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCS  647
              R N         TNSTRR+L    KKY GPC ATNPIDRCWRC  NWA  RK+LA+C 
Sbjct  68   KGRANKTRAFEGVTTNSTRRNLRGNHKKYIGPCMATNPIDRCWRCRKNWARNRKQLANCV  127

Query  646  LGFGYKAKGGKNGDFYTVTDNSD-HPLNPKRGTLRHAVIQIKPLWIIFARSMNIKLKQEL  470
            LGFG+K +GGK G +Y VTDNSD + LNP+ GTLRHAVIQ +PLWIIFA  MNIKL QEL
Sbjct  128  LGFGHKTEGGKQGGYYLVTDNSDDNVLNPRPGTLRHAVIQKEPLWIIFAHDMNIKLSQEL  187

Query  469  MVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRT  290
            +VQS KTIDGRGA VHI+ GAGITLQFV NVIIH + +H I    GG+IRDS++H+G RT
Sbjct  188  IVQSKKTIDGRGANVHIAYGAGITLQFVDNVIIHNLHIHHIRKSSGGLIRDSVDHYGFRT  247

Query  289  RSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDH  110
              DGDGIS+FG+T+IWLDHLSM +C+DG+IDAI+ STAITISN HFT HN+V+L GA+D 
Sbjct  248  VGDGDGISIFGSTNIWLDHLSMSECEDGLIDAIQGSTAITISNCHFTHHNDVILLGASDS  307

Query  109  SPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
              +DK+MQVT+AFNHFGK L+QRMPRCR+G+FHVVN
Sbjct  308  YSRDKLMQVTVAFNHFGKELIQRMPRCRWGFFHVVN  343



>ref|XP_010112093.1| putative pectate lyase 7 [Morus notabilis]
 gb|EXC32626.1| putative pectate lyase 7 [Morus notabilis]
Length=437

 Score =   424 bits (1090),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 206/334 (62%), Positives = 253/334 (76%), Gaps = 14/334 (4%)
 Frame = -1

Query  1000 LSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKV  821
            L L+F+    ++IP+   +I +FD+ WQ R EEA   AL+ Y+P+P  VT + N  V KV
Sbjct  7    LGLVFLIGFVVLIPSLQANIGDFDESWQQRAEEAHKAALEAYDPNPEEVTDSFNEEVDKV  66

Query  820  ILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLG  641
            I             +NSTRR L  ++Y GPC ATNPIDRCWRC  NWA+ RKRLA C LG
Sbjct  67   I-----------DGSNSTRREL--RRYSGPCAATNPIDRCWRCRSNWASNRKRLARCVLG  113

Query  640  FGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMV  464
            FG K  GG++G +Y VTD SD+ + NP+ GTLRHAVIQ +PLWIIFA SM I+L QEL++
Sbjct  114  FGRKTTGGRSGRYYVVTDPSDNDVQNPRPGTLRHAVIQKQPLWIIFAHSMIIRLSQELLI  173

Query  463  QSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRS  284
             SHKTID RGA +HI+ GAGIT+QF +NVIIHG+ +HDIV   GGMIRDS++HFG RT +
Sbjct  174  TSHKTIDARGANIHIANGAGITIQFARNVIIHGLHIHDIVASGGGMIRDSVDHFGFRTPA  233

Query  283  DGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSP  104
            DGDGIS+FG+T+IWLDH+SM  C DG+IDAI+ STAITISN HFT HN+VMLFGA+D   
Sbjct  234  DGDGISIFGSTNIWLDHISMSNCQDGLIDAIQGSTAITISNCHFTHHNDVMLFGASDSFE  293

Query  103  KDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             DKIMQVT+AFNHFG+ LVQRMPRCR+G+FHVVN
Sbjct  294  GDKIMQVTVAFNHFGRGLVQRMPRCRWGFFHVVN  327



>ref|XP_011025954.1| PREDICTED: probable pectate lyase P59 [Populus euphratica]
Length=441

 Score =   424 bits (1091),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 211/331 (64%), Positives = 255/331 (77%), Gaps = 14/331 (4%)
 Frame = -1

Query  991  LFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILD  812
            LFVSLA + +PT  GHI EFD+ W+ + +EA   A + + PDP NVTS  N  V KV+ +
Sbjct  13   LFVSLA-VFVPTLQGHIGEFDEYWKKKADEARKAAQEAFYPDPLNVTSQFNFQVNKVLTE  71

Query  811  YRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGY  632
                       TNSTRR L +K+  G C ATNPIDRCWRCDPNWA+ R++LADC LGFG+
Sbjct  72   -----------TNSTRRSLVRKR-GGRCIATNPIDRCWRCDPNWASHRQKLADCVLGFGH  119

Query  631  KAKGGKNGDFYTVTDNSDHP-LNPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSH  455
            K  GGK G  Y VTD SD+  LNPK GTLRHAVIQ +PLWIIF+ SM I+L QELMV S+
Sbjct  120  KTVGGKYGKIYVVTDASDNDMLNPKPGTLRHAVIQKEPLWIIFSGSMVIRLNQELMVASN  179

Query  454  KTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGD  275
            KTID RG +VHI+ GAGITLQF +NVIIHG+R+HDIV G GG+IRDS++H+G RT+SDGD
Sbjct  180  KTIDSRGFKVHIAYGAGITLQFAQNVIIHGLRIHDIVSGSGGLIRDSVDHYGFRTKSDGD  239

Query  274  GISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDK  95
            GIS+FG+++IW+DH+SM  C DG+ID I  S AITISNSHFT HNEVMLFGA+D    D 
Sbjct  240  GISIFGSSNIWIDHVSMSNCQDGLIDVIMGSNAITISNSHFTRHNEVMLFGASDSYSGDS  299

Query  94   IMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            IMQ+T++FNHFGK LVQRMPRCR+G+FHVVN
Sbjct  300  IMQITVSFNHFGKGLVQRMPRCRWGFFHVVN  330



>ref|XP_010066949.1| PREDICTED: pectate lyase [Eucalyptus grandis]
 gb|KCW65002.1| hypothetical protein EUGRSUZ_G02541 [Eucalyptus grandis]
Length=436

 Score =   420 bits (1080),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 207/335 (62%), Positives = 251/335 (75%), Gaps = 14/335 (4%)
 Frame = -1

Query  1003  ILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVK  824
             +   LF S  A+++P+   +I EFD+ W  R EEA   ALK Y+P P  VTS  N  V K
Sbjct  5     VCFFLFFSSFAVLVPSLQANIEEFDEYWAKRAEEAQKDALKAYDPHPETVTSLFNAKVDK  64

Query  823   VILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSL  644
              +              NSTRR L  KKY+GPC ATNPIDRCWRC+ NWA  RKRLA+C L
Sbjct  65    AV-----------RGNNSTRRQL--KKYKGPCLATNPIDRCWRCNRNWARNRKRLANCVL  111

Query  643   GFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELM  467
             GFG K +GGK G FY VTD+SD+ + NPK GTLRHAV+Q  PLWIIFA SM I+L QEL+
Sbjct  112   GFGRKTRGGKRGWFYVVTDSSDNDMVNPKPGTLRHAVVQKGPLWIIFAGSMVIRLNQELI  171

Query  466   VQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTR  287
             + S KTID RGA VHI+ GAGITLQF++NVIIHG+ +HDIV G GG+IRD+ +H GLRT 
Sbjct  172   MTSDKTIDARGANVHIAYGAGITLQFIRNVIIHGLHIHDIVRGSGGLIRDAHDHVGLRTA  231

Query  286   SDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHS  107
             SDGDGIS+FG++ +W+DH+SM  C DG+IDAI+ STAITISN HFT HNEVMLFGA+D  
Sbjct  232   SDGDGISIFGSSHLWIDHVSMSACSDGLIDAIQGSTAITISNCHFTHHNEVMLFGASDGY  291

Query  106   PKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
              +D+IMQ+T+AFNHFG+ LVQRMPRCR+G+FHVVN
Sbjct  292   SQDQIMQITVAFNHFGRGLVQRMPRCRWGFFHVVN  326



>ref|XP_010256490.1| PREDICTED: pectate lyase-like [Nelumbo nucifera]
Length=441

 Score =   420 bits (1080),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 207/341 (61%), Positives = 252/341 (74%), Gaps = 13/341 (4%)
 Frame = -1

Query  1018  GFQIKILSLLFVSL-AAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTL  842
             G    ILSL  ++   A+I PT   HI+EFD+VWQ R EEA  +A+  Y P+P  V + L
Sbjct  2     GATKAILSLFLLAFNLAVITPTLRAHIAEFDEVWQKRAEEAKKNAMDAYHPNPDEVINHL  61

Query  841   NHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKR  662
             N NV   + +           +N TRR L  K Y GPC ATNPIDRCWRC  NW+  RK+
Sbjct  62    NMNVHLAMQE-----------SNGTRRSLKTKPYGGPCLATNPIDRCWRCQKNWSRNRKK  110

Query  661   LADCSLGFGYKAKGGKNGDFYTVTDNSDHP-LNPKRGTLRHAVIQIKPLWIIFARSMNIK  485
             LADC +GFG K  GGK G FY VTD SD+  LNPK GTLRHAVIQ +PLWIIFAR M I+
Sbjct  111   LADCVVGFGRKTIGGKLGKFYVVTDGSDNDMLNPKPGTLRHAVIQKEPLWIIFARDMVIR  170

Query  484   LKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINH  305
             L QEL++   KTID RGA VH++ GAGIT+QFVKNVIIHG+ VHDIV G GG+IRDS++H
Sbjct  171   LNQELLMAGDKTIDARGANVHVAYGAGITIQFVKNVIIHGLHVHDIVPGSGGLIRDSVDH  230

Query  304   FGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLF  125
             +GLRT+SDGDGISLFGAT++W+DH+SM  C DG+IDAI ++TA+T+SN HFT HNEVMLF
Sbjct  231   YGLRTQSDGDGISLFGATNVWIDHISMSNCKDGLIDAIMSTTAVTVSNCHFTHHNEVMLF  290

Query  124   GANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             GA+     D +MQ+T+AFNHFG+ LVQRMPRCR+G+ HVVN
Sbjct  291   GASGSYSGDAVMQITVAFNHFGRGLVQRMPRCRWGFAHVVN  331



>ref|XP_008357758.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=459

 Score =   420 bits (1080),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 206/334 (62%), Positives = 255/334 (76%), Gaps = 4/334 (1%)
 Frame = -1

Query  1000 LSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKV  821
              +L  SL A     +L +I+ FD VWQ R  +A   ALK Y+P+P  VT   N +V + 
Sbjct  19   FCMLVPSLKAETANDTL-NIANFDAVWQERAMKAQKAALKAYQPNPEQVTEDFNESVEQT  77

Query  820  ILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLG  641
            +++   +  + ++  NSTRR+L  K Y+GPC ATNPIDRCWRC  NWAN RK+LA C  G
Sbjct  78   VVE--EDLEDDQSAGNSTRRNLRGKXYKGPCKATNPIDRCWRCRANWANNRKKLASCVKG  135

Query  640  FGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMV  464
            FG K +GGK G +Y VTD+SD  + +PK GTLRHAVIQ +PLWIIFARSM I+L QEL+V
Sbjct  136  FGRKTRGGKKGAYYIVTDSSDDNVHDPKPGTLRHAVIQTQPLWIIFARSMVIRLSQELIV  195

Query  463  QSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRS  284
             SHKTID RGA VHI+ GAGITLQFV+NVIIHG+R+HD V G GGMIRDS++H G+RT+S
Sbjct  196  TSHKTIDARGANVHIAHGAGITLQFVQNVIIHGLRIHDTVPGSGGMIRDSLSHIGIRTQS  255

Query  283  DGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSP  104
            DGDGIS++G+++IWLDHLSM  C DG+IDAI+ STAITISN HFT HN+VMLFGA+D   
Sbjct  256  DGDGISIYGSSNIWLDHLSMWNCADGLIDAIQGSTAITISNCHFTHHNDVMLFGASDAFA  315

Query  103  KDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             D IMQ+T+AFNHFGK L+QRMPRCR+G+ HVVN
Sbjct  316  GDAIMQITVAFNHFGKGLIQRMPRCRWGFVHVVN  349



>ref|XP_006338480.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=446

 Score =   419 bits (1078),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 197/318 (62%), Positives = 243/318 (76%), Gaps = 6/318 (2%)
 Frame = -1

Query  949  GHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNS  770
            GHI EFD+VW+ R +EA   A+K Y+PDP NVT        + + + +            
Sbjct  22   GHIGEFDEVWRRRAQEADEWAIKAYKPDPINVTLAFAKQTGQALKEIKEAKLAIN----G  77

Query  769  TRRHL--GKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYT  596
            TRR L  G KKY GPC  TNPIDRCWRC PNWA+ RKRLADC++GF     GGK G+ Y 
Sbjct  78   TRRELKGGGKKYNGPCLVTNPIDRCWRCQPNWADNRKRLADCAMGFAKGTTGGKAGEIYV  137

Query  595  VTDNSDHPLNPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHIS  416
            VTD+SD   +PK GTLR+ VIQ +PLWIIFA+SM I+L QEL+VQS KTIDGRG  VHI+
Sbjct  138  VTDSSDDTSDPKPGTLRYGVIQKEPLWIIFAKSMTIRLHQELIVQSDKTIDGRGVNVHIA  197

Query  415  GGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLD  236
             GAG  LQ+VKNVIIHG+R+HDIV G GGMIRD+++H G RT+SDGDGIS+FG+++IW+D
Sbjct  198  NGAGFMLQYVKNVIIHGLRIHDIVVGSGGMIRDAMDHIGQRTQSDGDGISIFGSSNIWVD  257

Query  235  HLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGK  56
            H+SM  C DG++DA+E STA+TISNSHFTDHNEVMLFGA+D S  D+ MQ+T+A+NHFGK
Sbjct  258  HVSMWSCYDGLVDAVEGSTAVTISNSHFTDHNEVMLFGASDSSSIDQRMQITVAYNHFGK  317

Query  55   RLVQRMPRCRYGYFHVVN  2
            RL+QRMPRCR+G+ HVVN
Sbjct  318  RLIQRMPRCRWGFIHVVN  335



>ref|XP_004232242.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=446

 Score =   419 bits (1077),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 197/318 (62%), Positives = 244/318 (77%), Gaps = 6/318 (2%)
 Frame = -1

Query  949  GHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNS  770
            GHI EFD+VW+ R +EA   A+K Y+PDP NVT        + + + +            
Sbjct  22   GHIGEFDEVWRRRAQEADEWAIKAYKPDPINVTLAFAKETGQALKEIKEAKLAVN----G  77

Query  769  TRRHL--GKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYT  596
            TRR L  G KKY GPC+ TNPIDRCWRC P+WA+ RKRLADC++GF     GGK G+ Y 
Sbjct  78   TRRELKGGGKKYDGPCSVTNPIDRCWRCQPDWADNRKRLADCAMGFAKGTTGGKAGEIYV  137

Query  595  VTDNSDHPLNPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHIS  416
            VTD+SD   +PK GTLR+ VIQ +PLWIIFA+SM I+L QEL+VQS KTIDGRG  VHI+
Sbjct  138  VTDSSDDTSDPKPGTLRYGVIQKEPLWIIFAKSMTIRLHQELIVQSDKTIDGRGVNVHIA  197

Query  415  GGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLD  236
             GAG  LQ+VKNVIIHG+R+HDIV G GGMIRD+++H G RT+SDGDGIS+FG+++IW+D
Sbjct  198  NGAGFMLQYVKNVIIHGLRIHDIVVGSGGMIRDAMDHVGQRTQSDGDGISIFGSSNIWVD  257

Query  235  HLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGK  56
            H+SM  C DG++DAIE STA+TISNSHFTDHNEVMLFGA+D S  D+ MQ+T+A+NHFGK
Sbjct  258  HVSMWSCYDGLVDAIEGSTAVTISNSHFTDHNEVMLFGASDSSSIDQRMQITVAYNHFGK  317

Query  55   RLVQRMPRCRYGYFHVVN  2
            RL+QRMPRCR+G+ HVVN
Sbjct  318  RLIQRMPRCRWGFIHVVN  335



>emb|CDP02198.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   419 bits (1076),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 206/355 (58%), Positives = 256/355 (72%), Gaps = 20/355 (6%)
 Frame = -1

Query  1006  KILSLLFVSLAAIIIPT---SLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNH  836
             K++ +   +   +++PT   + G  S  ++ W+ R EEAW H LK YE +P  V    N 
Sbjct  7     KLVCVFLCAFTIVVVPTLITAQGSGSAEEEYWRIRAEEAWNHTLKAYEANPHTVIGAFNK  66

Query  835   N----------------VVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDR  704
                              + K+ L    +  +  +E NSTRR L  KK+ G C ATNPIDR
Sbjct  67    QASENEMPGKTAAQDDKLTKLNLPPCCHTQQFLSEKNSTRRELRGKKWGGGCLATNPIDR  126

Query  703   CWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHP-LNPKRGTLRHAVIQI  527
             CWRC PNWA+ RKRLADC +GFG    GGKNG FY VTD+SD   L PK GTLRHAVIQ 
Sbjct  127   CWRCQPNWADNRKRLADCVVGFGRGTTGGKNGAFYVVTDSSDDSILAPKPGTLRHAVIQK  186

Query  526   KPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDI  347
             +PLWIIF R M I+L QEL++Q  KTIDGRG  VHI+ GAGIT+QFVKNVIIHG+ +HDI
Sbjct  187   EPLWIIFERDMVIRLTQELIMQGDKTIDGRGVSVHIAYGAGITIQFVKNVIIHGLHIHDI  246

Query  346   VHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITI  167
               G GG++RDS++HFG+RT SDGDGIS+FG++++W+DH+SM KC DG+IDA+EASTAITI
Sbjct  247   HQGSGGLVRDSVDHFGIRTMSDGDGISIFGSSNVWIDHVSMWKCYDGLIDAVEASTAITI  306

Query  166   SNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             SNSHFTDHNEVMLFGA+D   KD +MQ+T+AFNHFGKRL+QRMPRCR+G+ HVVN
Sbjct  307   SNSHFTDHNEVMLFGASDSQSKDAVMQITVAFNHFGKRLIQRMPRCRWGFIHVVN  361



>ref|XP_009342871.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=454

 Score =   418 bits (1074),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 206/334 (62%), Positives = 254/334 (76%), Gaps = 4/334 (1%)
 Frame = -1

Query  1000 LSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKV  821
              +L  SL A     +L +I+ FD VWQ R  +A   ALK Y+P+P  VT   N +V + 
Sbjct  14   FCMLVPSLKAETANDTL-NIANFDAVWQERGMKAQKAALKAYQPNPEQVTEDFNESVEQT  72

Query  820  ILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLG  641
            +++   +  + ++  NSTRRHL  K  +GPC ATNPIDRCWRC  NWAN RK+LA C  G
Sbjct  73   VVE--EDLEDDQSAGNSTRRHLRGKHNKGPCKATNPIDRCWRCRANWANNRKKLASCVKG  130

Query  640  FGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMV  464
            FG K +GGK G +Y VTD+SD  + +PK GTLRHAVIQ +PLWIIFARSM I+L QEL+V
Sbjct  131  FGRKTRGGKKGAYYIVTDSSDDNVHDPKPGTLRHAVIQTQPLWIIFARSMVIRLSQELIV  190

Query  463  QSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRS  284
             SHKTID RGA VHI+ GAGITLQFV+NVIIHG+R+HD V G GGMIRDS++H G+RT+S
Sbjct  191  TSHKTIDARGANVHIAHGAGITLQFVQNVIIHGLRIHDTVPGSGGMIRDSLSHIGIRTQS  250

Query  283  DGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSP  104
            DGDGIS++G+++IWLDHLSM  C DG+IDAI+ STAITISN HFT HN+VMLFGA+D   
Sbjct  251  DGDGISIYGSSNIWLDHLSMWNCADGLIDAIQGSTAITISNCHFTRHNDVMLFGASDAFA  310

Query  103  KDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             D IMQ+T+AFNHFGK L+QRMPRCR+G+ HVVN
Sbjct  311  GDAIMQITVAFNHFGKGLIQRMPRCRWGFVHVVN  344



>ref|XP_010242445.1| PREDICTED: pectate lyase [Nelumbo nucifera]
Length=443

 Score =   416 bits (1070),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 203/325 (62%), Positives = 242/325 (74%), Gaps = 8/325 (2%)
 Frame = -1

Query  973  AIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnn  794
            A IIPT   HI +FD+VWQ R EEA  +AL+ Y PDP  V +  NH+V     + R+ N+
Sbjct  20   AAIIPTLRAHIGDFDEVWQKRAEEAKSNALEAYHPDPDEVINHFNHHVHLATAEVRSGNS  79

Query  793  etetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGK  614
                   STRR L  K+Y+GPC ATNPIDRCWRC   W   RK+LADC LGFG K  GGK
Sbjct  80   -------STRRSLRNKEYKGPCMATNPIDRCWRCRSKWGKNRKKLADCVLGFGRKTVGGK  132

Query  613  NGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGR  437
             G FY VTD SD  + NPK GTLRHAVIQ +PLWIIF   M I+LKQEL++ S KT+DGR
Sbjct  133  YGKFYVVTDGSDDDMENPKPGTLRHAVIQTEPLWIIFEHDMIIRLKQELIMTSDKTLDGR  192

Query  436  GAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFG  257
            GA+VHI+ GAGIT+QF+KNVIIH +  HDIV  +GGMIRDS+NH G RT SDGD IS+FG
Sbjct  193  GARVHIAYGAGITIQFIKNVIIHNLHFHDIVAREGGMIRDSVNHLGFRTASDGDAISIFG  252

Query  256  ATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTI  77
            +T++W+DH SM  C DG++DAI  STAITISN+H T HNEVMLFGA+D  P D  MQ+T+
Sbjct  253  STNVWIDHNSMSNCKDGLVDAIMGSTAITISNNHLTHHNEVMLFGASDSYPDDSKMQITV  312

Query  76   AFNHFGKRLVQRMPRCRYGYFHVVN  2
            AFNHFG+ LVQRMPRCR+G+FHVVN
Sbjct  313  AFNHFGRGLVQRMPRCRWGFFHVVN  337



>ref|XP_008341537.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=454

 Score =   416 bits (1070),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 206/341 (60%), Positives = 256/341 (75%), Gaps = 11/341 (3%)
 Frame = -1

Query  1000 LSLLFVSLAAIIIPTSLG-------HISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTL  842
            L+LL +S   +++P+          +I+EFD VWQ R  +A   ALK Y+P+P  VT   
Sbjct  7    LALLMISFC-MLVPSLKAETQNDTLNIAEFDSVWQQRALKAQKAALKAYQPNPEQVTEDF  65

Query  841  NHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKR  662
            N +V   I++  ++++       ST RHL  K+Y GPC ATNPIDRCWRC  NWA+ RK 
Sbjct  66   NESVEMTIIEDDHDDDHAAGN--STGRHLLGKRYTGPCKATNPIDRCWRCQANWADNRKH  123

Query  661  LADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIK  485
            LA C  GFG K +GGK G +Y VTD+SD  + +PK GTLRHAVIQ +PLWIIFARSM I+
Sbjct  124  LASCVKGFGRKTRGGKKGAYYIVTDSSDDNIHDPKPGTLRHAVIQKQPLWIIFARSMVIR  183

Query  484  LKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINH  305
            L QEL+V SHKTID RGA VHI+ GAGITLQFV+NVIIHG+ +HD V G+GGMIRDS++H
Sbjct  184  LTQELIVTSHKTIDARGANVHIAHGAGITLQFVQNVIIHGLHIHDTVPGNGGMIRDSVDH  243

Query  304  FGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLF  125
             G+RT SDGDGIS++G+++IWLDHLSM  C DG+IDAI+ STAITISNSHFT HN+VMLF
Sbjct  244  IGIRTHSDGDGISIYGSSNIWLDHLSMWNCADGLIDAIQGSTAITISNSHFTRHNDVMLF  303

Query  124  GANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            GA+D    D IMQ+T+AFNHFGK L+QRMPRCR+G+ HVVN
Sbjct  304  GASDGFSGDAIMQITVAFNHFGKGLIQRMPRCRWGFIHVVN  344



>ref|XP_002270089.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32015.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   414 bits (1065),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 200/325 (62%), Positives = 248/325 (76%), Gaps = 14/325 (4%)
 Frame = -1

Query  973  AIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnn  794
            A+I PT   HI+E+DD W+ R+EEA   AL+ + P P  V    N +V   +        
Sbjct  18   AVIAPTIRAHIAEYDDYWKEREEEAKKAALEAFHPTPQEVNDHFNLHVEDELTG------  71

Query  793  etetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGK  614
                 +N TRR L  +  +GPC ATNPIDRCWRC PNWA++RKRLADC LGFG    GGK
Sbjct  72   -----SNGTRRSL--RVNKGPCKATNPIDRCWRCRPNWASQRKRLADCVLGFGRNTVGGK  124

Query  613  NGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGR  437
             G +Y VTD SD+ + NPK+GTLRHAVIQ +PLWI+FARSM I+L QEL++ S KTIDGR
Sbjct  125  YGKYYFVTDPSDNDMVNPKKGTLRHAVIQPRPLWIVFARSMIIRLNQELIMTSDKTIDGR  184

Query  436  GAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFG  257
            G  VHI+ GAGIT+QFVKNVIIHG+ +HDIV G GG+IRDS+NHFG R+RSDGDGIS++G
Sbjct  185  GVNVHIAYGAGITIQFVKNVIIHGLHIHDIVSGSGGLIRDSVNHFGYRSRSDGDGISIYG  244

Query  256  ATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTI  77
            ++ +W+DH SM  C DG+IDAI+ STAITISN+HFT HNEVMLFGA+D +  D+IMQ+T+
Sbjct  245  SSHVWIDHNSMSNCKDGLIDAIQGSTAITISNNHFTKHNEVMLFGASDSNSADEIMQITV  304

Query  76   AFNHFGKRLVQRMPRCRYGYFHVVN  2
            AFNHFG+ L+QRMPRCR+G+FHVVN
Sbjct  305  AFNHFGRGLIQRMPRCRWGFFHVVN  329



>gb|KGN59593.1| hypothetical protein Csa_3G827350 [Cucumis sativus]
Length=441

 Score =   414 bits (1064),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 208/342 (61%), Positives = 254/342 (74%), Gaps = 13/342 (4%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             M G +IK++ ++ VS+A +++PT    I+EFDD    + EEA   +L+ + PDP NVT  
Sbjct  2     MTGCKIKVV-MVLVSMA-VLMPTLRAGIAEFDDFLLQKSEEAKQASLEAFHPDPMNVTDH  59

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRK  665
              N +V   +        E    +NSTRR L   KY GPC ATNPIDRCWRCDPNWA  RK
Sbjct  60    FNQHVHLAL--------EGIEGSNSTRRSL--SKYNGPCLATNPIDRCWRCDPNWAKNRK  109

Query  664   RLADCSLGFGYKAKGGKNGDFYTVTDNSDHP-LNPKRGTLRHAVIQIKPLWIIFARSMNI  488
             +LA C LGFG K  GGK G  Y VTD SD+  +NP+ GTLR+  +Q KPLWIIFARSM I
Sbjct  110   KLAKCVLGFGRKTTGGKKGRIYVVTDPSDNDVINPRPGTLRYGALQKKPLWIIFARSMII  169

Query  487   KLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSIN  308
             +L +ELM+ SHKTID RGA VHI+ GAG+++QF +NVIIHG+R+H ++   GGMIRD+ N
Sbjct  170   RLSKELMITSHKTIDARGANVHIAYGAGLSIQFARNVIIHGLRIHHVISTGGGMIRDTAN  229

Query  307   HFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVML  128
             H GLRT SDGDGIS+FG+T+IWLDHLSM  C DG+IDAI+ STAITISNSHFT HN+VML
Sbjct  230   HVGLRTVSDGDGISIFGSTNIWLDHLSMSNCQDGLIDAIQGSTAITISNSHFTHHNDVML  289

Query  127   FGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             FGA+D    D IMQVT+AFNHFGK LVQRMPRCR+G+FHVVN
Sbjct  290   FGASDSYQGDSIMQVTVAFNHFGKGLVQRMPRCRWGFFHVVN  331



>ref|XP_008374522.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=441

 Score =   414 bits (1064),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 202/343 (59%), Positives = 252/343 (73%), Gaps = 14/343 (4%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSL-GHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTS  848
             ME      + +L + + AI IP ++  +I+ FD+ WQ R +EA   A K Y  +P+ VT 
Sbjct  3     MEAAYKLFVFILCIFIVAITIPATVTANIAVFDEHWQGRAKEAKQAANKAYNKNPAEVTG  62

Query  847   TLNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKR  668
             + N  V                  N+TRR+L K+KY+GPC ATNPIDRCWRCDPNW   R
Sbjct  63    SFNKEVHNTF-----------DSMNNTRRNL-KEKYKGPCVATNPIDRCWRCDPNWETNR  110

Query  667   KRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMN  491
             K+LADC+ GFG+K  GGK G+ Y VTDNSD+ L NPK GTLRHAVIQ  PLWIIFA  M 
Sbjct  111   KKLADCAKGFGHKTTGGKAGEIYVVTDNSDNDLVNPKPGTLRHAVIQTGPLWIIFAHDMK  170

Query  490   IKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSI  311
             IKL +ELMV S KTID RGA VHI  G  ITLQFVKNVIIH + +HD   G+GGMIRDS+
Sbjct  171   IKLSEELMVTSDKTIDARGANVHIQDGGQITLQFVKNVIIHNLHIHDNKAGNGGMIRDSV  230

Query  310   NHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVM  131
             NH+G RTRSDGDGIS++GA+++W+DH+S   C+DG+IDAI+ STAITISN HFT+HN+VM
Sbjct  231   NHYGQRTRSDGDGISMYGASNVWIDHVSASNCEDGLIDAIQGSTAITISNCHFTNHNDVM  290

Query  130   LFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             LFG++D + +D++MQ+TIAFNHFG+ L QRMPRCR+G+FHVVN
Sbjct  291   LFGSSDSNSQDEVMQITIAFNHFGQGLTQRMPRCRWGFFHVVN  333



>ref|XP_009617495.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=451

 Score =   413 bits (1062),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 211/343 (62%), Positives = 256/343 (75%), Gaps = 5/343 (1%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             M G ++  LSL   S    IIP+  GHI +FD+VW+ R +EA   ALK YEPDP NVT  
Sbjct  1     MGGPKLINLSLFLFSTFLAIIPSLNGHIGDFDEVWRRRAQEAEEWALKAYEPDPVNVTLA  60

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLG--KKKYRGPCNATNPIDRCWRCDPNWANK  671
                   + + + +            TRR L    K Y GPC  TNPIDRCWRC  NWA+ 
Sbjct  61    FAKQTKESMKELKEVKKLATN---DTRRELRGFHKNYAGPCLVTNPIDRCWRCQGNWADN  117

Query  670   RKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPLNPKRGTLRHAVIQIKPLWIIFARSMN  491
             RKRLADC+LGFG    GGK G FY VTD+SD   NPK GTLRHAVIQ +PLWIIFA+SMN
Sbjct  118   RKRLADCALGFGKGTTGGKAGRFYVVTDSSDDSSNPKPGTLRHAVIQKEPLWIIFAKSMN  177

Query  490   IKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSI  311
             I+L QEL++QS KTIDGRG  VHI+ GAGITLQ+VKNVIIHG+ +HDIV G+GGM+  ++
Sbjct  178   IRLHQELIMQSDKTIDGRGVNVHIAYGAGITLQYVKNVIIHGLHIHDIVVGNGGMVISAV  237

Query  310   NHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVM  131
             +H G+RT+SDGDGIS+FG+++IW+DH+SM +C DG+IDA+E STAITISN HFTDHNEVM
Sbjct  238   DHVGIRTQSDGDGISIFGSSNIWIDHVSMWRCSDGLIDAVEGSTAITISNGHFTDHNEVM  297

Query  130   LFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             LFGA+D S  D+ MQ+T+AFNHFGKRLVQRMPRCR+G+ HVVN
Sbjct  298   LFGASDSSSIDQRMQITVAFNHFGKRLVQRMPRCRWGFIHVVN  340



>ref|XP_011085780.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=447

 Score =   413 bits (1061),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 206/342 (60%), Positives = 252/342 (74%), Gaps = 5/342 (1%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             MEG ++  L + F++ A+I+ P     I+E+D+VW+ R  EA+   ++ Y PDP  V   
Sbjct  1     MEGTKLNWLLISFLAFASIL-PLLRADIAEYDEVWRRRAAEAYNRTVQAYHPDPLKVVMH  59

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRK  665
              N +V K + +  +   +     N+TRRHLGK  Y+GPC  TNPID CWRC+P W   R 
Sbjct  60    FNKHVNKHVEE--SGGLDDVMMLNTTRRHLGKA-YKGPCKVTNPIDACWRCNPKWHLNRF  116

Query  664   RLADCSLGFGYKAKGGKNGDFYTVTDNSDHP-LNPKRGTLRHAVIQIKPLWIIFARSMNI  488
             RLADC +GFG KA GGK G  Y VTD SD   LNPK GTLRHAVIQ +PLWI F R+M I
Sbjct  117   RLADCGMGFGSKATGGKGGRIYMVTDKSDDDVLNPKPGTLRHAVIQEEPLWITFRRNMVI  176

Query  487   KLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSIN  308
             KLKQELMV S KTIDGRGA V I+ GAGIT+QFVKNVIIH +++H IV  DGG+IRDS +
Sbjct  177   KLKQELMVTSDKTIDGRGAIVQIAYGAGITIQFVKNVIIHNLKIHHIVEKDGGLIRDSAS  236

Query  307   HFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVML  128
             H GLRT+SDGDGIS+FG+ DIW+DH+SM +C DG+ID I+ ST ITISNSHFTDH+  ML
Sbjct  237   HTGLRTQSDGDGISIFGSQDIWIDHVSMTRCADGLIDIIQGSTGITISNSHFTDHDHAML  296

Query  127   FGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             FG ND  P D+ MQ+T+AFNHFGKR+VQRMPRCRYG+FHVVN
Sbjct  297   FGGNDKYPGDEKMQITVAFNHFGKRMVQRMPRCRYGFFHVVN  338



>ref|XP_002282500.3| PREDICTED: pectate lyase [Vitis vinifera]
Length=443

 Score =   412 bits (1060),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 198/324 (61%), Positives = 248/324 (77%), Gaps = 14/324 (4%)
 Frame = -1

Query  970  IIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnne  791
            ++ P+   HI EFD+VWQ R EEA   AL+ Y+P+P  VT+  N NV K +         
Sbjct  23   VLAPSIRAHIGEFDEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKSM---------  73

Query  790  tetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKN  611
                TN+TRR+L  +   GPC ATNPIDRCWRC  +WA  RK+LADC LGFG +  GGK+
Sbjct  74   --QGTNTTRRNL--RSNNGPCMATNPIDRCWRCKQDWAKNRKKLADCVLGFGRRTTGGKD  129

Query  610  GDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRG  434
            G+FY VTD SD+ + +PK GTLRHAVIQ +PLWIIFAR M I+LKQEL++  +KTIDGRG
Sbjct  130  GEFYVVTDASDNDMIDPKPGTLRHAVIQKEPLWIIFARDMIIRLKQELIMAGNKTIDGRG  189

Query  433  AQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGA  254
            A VHI+ G GIT+QFVKN+IIH + +HDIV   GGMIRDS++H+GLRT SDGDG+S+FG+
Sbjct  190  ANVHIAYGCGITIQFVKNIIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGDGVSIFGS  249

Query  253  TDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIA  74
            +++W+DHLSM  C DG++D I ASTAITISN HFT+HNEVMLFG +++   DKIMQVT+A
Sbjct  250  SNVWVDHLSMSNCKDGLVDVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDKIMQVTVA  309

Query  73   FNHFGKRLVQRMPRCRYGYFHVVN  2
            FNH+G+ LVQRMPRCRYG+ HVVN
Sbjct  310  FNHYGRGLVQRMPRCRYGFVHVVN  333



>ref|XP_009369346.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=441

 Score =   412 bits (1060),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 199/333 (60%), Positives = 249/333 (75%), Gaps = 14/333 (4%)
 Frame = -1

Query  994  LLFVSLAAIIIPTSL-GHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVI  818
            +L + + AI IP ++  +I+ FD+ WQ R +EA   A K Y  +P+ VT + N  V    
Sbjct  13   ILCIFIVAITIPATVTANIAVFDEHWQGRAKEAKQAANKAYNKNPAEVTGSFNKEVHNTF  72

Query  817  LDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGF  638
                          N+TRR+L K+KY+GPC ATNPIDRCWRCDPNW   RK+LADC+ GF
Sbjct  73   -----------DSMNNTRRNL-KEKYKGPCLATNPIDRCWRCDPNWETNRKKLADCAQGF  120

Query  637  GYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQ  461
            G+K  GGK G+ Y VTDNSD+ L NPK GTLRHAVIQ  PLWIIFA  M IKL +ELMV 
Sbjct  121  GHKTTGGKAGEIYVVTDNSDNDLVNPKPGTLRHAVIQTGPLWIIFAHDMKIKLSEELMVT  180

Query  460  SHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSD  281
            S KTID RGA VHI  G  ITLQFVKNVIIH + +HD   G+GGMIRDS+NH+G RTRSD
Sbjct  181  SDKTIDARGANVHIQDGGQITLQFVKNVIIHNLHIHDNKAGNGGMIRDSVNHYGQRTRSD  240

Query  280  GDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPK  101
            GDGIS++GA+++W+DH+S   C+DG+IDAI+ STAITISN HFT+HN+VMLFG++D + +
Sbjct  241  GDGISMYGASNVWIDHVSASNCEDGLIDAIQGSTAITISNCHFTNHNDVMLFGSSDSNSQ  300

Query  100  DKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            D++MQ+T+AFNHFG+ L QRMPRCR+G+FHVVN
Sbjct  301  DEVMQITLAFNHFGQGLTQRMPRCRWGFFHVVN  333



>ref|XP_008443432.1| PREDICTED: probable pectate lyase 19 [Cucumis melo]
Length=441

 Score =   412 bits (1059),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 207/342 (61%), Positives = 255/342 (75%), Gaps = 13/342 (4%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             + G +IK+L ++ VS+A +++PT    I+EFDD    + EEA   +L+ + PDP NVT  
Sbjct  2     VAGCKIKLL-MVLVSMA-VLMPTLRAGIAEFDDYLLQKAEEAKQASLEAFHPDPMNVTDH  59

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRK  665
              N +V   +        E    +NSTRR L K  Y+GPC ATNPIDRCWRCDPNWA  RK
Sbjct  60    FNQHVHLAL--------EGIEGSNSTRRSLAK--YKGPCLATNPIDRCWRCDPNWAKNRK  109

Query  664   RLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNI  488
             +LA C LGFG K  GGK G  Y VTD SD+ + NPK GTLR+  +Q +PLWIIFARSM I
Sbjct  110   KLAKCVLGFGRKTTGGKKGRIYVVTDPSDNDVVNPKPGTLRYGALQKRPLWIIFARSMII  169

Query  487   KLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSIN  308
             +L +ELMV SHKTID RG+ VHI+ GAG+++QF +NVIIHG+R+H ++   GGMIRD+ N
Sbjct  170   RLSKELMVTSHKTIDARGSNVHIAYGAGLSIQFARNVIIHGLRIHHVISTGGGMIRDTAN  229

Query  307   HFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVML  128
             H GLRT SDGDGIS+FG+++IWLDHLSM  C DG+IDAI+ STAITISNSHFT HN+VML
Sbjct  230   HVGLRTVSDGDGISIFGSSNIWLDHLSMSNCQDGLIDAIQGSTAITISNSHFTHHNDVML  289

Query  127   FGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             FGA+D    D IMQVT+AFNHFGK LVQRMPRCR+G+FHVVN
Sbjct  290   FGASDSYQGDSIMQVTVAFNHFGKGLVQRMPRCRWGFFHVVN  331



>emb|CAN79927.1| hypothetical protein VITISV_042447 [Vitis vinifera]
Length=439

 Score =   412 bits (1059),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 198/324 (61%), Positives = 248/324 (77%), Gaps = 14/324 (4%)
 Frame = -1

Query  970  IIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnne  791
            ++ P+   HI EFD+VWQ R EEA   AL+ Y+P+P  VT+  N NV K +         
Sbjct  19   VLAPSIRAHIGEFDEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKSM---------  69

Query  790  tetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKN  611
                TN+TRR+L  +   GPC ATNPIDRCWRC  +WA  RK+LADC LGFG +  GGK+
Sbjct  70   --QGTNTTRRNL--RSNNGPCMATNPIDRCWRCKQDWAKNRKKLADCVLGFGRRTTGGKD  125

Query  610  GDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRG  434
            G+FY VTD SD+ + +PK GTLRHAVIQ +PLWIIFAR M I+LKQEL++  +KTIDGRG
Sbjct  126  GEFYVVTDASDNDMIDPKPGTLRHAVIQKEPLWIIFARDMIIRLKQELIMAGNKTIDGRG  185

Query  433  AQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGA  254
            A VHI+ G GIT+QFVKN+IIH + +HDIV   GGMIRDS++H+GLRT SDGDG+S+FG+
Sbjct  186  ANVHIAYGCGITIQFVKNIIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGDGVSIFGS  245

Query  253  TDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIA  74
            +++W+DHLSM  C DG++D I ASTAITISN HFT+HNEVMLFG +++   DKIMQVT+A
Sbjct  246  SNVWVDHLSMSNCKDGLVDVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDKIMQVTVA  305

Query  73   FNHFGKRLVQRMPRCRYGYFHVVN  2
            FNH+G+ LVQRMPRCRYG+ HVVN
Sbjct  306  FNHYGRGLVQRMPRCRYGFVHVVN  329



>emb|CBI22159.3| unnamed protein product [Vitis vinifera]
Length=468

 Score =   412 bits (1060),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 198/324 (61%), Positives = 248/324 (77%), Gaps = 14/324 (4%)
 Frame = -1

Query  970  IIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnne  791
            ++ P+   HI EFD+VWQ R EEA   AL+ Y+P+P  VT+  N NV K +         
Sbjct  48   VLAPSIRAHIGEFDEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKSM---------  98

Query  790  tetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKN  611
                TN+TRR+L  +   GPC ATNPIDRCWRC  +WA  RK+LADC LGFG +  GGK+
Sbjct  99   --QGTNTTRRNL--RSNNGPCMATNPIDRCWRCKQDWAKNRKKLADCVLGFGRRTTGGKD  154

Query  610  GDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRG  434
            G+FY VTD SD+ + +PK GTLRHAVIQ +PLWIIFAR M I+LKQEL++  +KTIDGRG
Sbjct  155  GEFYVVTDASDNDMIDPKPGTLRHAVIQKEPLWIIFARDMIIRLKQELIMAGNKTIDGRG  214

Query  433  AQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGA  254
            A VHI+ G GIT+QFVKN+IIH + +HDIV   GGMIRDS++H+GLRT SDGDG+S+FG+
Sbjct  215  ANVHIAYGCGITIQFVKNIIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGDGVSIFGS  274

Query  253  TDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIA  74
            +++W+DHLSM  C DG++D I ASTAITISN HFT+HNEVMLFG +++   DKIMQVT+A
Sbjct  275  SNVWVDHLSMSNCKDGLVDVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDKIMQVTVA  334

Query  73   FNHFGKRLVQRMPRCRYGYFHVVN  2
            FNH+G+ LVQRMPRCRYG+ HVVN
Sbjct  335  FNHYGRGLVQRMPRCRYGFVHVVN  358



>ref|XP_004147462.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
 ref|XP_004163529.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
Length=431

 Score =   410 bits (1053),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/332 (61%), Positives = 247/332 (74%), Gaps = 12/332 (4%)
 Frame = -1

Query  994  LLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVIL  815
            ++ VS+A +++PT    I+EFDD    + EEA   +L+ + PDP NVT   N +V   + 
Sbjct  1    MVLVSMA-VLMPTLRAGIAEFDDFLLQKSEEAKQASLEAFHPDPMNVTDHFNQHVHLAL-  58

Query  814  DYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFG  635
                   E    +NSTRR L   KY GPC ATNPIDRCWRCDPNWA  RK+LA C LGFG
Sbjct  59   -------EGIEGSNSTRRSL--SKYNGPCLATNPIDRCWRCDPNWAKNRKKLAKCVLGFG  109

Query  634  YKAKGGKNGDFYTVTDNSDHP-LNPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQS  458
             K  GGK G  Y VTD SD+  +NP+ GTLR+  +Q KPLWIIFARSM I+L +ELM+ S
Sbjct  110  RKTTGGKKGRIYVVTDPSDNDVINPRPGTLRYGALQKKPLWIIFARSMIIRLSKELMITS  169

Query  457  HKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDG  278
            HKTID RGA VHI+ GAG+++QF +NVIIHG+R+H ++   GGMIRD+ NH GLRT SDG
Sbjct  170  HKTIDARGANVHIAYGAGLSIQFARNVIIHGLRIHHVISTGGGMIRDTANHVGLRTVSDG  229

Query  277  DGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKD  98
            DGIS+FG+T+IWLDHLSM  C DG+IDAI+ STAITISNSHFT HN+VMLFGA+D    D
Sbjct  230  DGISIFGSTNIWLDHLSMSNCQDGLIDAIQGSTAITISNSHFTHHNDVMLFGASDSYQGD  289

Query  97   KIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             IMQVT+AFNHFGK LVQRMPRCR+G+FHVVN
Sbjct  290  SIMQVTVAFNHFGKGLVQRMPRCRWGFFHVVN  321



>ref|XP_009802165.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=451

 Score =   410 bits (1053),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 210/343 (61%), Positives = 256/343 (75%), Gaps = 5/343 (1%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             M G ++  LSL   S    IIP+  GHI  FD+VW+ R +EA   ALK YEPDP NVT  
Sbjct  1     MGGPKLINLSLFLFSTFLAIIPSLNGHIGNFDEVWRRRAQEAEEWALKAYEPDPVNVTLA  60

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLG--KKKYRGPCNATNPIDRCWRCDPNWANK  671
                   + + + +  N  +      TRR L    K Y GPC  TNPIDRCWRC  NWA+ 
Sbjct  61    FAKQTRESMKELKEVNKLSTN---ETRRELRGFHKIYAGPCLVTNPIDRCWRCQGNWADN  117

Query  670   RKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPLNPKRGTLRHAVIQIKPLWIIFARSMN  491
             RKRLADC++GFG    GGK G FY VTD+SD   NPK GTLRHAVIQ +PLWIIFA+SM 
Sbjct  118   RKRLADCAMGFGKGTTGGKAGQFYVVTDSSDDSSNPKPGTLRHAVIQKEPLWIIFAKSMT  177

Query  490   IKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSI  311
             I+L QEL++QS KTIDGRG  VHI+ GAGITLQ+VKNVIIHG+ +HDIV G+GGM+  ++
Sbjct  178   IRLHQELIMQSDKTIDGRGVNVHIAYGAGITLQYVKNVIIHGLHIHDIVVGNGGMVISAV  237

Query  310   NHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVM  131
             +H G+RT+SDGDGIS+FG+++IW+DH+SM +C DG+IDA+E STAITISN HFTDHNEVM
Sbjct  238   DHVGIRTQSDGDGISIFGSSNIWIDHVSMWRCSDGLIDAVEGSTAITISNGHFTDHNEVM  297

Query  130   LFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             LFGA+D S  D+ MQ+T+AFNHFGKRLVQRMPRCR+G+ HVVN
Sbjct  298   LFGASDSSSIDQRMQITVAFNHFGKRLVQRMPRCRWGFIHVVN  340



>ref|XP_007037229.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY21730.1| Pectate lyase family protein [Theobroma cacao]
Length=434

 Score =   408 bits (1049),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 200/321 (62%), Positives = 242/321 (75%), Gaps = 14/321 (4%)
 Frame = -1

Query  961  PTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetet  782
            P    +I EFD+VWQ R EEA   AL+ YEP+P  VT  LN    K +            
Sbjct  19   PIVKANIGEFDEVWQKRAEEAKKAALRAYEPNPEKVTDNLNKETGKAL-----------K  67

Query  781  etNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDF  602
             +NSTRR+LG+  YRGPC ATNPIDRCWRCDP+WA  RK+LA C LGFG +  GGK+G F
Sbjct  68   GSNSTRRNLGR--YRGPCLATNPIDRCWRCDPHWAENRKKLATCVLGFGRRTTGGKDGRF  125

Query  601  YTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQV  425
            Y VTD SD+ + NPK GT+RHAVIQ +PLWIIFA  M I+L +EL++ S KTIDGRGA V
Sbjct  126  YVVTDPSDNDMINPKPGTIRHAVIQKEPLWIIFAHDMVIRLNEELIMTSDKTIDGRGANV  185

Query  424  HISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDI  245
            H   GA ITLQ+++NVIIHGI +   V  +GGMIRDS++HFG RT+SDGDGIS+FG+ +I
Sbjct  186  HFFRGAQITLQYIQNVIIHGIHIRLSVEANGGMIRDSVDHFGFRTKSDGDGISIFGSHNI  245

Query  244  WLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNH  65
            W+DH+SM +C DG+ID I+ASTAITISN HFTDHN+VMLFGA+D    DKIMQVT+AFNH
Sbjct  246  WIDHVSMSRCSDGLIDVIQASTAITISNCHFTDHNDVMLFGASDSFSDDKIMQVTVAFNH  305

Query  64   FGKRLVQRMPRCRYGYFHVVN  2
            FG+ LVQRMPRCR+G+ HVVN
Sbjct  306  FGQGLVQRMPRCRWGFIHVVN  326



>ref|XP_011087217.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=436

 Score =   407 bits (1046),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 198/333 (59%), Positives = 244/333 (73%), Gaps = 14/333 (4%)
 Frame = -1

Query  997  SLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVI  818
            SL+F+    ++  T  G+I   D VWQ R+E A   A + Y+P+P  V   LN NV K +
Sbjct  7    SLVFLISLFVVFTTVAGNIGVHDAVWQERREAAKKAARQAYQPNPGEVLDHLNENVHKSV  66

Query  817  LDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGF  638
                           S  +  G  KY+G C ATNPID+CWRC PNWAN RK+L DC+LGF
Sbjct  67   -------------EGSNNQRRGLSKYKGSCLATNPIDQCWRCQPNWANNRKKLVDCALGF  113

Query  637  GYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQ  461
            G    GGK G  Y VTD SD  L +PK+GTLRHAVIQ +PLWIIF  +MNI+L +EL++ 
Sbjct  114  GRHTTGGKAGKMYVVTDPSDSDLVSPKKGTLRHAVIQPEPLWIIFKNNMNIRLSEELIMT  173

Query  460  SHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSD  281
            S+KTIDGRGAQVHI+ GAGITLQ++ NVIIH IRVHDI  G+GGMIRDS  H+G RTRSD
Sbjct  174  SNKTIDGRGAQVHIANGAGITLQYIHNVIIHNIRVHDIKTGNGGMIRDSATHYGFRTRSD  233

Query  280  GDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPK  101
            GDGISLFG+T+IW+DH+S+ +CDDG+IDAIEASTAITISN HF  HN+V+LFGA+D   +
Sbjct  234  GDGISLFGSTNIWIDHVSLSRCDDGLIDAIEASTAITISNCHFAHHNDVLLFGASDSRSE  293

Query  100  DKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            D IMQ+T+AFNHFGK L+QRMPR R+G+ H+VN
Sbjct  294  DHIMQITVAFNHFGKGLIQRMPRVRWGFVHIVN  326



>ref|XP_007209148.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
 gb|EMJ10347.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
Length=440

 Score =   406 bits (1043),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 209/343 (61%), Positives = 256/343 (75%), Gaps = 15/343 (4%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSL-GHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTS  848
             ME  ++ ++ +L V + AI IPT++  +I++FD+ WQ R  EA   A + Y  DP  VT 
Sbjct  3     MEAEKLNVV-ILCVFVIAITIPTTVRANIADFDEHWQQRAAEAKKAAHEAYHDDPIAVTE  61

Query  847   TLNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKR  668
               N  V+    DY           N+TRR+L  +KY+GPC ATNPIDRCWRCDPNW   R
Sbjct  62    HFNKQVLDT-FDY----------ANNTRRNL-NQKYKGPCMATNPIDRCWRCDPNWEKNR  109

Query  667   KRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMN  491
             KRLADC+LGFG KA GGK G  Y VTDN+D  L NPK GTLRHAVIQ  PLWIIFAR M 
Sbjct  110   KRLADCALGFGRKATGGKLGPIYVVTDNTDADLVNPKPGTLRHAVIQNGPLWIIFARDMR  169

Query  490   IKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSI  311
             IKL +EL+V S KTID RGA VHI  GA I+LQFVKNVII  + +H+   G+GGMIRDSI
Sbjct  170   IKLTEELLVASDKTIDARGANVHILDGAQISLQFVKNVIITNLHIHNNKPGNGGMIRDSI  229

Query  310   NHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVM  131
             NHFG RTRSDGDGIS+FGAT++W+DH+S+  C DG+IDAI+ STAITISN H T+HN+VM
Sbjct  230   NHFGQRTRSDGDGISMFGATNVWIDHVSLSNCADGLIDAIQGSTAITISNCHLTNHNDVM  289

Query  130   LFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             LFG++D + +D++MQ+T+AFNHFGK LVQRMPRCR+G+FHVVN
Sbjct  290   LFGSSDSNSQDQVMQITLAFNHFGKGLVQRMPRCRWGFFHVVN  332



>ref|XP_010496063.1| PREDICTED: probable pectate lyase 3 [Camelina sativa]
Length=455

 Score =   405 bits (1041),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 204/334 (61%), Positives = 247/334 (74%), Gaps = 2/334 (1%)
 Frame = -1

Query  1000 LSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKV  821
            L   F+SL AI+ P    H++ FD  W  RK +A      +Y+P+P NVT+  N++V  +
Sbjct  8    LGGFFLSLLAIVAPQVGAHVAVFDSYWMQRKSDALKQTFGSYDPNPLNVTNHFNYHV-NL  66

Query  820  ILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLG  641
             +D   + N+T  E    R     +K+ G C A NPID+CWRCD NWAN RK+LADC+LG
Sbjct  67   AVDATESINDTRRELTQVRSRRKLQKHGGKCVAYNPIDKCWRCDRNWANNRKKLADCALG  126

Query  640  FGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMV  464
            FG K  GGK+G  Y VTD SD+ L NPK GTLR+AV +  PLWIIFARSM IKL+QELM+
Sbjct  127  FGRKTTGGKDGPIYVVTDASDNDLINPKPGTLRYAVTRDGPLWIIFARSMIIKLQQELMI  186

Query  463  QSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRS  284
             S KTIDGRGA+V+I  GAG+TLQFV NVIIH I V  IV G+GG+IRDS  H GLRT+S
Sbjct  187  TSDKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKHIVTGNGGLIRDSEQHIGLRTKS  246

Query  283  DGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSP  104
            DGDGISLFGAT+IW+DH+SM +C+DG+IDAI+ STA+TISNSHFTDH EVMLFGA D   
Sbjct  247  DGDGISLFGATNIWIDHVSMTRCEDGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHV  306

Query  103  KDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             DK MQ+T+AFNHFGKRL QRMPRCR+G  HVVN
Sbjct  307  IDKKMQITVAFNHFGKRLEQRMPRCRFGTIHVVN  340



>gb|KHG16093.1| hypothetical protein F383_07683 [Gossypium arboreum]
Length=454

 Score =   405 bits (1040),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 205/343 (60%), Positives = 256/343 (75%), Gaps = 5/343 (1%)
 Frame = -1

Query  1015  FQIKILSLLFVSLAAIIIPTSLG---HISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
              +I    L+F+   A +IPT  G   +I++FDDVW+ R ++AW + L  YEP P NVTS 
Sbjct  1     MKITKAQLVFLFSFATLIPTLWGGGGNIADFDDVWKRRADQAWKNTLAAYEPSPENVTSK  60

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLGK-KKYRGPCNATNPIDRCWRCDPNWANKR  668
              N NV K ++  ++N  +    +   R   GK KKY GPC ATNPIDRCWRC P+WA  R
Sbjct  61    FNENVHKALVANKSNKTKDLEGSEDRRNLRGKHKKYTGPCMATNPIDRCWRCRPDWAENR  120

Query  667   KRLADCSLGFGYKAKGGKNGDFYTVTDNSDH-PLNPKRGTLRHAVIQIKPLWIIFARSMN  491
             KRL  C +GFG++ +GG+ G +Y VTDNSD  P+NPK GTLR AVIQ +PLWIIFA  M+
Sbjct  121   KRLTQCVIGFGHRTEGGEKGKYYEVTDNSDDDPVNPKPGTLRFAVIQKRPLWIIFAHDMH  180

Query  490   IKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSI  311
             IKL +EL+VQS KTIDGRGA VHI+ GAGITLQFV +VIIH I +H I     G+IRDS+
Sbjct  181   IKLSRELIVQSKKTIDGRGANVHIAHGAGITLQFVDDVIIHSIHIHHIGPSKAGLIRDSV  240

Query  310   NHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVM  131
             +H GLRT  DGDGI++FG+T+IWLDHLSM +C DG+IDAI+ STAITISN HFT HN+V+
Sbjct  241   DHIGLRTTGDGDGINIFGSTNIWLDHLSMSECQDGLIDAIQGSTAITISNCHFTHHNDVI  300

Query  130   LFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             L GA+D   +DK+MQVT+AFNHFGK L+QRMPRCR+G+FHVVN
Sbjct  301   LLGASDTYERDKLMQVTVAFNHFGKELIQRMPRCRWGFFHVVN  343



>ref|XP_007153840.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
 gb|ESW25834.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
Length=447

 Score =   404 bits (1038),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 200/317 (63%), Positives = 242/317 (76%), Gaps = 15/317 (5%)
 Frame = -1

Query  946  HISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNST  767
            H +EFD  W+ R E A +     Y PDP +V+  L+ +V ++I+                
Sbjct  34   HENEFDPYWKGRAETAAVDNNAAYFPDPYSVSGNLSSSVSELIV------------GKDK  81

Query  766  RRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTD  587
            RR+L  ++Y GPC ATNPIDRCWRCDPNWAN R++LADC  GFG    GGK G FY VTD
Sbjct  82   RRNLKGQRYTGPCMATNPIDRCWRCDPNWANNRQKLADCVQGFGRNTVGGKGGPFYVVTD  141

Query  586  NSD-HPLNPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGG  410
             SD + ++ K GTLRHAV +  PLWIIF RSM IKLKQEL++ S KTIDGRG +V+I+ G
Sbjct  142  PSDDNMVDLKPGTLRHAVTRTGPLWIIFERSMMIKLKQELIMTSDKTIDGRGVEVYIASG  201

Query  409  AGITLQFVKNVIIHGIRVHDI-VHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDH  233
            AGIT+QF++NVIIHGI+V+DI VHG GGMIRDS  H+GLRT+SDGDGIS+FG+++IW+DH
Sbjct  202  AGITVQFIRNVIIHGIKVYDIQVHG-GGMIRDSETHYGLRTQSDGDGISIFGSSNIWIDH  260

Query  232  LSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKR  53
            +SMR C DG+IDAI  STAITISNSHFTDHNE MLFGA+D   KDKIMQ+T+AFNHFGKR
Sbjct  261  VSMRNCYDGLIDAIMGSTAITISNSHFTDHNEAMLFGASDSYDKDKIMQITLAFNHFGKR  320

Query  52   LVQRMPRCRYGYFHVVN  2
            LVQRMPRCRYG+ HVVN
Sbjct  321  LVQRMPRCRYGFVHVVN  337



>ref|XP_008239834.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=438

 Score =   404 bits (1037),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 207/343 (60%), Positives = 256/343 (75%), Gaps = 15/343 (4%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSL-GHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTS  848
             ME  ++ ++ +L V + AI IPT++  +I++FD+ WQ R  EA   A + Y  DP  VT 
Sbjct  1     MEAEKLNVV-ILCVFVTAITIPTTVRANIADFDEHWQQRAAEAKKAAHEAYHDDPIAVTE  59

Query  847   TLNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKR  668
               N  V+    DY           N+TRR+L  +KY+GPC ATNPIDRCWRCDPNW   R
Sbjct  60    HFNKQVLDT-FDY----------ANNTRRNL-NQKYKGPCMATNPIDRCWRCDPNWEKNR  107

Query  667   KRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMN  491
             KRLADC+LGFG KA GGK G  Y VTDN+D  L NPK GTLRHAVIQ  PLWIIFAR M 
Sbjct  108   KRLADCALGFGRKATGGKLGPIYVVTDNTDADLVNPKPGTLRHAVIQNGPLWIIFARDMR  167

Query  490   IKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSI  311
             IKL +EL+V S KTID RGA VHI  GA I+LQFVKNVII  + +H+   G+GG+IRDSI
Sbjct  168   IKLTEELLVASDKTIDARGANVHILDGAQISLQFVKNVIITNLHIHNNKPGNGGLIRDSI  227

Query  310   NHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVM  131
             NHFG RTRSDGDGIS++GAT++W+DH+S+  C DG+IDAI+ STAITISN H T+HN+VM
Sbjct  228   NHFGQRTRSDGDGISMYGATNVWIDHVSLSNCADGLIDAIQGSTAITISNCHLTNHNDVM  287

Query  130   LFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             LFG++D + +D++MQ+T+AFNHFGK LVQRMPRCR+G+FHVVN
Sbjct  288   LFGSSDSNSQDQVMQITLAFNHFGKGLVQRMPRCRWGFFHVVN  330



>ref|XP_010476496.1| PREDICTED: probable pectate lyase 3 [Camelina sativa]
Length=455

 Score =   404 bits (1038),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 203/334 (61%), Positives = 247/334 (74%), Gaps = 2/334 (1%)
 Frame = -1

Query  1000 LSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKV  821
            L   F+SL AI+ P    H++ FD  W  RK +A      +Y+P+P NVT+  N++V  +
Sbjct  8    LGGFFLSLLAIVAPQVGAHVAVFDSYWMQRKTDALKQTFGSYDPNPLNVTNHFNYHV-NL  66

Query  820  ILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLG  641
             +D   + N+T  E    R     +K+ G C A NPID+CWRCD NWAN RK+LA+C+LG
Sbjct  67   AVDATESINDTRRELTQVRSRRKLQKHGGKCVAYNPIDKCWRCDRNWANNRKKLAECALG  126

Query  640  FGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMV  464
            FG K  GGK+G  Y VTD SD+ L NPK GTLR+AV +  PLWIIFARSM IKL+QELM+
Sbjct  127  FGRKTTGGKDGPIYVVTDASDNDLINPKPGTLRYAVTRDGPLWIIFARSMIIKLQQELMI  186

Query  463  QSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRS  284
             S KTIDGRGA+V+I  GAG+TLQFV NVIIH I V  IV G+GG+IRDS  H GLRT+S
Sbjct  187  TSDKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKQIVTGNGGLIRDSEQHIGLRTKS  246

Query  283  DGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSP  104
            DGDGISLFGAT+IW+DH+SM +C+DG+IDAI+ STA+TISNSHFTDH EVMLFGA D   
Sbjct  247  DGDGISLFGATNIWIDHVSMTRCEDGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHV  306

Query  103  KDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             DK MQ+T+AFNHFGKRL QRMPRCR+G  HVVN
Sbjct  307  IDKKMQITVAFNHFGKRLEQRMPRCRFGTIHVVN  340



>ref|XP_011085777.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=446

 Score =   403 bits (1035),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 211/342 (62%), Positives = 254/342 (74%), Gaps = 6/342 (2%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             MEG ++  L +LF  +A+I+ P    +I+E+D+VW+ R  EA+   L+ YEPDP  V   
Sbjct  1     MEGTKVNWLPILFFVVASIL-PVLRANIAEYDEVWRRRAAEAYNRTLQAYEPDPLKVVMH  59

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRK  665
              N NV + I   + +        NSTRR LGKK YRGPC  TNPID CWRCDPNW   R 
Sbjct  60    FNENVHRHI---KESGGVDMMMLNSTRRRLGKK-YRGPCKVTNPIDACWRCDPNWHLNRF  115

Query  664   RLADCSLGFGYKAKGGKNGDFYTVTDNSDHP-LNPKRGTLRHAVIQIKPLWIIFARSMNI  488
             +LADCSLGFG KA GGK G  Y VTD SD   L PK GTLRHAVIQ +PLWI F RSM I
Sbjct  116   KLADCSLGFGRKATGGKGGRIYVVTDPSDDDILTPKPGTLRHAVIQEEPLWITFKRSMVI  175

Query  487   KLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSIN  308
              L QEL++ S KTIDGRG +V I+ GAGIT+Q+V+N+IIH I++H+IV   GG+IRDS  
Sbjct  176   TLAQELIMTSDKTIDGRGVKVQIAHGAGITVQYVRNIIIHNIKIHNIVEKKGGIIRDSTT  235

Query  307   HFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVML  128
             H GLRT+SDGDGIS+FGA DIW+DH+SM +CDDG+IDAI+ STAITISN HFTDH+  ML
Sbjct  236   HSGLRTQSDGDGISIFGAQDIWIDHVSMTRCDDGLIDAIQGSTAITISNGHFTDHDHAML  295

Query  127   FGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             FGAND  P D+ MQ+T+AFNHFGKR+VQRMPRCRYG+FHVVN
Sbjct  296   FGANDKYPGDEKMQITVAFNHFGKRMVQRMPRCRYGFFHVVN  337



>ref|XP_002270112.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32014.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   402 bits (1034),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 199/321 (62%), Positives = 241/321 (75%), Gaps = 14/321 (4%)
 Frame = -1

Query  961  PTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetet  782
            PT   HI+E+DD W+ R++EA   A+  ++P P +V    N NV K I            
Sbjct  22   PTIRAHIAEYDDYWKAREKEAKTVAIDAFDPSPEDVNDDFNKNVEKSIFG----------  71

Query  781  etNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDF  602
              N TRR+L  K  +GPC ATNPIDRCWRC  NWA  R+RLADC LGFG +  GGK+G  
Sbjct  72   -KNGTRRNL--KVNKGPCKATNPIDRCWRCRRNWAMDRRRLADCVLGFGRRTVGGKHGRL  128

Query  601  YTVTDNSDHP-LNPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQV  425
            Y VTD SD+  LNPK GTLR+AVIQ +PLWI+F RSM IKLKQELMV S KTIDGRG  V
Sbjct  129  YIVTDPSDNDMLNPKPGTLRYAVIQPQPLWIVFGRSMIIKLKQELMVTSDKTIDGRGVNV  188

Query  424  HISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDI  245
            HI+ GAGIT+QF +NVIIHG+ +HDIV   GG+IRDS++HFGLRTRSDGDGIS+FG++ +
Sbjct  189  HIAYGAGITIQFARNVIIHGLHIHDIVSRPGGLIRDSVHHFGLRTRSDGDGISIFGSSHV  248

Query  244  WLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNH  65
            W+DH SM KC+DG++DAI+ STAITISN+HFT HNE ML GA+D    D IMQVT+AFNH
Sbjct  249  WIDHNSMSKCEDGLVDAIQGSTAITISNNHFTKHNETMLLGASDGYSGDIIMQVTVAFNH  308

Query  64   FGKRLVQRMPRCRYGYFHVVN  2
            FG+ L+QRMPRCR+G+FHVVN
Sbjct  309  FGRGLIQRMPRCRWGFFHVVN  329



>emb|CAN69904.1| hypothetical protein VITISV_001006 [Vitis vinifera]
Length=443

 Score =   402 bits (1033),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 199/321 (62%), Positives = 241/321 (75%), Gaps = 14/321 (4%)
 Frame = -1

Query  961  PTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetet  782
            PT   HI+E+DD W+ R++EA   A+  ++P P +V    N NV K I            
Sbjct  22   PTIRAHIAEYDDYWKAREKEAKTVAIDAFDPSPEDVNDDFNKNVEKSIFG----------  71

Query  781  etNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDF  602
              N TRR+L  K  +GPC ATNPIDRCWRC  NWA  R+RLADC LGFG +  GGK+G  
Sbjct  72   -KNGTRRNL--KVNKGPCKATNPIDRCWRCRRNWAMDRRRLADCVLGFGRRTVGGKHGRL  128

Query  601  YTVTDNSDHP-LNPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQV  425
            Y VTD SD+  LNPK GTLR+AVIQ +PLWI+F RSM IKLKQELMV S KTIDGRG  V
Sbjct  129  YIVTDPSDNDMLNPKPGTLRYAVIQPQPLWIVFGRSMIIKLKQELMVTSDKTIDGRGVNV  188

Query  424  HISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDI  245
            HI+ GAGIT+QF +NVIIHG+ +HDIV   GG+IRDS++HFGLRTRSDGDGIS+FG++ +
Sbjct  189  HIAYGAGITIQFARNVIIHGLHIHDIVSHPGGLIRDSVHHFGLRTRSDGDGISIFGSSHV  248

Query  244  WLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNH  65
            W+DH SM KC+DG++DAI+ STAITISN+HFT HNE ML GA+D    D IMQVT+AFNH
Sbjct  249  WIDHNSMSKCEDGLVDAIQGSTAITISNNHFTKHNETMLLGASDGYSGDIIMQVTVAFNH  308

Query  64   FGKRLVQRMPRCRYGYFHVVN  2
            FG+ L+QRMPRCR+G+FHVVN
Sbjct  309  FGRGLIQRMPRCRWGFFHVVN  329



>ref|XP_006306515.1| hypothetical protein CARUB_v10012514mg [Capsella rubella]
 gb|EOA39413.1| hypothetical protein CARUB_v10012514mg [Capsella rubella]
Length=455

 Score =   402 bits (1033),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 203/334 (61%), Positives = 247/334 (74%), Gaps = 2/334 (1%)
 Frame = -1

Query  1000 LSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKV  821
            L + F+SL AI+ P    H++ FD  W  R+ +A    + +Y+P+P NVT+ LN++V  +
Sbjct  8    LGVFFLSLLAIVAPQVKAHVAVFDSYWTQRQSDALKRTMGSYDPNPLNVTNHLNYHV-NL  66

Query  820  ILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLG  641
             +D   + N+T  E    R    K K  G C A NPID+CWRCD NWAN RK+LADC LG
Sbjct  67   AVDAAESFNDTRRELTQVRSGHRKLKRSGKCLAYNPIDKCWRCDRNWANNRKKLADCVLG  126

Query  640  FGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMV  464
            FG K  GGK+G  Y V D SD+ L NPK GTLR+AV +  PLWIIFARSM IKL+QELM+
Sbjct  127  FGRKTTGGKDGPIYVVNDASDNDLVNPKPGTLRYAVTRDGPLWIIFARSMIIKLQQELMI  186

Query  463  QSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRS  284
             S KTIDGRGA+V+I  GAG+T+Q+V NVIIH I V  IV G+GG+IRDS +H GLRT+S
Sbjct  187  ASDKTIDGRGAKVYIMEGAGLTMQYVNNVIIHSIYVKHIVPGNGGLIRDSEHHVGLRTKS  246

Query  283  DGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSP  104
            DGDGISLFGAT+IW+DH+SM +C DG+IDAI+ STA+TISNSHFTDH EVMLFGA D   
Sbjct  247  DGDGISLFGATNIWIDHVSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHV  306

Query  103  KDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             DK MQ+T+AFNHFGKRL QRMPRCRYG  HVVN
Sbjct  307  IDKKMQITVAFNHFGKRLEQRMPRCRYGTIHVVN  340



>ref|XP_010678579.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=443

 Score =   400 bits (1029),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 201/334 (60%), Positives = 245/334 (73%), Gaps = 9/334 (3%)
 Frame = -1

Query  1000 LSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKV  821
            L L F+ ++ I +     +I  +DD W+ R++ A  +A + Y  DP  +T   N  V   
Sbjct  8    LMLFFMLVSIIFLQHVEANIGNYDDHWKQREQAAKANAARAYNTDPHGITHQTNQRV---  64

Query  820  ILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLG  641
               +    N T    N  RR LGK  Y GPC A NPIDRCWRCD NW+  R++LADC +G
Sbjct  65   ---HNMGMNRTNRTNNYARRGLGK--YEGPCQADNPIDRCWRCDDNWSKDRQKLADCVVG  119

Query  640  FGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMV  464
            FG+K  GGK G+ Y VTD+SD+ L +PK GTLRHAVIQ  PLWIIF   M IKLK+EL+V
Sbjct  120  FGHKTTGGKKGNIYVVTDDSDNELLDPKPGTLRHAVIQDGPLWIIFKHGMVIKLKEELLV  179

Query  463  QSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRS  284
             S+KTIDGRG  VHI+GGAGI LQFV NVIIH + +HDI  G GG IRDS++HFG RT S
Sbjct  180  SSNKTIDGRGGHVHIAGGAGIMLQFVDNVIIHNVHIHDIKTGGGGFIRDSVSHFGFRTAS  239

Query  283  DGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSP  104
            DGDGIS+FG+T+IW+DH+SM  C DG+IDAIEASTAIT+SN HFTDHN+VMLFGA D S 
Sbjct  240  DGDGISIFGSTNIWIDHVSMSNCMDGLIDAIEASTAITVSNCHFTDHNDVMLFGARDSSS  299

Query  103  KDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            +D+IMQVTIAFNHFGKRL+QRMPRCR+G+FHV+N
Sbjct  300  QDEIMQVTIAFNHFGKRLIQRMPRCRFGFFHVLN  333



>gb|AAQ62997.1| oil palm polygalacturonase allergen PEST411 [Elaeis guineensis]
Length=447

 Score =   400 bits (1028),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 206/349 (59%), Positives = 248/349 (71%), Gaps = 22/349 (6%)
 Frame = -1

Query  1024  MEGFQIK----ILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSN  857
             MEG + K    + SL+F++ AA+    S   I E DD WQ + EEA   +   Y PDP  
Sbjct  1     MEGVRTKPSFFLCSLIFLASAAL----SGADIPELDDHWQKKAEEALARSRAAYHPDPEA  56

Query  856   VTSTLNHNVVKVILDYRnnnnetetetNSTRRHL---GKKKYRGPCNATNPIDRCWRCDP  686
             VT+  N  V   + + RN          STRR L   G KK++G C ATNPIDRCWRC  
Sbjct  57    VTNHFNKAVHLALAEARN----------STRRSLRAVGVKKFKGKCVATNPIDRCWRCQK  106

Query  685   NWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWII  509
             NW   RK+LA C  GFG  A GGK GDFY VTD SD  L NPK GTLR  VIQ +PLWI+
Sbjct  107   NWIKHRKKLATCGKGFGRHATGGKAGDFYVVTDPSDDDLVNPKFGTLRWGVIQDRPLWIV  166

Query  508   FARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGG  329
             FAR M I+L +ELM+ S+KTID RGA VHI+ GA IT+QFV NVIIHG+ +HDI   +GG
Sbjct  167   FARDMIIRLSEELMINSNKTIDARGANVHIAYGAQITIQFVNNVIIHGLHIHDIKPSNGG  226

Query  328   MIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFT  149
             MIRDS++HFGLRT+SDGDGIS++G++D+W+DH SMR C DG+IDAIE STAITISN HFT
Sbjct  227   MIRDSLHHFGLRTKSDGDGISIYGSSDVWIDHCSMRNCADGLIDAIEGSTAITISNCHFT  286

Query  148   DHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
              HN+V+LFGA+D +  D IMQ T+AFNHFGK LVQRMPRCR+G+FHVVN
Sbjct  287   HHNDVLLFGASDSNENDSIMQATVAFNHFGKGLVQRMPRCRWGFFHVVN  335



>emb|CDP14850.1| unnamed protein product [Coffea canephora]
Length=435

 Score =   400 bits (1027),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 195/339 (58%), Positives = 244/339 (72%), Gaps = 14/339 (4%)
 Frame = -1

Query  1015  FQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNH  836
              + K  SL+       ++ T   HI+EFD+VWQ R EEA   A + Y P+P NVTS  N 
Sbjct  1     MEFKKSSLILAFALIALVYTIEAHIAEFDEVWQKRAEEAKKAARQAYHPNPENVTSHFNE  60

Query  835   NVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLA  656
              V + I  +            S RR L   KY GPC ATNPID+CWRC  NW   R +LA
Sbjct  61    EVHRSIDGHN-----------SRRRDL--HKYNGPCTATNPIDQCWRCQKNWRKNRMKLA  107

Query  655   DCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLK  479
             DC+LGFG  A GGK G  Y VTD SD+ L NPK GTLRHA+IQ +PLW+IF ++M I+L 
Sbjct  108   DCALGFGRHATGGKGGRIYKVTDPSDNDLVNPKPGTLRHALIQPEPLWVIFTKNMVIRLS  167

Query  478   QELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFG  299
             QEL++ S+KTIDGRG QVHI+ GAG TLQFV N+IIH + +HDI  G+GGMIRDS+NH+G
Sbjct  168   QELIMTSNKTIDGRGVQVHIAYGAGFTLQFVHNIIIHNLHIHDIKSGNGGMIRDSVNHYG  227

Query  298   LRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGA  119
             +R+RSDGDGIS++G+T+IW+DH+SM  C+DG+IDA++ASTAITISN HFT HNE MLFGA
Sbjct  228   IRSRSDGDGISIYGSTNIWIDHISMSNCNDGLIDAVQASTAITISNGHFTHHNEAMLFGA  287

Query  118   NDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             +D    D IMQ+T+AFNHFG+ + QRMPR R+G+ HVVN
Sbjct  288   SDSYSDDSIMQITLAFNHFGQGIEQRMPRARWGFVHVVN  326



>ref|XP_010925369.1| PREDICTED: pectate lyase [Elaeis guineensis]
Length=444

 Score =   400 bits (1028),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 206/349 (59%), Positives = 248/349 (71%), Gaps = 22/349 (6%)
 Frame = -1

Query  1024  MEGFQIK----ILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSN  857
             MEG + K    + SL+F++ AA+    S   I E DD WQ + EEA   +   Y PDP  
Sbjct  1     MEGVRTKPSFFLCSLIFLASAAL----SGADIPELDDHWQKKAEEALARSRAAYHPDPEA  56

Query  856   VTSTLNHNVVKVILDYRnnnnetetetNSTRRHL---GKKKYRGPCNATNPIDRCWRCDP  686
             VT+  N  V   + + RN          STRR L   G KK++G C ATNPIDRCWRC  
Sbjct  57    VTNHFNKAVHLALAEARN----------STRRSLRAVGVKKFKGKCVATNPIDRCWRCQK  106

Query  685   NWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWII  509
             NW   RK+LA C  GFG  A GGK GDFY VTD SD  L NPK GTLR  VIQ +PLWI+
Sbjct  107   NWIKHRKKLATCGKGFGRHATGGKAGDFYVVTDPSDDDLVNPKFGTLRWGVIQDRPLWIV  166

Query  508   FARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGG  329
             FAR M I+L +ELM+ S+KTID RGA VHI+ GA IT+QFV NVIIHG+ +HDI   +GG
Sbjct  167   FARDMIIRLSEELMINSNKTIDARGANVHIAYGAQITIQFVNNVIIHGLHIHDIKPSNGG  226

Query  328   MIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFT  149
             MIRDS++HFGLRT+SDGDGIS++G++D+W+DH SMR C DG+IDAIE STAITISN HFT
Sbjct  227   MIRDSLHHFGLRTKSDGDGISIYGSSDVWIDHCSMRNCADGLIDAIEGSTAITISNCHFT  286

Query  148   DHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
              HN+V+LFGA+D +  D IMQ T+AFNHFGK LVQRMPRCR+G+FHVVN
Sbjct  287   HHNDVLLFGASDSNENDSIMQATVAFNHFGKGLVQRMPRCRWGFFHVVN  335



>gb|EYU36839.1| hypothetical protein MIMGU_mgv1a006379mg [Erythranthe guttata]
Length=446

 Score =   400 bits (1028),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 206/338 (61%), Positives = 257/338 (76%), Gaps = 7/338 (2%)
 Frame = -1

Query  1009  IKILSLLFVSLA-AIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHN  833
             ++ + LLF+S+A A  +P+   +  + D+ W  R  +AW + L++YEP P+ + S LN +
Sbjct  2     VRKMGLLFLSIAFAYALPSISANFLDSDEYWVKRSVQAWNNTLESYEPHPAKIVSHLNLH  61

Query  832   VVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLAD  653
               + + + ++    +     S+RRHL    Y GPC ATNPIDRCWRC  NWA+ R RLAD
Sbjct  62    STRALEEIKDLELVSN----SSRRHLAHG-YDGPCMATNPIDRCWRCQANWADNRFRLAD  116

Query  652   CSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQ  476
             C LGFGYKAKGGK G  Y V D+SD  + NP  GTLRHAVIQ +PLWIIF+RSM I+L Q
Sbjct  117   CGLGFGYKAKGGKGGRIYVVNDSSDSDMVNPIPGTLRHAVIQTEPLWIIFSRSMVIRLSQ  176

Query  475   ELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGL  296
             EL++QS KTIDGRG +VHI+GGAGIT+QFVKN+IIHG+ +HDIV GDGGMIRDS++H+G 
Sbjct  177   ELIMQSDKTIDGRGVRVHITGGAGITIQFVKNIIIHGLLIHDIVPGDGGMIRDSVDHYGF  236

Query  295   RTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGAN  116
             RTRSDGDGIS++GA DIW+DH+SM  C DG+IDAI  ST ITISN HFTDHNE MLFGA+
Sbjct  237   RTRSDGDGISIYGAQDIWIDHVSMTNCSDGLIDAIMGSTGITISNGHFTDHNEAMLFGAS  296

Query  115   DHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             D   +D  MQ+T+AFNHFGKRLVQRMPRCR+GY HVVN
Sbjct  297   DSHTQDVKMQITVAFNHFGKRLVQRMPRCRFGYIHVVN  334



>ref|XP_003530685.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=451

 Score =   400 bits (1028),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 207/345 (60%), Positives = 248/345 (72%), Gaps = 27/345 (8%)
 Frame = -1

Query  994  LLFVSLAAIIIPT----SL-------GHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTS  848
             L +SLA I IPT    SL        H+ EFD  WQ R + A + +   Y  DP +V+S
Sbjct  9    FLLLSLA-IFIPTLNANSLEKDEYWQSHVYEFDSYWQERAKAAKVDSQAAYFEDPYSVSS  67

Query  847  TLNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRG--PCNATNPIDRCWRCDPNWAN  674
                +V ++ +  +             RR+L K KYRG  PC ATNPIDRCWRCDPNWAN
Sbjct  68   NFTSSVSELTIGKK-----------DLRRNL-KGKYRGDGPCIATNPIDRCWRCDPNWAN  115

Query  673  KRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARS  497
             R++LADC  GFG    GGK G FY VTD SD  + NPK GTLRHAV +  PLWIIFARS
Sbjct  116  NRQKLADCVQGFGRNTVGGKGGPFYVVTDPSDDDMVNPKPGTLRHAVTRDGPLWIIFARS  175

Query  496  MNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRD  317
            M I L+QEL++ S+KTIDGRG  V+I+ GAGIT+QFVKN+IIHGI+V DIV  +GGMIRD
Sbjct  176  MFITLQQELIMNSNKTIDGRGVDVYIAKGAGITVQFVKNIIIHGIKVFDIVIREGGMIRD  235

Query  316  SINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNE  137
            S  H+G RT+SDGDGIS+FG++++W+DH+SMR C DG+IDAI  STAITISNSHFTDHNE
Sbjct  236  SETHYGFRTKSDGDGISIFGSSNVWIDHVSMRNCSDGLIDAIMGSTAITISNSHFTDHNE  295

Query  136  VMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            VMLFGA+D    DKIMQ+T+AFNHFGKRLVQRMPR RYG+ H VN
Sbjct  296  VMLFGASDSYSDDKIMQITLAFNHFGKRLVQRMPRVRYGFVHSVN  340



>ref|XP_004162547.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
Length=435

 Score =   399 bits (1025),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 201/338 (59%), Positives = 246/338 (73%), Gaps = 17/338 (5%)
 Frame = -1

Query  1009  IKILSLLFV-SLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHN  833
             + + S LFV SL   ++  +  ++ E D+ W+ R  EA   A   +  +P  VT TLN  
Sbjct  1     MAVFSSLFVCSLLFFVVANA--NVDE-DEYWETRATEAKKVAQGAFNANPEIVTDTLNAA  57

Query  832   VVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLAD  653
             V + +L +            STRR L +KKYRGPC ATNPIDRCWRCD NWA  R++LA+
Sbjct  58    VSRTMLGHN-----------STRRSL-RKKYRGPCLATNPIDRCWRCDRNWAKNRRKLAE  105

Query  652   CSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQ  476
             C LGFG++  GGK G  Y VTD SD  L NPK GTLRH VIQ  PLWIIF RSM I+L Q
Sbjct  106   CPLGFGHQTIGGKRGPIYVVTDASDDDLVNPKPGTLRHGVIQKGPLWIIFGRSMVIRLSQ  165

Query  475   ELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGL  296
             ELM+ SHKTID RGA VHI+ GAG+T+QFV NVIIH + +HDIV   GGMIRDS++H+G 
Sbjct  166   ELMISSHKTIDARGANVHIAFGAGLTIQFVNNVIIHNLHIHDIVSKSGGMIRDSVDHYGF  225

Query  295   RTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGAN  116
             RT+SDGDGIS+FG++ +W+DH+SM  C DG+IDAI  STAITISN HFT HNEVMLFGA+
Sbjct  226   RTQSDGDGISIFGSSHVWIDHVSMSNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGAS  285

Query  115   DHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             D   +D+IMQVT+AFNHFG+ LVQRMPRCR+G+FHVVN
Sbjct  286   DSYAEDEIMQVTLAFNHFGRGLVQRMPRCRWGFFHVVN  323



>ref|XP_004146792.1| PREDICTED: probable pectate lyase P59-like, partial [Cucumis 
sativus]
Length=442

 Score =   399 bits (1026),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 200/333 (60%), Positives = 242/333 (73%), Gaps = 16/333 (5%)
 Frame = -1

Query  997  SLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVI  818
            SL   SL   ++  +  ++ E D+ WQ R  EA   A   +  +P  VT TLN  V + +
Sbjct  13   SLFVCSLLFFVVANA--NVDE-DEYWQTRATEAKKVAQGAFNANPEIVTDTLNAAVSRTM  69

Query  817  LDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGF  638
            L +            STRR L +KKYRGPC ATNPIDRCWRCD NWA  R++LA+C LGF
Sbjct  70   LGHN-----------STRRSL-RKKYRGPCLATNPIDRCWRCDRNWAKNRRKLAECPLGF  117

Query  637  GYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQ  461
            G++  GGK G  Y VTD SD  L NPK GTLRH VIQ  PLWIIF RSM I+L QELM+ 
Sbjct  118  GHQTIGGKRGPIYVVTDASDDDLVNPKPGTLRHGVIQKGPLWIIFGRSMVIRLSQELMIS  177

Query  460  SHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSD  281
            SHKTID RGA VHI+ GAG+T+QFV NVIIH + +HDIV   GGMIRDS++H+G RT+SD
Sbjct  178  SHKTIDARGANVHIAFGAGLTIQFVNNVIIHNLHIHDIVSKSGGMIRDSVDHYGFRTQSD  237

Query  280  GDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPK  101
            GDGIS+FG++ +W+DH+SM  C DG+IDAI  STAITISN HFT HNEVMLFGA+D   +
Sbjct  238  GDGISIFGSSHVWIDHVSMSNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDSYAE  297

Query  100  DKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            D+IMQVT+AFNHFG+ LVQRMPRCR+G+FHVVN
Sbjct  298  DEIMQVTLAFNHFGRGLVQRMPRCRWGFFHVVN  330



>ref|XP_004165454.1| PREDICTED: pectate lyase-like [Cucumis sativus]
 gb|KGN64253.1| hypothetical protein Csa_1G045510 [Cucumis sativus]
Length=439

 Score =   399 bits (1025),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 196/334 (59%), Positives = 244/334 (73%), Gaps = 14/334 (4%)
 Frame = -1

Query  1000 LSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKV  821
            + LL +    +I PT   +I++FD+VWQ R  EA   + + YEP P   T+  N  V + 
Sbjct  11   IKLLMIFGFVMIFPTLKANIADFDEVWQKRAIEAQKASFEAYEPHPEEETNNFNKQVHRS  70

Query  820  ILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLG  641
            +              N+TRRHL  +KY GPC ATNPIDRCWRCD NWA  RK+LADC+LG
Sbjct  71   L-----------DGGNNTRRHL--RKYTGPCLATNPIDRCWRCDRNWARNRKKLADCALG  117

Query  640  FGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMV  464
            FG +  GGK+G  Y V D+SD+ L NPK GTLRHAVIQ +PLWIIFA  M I+L +EL+V
Sbjct  118  FGRRTTGGKDGKIYVVRDSSDNDLVNPKPGTLRHAVIQERPLWIIFAHDMVIRLSEELIV  177

Query  463  QSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRS  284
               KT+DGRGA VHI+ G  ITLQFVKN+IIH + +HDI  G+GGMIRDS++H+G RTRS
Sbjct  178  TDDKTLDGRGANVHIANGGQITLQFVKNIIIHNLHIHDIKAGNGGMIRDSVSHYGFRTRS  237

Query  283  DGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSP  104
            DGDGIS+FGA+ +W+DH+SM  C DG+IDA+ ASTAITISN HFT HN+V+L GA++   
Sbjct  238  DGDGISMFGASRVWIDHVSMSNCQDGLIDAVMASTAITISNCHFTHHNDVILLGASNGYS  297

Query  103  KDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             D+IMQVT+AFNHFGK LVQRMPRCR+G+ HVVN
Sbjct  298  NDQIMQVTLAFNHFGKGLVQRMPRCRWGFIHVVN  331



>gb|EYU34111.1| hypothetical protein MIMGU_mgv1a006386mg [Erythranthe guttata]
Length=446

 Score =   399 bits (1026),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 207/335 (62%), Positives = 258/335 (77%), Gaps = 7/335 (2%)
 Frame = -1

Query  1000 LSLLFVSLA-AIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVK  824
            + LLF+ +A A  +P+   + ++FDD W  R  +AW + L++YE  P+ + S LN +  +
Sbjct  5    MGLLFLLIAFASALPSISANFADFDDYWLKRSVQAWNNTLQSYESHPAKIVSHLNLHSKR  64

Query  823  VILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSL  644
             + + ++ N  +     S+RR L    Y GPC ATNPIDRCWRC  NWA+ R RLADC L
Sbjct  65   ALKEIKDINLVSN----SSRRQLAHG-YEGPCMATNPIDRCWRCQANWADNRFRLADCGL  119

Query  643  GFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELM  467
            GFGYKAKGGK G  Y V D+SD  + NPK GTLRHAVIQ +PLWIIF+RSM I+L QEL+
Sbjct  120  GFGYKAKGGKGGRIYVVNDSSDGDMVNPKPGTLRHAVIQTEPLWIIFSRSMVIRLSQELI  179

Query  466  VQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTR  287
            +QS KTIDGRG +VHI+GGAGIT+QFVKN+IIHGI +HDIV G+GG+IRDS++H+GLRTR
Sbjct  180  MQSDKTIDGRGVRVHITGGAGITIQFVKNIIIHGILIHDIVPGNGGLIRDSVDHYGLRTR  239

Query  286  SDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHS  107
            SDGDGIS++GA DIW+DH+SM KC DG+IDAI  ST ITISN HFTDHNE MLFGA+D  
Sbjct  240  SDGDGISIYGAQDIWIDHVSMTKCSDGLIDAIMGSTGITISNGHFTDHNEAMLFGASDSH  299

Query  106  PKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             +D  MQ+T+AFNHFGKR+VQRMPRCR+GY HVVN
Sbjct  300  TQDVKMQITVAFNHFGKRMVQRMPRCRFGYIHVVN  334



>ref|XP_004152537.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=434

 Score =   399 bits (1025),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 196/334 (59%), Positives = 244/334 (73%), Gaps = 14/334 (4%)
 Frame = -1

Query  1000 LSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKV  821
            + LL +    +I PT   +I++FD+VWQ R  EA   + + YEP P   T+  N  V + 
Sbjct  11   IKLLMIFGFVMIFPTLKANIADFDEVWQKRAIEAQKASFEAYEPHPEEETNNFNKQVHRS  70

Query  820  ILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLG  641
            +              N+TRRHL  +KY GPC ATNPIDRCWRCD NWA  RK+LADC+LG
Sbjct  71   L-----------DGGNNTRRHL--RKYTGPCLATNPIDRCWRCDRNWARNRKKLADCALG  117

Query  640  FGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMV  464
            FG +  GGK+G  Y V D+SD+ L NPK GTLRHAVIQ +PLWIIFA  M I+L +EL+V
Sbjct  118  FGRRTTGGKDGKIYVVRDSSDNDLVNPKPGTLRHAVIQERPLWIIFAHDMVIRLSEELIV  177

Query  463  QSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRS  284
               KT+DGRGA VHI+ G  ITLQFVKN+IIH + +HDI  G+GGMIRDS++H+G RTRS
Sbjct  178  TDDKTLDGRGANVHIANGGQITLQFVKNIIIHNLHIHDIKAGNGGMIRDSVSHYGFRTRS  237

Query  283  DGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSP  104
            DGDGIS+FGA+ +W+DH+SM  C DG+IDA+ ASTAITISN HFT HN+V+L GA++   
Sbjct  238  DGDGISMFGASRVWIDHVSMSNCQDGLIDAVMASTAITISNCHFTHHNDVILLGASNGYS  297

Query  103  KDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             D+IMQVT+AFNHFGK LVQRMPRCR+G+ HVVN
Sbjct  298  NDQIMQVTLAFNHFGKGLVQRMPRCRWGFIHVVN  331



>ref|XP_004508770.1| PREDICTED: probable pectate lyase P59-like [Cicer arietinum]
Length=434

 Score =   398 bits (1023),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 195/342 (57%), Positives = 242/342 (71%), Gaps = 16/342 (5%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             ME  ++++L      LA  + PT    I+     WQ R  EA   A K Y+P+P ++  T
Sbjct  1     MEANKLRLLCFCVFYLA--LFPTLRASIAHDAQFWQTRAREAKQAAQKAYKPNPHDIALT  58

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRK  665
              N +V K               +N TRR  G  KY GPC ATNPID+CWRCDPNW   RK
Sbjct  59    FNKHVDKSF-----------KSSNGTRR--GLSKYTGPCLATNPIDKCWRCDPNWEKNRK  105

Query  664   RLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNI  488
             +LA+C+LGFG+   GGKNG  Y VTD+SDH L NPK GTLRHAVIQ +PLWIIF  SMNI
Sbjct  106   KLANCALGFGHGTTGGKNGKIYVVTDSSDHDLINPKPGTLRHAVIQNEPLWIIFKHSMNI  165

Query  487   KLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSIN  308
             KL  EL+   +KTID RGA VHIS GA +TLQ+VKN+IIHG+ +HDI  G GG+IRDS+N
Sbjct  166   KLSSELIFTDNKTIDARGANVHISNGAQMTLQYVKNIIIHGLHIHDIKKGGGGLIRDSVN  225

Query  307   HFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVML  128
             H+G R+ SDGD ISLFG++ +W+DH+S+  CDDG+ID +E STAITISN H T HN+VML
Sbjct  226   HYGYRSSSDGDAISLFGSSHVWIDHISLWNCDDGLIDVVEGSTAITISNCHMTRHNDVML  285

Query  127   FGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             FGA+D    DK++QVT+AFNHFGK L+QRMPRCR+G+FH+VN
Sbjct  286   FGASDGYSGDKVLQVTVAFNHFGKGLIQRMPRCRWGFFHIVN  327



>ref|XP_010317101.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=389

 Score =   396 bits (1018),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 176/257 (68%), Positives = 215/257 (84%), Gaps = 0/257 (0%)
 Frame = -1

Query  772  STRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTV  593
            + RR LG KKY GPC  TNPID+CWRCDPNWA+ RK+L +CS+GFGYK  GG++G+FY V
Sbjct  22   TIRRALGTKKYDGPCTVTNPIDKCWRCDPNWADNRKKLVECSMGFGYKTTGGRDGEFYVV  81

Query  592  TDNSDHPLNPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISG  413
            TD SD    PK GTLRHAVIQ +PLWIIF ++M IKL QEL++Q  KTIDGRGA VHI+G
Sbjct  82   TDPSDDYTTPKPGTLRHAVIQKEPLWIIFEKNMKIKLHQELIMQGDKTIDGRGATVHITG  141

Query  412  GAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDH  233
            GA I +Q+ KNVIIHG+ +HDIV G GGM+RD+++H GLRT+SDGDGIS++G+++IW+DH
Sbjct  142  GASIMIQYTKNVIIHGLHIHDIVEGSGGMVRDAVDHIGLRTKSDGDGISIYGSSNIWIDH  201

Query  232  LSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKR  53
            +SM  C DG+IDA+E ST ITISN H+TDHNEVMLFGA+D S  D+ MQ+T+AFNHFGKR
Sbjct  202  MSMENCYDGLIDAVEGSTGITISNGHYTDHNEVMLFGASDSSSIDQKMQITLAFNHFGKR  261

Query  52   LVQRMPRCRYGYFHVVN  2
            LVQRMPRCR+GY HVVN
Sbjct  262  LVQRMPRCRWGYIHVVN  278



>ref|XP_009381244.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=423

 Score =   397 bits (1019),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 194/318 (61%), Positives = 240/318 (75%), Gaps = 14/318 (4%)
 Frame = -1

Query  949  GHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNS  770
             HI+EFD+ WQ ++  A  +    Y P+P +VT   N  V+K +            E N+
Sbjct  9    AHIAEFDEYWQKKEAMARANVQNAYNPNPESVTKHFNDAVLKDL------------EKNN  56

Query  769  TRRHL-GKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTV  593
            TRR L GK++Y GPC ATNPIDRCWRC  NWA+ RKRLA C+ GFG    GGKNGDFY V
Sbjct  57   TRRGLRGKRRYDGPCMATNPIDRCWRCQENWAHHRKRLATCAKGFGRHVTGGKNGDFYVV  116

Query  592  TDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHIS  416
            TD SD  L NP++GTLR+ VIQ +PLWI+FAR M I+L +EL+V S+KTIDGRG  V I 
Sbjct  117  TDPSDLDLVNPRKGTLRYGVIQDRPLWIVFARDMVIRLTEELIVNSNKTIDGRGVDVQIM  176

Query  415  GGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLD  236
             GAGIT+Q+V N+IIH +R+HDI  G+GGMIRDS +H+GLRTRSDGDGIS+FGA+++W+D
Sbjct  177  NGAGITIQYVDNIIIHNLRIHDIKAGNGGMIRDSEHHYGLRTRSDGDGISIFGASNVWID  236

Query  235  HLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGK  56
            H+SM  C DG+IDAI+ STAITISNSHFT HN+VMLFGA+D    D +MQ+T+AFNHFGK
Sbjct  237  HVSMSNCMDGLIDAIQGSTAITISNSHFTQHNDVMLFGASDAFSGDAVMQITVAFNHFGK  296

Query  55   RLVQRMPRCRYGYFHVVN  2
             LVQRMPRCR+G+ HVVN
Sbjct  297  GLVQRMPRCRWGFVHVVN  314



>ref|XP_004490003.1| PREDICTED: probable pectate lyase 3-like isoform X1 [Cicer arietinum]
Length=450

 Score =   397 bits (1021),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 191/311 (61%), Positives = 233/311 (75%), Gaps = 12/311 (4%)
 Frame = -1

Query  931  DDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNSTRRHLG  752
            D  W+ + E A     + Y PDP  V+  L   + ++I+  +             RR+L 
Sbjct  41   DSYWKEKAEIAAKANEEAYTPDPYAVSGNLTSTISEMIIGGK-----------KGRRNLR  89

Query  751  KKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHP  572
             +K  GPC ATNPIDRCWRCDPNWAN RK+LADC  GFG K  GGK G FY VTD SD  
Sbjct  90   GRKTAGPCMATNPIDRCWRCDPNWANNRKKLADCVQGFGRKTTGGKAGPFYVVTDPSDSD  149

Query  571  L-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITL  395
            + NP+ GTLRHAV +  PLWIIFARSMNI+L QEL++ S KTIDGRGA + I+ GAGIT+
Sbjct  150  MVNPRPGTLRHAVTRNGPLWIIFARSMNIRLNQELIMTSDKTIDGRGADIVIANGAGITI  209

Query  394  QFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKC  215
            Q+++NVIIHGI+V DIV G GG++RDS NH+GLRT SDGDGIS+FG+++IW+DH+SMR C
Sbjct  210  QYIRNVIIHGIKVFDIVVGSGGLVRDSENHYGLRTMSDGDGISIFGSSNIWIDHVSMRNC  269

Query  214  DDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMP  35
             DG+IDAI  STAITISNSHFTDHNEVMLFGA+D    D+ MQ+T+AFNHFGKRL+QRMP
Sbjct  270  RDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDGYDADQKMQITVAFNHFGKRLIQRMP  329

Query  34   RCRYGYFHVVN  2
            RCR+G+ HVVN
Sbjct  330  RCRFGFIHVVN  340



>ref|XP_006842121.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
 gb|ERN03796.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
Length=438

 Score =   396 bits (1018),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 199/335 (59%), Positives = 241/335 (72%), Gaps = 15/335 (4%)
 Frame = -1

Query  1003  ILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVK  824
             +  +L ++ ++  +P +  HI++FD+ WQNR   A   AL+ Y  +P NVT  +NH V K
Sbjct  9     LFVVLVLASSSFTVPKAEAHIADFDETWQNRSAIARQVALEAYVHEPHNVTDHVNHMVHK  68

Query  823   VILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSL  644
              +            E NSTRRHLGK  Y G C ATNPIDRCWRC  NWA  RKRLA C+L
Sbjct  69    AL------------EGNSTRRHLGK--YTGACMATNPIDRCWRCQRNWARDRKRLAKCAL  114

Query  643   GFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELM  467
             GFG K  GG  G FY VTD SD  L +PK GTLRHAVIQ +PLWI F   M I+L +EL+
Sbjct  115   GFGRKTTGGLKGRFYVVTDASDESLTDPKPGTLRHAVIQDRPLWITFKHDMIIRLTEELL  174

Query  466   VQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTR  287
             V SHKTIDGRG  VHI+ GAGIT+Q+ KNVIIHG+ +HDI  G+GGMIRDS  H+GLRT+
Sbjct  175   VNSHKTIDGRGTNVHIAYGAGITIQYQKNVIIHGLHIHDIKAGNGGMIRDSPEHYGLRTK  234

Query  286   SDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHS  107
             SDGD IS+F ++ +W+DH SM  C DG+IDAI  STAITISN+HFT+HNEV L GA+D  
Sbjct  235   SDGDAISIFASSFVWIDHNSMSNCMDGLIDAIMGSTAITISNNHFTNHNEVSLMGASDSF  294

Query  106   PKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
               DKIMQVT AFNHFG+ L+QRMPRCR+G+FHVVN
Sbjct  295   SDDKIMQVTFAFNHFGRGLIQRMPRCRWGFFHVVN  329



>ref|XP_007227702.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
 gb|EMJ28901.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
Length=446

 Score =   396 bits (1018),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 195/314 (62%), Positives = 233/314 (74%), Gaps = 13/314 (4%)
 Frame = -1

Query  937  EFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNSTRRH  758
            + D  W+ R EEA   A++++E DP  VT   N NV ++++               TRRH
Sbjct  35   QLDIYWKQRAEEAKKEAMQSFETDPEQVTEEFNSNVGELLMKQN-----------GTRRH  83

Query  757  L-GKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNS  581
            L G KKY GPC ATNP+D CWRCD NWA  RKRLADC  GFG K  GGK G  Y VTD S
Sbjct  84   LRGNKKYNGPCMATNPMDACWRCDKNWAKNRKRLADCVQGFGKKTTGGKAGPIYVVTDPS  143

Query  580  DHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAG  404
            D  L NPK GTLRHAVIQ  PLWIIFAR+M I+L+QEL+V S KTIDGRGA V+I  GAG
Sbjct  144  DLDLVNPKPGTLRHAVIQKGPLWIIFARNMVIRLQQELLVTSDKTIDGRGANVNIHNGAG  203

Query  403  ITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSM  224
            ITLQFVKNVII  + +  IV   GGMIRDS++H G RT+SDGDGIS+FG++++W+DH+SM
Sbjct  204  ITLQFVKNVIITNLHIKKIVPKQGGMIRDSVDHIGRRTKSDGDGISIFGSSNVWIDHVSM  263

Query  223  RKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQ  44
              C DG+IDAI  STAITISNSHFT HN+VMLFGA++   +DKIMQ+T+AFNHFG+ LVQ
Sbjct  264  ENCADGLIDAIMGSTAITISNSHFTHHNDVMLFGASNSYTQDKIMQITVAFNHFGQGLVQ  323

Query  43   RMPRCRYGYFHVVN  2
            RMPRCR+G+FHVVN
Sbjct  324  RMPRCRHGFFHVVN  337



>ref|XP_006374492.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
 gb|ERP52289.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
Length=435

 Score =   396 bits (1017),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 199/334 (60%), Positives = 242/334 (72%), Gaps = 15/334 (4%)
 Frame = -1

Query  1000 LSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKV  821
            + L+F +LA        G I+ FD+ W+ R EEA   + + YEP+P+ VT   N  V K 
Sbjct  8    MLLVFFALAMQTSTLKAG-IANFDEYWKKRAEEAKEASREAYEPNPAKVTKHFNDEVHKS  66

Query  820  ILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLG  641
            +              NSTRR+LGK K  GPC ATNPIDRCWRCD NWA  RK+L  C+LG
Sbjct  67   L-----------EGGNSTRRNLGKNK--GPCLATNPIDRCWRCDKNWAKNRKKLGGCALG  113

Query  640  FGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMV  464
            FG K  GGK+G +Y VTD SD+ + NPK GTLR+ VIQ KPLWIIFA  M I+L +ELMV
Sbjct  114  FGRKTIGGKHGKYYRVTDPSDNDMVNPKAGTLRYGVIQDKPLWIIFAHDMVIRLSEELMV  173

Query  463  QSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRS  284
             S+KTIDGRG  VHI  GA ITLQFVKNVIIHGI +HD   G+GGMIRDS++H+G R+RS
Sbjct  174  ASNKTIDGRGVNVHIYNGAQITLQFVKNVIIHGIHIHDAKAGNGGMIRDSVDHYGFRSRS  233

Query  283  DGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSP  104
            DGDGIS+FG+TDIW+DH+S+  C+DG+IDAI  S AITISN HFT HN+VMLFGA+D   
Sbjct  234  DGDGISIFGSTDIWIDHISLSNCEDGLIDAIMGSNAITISNCHFTKHNDVMLFGASDSYS  293

Query  103  KDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             D +MQ+T+AFNHFG+ LVQRMPR R+G+ HVVN
Sbjct  294  GDSVMQITVAFNHFGRGLVQRMPRVRWGFVHVVN  327



>ref|XP_002892805.1| hypothetical protein ARALYDRAFT_471616 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69064.1| hypothetical protein ARALYDRAFT_471616 [Arabidopsis lyrata subsp. 
lyrata]
Length=459

 Score =   397 bits (1019),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 200/332 (60%), Positives = 243/332 (73%), Gaps = 2/332 (1%)
 Frame = -1

Query  994  LLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVIL  815
            + F S  AI+ P    +++ FD  W  R+ +A    + +Y+P+P NVT+  N++V  + +
Sbjct  14   VFFSSFLAIVAPQVRANVAVFDSYWTQRQSDALKQTMGSYDPNPINVTNHFNYHV-NIAV  72

Query  814  DYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFG  635
            D   +NN+T  E    R     KK+ G C A NPID+CWRCD NWA  RK+LADC LGFG
Sbjct  73   DVSESNNDTRRELTQVRSGRKTKKHSGKCLAYNPIDKCWRCDRNWAKNRKKLADCVLGFG  132

Query  634  YKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQS  458
             +  GGK+G  Y V D SD  L NPK GTLRHAV +  PLWIIFARSM IKL+QELM+ S
Sbjct  133  RRTTGGKDGPIYVVKDASDDDLINPKPGTLRHAVTRNGPLWIIFARSMIIKLQQELMITS  192

Query  457  HKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDG  278
             KTIDGRGA+V+I  GAG+TLQ+V NVIIH I V  IV G+GG+IRDS +H GLRT+SDG
Sbjct  193  DKTIDGRGARVYIMEGAGLTLQYVNNVIIHNIYVKHIVPGNGGLIRDSEDHIGLRTKSDG  252

Query  277  DGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKD  98
            DGISLFGAT+IW+DH+SM +C DG+IDAI+ STA+TISNSHFTDH EVMLFGA D    D
Sbjct  253  DGISLFGATNIWIDHVSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVID  312

Query  97   KIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            K MQ+T+AFNHFGKRL QRMPRCRYG  HVVN
Sbjct  313  KKMQITVAFNHFGKRLEQRMPRCRYGTIHVVN  344



>ref|XP_010523445.1| PREDICTED: probable pectate lyase 3 [Tarenaya hassleriana]
Length=464

 Score =   396 bits (1018),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 196/338 (58%), Positives = 242/338 (72%), Gaps = 6/338 (2%)
 Frame = -1

Query  1003  ILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNV--  830
             +L  LF S++ +  P    H++ FD+ W  R+  A    L+ Y+P+P NVT   NH+V  
Sbjct  14    VLCFLFSSISDVAQPVK-AHVAVFDEYWTQRQAHALRQTLRFYDPNPFNVTDHFNHHVNL  72

Query  829   -VKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLAD  653
              V+   +  N       +  S  +HL K++  G C A NPIDRCWRC PNWA  RK+LAD
Sbjct  73    AVEEATEASNGTRRELWQVGSGGKHL-KRRNTGKCVAYNPIDRCWRCQPNWAKDRKKLAD  131

Query  652   CSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQ  476
             C LGFG +  GGK G +Y VTD SD  L NP+ GTLRHAV + +PLWI+F RSM I+L Q
Sbjct  132   CVLGFGRRTTGGKAGRYYVVTDASDTDLINPRPGTLRHAVTRDEPLWIVFERSMVIRLAQ  191

Query  475   ELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGL  296
             EL++ S+KTIDGRG +VHI+GGAG+T+QFV NVIIH I + DIV G+GG+IRDS  HFGL
Sbjct  192   ELIITSNKTIDGRGVRVHITGGAGLTVQFVNNVIIHNIYIKDIVPGNGGLIRDSETHFGL  251

Query  295   RTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGAN  116
             RTRSDGDGI++FGAT++W+DH+SM  C DG+IDAI+ ST ITISN H TDH EVMLFGA 
Sbjct  252   RTRSDGDGINIFGATNVWIDHVSMAHCSDGMIDAIQGSTGITISNCHLTDHGEVMLFGAT  311

Query  115   DHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             D    D  MQ+T+AFNHFGKRLVQRMPRCRYG  HVVN
Sbjct  312   DKDEIDTKMQITVAFNHFGKRLVQRMPRCRYGLIHVVN  349



>ref|NP_172894.1| putative pectate lyase 3 [Arabidopsis thaliana]
 sp|Q9M9S2.1|PLY3_ARATH RecName: Full=Probable pectate lyase 3; AltName: Full=Pectate 
lyase A2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF43942.1|AC012188_19 Strong similarity to Pectate Lyase Precursor from Lilium longiflorum 
gi|730290 and contains a Pectate lyase PF|00544 domain. 
EST gb|AW004514 comes from this gene [Arabidopsis thaliana]
 gb|AAQ62871.1| At1g14420 [Arabidopsis thaliana]
 dbj|BAD43564.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43610.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43654.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43743.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43876.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43899.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29161.1| putative pectate lyase 3 [Arabidopsis thaliana]
Length=459

 Score =   395 bits (1016),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 201/332 (61%), Positives = 240/332 (72%), Gaps = 2/332 (1%)
 Frame = -1

Query  994  LLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVIL  815
            + F S  AI+ P   G+++ FD  W  R+ +A    + +Y+P P NVT+  N++V  + +
Sbjct  14   VFFSSFLAIVAPQVRGNVAVFDSYWTQRQSDALKQTIGSYDPHPLNVTNHFNYHV-NIAV  72

Query  814  DYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFG  635
            D   + N+T  E    R      K  G C A NPID CWRCD NWAN RK+LADC LGFG
Sbjct  73   DASESRNDTRRELTQVRSGRKTHKSSGKCLAYNPIDNCWRCDRNWANNRKKLADCVLGFG  132

Query  634  YKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQS  458
             +  GGK+G  Y V D SD+ L NPK GTLRHAV +  PLWIIFARSM IKL+QELM+ S
Sbjct  133  RRTTGGKDGPIYVVKDASDNDLINPKPGTLRHAVTRDGPLWIIFARSMIIKLQQELMITS  192

Query  457  HKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDG  278
             KTIDGRGA+V+I  GAG+TLQFV NVIIH I V  IV G+GG+IRDS  H GLRT+SDG
Sbjct  193  DKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKHIVPGNGGLIRDSEAHIGLRTKSDG  252

Query  277  DGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKD  98
            DGISLFGAT+IW+DH+SM +C DG+IDAI+ STA+TISNSHFTDH EVMLFGA D    D
Sbjct  253  DGISLFGATNIWIDHVSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVID  312

Query  97   KIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            K MQ+T+AFNHFGKRL QRMPRCRYG  HVVN
Sbjct  313  KKMQITVAFNHFGKRLEQRMPRCRYGTIHVVN  344



>gb|KHG08055.1| putative pectate lyase P59 [Gossypium arboreum]
 gb|KHG08558.1| putative pectate lyase P59 [Gossypium arboreum]
Length=440

 Score =   395 bits (1014),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 199/331 (60%), Positives = 247/331 (75%), Gaps = 12/331 (4%)
 Frame = -1

Query  991  LFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILD  812
            L + L A IIP   GHI E+D+ W+ R+ EA  +  + Y P+P  VT  +NH V + ++ 
Sbjct  11   LLLFLFAAIIPALQGHIGEYDENWKQRELEAKENTEQAYNPNPEEVTQHVNHLVSRSLMG  70

Query  811  YRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGY  632
                         STRRHL  +K  GPC+ TNPID+CWRCD NW   R+RLADC++GF  
Sbjct  71   LN-----------STRRHLRARKKGGPCDPTNPIDQCWRCDRNWEKNRQRLADCAIGFAR  119

Query  631  KAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSH  455
               GGK G  Y VTD SD  L NPK GTLRHAVIQ +PLWIIFAR+M I+LK+EL++  +
Sbjct  120  GTIGGKYGRIYVVTDPSDDDLLNPKPGTLRHAVIQKEPLWIIFARAMIIRLKEELIMSGN  179

Query  454  KTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGD  275
            KTID RGA VH++ GAGIT+Q+V+NVIIHG+ +H IV G+GGMIRDS+NH+G RT+SDGD
Sbjct  180  KTIDARGANVHVAYGAGITIQYVRNVIIHGLHIHHIVPGNGGMIRDSVNHYGFRTKSDGD  239

Query  274  GISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDK  95
            GISLFGAT++WLDHLSM KC DG+IDAI+ STAITISN HFT H++VMLFGAND+   D+
Sbjct  240  GISLFGATNVWLDHLSMYKCRDGLIDAIQGSTAITISNCHFTHHDQVMLFGANDNHKMDE  299

Query  94   IMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             MQ+T+ FNHFGK LVQRMPRCR+G+ HVVN
Sbjct  300  KMQITLVFNHFGKGLVQRMPRCRWGFIHVVN  330



>gb|KHN08855.1| Putative pectate lyase P59 [Glycine soja]
Length=435

 Score =   394 bits (1013),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 193/342 (56%), Positives = 245/342 (72%), Gaps = 15/342 (4%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             ME  +  +L    + LA  I PT   +I  FD VW  R +EA   A + Y+P+P  VT+ 
Sbjct  1     METSKFSLLFFYVICLA--IFPTLNANIGHFDHVWHRRLKEAREAAKQAYKPNPMKVTAE  58

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRK  665
              N +V++ +             +N++RR L   +Y GPC ATNPID+CWRCDPNW   RK
Sbjct  59    FNTHVIRAM-----------RGSNNSRRGL-SNQYDGPCKATNPIDKCWRCDPNWEKNRK  106

Query  664   RLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNI  488
             RLADC+LGFG+   GGK+G  Y V D+SD+ L NPK GTLRHA IQ +PLWIIF R+MNI
Sbjct  107   RLADCALGFGHGTTGGKDGKIYVVNDSSDNDLVNPKPGTLRHAAIQREPLWIIFDRNMNI  166

Query  487   KLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSIN  308
             KL  ELM+  +KTID RGA VHIS GA ITLQ+VKN+IIHG+ +HDI    GG+IRDS++
Sbjct  167   KLHAELMLTDNKTIDARGANVHISEGAQITLQYVKNIIIHGLHIHDIKKCSGGLIRDSMD  226

Query  307   HFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVML  128
             H+G+R  SDGD IS+FG+T +W+DH+S   CDDG+ID + ASTA+TISN H T HN+V+L
Sbjct  227   HYGVRAMSDGDAISVFGSTYVWIDHVSFTNCDDGLIDVVSASTAVTISNCHLTKHNDVLL  286

Query  127   FGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             FGA+D    DKIMQVT+AFNHFGK L+QRMPRCR+G+FH+VN
Sbjct  287   FGASDSYSGDKIMQVTLAFNHFGKGLIQRMPRCRWGFFHIVN  328



>ref|XP_011013803.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=419

 Score =   393 bits (1009),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 193/315 (61%), Positives = 233/315 (74%), Gaps = 14/315 (4%)
 Frame = -1

Query  943  ISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNSTR  764
            I+ FD+ W+ R EEA   + + YEP+P  V    N  V K +              NSTR
Sbjct  10   IANFDEYWKKRAEEAKEASREAYEPNPEKVAKHFNDEVHKSL-----------EGGNSTR  58

Query  763  RHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDN  584
            R+LGK  Y+GPC ATNPIDRCWRCD NWA  RK+L  C+LGFG K  GGKNG +Y VTD 
Sbjct  59   RNLGK--YKGPCLATNPIDRCWRCDKNWAKNRKKLGGCALGFGRKTIGGKNGKYYRVTDP  116

Query  583  SDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGA  407
            SD+ + NPK GTLR+ VIQ KPLWIIFA  M I+L +ELMV S+KTIDGRG  VHI  GA
Sbjct  117  SDNDMVNPKPGTLRYGVIQDKPLWIIFAHDMVIRLSEELMVASNKTIDGRGVNVHIYNGA  176

Query  406  GITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLS  227
             ITLQFVKNVIIHGI +HD   G+GGMIRDS++H+G R+RSDGDGIS+FG+TDIW+DH+S
Sbjct  177  QITLQFVKNVIIHGIHIHDAKAGNGGMIRDSVDHYGFRSRSDGDGISIFGSTDIWIDHIS  236

Query  226  MRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLV  47
            +  C+DG+IDA+  S AITISN HFT HN+VMLFGA+D    D +MQ+T+AFNHFG+ LV
Sbjct  237  LSNCEDGLIDAVMGSNAITISNCHFTKHNDVMLFGASDGYSGDSVMQITVAFNHFGRGLV  296

Query  46   QRMPRCRYGYFHVVN  2
            QRMPR R+G+ HVVN
Sbjct  297  QRMPRVRWGFAHVVN  311



>ref|XP_008456459.1| PREDICTED: pectate lyase-like [Cucumis melo]
Length=434

 Score =   393 bits (1010),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 201/343 (59%), Positives = 244/343 (71%), Gaps = 23/343 (7%)
 Frame = -1

Query  1024  MEGFQ-IKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTS  848
             M GF  + + SLLF  +A         ++ E D+ W  R  EA   A   + P+P  VT 
Sbjct  1     MAGFSTLFVCSLLFFVVAN-------ANVDE-DEYWNTRATEAKKVAKSAFNPNPEIVTD  52

Query  847   TLNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKR  668
              LN  V + ++             NSTRR L  KKYRGPC ATNPIDRCWRCD NWA  R
Sbjct  53    NLNAAVSRAMVG-----------RNSTRRSL--KKYRGPCLATNPIDRCWRCDRNWAKNR  99

Query  667   KRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMN  491
             K+LA+C LGFG++  GGK G  Y VTD SD  L NPK GTLR+ VIQ  PLWIIF RSM 
Sbjct  100   KKLAECPLGFGHQTIGGKRGPIYVVTDASDDDLVNPKPGTLRYGVIQKGPLWIIFGRSMI  159

Query  490   IKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSI  311
             I+L QELM+ S KTID RGA VHI+ GAG+T+QFV NVIIH + +HDI+   GGMIRDS+
Sbjct  160   IRLSQELMISSDKTIDARGANVHIAFGAGLTIQFVNNVIIHNLHIHDIISKSGGMIRDSV  219

Query  310   NHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVM  131
             +H+G RT+SDGDGIS+FG++ +W+DH+SM  C+DG+IDAI  STAITISN HFT HNEVM
Sbjct  220   DHYGFRTQSDGDGISIFGSSHVWIDHVSMSNCEDGLIDAIMGSTAITISNCHFTHHNEVM  279

Query  130   LFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             LFGA+D   +D+IMQVT+AFNHFG+ LVQRMPRCR+G+FHVVN
Sbjct  280   LFGASDSYAEDEIMQVTLAFNHFGRGLVQRMPRCRWGFFHVVN  322



>gb|AAB69759.1| putative pectate lyase [Arabidopsis thaliana]
Length=459

 Score =   393 bits (1010),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 200/332 (60%), Positives = 239/332 (72%), Gaps = 2/332 (1%)
 Frame = -1

Query  994  LLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVIL  815
            + F S  AI+ P   G+++ FD  W  R+ +A    + +Y+P P NVT+  N++V  + +
Sbjct  14   VFFSSFLAIVAPQVRGNVAVFDSYWTQRQSDALKQTIGSYDPHPLNVTNHFNYHV-NIAV  72

Query  814  DYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFG  635
            D   + N+T  E    R      K  G C A NPID CWRCD NWAN RK+LADC LGFG
Sbjct  73   DASESRNDTRRELTQVRSGRKTHKSSGKCLAYNPIDNCWRCDRNWANNRKKLADCVLGFG  132

Query  634  YKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQS  458
             +  GGK+G  Y V D SD+ L NPK GTLRHAV +  PLWIIFARSM IKL+QELM+ S
Sbjct  133  RRTTGGKDGPIYVVKDASDNDLINPKPGTLRHAVTRDGPLWIIFARSMIIKLQQELMITS  192

Query  457  HKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDG  278
             KTIDGRGA+V+I  GAG+TLQFV NVIIH I V  IV G+GG+IRDS  H GLRT+SDG
Sbjct  193  DKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKHIVPGNGGLIRDSEAHIGLRTKSDG  252

Query  277  DGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKD  98
            DGISL GAT+IW+DH+SM +C DG+IDAI+ STA+TISNSHFTDH EVMLFGA D    D
Sbjct  253  DGISLIGATNIWIDHVSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVID  312

Query  97   KIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            K MQ+T+AFNHFGKRL QRMPRCRYG  HVVN
Sbjct  313  KKMQITVAFNHFGKRLEQRMPRCRYGTIHVVN  344



>ref|XP_007138209.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
 gb|ESW10203.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
Length=434

 Score =   392 bits (1006),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 191/342 (56%), Positives = 245/342 (72%), Gaps = 16/342 (5%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             ME     +L    + LA  I+PT   +I +FD VW  R +EA   A + Y+P+P  VT+ 
Sbjct  1     MESSNFSLLFFYVIFLA--ILPTLQANIGQFDHVWHRRLKEAREAAKQAYKPNPMKVTAE  58

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRK  665
              N +V++ +             +NSTRR LGKK     C A NPID+CWRCDP+W   RK
Sbjct  59    FNTHVMRAM-----------KGSNSTRRGLGKKN--DECEAANPIDKCWRCDPDWEKNRK  105

Query  664   RLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNI  488
             +LADC++GFG+   GGK+G  Y V DNSD  L NPK GTLRHAVIQ +PLWIIF+R+MNI
Sbjct  106   KLADCAIGFGHGTTGGKDGKIYVVGDNSDKDLVNPKPGTLRHAVIQTEPLWIIFSRNMNI  165

Query  487   KLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSIN  308
             +L  EL++  +KTID RGA VHI  GA +T+QFVKN+IIHG+ +HDI    GG+IRDS++
Sbjct  166   RLTAELLITDNKTIDARGANVHILDGAQMTIQFVKNIIIHGLHIHDIQPISGGLIRDSMS  225

Query  307   HFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVML  128
             H+G+R  SDGDGIS+FG+T IW+DH+SM  C DG+ID + ASTA+TISN HF  HN+V+L
Sbjct  226   HYGVRAMSDGDGISVFGSTHIWIDHVSMTNCSDGLIDVVSASTAVTISNCHFVKHNDVLL  285

Query  127   FGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             FGA D   +DK+MQVT+AFNHFGK LVQRMPRCR+G+FH+VN
Sbjct  286   FGATDSFSRDKVMQVTLAFNHFGKGLVQRMPRCRWGFFHIVN  327



>ref|XP_004135462.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
 gb|KGN51889.1| hypothetical protein Csa_5G604340 [Cucumis sativus]
Length=432

 Score =   391 bits (1005),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 194/315 (62%), Positives = 236/315 (75%), Gaps = 14/315 (4%)
 Frame = -1

Query  943  ISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNSTR  764
            I +FDD W+ R   A   A   Y+PDP  V +++N  +               +  NSTR
Sbjct  21   IGDFDDYWKARAAAAEKAAADAYDPDPETVANSVNAEIAHA-----------SSGRNSTR  69

Query  763  RHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDN  584
            R+L  KKY GPC ATNPIDRCWRCDPNWA  RK+LADC LGFG K  GGK G +Y V D+
Sbjct  70   RNL--KKYAGPCLATNPIDRCWRCDPNWAQNRKKLADCVLGFGRKTTGGKLGPYYVVNDS  127

Query  583  SDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGA  407
            SD  L NPK GTLRHAVIQ  PLWIIF+ +M I+L QEL++ S KTID RGA V I+ GA
Sbjct  128  SDSDLMNPKPGTLRHAVIQKGPLWIIFSTNMAIRLSQELIMTSDKTIDARGANVQIAYGA  187

Query  406  GITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLS  227
            GITLQ+++NVIIHG+R+H IV G GGMIRD+++H GLRT SDGDGIS+FG++++W+DH+S
Sbjct  188  GITLQYIRNVIIHGLRIHHIVVGSGGMIRDAVDHVGLRTMSDGDGISIFGSSNVWIDHVS  247

Query  226  MRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLV  47
            M  C DG+IDAI  STAITISN HFT HNEVMLFGA+D   +D+IMQ+T+AFNHFG+ LV
Sbjct  248  MSNCHDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDGYSQDQIMQITVAFNHFGQGLV  307

Query  46   QRMPRCRYGYFHVVN  2
            QRMPRCR+G+FHVVN
Sbjct  308  QRMPRCRWGFFHVVN  322



>ref|XP_004155392.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=432

 Score =   391 bits (1005),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 194/315 (62%), Positives = 236/315 (75%), Gaps = 14/315 (4%)
 Frame = -1

Query  943  ISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNSTR  764
            I +FDD W+ R   A   A   Y+PDP  V +++N  +               +  NSTR
Sbjct  21   IGDFDDYWKARAAAAEKAAADAYDPDPETVANSVNAEIAHA-----------SSGRNSTR  69

Query  763  RHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDN  584
            R+L  KKY GPC ATNPIDRCWRCDPNWA  RK+LADC LGFG K  GGK G +Y V D+
Sbjct  70   RNL--KKYAGPCLATNPIDRCWRCDPNWAQNRKKLADCVLGFGRKTTGGKLGPYYVVNDS  127

Query  583  SDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGA  407
            SD  L NPK GTLRHAVIQ  PLWIIF+ +M I+L QEL++ S KTID RGA V I+ GA
Sbjct  128  SDSDLMNPKPGTLRHAVIQKGPLWIIFSXNMAIRLSQELIMTSDKTIDARGANVQIAYGA  187

Query  406  GITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLS  227
            GITLQ+++NVIIHG+R+H IV G GGMIRD+++H GLRT SDGDGIS+FG++++W+DH+S
Sbjct  188  GITLQYIRNVIIHGLRIHHIVVGSGGMIRDAVDHVGLRTMSDGDGISIFGSSNVWIDHVS  247

Query  226  MRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLV  47
            M  C DG+IDAI  STAITISN HFT HNEVMLFGA+D   +D+IMQ+T+AFNHFG+ LV
Sbjct  248  MSNCHDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDGYSQDQIMQITVAFNHFGQGLV  307

Query  46   QRMPRCRYGYFHVVN  2
            QRMPRCR+G+FHVVN
Sbjct  308  QRMPRCRWGFFHVVN  322



>gb|KHG07401.1| putative pectate lyase P59 [Gossypium arboreum]
Length=442

 Score =   391 bits (1005),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 203/342 (59%), Positives = 249/342 (73%), Gaps = 11/342 (3%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLA-AIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTS  848
             M G   +  SL+   L   +IIP+   HI+E+DD W+ R+ +A  +  K Y P+P  VT 
Sbjct  1     MAGVGNRSFSLILYFLCLGVIIPSLEAHIAEYDDYWRERELQAKENLEKAYNPNPEEVTQ  60

Query  847   TLNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKR  668
               N +V ++++ +R N         STRR L KK+  GPC ATNPID+CWRCD NW   R
Sbjct  61    HFNDHVARILMGFRTN---------STRRML-KKRKGGPCEATNPIDQCWRCDRNWEKNR  110

Query  667   KRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPLNPKRGTLRHAVIQIKPLWIIFARSMNI  488
             K+LADC+LGFG    GGK+G  Y VTD +D  LNP RGTLRHAVIQ +PLWI FAR M I
Sbjct  111   KKLADCALGFGRGTTGGKDGPIYVVTDPTDDVLNPSRGTLRHAVIQNRPLWITFARGMII  170

Query  487   KLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSIN  308
             +LK+EL++ S+KTIDGRGA VHI+ GAGIT+QF KNVIIH I +H+I    GG I+D  N
Sbjct  171   RLKEELLMTSNKTIDGRGANVHIAYGAGITIQFAKNVIIHNIHIHNIFPSKGGKIKDGEN  230

Query  307   HFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVML  128
             H GLRTRSDGDGISLFGAT++WLDHLS+ KC DG+IDAI+ STAITISN HFTDHN+VML
Sbjct  231   HLGLRTRSDGDGISLFGATNVWLDHLSVYKCSDGIIDAIQGSTAITISNCHFTDHNDVML  290

Query  127   FGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             FGA+D    D+ MQ+T+AF HFGK LVQRMPR R+G+ HVVN
Sbjct  291   FGASDSYSADEKMQITVAFTHFGKNLVQRMPRVRFGFVHVVN  332



>ref|XP_009403112.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=437

 Score =   391 bits (1004),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 195/320 (61%), Positives = 235/320 (73%), Gaps = 14/320 (4%)
 Frame = -1

Query  955  SLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetet  776
            S  HI +FD+ WQ + E A   A  +Y PDP +VT + N  V K +            E 
Sbjct  21   SNAHIGDFDEYWQKKAEAARDRAQGSYNPDPESVTQSFNEAVSKDL------------EG  68

Query  775  NSTRRHL-GKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFY  599
            N TRR L GK K+ GPC ATNPIDRCWRC  +W   RKRLA C+ GFG    GGKNGD Y
Sbjct  69   NVTRRSLRGKHKFNGPCVATNPIDRCWRCKKDWMQNRKRLAKCAKGFGRHTIGGKNGDLY  128

Query  598  TVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVH  422
             VTD SD+ L +PK+GTLR+ VIQ +PLWI+FA  M I+L +EL+V S KTID RG+ VH
Sbjct  129  VVTDASDNDLISPKKGTLRYGVIQDRPLWIVFASDMIIRLNEELLVTSDKTIDARGSNVH  188

Query  421  ISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIW  242
            I GGAGI LQFV NVIIHG+ +HDI  G+GGMIRDS +HFGLRTRSDGDGIS++G+++IW
Sbjct  189  IMGGAGIMLQFVHNVIIHGLHIHDIKAGNGGMIRDSEHHFGLRTRSDGDGISIYGSSNIW  248

Query  241  LDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHF  62
            +DH+SM  C DG+ID I+ STAITISNSHFT HN+VMLFGA+D    D +MQ+T+AFNHF
Sbjct  249  IDHVSMSNCMDGLIDVIQGSTAITISNSHFTKHNDVMLFGASDSYQGDAMMQITVAFNHF  308

Query  61   GKRLVQRMPRCRYGYFHVVN  2
            GK LVQRMPRCR+G+ HVVN
Sbjct  309  GKGLVQRMPRCRWGFVHVVN  328



>ref|XP_010527872.1| PREDICTED: probable pectate lyase 3 isoform X2 [Tarenaya hassleriana]
Length=461

 Score =   392 bits (1006),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 194/347 (56%), Positives = 244/347 (70%), Gaps = 7/347 (2%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             M  +    L +LF ++++    +  GH++ FD+ W  R+++A    L+ Y+P+P NVT  
Sbjct  1     MASWDFVKLVILF-AISSWASSSVRGHVAVFDEYWTQRQDKALRQTLRFYDPNPFNVTDH  59

Query  844   LNHNVVKVILDY-----RnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNW  680
              N++V   + +           E      S  +H  ++   G C A NPIDRCWRCDP W
Sbjct  60    FNYHVNLAVEETMKTGNNGTRRELLQVGQSRGQHPKRRNLGGKCVAYNPIDRCWRCDPGW  119

Query  679   ANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFA  503
             +  RK+LADC+LGFG K  GGK G +Y VTD SD  L NPK GTLRHAV + +PLWI+FA
Sbjct  120   SKNRKKLADCALGFGRKTTGGKAGPYYVVTDASDDDLLNPKAGTLRHAVTREEPLWIVFA  179

Query  502   RSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMI  323
             +SM IKL+QEL++ S KTIDGRG +VHI+GGAG TLQFV NVIIH I + +IV G+GG+I
Sbjct  180   KSMVIKLQQELIMTSDKTIDGRGVRVHITGGAGFTLQFVNNVIIHNIYIKNIVPGNGGLI  239

Query  322   RDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDH  143
             RDS  HFGLRTRSDGDGI++FGAT++W+DH+SM  C DG+IDAI+ ST ITISN H TDH
Sbjct  240   RDSETHFGLRTRSDGDGINIFGATNVWIDHVSMSHCSDGMIDAIQGSTGITISNCHLTDH  299

Query  142   NEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
              EVMLFG  D    DK MQ+T+AFNHFGKRLVQRMPRCRYG  HVVN
Sbjct  300   QEVMLFGGTDKDVIDKKMQITVAFNHFGKRLVQRMPRCRYGLIHVVN  346



>ref|XP_009389712.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=438

 Score =   391 bits (1004),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 196/336 (58%), Positives = 245/336 (73%), Gaps = 18/336 (5%)
 Frame = -1

Query  1003  ILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVK  824
               SL+F++ AA     +  HI++FD+ WQ + E A   A  +Y PDP +VT   N  V +
Sbjct  9     FFSLVFLASAAF----ANAHIADFDEYWQKKAEVAQSKARNSYNPDPESVTRHFNEAVYE  64

Query  823   VILDYRnnnnetetetNSTRRHL-GKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCS  647
                         + +TN TRR L G+K+  GPC ATNPIDRCWRC+ NW + RK+LA C+
Sbjct  65    ------------DAQTNVTRRGLRGQKRSHGPCLATNPIDRCWRCNENWIHHRKQLATCA  112

Query  646   LGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQEL  470
              GFG    GGKNG FY VTD SD  L NPK+GTLR+ VIQ +PLWI+FA  M I+L +EL
Sbjct  113   KGFGRHTIGGKNGKFYVVTDASDDDLVNPKKGTLRYGVIQDRPLWIVFAHDMVIRLTEEL  172

Query  469   MVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRT  290
             +V S+KTIDGRGA V I GGAG+T+Q+V NVI+H + + DI  G+GGMIRDS +H+GLRT
Sbjct  173   IVNSYKTIDGRGANVQIMGGAGVTIQYVHNVIVHNLHIQDIKAGNGGMIRDSEHHYGLRT  232

Query  289   RSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDH  110
             RSDGDGIS++G+++IW+DH+SM  C DG+IDAIE STAITISNSHFT HNE MLFGA+D 
Sbjct  233   RSDGDGISIYGSSNIWIDHVSMSNCMDGLIDAIEGSTAITISNSHFTRHNEAMLFGASDA  292

Query  109   SPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
                D IMQ+T+AFNHFGK LVQRMPRCR+G+ HVVN
Sbjct  293   YSPDAIMQITVAFNHFGKGLVQRMPRCRWGFVHVVN  328



>ref|XP_010068708.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
 gb|KCW64557.1| hypothetical protein EUGRSUZ_G02162 [Eucalyptus grandis]
Length=435

 Score =   390 bits (1002),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 197/333 (59%), Positives = 242/333 (73%), Gaps = 15/333 (5%)
 Frame = -1

Query  994  LLFV-SLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVI  818
            L+F  +  A+ +P    +I++FD+VWQ R EEA    +K YEPDP+ V    NH V + +
Sbjct  8    LVFAFAFLAVAVPVLRANIADFDEVWQKRAEEAKKATIKAYEPDPAKVAEDFNHRVHEDM  67

Query  817  LDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGF  638
                         +N+TRR L  K+ +G C ATNPIDRCWRC  +WA+ RKRLA+C+LGF
Sbjct  68   -----------QRSNNTRRSL--KRTKGGCLATNPIDRCWRCRKDWASHRKRLANCALGF  114

Query  637  GYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQ  461
            G    GGK G  Y VTD SD  L NPK GTLRHAVIQ +PLWIIFA +M I+L +EL+V 
Sbjct  115  GRGTTGGKAGKIYKVTDPSDDNLMNPKPGTLRHAVIQPEPLWIIFAHNMVIRLSEELIVT  174

Query  460  SHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSD  281
             +KTIDGRGA VHI  GA ITLQFV+NVIIHG+ +HD   G+GG+IRDS+ H+G RT SD
Sbjct  175  DNKTIDGRGANVHICDGAQITLQFVRNVIIHGLHIHDTHPGNGGLIRDSLEHYGFRTGSD  234

Query  280  GDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPK  101
            GDGISLFGAT++W+DH+SM  C DG+ID I+ASTAITISN HFT HNEVMLFG +D    
Sbjct  235  GDGISLFGATNVWIDHVSMSHCYDGLIDVIQASTAITISNCHFTRHNEVMLFGGSDTYSD  294

Query  100  DKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            D  MQ+T+AFNHFG+ LVQRMPRCR+G+ HVVN
Sbjct  295  DAHMQITVAFNHFGQGLVQRMPRCRWGFVHVVN  327



>ref|XP_008446316.1| PREDICTED: probable pectate lyase P59 [Cucumis melo]
Length=432

 Score =   389 bits (999),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 198/315 (63%), Positives = 238/315 (76%), Gaps = 14/315 (4%)
 Frame = -1

Query  943  ISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNSTR  764
            I +FDD W+ R  EA   A   YEP+P  +  +LN  V + +           + +NSTR
Sbjct  21   IGDFDDYWKARAAEAEQAAADAYEPNPETIADSLNAEVGQAL-----------SGSNSTR  69

Query  763  RHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDN  584
            R+L  KKY GPC ATNPIDRCWRCDPNWA  RK+LADC LGFG K  GGK G +Y V D+
Sbjct  70   RNL--KKYTGPCRATNPIDRCWRCDPNWAQNRKKLADCVLGFGRKTIGGKLGPYYVVNDS  127

Query  583  SDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGA  407
            SD  L NPK GTLRHAVIQ  PLWI F+ +M I+L QEL+V S KTID RGA V I+ GA
Sbjct  128  SDSDLMNPKPGTLRHAVIQKGPLWITFSTNMAIRLTQELIVTSDKTIDARGANVQIAYGA  187

Query  406  GITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLS  227
            GITLQ+V+NVIIHG+R+H IV G+GGMIRD+++H GLRT SDGDGIS+FG++++W+DH+S
Sbjct  188  GITLQYVRNVIIHGLRIHHIVVGNGGMIRDAVDHVGLRTMSDGDGISIFGSSNVWIDHVS  247

Query  226  MRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLV  47
            M  C DG+IDAI  STAITISN HFT HNEVMLFGA+D    D+IMQVT+AFNHFG+ LV
Sbjct  248  MSNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDGYSNDQIMQVTVAFNHFGQGLV  307

Query  46   QRMPRCRYGYFHVVN  2
            QRMPRCR+G+FHVVN
Sbjct  308  QRMPRCRWGFFHVVN  322



>ref|XP_009117903.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=452

 Score =   389 bits (1000),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 197/345 (57%), Positives = 245/345 (71%), Gaps = 12/345 (3%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             M    + I     V L AI++P    +++ FD+ W  R+ +A    + +Y+P+P NVT  
Sbjct  1     MAAAFLNIGGYTLVFLLAILVPHVQSNVAVFDNYWTQRQGDALKQTIASYDPNPLNVTDH  60

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYR---GPCNATNPIDRCWRCDPNWAN  674
             LN++V   +        +    TN+TRR L  +K +   G C A NPID+CWRCDPNW  
Sbjct  61    LNYHVALAV--------DATESTNNTRRELIGRKTQEGSGKCIAYNPIDKCWRCDPNWEK  112

Query  673   KRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARS  497
              RK+LA+C LGFG K  GGK+G  Y V D+SD  L NPK GTLRHAV +  PLWIIFA S
Sbjct  113   NRKKLAECVLGFGRKTTGGKDGPIYVVNDSSDDDLVNPKPGTLRHAVTRDGPLWIIFANS  172

Query  496   MNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRD  317
             M IKL+QELM+ S+KTIDGRGA+V+I  G G+TLQFV NVII+ I V  I+ G+GG+IRD
Sbjct  173   MVIKLQQELMITSNKTIDGRGAKVYIMEGVGLTLQFVNNVIINNIYVKHIIPGNGGLIRD  232

Query  316   SINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNE  137
             S  H G+RT+SDGDGISLFGAT++W+DH+SM +C DG+IDAIE STA+TISNSHFTDH E
Sbjct  233   SEEHVGIRTKSDGDGISLFGATNVWIDHVSMTRCTDGMIDAIEGSTAVTISNSHFTDHQE  292

Query  136   VMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             VMLFGA D    DK MQ+T+AFNHFGKRL QRMPRCR+G  HVVN
Sbjct  293   VMLFGAKDEHVIDKNMQITVAFNHFGKRLEQRMPRCRFGTIHVVN  337



>gb|KFK43687.1| hypothetical protein AALP_AA1G160000 [Arabis alpina]
Length=460

 Score =   389 bits (1000),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 198/334 (59%), Positives = 243/334 (73%), Gaps = 5/334 (1%)
 Frame = -1

Query  994  LLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVIL  815
            + F+S  A   P S  H++ FD+ W  R+ +A    + +Y+P+P NVT   NH+V  + +
Sbjct  14   VFFLSFIATFPPESRAHVAVFDNYWTQRQTDALRQTMNSYDPNPLNVTDHFNHHV-SLAM  72

Query  814  DYRnnnnetetetNSTRRHLGKK--KYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLG  641
            D   +NN T  E    R+  G+K  K  G C A N ID+CWRCD NWA  RK+L DC LG
Sbjct  73   DATESNNGTRRELTQVRKS-GRKIHKSSGKCLAYNAIDKCWRCDRNWAKNRKKLTDCVLG  131

Query  640  FGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMV  464
            FG K  GGK+G  Y V D SD+ L NPK GTLR+AV +  PLWIIFARSM IKL+QELM+
Sbjct  132  FGRKTTGGKDGPIYVVNDASDNDLVNPKPGTLRYAVTRDGPLWIIFARSMIIKLQQELMI  191

Query  463  QSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRS  284
             S KTIDGRGA+++I  GAG+TLQ+V NVIIH I V  IV G+GG+IRDS +H GLRT+S
Sbjct  192  TSDKTIDGRGARIYIMEGAGLTLQYVNNVIIHNIYVKHIVPGNGGLIRDSEHHLGLRTKS  251

Query  283  DGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSP  104
            DGDGISLFGAT++W+DH+SM +C DG+IDAI+ STA+TISNSHFTDH EVMLFGA D   
Sbjct  252  DGDGISLFGATNVWIDHVSMTRCADGMIDAIQGSTAVTISNSHFTDHQEVMLFGARDEDV  311

Query  103  KDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             DK MQ+T+AFNHFGKRL QRMPRCR+G  HVVN
Sbjct  312  IDKKMQITVAFNHFGKRLEQRMPRCRFGLIHVVN  345



>ref|XP_009408830.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=436

 Score =   388 bits (997),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 194/319 (61%), Positives = 238/319 (75%), Gaps = 15/319 (5%)
 Frame = -1

Query  949  GHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNS  770
             HI+++D+ WQ +   A  HA   Y P+P +VT   N  V++ +             +NS
Sbjct  23   AHIADYDEYWQKKAALARSHANNAYNPNPESVTHHFNEAVMRDL------------ASNS  70

Query  769  TRRHL-GKKKYR-GPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYT  596
            TRR L GK +   G C ATNPIDRC+RC  NW + RK+LA C+ GFG  A GGKNGDFY 
Sbjct  71   TRRGLRGKMRNEDGACQATNPIDRCFRCQSNWVHHRKKLATCAKGFGRHATGGKNGDFYV  130

Query  595  VTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHI  419
            VTD+SD  L NP+ GTLRHAVIQ +PLWI+FA  M I+L +EL++ S+KTIDGRGA V I
Sbjct  131  VTDSSDADLVNPRNGTLRHAVIQDRPLWIVFAHDMLIRLTEELIINSNKTIDGRGANVQI  190

Query  418  SGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWL  239
            + GAG+T+QFV NVI+H IR+HDI  G+GGMIRDS  H+GLRTRSDGDGIS+FGA++IW+
Sbjct  191  AYGAGLTIQFVHNVIVHNIRIHDIKAGNGGMIRDSEEHYGLRTRSDGDGISIFGASNIWI  250

Query  238  DHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFG  59
            DH+SM  C DG+IDAIE STAITISNSHFT HN+VMLFGA+D    D IMQ+T+AFNHFG
Sbjct  251  DHVSMSNCMDGLIDAIEGSTAITISNSHFTQHNDVMLFGASDAFSGDAIMQITVAFNHFG  310

Query  58   KRLVQRMPRCRYGYFHVVN  2
            K LVQRMPRCR+G+ HVVN
Sbjct  311  KGLVQRMPRCRWGFVHVVN  329



>ref|XP_008389523.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 3 [Malus 
domestica]
Length=452

 Score =   389 bits (998),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 189/316 (60%), Positives = 237/316 (75%), Gaps = 13/316 (4%)
 Frame = -1

Query  943  ISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNSTR  764
            + + D  W+ R +EA   A+++Y  +P  VT   N  V +++           ++ N+TR
Sbjct  39   VLDLDAYWKERAQEALKEAMESYHKNPEQVTEEFNTGVAELL-----------SKENTTR  87

Query  763  RHL-GKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTD  587
            R+L G K Y GPC ATNPID CWRCDPNWA+ RK++  C+ GFG KA GGK+G  Y VT 
Sbjct  88   RNLRGNKGYNGPCMATNPIDACWRCDPNWADNRKKIVGCAQGFGKKATGGKDGPIYVVTV  147

Query  586  NSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGG  410
             +D  + NPK GTLRHAVIQ  PLWIIFARSM I+L+QELMV S KTIDGRGA V I  G
Sbjct  148  GTDDDVQNPKPGTLRHAVIQKGPLWIIFARSMVIRLQQELMVTSDKTIDGRGANVVIEEG  207

Query  409  AGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHL  230
             GITLQFVKNVI+  + +  IV   GGMIRDS++H GLRT+SDGDGISLFGA+++W+DH+
Sbjct  208  GGITLQFVKNVILTNLHIKMIVSKTGGMIRDSVDHMGLRTKSDGDGISLFGASNVWIDHM  267

Query  229  SMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRL  50
            SM +C DG+IDA+ ASTAITISNSHFTDH++VMLFGAN+   +DKIMQ+T+AFNHFG+ L
Sbjct  268  SMSRCADGLIDAVMASTAITISNSHFTDHDDVMLFGANNAHTQDKIMQITLAFNHFGRGL  327

Query  49   VQRMPRCRYGYFHVVN  2
            VQRMPR R+G+FH+VN
Sbjct  328  VQRMPRVRHGFFHLVN  343



>ref|XP_011005067.1| PREDICTED: probable pectate lyase P59 [Populus euphratica]
Length=452

 Score =   388 bits (997),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 201/336 (60%), Positives = 253/336 (75%), Gaps = 5/336 (1%)
 Frame = -1

Query  994  LLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVIL  815
            L+F    A +IP  L  I+ FD+VWQ R EEA    L +Y P+P + T   N  V   ++
Sbjct  8    LIFAITLATLIPALLADIAFFDEVWQKRAEEAKKVTLNSYVPNPEDATDDFNFEVNNTLV  67

Query  814  DYRn--nnnetetetNSTRRHL--GKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCS  647
            D+ +  N+   E   NSTRR+L  GKKKY GPC  TNPID+CWRC  NWA  RKRLA C+
Sbjct  68   DFDDDGNDAGFELLANSTRRNLKQGKKKYLGPCKVTNPIDKCWRCRRNWARNRKRLAKCA  127

Query  646  LGFGYKAKGGKNGDFYTVTDNSDHP-LNPKRGTLRHAVIQIKPLWIIFARSMNIKLKQEL  470
            LGFG +A GG  G  Y VT+NSD   +NPK GTLRHAVIQ +PLWIIF+++MNI+L +EL
Sbjct  128  LGFGRRATGGLKGRVYVVTENSDDDVMNPKPGTLRHAVIQKEPLWIIFSKNMNIRLSKEL  187

Query  469  MVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRT  290
            ++ SHKTIDGRG  +HI+ GAGIT+QF++NVIIHGIR+H IV   GG IRDS+ H+G+RT
Sbjct  188  IMTSHKTIDGRGHHIHIAYGAGITIQFIQNVIIHGIRIHHIVATSGGNIRDSVGHYGIRT  247

Query  289  RSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDH  110
             SDGDGIS+FG+++IW+DH+SM +C DG+IDAI  STAITISNSHFT HN+ +L GA+D 
Sbjct  248  NSDGDGISIFGSSNIWIDHVSMSRCTDGLIDAIMGSTAITISNSHFTHHNDAILLGASDS  307

Query  109  SPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
               D++MQVT+AFNHFG+ LVQRMPRCR+G+FHVVN
Sbjct  308  FSGDELMQVTVAFNHFGQGLVQRMPRCRWGFFHVVN  343



>gb|AES91206.2| pectate lyase P59-like protein [Medicago truncatula]
Length=434

 Score =   388 bits (996),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 188/323 (58%), Positives = 234/323 (72%), Gaps = 14/323 (4%)
 Frame = -1

Query  967  IIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnet  788
            I+P    +I  FD  WQNR ++A   A + Y+P+P  +TS LN +V K +          
Sbjct  18   IVPIFEANIVHFDQYWQNRSDDAKKAAQQAYKPNPQEITSNLNMHVHKAL----------  67

Query  787  etetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNG  608
             + +NSTRR L K  Y+GPC+ATNPID CWRCDPNW   RK+LADC LGFG+   GGK G
Sbjct  68   -SGSNSTRRELAK--YKGPCSATNPIDSCWRCDPNWEKNRKKLADCVLGFGHGTTGGKAG  124

Query  607  DFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGA  431
              Y VTD+SD+ L  PK GTLR A IQ +PLWIIF  +MNIKLK EL++ S KTID RGA
Sbjct  125  KIYVVTDSSDNDLVTPKPGTLRFAAIQKEPLWIIFKHNMNIKLKAELLLTSDKTIDARGA  184

Query  430  QVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGAT  251
             VHIS GA ITLQ+VKN+IIHG+ +HD     GG IRDS++H+G R+ SDGD IS+FGA+
Sbjct  185  NVHISEGAQITLQYVKNIIIHGLHIHDTKKTSGGQIRDSMDHYGSRSASDGDAISMFGAS  244

Query  250  DIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAF  71
             +W+DH+SM  C DG++DA+  STAITISN H T HN+VMLFGAND    D+I Q+T+AF
Sbjct  245  HVWIDHISMWNCADGLVDAVAGSTAITISNCHMTRHNDVMLFGANDGFSGDQISQITVAF  304

Query  70   NHFGKRLVQRMPRCRYGYFHVVN  2
            NHFGK L+QRMPRCR+G+FH+VN
Sbjct  305  NHFGKGLIQRMPRCRWGFFHIVN  327



>emb|CDY53552.1| BnaA09g57110D [Brassica napus]
Length=495

 Score =   389 bits (1000),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 196/333 (59%), Positives = 242/333 (73%), Gaps = 12/333 (4%)
 Frame = -1

Query  988  FVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDY  809
             V L AI++P    +++ FD+ W  R+ +A    + +Y+P+P NVT  LN++V   +   
Sbjct  13   LVFLLAILVPHVQANVAVFDNYWTQRQGDALKQTIASYDPNPLNVTDHLNYHVALAV---  69

Query  808  RnnnnetetetNSTRRHLGKKKYR---GPCNATNPIDRCWRCDPNWANKRKRLADCSLGF  638
                 +    TN+TRR L  +K +   G C A NPID+CWRCDPNW   RK+LA+C LGF
Sbjct  70   -----DATESTNNTRRELIGRKTQEGSGKCIAHNPIDKCWRCDPNWEKNRKKLAECVLGF  124

Query  637  GYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQ  461
            G K  GGK+G  Y V D+SD  L NPK GTLRHAV +  PLWIIFA SM IKL+QELM+ 
Sbjct  125  GRKTTGGKDGPIYVVNDSSDDDLVNPKPGTLRHAVTRDGPLWIIFANSMVIKLQQELMIT  184

Query  460  SHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSD  281
            S+KTIDGRGA+V+I  G G+TLQFV NVII+ I V  I+ G+GG+IRDS  H GLRT+SD
Sbjct  185  SNKTIDGRGAKVYIMEGVGLTLQFVNNVIINNIYVKHIIPGNGGLIRDSEEHVGLRTKSD  244

Query  280  GDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPK  101
            GDGISLFGAT++W+DH+SM +C DG+IDAIE STA+TISNSHFTDH EVMLFGA D    
Sbjct  245  GDGISLFGATNVWIDHVSMTRCTDGMIDAIEGSTAVTISNSHFTDHQEVMLFGAKDEHVI  304

Query  100  DKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            DK MQ+T+AFNHFGKRL QRMPRCR+G  HVVN
Sbjct  305  DKNMQITVAFNHFGKRLEQRMPRCRFGTIHVVN  337



>ref|XP_008365507.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=396

 Score =   386 bits (991),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 182/258 (71%), Positives = 216/258 (84%), Gaps = 1/258 (0%)
 Frame = -1

Query  772  STRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTV  593
            STRR+L  K+Y+GPC ATNPIDRCWRC  NWAN RK+LA C  GFG K +GGK G +Y V
Sbjct  29   STRRNLRGKQYKGPCKATNPIDRCWRCRANWANNRKKLASCVKGFGRKTRGGKKGAYYIV  88

Query  592  TDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHIS  416
            TD+SD  + +PK GTLRHAVIQ +PLWIIFARSM I+L QEL+V SHKTID RGA VHI+
Sbjct  89   TDSSDDNVHDPKPGTLRHAVIQTQPLWIIFARSMVIRLSQELIVTSHKTIDARGANVHIA  148

Query  415  GGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLD  236
             GAGITLQFV+NVIIHG+R+HD V G GGMIRDS++H G+RT+SDGDGIS++G+++IWLD
Sbjct  149  HGAGITLQFVQNVIIHGLRIHDTVPGSGGMIRDSLSHIGIRTQSDGDGISIYGSSNIWLD  208

Query  235  HLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGK  56
            HLSM  C DG+IDAI+ STAITISN HFT HN+VMLFGA+D    D IMQ+T+AFNHFGK
Sbjct  209  HLSMWNCADGLIDAIQGSTAITISNCHFTHHNDVMLFGASDAFAGDAIMQITVAFNHFGK  268

Query  55   RLVQRMPRCRYGYFHVVN  2
             L+QRMPRCR+G+ HVVN
Sbjct  269  GLIQRMPRCRWGFVHVVN  286



>ref|XP_003519771.2| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=447

 Score =   387 bits (995),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 194/348 (56%), Positives = 245/348 (70%), Gaps = 26/348 (7%)
 Frame = -1

Query  1006  KILSLLFVSLAAIIIPTSLGHISE------------FDDVWQNRKEEAWMHALKTYEPDP  863
             K+ +   ++   +IIPT   ++ E             D  W+ +   A     + Y  DP
Sbjct  3     KMHNFFLLTCLIVIIPTLHANVKEDEIYWKRQSQILNDSYWKQKASVAEKENKQAYTSDP  62

Query  862   SNVTSTLNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPN  683
              ++T  L ++V ++I+  +           + RR+L  K   G C ATNPIDRCWRCDPN
Sbjct  63    YSLTKNLTYSVSEIIVGEQ-----------NGRRNLKGKG--GNCMATNPIDRCWRCDPN  109

Query  682   WANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIF  506
             WAN RK+LA+C  GFG    GGKNG FY VT N D+ + NP  GTLRHAV +  PLWIIF
Sbjct  110   WANNRKKLANCVQGFGRNTVGGKNGPFYVVTSNLDNDMVNPVPGTLRHAVTRTGPLWIIF  169

Query  505   ARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGM  326
             A SM I+L QEL++ S KTIDGRG  V+++GGAGIT+QF+KNVIIHG+++ DI  G+GG+
Sbjct  170   AHSMKIRLNQELIMASDKTIDGRGVDVYLAGGAGITIQFIKNVIIHGVKIFDIQVGNGGL  229

Query  325   IRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTD  146
             I DS NH+GLRT SDGDGIS+FG+++IW+DH+SMRKC DG+IDAI+ STAITISNSHFTD
Sbjct  230   IIDSENHYGLRTMSDGDGISIFGSSNIWIDHVSMRKCKDGLIDAIQGSTAITISNSHFTD  289

Query  145   HNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             HNEVMLFGA+D    D IMQ+T+AFNHFGKRLVQRMPRCRYG+ HVVN
Sbjct  290   HNEVMLFGASDSYDGDTIMQITLAFNHFGKRLVQRMPRCRYGFVHVVN  337



>ref|XP_004514773.1| PREDICTED: probable pectate lyase 3-like [Cicer arietinum]
Length=454

 Score =   387 bits (994),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 194/343 (57%), Positives = 238/343 (69%), Gaps = 25/343 (7%)
 Frame = -1

Query  994  LLFVSLAAIIIPTSLG-----------HISEFDDVWQNRKEEAWMHALKTYEPDPSNVTS  848
            +LF+   A++ PT              H+ EFD  WQ R + A       Y  DP  V+ 
Sbjct  8    ILFLLCLAVLTPTLNANPLEKNEYWEEHVPEFDSYWQERAKVAKEANQAAYFVDPYAVSG  67

Query  847  TLNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKR  668
                 V ++I               S RR L +    G C ATNPIDRCWRCDPNWAN R
Sbjct  68   NFTATVSEII------------AAKSARRSL-RGNNNGTCMATNPIDRCWRCDPNWANNR  114

Query  667  KRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMN  491
            ++LADC  GFG   +GGK G FY VTD SD+ L +PK GTLRHAV +  PLWI FARSM 
Sbjct  115  QKLADCVQGFGRNTRGGKGGPFYVVTDPSDNELLDPKPGTLRHAVTRNGPLWITFARSMV  174

Query  490  IKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSI  311
            I L+QEL++ S KTIDGRG +V+I+ GAGIT+QFVKN+IIHGI++++I   +GGMIRDS 
Sbjct  175  ITLQQELIMSSDKTIDGRGVEVYIANGAGITVQFVKNIIIHGIKIYNIKVKEGGMIRDSE  234

Query  310  NHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVM  131
            +H+G RT+SDGDGIS+FGA+++W+DH+SMR C DG+IDAI  STAITISN HFTDHNEVM
Sbjct  235  SHYGFRTKSDGDGISIFGASNVWIDHVSMRNCTDGLIDAIMGSTAITISNGHFTDHNEVM  294

Query  130  LFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            LFGA+D    DKIMQ+T+AFNHFGKRLVQRMPR R+G+ HVVN
Sbjct  295  LFGASDDYSDDKIMQITLAFNHFGKRLVQRMPRARFGFVHVVN  337



>gb|KHN08706.1| Putative pectate lyase 3 [Glycine soja]
Length=444

 Score =   386 bits (992),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 193/345 (56%), Positives = 243/345 (70%), Gaps = 26/345 (8%)
 Frame = -1

Query  997  SLLFVSLAAIIIPTSLGHISE------------FDDVWQNRKEEAWMHALKTYEPDPSNV  854
            +   ++   +IIPT   ++ E             D  W+ +   A     + Y  DP ++
Sbjct  3    NFFLLTCLIVIIPTLHANVKEDEIYWKRQSQILNDSYWKQKASVAEKENKQAYTSDPYSL  62

Query  853  TSTLNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWAN  674
            T  L ++V ++I+  +           + RR+L  K   G C ATNPIDRCWRCDPNWAN
Sbjct  63   TKNLTYSVSEIIVGEQ-----------NGRRNLKGKG--GNCMATNPIDRCWRCDPNWAN  109

Query  673  KRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARS  497
             RK+LA+C  GFG    GGKNG FY VT N D+ + NP  GTLRHAV +  PLWIIFA S
Sbjct  110  NRKKLANCVQGFGRNTVGGKNGPFYVVTSNLDNDMVNPVPGTLRHAVTRTGPLWIIFAHS  169

Query  496  MNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRD  317
            M I+L QEL++ S KTIDGRG  V+++GGAGIT+QF+KNVIIHG+++ DI  G+GG+I D
Sbjct  170  MKIRLNQELIMASDKTIDGRGVDVYLAGGAGITIQFIKNVIIHGVKIFDIQVGNGGLIID  229

Query  316  SINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNE  137
            S NH+GLRT SDGDGIS+FG+++IW+DH+SMRKC DG+IDAI+ STAITISNSHFTDHNE
Sbjct  230  SENHYGLRTMSDGDGISIFGSSNIWIDHVSMRKCKDGLIDAIQGSTAITISNSHFTDHNE  289

Query  136  VMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            VMLFGA+D    D IMQ+T+AFNHFGKRLVQRMPRCRYG+ HVVN
Sbjct  290  VMLFGASDSYDGDTIMQITLAFNHFGKRLVQRMPRCRYGFVHVVN  334



>emb|CDX81636.1| BnaC08g39650D [Brassica napus]
Length=484

 Score =   387 bits (995),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 195/345 (57%), Positives = 245/345 (71%), Gaps = 12/345 (3%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             M    + I     V L+ I++P    +++ FD+ W+ R+ +A    + +Y+P+P NVT  
Sbjct  1     MAATFLNIGGYTLVFLSVILVPHVQANVAIFDNYWKQRQGDALKQTIASYDPNPLNVTDH  60

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYR---GPCNATNPIDRCWRCDPNWAN  674
             LN++V   +        +    TN+TRR L  ++ +   G C A NPID+CWRCDPNW  
Sbjct  61    LNYHVALAV--------DATESTNNTRRELIGRETQEGSGKCIAYNPIDKCWRCDPNWEK  112

Query  673   KRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARS  497
              RK+L +C LGFG K  GGK+G  Y V D+SD  L NPK GTLRHAV +  PLWIIFA S
Sbjct  113   NRKKLVECVLGFGRKTTGGKDGPIYVVNDSSDEDLVNPKPGTLRHAVTRDGPLWIIFANS  172

Query  496   MNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRD  317
             M IKL+QELM+ S+KTIDGRGA+V+I  GAG+T QFV NVII+ I V  I+ G+GG+IRD
Sbjct  173   MVIKLQQELMITSNKTIDGRGARVYIMEGAGLTQQFVNNVIINNIYVKHIIPGNGGLIRD  232

Query  316   SINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNE  137
             S  H GLRT+SDGDGISLFGAT++W+DH+SM +C DG+IDAIE STA+TISNSHFTDH E
Sbjct  233   SEEHVGLRTKSDGDGISLFGATNVWIDHVSMTRCTDGMIDAIEGSTAVTISNSHFTDHQE  292

Query  136   VMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             VMLFGA D    DK MQ+T+AFNHFGKRL QRMPRCR+G  HVVN
Sbjct  293   VMLFGAKDEHVIDKNMQITVAFNHFGKRLEQRMPRCRFGTIHVVN  337



>ref|XP_002323835.1| hypothetical protein POPTR_0017s11450g [Populus trichocarpa]
 gb|EEF03968.1| hypothetical protein POPTR_0017s11450g [Populus trichocarpa]
Length=452

 Score =   386 bits (992),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 201/336 (60%), Positives = 253/336 (75%), Gaps = 5/336 (1%)
 Frame = -1

Query  994  LLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVIL  815
            L+F    A +IP  L  I+ FD+VWQ R EEA    L +Y P+P + T   N  V   ++
Sbjct  8    LIFAITLATLIPGLLADIAFFDEVWQKRAEEAKKVTLNSYIPNPEDATDDFNFEVNNTLV  67

Query  814  DYRnnnnetete--tNSTRRHL--GKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCS  647
            D+ ++ N+   E   NSTRR+L  GKKKY GPC  TNPID+CWRC  NWA  RKRLA C+
Sbjct  68   DFDDDRNDAGFELHANSTRRNLKQGKKKYLGPCKVTNPIDKCWRCRRNWARNRKRLAKCA  127

Query  646  LGFGYKAKGGKNGDFYTVTDNSDHP-LNPKRGTLRHAVIQIKPLWIIFARSMNIKLKQEL  470
            LGFG +A GG  G  Y VT+NSD   +NPK GTLRHAVIQ  PLWIIF+++MNI+L +EL
Sbjct  128  LGFGRRATGGLKGRVYVVTENSDDDVMNPKPGTLRHAVIQKGPLWIIFSKNMNIRLSKEL  187

Query  469  MVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRT  290
            ++ SHKTIDGRG  +HI+ GAGIT+QF++NVIIHGIR+H IV   GG IRDS+ H+G+RT
Sbjct  188  IMTSHKTIDGRGHHIHIAYGAGITIQFIQNVIIHGIRIHHIVATSGGNIRDSVEHYGIRT  247

Query  289  RSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDH  110
             SDGDGIS+FG+++IW+DH+SM +C DG+IDAI  STAITISNSHFT HN+ +L GA+D 
Sbjct  248  NSDGDGISIFGSSNIWIDHVSMSRCTDGLIDAIMGSTAITISNSHFTHHNDAILLGASDS  307

Query  109  SPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
               D++MQVT+AFNHFG+ LVQRMPRCR+G+FHVVN
Sbjct  308  FSGDELMQVTVAFNHFGQGLVQRMPRCRWGFFHVVN  343



>ref|XP_010463548.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   387 bits (994),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/359 (56%), Positives = 244/359 (68%), Gaps = 25/359 (7%)
 Frame = -1

Query  1006  KILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDP------------  863
             +++ L+ V   A +IPT   +++E D+ W N+  EA  H L  Y PDP            
Sbjct  5     RLVKLVCVICIASLIPTIRANVAETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHY  64

Query  862   ---SNVTSTLNHNVVKVILDYRnnnnetetetNSTRRHLGKK--------KYRGPCNATN  716
                ++V  T     V    D  +    T + TNSTRR L  K        K +GPC A+N
Sbjct  65    DNSTDVEGTEEDKAVDSAED-EDVIEMTSSPTNSTRRSLSGKRRGRGKWSKLKGPCTASN  123

Query  715   PIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTD-NSDHPLNPKRGTLRHA  539
             PID+CWRC P+WA +RKRL  C  GFGY+  GGK G  Y VT    D  +NP+ GTLRHA
Sbjct  124   PIDKCWRCQPDWARRRKRLVRCVRGFGYRTTGGKRGRIYVVTSPRDDDTVNPRPGTLRHA  183

Query  538   VIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIR  359
             VIQ +PLWIIF   M+I+L QELM+ SHKTID RGA VHI+ GAGIT+Q+VKN+IIHG+ 
Sbjct  184   VIQKEPLWIIFKHDMSIRLSQELMIASHKTIDARGANVHIAYGAGITMQYVKNIIIHGLH  243

Query  358   VHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEAST  179
             VH IV   GG+IRDSI+HFG R ++DGDGIS+FGATDIWLDH+SM KC DG+IDAI  ST
Sbjct  244   VHHIVTSSGGLIRDSIDHFGQRGQADGDGISIFGATDIWLDHISMSKCQDGLIDAIMGST  303

Query  178   AITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             AITISNSHFT HN+VML GA DH+  DK MQVT+A+NHFGK LVQRMPR R+G+ HVVN
Sbjct  304   AITISNSHFTHHNDVMLLGAQDHNQDDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVN  362



>ref|XP_009129128.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=457

 Score =   386 bits (992),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 202/338 (60%), Positives = 240/338 (71%), Gaps = 15/338 (4%)
 Frame = -1

Query  994  LLFVSLA-AIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVI  818
            ++FVSL+ AI+ P+   HI+ FDD W  R+  A    +++YEP+P NVT+  N++    +
Sbjct  13   IVFVSLSIAIVAPSVQAHIAVFDDYWTQRQANALRQTMESYEPNPLNVTNHFNYHAALAM  72

Query  817  LDYRnnnnetetetNSTRRHLGK-----KKYRGPCNATNPIDRCWRCDPNWANKRKRLAD  653
                    ET    N TRR LG+     K   G   + N IDRCWR D NWA  RK+LAD
Sbjct  73   --------ETTGADNGTRRELGQVKAGQKARGGRFKSLNAIDRCWRGDKNWAKNRKKLAD  124

Query  652  CSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQ  476
            C LGFG K  GGKNG  Y VTD SD  L +PK GTLRHAV + +PLWIIFAR+M IKL+Q
Sbjct  125  CVLGFGLKTTGGKNGPIYVVTDASDDDLLSPKPGTLRHAVTRDRPLWIIFARTMVIKLQQ  184

Query  475  ELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGL  296
            ELM+ + KTIDGRG  V+I+GGAG TLQFVKNVIIH I +  I  G GG+IRDS  HFGL
Sbjct  185  ELMITNDKTIDGRGVSVYITGGAGFTLQFVKNVIIHNIHMKFIKRGFGGLIRDSEEHFGL  244

Query  295  RTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGAN  116
            RT SDGDGI++FGAT+IW+DH+SMR C DG+IDAI  STAITISNSHFTDH EVMLFGA 
Sbjct  245  RTISDGDGINIFGATNIWIDHVSMRNCSDGMIDAIMGSTAITISNSHFTDHKEVMLFGAK  304

Query  115  DHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            +    DK MQ+T+AFNHFGKRL QRMPR RYG  HVVN
Sbjct  305  NGDEFDKKMQITVAFNHFGKRLNQRMPRVRYGMVHVVN  342



>emb|CDY09356.1| BnaA02g26540D [Brassica napus]
Length=457

 Score =   386 bits (991),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 202/338 (60%), Positives = 240/338 (71%), Gaps = 15/338 (4%)
 Frame = -1

Query  994  LLFVSLA-AIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVI  818
            ++FVSL+ AI+ P+   HI+ FDD W  R+  A    +++YEP+P NVT+  N++    +
Sbjct  13   IVFVSLSIAIVAPSVQAHIAVFDDYWTQRQANALRQTMESYEPNPLNVTNHFNYHAALAM  72

Query  817  LDYRnnnnetetetNSTRRHLGK-----KKYRGPCNATNPIDRCWRCDPNWANKRKRLAD  653
                    ET    N TRR LG+     K   G   + N IDRCWR D NWA  RK+LAD
Sbjct  73   --------ETTGADNGTRRELGQVKAGQKARGGRFKSLNAIDRCWRGDKNWAKNRKKLAD  124

Query  652  CSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQ  476
            C LGFG K  GGKNG  Y VTD SD  L +PK GTLRHAV + +PLWIIFAR+M IKL+Q
Sbjct  125  CVLGFGLKTTGGKNGPIYVVTDASDDDLLSPKPGTLRHAVTRDRPLWIIFARTMVIKLQQ  184

Query  475  ELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGL  296
            ELM+ + KTIDGRG  V+I+GGAG TLQFVKNVIIH I +  I  G GG+IRDS  HFGL
Sbjct  185  ELMITNDKTIDGRGVSVYITGGAGFTLQFVKNVIIHNIHMKFIKRGFGGLIRDSEEHFGL  244

Query  295  RTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGAN  116
            RT SDGDGI++FGAT+IW+DH+SMR C DG+IDAI  STAITISNSHFTDH EVMLFGA 
Sbjct  245  RTISDGDGINIFGATNIWIDHVSMRNCSDGMIDAIMGSTAITISNSHFTDHKEVMLFGAK  304

Query  115  DHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            +    DK MQ+T+AFNHFGKRL QRMPR RYG  HVVN
Sbjct  305  NGDEFDKKMQITVAFNHFGKRLNQRMPRVRYGMVHVVN  342



>ref|XP_008339935.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score =   386 bits (991),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 191/323 (59%), Positives = 236/323 (73%), Gaps = 13/323 (4%)
 Frame = -1

Query  964  IPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnete  785
            +P     + + D  W+ R EEA   A+++Y  +P  VT   N  V K++           
Sbjct  32   VPNEDTLVLDLDAYWKERAEEAEKVAMESYNKNPEKVTEEFNTEVGKLM-----------  80

Query  784  tetNSTRRHL-GKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNG  608
            ++ N+TRR+L G K Y GPC ATNP+D CWRCDPNWAN RK++  C+ GFG K  GGK+G
Sbjct  81   SKENTTRRNLRGNKAYTGPCMATNPMDACWRCDPNWANNRKKIVGCAQGFGKKTTGGKDG  140

Query  607  DFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGA  431
             FY VT  +D  + NPK GTLRHAVIQ  PLWIIF +SM I+L+QELMV S KTID RGA
Sbjct  141  PFYVVTMGTDDDVQNPKPGTLRHAVIQKGPLWIIFTKSMVIRLQQELMVTSDKTIDARGA  200

Query  430  QVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGAT  251
             V I  GAGITLQFVKNVII  + +  IV   GG+IRDS++H GLRT+SDGDGISLFGA+
Sbjct  201  NVVIEEGAGITLQFVKNVIITNLHIKMIVTKPGGLIRDSVDHIGLRTQSDGDGISLFGAS  260

Query  250  DIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAF  71
            ++W+DH+SM +C DG+IDAI  STAITISNSHFTDH+E MLFGAN+   +DKIMQ+T+AF
Sbjct  261  NVWIDHVSMSRCADGLIDAIMGSTAITISNSHFTDHDEAMLFGANNAHTQDKIMQITLAF  320

Query  70   NHFGKRLVQRMPRCRYGYFHVVN  2
            NHFG+ LVQRMPR R+G+FHVVN
Sbjct  321  NHFGQGLVQRMPRVRHGFFHVVN  343



>ref|XP_006477525.1| PREDICTED: pectate lyase-like [Citrus sinensis]
Length=437

 Score =   385 bits (989),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 191/332 (58%), Positives = 235/332 (71%), Gaps = 12/332 (4%)
 Frame = -1

Query  994  LLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVIL  815
            LL +   A I P    +I +FD+VWQ R E A  HAL+ Y P+P  V S+ N +V  +  
Sbjct  9    LLTLFGLASISPILKANIHDFDEVWQKRAENARRHALEAYHPNPEEVVSSFNKHVHMMFE  68

Query  814  DYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFG  635
            +            NSTRR+L  + Y G C ATNPID+CWRCD NWAN RKRLADC+ GFG
Sbjct  69   N-----------GNSTRRYLRGRPYTGRCAATNPIDQCWRCDRNWANNRKRLADCAQGFG  117

Query  634  YKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQS  458
                GGKNG FY VT+ +D  L NPK GTLRHAVIQ +PLWI FA  M I+L +EL++ S
Sbjct  118  RGTIGGKNGPFYVVTNPADDDLVNPKPGTLRHAVIQERPLWITFAHDMVIRLSEELLITS  177

Query  457  HKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDG  278
             KTID RG+ V I  GA IT+QFVKN+IIHG+ +     G GGMIRDS++H+G R+ SDG
Sbjct  178  DKTIDARGSNVQIYNGAQITMQFVKNIIIHGLHIRKTKAGKGGMIRDSVSHYGFRSSSDG  237

Query  277  DGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKD  98
            DGIS+FGA+ IW+DH+SM  C DG+IDA+  STAIT+SNSHFT  + VML GA+D  P+D
Sbjct  238  DGISMFGASHIWIDHVSMSGCQDGLIDAVMGSTAITVSNSHFTHQDHVMLLGASDGHPQD  297

Query  97   KIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             IMQVT+AFNHFGK+LVQRMPR R+G+ HVVN
Sbjct  298  SIMQVTVAFNHFGKQLVQRMPRVRFGFAHVVN  329



>ref|XP_008786760.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=467

 Score =   386 bits (991),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 197/346 (57%), Positives = 242/346 (70%), Gaps = 15/346 (4%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             MEG   K    LF          S  +++E DD WQ + EEA+  +   Y PDP  VT+ 
Sbjct  23    MEGLHTKPSFFLFSLFFLASAALSGANVAELDDHWQKKAEEAFARSRAAYHPDPEGVTNH  82

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHL----GKKKYRGPCNATNPIDRCWRCDPNWA  677
              N  V   +   RN          STRR L      K  +G C A+NPIDRCWRC  +W 
Sbjct  83    FNQAVHLALAQARN----------STRRGLKAVRADKFRQGQCVASNPIDRCWRCQKDWI  132

Query  676   NKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFAR  500
               RK+LA C  GFG  A GG++GDFY VTD SD+ L NPK GTLR  VIQ +PLWIIFAR
Sbjct  133   KDRKKLASCGKGFGRNAVGGRDGDFYVVTDPSDNDLVNPKYGTLRWGVIQDRPLWIIFAR  192

Query  499   SMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIR  320
              M I+L +EL++ S+KTID RGA VHI+ GA I++QFV+NVIIHG+ +HDI  G+GGMIR
Sbjct  193   DMIIRLSEELIINSNKTIDARGANVHIAFGAQISIQFVQNVIIHGLHIHDIKPGNGGMIR  252

Query  319   DSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHN  140
             DS+ H+G RT+SDGDGIS++G++DIW+DH SMR C DG+IDAIEASTAITISN HF  HN
Sbjct  253   DSLRHYGFRTKSDGDGISIYGSSDIWIDHCSMRNCADGLIDAIEASTAITISNCHFARHN  312

Query  139   EVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             +V+LFGA+D + +D IMQVT+AFNHFGK LVQRMPRCR+G+FHVVN
Sbjct  313   DVLLFGASDSNERDSIMQVTVAFNHFGKGLVQRMPRCRWGFFHVVN  358



>emb|CDY39314.1| BnaC05g10650D [Brassica napus]
Length=459

 Score =   385 bits (990),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 193/332 (58%), Positives = 241/332 (73%), Gaps = 2/332 (1%)
 Frame = -1

Query  994  LLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVIL  815
            + F+S  A + P    +I+ FDD W  R+ +A    L +++P P NVT+ LN++V  + L
Sbjct  14   VFFLSSLATLAPQVQANIAVFDDYWTQRQGDALKQTLASFDPYPLNVTNHLNYHVA-LAL  72

Query  814  DYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFG  635
            D   + N T  E +  RR    +  RG C A NPID+CWRCD +W   RK+LA C+LGFG
Sbjct  73   DTTGSINSTRRELSQARRGRKMQNRRGKCVAHNPIDKCWRCDRDWEKNRKKLAVCALGFG  132

Query  634  YKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQS  458
             +  GGK+G  Y VTD SD  L +P+ GTLRHAV +  PLWIIFARSM IKL+QELM+ S
Sbjct  133  RRTSGGKDGPIYVVTDASDDELISPRPGTLRHAVTRDGPLWIIFARSMVIKLQQELMMTS  192

Query  457  HKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDG  278
             KTIDGRGA+V+I GG+G+TLQFV NVI+H I +  IV  +GG+IRDS  H GLRTRSDG
Sbjct  193  DKTIDGRGARVYIMGGSGLTLQFVNNVIVHNIYIKQIVPANGGLIRDSEQHIGLRTRSDG  252

Query  277  DGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKD  98
            DGI+LFGAT++W+DH+SM +C DG+IDAI  STA+T+SNSHFTDH EVMLFGAND    D
Sbjct  253  DGINLFGATNVWIDHVSMTRCSDGMIDAILGSTAVTVSNSHFTDHQEVMLFGANDKHEID  312

Query  97   KIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            K MQ+T+AFNHFGKRL QRMPR R+G  HVVN
Sbjct  313  KKMQITVAFNHFGKRLEQRMPRVRFGTIHVVN  344



>ref|XP_004490004.1| PREDICTED: probable pectate lyase 3-like isoform X2 [Cicer arietinum]
Length=376

 Score =   383 bits (983),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 180/256 (70%), Positives = 213/256 (83%), Gaps = 1/256 (0%)
 Frame = -1

Query  766  RRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTD  587
            RR+L  +K  GPC ATNPIDRCWRCDPNWAN RK+LADC  GFG K  GGK G FY VTD
Sbjct  11   RRNLRGRKTAGPCMATNPIDRCWRCDPNWANNRKKLADCVQGFGRKTTGGKAGPFYVVTD  70

Query  586  NSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGG  410
             SD  + NP+ GTLRHAV +  PLWIIFARSMNI+L QEL++ S KTIDGRGA + I+ G
Sbjct  71   PSDSDMVNPRPGTLRHAVTRNGPLWIIFARSMNIRLNQELIMTSDKTIDGRGADIVIANG  130

Query  409  AGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHL  230
            AGIT+Q+++NVIIHGI+V DIV G GG++RDS NH+GLRT SDGDGIS+FG+++IW+DH+
Sbjct  131  AGITIQYIRNVIIHGIKVFDIVVGSGGLVRDSENHYGLRTMSDGDGISIFGSSNIWIDHV  190

Query  229  SMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRL  50
            SMR C DG+IDAI  STAITISNSHFTDHNEVMLFGA+D    D+ MQ+T+AFNHFGKRL
Sbjct  191  SMRNCRDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDGYDADQKMQITVAFNHFGKRL  250

Query  49   VQRMPRCRYGYFHVVN  2
            +QRMPRCR+G+ HVVN
Sbjct  251  IQRMPRCRFGFIHVVN  266



>ref|XP_006826355.1| hypothetical protein AMTR_s00004p00123190 [Amborella trichopoda]
 gb|ERM93592.1| hypothetical protein AMTR_s00004p00123190 [Amborella trichopoda]
Length=479

 Score =   386 bits (992),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 187/311 (60%), Positives = 231/311 (74%), Gaps = 13/311 (4%)
 Frame = -1

Query  931  DDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNSTRRHLG  752
            D V + R  ++W+ A   YEPDP  V+  L H V           +      N  RR LG
Sbjct  75   DSVLEARAHQSWLEAQAAYEPDPEAVSRNLTHLV-----------HMELPSGNHMRRQLG  123

Query  751  KKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHP  572
            ++ + GPC ATNPIDRCWRCD  W   RK+LADC++GFG +A GGK G +Y VTD SD+ 
Sbjct  124  RR-WHGPCVATNPIDRCWRCDQKWHTNRKKLADCAMGFGQQALGGKYGRYYVVTDPSDND  182

Query  571  L-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITL  395
            L NPK GTLRHAVIQ +PLWIIF R M IKL +ELMV S KT+DGRGA VHI+ GA IT+
Sbjct  183  LLNPKPGTLRHAVIQNEPLWIIFQRDMVIKLTEELMVNSFKTVDGRGANVHIAYGACITI  242

Query  394  QFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKC  215
            Q+VKNVIIHG+ +HD   G+GGMIRDS +HFG+RTRSDGDGIS++G+T++W+DH ++ KC
Sbjct  243  QYVKNVIIHGLHIHDCKAGNGGMIRDSEDHFGIRTRSDGDGISIYGSTNVWVDHNTLSKC  302

Query  214  DDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMP  35
             DG++DAI  STAITISN+HF+ H+EV+L G +D  P DK+MQVT+AFNHFGK L QRMP
Sbjct  303  QDGLVDAIMGSTAITISNNHFSKHDEVLLLGGSDLYPMDKVMQVTVAFNHFGKGLSQRMP  362

Query  34   RCRYGYFHVVN  2
            RCR+GYFHVVN
Sbjct  363  RCRFGYFHVVN  373



>ref|XP_010513594.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   386 bits (991),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 199/359 (55%), Positives = 244/359 (68%), Gaps = 25/359 (7%)
 Frame = -1

Query  1006  KILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDP------------  863
             +++ L+ V   A +IPT L +++E D+ W N+  EA  H L  Y PDP            
Sbjct  5     RLVKLVCVICIASLIPTILANVAETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHY  64

Query  862   ---SNVTSTLNHNVVKVILDYRnnnnetetetNSTRRHLGKK--------KYRGPCNATN  716
                ++V  T     V    D  +    T + TNSTRR L  K        K +GPC A+N
Sbjct  65    DNSTDVEGTEEDKAVDSTED-EDVIEMTSSPTNSTRRSLSGKRRGRGKWSKLKGPCTASN  123

Query  715   PIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTD-NSDHPLNPKRGTLRHA  539
             PID+CWRC P+WA +RKRL  C  GFGY+  GGK G  Y VT    D  +NP+ GTLRHA
Sbjct  124   PIDKCWRCQPDWARRRKRLVRCVRGFGYRTTGGKRGRIYVVTSPRDDDTVNPRPGTLRHA  183

Query  538   VIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIR  359
             VIQ +PLWIIF   M+I+L QELM+ SHKTID RGA VHI+ GAGIT+Q+V N+IIHG+ 
Sbjct  184   VIQKEPLWIIFKHDMSIRLSQELMIASHKTIDARGANVHIAYGAGITMQYVHNIIIHGLH  243

Query  358   VHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEAST  179
             VH IV   GG+IRDSI+HFG R ++DGDGIS+FGAT+IWLDH+SM KC DG+IDAI  ST
Sbjct  244   VHHIVSSSGGLIRDSIDHFGQRGQADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGST  303

Query  178   AITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             AITISNSHFT HN+VML GA DH+  DK MQVT+A+NHFGK LVQRMPR R+G+ HVVN
Sbjct  304   AITISNSHFTHHNDVMLLGAQDHNQDDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVN  362



>ref|XP_010105747.1| putative pectate lyase P59 [Morus notabilis]
 gb|EXC05967.1| putative pectate lyase P59 [Morus notabilis]
Length=421

 Score =   384 bits (985),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 205/319 (64%), Positives = 241/319 (76%), Gaps = 14/319 (4%)
 Frame = -1

Query  949  GHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNS  770
             HI+EFDD W++R E+A   AL+ Y P P  VT+ LN++V + +           T  NS
Sbjct  4    AHIAEFDDYWKSRAEQAQKDALQAYHPHPEEVTNQLNYDVEEAL-----------TVKNS  52

Query  769  TRRHLGKKKYR--GPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYT  596
            TRR L  KK +  GPC ATNPIDRCWRCDPNWA+ RKRLADC+ GFG  + GGK G +Y 
Sbjct  53   TRRVLRGKKNKKGGPCMATNPIDRCWRCDPNWASNRKRLADCARGFGRNSVGGKFGRYYV  112

Query  595  VTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHI  419
            VTD+SD  L NPK GTLRHAVIQ  PLWIIFARSM I+L +EL++   KTIDGRGA V I
Sbjct  113  VTDSSDTDLVNPKPGTLRHAVIQKAPLWIIFARSMIIRLSEELIMTGDKTIDGRGANVRI  172

Query  418  SGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWL  239
            + GAGIT+QFVKNVIIH I +HDI  G GG IRDSINH G RT+SDGDGIS+FG++ IW+
Sbjct  173  AYGAGITIQFVKNVIIHNIHIHDINAGSGGNIRDSINHIGFRTKSDGDGISIFGSSHIWI  232

Query  238  DHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFG  59
            DH+SM  C DG+IDAI  STAITISN HFT HNEVMLFGA+D    D+ MQVT+AFNHFG
Sbjct  233  DHVSMSNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDSYSDDQRMQVTVAFNHFG  292

Query  58   KRLVQRMPRCRYGYFHVVN  2
            + LVQRMPRCR+G+FHVVN
Sbjct  293  QGLVQRMPRCRWGFFHVVN  311



>ref|XP_004951474.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=440

 Score =   384 bits (987),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 184/315 (58%), Positives = 232/315 (74%), Gaps = 18/315 (6%)
 Frame = -1

Query  937  EFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNSTRRH  758
            ++D+ WQ R+E A   A + Y+PDP NVT++ N  V +               + S RR 
Sbjct  33   DWDEHWQKRRELAEASAREAYKPDPFNVTNSFNAAVHR---------------STSPRRE  77

Query  757  L--GKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDN  584
            +   KKK  GPC ATNPID+CWRC  NWA  R+RLA C+ GFG  A GG  G  Y VTD 
Sbjct  78   MREKKKKSNGPCRATNPIDKCWRCRKNWATDRQRLARCARGFGRAATGGLGGKIYVVTDP  137

Query  583  SDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGA  407
            +D  + NP+ GTLR   IQ  PLWIIFARSM I+L QEL+V S KTIDGRGAQVHI+ G 
Sbjct  138  TDADVVNPRPGTLRWGAIQPGPLWIIFARSMIIQLSQELLVSSDKTIDGRGAQVHIANGG  197

Query  406  GITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLS  227
            GIT+QF +NVIIHG+ VHD+ H DGG++RDS  H G RT++DGDGISLFGATD+W+DH+S
Sbjct  198  GITVQFARNVIIHGLHVHDVKHTDGGLMRDSPTHMGPRTKADGDGISLFGATDVWIDHIS  257

Query  226  MRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLV  47
            M  C+DG+ID +++ST +TISN HFT+HN+VMLFGA+D  P+D++MQ+T+AFNHFG+ LV
Sbjct  258  MSNCEDGLIDVVQSSTGVTISNCHFTNHNDVMLFGASDSYPQDQVMQITVAFNHFGRGLV  317

Query  46   QRMPRCRYGYFHVVN  2
            QRMPRCR+G+FHVVN
Sbjct  318  QRMPRCRWGFFHVVN  332



>gb|KHN13652.1| Pectate lyase [Glycine soja]
Length=440

 Score =   384 bits (986),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 188/334 (56%), Positives = 245/334 (73%), Gaps = 12/334 (4%)
 Frame = -1

Query  1000 LSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKV  821
            ++ +F+   AI IP     I+EFDD  + + +EA   AL++YEPDP NVT+  N +V + 
Sbjct  8    VTFIFLVAFAISIPCLEAGIAEFDDFLKAQADEAHEIALRSYEPDPINVTAEFNIHVHRA  67

Query  820  ILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLG  641
            +++          E+N TRR L K+KYRGPC ATNPIDRCWRC  +WA  R RLA C  G
Sbjct  68   LME----------ESNDTRREL-KQKYRGPCLATNPIDRCWRCRKDWAQDRYRLASCGKG  116

Query  640  FGYKAKGGKNGDFYTVTDNSD-HPLNPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMV  464
            FG +A GG +G  Y VTD+SD  P+NP+ GTLR+ V+Q +PLWIIFA+SM I LK EL++
Sbjct  117  FGRRAVGGLHGKIYVVTDSSDDEPINPRPGTLRYGVLQREPLWIIFAQSMVITLKFELLI  176

Query  463  QSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRS  284
             S KTIDGRGA V I GGAG+ +QFV N+IIHGIR++ I   +G M+RD  NH G+RTR 
Sbjct  177  SSDKTIDGRGANVVIKGGAGLAMQFVNNIIIHGIRINKIKSMEGTMLRDLWNHVGIRTRC  236

Query  283  DGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSP  104
            DGD +S+FG+++IWLDHLS+ +C+DG+ID ++ ST ITISN H T HN+VMLFGA+D   
Sbjct  237  DGDAVSIFGSSNIWLDHLSLSECEDGLIDIVQGSTGITISNCHMTKHNDVMLFGASDTYA  296

Query  103  KDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             DKIMQVT+AFNHFG+ L+QRMPRCR+G+ HV+N
Sbjct  297  GDKIMQVTVAFNHFGQGLIQRMPRCRWGFVHVIN  330



>ref|XP_003552513.1| PREDICTED: pectate lyase-like [Glycine max]
Length=440

 Score =   384 bits (986),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 188/334 (56%), Positives = 245/334 (73%), Gaps = 12/334 (4%)
 Frame = -1

Query  1000 LSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKV  821
            ++ +F+   AI IP     I+EFDD  + + +EA   AL++YEPDP NVT+  N +V + 
Sbjct  8    VTFIFLVAFAISIPCLEAGIAEFDDFLKAQADEAHEIALRSYEPDPINVTAEFNIHVHRA  67

Query  820  ILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLG  641
            +++          E+N TRR L K+KYRGPC ATNPIDRCWRC  +WA  R RLA C  G
Sbjct  68   LME----------ESNDTRREL-KQKYRGPCLATNPIDRCWRCRKDWAQDRYRLASCGKG  116

Query  640  FGYKAKGGKNGDFYTVTDNSD-HPLNPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMV  464
            FG +A GG +G  Y VTD+SD  P+NP+ GTLR+ V+Q +PLWIIFA+SM I LK EL++
Sbjct  117  FGRRAVGGLHGKIYVVTDSSDDEPINPRPGTLRYGVLQREPLWIIFAQSMVITLKFELLI  176

Query  463  QSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRS  284
             S KTIDGRGA V I GGAG+ +QFV N+IIHGIR++ I   +G M+RD  NH G+RTR 
Sbjct  177  SSDKTIDGRGANVVIKGGAGLAMQFVNNIIIHGIRINKIKSMEGTMLRDLWNHVGIRTRC  236

Query  283  DGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSP  104
            DGD +S+FG+++IWLDHLS+ +C+DG+ID ++ ST ITISN H T HN+VMLFGA+D   
Sbjct  237  DGDAVSIFGSSNIWLDHLSLSECEDGLIDIVQGSTGITISNCHMTKHNDVMLFGASDTYA  296

Query  103  KDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             DKIMQVT+AFNHFG+ L+QRMPRCR+G+ HV+N
Sbjct  297  GDKIMQVTVAFNHFGQGLIQRMPRCRWGFVHVIN  330



>ref|XP_010514040.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   384 bits (986),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 197/338 (58%), Positives = 243/338 (72%), Gaps = 15/338 (4%)
 Frame = -1

Query  994  LLFVSLA-AIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVI  818
            ++FVSL+ A+++PT   H++E+D+ W  R+ EA    L++Y+P+P NVT   N++    +
Sbjct  9    IVFVSLSLAVVVPTVHAHVAEYDEYWTQRQTEALHQTLESYDPEPLNVTDHFNYHAALAM  68

Query  817  LDYRnnnnetetetNSTRRHL-----GKKKYRGPCNATNPIDRCWRCDPNWANKRKRLAD  653
                    ET    N TRR L     GKK+  G   + N ID+CWR D NW   RK+LAD
Sbjct  69   --------ETTGIANETRRDLRQVKSGKKRRGGRYESLNAIDKCWRGDKNWDKNRKKLAD  120

Query  652  CSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQ  476
            C LGFG K  GGKNG  Y VTD SD+ L NPK GTLRHAV + +PLWIIFAR M IKL+Q
Sbjct  121  CVLGFGRKTTGGKNGPIYVVTDPSDNDLLNPKPGTLRHAVTRDRPLWIIFARHMIIKLQQ  180

Query  475  ELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGL  296
            EL++ + KTIDGRG  V+I+GGAG+TLQ+V+NVIIH I +  I  G GG+IRDS +HFGL
Sbjct  181  ELIITNDKTIDGRGVSVYITGGAGLTLQYVRNVIIHNIYIKQIKKGPGGLIRDSEHHFGL  240

Query  295  RTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGAN  116
            RT SDGDGIS+FGAT+IW+DH+SM  C DG+IDAI  STAITISNSHFTDH+EVMLFG  
Sbjct  241  RTMSDGDGISIFGATNIWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGK  300

Query  115  DHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            +    DK MQ+T+AFNHFGKRL QRMPR RYG  HVVN
Sbjct  301  NTDVIDKKMQITVAFNHFGKRLKQRMPRARYGLVHVVN  338



>ref|XP_008366366.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=479

 Score =   384 bits (987),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 176/257 (68%), Positives = 215/257 (84%), Gaps = 2/257 (1%)
 Frame = -1

Query  769  TRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVT  590
            TRR+L K+KY+GPC ATNPIDRCWRCDPNW   RK+LADC+ GFG+K  GGK G  Y VT
Sbjct  116  TRRNL-KQKYKGPCLATNPIDRCWRCDPNWETNRKKLADCAKGFGHKTTGGKAGKIYVVT  174

Query  589  DNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISG  413
            DNSD+ + NPK GTLRHAVIQ  PLWIIFAR M IKL++ELMV S KTID RGA VHI  
Sbjct  175  DNSDNDMVNPKPGTLRHAVIQTGPLWIIFARDMRIKLREELMVTSDKTIDARGANVHIED  234

Query  412  GAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDH  233
            GA ITLQFV NVIIH + +HD   G+GGMIRDS+NH+G RTRSDGDGIS++GA+++W+DH
Sbjct  235  GAQITLQFVXNVIIHNLHIHDTKPGNGGMIRDSVNHYGQRTRSDGDGISMYGASNVWIDH  294

Query  232  LSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKR  53
            +S   C DG++DAI+ STAITISN HFT+HN+VMLFG++D + +D++MQ+T+AFNHFG+ 
Sbjct  295  VSGSNCADGLVDAIQGSTAITISNCHFTNHNDVMLFGSSDSNSQDEVMQITLAFNHFGQG  354

Query  52   LVQRMPRCRYGYFHVVN  2
            L+QRMPRCR+G+FHVVN
Sbjct  355  LIQRMPRCRWGFFHVVN  371



>ref|XP_009360393.1| PREDICTED: probable pectate lyase 3 [Pyrus x bretschneideri]
Length=452

 Score =   384 bits (985),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 188/316 (59%), Positives = 235/316 (74%), Gaps = 13/316 (4%)
 Frame = -1

Query  943  ISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNSTR  764
            + + D  W+ R +EA   A+++Y  +P       +  V +++           ++ N+TR
Sbjct  39   VLDLDAYWKERAQEALKEAMESYHKNPEQAAEEFHTGVAELL-----------SKENTTR  87

Query  763  RHL-GKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTD  587
            R+L G K Y GPC ATNPID CWRCD NWAN RK++  C+ GFG KA GGK+G  Y VT 
Sbjct  88   RNLRGNKGYNGPCMATNPIDACWRCDANWANNRKKIVGCAQGFGKKATGGKDGPIYVVTV  147

Query  586  NSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGG  410
             +D+ + NPK GTLRHAVIQ  PLWIIFARSM I+L+QELMV S KTIDGRGA V I  G
Sbjct  148  GTDNDVQNPKPGTLRHAVIQKGPLWIIFARSMVIRLEQELMVTSDKTIDGRGANVVIEEG  207

Query  409  AGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHL  230
             GITLQFVKNVII  + +  IV   GGMIRDS++H GLRT+SDGDGISLFGA+++W+DH+
Sbjct  208  GGITLQFVKNVIITNLHIKMIVSKPGGMIRDSVDHMGLRTKSDGDGISLFGASNVWIDHV  267

Query  229  SMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRL  50
            SM +C DG+IDA+ ASTAITISNSHFTDH++VMLFGAN+   +DKIMQ+T+AFNHFG+ L
Sbjct  268  SMSRCADGLIDAVMASTAITISNSHFTDHDDVMLFGANNAHTQDKIMQITLAFNHFGQGL  327

Query  49   VQRMPRCRYGYFHVVN  2
            VQRMPR R+G+FHVVN
Sbjct  328  VQRMPRVRHGFFHVVN  343



>ref|XP_007157384.1| hypothetical protein PHAVU_002G065800g [Phaseolus vulgaris]
 gb|ESW29378.1| hypothetical protein PHAVU_002G065800g [Phaseolus vulgaris]
Length=448

 Score =   383 bits (984),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 192/347 (55%), Positives = 239/347 (69%), Gaps = 23/347 (7%)
 Frame = -1

Query  1006  KILSLLFVSLAAIIIPTSLGHISE-----------FDDVWQNRKEEAWMHALKTYEPDPS  860
             K+ S+  ++   + IPT   ++ E           FD  W+ RK+ A     + Y  DP 
Sbjct  3     KLCSIFLLTCLVVTIPTFYANVLEDEEFLDNQTKSFDGYWKGRKQVAEKQNQEAYITDPY  62

Query  859   NVTSTLNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNW  680
             + T  + +N+  +I           T     RR+L  K+ +  C ATNPIDRCWRCDP W
Sbjct  63    SFTINMTNNISDLI-----------TGEEKGRRNLAGKQSQDSCLATNPIDRCWRCDPKW  111

Query  679   ANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFA  503
             +  RK+LADC  GFG    GGK G FY VT N D+ + NP  GTLRHAV +  PLWIIFA
Sbjct  112   SENRKKLADCVQGFGRDTIGGKKGPFYVVTSNLDNDMVNPVPGTLRHAVTRNGPLWIIFA  171

Query  502   RSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMI  323
              SMNI+L QEL+V   KTIDGRGA ++I  GAG T+QFVKNVIIHGI++ DI  G GG+I
Sbjct  172   HSMNIRLSQELIVAGDKTIDGRGADIYIVNGAGFTIQFVKNVIIHGIKIFDINAGQGGLI  231

Query  322   RDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDH  143
             RDS +H+GLRT+SDGDGIS+FG++ IW+DH+SMR   DG+IDAI+ STAITISNSHFTDH
Sbjct  232   RDSESHYGLRTQSDGDGISIFGSSYIWIDHVSMRNARDGLIDAIQGSTAITISNSHFTDH  291

Query  142   NEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             NEVMLFGA+D   +DKIMQ+T+ FNHFGKRLVQRMPRCR+G+ HVVN
Sbjct  292   NEVMLFGASDSHEEDKIMQITLVFNHFGKRLVQRMPRCRFGFIHVVN  338



>ref|XP_002272638.2| PREDICTED: pectate lyase-like [Vitis vinifera]
Length=434

 Score =   383 bits (983),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 201/342 (59%), Positives = 244/342 (71%), Gaps = 17/342 (5%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             ME   ++++ L+      +I+P    +I +FD+VWQ R EEA   AL+ Y P P  VT  
Sbjct  1     MEAVNMRLVILIPF---LVIVPAVTANIGDFDEVWQTRAEEARKAALQAYNPHPEKVTDN  57

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRK  665
              N  V K               TN TRR+L   K+ G C ATNPIDRCWRC  +WA+ R 
Sbjct  58    FNKKVHKSF-----------DSTNHTRRNL--SKFSGLCMATNPIDRCWRCRSDWASNRM  104

Query  664   RLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNI  488
             +LADC LGFG K  GGK G  Y VTD SD+ + NPK GTLRHA IQ +PLWIIFA SM I
Sbjct  105   KLADCVLGFGQKTTGGKGGKIYVVTDPSDNDMVNPKPGTLRHAAIQEEPLWIIFAHSMAI  164

Query  487   KLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSIN  308
             +L +EL++ S+KTID RGA VHI+ GAG+TLQFV N+IIHG+ +HDI  G+GG+IRDS +
Sbjct  165   RLNEELIMTSNKTIDARGANVHIANGAGLTLQFVHNIIIHGLHIHDIKVGNGGLIRDSAS  224

Query  307   HFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVML  128
             H+G RTRSDGDGIS+FGAT+IW+DH+SM  C DG+IDAI ASTAITISN HFT HNEVML
Sbjct  225   HYGFRTRSDGDGISIFGATNIWIDHISMSNCADGLIDAIMASTAITISNCHFTHHNEVML  284

Query  127   FGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             FGA+D    D IMQ+TI FNHFG+ L QRMPRCR+G+FHVVN
Sbjct  285   FGASDGYSGDAIMQITITFNHFGQGLTQRMPRCRWGFFHVVN  326



>ref|XP_006573090.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=448

 Score =   383 bits (984),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 189/349 (54%), Positives = 236/349 (68%), Gaps = 27/349 (8%)
 Frame = -1

Query  1006  KILSLLFVSLAAIIIPTSLGHISE-------------FDDVWQNRKEEAWMHALKTYEPD  866
             KI +   ++   ++IPT   ++ E              D  WQ R   A     + Y  D
Sbjct  3     KIHNFYLLTCLVVMIPTLYANVKEDEAYWKRQSEVLLVDSYWQERASIAEKENQQAYTSD  62

Query  865   PSNVTSTLNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDP  686
             P ++T  L  +V ++I+  ++                        C ATNPIDRCWRCDP
Sbjct  63    PYSLTKNLTFSVSEIIIGEKSGRRNLRGRGGK-------------CMATNPIDRCWRCDP  109

Query  685   NWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWII  509
             NWAN RK+LADC  GFG    GGKNG FY V  + D+ + NP  GTLRHAV +  PLWII
Sbjct  110   NWANNRKKLADCVQGFGRNTIGGKNGPFYVVNSSLDNDMVNPAPGTLRHAVTRSGPLWII  169

Query  508   FARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGG  329
             FARSMNI+L QEL++ S KTIDGRG  V+I+ GAGIT+QF+KNVIIHGI++ +I  G+GG
Sbjct  170   FARSMNIRLSQELIMTSDKTIDGRGVDVYIANGAGITIQFIKNVIIHGIKIFNIQVGNGG  229

Query  328   MIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFT  149
             +IRDS  H+G RT SDGDGIS+FG++++W+DH+SMR C DG+IDAI+ STAITISN HFT
Sbjct  230   LIRDSETHYGFRTYSDGDGISIFGSSNVWIDHVSMRNCKDGLIDAIQGSTAITISNGHFT  289

Query  148   DHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             DHNEVMLFGA+D    DKIMQ+T+AFNHFGKRLVQRMPRCRYG+ HVVN
Sbjct  290   DHNEVMLFGASDSYDGDKIMQITLAFNHFGKRLVQRMPRCRYGFVHVVN  338



>ref|XP_006439649.1| hypothetical protein CICLE_v10020193mg [Citrus clementina]
 gb|ESR52889.1| hypothetical protein CICLE_v10020193mg [Citrus clementina]
Length=437

 Score =   382 bits (982),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 189/332 (57%), Positives = 233/332 (70%), Gaps = 12/332 (4%)
 Frame = -1

Query  994  LLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVIL  815
            LL +   A I P    +  +FD+VWQ R E A  HAL+ Y P+P  V S+ N +V  +  
Sbjct  9    LLTLFGLASISPILKANTHDFDEVWQKRAENARRHALEAYHPNPEEVVSSFNKHVHMMFE  68

Query  814  DYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFG  635
            +            +STRR+L  + Y G C ATNPID+CWRCD NWAN RKRLADC+ GFG
Sbjct  69   N-----------GSSTRRYLRGRPYTGRCAATNPIDQCWRCDRNWANNRKRLADCAQGFG  117

Query  634  YKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQS  458
                GGKNG FY VT+ +D  L NPK GTLRHAVIQ +PLWI FA  M I+L +EL++ S
Sbjct  118  RGTIGGKNGPFYVVTNPADDDLVNPKPGTLRHAVIQERPLWITFAHDMVIRLSEELLITS  177

Query  457  HKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDG  278
             KTID RG+ V I  GA IT+QFVKN+IIHG+ +     G GGMIRDS++H G R+ SDG
Sbjct  178  DKTIDARGSNVQIYNGAQITMQFVKNIIIHGLHIRKTKAGKGGMIRDSVSHHGFRSSSDG  237

Query  277  DGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKD  98
            DGIS+FGA+ IW+DH+SM  C DG+IDA+  STAIT+SNSHFT  + VML GA+D  P+D
Sbjct  238  DGISMFGASHIWIDHVSMSGCQDGLIDAVMGSTAITVSNSHFTHQDHVMLLGASDSHPQD  297

Query  97   KIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             IMQVT+AFNHFGK+LVQRMPR R+G+ HVVN
Sbjct  298  SIMQVTVAFNHFGKQLVQRMPRVRFGFAHVVN  329



>ref|XP_008230729.1| PREDICTED: pectate lyase [Prunus mume]
Length=452

 Score =   383 bits (983),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 200/343 (58%), Positives = 256/343 (75%), Gaps = 12/343 (3%)
 Frame = -1

Query  1006  KILSLLFVSLAAIIIPTSLGHIS------EFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             K+  +LF+    I++P+    I+      +FD VW+ R+ +A   ALK Y+ +P  VT  
Sbjct  4     KLDLVLFMISFCILVPSLRASIANDSNVGQFDAVWKERELKAEKTALKAYQRNPEKVTDD  63

Query  844   LNHNVVKVI-LDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKR  668
              N +V +V  L++ +++  +      T RHL  KKY+GPC ATNPIDRCWRC  +WAN R
Sbjct  64    FNESVQEVDDLNFEDDDQVSNI----TGRHLLGKKYKGPCKATNPIDRCWRCRKDWANDR  119

Query  667   KRLADCSLGFGYKAKGGKNGDFYTVTDNSD-HPLNPKRGTLRHAVIQIKPLWIIFARSMN  491
             K+LA+C  GFG + +GGK G+FY VTD SD + + PK GTLRHAVIQ +PLWIIFARSM 
Sbjct  120   KKLANCVKGFGRRTRGGKRGEFYVVTDPSDSNVVEPKPGTLRHAVIQPQPLWIIFARSMT  179

Query  490   IKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSI  311
             I+L QEL++ SHKTID RGA VHI+ GAG+TLQFV+NVIIHG+ +HDIV G GG IRDS+
Sbjct  180   IRLTQELIMTSHKTIDARGANVHIAHGAGLTLQFVQNVIIHGLHIHDIVPGSGGTIRDSV  239

Query  310   NHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVM  131
             +HFG RT+SDGDGIS+FG++ +WLDHLSM  C DG+ID I+ STA+TISN HFT HN+V+
Sbjct  240   DHFGTRTQSDGDGISIFGSSHVWLDHLSMWNCADGLIDVIQGSTAVTISNCHFTRHNDVL  299

Query  130   LFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             LFGA+D    D IMQ+T+AFNHFGK LVQRMPRCR+G+ HVVN
Sbjct  300   LFGASDSFAGDAIMQITVAFNHFGKGLVQRMPRCRWGFIHVVN  342



>ref|XP_009148818.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=458

 Score =   383 bits (984),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 202/351 (58%), Positives = 247/351 (70%), Gaps = 18/351 (5%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLA---AIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNV  854
             M    + I S +FV L    A + P    +I+ FDD W  R+ +A    L +++P P NV
Sbjct  1     MAAAFLNIGSYIFVFLLSSLATLAPQVQANIAVFDDYWTQRQGDALKQTLASFDPYPLNV  60

Query  853   TSTLNHNVVKVILDYRnnnnetetetNSTRRHLG------KKKYRGPCNATNPIDRCWRC  692
             T+ LN++V  + LD       T   TNSTRR L       K + RG C A NPID+CWRC
Sbjct  61    TNHLNYHVA-LALD-------TTESTNSTRRELSQARRGRKMQNRGKCVAHNPIDKCWRC  112

Query  691   DPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLW  515
             D +W   RK+LA C+LGFG +  GGK+G  Y VTD SD  L +P+ GTLRHAV +  PLW
Sbjct  113   DRDWEKNRKKLAVCALGFGRRTTGGKDGPIYVVTDASDDELISPRPGTLRHAVTRDGPLW  172

Query  514   IIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGD  335
             IIFARSM IKL+QELM+ S KTIDGRGA+V+I GG+G+TLQFV NVIIH I +  IV  +
Sbjct  173   IIFARSMVIKLQQELMMTSDKTIDGRGARVYIMGGSGLTLQFVNNVIIHNIYIKQIVPAN  232

Query  334   GGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSH  155
             GG+IRDS  H GLRTRSDGDGI+LFGAT++W+DH+SM +C DG+IDAI  STA+T+SNSH
Sbjct  233   GGLIRDSEQHIGLRTRSDGDGINLFGATNVWIDHVSMTRCSDGMIDAILGSTAVTVSNSH  292

Query  154   FTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             FTDH EVMLFGAND    DK MQ+T+AFNHFGKRL QRMPR R+G  HVVN
Sbjct  293   FTDHQEVMLFGANDKHEIDKKMQITVAFNHFGKRLEQRMPRVRFGTIHVVN  343



>ref|XP_007137422.1| hypothetical protein PHAVU_009G125800g [Phaseolus vulgaris]
 gb|ESW09416.1| hypothetical protein PHAVU_009G125800g [Phaseolus vulgaris]
Length=439

 Score =   382 bits (982),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 196/344 (57%), Positives = 239/344 (69%), Gaps = 17/344 (5%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             M G   K++  L V+LA I IP     I+EFDD  + + E+A   AL++Y P P  V S 
Sbjct  1     MAGSASKVVFSLLVTLA-ITIPCLEAGIAEFDDFLKAQSEKAHKIALESYVPTPEFVASE  59

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHL--GKKKYRGPCNATNPIDRCWRCDPNWANK  671
             LN++V   +L+             STRR L  G      PC+++NPID CWRC+ +WAN 
Sbjct  60    LNYHVHLSMLN-------------STRRGLKAGNNDAGAPCDSSNPIDNCWRCNKDWAND  106

Query  670   RKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSM  494
             R RLA C  GFG +A GG  G  Y VTDNSD  + NPK GTLR+ V Q  PLWI FARSM
Sbjct  107   RYRLAKCGKGFGRRAVGGLGGPIYVVTDNSDEDMVNPKEGTLRYGVTQKGPLWITFARSM  166

Query  493   NIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDS  314
              I L+QEL++ S KTIDGRGA V I  GAG+T+QFV NVIIHGIRV +IV  +GGMIRDS
Sbjct  167   IITLQQELLISSDKTIDGRGANVQIRDGAGLTMQFVNNVIIHGIRVKNIVSKEGGMIRDS  226

Query  313   INHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEV  134
              NH GLRTRSDGD IS+FGA++IW+DH+S+   DDG+ID I+ STAITISN H T HN+V
Sbjct  227   YNHVGLRTRSDGDAISVFGASNIWIDHVSLSNSDDGLIDVIQGSTAITISNCHMTRHNDV  286

Query  133   MLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             MLFGA D    DKIMQ+T+AFNHFG+ L+QRMPRCR G+FHV+N
Sbjct  287   MLFGATDTYSGDKIMQITVAFNHFGQGLIQRMPRCRMGFFHVLN  330



>emb|CDY45254.1| BnaA06g09240D [Brassica napus]
Length=458

 Score =   383 bits (983),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 201/351 (57%), Positives = 246/351 (70%), Gaps = 18/351 (5%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLA---AIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNV  854
             M    + I S +FV L    A + P    +I+ FDD W  R+ +A    L +++P P NV
Sbjct  1     MAAAFLNIGSYIFVFLLSSFATLAPQVQANIAVFDDYWTQRQGDALKQTLASFDPYPLNV  60

Query  853   TSTLNHNVVKVILDYRnnnnetetetNSTRRHLG------KKKYRGPCNATNPIDRCWRC  692
             T+ LN++V  + LD       T    NSTRR L       K + RG C A NPID+CWRC
Sbjct  61    TNHLNYHVA-LALD-------TTESINSTRRELSQARRGRKMQNRGKCVAHNPIDKCWRC  112

Query  691   DPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLW  515
             D +W   RK+LA C+LGFG +  GGK+G  Y VTD SD  L +P+ GTLRHAV +  PLW
Sbjct  113   DRDWEKNRKKLAVCALGFGRRTTGGKDGPIYVVTDASDDELISPRPGTLRHAVTRDGPLW  172

Query  514   IIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGD  335
             IIFARSM IKL+QELM+ S KTIDGRGA+V+I GG+G+TLQFV NVIIH I +  IV  +
Sbjct  173   IIFARSMVIKLQQELMMTSDKTIDGRGARVYIMGGSGLTLQFVNNVIIHNIYIKQIVPAN  232

Query  334   GGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSH  155
             GG+IRDS  H GLRTRSDGDGI+LFGAT++W+DH+SM +C DG+IDAI  STA+T+SNSH
Sbjct  233   GGLIRDSEQHIGLRTRSDGDGINLFGATNVWIDHVSMTRCSDGMIDAILGSTAVTVSNSH  292

Query  154   FTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             FTDH EVMLFGAND    DK MQ+T+AFNHFGKRL QRMPR R+G  HVVN
Sbjct  293   FTDHQEVMLFGANDKHEIDKKMQITVAFNHFGKRLEQRMPRVRFGTIHVVN  343



>gb|KDO76053.1| hypothetical protein CISIN_1g013757mg [Citrus sinensis]
Length=437

 Score =   382 bits (981),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 189/332 (57%), Positives = 233/332 (70%), Gaps = 12/332 (4%)
 Frame = -1

Query  994  LLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVIL  815
            LL +   A I P    +  +FD+VWQ R E A  HAL+ Y P+P  V S+ N +V  +  
Sbjct  9    LLTLFGLASISPILKANTHDFDEVWQKRAENARRHALEAYHPNPEEVVSSFNKHVHMMFE  68

Query  814  DYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFG  635
            +            +STRR+L  + Y G C ATNPID+CWRCD NWAN RKRLADC+ GFG
Sbjct  69   N-----------GSSTRRYLRGRPYTGRCAATNPIDQCWRCDRNWANNRKRLADCAQGFG  117

Query  634  YKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQS  458
                GGKNG FY VT+ +D  L NPK GTLRHAVIQ +PLWI FA  M I+L +EL++ S
Sbjct  118  RGTIGGKNGPFYVVTNPADDDLVNPKPGTLRHAVIQERPLWITFAHDMVIRLSEELLITS  177

Query  457  HKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDG  278
             KTID RG+ V I  GA IT+QFVKN+IIHG+ +     G GGMIRDS++H G R+ SDG
Sbjct  178  DKTIDARGSNVQIYNGAQITMQFVKNIIIHGLHIRKTKAGKGGMIRDSVSHHGFRSSSDG  237

Query  277  DGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKD  98
            DGIS+FGA+ IW+DH+SM  C DG+IDA+  STAIT+SNSHFT  + VML GA+D  P+D
Sbjct  238  DGISMFGASHIWIDHVSMSGCQDGLIDAVMGSTAITVSNSHFTHQDHVMLLGASDGHPQD  297

Query  97   KIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             IMQVT+AFNHFGK+LVQRMPR R+G+ HVVN
Sbjct  298  SIMQVTVAFNHFGKQLVQRMPRVRFGFAHVVN  329



>ref|XP_010485518.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   383 bits (983),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 198/359 (55%), Positives = 243/359 (68%), Gaps = 25/359 (7%)
 Frame = -1

Query  1006  KILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDP------------  863
             +++ L+ V   A +IPT   +++E D+ W N+  EA  H L  Y PDP            
Sbjct  5     RLVKLVCVICIASLIPTIRANVAETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHY  64

Query  862   ---SNVTSTLNHNVVKVILDYRnnnnetetetNSTRRHLGKK--------KYRGPCNATN  716
                ++V  T     V    D  +    T + TNSTRR L  K        K +GPC A+N
Sbjct  65    DNSTDVEGTEEDTAVDSAED-EDVIEMTSSPTNSTRRSLSGKRRGRGKWSKLKGPCTASN  123

Query  715   PIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTD-NSDHPLNPKRGTLRHA  539
             PID+CWRC P+WA +RKRL  C  GFGY+  GGK G  Y VT    D  +NP+ GTLRHA
Sbjct  124   PIDKCWRCQPDWAKRRKRLVRCVRGFGYRTTGGKRGRIYVVTSPRDDDTVNPRPGTLRHA  183

Query  538   VIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIR  359
             VIQ +PLWIIF   M+I+L QELM+ SHKTID RGA VHI+ GAGIT+Q+V N+IIHG+ 
Sbjct  184   VIQKEPLWIIFKHDMSIRLSQELMIASHKTIDARGANVHIAYGAGITMQYVHNIIIHGLH  243

Query  358   VHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEAST  179
             VH IV   GG+IRDSI+HFG R ++DGDGIS+FGAT+IWLDH+SM KC DG+IDAI  ST
Sbjct  244   VHHIVTSSGGLIRDSIDHFGQRGQADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGST  303

Query  178   AITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             AITISNSHFT HN+VML GA DH+  DK MQVT+A+NHFGK LVQRMPR R+G+ HVVN
Sbjct  304   AITISNSHFTHHNDVMLLGAQDHNQDDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVN  362



>emb|CDY41679.1| BnaC02g34750D [Brassica napus]
Length=457

 Score =   382 bits (982),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 201/338 (59%), Positives = 239/338 (71%), Gaps = 15/338 (4%)
 Frame = -1

Query  994  LLFVSLA-AIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVI  818
            ++FVSL+ AI+ P+   HI+ FDD W  R+  A    +++YEP+P NVT+  N++    +
Sbjct  13   IVFVSLSIAIVAPSVQAHIAVFDDYWTQRQANALRQTMESYEPNPLNVTNHFNYHAALAM  72

Query  817  LDYRnnnnetetetNSTRRHLGK-----KKYRGPCNATNPIDRCWRCDPNWANKRKRLAD  653
                    ET    N  RR LG+     K   G   + N IDRCWR D NWA  RK+LAD
Sbjct  73   --------ETTGADNGPRRELGQVKAGQKTRGGRFRSLNAIDRCWRGDKNWAKNRKKLAD  124

Query  652  CSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQ  476
            C LGFG K  GGKNG  Y VTD SD  L +PK GTLRHAV + +PLWIIFAR+M IKL+Q
Sbjct  125  CVLGFGLKTIGGKNGPIYVVTDASDDDLLSPKPGTLRHAVTRDRPLWIIFARTMVIKLQQ  184

Query  475  ELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGL  296
            ELM+ + KTIDGRG  V+I+GGAG TLQFVKNVIIH I +  I  G GG+IRDS  HFGL
Sbjct  185  ELMITNDKTIDGRGVSVYITGGAGFTLQFVKNVIIHNIHMKFIKRGFGGLIRDSEEHFGL  244

Query  295  RTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGAN  116
            RT SDGDGI++FGAT+IW+DH+SMR C DG+IDAI  STAITISNSHFTDH EVMLFGA 
Sbjct  245  RTISDGDGINIFGATNIWIDHVSMRNCSDGMIDAIMGSTAITISNSHFTDHKEVMLFGAK  304

Query  115  DHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            +    DK MQ+T+AFNHFGKRL QRMPR RYG  HVVN
Sbjct  305  NGDEFDKKMQITVAFNHFGKRLNQRMPRVRYGMVHVVN  342



>dbj|BAK06965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   382 bits (980),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 196/349 (56%), Positives = 246/349 (70%), Gaps = 22/349 (6%)
 Frame = -1

Query  1024  MEGFQ------IKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDP  863
             MEGFQ      + + ++LF+S AA+    S  +I EFD+ WQ RK EA   A  TY P+P
Sbjct  1     MEGFQWSRPVSLLLYAVLFLSAAAV----SEANIGEFDEHWQRRKLEARARAEATYHPNP  56

Query  862   SNVTSTLNHNVVKVILDYRnnnnetetetNSTRRHLG-KKKYRGPCNATNPIDRCWRCDP  686
               V ++LN  V + + D          E+ S R+ LG  KK+ GPC ATNPIDRCWRC  
Sbjct  57    IEVANSLNRAVHRSLRD----------ESGSRRKLLGLHKKFAGPCTATNPIDRCWRCRK  106

Query  685   NWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHP-LNPKRGTLRHAVIQIKPLWII  509
             +WA  R RLA C+ GFG  A GG  G  Y VTD +D   L P+ GTLR  VIQ +PLWII
Sbjct  107   DWATDRMRLARCAQGFGRNATGGLGGKIYIVTDGTDDDVLEPRPGTLRWGVIQNEPLWII  166

Query  508   FARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGG  329
             FAR M IKLK+EL+V S KTIDGRGAQV I+ GA +T+Q+  NVIIH I V+D++ G GG
Sbjct  167   FARPMLIKLKEELLVGSDKTIDGRGAQVRIADGAQVTVQYSHNVIIHNIHVNDLIVGKGG  226

Query  328   MIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFT  149
              IRDS  H G RT+SDGDG+S+FG+T++WLDHLS+  C DG+ID I  +T +TISN H T
Sbjct  227   RIRDSPQHAGFRTQSDGDGVSVFGSTNVWLDHLSLATCQDGLIDVIAEATGVTISNCHLT  286

Query  148   DHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             +HN+VMLFG++D +PKD+IMQVT+AFNHFG+ LVQRMPRCR+G+FHVVN
Sbjct  287   NHNDVMLFGSSDSNPKDQIMQVTVAFNHFGRGLVQRMPRCRWGFFHVVN  335



>ref|NP_001046281.1| Os02g0214400 [Oryza sativa Japonica Group]
 dbj|BAD25039.1| putative pectate lyase precursor [Oryza sativa Japonica Group]
 dbj|BAF08195.1| Os02g0214400 [Oryza sativa Japonica Group]
 dbj|BAG94880.1| unnamed protein product [Oryza sativa Japonica Group]
Length=446

 Score =   381 bits (978),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 188/318 (59%), Positives = 230/318 (72%), Gaps = 16/318 (5%)
 Frame = -1

Query  943  ISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNSTR  764
            I EFD+ W+ R+  A   A + Y+PDP NVT+  NH V++             TE    R
Sbjct  33   IGEFDEHWEKRRAAAEAAAEEVYKPDPFNVTNEFNHAVIR------------STERGVLR  80

Query  763  RHLGKK--KYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVT  590
            R L  K  KY+GPC ATNPIDRCWRC  +WA  RKRLA C++GFG  A GG  G  Y VT
Sbjct  81   RELSGKNSKYKGPCLATNPIDRCWRCRKDWATDRKRLARCAMGFGRGATGGVRGKIYVVT  140

Query  589  DNSD-HPLNPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHIS-  416
            D  D    NP+ GTLR   +Q  PLWI FA+SM I+L QEL+V S KTIDGRGAQVHI+ 
Sbjct  141  DPGDGDAANPRYGTLRWGAMQAAPLWITFAKSMVIRLTQELLVASDKTIDGRGAQVHIAR  200

Query  415  GGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLD  236
            GGAGIT+QF +NVII  + VHD+ H DGG +RDS  H G RTR+DGDGISLF ATD+W+D
Sbjct  201  GGAGITVQFARNVIITSLHVHDVKHSDGGAVRDSPTHIGPRTRADGDGISLFAATDVWVD  260

Query  235  HLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGK  56
            H+SM  C+DG+ID ++ ST +TISNSHFT+HN+VMLFGA+D  P+DK+MQ+T+AFNHFG+
Sbjct  261  HVSMSMCEDGLIDVVQGSTGVTISNSHFTNHNDVMLFGASDSYPQDKVMQITVAFNHFGR  320

Query  55   RLVQRMPRCRYGYFHVVN  2
             LVQRMPRCR+G+FHVVN
Sbjct  321  GLVQRMPRCRWGFFHVVN  338



>ref|XP_008339934.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score =   381 bits (978),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 194/323 (60%), Positives = 239/323 (74%), Gaps = 13/323 (4%)
 Frame = -1

Query  964  IPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnete  785
            +P     + + D  W+ R EEA   AL++Y  +P  VT   N+ V K++L          
Sbjct  32   VPNEDTQVLDLDAYWKQRAEEAEKEALESYNKNPEQVTEEFNNEVGKLML----------  81

Query  784  tetNSTRRHL-GKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNG  608
             + N+TRR+L G K Y+GPC ATNPID CWRCDP WAN RK++  C+ GFG KA GGK+G
Sbjct  82   -KENTTRRNLRGNKAYKGPCMATNPIDACWRCDPYWANNRKKIVGCAQGFGKKATGGKDG  140

Query  607  DFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGA  431
             FY VT  +D  + NPK GTLRHAVIQ  PLWIIFA+SM I+L+QELMV S KTID RGA
Sbjct  141  PFYVVTMGTDDDVQNPKPGTLRHAVIQKGPLWIIFAKSMVIRLQQELMVTSDKTIDARGA  200

Query  430  QVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGAT  251
             V I  GAGITLQFVKNVII  + +  IV   GGMIRDS++H GLRT+SDGDGISLFGA+
Sbjct  201  NVVIEEGAGITLQFVKNVIITNLHIKMIVPKPGGMIRDSVDHIGLRTQSDGDGISLFGAS  260

Query  250  DIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAF  71
            ++W+DH+SM +C DG+IDA+  ST+ITISNSHFTDH+E MLFGAN+   +DKIMQ+T+AF
Sbjct  261  NVWIDHVSMSRCADGLIDAVMGSTSITISNSHFTDHDEAMLFGANNAHTQDKIMQITLAF  320

Query  70   NHFGKRLVQRMPRCRYGYFHVVN  2
            NHFG+ LVQRMPR R+G+FHVVN
Sbjct  321  NHFGQGLVQRMPRVRHGFFHVVN  343



>ref|XP_006292606.1| hypothetical protein CARUB_v10018855mg [Capsella rubella]
 gb|EOA25504.1| hypothetical protein CARUB_v10018855mg [Capsella rubella]
Length=455

 Score =   381 bits (978),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 197/340 (58%), Positives = 238/340 (70%), Gaps = 17/340 (5%)
 Frame = -1

Query  994  LLFVSLA-AIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVI  818
             +FVSL+ A+++P+   HI+  D+ W  R+ EA    L+ Y+P+P NVT   NH     +
Sbjct  9    FVFVSLSLAVVVPSVQAHIAVHDEYWTQRQTEALQQTLEAYDPEPLNVTDHFNHQAALAM  68

Query  817  LDYRnnnnetetetNSTRRHL------GKKKYRGP-CNATNPIDRCWRCDPNWANKRKRL  659
            +             N TRR L       KK  RG    + N ID+CWR D NW   RK+L
Sbjct  69   VP--------TGIVNETRRELRQVGRGNKKPRRGRRYESLNAIDKCWRGDKNWDKNRKKL  120

Query  658  ADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKL  482
            ADC LGFG K  GGKNG FY VTD SD  L NPK GTLR+AV + +PLWIIFARSM IKL
Sbjct  121  ADCVLGFGRKTTGGKNGPFYVVTDPSDTDLMNPKPGTLRYAVTRDRPLWIIFARSMIIKL  180

Query  481  KQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHF  302
            +QEL++ + KTIDGRGA VHI+GGAG+TLQFV+NVIIH I +  I  G GG+IRDS +HF
Sbjct  181  QQELIITNDKTIDGRGANVHITGGAGLTLQFVRNVIIHNIYIKQIKKGAGGLIRDSEHHF  240

Query  301  GLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFG  122
            GLRT SDGDGI++FGAT++W+DH+SM  C DG+IDAI  STAITISNSHFTDH+EVMLFG
Sbjct  241  GLRTVSDGDGINIFGATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFG  300

Query  121  ANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
              +    DK MQ+T+AFNHFGKRL QRMPR RYG  HVVN
Sbjct  301  GTNKDVIDKKMQITVAFNHFGKRLKQRMPRVRYGLVHVVN  340



>ref|XP_009788285.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=434

 Score =   380 bits (976),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 196/337 (58%), Positives = 246/337 (73%), Gaps = 16/337 (5%)
 Frame = -1

Query  1009  IKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNV  830
             +K  S+ FVS+  ++  +   +ISEFD+VWQ R  +A   A  +Y P P  V   LN +V
Sbjct  4     LKNRSIFFVSVTLVL--SIEANISEFDEVWQTRATQAKKTAQDSYNPHPETVADNLNKHV  61

Query  829   VKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADC  650
                        + +E  +NSTRR L   KY GPC +TNPIDRCWRCDPNWA  R +LADC
Sbjct  62    -----------HTSEEGSNSTRRDL--HKYNGPCMSTNPIDRCWRCDPNWAKTRMKLADC  108

Query  649   SLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQE  473
              LGFG+   GGK G  Y VTD SD  + NPK GTLRHAVIQ +PLWIIF   M I+L QE
Sbjct  109   VLGFGHHTTGGKGGKIYVVTDPSDDDMVNPKPGTLRHAVIQPEPLWIIFKHHMVIRLNQE  168

Query  472   LMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLR  293
             L++ S+KTID RG QVHI+ GA   LQF+ NVIIHG+ +HDI  G+GG+IRDSINH+G R
Sbjct  169   LIMTSNKTIDARGQQVHIAFGASFMLQFINNVIIHGLHIHDIKAGNGGLIRDSINHYGFR  228

Query  292   TRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGAND  113
             +RSDGDGIS+FG+T+IW+DH+SM  CDDG+IDA++ASTAITISN HFT+HN+VMLFGA+D
Sbjct  229   SRSDGDGISIFGSTNIWIDHVSMSNCDDGLIDAVQASTAITISNCHFTNHNDVMLFGASD  288

Query  112   HSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
                +D I+Q+T+AFNHFG+ L+QRMPR R+G+ H VN
Sbjct  289   SYSEDSILQITLAFNHFGQGLIQRMPRVRWGFVHAVN  325



>gb|KFK33456.1| hypothetical protein AALP_AA5G015800 [Arabis alpina]
Length=460

 Score =   381 bits (978),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 202/341 (59%), Positives = 240/341 (70%), Gaps = 18/341 (5%)
 Frame = -1

Query  994  LLFVSLA-AIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVI  818
            L FVSLA AII P+   HI+ +D+ W  R+ EA    L++YEPDP NVT   N++    +
Sbjct  13   LAFVSLALAIIAPSVQAHIAVYDEYWTQRQTEALRRTLESYEPDPLNVTDHFNYHSALAM  72

Query  817  LDYRnnnnetetetNSTRRHL-----GKK---KYRGPCNATNPIDRCWRCDPNWANKRKR  662
                    ET    N TRR L     G+K   K  G   + N ID+CWR D NWA  RK+
Sbjct  73   --------ETTEAVNGTRRELRVVGGGRKTIKKRGGRFQSLNAIDKCWRGDKNWAKNRKK  124

Query  661  LADCSLGFGYKAKGGKNGDFYTVTDNSDHP-LNPKRGTLRHAVIQIKPLWIIFARSMNIK  485
            LADC LGFG K  GGK G  Y VTD SD+  +NP+ GTLRHAV + +PLWIIFA+SM IK
Sbjct  125  LADCVLGFGRKTTGGKAGPIYEVTDASDNDVMNPRPGTLRHAVTRDRPLWIIFAKSMVIK  184

Query  484  LKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINH  305
            L+QEL++ + KTIDGRG  VHI+GGAG+T+QFVKNVIIH I +  I    GGMIRDS NH
Sbjct  185  LQQELIITNDKTIDGRGVSVHITGGAGLTIQFVKNVIIHNIHMKFIERRAGGMIRDSENH  244

Query  304  FGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLF  125
            FGLRT SDGDGI++FGAT++W+DH+SMR C DG+IDAI  STAITISN HFTDH EVMLF
Sbjct  245  FGLRTESDGDGINIFGATNVWIDHVSMRNCSDGMIDAIMGSTAITISNCHFTDHEEVMLF  304

Query  124  GANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            GA +    DK MQ+T+AFNHFGKRL QRMPR RYG  HVVN
Sbjct  305  GAKNGDVIDKKMQITVAFNHFGKRLDQRMPRVRYGMVHVVN  345



>ref|XP_003563707.1| PREDICTED: pectate lyase-like [Brachypodium distachyon]
Length=448

 Score =   380 bits (977),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 195/349 (56%), Positives = 244/349 (70%), Gaps = 18/349 (5%)
 Frame = -1

Query  1024  MEGFQIK------ILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDP  863
             MEGFQ        +L ++F  L+A   P S  +I +FD+ WQ RK  A   A   Y+ DP
Sbjct  1     MEGFQWGRRAGSFVLYVVFFFLSASA-PVSQANIGDFDEHWQQRKAAARAAAEAIYQSDP  59

Query  862   SNVTSTLNHNVVKVILDYRnnnnetetetNSTRRHLGK-KKYRGPCNATNPIDRCWRCDP  686
               V ++LN  V +   +          +  + R  LGK KK+ GPC ATNPIDRCWRC  
Sbjct  60    LEVANSLNRAVHRATKE---------DDAGTRRSMLGKHKKFAGPCRATNPIDRCWRCRK  110

Query  685   NWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHP-LNPKRGTLRHAVIQIKPLWII  509
             +WA  RKRLA C+ GFG  A GG  G FY VTD SD   L P+ GTLR AVIQ +PLWII
Sbjct  111   DWATDRKRLARCAQGFGRNATGGLAGKFYIVTDGSDDDVLAPRPGTLRWAVIQAEPLWII  170

Query  508   FARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGG  329
             FARSM IKLK+EL++ S KTIDGRGAQV I+ GA +T+Q+  NVIIH I ++D++ G GG
Sbjct  171   FARSMLIKLKEELLIGSDKTIDGRGAQVRIADGAQVTVQYAHNVIIHNIHINDLIVGKGG  230

Query  328   MIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFT  149
             MIRDS  HFG RT+SDGDG+++FG+T +WLDHLS+  C DG+ID I  ST +TISN H T
Sbjct  231   MIRDSPAHFGFRTQSDGDGVNVFGSTSVWLDHLSLATCQDGLIDVIAESTGVTISNCHLT  290

Query  148   DHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             +HN+VMLFG++D +PKD IMQ+T+AFNHFG+ LVQRMPRCR+G+FHVVN
Sbjct  291   NHNDVMLFGSSDSNPKDVIMQITVAFNHFGRGLVQRMPRCRWGFFHVVN  339



>ref|XP_004228388.1| PREDICTED: pectate lyase [Solanum lycopersicum]
Length=439

 Score =   380 bits (975),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 190/335 (57%), Positives = 236/335 (70%), Gaps = 16/335 (5%)
 Frame = -1

Query  1003  ILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVK  824
             IL +LF+ LA+++ P     I+EFD   + +  EA   +L+ Y  +P  +T+  N  V  
Sbjct  9     ILLVLFIWLASLV-PHLHARIAEFDPYLEKQALEALNSSLEAYTNNPEEITNAFNKEVGN  67

Query  823   VILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSL  644
              +L Y+           S RRHL   K +  C ATNPIDRCWRCD NWA  R  L +C+ 
Sbjct  68    ALLKYK-----------SLRRHL---KEKDKCMATNPIDRCWRCDKNWAENRMDLEECAR  113

Query  643   GFGYKAKGGKNGDFYTVTDNSDHPLN-PKRGTLRHAVIQIKPLWIIFARSMNIKLKQELM  467
             GFG+K  GGKNG +Y VTD SD  +  PK GTLRHAVIQ +PLWIIF +SM IKL+QELM
Sbjct  114   GFGHKTTGGKNGKYYVVTDESDDNVQEPKPGTLRHAVIQEEPLWIIFEKSMVIKLRQELM  173

Query  466   VQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTR  287
             + S KTIDGRG  VHI+ GAG+ +QFV NVIIH IR+ +I+  +GGMIRDSINH GLRT 
Sbjct  174   ITSDKTIDGRGVAVHIAYGAGLMIQFVHNVIIHNIRIQNIISTNGGMIRDSINHIGLRTV  233

Query  286   SDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHS  107
             SDGDGIS+FG+  IW+DH ++ +C DG+IDAI ASTAITISN  F  HN+VML GA D  
Sbjct  234   SDGDGISIFGSNHIWIDHCTLSECTDGLIDAIMASTAITISNCKFNYHNDVMLLGATDAF  293

Query  106   PKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             P+D IMQVT+AFN FG+ L+QRMPRCR+G+FHVVN
Sbjct  294   PQDAIMQVTVAFNRFGEGLIQRMPRCRWGFFHVVN  328



>ref|XP_007215366.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
 gb|EMJ16565.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
Length=452

 Score =   380 bits (975),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 202/343 (59%), Positives = 255/343 (74%), Gaps = 12/343 (3%)
 Frame = -1

Query  1006  KILSLLFVSLAAIIIPTSLGHIS------EFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             K+  +LF+    I++P+    I+      +FD VW+ R+ +A   ALK Y+P+P  VT  
Sbjct  4     KLDLVLFMISFCILVPSLRASIANDSNVGQFDAVWKERELKAEKAALKAYQPNPEKVTDD  63

Query  844   LNHNVVKVI-LDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKR  668
              N +V +   L++ +++  +      T RHL  KKY+GPC ATNPIDRCWRC  +WAN R
Sbjct  64    FNESVQEFDDLNFEDDDQVSNI----TGRHLLGKKYKGPCKATNPIDRCWRCRKDWANDR  119

Query  667   KRLADCSLGFGYKAKGGKNGDFYTVTDNSD-HPLNPKRGTLRHAVIQIKPLWIIFARSMN  491
             K+LA+C  GFG + +GGK G FY VTD SD + ++PK GTLRHAVIQ +PLWIIFARSM 
Sbjct  120   KKLANCVKGFGRRTRGGKRGGFYVVTDPSDSNVVDPKPGTLRHAVIQPQPLWIIFARSMT  179

Query  490   IKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSI  311
             I+L QEL++ SHKTID RGA V I+ GAGITLQFV+NVIIHG+ +HDIV G GG IRDS+
Sbjct  180   IRLTQELILTSHKTIDARGANVRIAHGAGITLQFVQNVIIHGLHIHDIVPGSGGTIRDSV  239

Query  310   NHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVM  131
             +HFG RT+SDGDGIS+FG++ IWLDHLSM  C DG+ID I+ STAITISN HFT HN+V+
Sbjct  240   DHFGTRTQSDGDGISIFGSSHIWLDHLSMWNCGDGLIDVIQGSTAITISNCHFTRHNDVL  299

Query  130   LFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             LFGA+D    D IMQ+T+AFNHFGK LVQRMPRCR+G+ HVVN
Sbjct  300   LFGASDSFAGDAIMQITVAFNHFGKGLVQRMPRCRWGFIHVVN  342



>ref|XP_003609009.1| Pectate lyase [Medicago truncatula]
Length=445

 Score =   379 bits (973),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 188/334 (56%), Positives = 234/334 (70%), Gaps = 25/334 (7%)
 Frame = -1

Query  967  IIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnet  788
            I+P    +I  FD  WQNR ++A   A + Y+P+P  +TS LN +V K +          
Sbjct  18   IVPIFEANIVHFDQYWQNRSDDAKKAAQQAYKPNPQEITSNLNMHVHKAL----------  67

Query  787  etetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNG  608
             + +NSTRR L K  Y+GPC+ATNPID CWRCDPNW   RK+LADC LGFG+   GGK G
Sbjct  68   -SGSNSTRRELAK--YKGPCSATNPIDSCWRCDPNWEKNRKKLADCVLGFGHGTTGGKAG  124

Query  607  DFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGA  431
              Y VTD+SD+ L  PK GTLR A IQ +PLWIIF  +MNIKLK EL++ S KTID RGA
Sbjct  125  KIYVVTDSSDNDLVTPKPGTLRFAAIQKEPLWIIFKHNMNIKLKAELLLTSDKTIDARGA  184

Query  430  QVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGAT  251
             VHIS GA ITLQ+VKN+IIHG+ +HD     GG IRDS++H+G R+ SDGD IS+FGA+
Sbjct  185  NVHISEGAQITLQYVKNIIIHGLHIHDTKKTSGGQIRDSMDHYGSRSASDGDAISMFGAS  244

Query  250  DIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNE-----------VMLFGANDHSP  104
             +W+DH+SM  C DG++DA+  STAITISN H T HN+           VMLFGAND   
Sbjct  245  HVWIDHISMWNCADGLVDAVAGSTAITISNCHMTRHNDVINNISSTYSFVMLFGANDGFS  304

Query  103  KDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             D+I Q+T+AFNHFGK L+QRMPRCR+G+FH+VN
Sbjct  305  GDQISQITVAFNHFGKGLIQRMPRCRWGFFHIVN  338



>gb|KDP45476.1| hypothetical protein JCGZ_09725 [Jatropha curcas]
Length=462

 Score =   380 bits (975),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 195/352 (55%), Positives = 247/352 (70%), Gaps = 14/352 (4%)
 Frame = -1

Query  1015  FQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNH  836
              ++  ++ +FV     I P  +  + ++D VWQ R EEA  + ++ Y+PDP  VT+ +N 
Sbjct  1     MEVAKIAFMFVFWFGFITPNLMADMKKYDKVWQERSEEARKNMMEAYDPDPIAVTAEVNE  60

Query  835   NVVKVILDYRnnnne-----------tetetNSTRRHLGKKK--YRGPCNATNPIDRCWR  695
              V   I      N+            T  E N+TRR L +KK  Y GPC A NPID+CWR
Sbjct  61    QVNHQIDGNAKTNSTINHTKGTNNFETGAEANNTRRSLKQKKQKYNGPCQANNPIDKCWR  120

Query  694   CDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHP-LNPKRGTLRHAVIQIKPL  518
             C  NW   R+RLA C+LGFG +  GGK G  Y VTDNSDH  + PK GTLRHAVIQ +PL
Sbjct  121   CRKNWVKDRQRLASCALGFGRRTTGGKGGKIYVVTDNSDHDCVEPKPGTLRHAVIQKEPL  180

Query  517   WIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHG  338
             WIIFA  MNIKL QEL++  +KTIDGRG  VHIS GAGIT+QFV N+IIHG+R+H I   
Sbjct  181   WIIFACDMNIKLSQELIMAHNKTIDGRGFNVHISHGAGITIQFVSNIIIHGLRIHHICST  240

Query  337   DGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNS  158
              GGMIRDS++H GLRT SDGDGIS+FG+T++W+DH+SM  C DG+IDAI+ STAITISN 
Sbjct  241   CGGMIRDSVDHVGLRTASDGDGISIFGSTNVWIDHVSMSNCQDGLIDAIQGSTAITISNC  300

Query  157   HFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             HF++HN+ +L GA+D    D+ MQ+T+AFNHFG+ LVQRMPRCR+G+FHVVN
Sbjct  301   HFSNHNDAILLGASDSFSGDQFMQITVAFNHFGQGLVQRMPRCRWGFFHVVN  352



>gb|ACU23277.1| unknown [Glycine max]
Length=443

 Score =   379 bits (973),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 193/344 (56%), Positives = 238/344 (69%), Gaps = 17/344 (5%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             M G   K+   L  + A I+IP     I+EFDD  + + +EA   AL +Y P+P +V   
Sbjct  5     MVGSATKVAFTLLATFA-IVIPCLEAGIAEFDDFLKAQADEAHKIALDSYVPEPHDVAHE  63

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRG--PCNATNPIDRCWRCDPNWANK  671
             LN +V   + +             STRR L ++K RG   C A+NPID CWRC+ +WAN 
Sbjct  64    LNFHVHMALEN-------------STRRELRQRKLRGGGKCQASNPIDACWRCNKDWAND  110

Query  670   RKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSM  494
             R RLA C  GFG +A GG  G  Y VTDNSD  + NPK GT+RHAV Q  PLWIIF  SM
Sbjct  111   RFRLAKCGKGFGRRATGGLGGPIYAVTDNSDDDMVNPKPGTIRHAVTQKGPLWIIFGHSM  170

Query  493   NIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDS  314
              I L+QELM+ S KTIDGRGA V   GGAG+T+QFV NVIIHG+R+ DIV  DGGMIRDS
Sbjct  171   IISLRQELMISSDKTIDGRGANVQFRGGAGLTIQFVNNVIIHGVRIKDIVPKDGGMIRDS  230

Query  313   INHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEV  134
              +H+GLRTRSDGD IS+FG+T+IW+DH+S+  C DG+ID I+ STAITISN H T HN+V
Sbjct  231   ADHYGLRTRSDGDAISIFGSTNIWIDHVSLSNCADGLIDIIQGSTAITISNCHMTKHNDV  290

Query  133   MLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
              LFGA+D    DKIMQ+T+AFNHFG+ LVQRMPRCR+G+ HV+N
Sbjct  291   FLFGASDSYNGDKIMQITVAFNHFGQGLVQRMPRCRWGFVHVLN  334



>ref|XP_008221658.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=443

 Score =   379 bits (973),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 194/327 (59%), Positives = 236/327 (72%), Gaps = 13/327 (4%)
 Frame = -1

Query  976  AAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnn  797
            AAII         E D+ W+ R ++A  + +++YEP+P  VT   N  V ++I+      
Sbjct  19   AAIIANAETDQPQELDEYWKKRADQAENYTMESYEPNPERVTDEFNAQVGELIMG-----  73

Query  796  netetetNSTRRHL-GKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKG  620
                   N TRR+L G+KKY GPC  TNPID CWRCDPNWAN R ++ DC  GFG K  G
Sbjct  74   ------KNETRRNLKGQKKYVGPCTVTNPIDACWRCDPNWANNRMKIVDCIQGFGRKTTG  127

Query  619  GKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTID  443
            GK G  Y VTD SD  L NP+ GTLRHAVIQ  PLWI FAR+M IKL+QELMV S KTID
Sbjct  128  GKGGPIYVVTDPSDGDLVNPRPGTLRHAVIQKGPLWITFARNMVIKLQQELMVASDKTID  187

Query  442  GRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISL  263
            GRGA V+I  GA IT+QFVKNVII  I +  I   +GGMIRDS++HFG RT+SDGDGIS+
Sbjct  188  GRGANVNIFDGACITIQFVKNVIITNIHIKQIKAKEGGMIRDSVDHFGQRTKSDGDGISI  247

Query  262  FGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQV  83
            +G+++IW+DH+SM  C DG+ID I  ST ITISNSHFT HNEVMLFGA++   +DK+MQ+
Sbjct  248  YGSSNIWIDHVSMENCTDGLIDVIMGSTGITISNSHFTKHNEVMLFGASNSYTQDKMMQI  307

Query  82   TIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            T+AFNHFGK LVQRMPRCR+G+FHVVN
Sbjct  308  TVAFNHFGKGLVQRMPRCRHGFFHVVN  334



>ref|XP_007224275.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
 gb|EMJ25474.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
Length=443

 Score =   379 bits (973),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 193/327 (59%), Positives = 237/327 (72%), Gaps = 13/327 (4%)
 Frame = -1

Query  976  AAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnn  797
            AAII         + D+ W+ R E+A  + +++YEP+P  VT   N  V ++I+      
Sbjct  19   AAIIANAESDQPQQLDEYWKKRAEQAENYTMESYEPNPQRVTDEFNAEVGELIMG-----  73

Query  796  netetetNSTRRHL-GKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKG  620
                   N TRR+L G+KKY GPC  TNPID CWRCDPNWAN R ++ DC  GFG K  G
Sbjct  74   ------KNETRRNLKGQKKYVGPCKVTNPIDSCWRCDPNWANNRMKIVDCIQGFGRKTTG  127

Query  619  GKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTID  443
            GK G  Y VTD SD  L NP+ GTLRHAVIQ  PLWI FAR+M IKL+QELMV S KTID
Sbjct  128  GKGGPIYVVTDPSDGDLVNPRPGTLRHAVIQKGPLWITFARNMVIKLQQELMVASDKTID  187

Query  442  GRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISL  263
            GRGA V+I  GAGIT+QFVKNVII  + +  I   +GG+IRDS++HFG RT+SDGDGIS+
Sbjct  188  GRGANVNIFDGAGITIQFVKNVIITNLHIKQIKAKEGGIIRDSVDHFGQRTKSDGDGISI  247

Query  262  FGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQV  83
            FG+++IW+DH+SM  C DG+IDAI  ST ITISN HFT HNEV+LFGA++   +DK+MQ+
Sbjct  248  FGSSNIWIDHVSMENCTDGLIDAIMGSTGITISNCHFTKHNEVLLFGASNSYTQDKMMQI  307

Query  82   TIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            T+AFNHFGK LVQRMPRCR+G+FHVVN
Sbjct  308  TVAFNHFGKGLVQRMPRCRHGFFHVVN  334



>gb|KHN01171.1| Putative pectate lyase 3 [Glycine soja]
Length=433

 Score =   378 bits (971),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 184/311 (59%), Positives = 223/311 (72%), Gaps = 14/311 (5%)
 Frame = -1

Query  931  DDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNSTRRHLG  752
            D  WQ R   A     + Y  DP ++T  L  +V ++I+  +N                 
Sbjct  26   DSYWQERASIAEKENQQAYTSDPYSLTKNLTFSVSEIIIGEKNGRRNLRGRGGK------  79

Query  751  KKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHP  572
                   C ATNPIDRCWRCDPNWAN RK+LADC  GFG    GGKNG FY V  + D+ 
Sbjct  80   -------CMATNPIDRCWRCDPNWANNRKKLADCVQGFGRNTIGGKNGPFYVVNSSLDND  132

Query  571  L-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITL  395
            + NP  GTLRHAV +  PLWIIFARSMNI+L QEL++ S KTIDGRG  V+I+ GAGIT+
Sbjct  133  MVNPAPGTLRHAVTRSGPLWIIFARSMNIRLSQELIMTSDKTIDGRGVDVYIANGAGITI  192

Query  394  QFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKC  215
            QF+KNVIIHGI++ +I  G+GG+IRDS  H+G RT SDGDGIS+FG++++W+DH+SMR C
Sbjct  193  QFIKNVIIHGIKIFNIQVGNGGLIRDSETHYGFRTYSDGDGISIFGSSNVWIDHVSMRNC  252

Query  214  DDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMP  35
             DG+IDAI+ STAITISN HFTDHNEVMLFGA+D    DKIMQ+T+AFNHFGKRLVQRMP
Sbjct  253  KDGLIDAIQGSTAITISNGHFTDHNEVMLFGASDSYDGDKIMQITLAFNHFGKRLVQRMP  312

Query  34   RCRYGYFHVVN  2
            RCRYG+ HVVN
Sbjct  313  RCRYGFVHVVN  323



>ref|XP_010425041.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   379 bits (973),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 193/338 (57%), Positives = 244/338 (72%), Gaps = 15/338 (4%)
 Frame = -1

Query  994  LLFVSLA-AIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVI  818
            ++FVSL+ A+++P+   H++E+D+ W  R+ EA    L++Y+P+P NVT   N++    +
Sbjct  9    IVFVSLSLAVVVPSVHAHVAEYDEYWTQRQTEALHQTLESYDPEPLNVTDHFNYHAALAM  68

Query  817  LDYRnnnnetetetNSTRRHL-----GKKKYRGPCNATNPIDRCWRCDPNWANKRKRLAD  653
                    ET   +N TRR L     GKK+  G   + N ID+CWR + NW   RK+LAD
Sbjct  69   --------ETTGISNETRRDLRQVKSGKKRRGGRYESLNAIDKCWRGNKNWDKNRKKLAD  120

Query  652  CSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQ  476
            C LGFG K  GGKNG  Y VTD SD+ L NPK GTLR+AV + +PLWIIFAR M IKL+Q
Sbjct  121  CVLGFGRKTTGGKNGPIYVVTDPSDNDLLNPKPGTLRYAVTRDRPLWIIFARHMIIKLQQ  180

Query  475  ELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGL  296
            EL++ + KTIDGRG  V+I+GGAG+TLQ+V+NVIIH I +  I  G GG+IRDS +HFGL
Sbjct  181  ELIITNDKTIDGRGVSVYITGGAGLTLQYVRNVIIHNIYIKQIKKGPGGLIRDSEHHFGL  240

Query  295  RTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGAN  116
            RT SDGDGIS+FGAT++W+DH+SM  C DG+IDAI  STAITISNSHFTDH+EVMLFG  
Sbjct  241  RTMSDGDGISIFGATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGK  300

Query  115  DHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            +    DK MQ+T+AFNHFGKRL QRMPR RYG  HVVN
Sbjct  301  NTDVIDKKMQITVAFNHFGKRLKQRMPRARYGLVHVVN  338



>ref|XP_003543726.1| PREDICTED: pectate lyase [Glycine max]
Length=443

 Score =   379 bits (972),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 193/344 (56%), Positives = 238/344 (69%), Gaps = 17/344 (5%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             M G   K+   L  + A I+IP     I+EFDD  + + +EA   AL +Y P+P +V   
Sbjct  5     MVGSATKVAFTLLATFA-IVIPCLEAGIAEFDDFLKAQADEAHKIALDSYVPEPHDVAHE  63

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRG--PCNATNPIDRCWRCDPNWANK  671
             LN +V   + +             STRR L ++K RG   C A+NPID CWRC+ +WAN 
Sbjct  64    LNFHVHMALEN-------------STRRELRQRKLRGGGKCQASNPIDACWRCNKDWAND  110

Query  670   RKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSM  494
             R RLA C  GFG +A GG  G  Y VTDNSD  + NPK GT+RHAV Q  PLWIIF  SM
Sbjct  111   RFRLAKCGKGFGRRATGGLGGPIYVVTDNSDDDMVNPKPGTIRHAVTQKGPLWIIFGHSM  170

Query  493   NIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDS  314
              I L+QELM+ S KTIDGRGA V   GGAG+T+QFV NVIIHG+R+ DIV  DGGMIRDS
Sbjct  171   IISLRQELMISSDKTIDGRGANVQFRGGAGLTIQFVNNVIIHGVRIKDIVPKDGGMIRDS  230

Query  313   INHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEV  134
              +H+GLRTRSDGD IS+FG+T+IW+DH+S+  C DG+ID I+ STAITISN H T HN+V
Sbjct  231   ADHYGLRTRSDGDAISIFGSTNIWIDHVSLSNCADGLIDIIQGSTAITISNCHMTKHNDV  290

Query  133   MLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
              LFGA+D    DKIMQ+T+AFNHFG+ LVQRMPRCR+G+ HV+N
Sbjct  291   FLFGASDSYNGDKIMQITVAFNHFGQGLVQRMPRCRWGFVHVLN  334



>ref|XP_002306040.1| hypothetical protein POPTR_0004s12300g [Populus trichocarpa]
 gb|EEE86551.1| hypothetical protein POPTR_0004s12300g [Populus trichocarpa]
Length=432

 Score =   378 bits (971),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 196/334 (59%), Positives = 241/334 (72%), Gaps = 21/334 (6%)
 Frame = -1

Query  994  LLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVIL  815
            L+FV   A +IP+ L  I  FDDVWQ R ++A    L+ Y PDP   T   N  V     
Sbjct  8    LIFVFTLATLIPSLLADIGIFDDVWQKRAQDAKKMTLEAYVPDPEEATDAFNVEV-----  62

Query  814  DYRnnnnetetetNSTRRHL--GKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLG  641
                         N+TRR+L  G+KKY GPC  TNPIDRCWRC  NWA  RK+LA C+LG
Sbjct  63   -------------NNTRRNLRQGRKKYAGPCQVTNPIDRCWRCQRNWAKNRKQLAKCALG  109

Query  640  FGYKAKGGKNGDFYTVTDNSDHP-LNPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMV  464
            FG +  GG  G  Y VTD+SD+  + PK GTLRHAVIQ +PLWIIF+++MNIKL +EL++
Sbjct  110  FGRRTTGGMAGRIYVVTDSSDNNVMKPKPGTLRHAVIQKEPLWIIFSKNMNIKLSKELIM  169

Query  463  QSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRS  284
             SHKTIDGRG  VHIS G GIT+QF+ NVIIHGIR+H I+   GG IRDS++H+G+RT S
Sbjct  170  SSHKTIDGRGHHVHISYGGGITIQFIHNVIIHGIRIHHIIATSGGNIRDSVDHYGIRTNS  229

Query  283  DGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSP  104
            DGDGIS+FG+TD+W+DH+SM +C DG+IDAI  STAITISN HFT HN+ +L GA+D   
Sbjct  230  DGDGISIFGSTDVWIDHVSMSRCTDGLIDAIMGSTAITISNCHFTHHNDAILLGASDSYS  289

Query  103  KDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             D +MQVT+AFNHFG+ LVQRMPRCR+G+FHVVN
Sbjct  290  GDHLMQVTVAFNHFGQGLVQRMPRCRWGFFHVVN  323



>ref|XP_006363934.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=439

 Score =   378 bits (971),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 188/335 (56%), Positives = 236/335 (70%), Gaps = 16/335 (5%)
 Frame = -1

Query  1003  ILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVK  824
             IL +LF+ LA+++ P     I+EFD   + +  E    +L+ Y  +P  VT+  N  V  
Sbjct  9     ILLILFIWLASLV-PHIHARIAEFDAYLEKQALEDLNSSLEAYTHNPEEVTNAFNKEVGN  67

Query  823   VILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSL  644
              +L Y+           S RR+L   K +  C ATNPIDRCWRCD NWA  R  L +C+ 
Sbjct  68    ALLKYK-----------SLRRNL---KEKNKCMATNPIDRCWRCDKNWAENRMDLEECAR  113

Query  643   GFGYKAKGGKNGDFYTVTDNSDHPLN-PKRGTLRHAVIQIKPLWIIFARSMNIKLKQELM  467
             GFG+K  GGKNG +Y VTD SD  +  PK GTLRHAVIQ +PLWIIF +SM IKL+QELM
Sbjct  114   GFGHKTTGGKNGKYYVVTDESDDNVQEPKPGTLRHAVIQEEPLWIIFEKSMVIKLQQELM  173

Query  466   VQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTR  287
             + S KTIDGRG  VHI+ GAG+T+QFV NVIIH IR+ +I+  +GGMIRDS+NH GLRT 
Sbjct  174   ITSDKTIDGRGVAVHIANGAGLTIQFVHNVIIHNIRIQNIISTNGGMIRDSVNHIGLRTV  233

Query  286   SDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHS  107
             SDGDGIS+FG+  IW+DH ++ +C DG++DAI ASTAITISN  F  HN+VML GA D  
Sbjct  234   SDGDGISIFGSNHIWIDHCTLSECTDGLVDAIMASTAITISNCKFNHHNDVMLLGATDAF  293

Query  106   PKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             P+D IMQVT+AFN FG+ L+QRMPRCR+G+FHVVN
Sbjct  294   PQDSIMQVTVAFNRFGEGLIQRMPRCRWGFFHVVN  328



>ref|XP_008793504.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=446

 Score =   378 bits (971),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 202/345 (59%), Positives = 244/345 (71%), Gaps = 14/345 (4%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             MEG Q +    L           S  +++EFDD WQ + EEA+  +   Y PDP  VT+ 
Sbjct  3     MEGLQTRPSFFLLSLFFLASATLSGANMAEFDDHWQKKAEEAFARSRAAYHPDPEAVTNK  62

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHL---GKKKYRGPCNATNPIDRCWRCDPNWAN  674
              N  V   +   RN          STRR L   G  K++GPC ATNPIDRCWRC  NW  
Sbjct  63    FNKAVHLAVSQARN----------STRRALRSAGVNKFKGPCVATNPIDRCWRCRENWME  112

Query  673   KRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARS  497
              RK+LA C+ GFG  A GGK+GDFY VTD SD+ L NPK GTLR  VIQ +PLWIIFAR 
Sbjct  113   NRKKLAGCAKGFGRNAVGGKDGDFYVVTDPSDNDLVNPKYGTLRWGVIQDRPLWIIFARD  172

Query  496   MNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRD  317
             M I+L +ELM+ S+KTIDGRGA V I+ GA ITLQFV NVIIHGI +HDI   +GG+IRD
Sbjct  173   MIIRLSEELMINSNKTIDGRGANVRIAYGAQITLQFVHNVIIHGIHIHDIKPSNGGIIRD  232

Query  316   SINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNE  137
             S+ HFG+RT+SDGDGIS++G++DIW+DH S+R C DG+IDAIE STAITISN HFT HN+
Sbjct  233   SLQHFGIRTKSDGDGISIYGSSDIWIDHCSLRNCADGLIDAIEGSTAITISNCHFTHHND  292

Query  136   VMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             V+LFGA+D +  D IMQ+T+AFNHFGK LVQRMPRCR+G+ HVVN
Sbjct  293   VLLFGASDSNEHDSIMQITVAFNHFGKGLVQRMPRCRWGFVHVVN  337



>gb|ABK28696.1| unknown [Arabidopsis thaliana]
Length=473

 Score =   379 bits (973),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 190/358 (53%), Positives = 246/358 (69%), Gaps = 22/358 (6%)
 Frame = -1

Query  1009  IKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDP-----------  863
             +++  L+F    A++IPT  G+ISE D+ W  R +EA    L+ Y  DP           
Sbjct  4     VRLSKLMFTFCIAVLIPTIRGNISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERH  63

Query  862   ----SNVTSTLNHNVVKVILDYRnnnnetetetNSTRRHL---GKKKY---RGPCNATNP  713
                 ++VT+       K   + +       + TNSTRR L   GK K+   +GPC A+NP
Sbjct  64    YDNSTDVTTPEEDGDAKPEEEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNP  123

Query  712   IDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAV  536
             ID+CWRC  +WA +RK+L  C  GFG++  GGK G  Y VT N D  + NPK GTLRHAV
Sbjct  124   IDKCWRCRSDWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAV  183

Query  535   IQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRV  356
             IQ +PLWIIF   M+I+L QEL++ SHKTID RGA VH++ GAGIT+QFVKNV+IHG+ +
Sbjct  184   IQKEPLWIIFKNDMSIRLNQELLINSHKTIDARGANVHVAHGAGITMQFVKNVVIHGLHI  243

Query  355   HDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTA  176
             H I    GGMIRDS++HFG+RTR+DGDG+S++G+++IWLDH+SM KC DG+IDAI  ST 
Sbjct  244   HHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISMSKCQDGLIDAIVGSTG  303

Query  175   ITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             ITISNSHFT HN+VML GA + +  DK MQVT+A+NHFGK LVQRMPR R+G+ HVVN
Sbjct  304   ITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWGFVHVVN  361



>gb|KEH19822.1| pectate lyase-like protein [Medicago truncatula]
Length=455

 Score =   378 bits (971),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 191/343 (56%), Positives = 233/343 (68%), Gaps = 24/343 (7%)
 Frame = -1

Query  994  LLFVSLAAIIIPTSLGHI-----------SEFDDVWQNRKEEAWMHALKTYEPDPSNVTS  848
            +LFV   AI+ PT   +             EFD  WQ R + A       Y  DP  ++ 
Sbjct  8    ILFVLCLAILTPTLNANKLENNEYWTEQRPEFDSYWQERAKVAKQENKAAYFKDPYAISG  67

Query  847  TLNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKR  668
                ++ ++I                  R+LG  K  G C ATNPIDRCWRCDPNWAN R
Sbjct  68   NFTASISEII------------AVKEKGRNLGGLKDDGTCLATNPIDRCWRCDPNWANNR  115

Query  667  KRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMN  491
            ++LADC  GFG   +GG+ G  Y VTD SD  + NPK GTLR+AV +   LWI FARSM 
Sbjct  116  QKLADCVQGFGRNTRGGQGGPIYVVTDPSDDDMMNPKPGTLRYAVTRNGSLWITFARSMA  175

Query  490  IKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSI  311
            I L+QEL++   KTIDGRG  V+IS GAGIT+QFVKNVIIHGI+++DI   DGGMIRDS 
Sbjct  176  ITLQQELIMSGDKTIDGRGVDVYISNGAGITIQFVKNVIIHGIKIYDIQVRDGGMIRDSE  235

Query  310  NHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVM  131
             H+G RT+SDGDGIS+FGA+++W+DH+SMR C DG+IDAI  STAITISNSHFTDHNEVM
Sbjct  236  AHYGFRTKSDGDGISIFGASNVWIDHVSMRNCTDGLIDAIMGSTAITISNSHFTDHNEVM  295

Query  130  LFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            LFGA++   +DKIMQ+T+AFNHFGKRLVQRMPR R+G+ H VN
Sbjct  296  LFGASNDYSEDKIMQITLAFNHFGKRLVQRMPRARFGFVHCVN  338



>gb|KHG23093.1| hypothetical protein F383_29772 [Gossypium arboreum]
Length=385

 Score =   376 bits (965),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 183/260 (70%), Positives = 210/260 (81%), Gaps = 3/260 (1%)
 Frame = -1

Query  772  STRRHL-GK-KKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFY  599
            STRR L GK KKY GPC A NPIDRCWRC  NWA  RKRLA C LGFG+K +GGK G++Y
Sbjct  15   STRRDLRGKHKKYTGPCMAINPIDRCWRCRKNWAKNRKRLAKCVLGFGHKTRGGKKGEYY  74

Query  598  TVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVH  422
             VTDNSD  + NPK GTLRHAVIQ +PLWIIFA  MNIKL QELMVQSHKTIDGRGA VH
Sbjct  75   LVTDNSDDDVVNPKPGTLRHAVIQKRPLWIIFAHDMNIKLSQELMVQSHKTIDGRGANVH  134

Query  421  ISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIW  242
            I+ G GITLQFV NVIIH I +H +V   GG+IRDS +H+G RT  DGDGIS+FG++ IW
Sbjct  135  IAYGCGITLQFVHNVIIHNIHIHRVVRSSGGLIRDSEDHYGFRTVGDGDGISIFGSSKIW  194

Query  241  LDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHF  62
            LDH+SM +C DG+IDAI+ STAITISN HFT H+ V+L GA+D   +D+ MQVT+AFNHF
Sbjct  195  LDHISMSECQDGLIDAIQGSTAITISNCHFTHHDHVILLGASDTYSRDQFMQVTLAFNHF  254

Query  61   GKRLVQRMPRCRYGYFHVVN  2
            GK L+QRMPRCR+GYFHVVN
Sbjct  255  GKELIQRMPRCRWGYFHVVN  274



>ref|NP_197015.4| putative pectate lyase 19 [Arabidopsis thaliana]
 gb|AED92118.1| putative pectate lyase 19 [Arabidopsis thaliana]
Length=472

 Score =   379 bits (973),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 190/358 (53%), Positives = 246/358 (69%), Gaps = 22/358 (6%)
 Frame = -1

Query  1009  IKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDP-----------  863
             +++  L+F    A++IPT  G+ISE D+ W  R +EA    L+ Y  DP           
Sbjct  4     VRLSKLMFTFCIAVLIPTIRGNISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERH  63

Query  862   ----SNVTSTLNHNVVKVILDYRnnnnetetetNSTRRHL---GKKKY---RGPCNATNP  713
                 ++VT+       K   + +       + TNSTRR L   GK K+   +GPC A+NP
Sbjct  64    YDNSTDVTTPEEDGDAKPEEEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNP  123

Query  712   IDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAV  536
             ID+CWRC  +WA +RK+L  C  GFG++  GGK G  Y VT N D  + NPK GTLRHAV
Sbjct  124   IDKCWRCRSDWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAV  183

Query  535   IQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRV  356
             IQ +PLWIIF   M+I+L QEL++ SHKTID RGA VH++ GAGIT+QFVKNV+IHG+ +
Sbjct  184   IQKEPLWIIFKNDMSIRLNQELLINSHKTIDARGANVHVAHGAGITMQFVKNVVIHGLHI  243

Query  355   HDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTA  176
             H I    GGMIRDS++HFG+RTR+DGDG+S++G+++IWLDH+SM KC DG+IDAI  ST 
Sbjct  244   HHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISMSKCQDGLIDAIVGSTG  303

Query  175   ITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             ITISNSHFT HN+VML GA + +  DK MQVT+A+NHFGK LVQRMPR R+G+ HVVN
Sbjct  304   ITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWGFVHVVN  361



>ref|XP_009598230.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=434

 Score =   377 bits (969),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 194/332 (58%), Positives = 241/332 (73%), Gaps = 15/332 (5%)
 Frame = -1

Query  994  LLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVIL  815
            L+F  L  +++     +ISEFD+VWQ R  +A   A  +Y P P  V   LN +V K   
Sbjct  8    LIFFVLVTLVLSIE-ANISEFDEVWQTRATQAKKTAQDSYNPHPETVADNLNKHVHK---  63

Query  814  DYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFG  635
                     E  +NSTRR L   KY GPC +TNPIDRCWRCDPNW   R +LADC LGFG
Sbjct  64   --------WEEGSNSTRRDL--HKYDGPCMSTNPIDRCWRCDPNWVKNRMKLADCVLGFG  113

Query  634  YKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQS  458
            +   GGK G  Y VTD SD  + NPK GTLRHAVIQ +PLWIIF   M I+L QEL++ S
Sbjct  114  HHTTGGKGGKIYVVTDPSDDDMVNPKPGTLRHAVIQPEPLWIIFKHHMVIRLNQELIMTS  173

Query  457  HKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDG  278
            +KTID RG +VHI+ GA   LQF+ NVIIHG+ +HDI  G+GG+IRDSINH+G R+RSDG
Sbjct  174  NKTIDARGQKVHIAFGASFMLQFINNVIIHGLHIHDIKAGNGGLIRDSINHYGFRSRSDG  233

Query  277  DGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKD  98
            DGIS+FG+T+IW+DH+SM  CDDG+IDA++ASTAITISNSHFT+HN+VMLFGA+D   +D
Sbjct  234  DGISIFGSTNIWIDHVSMSNCDDGLIDAVQASTAITISNSHFTNHNDVMLFGASDSYSED  293

Query  97   KIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             I+Q+T+AFNHFG+ L+QRMPR R+G+ H VN
Sbjct  294  SILQITLAFNHFGQGLIQRMPRVRWGFVHAVN  325



>ref|XP_009615547.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=434

 Score =   377 bits (969),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 191/331 (58%), Positives = 242/331 (73%), Gaps = 14/331 (4%)
 Frame = -1

Query  991  LFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILD  812
            LF+ +  +++ +   HI EFD+VW+ R ++A   A   Y P+P  V   LN+ V K +  
Sbjct  8    LFLFVMFVLVLSIEAHIGEFDEVWRKRAQQAKKAARHAYHPNPKIVADHLNNQVDKAV--  65

Query  811  YRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGY  632
                       +NS RR L   +Y G C ATNPID+CWRCDPNWA  R +LADC LGFG 
Sbjct  66   ---------RGSNSRRRDL--HRYNGQCKATNPIDQCWRCDPNWARNRMKLADCVLGFGR  114

Query  631  KAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSH  455
            K  GGK G  Y VTDNSD+ L NPK GTLRHAVIQ +PLWIIFA++M I+L +EL++ S+
Sbjct  115  KTTGGKGGKSYVVTDNSDNDLVNPKPGTLRHAVIQPQPLWIIFAKNMVIRLNEELIMTSN  174

Query  454  KTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGD  275
            KTID RG QVHI+ G G+ LQF+ NVII  +R+HD   G+GG+IRDS+NH+G RT+SDGD
Sbjct  175  KTIDARGKQVHIAHGGGLMLQFIHNVIISNLRIHDTKAGNGGLIRDSVNHYGYRTKSDGD  234

Query  274  GISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDK  95
            GIS+FG+T++W+DH+SM  C DG+IDA+EASTAITISN HFT HNEVMLFGA+D S +D 
Sbjct  235  GISIFGSTNVWIDHVSMSNCQDGLIDAVEASTAITISNCHFTKHNEVMLFGASDSSSRDS  294

Query  94   IMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            IMQ+T+AFNHFG+ L QRMPR R+G+ H VN
Sbjct  295  IMQITLAFNHFGQGLRQRMPRVRWGFVHAVN  325



>ref|XP_003554335.1| PREDICTED: pectate lyase-like [Glycine max]
Length=443

 Score =   378 bits (970),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 195/344 (57%), Positives = 238/344 (69%), Gaps = 17/344 (5%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             M G   K+   L V+ A I+IP     I+EFDD  + + +EA   AL+ Y P P +VT  
Sbjct  5     MVGSATKVAFNLLVTFA-IVIPCLEAGIAEFDDFLKAQADEAQKIALEAYVPVPEDVTDE  63

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRG--PCNATNPIDRCWRCDPNWANK  671
             LN +V               +  NSTRR L ++K R    C A+NPID CWRC+ NWAN 
Sbjct  64    LNFHV-------------HLSLENSTRRELRQRKGRSGKKCVASNPIDTCWRCNKNWAND  110

Query  670   RKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSM  494
             R RLA C  GFG +A GG  G  Y VTDNSD  + NPK GT+RHAV Q  PLWIIF RSM
Sbjct  111   RYRLAKCGKGFGRRATGGLGGPIYVVTDNSDDDMVNPKPGTIRHAVTQRGPLWIIFQRSM  170

Query  493   NIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDS  314
              IKL QELM+ S KTIDGRGA V    GAG+T+QFV NVIIHG+R+ +IV  +GGMIRDS
Sbjct  171   MIKLNQELMISSDKTIDGRGANVVFRDGAGLTIQFVNNVIIHGVRIKNIVPKEGGMIRDS  230

Query  313   INHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEV  134
              NH GLRT+SDGD IS+FGA+++W+DH+S+  C DG+ID I+ STAITISN H T HN+V
Sbjct  231   YNHVGLRTKSDGDAISIFGASNVWIDHVSLSNCADGLIDVIQGSTAITISNCHMTKHNDV  290

Query  133   MLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             MLFGA+D    DKIMQ+T+AFNHFG+ LVQRMPRCR+G+ HV+N
Sbjct  291   MLFGASDSYSGDKIMQITVAFNHFGQGLVQRMPRCRWGFVHVLN  334



>ref|XP_010502279.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   378 bits (970),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 193/338 (57%), Positives = 242/338 (72%), Gaps = 15/338 (4%)
 Frame = -1

Query  994  LLFVSLA-AIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVI  818
            ++FVSL+ A+ +P+   H++E+D+ W  R+ EA    L++Y+P+P NVT   N++    +
Sbjct  9    IVFVSLSLAVAVPSVHAHVAEYDEYWTQRQTEALHQTLESYDPEPLNVTDHFNYHAALAM  68

Query  817  LDYRnnnnetetetNSTRRHL-----GKKKYRGPCNATNPIDRCWRCDPNWANKRKRLAD  653
                    ET    N TRR L     GKK+  G   + N ID+CWR D NW   RK+LAD
Sbjct  69   --------ETTGTANETRRDLRQVKSGKKRRGGRYESLNAIDKCWRGDKNWDKNRKKLAD  120

Query  652  CSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQ  476
            C LGFG K  GGKNG  Y VTD SD+ L +PK GTLRHAV + +PLWIIFAR M IKL+Q
Sbjct  121  CVLGFGRKTTGGKNGPIYVVTDPSDNDLLDPKPGTLRHAVTRDRPLWIIFARHMIIKLQQ  180

Query  475  ELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGL  296
            EL++ + KTIDGRG  V+I+GGAG+TLQ+V+NVIIH I +  I  G GG+IRDS +HFGL
Sbjct  181  ELIITNDKTIDGRGVSVYITGGAGLTLQYVRNVIIHNIYIKQIKRGPGGLIRDSEHHFGL  240

Query  295  RTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGAN  116
            RT SDGDGI++FGAT++W+DH+SM  C DG+IDAI  STAITISNSHFTDH+EVMLFG  
Sbjct  241  RTMSDGDGINIFGATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGK  300

Query  115  DHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            +    DK MQ+T+AFNHFGKRL QRMPR RYG  HVVN
Sbjct  301  NTDVIDKKMQITVAFNHFGKRLKQRMPRARYGLVHVVN  338



>ref|XP_008679844.1| PREDICTED: pectate lyase [Zea mays]
 gb|AFW66064.1| pectate lyase-like protein [Zea mays]
Length=444

 Score =   377 bits (968),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 182/316 (58%), Positives = 228/316 (72%), Gaps = 11/316 (3%)
 Frame = -1

Query  946  HISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNST  767
            ++ +FDD  Q RKE A   A + Y PDP NVT++ N  V + +   R             
Sbjct  32   NVGQFDDHLQKRKELAEASAREAYRPDPYNVTNSFNAAVHRAVSSSRR----------EM  81

Query  766  RRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTD  587
            R    K K RGPC ATNPID+CWRC  +WA  R+RLA C+ GFG+   GG  G  Y VTD
Sbjct  82   RERPRKHKKRGPCRATNPIDKCWRCRRDWATDRQRLARCARGFGHATTGGLGGKIYVVTD  141

Query  586  NSD-HPLNPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGG  410
             +D   +NP+ GTLR  VIQ  PLWIIFARSM I+L QEL++ S KTIDGRGAQVHI+ G
Sbjct  142  PTDLDVVNPRPGTLRWGVIQPGPLWIIFARSMIIQLSQELLMSSDKTIDGRGAQVHIANG  201

Query  409  AGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHL  230
            AGIT+Q  +NVIIH + VHD+ H  GG++RDS  H G RTR+DGDGISLF AT++W+DH+
Sbjct  202  AGITVQLAQNVIIHNLHVHDVKHTMGGLMRDSPTHIGSRTRADGDGISLFSATNVWIDHI  261

Query  229  SMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRL  50
            SM  C+DG+ID +++ST ITISN HFT+HN+VMLFGA+D  P+D+IMQ+T+AFNHFG+ L
Sbjct  262  SMSNCEDGLIDVVQSSTGITISNCHFTNHNDVMLFGASDSWPQDQIMQITVAFNHFGRGL  321

Query  49   VQRMPRCRYGYFHVVN  2
            VQRMPRCR+G+FHVVN
Sbjct  322  VQRMPRCRWGFFHVVN  337



>gb|KHN13490.1| Putative pectate lyase 3, partial [Glycine soja]
Length=364

 Score =   374 bits (960),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 181/253 (72%), Positives = 208/253 (82%), Gaps = 3/253 (1%)
 Frame = -1

Query  751  KKKYRG--PCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSD  578
            K KYRG  PC ATNPIDRCWRCDPNWAN R++LADC  GFG    GGK G FY VTD SD
Sbjct  1    KGKYRGDGPCIATNPIDRCWRCDPNWANNRQKLADCVQGFGRNTVGGKGGPFYVVTDPSD  60

Query  577  HPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGI  401
              + NPK GTLRHAV +  PLWIIFARSM I L+QEL++ S+KTIDGRG  V+I+ GAGI
Sbjct  61   DDMVNPKPGTLRHAVTRDGPLWIIFARSMFITLQQELIMNSNKTIDGRGVDVYIAKGAGI  120

Query  400  TLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMR  221
            T+QFVKN+IIHGI+V DIV  +GGMIRDS  H+G RT+SDGDGIS+FG+++IW+DH+SMR
Sbjct  121  TVQFVKNIIIHGIKVFDIVIREGGMIRDSETHYGFRTKSDGDGISIFGSSNIWIDHVSMR  180

Query  220  KCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQR  41
             C DG+IDAI  STAITISNSHFTDHNEVMLFGA+D    DKIMQ+T+AFNHFGKRLVQR
Sbjct  181  NCSDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDSYSDDKIMQITLAFNHFGKRLVQR  240

Query  40   MPRCRYGYFHVVN  2
            MPR RYG+ H VN
Sbjct  241  MPRVRYGFVHSVN  253



>ref|XP_003613595.1| Pectate lyase [Medicago truncatula]
 gb|AES96553.1| pectate lyase P59-like protein [Medicago truncatula]
Length=449

 Score =   377 bits (967),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 193/347 (56%), Positives = 245/347 (71%), Gaps = 21/347 (6%)
 Frame = -1

Query  1015  FQIKILSLLFVSLAAIIIPTSLGHISEFDDV--------WQNRKEEAWMHALKTYEPDPS  860
             + I +L+ L V+++ ++        + +D +        WQ +   A M   K Y PDP 
Sbjct  5     YPIFLLTCLVVTISTLVHANVKEDKAYWDRIAPVLNTTYWQQKASAAAMKNDKAYTPDPY  64

Query  859   NVTSTLNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNW  680
              V+  L+H+V ++I+  +             RR+L   K RGPC ATNPIDRCWRCDPNW
Sbjct  65    AVSGNLSHSVSEMIIGNQG------------RRNLAGGKARGPCMATNPIDRCWRCDPNW  112

Query  679   ANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFA  503
             AN R++LADC  GFG K  GGK G  Y VTD SD  + NP+ GTLR  V +  PLWI FA
Sbjct  113   ANNRQKLADCVKGFGRKTTGGKGGPIYVVTDPSDSDMVNPRPGTLRFGVTRNGPLWITFA  172

Query  502   RSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMI  323
             RSM I+L QEL++ SHKTIDGRGA V I+ GAGIT+QF++NVIIHGI++ DIV G GG+I
Sbjct  173   RSMTIRLNQELIMTSHKTIDGRGADVTIASGAGITIQFIENVIIHGIKIFDIVVGSGGLI  232

Query  322   RDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDH  143
             RD  +HFG RT SDGDGIS+FG+++IW+DH+SMR C DG++DAI  STAITISNSHFTDH
Sbjct  233   RDGQDHFGQRTMSDGDGISIFGSSNIWIDHVSMRNCRDGLVDAIMGSTAITISNSHFTDH  292

Query  142   NEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             NEVMLFGA+D    D+ MQ+T+AFNHFGKRL+QRMPRCR+G+ HV+N
Sbjct  293   NEVMLFGASDGYGGDEKMQITVAFNHFGKRLIQRMPRCRFGFIHVLN  339



>ref|XP_006354795.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=435

 Score =   376 bits (966),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 193/331 (58%), Positives = 242/331 (73%), Gaps = 15/331 (5%)
 Frame = -1

Query  991  LFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILD  812
             FV L  ++      +I EFD+VW+ R  +A  +A ++Y P P  V + LN +V +    
Sbjct  10   FFVILCTLVFSIE-ANIGEFDEVWRTRATQANKNAKESYNPHPEKVAANLNKHVHR----  64

Query  811  YRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGY  632
                   +E  +NSTRR L   KY GPC ATNPIDRCWRCDP+WA  R++LADC LGFG+
Sbjct  65   -------SEEGSNSTRRDL--HKYNGPCVATNPIDRCWRCDPHWAKNRQKLADCVLGFGH  115

Query  631  KAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSH  455
               GGK G  Y VTD  D+ + NPK GTLRHAVIQ  PLWIIFA  M IKL QEL++   
Sbjct  116  HTTGGKGGKIYIVTDPGDNDMVNPKPGTLRHAVIQPGPLWIIFAHHMVIKLNQELIMTGD  175

Query  454  KTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGD  275
            KTID RG QVHI+GGA + LQ++ NVIIHG+ +HDI  G+GG+IRDSINH+G RTRSDGD
Sbjct  176  KTIDARGQQVHITGGASLMLQYINNVIIHGLHIHDIKSGNGGLIRDSINHYGFRTRSDGD  235

Query  274  GISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDK  95
            GIS+FG+T+IW+DH+SM  CDDG+IDA++ASTAITISN HFT HN+VMLFGA+D   +D 
Sbjct  236  GISIFGSTNIWIDHVSMSNCDDGLIDAVQASTAITISNCHFTHHNDVMLFGASDSYKQDA  295

Query  94   IMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            I+Q+T+AFNHFG+ L+QRMPR R+G+ H VN
Sbjct  296  ILQITLAFNHFGQGLIQRMPRVRWGFVHAVN  326



>gb|AAQ62996.1| oil palm polygalacturonase allergen PEST361 [Elaeis guineensis]
Length=447

 Score =   376 bits (966),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 205/345 (59%), Positives = 244/345 (71%), Gaps = 14/345 (4%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             MEG Q K     F          S  +I EFDD WQ + EEA   +   Y PDP  VT  
Sbjct  1     MEGLQTKPRFFFFSLFFLASAALSGANIVEFDDHWQKKAEEALARSRAAYNPDPEAVTHD  60

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLG---KKKYRGPCNATNPIDRCWRCDPNWAN  674
              N  V   + + RN          STRR L    + K++GPC ATNPIDRCWRC  NW N
Sbjct  61    FNKAVHLALSEARN----------STRRTLRSVHRNKFKGPCVATNPIDRCWRCQKNWIN  110

Query  673   KRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARS  497
              RK+LA C+ GFG  A GGKNGDFY VTD SD  L NPK GTLR  VIQ +PLWIIFAR 
Sbjct  111   HRKKLATCAKGFGRNAIGGKNGDFYVVTDPSDDDLVNPKYGTLRWGVIQDRPLWIIFARD  170

Query  496   MNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRD  317
             M I+L +ELM+ S+KTIDGRGA VHI+ GA IT+QFV +VIIHGI +HDI   +GG+IRD
Sbjct  171   MIIRLSEELMINSNKTIDGRGANVHIAFGAQITIQFVHDVIIHGIHIHDIRPSNGGIIRD  230

Query  316   SINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNE  137
             S+ HFG+RT+SDGDGIS++G++DIW+DH S+R C DG+IDAIEASTAITISN HFT HN+
Sbjct  231   SLQHFGIRTKSDGDGISIYGSSDIWIDHCSLRNCADGLIDAIEASTAITISNCHFTHHND  290

Query  136   VMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             V+LFGA+D +  D +MQ T+AFNHFGK LVQRMPRCR+G+FHVVN
Sbjct  291   VLLFGASDSNEHDSMMQATVAFNHFGKGLVQRMPRCRWGFFHVVN  335



>ref|XP_010915114.1| PREDICTED: LOW QUALITY PROTEIN: pectate lyase-like [Elaeis guineensis]
Length=444

 Score =   376 bits (966),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 205/345 (59%), Positives = 244/345 (71%), Gaps = 14/345 (4%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             MEG Q K     F          S  +I EFDD WQ + EEA   +   Y PDP  VT  
Sbjct  1     MEGLQTKPRFFFFSLFFLASAALSGANIVEFDDHWQKKAEEALARSRAAYNPDPEGVTHD  60

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLG---KKKYRGPCNATNPIDRCWRCDPNWAN  674
              N  V   + + RN          STRR L    + K++GPC ATNPIDRCWRC  NW N
Sbjct  61    FNKAVHLALSEARN----------STRRTLRSVHRNKFKGPCVATNPIDRCWRCQKNWIN  110

Query  673   KRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARS  497
              RK+LA C+ GFG  A GGKNGDFY VTD SD  L NPK GTLR  VIQ +PLWIIFAR 
Sbjct  111   HRKKLATCAKGFGRNAIGGKNGDFYVVTDPSDDDLVNPKYGTLRWGVIQDRPLWIIFARD  170

Query  496   MNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRD  317
             M I+L +ELM+ S+KTIDGRGA VHI+ GA IT+QFV +VIIHGI +HDI   +GG+IRD
Sbjct  171   MIIRLSEELMINSNKTIDGRGANVHIAFGAQITIQFVHDVIIHGIHIHDIRPSNGGIIRD  230

Query  316   SINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNE  137
             S+ HFG+RT+SDGDGIS++G++DIW+DH S+R C DG+IDAIEASTAITISN HFT HN+
Sbjct  231   SLQHFGIRTKSDGDGISIYGSSDIWIDHCSLRNCADGLIDAIEASTAITISNCHFTHHND  290

Query  136   VMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             V+LFGA+D +  D +MQ T+AFNHFGK LVQRMPRCR+G+FHVVN
Sbjct  291   VLLFGASDSNEHDSMMQATVAFNHFGKGLVQRMPRCRWGFFHVVN  335



>ref|XP_008221660.1| PREDICTED: probable pectate lyase 3 [Prunus mume]
Length=443

 Score =   376 bits (965),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 195/314 (62%), Positives = 233/314 (74%), Gaps = 13/314 (4%)
 Frame = -1

Query  937  EFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNSTRRH  758
            + D  W+ R EEA   A+++++ DP  VT   N NV ++++               TRR+
Sbjct  32   QLDAYWKQRAEEAEKVAMQSFQTDPELVTEEFNSNVGELLMKLN-----------GTRRN  80

Query  757  L-GKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNS  581
            L G KKY GPC ATNPID CWRCD NWA  RKRLA+C  GFG K  GGK G  Y VTD S
Sbjct  81   LRGVKKYNGPCMATNPIDACWRCDKNWAKNRKRLANCVQGFGRKTTGGKGGPIYVVTDPS  140

Query  580  DHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAG  404
            D  L NPK GTLRHAVIQ  PLWIIFARSM I+L+QEL+V S KTIDGRGA V+I  GAG
Sbjct  141  DLDLVNPKPGTLRHAVIQKGPLWIIFARSMVIRLQQELIVTSDKTIDGRGANVNIHDGAG  200

Query  403  ITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSM  224
            ITLQFVKNVII  + +  IV   GGMIRDS++H G RTRSDGDGIS+FG++++W+DH+SM
Sbjct  201  ITLQFVKNVIITNLHIKRIVPKGGGMIRDSVDHLGQRTRSDGDGISIFGSSNVWIDHVSM  260

Query  223  RKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQ  44
              C DG+IDAI  STAITISNSHFT HN+VMLFGA++   +DKIMQ+T+AFNHFG+ LVQ
Sbjct  261  ENCADGLIDAIMGSTAITISNSHFTHHNDVMLFGASNSYTQDKIMQITVAFNHFGQGLVQ  320

Query  43   RMPRCRYGYFHVVN  2
            RMPRCR+G+FHVVN
Sbjct  321  RMPRCRHGFFHVVN  334



>ref|XP_011009454.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=474

 Score =   377 bits (968),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 200/358 (56%), Positives = 247/358 (69%), Gaps = 27/358 (8%)
 Frame = -1

Query  994  LLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVIL  815
            L+FV   A +IP+ L  +  FDDVW+ R EEA    L+ Y PDP   T   N  V K  L
Sbjct  8    LIFVFTLATLIPSLLADLGIFDDVWRKRAEEAKKMTLEAYVPDPEEATDAFNVEVNKYSL  67

Query  814  DYRnnnnete------------------------tetNSTRRHL--GKKKYRGPCNATNP  713
               +++                               NSTRR+L  G+KKY GPC  TNP
Sbjct  68   AKNSSSLYGAFGSTNITNLDLDDIDDNDNDADFEQFANSTRRNLRQGRKKYAGPCQVTNP  127

Query  712  IDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHP-LNPKRGTLRHAV  536
            IDRCWRC  NWA  RK+LA C+LGFG +  GG  G  Y VTD+SD+  + PK GTLRHAV
Sbjct  128  IDRCWRCQRNWAKNRKQLAKCALGFGRRTTGGMAGRIYVVTDSSDNNVMKPKPGTLRHAV  187

Query  535  IQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRV  356
            IQ +PLWIIF+++MNIKL +EL++ SHKTIDGRG  VHIS GAGIT+QF+ NVIIHGIR+
Sbjct  188  IQKEPLWIIFSKNMNIKLSKELIMSSHKTIDGRGHHVHISYGAGITIQFIHNVIIHGIRI  247

Query  355  HDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTA  176
            H I+   GG IRDS++H+G+RT SDGDGIS+FG+TD+W+DH+SM +C DG+IDAI  STA
Sbjct  248  HHIIATSGGNIRDSVDHYGIRTNSDGDGISIFGSTDVWIDHVSMSRCTDGLIDAIMGSTA  307

Query  175  ITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            ITISN HFT HN+ +L GA+D    D +MQVT+AFNHFG+ LVQRMPRCR+G+FHVVN
Sbjct  308  ITISNCHFTHHNDAILLGASDSYSGDHLMQVTVAFNHFGQGLVQRMPRCRWGFFHVVN  365



>gb|ACF87417.1| unknown [Zea mays]
Length=444

 Score =   375 bits (964),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 183/320 (57%), Positives = 232/320 (73%), Gaps = 19/320 (6%)
 Frame = -1

Query  946  HISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNST  767
            ++ +FDD  Q RKE A   A + Y PDP NVT++ N  V + +              +S+
Sbjct  32   NVGQFDDHLQKRKELAEASAREAYRPDPYNVTNSFNAAVHRAV--------------SSS  77

Query  766  RRHLG----KKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFY  599
            RR +     K K RGPC ATNPID+CWRC  +WA  R+RLA C+ GFG+   GG  G  Y
Sbjct  78   RREMWERPRKHKKRGPCRATNPIDKCWRCRRDWATDRQRLARCARGFGHATTGGLGGKIY  137

Query  598  TVTDNSD-HPLNPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVH  422
             VTD +D   +NP+ GTLR  VIQ  PLWIIFARSM I+L QEL++ S KTIDGRGAQVH
Sbjct  138  VVTDPTDLDVVNPRPGTLRWGVIQPGPLWIIFARSMIIQLSQELLMSSDKTIDGRGAQVH  197

Query  421  ISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIW  242
            I+ GAGIT+Q  +NVIIH + VHD+ H  GG++RDS  H G RTR+DGDGISLF AT++W
Sbjct  198  IANGAGITVQLAQNVIIHNLHVHDVKHTMGGLMRDSPTHIGSRTRADGDGISLFSATNVW  257

Query  241  LDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHF  62
            +DH+SM  C+DG+ID +++ST ITISN HFT+HN+VMLFGA+D  P+D+IMQ+T+AFNHF
Sbjct  258  IDHISMSNCEDGLIDVVQSSTGITISNCHFTNHNDVMLFGASDSWPQDQIMQITVAFNHF  317

Query  61   GKRLVQRMPRCRYGYFHVVN  2
            G+ LVQRMPRCR+G+FHVVN
Sbjct  318  GRGLVQRMPRCRWGFFHVVN  337



>ref|XP_006357289.1| PREDICTED: probable pectate lyase 3-like [Solanum tuberosum]
Length=459

 Score =   376 bits (965),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 198/356 (56%), Positives = 236/356 (66%), Gaps = 37/356 (10%)
 Frame = -1

Query  1009  IKILSLL-FVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHN  833
             I + SLL F+S    IIP    +I++FD   + R EEA   +L  Y  +P  VT   N  
Sbjct  11    IFLFSLLCFIS----IIPKLYANIADFDPYLEKRAEEALQSSLAAYNENPEAVTQIFNKE  66

Query  832   VVKVILDYRnnnnetetetNSTRRHL------------------GKKKYRGPCNATNPID  707
             V + IL+              TRRHL                  G +K    C A NPID
Sbjct  67    VGETILN-------------GTRRHLKEEDKEDKNEKVEKDDKEGDEKSVDICKAYNPID  113

Query  706   RCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPLN-PKRGTLRHAVIQ  530
             +CWRCD NWAN RK LADC+ GFG+   GGK+G FY VTD SD+ +  P  GTLRHAVIQ
Sbjct  114   KCWRCDKNWANNRKALADCARGFGHGTTGGKDGKFYVVTDPSDNNVEEPVPGTLRHAVIQ  173

Query  529   IKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHD  350
              +PLWIIF +SM IKLKQELM+ + KTIDGRG  VH++ GAG+TLQFV NVI+H IRVH 
Sbjct  174   EEPLWIIFEKSMIIKLKQELMINNDKTIDGRGISVHVAYGAGLTLQFVHNVIVHNIRVHH  233

Query  349   IVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAIT  170
             I+  DGGMIRDS+ H GLRT SDGD ISLFGA  IW+DH ++ K  DG++DAI ASTAIT
Sbjct  234   ILSKDGGMIRDSVKHIGLRTVSDGDAISLFGANRIWIDHCTLTKGADGLVDAIMASTAIT  293

Query  169   ISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             ISN  F  HN+VML GAND  P+DKIMQVT+AFN FGK  +QRMPRCR+G+FHVVN
Sbjct  294   ISNCKFNHHNDVMLLGANDAFPQDKIMQVTVAFNRFGKGCIQRMPRCRWGFFHVVN  349



>ref|XP_010683249.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=444

 Score =   375 bits (964),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 195/317 (62%), Positives = 236/317 (74%), Gaps = 9/317 (3%)
 Frame = -1

Query  949  GHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNS  770
             +I+EFD+ W  R+ EA  +  + Y P+P NVT+  NH V        + +     + NS
Sbjct  27   ANIAEFDEYWHKRRLEAVKYFEEAYHPEPYNVTNHFNHQV--------HLHARNMKKLNS  78

Query  769  TRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVT  590
            TRR L  K + GPC ATNPID CWRC PNWA  RKRLADC++GFG    GGK+G  Y VT
Sbjct  79   TRRGLLGKGHIGPCVATNPIDACWRCQPNWAENRKRLADCAIGFGKGTTGGKDGRIYVVT  138

Query  589  DNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISG  413
            D+SD+ + NPK GTLRHAVIQ +PLWIIFARSMNI+L QEL++   KTID RGA VHI+ 
Sbjct  139  DSSDNDMQNPKPGTLRHAVIQTEPLWIIFARSMNIRLTQELIMTGDKTIDARGANVHIAH  198

Query  412  GAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDH  233
            GAGIT+QF+KNVIIHG+ +H I  GDGG+IRDS NHFGLRTRSDGD IS+FGA++IW+DH
Sbjct  199  GAGITIQFIKNVIIHGLHIHQIYPGDGGLIRDSANHFGLRTRSDGDAISIFGASNIWIDH  258

Query  232  LSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKR  53
            +SM +  DG+ID I+ STAITISN H TDHNEV LFGA +    D+ MQVT+AFNHFGK 
Sbjct  259  VSMARGTDGLIDIIQGSTAITISNCHMTDHNEVFLFGATNDYTDDQKMQVTVAFNHFGKG  318

Query  52   LVQRMPRCRYGYFHVVN  2
            LVQRMPR R+G+ HVVN
Sbjct  319  LVQRMPRARFGFIHVVN  335



>gb|KHG05193.1| hypothetical protein F383_30875 [Gossypium arboreum]
Length=385

 Score =   373 bits (958),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 182/260 (70%), Positives = 209/260 (80%), Gaps = 3/260 (1%)
 Frame = -1

Query  772  STRRHL-GK-KKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFY  599
            STRR L GK KKY GPC A NPIDRCWRC  NWA  RKRLA C LGFG+K +GGK G++Y
Sbjct  15   STRRSLRGKHKKYTGPCMAINPIDRCWRCKKNWAKNRKRLAKCVLGFGHKTRGGKKGEYY  74

Query  598  TVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVH  422
             VTDNSD  + NPK GTLRHAVIQ +PLWIIFA  MNIKL +ELMVQSHKTIDGRG  VH
Sbjct  75   LVTDNSDDDVVNPKPGTLRHAVIQKRPLWIIFAHDMNIKLSKELMVQSHKTIDGRGVNVH  134

Query  421  ISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIW  242
            I+ G GITLQFV NVIIH I +H +V   GG+IRDS +H+G RT  DGDGIS+FG++ IW
Sbjct  135  IAYGCGITLQFVHNVIIHNIHIHRVVRSSGGLIRDSEDHYGYRTVGDGDGISIFGSSKIW  194

Query  241  LDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHF  62
            LDH+SM +C DG+IDAI+ STAITISN HFT H+ V+L GA+D   KD+ MQVT+AFNHF
Sbjct  195  LDHISMSECQDGLIDAIQGSTAITISNCHFTHHDHVILLGASDTYSKDQYMQVTLAFNHF  254

Query  61   GKRLVQRMPRCRYGYFHVVN  2
            GK L+QRMPRCR+GYFHVVN
Sbjct  255  GKELIQRMPRCRWGYFHVVN  274



>ref|XP_002453531.1| hypothetical protein SORBIDRAFT_04g007450 [Sorghum bicolor]
 gb|EES06507.1| hypothetical protein SORBIDRAFT_04g007450 [Sorghum bicolor]
Length=445

 Score =   375 bits (962),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 182/318 (57%), Positives = 231/318 (73%), Gaps = 14/318 (4%)
 Frame = -1

Query  949  GHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNS  770
             +I++FD+ WQ RKE A     +TY PDP NVT++ N  V +     R            
Sbjct  32   ANIADFDEHWQKRKELAEASVRETYRPDPYNVTNSFNVAVHRATSLRR------------  79

Query  769  TRRHLGKK-KYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTV  593
            T R + +K K +GPC ATNPID+CWRC  +WA  R RLA C+ GFG    GG  G  Y V
Sbjct  80   TMREMPRKHKKKGPCRATNPIDKCWRCKNDWATDRFRLARCARGFGQATTGGLGGPIYIV  139

Query  592  TDNSD-HPLNPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHIS  416
            TD SD   +NP+ GTLR  VIQ  PLWIIFA+SM I+L QEL+V S KTIDGRGAQVHI+
Sbjct  140  TDPSDGDVVNPRPGTLRWGVIQPGPLWIIFAKSMIIQLSQELLVSSDKTIDGRGAQVHIA  199

Query  415  GGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLD  236
             GAGIT+Q  +NVIIH + VHD++H  GG++RDS  H G RT++DGDGISLF AT++W+D
Sbjct  200  NGAGITVQLARNVIIHNLHVHDVLHSMGGLMRDSPTHVGSRTKADGDGISLFQATNVWID  259

Query  235  HLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGK  56
            H+SM  C+DG+ID +++ST ITISN HFT+HN+VMLFGA+D  P+D++MQ+T+AFNHFG+
Sbjct  260  HISMSNCEDGLIDVVQSSTGITISNCHFTNHNDVMLFGASDSYPQDQMMQITVAFNHFGR  319

Query  55   RLVQRMPRCRYGYFHVVN  2
             LVQRMPRCR+G+FHVVN
Sbjct  320  GLVQRMPRCRWGFFHVVN  337



>ref|XP_010320663.1| PREDICTED: probable pectate lyase 3 [Solanum lycopersicum]
Length=386

 Score =   372 bits (955),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 190/354 (54%), Positives = 234/354 (66%), Gaps = 29/354 (8%)
 Frame = -1

Query  1015  FQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNH  836
             F   ++ L  +   + IIP    +I++FD   + R EEA   +L  Y  +P  VT   N 
Sbjct  6     FNNSVIFLFSLFCFSSIIPKLYANIADFDPYLEKRAEEALQSSLAAYNENPEGVTQIFNK  65

Query  835   NVVKVILDYRnnnnetetetNSTRRHLGK---------------KKYRGPCNATNPIDRC  701
              V + +L+              TRRHL +               +K    C A NPID+C
Sbjct  66    EVGETLLN-------------GTRRHLKEKDKEDKNDKDDKEGDEKSVDGCKAYNPIDKC  112

Query  700   WRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPLN-PKRGTLRHAVIQIK  524
             WRCD NWAN RK LADC+ GFG+   GGK+G FY VTD SD+ +  P  GTLRHAVIQ +
Sbjct  113   WRCDKNWANNRKALADCARGFGHGTTGGKDGRFYVVTDPSDNNVEEPVPGTLRHAVIQEE  172

Query  523   PLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIV  344
             PLWIIF +SM I+LKQELM+ S+KTIDGRG  VH++ G G+TLQFV NVI+H IRVH I+
Sbjct  173   PLWIIFEKSMIIRLKQELMINSNKTIDGRGVSVHVAYGGGLTLQFVHNVIVHNIRVHHIL  232

Query  343   HGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITIS  164
               +GGMIRDS+ H GLRT SDGD ISLFGA  IW+DH ++ K  DG++DAI ASTAITIS
Sbjct  233   SKNGGMIRDSVKHIGLRTVSDGDAISLFGANRIWIDHCTLTKGADGLLDAIMASTAITIS  292

Query  163   NSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             N  F  HN+VML GAND  P+DKIMQVT+AFN FGK  +QRMPRCR+G+FHVVN
Sbjct  293   NCKFNHHNDVMLLGANDAFPQDKIMQVTVAFNRFGKGCIQRMPRCRWGFFHVVN  346



>gb|EAY85003.1| hypothetical protein OsI_06363 [Oryza sativa Indica Group]
Length=439

 Score =   373 bits (958),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 185/318 (58%), Positives = 227/318 (71%), Gaps = 23/318 (7%)
 Frame = -1

Query  943  ISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNSTR  764
            I EFD+ W+ R+  A   A + Y+PDP NVT   N +  + +L                R
Sbjct  33   IGEFDEHWEKRRAAAEAAAEEVYKPDPFNVT---NESTERGVL----------------R  73

Query  763  RHLGKK--KYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVT  590
            R L  K  KY+GPC ATNPIDRCWRC  +WA  RKRLA C++GFG  A GG  G  Y VT
Sbjct  74   RELSGKNSKYKGPCLATNPIDRCWRCRKDWATDRKRLARCAMGFGRGATGGVRGKIYVVT  133

Query  589  DNSD-HPLNPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHIS-  416
            D  D    NP+ GTLR   +Q  PLWI FA+SM I+L QEL+V S KTIDGRGAQVHI+ 
Sbjct  134  DPGDGDAANPRYGTLRWGAMQAAPLWITFAKSMVIRLTQELLVASDKTIDGRGAQVHIAR  193

Query  415  GGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLD  236
            GGAGIT+QF +NVII  + VHD+ H DGG +RDS  H G RTR+DGDGISLF ATD+W+D
Sbjct  194  GGAGITVQFARNVIITSLHVHDVKHSDGGAVRDSPTHIGPRTRADGDGISLFAATDVWVD  253

Query  235  HLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGK  56
            H+SM  C+DG+ID ++ ST +TISNSHFT+HN+VMLFGA+D  P+DK+MQ+T+AFNHFG+
Sbjct  254  HVSMSMCEDGLIDVVQGSTGVTISNSHFTNHNDVMLFGASDSYPQDKVMQITVAFNHFGR  313

Query  55   RLVQRMPRCRYGYFHVVN  2
             LVQRMPRCR+G+FHVVN
Sbjct  314  GLVQRMPRCRWGFFHVVN  331



>ref|XP_009758350.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=445

 Score =   373 bits (958),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 192/348 (55%), Positives = 234/348 (67%), Gaps = 20/348 (6%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLA-AIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTS  848
             M  F    +  L+  L  A +IP    +I+EFD   + + EEA   +L  Y  +P  +T 
Sbjct  1     MASFSCNSVIFLYSLLCIASLIPNLHANIAEFDPYLEKKAEEALKSSLAAYNENPEELTD  60

Query  847   TLNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGP-----CNATNPIDRCWRCDPN  683
             T N  V + I +              TRRHL ++          C A NPID+CWRCD N
Sbjct  61    TFNKEVGETIFN-------------GTRRHLKEEDKDDKDDNDGCKAYNPIDKCWRCDKN  107

Query  682   WANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPLN-PKRGTLRHAVIQIKPLWIIF  506
             WAN RK LADC+ GFG+   GGK+G FY VTD SD  +  PK GTLRHAVIQ +PLWIIF
Sbjct  108   WANNRKALADCARGFGHGTTGGKDGKFYVVTDPSDDNVEEPKPGTLRHAVIQEEPLWIIF  167

Query  505   ARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGM  326
              +SM IKL+QELM+ + KTIDGRG  VH++ GAG+T+QFV NVI+H IRVH I+   GGM
Sbjct  168   EKSMIIKLQQELMINNDKTIDGRGVSVHVAYGAGLTIQFVHNVIVHNIRVHHILSTSGGM  227

Query  325   IRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTD  146
             IRDSI+H GLRT SDGD IS+FGA  IW+DH ++ K  DG+IDAI ASTAITISN  F  
Sbjct  228   IRDSIDHIGLRTVSDGDAISIFGANRIWIDHCTLTKGADGLIDAIMASTAITISNCKFNH  287

Query  145   HNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             HN+VML GAND  P+DKIMQVT+AFN FGK  +QRMPRCR+G+FHVVN
Sbjct  288   HNDVMLLGANDAFPQDKIMQVTVAFNRFGKGCIQRMPRCRWGFFHVVN  335



>ref|XP_007139601.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
 gb|ESW11595.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
Length=444

 Score =   373 bits (958),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 192/342 (56%), Positives = 240/342 (70%), Gaps = 9/342 (3%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             M G   K+  ++ V+ A I IP   G I EFDD  + +  EA   AL++Y PDP N+T  
Sbjct  1     MVGSSSKVSIIILVAFA-ITIPCLEGGIGEFDDFLKGQALEAHEIALESYVPDPVNMTDD  59

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRK  665
             LN NV   + +        + E+N TRR L K+KY GPC A NPIDRCWRC   WA  R 
Sbjct  60    LNINVHGALTEV------FKEESNHTRREL-KQKYGGPCLALNPIDRCWRCKKGWAKNRF  112

Query  664   RLADCSLGFGYKAKGGKNGDFYTVTDNSDH-PLNPKRGTLRHAVIQIKPLWIIFARSMNI  488
             +LA C+ GFG KA GG  G  Y V D SD  P+NPK GTLR  V+Q +PLWIIFARSM I
Sbjct  113   KLAHCAKGFGRKATGGLEGKMYIVNDPSDDDPINPKPGTLRFGVLQKEPLWIIFARSMII  172

Query  487   KLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSIN  308
             KL  EL++ S KTIDGRGA V I  G+G+T+QFV NVIIHG+R+ +I    GG IRDS N
Sbjct  173   KLNYELLISSDKTIDGRGANVMIKDGSGLTMQFVNNVIIHGLRLQNIKSTPGGTIRDSWN  232

Query  307   HFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVML  128
             H G+RT++DGD IS+FG+++IW+DHLS+  C+DG++D I+ ST ITISN H T HN+VML
Sbjct  233   HVGIRTKADGDAISIFGSSNIWIDHLSLSDCEDGLVDIIQGSTGITISNCHMTKHNDVML  292

Query  127   FGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             FGA+D    DKIMQVT+AFNHFG+ L+QRMPRCR+G+FHV+N
Sbjct  293   FGASDTFTGDKIMQVTVAFNHFGQGLIQRMPRCRWGFFHVLN  334



>ref|XP_009599232.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=445

 Score =   373 bits (957),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 192/348 (55%), Positives = 233/348 (67%), Gaps = 20/348 (6%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLA-AIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTS  848
             M  F    +  LF  L  A +IP    +I+EFD   + + EEA   +L  Y  +P  +T 
Sbjct  1     MASFSCNSVIFLFSLLCIASLIPNLHANIAEFDPYLEKKAEEALKSSLAAYNENPEELTD  60

Query  847   TLNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGP-----CNATNPIDRCWRCDPN  683
             T N  V + I +              TRRHL ++          C A NPID+CWRCD N
Sbjct  61    TFNKEVGETIFN-------------GTRRHLKEEDKDDKDDNDGCKAYNPIDKCWRCDKN  107

Query  682   WANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPLN-PKRGTLRHAVIQIKPLWIIF  506
             WAN RK LADC+ GFG+   GGK+G FY VTD SD  +  P  GTLRHAVIQ +PLWIIF
Sbjct  108   WANNRKALADCARGFGHGTTGGKDGKFYVVTDPSDDNVEEPNPGTLRHAVIQEEPLWIIF  167

Query  505   ARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGM  326
              +SM I+LKQELM+ + KTIDGRG  VH++ GAG+T+QFV NVI+H IRVH I+   GGM
Sbjct  168   EKSMIIRLKQELMINNDKTIDGRGVSVHVAYGAGLTIQFVHNVIVHNIRVHHILSTSGGM  227

Query  325   IRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTD  146
             IRDSI+H GLRT SDGD IS+FGA  IW+DH ++ K  DG+IDAI ASTAITISN  F  
Sbjct  228   IRDSIDHIGLRTVSDGDAISIFGANRIWIDHCTLTKGADGLIDAIMASTAITISNCKFNH  287

Query  145   HNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             HN+VML GAND  P+DKIMQVT+AFN FGK  +QRMPRCR+G+FHVVN
Sbjct  288   HNDVMLLGANDAFPQDKIMQVTVAFNRFGKGCIQRMPRCRWGFFHVVN  335



>ref|XP_009110541.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=458

 Score =   373 bits (958),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 198/351 (56%), Positives = 238/351 (68%), Gaps = 18/351 (5%)
 Frame = -1

Query  1024  MEGFQIKILSLLFV---SLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNV  854
             M    + I   LFV   SL A + P    +++ FD+ W  R+ +A    + +++P+P NV
Sbjct  1     MTAAVLNIGGYLFVFCLSLLATLTPHVGANVAVFDNYWLQRQGDALKQTIASFDPNPLNV  60

Query  853   TSTLNHNVVKVILDYRnnnnetetetNSTRRHLG------KKKYRGPCNATNPIDRCWRC  692
             T  LN++V   +        +    TNSTRR L       K K  G C A NPIDRCWRC
Sbjct  61    TDHLNYHVALAV--------DATESTNSTRRELSQVRNGRKLKRSGKCVAYNPIDRCWRC  112

Query  691   DPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLW  515
             + +W   RK+LADC LGFG +  GGK+G  Y V D SD  L NPK GTLRHAV +  PLW
Sbjct  113   NGDWEKNRKKLADCVLGFGRRTTGGKDGPIYVVNDASDDDLINPKPGTLRHAVTRDGPLW  172

Query  514   IIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGD  335
             IIF  SM I L+QEL++ S KTIDGRGA+V+I  GAG+TLQFV NVIIH I V  +V   
Sbjct  173   IIFGSSMIINLQQELIITSDKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKHVVPKS  232

Query  334   GGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSH  155
             GG+IRDS  H GLRT SDGDGISLFGAT++W+DH+SM +C DG+IDAI  STAITISNSH
Sbjct  233   GGLIRDSEQHIGLRTVSDGDGISLFGATNVWIDHVSMTRCSDGMIDAILGSTAITISNSH  292

Query  154   FTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             FTDH EVMLFGAND    DK MQ+T+AFNHFGKRL QRMPRCR+G  HVVN
Sbjct  293   FTDHEEVMLFGANDKHVIDKKMQITVAFNHFGKRLDQRMPRCRFGTIHVVN  343



>ref|XP_010670318.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=450

 Score =   372 bits (956),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 192/354 (54%), Positives = 249/354 (70%), Gaps = 26/354 (7%)
 Frame = -1

Query  1027  EMEGFQIKILSLLFVSLAAIIIPT----SLGHI-------SEFDDVWQNRKEEAWMHALK  881
             E   F+I+I   +F ++  + IPT    ++GH+       +E D+ +Q +  EA+  +L 
Sbjct  2     EFVKFKIQIPIFIFATIF-VAIPTIQANTIGHVGNHTTKDTEHDEWFQRKLAEAYNASLL  60

Query  880   TYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRC  701
              Y  DP  V +  N++V + +             TNSTRR  G  KY+G C A NPIDRC
Sbjct  61    AYHHDPIEVMNHFNYHVHRAL-----------EGTNSTRR--GLNKYQGECKAQNPIDRC  107

Query  700   WRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIK  524
             WRC  +WA  RK+LADC  GFG +  GGK G +YTVTD SD+ + NPK GTLR AV+Q +
Sbjct  108   WRCKADWAVDRKKLADCVKGFGRQTTGGKKGAYYTVTDPSDNDVVNPKPGTLRFAVLQPQ  167

Query  523   PLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIV  344
             PLWIIFA+ M IKLK ELM+ S KTIDGRGAQV I+ GAGIT+QF  NVIIH I++HDIV
Sbjct  168   PLWIIFAKDMTIKLKAELMITSDKTIDGRGAQVQIADGAGITIQFANNVIIHNIKIHDIV  227

Query  343   HGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITIS  164
                GGMIRD+ NH G+R   DGDGI++F +++IWLDHLSM  C DG+ID ++ASTAIT+S
Sbjct  228   PSTGGMIRDTNNHVGIRGADDGDGINVFASSNIWLDHLSMWNCKDGLIDIVKASTAITLS  287

Query  163   NSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             N+HFT H+ V+LFGA+D  P D+IMQ+++AFNHFGK LVQRMPRCR+G+FHV+N
Sbjct  288   NNHFTRHDHVLLFGADDKDPADEIMQISLAFNHFGKGLVQRMPRCRFGFFHVLN  341



>ref|XP_004489168.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=444

 Score =   372 bits (955),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 189/345 (55%), Positives = 240/345 (70%), Gaps = 15/345 (4%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             M G   KI     V + AI IP     I+EFDD  + + + A   ALK+Y P+P N+T+ 
Sbjct  1     MAGITRKIT--FIVLILAITIPCLEAGIAEFDDYLKEQADLARQIALKSYVPNPENITTE  58

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRG---PCNATNPIDRCWRCDPNWAN  674
             LN +V   + +           +NSTRR L +++  G    C ++NPID CWRC  +WA 
Sbjct  59    LNLHVNMAMEE---------AYSNSTRRELRQRQKHGGSSACMSSNPIDNCWRCKKDWAQ  109

Query  673   KRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARS  497
              R++LA C  GFG KA GG  G FY VTD SD+ L  PK GTLR+  +Q  PLWIIFARS
Sbjct  110   NRQQLAQCGKGFGRKAVGGLGGKFYVVTDESDNDLVTPKFGTLRYGAVQKGPLWIIFARS  169

Query  496   MNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRD  317
             M I+L QEL+V S KTIDGRGA VHI  GAGIT+QFV NVIIHG+ + +I    GGMIRD
Sbjct  170   MIIRLNQELLVSSDKTIDGRGANVHIRDGAGITMQFVNNVIIHGLHIRNIKARSGGMIRD  229

Query  316   SINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNE  137
             S NH GLRTRSDGD +S+FG+++IW+DH+S+ + +DG+ID I+ STAITISN H T HN+
Sbjct  230   SYNHVGLRTRSDGDALSVFGSSNIWIDHISLSESEDGLIDVIQGSTAITISNCHMTKHND  289

Query  136   VMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             VMLFGA+D    DKIMQ+T+AFNHFG+ L+QRMPRCR+G+FHV+N
Sbjct  290   VMLFGASDSYSDDKIMQITVAFNHFGQGLIQRMPRCRWGFFHVLN  334



>emb|CDX96854.1| BnaA08g23970D [Brassica napus]
Length=458

 Score =   372 bits (956),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 193/340 (57%), Positives = 234/340 (69%), Gaps = 15/340 (4%)
 Frame = -1

Query  1000 LSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKV  821
            L +  +SL A + P    +++ FD+ W  R+ +A    + +++P+P NVT  LN++V   
Sbjct  12   LFVFCLSLLATLTPHVGANVAVFDNYWLQRQGDALKQTIASFDPNPLNVTDHLNYHVALA  71

Query  820  ILDYRnnnnetetetNSTRRHLG------KKKYRGPCNATNPIDRCWRCDPNWANKRKRL  659
            +        +     NSTRR L       K K  G C A NPIDRCWRC+ +W   RK+L
Sbjct  72   V--------DATESINSTRRELSQVRNGRKLKRSGKCVAYNPIDRCWRCNGDWEKNRKKL  123

Query  658  ADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKL  482
            ADC LGFG +  GGK+G  Y V D SD  L NPK GTLRHAV +  PLWIIF  SM I L
Sbjct  124  ADCVLGFGRRTTGGKDGPIYVVNDASDDDLINPKPGTLRHAVTRDGPLWIIFGSSMIINL  183

Query  481  KQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHF  302
            +QEL++ S KTIDGRGA+V+I  GAG+TLQFV NVIIH I V  +V   GG+IRDS  H 
Sbjct  184  QQELIITSDKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKHVVPKSGGLIRDSEQHI  243

Query  301  GLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFG  122
            GLRT SDGDGISLFGAT++W+DH+SM +C DG+IDAI  STAITISNSHFTDH EVMLFG
Sbjct  244  GLRTVSDGDGISLFGATNVWIDHVSMTRCSDGMIDAILGSTAITISNSHFTDHEEVMLFG  303

Query  121  ANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            AND    DK MQ+T+AFNHFGKRL QRMPRCR+G  HVVN
Sbjct  304  ANDKHVIDKKMQITVAFNHFGKRLDQRMPRCRFGTIHVVN  343



>ref|XP_011086389.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=442

 Score =   371 bits (953),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 181/339 (53%), Positives = 239/339 (71%), Gaps = 19/339 (6%)
 Frame = -1

Query  1012  QIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHN  833
             +  IL L+ +    +++P S   I+++D+  + R + +   + K + P+P  +   LN  
Sbjct  9     KFSILVLIIILSFVLLLPKSGAAIAKYDEYLKKRAQASLEESRKAFNPNPEELADDLNDQ  68

Query  832   VVKVILDYRnnnnetetetNSTRRHLGKKKYR-GPCNATNPIDRCWRCDPNWANKRKRLA  656
             V + +                  R  GK+  R G C ATNPIDRCWRCDPNW   RK+LA
Sbjct  69    VSETLT-----------------REGGKRNLRQGGCKATNPIDRCWRCDPNWDKNRKQLA  111

Query  655   DCSLGFGYKAKGGKNGDFYTVTDNSDHPLN-PKRGTLRHAVIQIKPLWIIFARSMNIKLK  479
             +C+ GFG++A GGK+G +Y VTD SD+ ++ PK GTLRHAVIQ +PLWIIF R+M I LK
Sbjct  112   ECARGFGHRATGGKSGRYYVVTDPSDNDMDKPKPGTLRHAVIQPQPLWIIFGRNMVITLK  171

Query  478   QELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFG  299
             +EL+  S KT+DGRGA+VHI+ GAGITLQFV NVIIH I +HDIV   GGMIRD+++H G
Sbjct  172   EELIFASDKTVDGRGAEVHIAYGAGITLQFVHNVIIHNIWIHDIVPEPGGMIRDAVDHIG  231

Query  298   LRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGA  119
             LRT+SDGDGIS+FG+ +IW+DH+S+ K  DG+ID IE STA+TISN  F +HN+VML GA
Sbjct  232   LRTQSDGDGISVFGSNNIWIDHVSLSKGTDGLIDVIEGSTAVTISNCKFNNHNDVMLLGA  291

Query  118   NDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             +D S KD IMQVT+AFN FG+ L+QRMPRCR G+ HV+N
Sbjct  292   HDGSNKDSIMQVTVAFNQFGEGLIQRMPRCRLGFVHVIN  330



>ref|XP_009761969.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=434

 Score =   371 bits (953),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 192/331 (58%), Positives = 243/331 (73%), Gaps = 14/331 (4%)
 Frame = -1

Query  991  LFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILD  812
            LF+ +  +++ +   HI EFD+VW+ R E+A   A   Y P+P  V   LN+ V K +  
Sbjct  8    LFLFVMVVLVLSIEAHIGEFDEVWRKRAEKAKKAARHAYHPNPKIVADHLNNQVDKAV--  65

Query  811  YRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGY  632
                       +NS RR L   +Y G C ATNPID+CWRCDPNWA  R +LADC LGFG 
Sbjct  66   ---------RGSNSRRRDL--HRYNGQCKATNPIDQCWRCDPNWARNRMKLADCVLGFGR  114

Query  631  KAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSH  455
            K  GGK G  Y VTDNSD  L NPK GTLRHAVIQ +PLWIIFA++M I+L +EL++ S+
Sbjct  115  KTTGGKGGKIYVVTDNSDSDLVNPKPGTLRHAVIQPQPLWIIFAKNMVIRLNEELIMTSN  174

Query  454  KTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGD  275
            KTID RG QVHI+ G G+ LQF+ NVII  +R+HD   G+GG+IRDS++H+G RT+SDGD
Sbjct  175  KTIDARGKQVHIAHGGGLMLQFIHNVIISNLRIHDTKAGNGGLIRDSVDHYGYRTKSDGD  234

Query  274  GISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDK  95
            GIS+FG+T++W+DH+SM  C DG+IDA+EASTAITISNSHFT HNEVMLFGA+D S +D 
Sbjct  235  GISIFGSTNVWIDHVSMSNCQDGLIDAVEASTAITISNSHFTKHNEVMLFGASDSSSRDS  294

Query  94   IMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            IMQ+T+AFNHFG+ L+QRMPR R+G+ H VN
Sbjct  295  IMQITLAFNHFGQGLMQRMPRVRWGFVHAVN  325



>ref|NP_178375.1| putative pectate lyase 6 [Arabidopsis thaliana]
 sp|O64510.1|PLY6_ARATH RecName: Full=Probable pectate lyase 6; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC05350.1| putative pectate lyase [Arabidopsis thaliana]
 gb|AAO64162.1| putative pectate lyase [Arabidopsis thaliana]
 gb|AAV34776.1| At2g02720 [Arabidopsis thaliana]
 gb|AEC05615.1| putative pectate lyase 6 [Arabidopsis thaliana]
Length=455

 Score =   372 bits (954),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 191/340 (56%), Positives = 240/340 (71%), Gaps = 17/340 (5%)
 Frame = -1

Query  994  LLFVSLA-AIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVI  818
             +FV+L+  +++P+   HI+E+D+ W  R+  A    L++Y+P+P NVT   N++    +
Sbjct  9    FVFVALSLTVVVPSVQAHIAEYDEYWTQRQTNALRETLESYDPNPENVTDHFNYHAALAM  68

Query  817  LDYRnnnnetetetNSTRRHL-----GKKKYR--GPCNATNPIDRCWRCDPNWANKRKRL  659
                    ET    N TRR L     GKK  R  G   + N ID+CWR D NW   RK+L
Sbjct  69   --------ETTGIVNETRRDLRQVGRGKKTTRRGGRFESLNAIDKCWRGDKNWDKNRKKL  120

Query  658  ADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKL  482
            ADC LGFG K  GGKNG  Y VTD SD+ L  PK GT+RHAV + +PLWIIFARSM IKL
Sbjct  121  ADCVLGFGRKTTGGKNGPIYVVTDPSDNDLLKPKPGTIRHAVTRDRPLWIIFARSMIIKL  180

Query  481  KQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHF  302
            +QEL++ + KTIDGRGA+++I+GGAG+TLQFV+NVIIH I +  I  G GG+I DS  HF
Sbjct  181  QQELIITNDKTIDGRGAKIYITGGAGLTLQFVRNVIIHNIHIKQIKRGAGGLIIDSEQHF  240

Query  301  GLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFG  122
            GLRT SDGDGI++FGAT++W+DH+SM  C DG+IDAI  STAITISNSHFTDH+EVMLFG
Sbjct  241  GLRTVSDGDGINIFGATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFG  300

Query  121  ANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
              +    DK MQ+T+AFNHFGKRL QRMPR R+G  HVVN
Sbjct  301  GTNKDVIDKKMQITVAFNHFGKRLKQRMPRVRFGLVHVVN  340



>ref|XP_002875142.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51401.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=455

 Score =   370 bits (951),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 192/340 (56%), Positives = 242/340 (71%), Gaps = 17/340 (5%)
 Frame = -1

Query  994  LLFVSLA-AIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVI  818
             +FVSL+  +++P+   HI+ +DD W  R+  A    L++Y+P+P NVT   N++    +
Sbjct  9    FVFVSLSLTVVVPSVQAHIAVYDDYWTQRQTIALRQTLESYDPNPDNVTDHFNYHAALAM  68

Query  817  LDYRnnnnetetetNSTRRHL-----GKKKYR--GPCNATNPIDRCWRCDPNWANKRKRL  659
                    ET    N TRR L     GKKK R  G   + N ID+CWR D NW   RK+L
Sbjct  69   --------ETTGIVNETRRDLRQVRSGKKKPRRGGRFESLNAIDKCWRGDKNWDKNRKKL  120

Query  658  ADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKL  482
            ADC LGFG K  GGKNG  Y VTD SD+ L NPK GT+RHAV + +PLWI+FARSM IKL
Sbjct  121  ADCVLGFGRKTTGGKNGPIYVVTDPSDNDLLNPKPGTIRHAVTRDRPLWIVFARSMIIKL  180

Query  481  KQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHF  302
            +QEL++ + KTIDGRGA+++I+GGAG+TLQFV+NVIIH + +  I  G GG+IRDS +H+
Sbjct  181  QQELIITNDKTIDGRGARIYITGGAGLTLQFVRNVIIHNVHIKLIKKGVGGVIRDSEHHY  240

Query  301  GLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFG  122
            G RT SDGDGI++FGAT++W+DH+SM  C DG+IDAI  STAITISNSHFTDH+EVMLFG
Sbjct  241  GHRTMSDGDGINIFGATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFG  300

Query  121  ANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
              +    DK MQ+T+AFNHFGKRL QRMPR RYG  HVVN
Sbjct  301  GTNKDVIDKKMQITVAFNHFGKRLKQRMPRVRYGLVHVVN  340



>gb|KFK37588.1| hypothetical protein AALP_AA3G002600 [Arabis alpina]
Length=472

 Score =   370 bits (951),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 187/357 (52%), Positives = 238/357 (67%), Gaps = 22/357 (6%)
 Frame = -1

Query  1006  KILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDP------------  863
             ++  L+ V   A +IPT   +++E DD W N+  EA    L  Y PDP            
Sbjct  5     RLFKLVCVVCIASLIPTLRANVAETDDYWVNKANEARKRTLSVYHPDPYAIVDHFHERHY  64

Query  862   ---SNVTSTLNHNVVKVIL--DYRnnnnetetetNSTRRHLGKK----KYRGPCNATNPI  710
                ++V     H         D    ++ T +   S   + GK+    K +GPC A+NPI
Sbjct  65    DNSTDVEEREEHEATAFAEEDDTEMISSSTNSTRRSLSGNRGKRGKWSKLKGPCTASNPI  124

Query  709   DRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTD-NSDHPLNPKRGTLRHAVI  533
             D+CWRC  +WA +RK+L  C  GFGY+  GGK G  Y VT    D  +NPK GTLRHAVI
Sbjct  125   DKCWRCQADWAKRRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDVVNPKPGTLRHAVI  184

Query  532   QIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVH  353
             Q +PLWIIF   M+I+LKQELM+ SHKTID RGA VH++ GAGIT+Q+V N+IIHG+ VH
Sbjct  185   QKEPLWIIFKHDMSIRLKQELMINSHKTIDARGANVHVAYGAGITMQYVHNIIIHGLHVH  244

Query  352   DIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAI  173
              I+ G GGM+R+S++HFG R ++DGDGIS+FGAT+IWLDH+SM KC DG+IDAI  ST I
Sbjct  245   HIIEGSGGMVRNSVDHFGFRGKADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTGI  304

Query  172   TISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             TISNSHFT HN+VML GA+D +  DK MQVT+A+NHFGK LVQRMPR R+G+ HVVN
Sbjct  305   TISNSHFTHHNDVMLLGAHDSNKDDKKMQVTVAYNHFGKGLVQRMPRVRWGFVHVVN  361



>ref|XP_003613596.1| Pectate lyase [Medicago truncatula]
 gb|AES96554.1| pectate lyase P59-like protein [Medicago truncatula]
Length=449

 Score =   369 bits (947),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 186/347 (54%), Positives = 241/347 (69%), Gaps = 21/347 (6%)
 Frame = -1

Query  1015  FQIKILSLLFVSLAAIIIPTSLGHISEFDDV--------WQNRKEEAWMHALKTYEPDPS  860
             + + +L+ L V+++ ++        + +D +        WQ +   A     K Y PDP 
Sbjct  5     YHLFLLTCLVVTISTLVHANVKEDKAYWDRILPTLNTTYWQKKASIAAKANDKAYTPDPY  64

Query  859   NVTSTLNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNW  680
              V+  L+  V ++I+              + RR+L        C ATNPIDRCWRCDPNW
Sbjct  65    AVSGNLSSTVSEMIIG-----------GINGRRNLVGLG-NSSCMATNPIDRCWRCDPNW  112

Query  679   ANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFA  503
             AN RK+LADC  GFG K  GGK+G  Y VTD SD  L NP+ GTLRHAV +  PLWIIFA
Sbjct  113   ANNRKKLADCVQGFGRKTTGGKDGPIYVVTDPSDSDLVNPRPGTLRHAVTRNGPLWIIFA  172

Query  502   RSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMI  323
             RSM I+L QEL++  +KTIDGRGA V I+ GAGIT+QF++NVIIHGI+++DI+ G GG++
Sbjct  173   RSMKIRLNQELIMAGNKTIDGRGADVTIANGAGITIQFIENVIIHGIKIYDIMVGSGGLV  232

Query  322   RDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDH  143
             RDS +H+GLRT SDGDGIS+FG++ IW+DH+SMR C DG+IDAI  STAITISNSHFTDH
Sbjct  233   RDSEDHYGLRTISDGDGISIFGSSHIWIDHVSMRNCRDGLIDAIMGSTAITISNSHFTDH  292

Query  142   NEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             NEVMLFGA+D    D+ MQ+T+ FN FGK+L+QRMPRCR+G+ HV+N
Sbjct  293   NEVMLFGASDTYDGDQKMQITVVFNRFGKKLIQRMPRCRFGFIHVLN  339



>ref|XP_009114192.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=459

 Score =   369 bits (947),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 191/340 (56%), Positives = 237/340 (70%), Gaps = 17/340 (5%)
 Frame = -1

Query  994  LLFVSLA-AIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVI  818
              F+SL  A++ P+   H++ FD+ W  R+  A    +++Y+P+P NVT  LN++    +
Sbjct  13   FAFLSLCLAVVAPSIQAHVAVFDEYWTQRQAAALRQTIESYDPNPFNVTDHLNYHAALAM  72

Query  817  LDYRnnnnetetetNSTRRHLGK-------KKYRGPCNATNPIDRCWRCDPNWANKRKRL  659
                    ET    N TRR LG+       K+  G  ++ N ID+CWR   NW   RK+L
Sbjct  73   --------ETTGADNGTRRELGQVGGGRKTKRRGGRYHSLNAIDKCWRGHRNWHKNRKKL  124

Query  658  ADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKL  482
            ADC LGFG K  GGK G  Y VTD SD  L NPK GTLR+AV + +PLWIIF RSM IKL
Sbjct  125  ADCVLGFGRKTTGGKKGPMYVVTDASDDDLMNPKPGTLRYAVTRDRPLWIIFGRSMIIKL  184

Query  481  KQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHF  302
            +QEL++ S KTIDGRGA +HI+GGAG+TLQFVKNVIIH I +  IV G+GGMIRDS +HF
Sbjct  185  QQELIINSDKTIDGRGANIHITGGAGLTLQFVKNVIIHNIHIKTIVPGNGGMIRDSEHHF  244

Query  301  GLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFG  122
            G RT SDGDGI++FG+T++W+DH+SM  C DG+ID I  STAITISN H TDHNEVMLFG
Sbjct  245  GHRTTSDGDGINIFGSTNVWIDHVSMTNCTDGMIDVIMGSTAITISNCHLTDHNEVMLFG  304

Query  121  ANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            A +    DK MQ+T+AFNHFGKRLVQRMPR R+G  HVVN
Sbjct  305  AREEDVVDKKMQITVAFNHFGKRLVQRMPRARFGLVHVVN  344



>emb|CDY04133.1| BnaA09g19110D [Brassica napus]
 gb|AIS67292.1| pectate lyase-like protein 9 [Brassica rapa subsp. chinensis]
Length=459

 Score =   369 bits (947),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 191/340 (56%), Positives = 237/340 (70%), Gaps = 17/340 (5%)
 Frame = -1

Query  994  LLFVSLA-AIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVI  818
              F+SL  A++ P+   H++ FD+ W  R+  A    +++Y+P+P NVT  LN++    +
Sbjct  13   FAFLSLCLAVVAPSIQAHVAVFDEYWTQRQAAALRQTIESYDPNPFNVTDHLNYHAALAM  72

Query  817  LDYRnnnnetetetNSTRRHLGK-------KKYRGPCNATNPIDRCWRCDPNWANKRKRL  659
                    ET    N TRR LG+       K+  G  ++ N ID+CWR   NW   RK+L
Sbjct  73   --------ETTGADNGTRRELGQVGGGRKTKRRGGRYHSLNAIDKCWRGHRNWHKNRKKL  124

Query  658  ADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKL  482
            ADC LGFG K  GGK G  Y VTD SD  L NPK GTLR+AV + +PLWIIF RSM IKL
Sbjct  125  ADCVLGFGRKTTGGKKGPMYVVTDASDDDLMNPKPGTLRYAVTRDRPLWIIFGRSMIIKL  184

Query  481  KQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHF  302
            +QEL++ S KTIDGRGA +HI+GGAG+TLQFVKNVIIH I +  IV G+GGMIRDS +HF
Sbjct  185  QQELIINSDKTIDGRGANIHITGGAGLTLQFVKNVIIHNIHIKTIVPGNGGMIRDSEHHF  244

Query  301  GLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFG  122
            G RT SDGDGI++FG+T++W+DH+SM  C DG+ID I  STAITISN H TDHNEVMLFG
Sbjct  245  GHRTTSDGDGINIFGSTNVWIDHVSMTNCTDGMIDVIMGSTAITISNCHLTDHNEVMLFG  304

Query  121  ANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            A +    DK MQ+T+AFNHFGKRLVQRMPR R+G  HVVN
Sbjct  305  AREEDVIDKKMQITVAFNHFGKRLVQRMPRARFGLVHVVN  344



>emb|CDY68729.1| BnaCnng60280D [Brassica napus]
Length=458

 Score =   369 bits (947),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 194/346 (56%), Positives = 234/346 (68%), Gaps = 18/346 (5%)
 Frame = -1

Query  1018  GFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLN  839
             G  + + SLL   L A + P    +++ FD+ W  R+ +A    + +++P+P NVT  LN
Sbjct  9     GGYLFVFSLL---LLATLTPHVGANVAVFDNYWLQRQGDALKQTIASFDPNPLNVTDHLN  65

Query  838   HNVVKVILDYRnnnnetetetNSTRRHLG------KKKYRGPCNATNPIDRCWRCDPNWA  677
             ++V   +              NSTRR L       K K  G C A NPIDRCWRC  +W 
Sbjct  66    YHVALAV--------GATESINSTRRELSQVRNGRKLKRSGKCVAYNPIDRCWRCHGDWE  117

Query  676   NKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFAR  500
               RK+LADC LGFG +  GGK+G  Y V D SD  L NPK GTLRHAV +  PLWIIF  
Sbjct  118   KNRKKLADCVLGFGRRTTGGKDGPIYVVNDASDDDLINPKPGTLRHAVTRDGPLWIIFGS  177

Query  499   SMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIR  320
             SM I L+QEL++ S KTIDGRGA+V+I  GAG+TLQFV NVIIH I +  +V   GG+IR
Sbjct  178   SMIINLQQELIITSDKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYIKHVVPKSGGLIR  237

Query  319   DSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHN  140
             DS  H GLRT SDGDGISLFGAT++W+DH+SM +C DG+IDAI  STAITISNSHFTDH 
Sbjct  238   DSEQHIGLRTVSDGDGISLFGATNVWIDHVSMTRCSDGMIDAILGSTAITISNSHFTDHE  297

Query  139   EVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             EVMLFGAND    DK MQ+T+AFNHFGKRL QRMPRCR+G  HVVN
Sbjct  298   EVMLFGANDKHVIDKKMQITVAFNHFGKRLDQRMPRCRFGTIHVVN  343



>emb|CDX74293.1| BnaA03g27540D [Brassica napus]
Length=471

 Score =   369 bits (947),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 189/356 (53%), Positives = 233/356 (65%), Gaps = 21/356 (6%)
 Frame = -1

Query  1006  KILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVV  827
             ++  L+ V   A +IPT   +++E DD W     EA    L  Y PDP  +    +    
Sbjct  5     RLFKLVCVICIASLIPTLRANVAETDDYWVKMANEARKRTLMAYHPDPYQIVDHFHERHY  64

Query  826   KVILDYRnnn----------netetetNSTRRHLGK----------KKYRGPCNATNPID  707
                 D                 + + TNSTRR L             K +GPC A+NPID
Sbjct  65    DNSTDVEETEEHASEEEDDIEMSSSLTNSTRRSLRGRGKGKGRGKWSKLKGPCTASNPID  124

Query  706   RCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDN-SDHPLNPKRGTLRHAVIQ  530
             +CWRC P+WA +RK+L  C  GFGY+  GGK G  Y VT N  D  +NP+ GTLRHAVIQ
Sbjct  125   KCWRCQPDWARRRKKLVKCVRGFGYRTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQ  184

Query  529   IKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHD  350
              +PLWIIF   M+I+L QELM+ SHKTID RG  VHI+ GAGIT+Q+V+N+IIHG+ VH 
Sbjct  185   NEPLWIIFKHDMSIRLSQELMINSHKTIDARGTNVHIAYGAGITMQYVRNIIIHGLHVHH  244

Query  349   IVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAIT  170
             IV G GGMIR+S +HFG R ++DGDGIS+FGAT+IWLDH+SM KC DG+IDAI  ST IT
Sbjct  245   IVPGSGGMIRNSNDHFGFRGQADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTGIT  304

Query  169   ISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             ISNSHFT HN+VML GA + +  DK MQVT+AFNHFGK LVQRMPR R+G+ HVVN
Sbjct  305   ISNSHFTHHNDVMLLGAQNDNHADKKMQVTVAFNHFGKGLVQRMPRIRWGFVHVVN  360



>ref|XP_011098576.1| PREDICTED: probable pectate lyase P56 [Sesamum indicum]
Length=465

 Score =   369 bits (946),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 188/342 (55%), Positives = 236/342 (69%), Gaps = 9/342 (3%)
 Frame = -1

Query  1021  EGFQIKILSLLFVSLAAIIIPTSLGHISEFDDV-WQNRKEEAWMHALKTYEPDPSNVTST  845
             + F I  L L F+S A   IPTS  + ++  DV WQ R   A    L+ Y P+P  + + 
Sbjct  20    KNFSITFLFLFFISAA--FIPTSGANYTDSHDVYWQERAALARARILQAYNPNPEAIVTD  77

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRK  665
              N    + +     ++       N TRR+LG+K Y GPC ATNPIDRCWRC+PNWA  R+
Sbjct  78    FNQKTKEAL----EHSQVNRAPHNGTRRNLGRK-YMGPCVATNPIDRCWRCNPNWALNRQ  132

Query  664   RLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNI  488
             +LADC+ GFG  A GGK G  Y V D SD+ + NPK GTLRHAVIQ  PLWIIF+ SMNI
Sbjct  133   KLADCAQGFGAAATGGKFGPIYVVRDPSDNDMMNPKPGTLRHAVIQPGPLWIIFSHSMNI  192

Query  487   KLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSIN  308
             KL QEL++ S KTIDGRGA + I+GGAG+T+QFV N+II  +++ +IV   GG IRDS+N
Sbjct  193   KLNQELIMTSDKTIDGRGALIQITGGAGLTIQFVHNIIITNLKITNIVPSPGGTIRDSVN  252

Query  307   HFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVML  128
             HFG RT SDGD I++FG+ +IW+DHLSM    DG+IDA+  STAITISN HF  H++V+L
Sbjct  253   HFGFRTGSDGDAINIFGSHNIWIDHLSMSGGADGLIDAVMGSTAITISNCHFVRHDKVLL  312

Query  127   FGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             FG  D    D  MQ+T+AFNHFGK LVQRMPRCR G+FH+VN
Sbjct  313   FGGRDMDEIDSKMQITLAFNHFGKHLVQRMPRCRRGFFHLVN  354



>emb|CDX91953.1| BnaC03g32550D [Brassica napus]
Length=471

 Score =   369 bits (946),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 189/356 (53%), Positives = 233/356 (65%), Gaps = 21/356 (6%)
 Frame = -1

Query  1006  KILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVV  827
             ++  L+ V   A +IPT   +++E DD W     EA    L  Y PDP  +    +    
Sbjct  5     RLFKLVCVICIASLIPTLRANVAETDDYWVKMANEARKRTLMAYHPDPYQIVDHFHERHY  64

Query  826   KVILDYRnnn----------netetetNSTRRHLGK----------KKYRGPCNATNPID  707
                 D                 + + TNSTRR L             K +GPC A+NPID
Sbjct  65    DNSTDVEETEEHASEEEDDIEMSSSPTNSTRRSLRGRGKGKGRGKWSKLKGPCTASNPID  124

Query  706   RCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDN-SDHPLNPKRGTLRHAVIQ  530
             +CWRC P+WA +RK+L  C  GFGY+  GGK G  Y VT N  D  +NP+ GTLRHAVIQ
Sbjct  125   KCWRCQPDWARRRKKLVKCVRGFGYRTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQ  184

Query  529   IKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHD  350
              +PLWIIF   M+I+L QELM+ SHKTID RG  VHI+ GAGIT+Q+V+N+IIHG+ VH 
Sbjct  185   NEPLWIIFKHDMSIRLSQELMINSHKTIDARGTNVHIAYGAGITMQYVRNIIIHGLHVHH  244

Query  349   IVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAIT  170
             IV G GGMIR+S +HFG R ++DGDGIS+FGAT+IWLDH+SM KC DG+IDAI  ST IT
Sbjct  245   IVPGSGGMIRNSNDHFGFRGQADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTGIT  304

Query  169   ISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             ISNSHFT HN+VML GA + +  DK MQVT+AFNHFGK LVQRMPR R+G+ HVVN
Sbjct  305   ISNSHFTHHNDVMLLGAQNDNHADKKMQVTVAFNHFGKGLVQRMPRIRWGFVHVVN  360



>emb|CDY17432.1| BnaC09g21050D [Brassica napus]
Length=459

 Score =   368 bits (944),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 190/340 (56%), Positives = 238/340 (70%), Gaps = 17/340 (5%)
 Frame = -1

Query  994  LLFVSLA-AIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVI  818
              F+SL  A++ P+   H++ FD+ W  R+ +A    +++Y+P+P NVT  LN++    +
Sbjct  13   FAFLSLCLAVVAPSVQAHVAVFDEYWTQRQSDALRQTIESYDPNPFNVTDHLNYHAALAM  72

Query  817  LDYRnnnnetetetNSTRRHLGK-------KKYRGPCNATNPIDRCWRCDPNWANKRKRL  659
                    ET    N TRR LG+       K+  G  ++ N ID+CWR   NW   RK+L
Sbjct  73   --------ETTGADNGTRRKLGQVGDGRKTKRRGGRYHSLNAIDKCWRGHRNWHKNRKKL  124

Query  658  ADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKL  482
            ADC LGFG K  GGK G  Y VTD +D  L NPK GTLR+AV + +PLWIIF RSM IKL
Sbjct  125  ADCVLGFGRKTTGGKKGPIYVVTDAADDDLMNPKPGTLRYAVTRDRPLWIIFGRSMIIKL  184

Query  481  KQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHF  302
            +QEL++ S KTIDGRGA VHI+GGAG+TLQFVKNVIIH I +  I+ G+GGMIRDS +HF
Sbjct  185  QQELIINSDKTIDGRGANVHITGGAGLTLQFVKNVIIHNIHIKTIIPGNGGMIRDSEHHF  244

Query  301  GLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFG  122
            G RT SDGDGI++FG+T++W+DH+SM  C DG+ID I  STAITISN H TDHNEVMLFG
Sbjct  245  GHRTTSDGDGINIFGSTNVWIDHVSMTNCTDGMIDVIMGSTAITISNCHLTDHNEVMLFG  304

Query  121  ANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
            A +    DK MQ+T+AFNHFGKRLVQRMPR R+G  HVVN
Sbjct  305  AREEDVIDKKMQITVAFNHFGKRLVQRMPRARFGLVHVVN  344



>gb|KHN13240.1| Putative pectate lyase 3 [Glycine soja]
Length=446

 Score =   367 bits (943),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 192/351 (55%), Positives = 237/351 (68%), Gaps = 24/351 (7%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             M G   K+   L  + A I+IP     I+EFDD  + + +EA   AL +Y P+P +V   
Sbjct  1     MVGSATKVAFTLLATFA-IVIPCLEAGIAEFDDFLKAQADEAHKIALDSYVPEPHDVAHE  59

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRG--PCNATNPIDRCWRCDPNWANK  671
             LN +V   + +             STRR L ++K RG   C A+NPID CWRC+ +WAN 
Sbjct  60    LNFHVHMALEN-------------STRRELRQRKLRGGGKCQASNPIDACWRCNKDWAND  106

Query  670   RKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHA-------VIQIKPLW  515
             R RLA C  GFG +A GG  G  Y VTDNSD  + NPK GT+RHA       V Q  PLW
Sbjct  107   RFRLAKCGKGFGRRATGGLGGPIYVVTDNSDDDMVNPKPGTIRHAPGTIRHAVTQKGPLW  166

Query  514   IIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGD  335
             IIF  SM I L+QELM+ S KTIDGRGA V    GAG+T+QFV NVIIHG+R+ DIV  D
Sbjct  167   IIFGHSMIISLRQELMISSDKTIDGRGANVVFRDGAGLTIQFVNNVIIHGVRIKDIVPKD  226

Query  334   GGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSH  155
             GGMIRDS +H+GLRTRSDGD IS+FG+T+IW+DH+S+  C DG+ID I+ STAITISN H
Sbjct  227   GGMIRDSADHYGLRTRSDGDAISIFGSTNIWIDHVSLSNCADGLIDIIQGSTAITISNCH  286

Query  154   FTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
              T HN+V LFGA+D    DKIMQ+T+AFNHFG+ LVQRMPRCR+G+ HV+N
Sbjct  287   MTKHNDVFLFGASDSYNGDKIMQITVAFNHFGQGLVQRMPRCRWGFVHVLN  337



>ref|XP_006656188.1| PREDICTED: pectate lyase-like [Oryza brachyantha]
Length=446

 Score =   366 bits (940),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 188/353 (53%), Positives = 239/353 (68%), Gaps = 28/353 (8%)
 Frame = -1

Query  1024  MEGFQ--------IKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEP  869
             MEGF+        + + ++  +S AA    TS  +I ++D+ WQ RK  A   A  TY+ 
Sbjct  1     MEGFRWSKPAAGSLVLYAVFLLSAAA----TSEANIGDYDEHWQKRKLMADAAAEATYKR  56

Query  868   DPSNVTSTLNHNVVKVILDYRnnnnetetetNSTRRHL---GKKKYRGPCNATNPIDRCW  698
             DP  VT+  N  V +              E  + RR L    +KK+ GPC ATNPIDRCW
Sbjct  57    DPFEVTNDFNRAVHR------------SEEKETARRSLMLSKRKKFAGPCKATNPIDRCW  104

Query  697   RCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKP  521
             RC  +WA  RKRLA C+ GFG    GG  G FY VTD +D  + NP+ GTLR  VIQ +P
Sbjct  105   RCRDDWATDRKRLARCAQGFGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWGVIQDEP  164

Query  520   LWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVH  341
             LWIIF ++M I LK+ELM+ + KT+DGRGAQV I+ GA +T+Q   NVIIH I VHDIV 
Sbjct  165   LWIIFGKNMIINLKEELMIGNDKTVDGRGAQVRITNGAQVTVQNSNNVIIHNIHVHDIVL  224

Query  340   GDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISN  161
             G GGMIRDS  HFG RT+SDGDGI++FG+T++WLDHLS+  C DG+ID I  ST +TISN
Sbjct  225   GKGGMIRDSPEHFGFRTQSDGDGITIFGSTNVWLDHLSLSNCQDGLIDVIAKSTGVTISN  284

Query  160   SHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
              H T+HN+VMLFG++D   +D+IMQ+T+AFNHFG+ LVQRMPRCR+G+FHVVN
Sbjct  285   CHLTNHNDVMLFGSSDSFSEDQIMQITVAFNHFGRGLVQRMPRCRWGFFHVVN  337



>ref|XP_009134622.1| PREDICTED: probable pectate lyase 7 [Brassica rapa]
Length=471

 Score =   367 bits (941),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 188/356 (53%), Positives = 232/356 (65%), Gaps = 21/356 (6%)
 Frame = -1

Query  1006  KILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVV  827
             ++  L+ V   A +IPT   +++E DD W     EA    L  Y PDP  +    +    
Sbjct  5     RLFKLVCVICIASLIPTLRANVAETDDYWVKMANEARKRTLMAYHPDPYQIVDHFHERHY  64

Query  826   KVILDYRnnn----------netetetNSTRRHLGK----------KKYRGPCNATNPID  707
                 D                 + + TNSTRR L             K +GPC A+NPID
Sbjct  65    DNSTDVEETEEHASEEEDDIEMSSSLTNSTRRSLRGRGKGKGRGKWSKLKGPCTASNPID  124

Query  706   RCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDN-SDHPLNPKRGTLRHAVIQ  530
             +CWRC P+WA +RK+L  C  GFGY+  GGK G  Y VT N  D  +NP+ GTLRHAVIQ
Sbjct  125   KCWRCQPDWARRRKKLVKCVRGFGYRTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQ  184

Query  529   IKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHD  350
              +PLWIIF   M+I+L QELM+ SHKTID RG  VHI+ GAGIT+Q+V+N+IIHG+ VH 
Sbjct  185   NEPLWIIFKHDMSIRLSQELMINSHKTIDARGTNVHIAYGAGITMQYVRNIIIHGLHVHH  244

Query  349   IVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAIT  170
             IV G GGMIR+S +HFG R ++DGDGISLFGAT+IWLDH+SM KC DG+IDAI  S  IT
Sbjct  245   IVPGSGGMIRNSNDHFGFRGQADGDGISLFGATNIWLDHISMSKCQDGLIDAIMGSPGIT  304

Query  169   ISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             +SNSHFT HN+VML GA + +  DK MQVT+AFNHFGK LVQRMPR R+G+ HVVN
Sbjct  305   LSNSHFTHHNDVMLLGAQNDNHADKKMQVTVAFNHFGKGLVQRMPRIRWGFVHVVN  360



>ref|XP_010550068.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=469

 Score =   367 bits (941),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 193/360 (54%), Positives = 246/360 (68%), Gaps = 21/360 (6%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             MEG   ++L L+ V   A +IP    +I+E D+ WQ R EEA  H+L  Y  DP  +   
Sbjct  1     MEG--ARLLHLICVVCIASLIPAIRSNIAELDEYWQQRSEEAEKHSLAAYHSDPFEIVDH  58

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLGK------------------KKYRGPCNAT  719
              +        D      + + E +S     G                    K +GPC+A+
Sbjct  59    FHERHYDNSTDIETERQDDQEEEDSIAMLTGSINSTRRSLRGGRRGRGKWSKLKGPCSAS  118

Query  718   NPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRH  542
             NPID+CWRC P+WA +R++LADC  GFGYK  GGK G  Y VT N D+ L NP+ GTLRH
Sbjct  119   NPIDKCWRCMPDWARRRQKLADCVRGFGYKTTGGKLGRIYVVTSNLDNDLINPRPGTLRH  178

Query  541   AVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGI  362
             AVIQ +PLWIIF   MNI+L+QELM+ SHKTID RGA VHI+ GAGIT+QFV N+IIHG+
Sbjct  179   AVIQKEPLWIIFKNDMNIRLQQELMINSHKTIDARGANVHIAYGAGITMQFVTNIIIHGL  238

Query  361   RVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEAS  182
              +H IV  +GGMIRDS++H+G RTR+DGDG+S+FGA++IW+DH+SM +C DG+IDAI+ S
Sbjct  239   HIHHIVSSNGGMIRDSVDHYGFRTRADGDGLSIFGASNIWIDHVSMSRCQDGLIDAIDGS  298

Query  181   TAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             T ITISNSHFT HN+VML GA++   KDK MQVT+A+NHFGK LVQRMPR R+G+ HVVN
Sbjct  299   TGITISNSHFTHHNDVMLLGAHNVIDKDKRMQVTVAYNHFGKGLVQRMPRVRWGFVHVVN  358



>ref|XP_006579282.1| PREDICTED: probable pectate lyase P59-like [Glycine max]
Length=420

 Score =   365 bits (936),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 168/258 (65%), Positives = 206/258 (80%), Gaps = 2/258 (1%)
 Frame = -1

Query  772  STRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTV  593
            ++RR L   +Y GPC ATNPID+CWRCDPNW   RKRLADC+LGFG+   GGK+G  Y V
Sbjct  6    NSRRGL-SNQYDGPCKATNPIDKCWRCDPNWEKNRKRLADCALGFGHGTTGGKDGKIYVV  64

Query  592  TDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHIS  416
             D+SD+ L NPK GTLRHA IQ +PLWIIF R+MNIKL  ELM+  +KTID RGA VHIS
Sbjct  65   NDSSDNDLVNPKPGTLRHAAIQREPLWIIFDRNMNIKLHAELMLTDNKTIDARGANVHIS  124

Query  415  GGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLD  236
             GA ITLQ+VKN+IIHG+ +HDI    GG+IRDS++H+G+R  SDGD IS+FG+T +W+D
Sbjct  125  EGAQITLQYVKNIIIHGLHIHDIKKCSGGLIRDSMDHYGVRAMSDGDAISVFGSTYVWID  184

Query  235  HLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGK  56
            H+S   CDDG+ID + ASTA+TISN H T HN+V+LFGA+D    DKIMQVT+AFNHFGK
Sbjct  185  HVSFTNCDDGLIDVVSASTAVTISNCHLTKHNDVLLFGASDSYSGDKIMQVTLAFNHFGK  244

Query  55   RLVQRMPRCRYGYFHVVN  2
             L+QRMPRCR+G+FH+VN
Sbjct  245  GLIQRMPRCRWGFFHIVN  262



>gb|AAM60924.1| putative pectate lyase [Arabidopsis thaliana]
Length=475

 Score =   366 bits (940),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 192/360 (53%), Positives = 237/360 (66%), Gaps = 25/360 (7%)
 Frame = -1

Query  1006  KILSLLFVSLAAIIIPTSLGHISE-FDDVWQNRKEEAWMHALKTYEPDP-----------  863
             ++  L+ V   A +IPT   +++E  D+ W N+  EA  H L  Y PDP           
Sbjct  5     RLFKLVCVICIASLIPTIRANVAEETDEYWVNKANEARKHTLMAYHPDPYEIVDHFHERH  64

Query  862   -SNVTSTLNHNVVKVIL-DYRnnnnetetetNSTRRHLGKK----------KYRGPCNAT  719
               N T        K I  +  +      + TNSTRR L  +          K  GPC A+
Sbjct  65    YDNSTDVEGTEEEKAIASEEEDVIEMISSPTNSTRRSLTGRGKGKGKGKWSKLTGPCTAS  124

Query  718   NPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRH  542
             NPID+CWRC P+WA +RK+L  C  GFGY+  GGK G  Y VT   D  + NP+ GTLRH
Sbjct  125   NPIDKCWRCQPDWARRRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDMVNPRPGTLRH  184

Query  541   AVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGI  362
             AVIQ +PLWI+F   M+I+L QELM+ S KTID RGA VHI+ GAGIT+Q+V N+IIHG+
Sbjct  185   AVIQKEPLWIVFKHDMSIRLSQELMITSDKTIDARGANVHIAYGAGITMQYVHNIIIHGL  244

Query  361   RVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEAS  182
              VH IV   GG+IRDSINHFG R  +DGDGIS+FGAT+IWLDH+SM KC DG+IDAI  S
Sbjct  245   HVHHIVKSSGGLIRDSINHFGHRGEADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGS  304

Query  181   TAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             TAITISNSHFT HN+VML GA +++  DK MQVT+A+NHFGK LVQRMPR R+G+ HVVN
Sbjct  305   TAITISNSHFTHHNDVMLLGAQNNNMDDKKMQVTVAYNHFGKGLVQRMPRVRWGFVHVVN  364



>ref|NP_186776.1| putative pectate lyase 7 [Arabidopsis thaliana]
 sp|Q9SRH4.1|PLY7_ARATH RecName: Full=Probable pectate lyase 7; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF03499.1|AC010676_9 putative pectate lyase [Arabidopsis thaliana]
 gb|AAF26147.1|AC008261_4 putative pectate lyase [Arabidopsis thaliana]
 gb|ABI93918.1| At3g01270 [Arabidopsis thaliana]
 gb|AEE73631.1| putative pectate lyase 7 [Arabidopsis thaliana]
Length=475

 Score =   366 bits (940),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 189/360 (53%), Positives = 236/360 (66%), Gaps = 25/360 (7%)
 Frame = -1

Query  1006  KILSLLFVSLAAIIIPTSLGHIS-EFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNH--  836
             ++  L+ V   A +IPT   +++ E D+ W N+  EA  H L  Y PDP  +    +   
Sbjct  5     RLFKLVCVICIASLIPTIRANVADETDEYWVNKANEARKHTLMAYHPDPYEIVDHFHERH  64

Query  835   -----------NVVKVILDYRnnnnetetetNSTRRHLGKK----------KYRGPCNAT  719
                            V  +  +      + TNSTRR L  +          K  GPC A+
Sbjct  65    YDNSTDVEGTEEEKAVASEEEDVIEMISSPTNSTRRSLTGRGKGKGKGKWSKLTGPCTAS  124

Query  718   NPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRH  542
             NPID+CWRC P+WA +RK+L  C  GFGY+  GGK G  Y VT   D  + NP+ GTLRH
Sbjct  125   NPIDKCWRCQPDWARRRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDMVNPRPGTLRH  184

Query  541   AVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGI  362
             AVIQ +PLWI+F   M+I+L QELM+ S KTID RGA VHI+ GAGIT+Q+V N+IIHG+
Sbjct  185   AVIQKEPLWIVFKHDMSIRLSQELMITSDKTIDARGANVHIAYGAGITMQYVHNIIIHGL  244

Query  361   RVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEAS  182
              VH IV   GG+IRDSINHFG R  +DGDGIS+FGAT+IWLDH+SM KC DG+IDAI  S
Sbjct  245   HVHHIVKSSGGLIRDSINHFGHRGEADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGS  304

Query  181   TAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             TAITISNSHFT HN+VML GA +++  DK MQVT+A+NHFGK LVQRMPR R+G+ HVVN
Sbjct  305   TAITISNSHFTHHNDVMLLGAQNNNMDDKKMQVTVAYNHFGKGLVQRMPRVRWGFVHVVN  364



>ref|XP_010528323.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=458

 Score =   365 bits (938),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 195/346 (56%), Positives = 244/346 (71%), Gaps = 17/346 (5%)
 Frame = -1

Query  1003  ILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHN---  833
             I   +F+      IP   G I E+DD  + ++ EA   AL+ Y+P+        +HN   
Sbjct  7     IACYVFLVCFVSQIPNLRGKIGEYDDYLRKQEAEAQEQALRAYDPEFDQTVKKFDHNDPS  66

Query  832   ----VVKVILDYRnnnnetetetNSTRRHL-GK---KKYRGPCNATNPIDRCWRCDPNWA  677
                  + +   YR N N T     STRR L G+   KK  GPC ATNP+D+CWRC  +WA
Sbjct  67    HQNATISIKGGYRPNKNTT-----STRRSLRGRGNWKKIAGPCKATNPVDKCWRCQADWA  121

Query  676   NKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFAR  500
               RKRL  C  GFG+K  GG +G FY VTD SD  + NPK GT+RHAVIQ  PLWIIFAR
Sbjct  122   QNRKRLVSCVRGFGHKTTGGFSGKFYKVTDPSDDDMQNPKPGTIRHAVIQKVPLWIIFAR  181

Query  499   SMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIR  320
             SM+I+LKQELM+ S+KTID RGA VHI+ GAGIT+QF +NVIIHG+ +H IV  +GGMIR
Sbjct  182   SMHIRLKQELMITSNKTIDARGANVHIAFGAGITIQFAQNVIIHGLHIHHIVTSNGGMIR  241

Query  319   DSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHN  140
             DS++H G+RT++DGDGIS+FG++++WLDHLSM +C DG+ID I+ STAITISN HFT HN
Sbjct  242   DSVDHIGIRTQADGDGISVFGSSNVWLDHLSMSRCQDGLIDVIQGSTAITISNCHFTHHN  301

Query  139   EVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             +V+L GA+D    D IMQVTIA+NHFGK LVQRMPRCR+G+ HVVN
Sbjct  302   DVILLGASDQFSGDSIMQVTIAYNHFGKGLVQRMPRCRWGFVHVVN  347



>emb|CDP02199.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   361 bits (927),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 169/242 (70%), Positives = 201/242 (83%), Gaps = 1/242 (0%)
 Frame = -1

Query  724  ATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTL  548
            ATN ID+CWRCDPNWAN R+RLADC+ GFG  AKGG+ G  Y VTD SD  +  P+ GTL
Sbjct  2    ATNVIDKCWRCDPNWANNRQRLADCAQGFGRAAKGGQGGPIYVVTDPSDDNVAEPRPGTL  61

Query  547  RHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIH  368
            RHAVIQ  PLWIIFARSM I L QEL++QSHKTIDGRG  VHI+ GAG T+QFV+N+IIH
Sbjct  62   RHAVIQKGPLWIIFARSMTITLSQELIMQSHKTIDGRGVNVHIAYGAGFTIQFVRNIIIH  121

Query  367  GIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIE  188
             + +HD+    GGMIRDS++H GLRT ++GDGIS+FGA D+WLDHLSM KC DG+IDA++
Sbjct  122  NVHIHDVKTTSGGMIRDSVDHVGLRTANEGDGISIFGARDVWLDHLSMSKCSDGLIDAVQ  181

Query  187  ASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHV  8
            ASTAITISN HFTDH++V+LFGA+D +  DK MQVT+AFNHFGKRLVQRMPRCR G+FH+
Sbjct  182  ASTAITISNCHFTDHDKVLLFGASDVTEVDKNMQVTVAFNHFGKRLVQRMPRCRSGFFHL  241

Query  7    VN  2
            VN
Sbjct  242  VN  243



>ref|XP_002437204.1| hypothetical protein SORBIDRAFT_10g022830 [Sorghum bicolor]
 gb|EER88571.1| hypothetical protein SORBIDRAFT_10g022830 [Sorghum bicolor]
Length=454

 Score =   365 bits (936),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 193/355 (54%), Positives = 245/355 (69%), Gaps = 25/355 (7%)
 Frame = -1

Query  1027  EMEGFQIK-----ILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDP  863
             E EGF+       +L  L + L+A +  +S  +I +FDD W+ RK  A   A  TY+ DP
Sbjct  2     EEEGFRWSRAGSFVLFYLVLFLSAAV--SSEANIGDFDDYWRQRKLMADAAAEATYKHDP  59

Query  862   SNVTSTLNHNVVKVILDYRnnnnetetetNSTRRH--LGKKKYR---GPCNATNPIDRCW  698
               VT+ LN  V + +          E E  STRR   +G KK +   GPC ATNPIDRCW
Sbjct  60    LEVTNQLNRAVHRSV----------EKEDMSTRRRAMMGHKKGKLNNGPCEATNPIDRCW  109

Query  697   RCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKP  521
             RC  +WA  RKRLA C+ GFG    GG  G FY VTD +D  + NP+ GTLR AVIQI+P
Sbjct  110   RCRQDWATDRKRLARCAQGFGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWAVIQIEP  169

Query  520   LWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVH  341
             LWI FAR+M I LK+EL++Q  KTIDGRGAQV I+ GA +T+QF  NVIIH + ++DI+ 
Sbjct  170   LWITFARTMIITLKEELIIQGDKTIDGRGAQVRIANGAQLTVQFANNVIIHNVHINDIMS  229

Query  340   GD--GGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITI  167
              +  GG IRDS +HFG RT SDGDGI+LFG+T++WLDHLS+  C DG+ID I  ST +TI
Sbjct  230   SNKNGGNIRDSPDHFGWRTVSDGDGITLFGSTNVWLDHLSLSNCQDGLIDVIVKSTGVTI  289

Query  166   SNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             SN H T+HN+VMLF ++D  P+D+IMQ+T+AFNHFG+ LVQRMPRCR+G+FHVVN
Sbjct  290   SNCHMTNHNDVMLFSSSDKHPEDQIMQITVAFNHFGRGLVQRMPRCRWGFFHVVN  344



>ref|XP_002871648.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47907.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=472

 Score =   365 bits (938),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 193/357 (54%), Positives = 247/357 (69%), Gaps = 22/357 (6%)
 Frame = -1

Query  1006  KILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDP------------  863
             ++  L+F+   A++IPT  G+ISE D+ W  R +EA    L+ Y  DP            
Sbjct  5     RLSKLMFMFCIAVLIPTIRGNISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHY  64

Query  862   ---SNVTSTLNHNVVKVILDYRnnnnetetetNSTRRHL---GKKKY---RGPCNATNPI  710
                ++VT+T      K   + +       + TNSTRR L   GK K+   +GPC A+NPI
Sbjct  65    DNSTDVTTTEEEGDAKPEEEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNPI  124

Query  709   DRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVI  533
             D+CWRC  +WA +RKRL  C  GFG++  GGK G  Y VT N D  + NPK GTLRHAVI
Sbjct  125   DKCWRCRSDWAKRRKRLTRCVRGFGHRTTGGKRGRIYVVTSNLDDDMVNPKPGTLRHAVI  184

Query  532   QIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVH  353
             Q +PLWIIF   M+I+L QEL++ SHKTID RGA VH++ GAGIT+QFVKNVIIHG+ +H
Sbjct  185   QKEPLWIIFKNDMSIRLNQELLINSHKTIDARGANVHVAHGAGITMQFVKNVIIHGLHIH  244

Query  352   DIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAI  173
              I    GGMIRDS++HFG+RTR+DGDG+S++G+++IWLDH+SM KC DG+IDAI  ST I
Sbjct  245   HISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISMSKCQDGLIDAIVGSTGI  304

Query  172   TISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             TISNSHFT HN+VML GA + +  DK MQVT+A+NHFGK LVQRMPR R+G+ HVVN
Sbjct  305   TISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWGFVHVVN  361



>ref|XP_008446067.1| PREDICTED: pectate lyase-like, partial [Cucumis melo]
Length=381

 Score =   362 bits (929),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/258 (66%), Positives = 209/258 (81%), Gaps = 3/258 (1%)
 Frame = -1

Query  772  STRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTV  593
            +TRRHL  +KY GPC ATNPIDRCWRCD NWA  RK+LADC+LGFG    GGK+G  Y V
Sbjct  18   NTRRHL--RKYTGPCLATNPIDRCWRCDRNWARNRKKLADCALGFGRGTTGGKDGKIYVV  75

Query  592  TDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHIS  416
             D+SD+ L NPK GTLRHAVIQ +PLWIIFA  M I+L +EL++  +KT+DGRGA VHI+
Sbjct  76   RDSSDNDLVNPKPGTLRHAVIQERPLWIIFAHDMVIRLSEELIMTDNKTLDGRGANVHIA  135

Query  415  GGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLD  236
             G  ITLQFV+N+IIH + +HDI  G+GG IRDS++H+G RT+SDGDGIS+FG++ +W+D
Sbjct  136  NGGQITLQFVRNIIIHNLHIHDIKAGNGGFIRDSVSHYGYRTQSDGDGISMFGSSRVWID  195

Query  235  HLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGK  56
            H+SM  C DG+IDA+ ASTAITISN HFT HN+V+L GA+D    DKIMQVT+AFNHFGK
Sbjct  196  HVSMSNCQDGLIDAVMASTAITISNCHFTHHNDVILLGASDSYSNDKIMQVTLAFNHFGK  255

Query  55   RLVQRMPRCRYGYFHVVN  2
             LVQRMPRCR+G+ HVVN
Sbjct  256  GLVQRMPRCRWGFIHVVN  273



>ref|XP_004236194.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=435

 Score =   363 bits (931),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 182/317 (57%), Positives = 228/317 (72%), Gaps = 14/317 (4%)
 Frame = -1

Query  949  GHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNS  770
             HI EFD+VW+ R ++A   A   Y P+P  V   LN+ V K +   +           S
Sbjct  23   AHIKEFDEVWKKRAQQAKKAARHAYNPNPKIVADHLNYQVDKAVRGSK-----------S  71

Query  769  TRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVT  590
             RR L  ++Y G C ATNPID+CWRCDPNWA  R +L DC LGFG K  GGK G  Y V 
Sbjct  72   RRRDL--QRYSGKCMATNPIDQCWRCDPNWARNRMKLTDCVLGFGRKTTGGKGGKIYVVM  129

Query  589  DNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISG  413
            DNSD+ L NPK GTLRHAVIQ +PLWIIFA++M IKL QEL++ S+KTID RG QVHI+ 
Sbjct  130  DNSDNELVNPKPGTLRHAVIQPEPLWIIFAKNMVIKLNQELIMTSNKTIDARGRQVHIAH  189

Query  412  GAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDH  233
            G G+ LQF+ NVII  + +HD   G GG+IRDS++H+G R++SDGDGIS+FG+T++W+DH
Sbjct  190  GGGLMLQFIHNVIISNLHIHDTKAGAGGLIRDSVSHYGYRSKSDGDGISIFGSTNVWIDH  249

Query  232  LSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKR  53
            +SM  C DG+IDA+E STAITISN HFT HN+VMLFGA+D +  D +MQ+T+AFNHFG  
Sbjct  250  ISMSNCQDGLIDAVEGSTAITISNCHFTKHNDVMLFGASDTASGDSVMQITLAFNHFGHG  309

Query  52   LVQRMPRCRYGYFHVVN  2
            L QRMPR R+G+ HVVN
Sbjct  310  LTQRMPRVRWGFVHVVN  326



>ref|XP_010420164.1| PREDICTED: probable pectate lyase 19 isoform X2 [Camelina sativa]
Length=472

 Score =   363 bits (933),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 193/357 (54%), Positives = 242/357 (68%), Gaps = 22/357 (6%)
 Frame = -1

Query  1006  KILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDP------------  863
             ++L L+F+   A +IPT  G+ISE D+ W  R +EA    L+ Y  DP            
Sbjct  5     RLLKLMFMFCIAGLIPTIRGNISELDEYWSRRADEAREFTLQAYHSDPYEIVDHFHERHY  64

Query  862   ---SNVTSTLNHNVVKVILDYRnnnnetetetNSTRRHL---GKKKY---RGPCNATNPI  710
                ++ T T      K   +           T STRR L   GK K+   +GPC A+NPI
Sbjct  65    DNSTDATETEEDGGAKPEEEEEEGIKMVGNSTKSTRRSLRGKGKGKWSKLKGPCTASNPI  124

Query  709   DRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVI  533
             D+CWRC  NWA +RK+L  C  GFG++  GGK G  Y VT N D  + NPK GTLRHAVI
Sbjct  125   DKCWRCRTNWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVI  184

Query  532   QIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVH  353
             Q +PLWIIF   M+I+L QEL++ SHKTID RGA VHI+ GAGIT+QFVKNVIIHG+ +H
Sbjct  185   QKEPLWIIFKNDMSIRLSQELLINSHKTIDARGANVHIAHGAGITMQFVKNVIIHGLHIH  244

Query  352   DIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAI  173
              I    GGMIRDS++HFG+RTR+DGDG+S++G+++IWLDH+SM KC DG+IDAI  ST I
Sbjct  245   HISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISMSKCQDGLIDAIVGSTGI  304

Query  172   TISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             TISNSHFT HN+VML GA + +  DK MQVT+A+NHFGK LVQRMPR R+G+ HVVN
Sbjct  305   TISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWGFVHVVN  361



>ref|XP_007151201.1| hypothetical protein PHAVU_004G026400g [Phaseolus vulgaris]
 gb|ESW23195.1| hypothetical protein PHAVU_004G026400g [Phaseolus vulgaris]
Length=441

 Score =   362 bits (929),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 188/338 (56%), Positives = 230/338 (68%), Gaps = 17/338 (5%)
 Frame = -1

Query  1006  KILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVV  827
             K++  L  +LA I IP     I+EFD+  + + E+A   AL++Y P P  VT+ LN++V 
Sbjct  9     KVVFSLLATLA-ITIPCLEAGIAEFDEFLRAQSEKAHEIALQSYVPTPEFVTNDLNYHV-  66

Query  826   KVILDYRnnnnetetetNSTRRHL--GKKKYRGPCNATNPIDRCWRCDPNWANKRKRLAD  653
                           +  N TRR L  G      PC ++NPID CWRC+ +WA  R RLA 
Sbjct  67    ------------HLSMQNVTRRGLKEGNNAIGKPCESSNPIDNCWRCNKDWAKDRYRLAK  114

Query  652   CSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQ  476
             C  GFG +A GG  G  Y VTDNSD  + NPK GTLR+AV Q  PLWI F RSM I L+Q
Sbjct  115   CGKGFGRRAVGGLGGPIYVVTDNSDEDMINPKPGTLRYAVTQKGPLWITFERSMIISLQQ  174

Query  475   ELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGL  296
             ELM+ S KTIDGRGA V I  G G+T+QFV NVIIHGIRV DIV  +GG+IRDS NH G 
Sbjct  175   ELMISSDKTIDGRGANVQIRDGGGLTMQFVNNVIIHGIRVKDIVPKEGGLIRDSYNHIGQ  234

Query  295   RTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGAN  116
             RTRSDGD IS+FGA++IW+DH+S+    DG+ID I+ STAITISN H T HN+VMLFGA 
Sbjct  235   RTRSDGDAISVFGASNIWIDHVSLSNSADGLIDVIQGSTAITISNCHMTRHNDVMLFGAA  294

Query  115   DHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             D    DKIMQ+T+AFNHFG+ L+QRMPRCR G+FHV+N
Sbjct  295   DSYTGDKIMQITVAFNHFGQGLIQRMPRCRMGFFHVLN  332



>gb|KHN45481.1| Putative pectate lyase 3 [Glycine soja]
Length=379

 Score =   360 bits (923),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 195/344 (57%), Positives = 238/344 (69%), Gaps = 17/344 (5%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             M G   K+   L V+ A I+IP     I+EFDD  + + +EA   AL+ Y P P +VT  
Sbjct  1     MVGSATKVAFNLLVTFA-IVIPCLEAGIAEFDDFLKAQADEAQKIALEAYVPVPEDVTDE  59

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRG--PCNATNPIDRCWRCDPNWANK  671
             LN +V               +  NSTRR L ++K R    C A+NPID CWRC+ NWAN 
Sbjct  60    LNFHV-------------HLSLENSTRRELRQRKGRSGKKCVASNPIDTCWRCNKNWAND  106

Query  670   RKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSM  494
             R RLA C  GFG  A+GG  G  Y VTDNSD  + NPK GT+RHAV Q  PLWIIF RSM
Sbjct  107   RYRLAKCGKGFGRGARGGLGGPIYVVTDNSDDDMVNPKPGTIRHAVTQRGPLWIIFQRSM  166

Query  493   NIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDS  314
              IKL QELM+ S KTIDGRGA V    GAG+T+QFV NVIIHG+R+ +IV  +GGMIRDS
Sbjct  167   MIKLNQELMISSDKTIDGRGANVVFRDGAGLTIQFVNNVIIHGVRIKNIVPKEGGMIRDS  226

Query  313   INHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEV  134
              NH GLRT+SDGD IS+FGA+++W+DH+S+  C DG+ID I+ STAITISN H T HN+V
Sbjct  227   YNHVGLRTKSDGDAISIFGASNVWIDHVSLSNCADGLIDVIQGSTAITISNCHMTKHNDV  286

Query  133   MLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             MLFGA+D    DKIMQ+T+AFNHFG+ LVQRMPRCR+G+ HV+N
Sbjct  287   MLFGASDSYSGDKIMQITVAFNHFGQGLVQRMPRCRWGFVHVLN  330



>emb|CDX85564.1| BnaA02g02490D [Brassica napus]
Length=473

 Score =   363 bits (931),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 189/358 (53%), Positives = 238/358 (66%), Gaps = 23/358 (6%)
 Frame = -1

Query  1006  KILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVV  827
             ++L L+F    A +IPT   ++SE D+ W  R  EA    L+ Y  +P  V    +    
Sbjct  5     RLLKLMFTFYIAGLIPTIRANLSELDEYWSKRAGEAREFTLQAYHSNPYEVVDHFHERHY  64

Query  826   KVILDYRnnnnete----------------tetNSTRRHL-GKKK-----YRGPCNATNP  713
                 D +    +++                 E NSTRR L GK+K      +GPC A+NP
Sbjct  65    DNSTDVKETEEDSDDEKPEEVEDDVIEMVGNEMNSTRRILRGKRKGKWSKLKGPCTASNP  124

Query  712   IDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAV  536
             ID+CWRC  NWA +RK L  C  GFG+   GGK G  Y VT N D  + NPK GTLRHAV
Sbjct  125   IDKCWRCRSNWAKRRKNLVKCVRGFGHSTIGGKRGRIYVVTSNLDEDMVNPKPGTLRHAV  184

Query  535   IQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRV  356
             IQ +PLWIIF   M+I+L QELM+ S KTID RG  VHI+ GAGIT+QFV++VIIHG+R+
Sbjct  185   IQKEPLWIIFKNDMHIRLSQELMICSFKTIDARGTDVHIAHGAGITIQFVRHVIIHGLRI  244

Query  355   HDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTA  176
             H I   +GGMIRDS +HFG+RT++DGDGIS++G++ IWLDH+SM KC DG+IDAI  STA
Sbjct  245   HHICQSNGGMIRDSTDHFGMRTKADGDGISIYGSSMIWLDHISMSKCQDGLIDAIVGSTA  304

Query  175   ITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             ITISNSHFT HN+VML GA + +  DK MQVT+A+NHFGK LVQRMPR R+G+ HVVN
Sbjct  305   ITISNSHFTHHNDVMLLGAQNDNQGDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVN  362



>sp|Q9LFP5.1|PLY19_ARATH RecName: Full=Probable pectate lyase 19; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAC01830.1| pectate lyase-like protein [Arabidopsis thaliana]
Length=472

 Score =   362 bits (930),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 191/358 (53%), Positives = 246/358 (69%), Gaps = 22/358 (6%)
 Frame = -1

Query  1009  IKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDP-----------  863
             +++  L+F    A++IPT  G+ISE D+ W  R +EA    L+ Y  DP           
Sbjct  4     VRLSKLMFTFCIAVLIPTIRGNISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERH  63

Query  862   ----SNVTSTLNHNVVKVILDYRnnnnetetetNSTRRHL---GKKKY---RGPCNATNP  713
                 ++VT+       K   + +       + TNSTRR L   GK K+   +GPC A+NP
Sbjct  64    YDNSTDVTTPEEDGDAKPEEEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNP  123

Query  712   IDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAV  536
             ID+CWRC  +WA +RK+L  C  GFG++  GGK G  Y VT N D  + NPK GTLRHAV
Sbjct  124   IDKCWRCRSDWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAV  183

Query  535   IQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRV  356
             IQ +PLWIIF   M+I+L QEL++ SHKTID RGA VH++ GAGIT+QFVKNVIIHG+ +
Sbjct  184   IQKEPLWIIFKNDMSIRLNQELLINSHKTIDARGANVHVAHGAGITMQFVKNVIIHGLHI  243

Query  355   HDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTA  176
             H I    GGMIRDS++HFG+RTR+DGDG+S++G+++IWLDH+SM KC DG+IDAI  ST 
Sbjct  244   HHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISMSKCQDGLIDAIVGSTG  303

Query  175   ITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             ITISNSHFT HN+VML GA + +  DK MQVT+A+NHFGK LVQRMPR R+G+ HVVN
Sbjct  304   ITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWGFVHVVN  361



>ref|XP_002511525.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF52127.1| Pectate lyase precursor, putative [Ricinus communis]
Length=433

 Score =   361 bits (926),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 191/337 (57%), Positives = 237/337 (70%), Gaps = 15/337 (4%)
 Frame = -1

Query  1009  IKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNV  830
             +K + LL ++ A II PT   +I+ FD VWQ R +EA   AL+ Y P+P ++ +  N  V
Sbjct  4     VKYIKLLVIAFATII-PTLKANIAHFDKVWQQRAKEASHAALQAYHPNPEDIVNHFNKEV  62

Query  829   VKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADC  650
              K + D+           +ST   L + K   PC+ATNPIDRCWRCD NWA+ RK+LA C
Sbjct  63    AKSLNDF-----------SSTSSQLSQHKR--PCHATNPIDRCWRCDANWASNRKKLAGC  109

Query  649   SLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQE  473
             +LGFG    GGK+GD+Y VTD SD  L NP+ GTLR+ VIQ +PLWI FA  M I L QE
Sbjct  110   ALGFGRMTTGGKDGDYYVVTDPSDDDLVNPREGTLRYGVIQDRPLWITFAGDMVITLSQE  169

Query  472   LMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLR  293
             L++ S+KTIDGRGA VHIS GA IT+Q+ +N+IIHGI +HDI  G GG IRDS  HFG R
Sbjct  170   LIINSNKTIDGRGANVHISCGAQITIQYARNIIIHGIHIHDIRGGSGGKIRDSETHFGKR  229

Query  292   TRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGAND  113
             T SDGDGIS++G+ +IW+DH+S+  C DG+IDAI ASTAITISN HFT HN VML G N+
Sbjct  230   TASDGDGISIYGSNNIWIDHVSISNCTDGLIDAIMASTAITISNCHFTRHNTVMLLGGNN  289

Query  112   HSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
                 D +MQVT+AFNHF ++LVQRMPR RYG  HVVN
Sbjct  290   KFSADSVMQVTVAFNHFDRKLVQRMPRVRYGLAHVVN  326



>ref|XP_009380431.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=436

 Score =   361 bits (926),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 181/336 (54%), Positives = 242/336 (72%), Gaps = 19/336 (6%)
 Frame = -1

Query  1003  ILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVK  824
               SLLF++ AA    +S  +I+++D+ W  R+ EA  + ++ Y  +P +V +  N   + 
Sbjct  9     FYSLLFLASAA----SSNTNITDYDEYWVKREAEALSNIMQAYVSEPESVVNHFNTPDIF  64

Query  823   VILDYRnnnnetetetNSTRRHLGKKKYRG-PCNATNPIDRCWRCDPNWANKRKRLADCS  647
              + +             STRR L   K +G  C ATNPIDRCWRC  +WA+ RK LA C+
Sbjct  65    QVFN-------------STRRSLRHGKGKGRKCVATNPIDRCWRCRSDWASNRKLLAKCA  111

Query  646   LGFGYKAKGGKNGDFYTVTDNSD-HPLNPKRGTLRHAVIQIKPLWIIFARSMNIKLKQEL  470
              GFG  A+GG +G  Y VT+ SD + L+P+ GTLR+ V + +PLWIIFAR M IKL+QEL
Sbjct  112   KGFGRHAEGGLSGSIYVVTNPSDDNLLDPRPGTLRYGVTRDRPLWIIFARDMVIKLQQEL  171

Query  469   MVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRT  290
             M+ ++KTIDGRGA VHI+ GAG+T+QFVK+VI+H + +HDI  G GG IRDS  H+G+RT
Sbjct  172   MINNYKTIDGRGANVHIAYGAGLTIQFVKHVIVHNLHIHDIKPGAGGNIRDSEGHWGIRT  231

Query  289   RSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDH  110
             RSDGDG+S+FGA+ +W+DHLSM  C DG+IDA++ASTAITISN H T HN+V+L GA+D 
Sbjct  232   RSDGDGVSIFGASHVWVDHLSMSNCADGLIDAVKASTAITISNCHLTRHNDVILLGASDK  291

Query  109   SPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             S +D +MQVT+A+NHFGK LVQRMPRCR+G+FHVVN
Sbjct  292   SQEDAVMQVTVAYNHFGKGLVQRMPRCRWGFFHVVN  327



>gb|AAB69758.1| putative pectate lyase Nt59 [Nicotiana tabacum]
Length=274

 Score =   355 bits (910),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/271 (62%), Positives = 208/271 (77%), Gaps = 8/271 (3%)
 Frame = -1

Query  994  LLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVIL  815
             LF+ + A IIP  + HI +FD+VW+ R EEA  +A + YEP+P NVT   N  V     
Sbjct  12   FLFI-IFATIIPCLMAHIGDFDEVWRRRAEEAREYARQIYEPNPENVTLAFNQKV-----  65

Query  814  DYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFG  635
              R++  E     NSTRR LG KKY+GPC  TNPIDRCWRCDPNWA+ RKRLADC++GFG
Sbjct  66   --RDSMKEVTVSNNSTRRGLGTKKYKGPCMVTNPIDRCWRCDPNWADNRKRLADCAMGFG  123

Query  634  YKAKGGKNGDFYTVTDNSDHPLNPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSH  455
             KA GGK+G+ Y VTDNSD    PK GTLR+AVIQ +PLWIIF RSM I+L QEL++QS 
Sbjct  124  SKATGGKDGEIYIVTDNSDDYAEPKPGTLRYAVIQKEPLWIIFERSMTIRLHQELIMQSD  183

Query  454  KTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGD  275
            KTID RGA VHI+ GAGITLQ++KNVIIHG+ +HDIV G GGM+RD+++H G+RT SDGD
Sbjct  184  KTIDARGANVHIAKGAGITLQYIKNVIIHGLHIHDIVEGSGGMVRDAVDHIGIRTVSDGD  243

Query  274  GISLFGATDIWLDHLSMRKCDDGVIDAIEAS  182
            GIS+FGA++IW+DH+SMRKC DG+IDA+E S
Sbjct  244  GISIFGASNIWIDHVSMRKCYDGIIDAVEGS  274



>ref|XP_010527871.1| PREDICTED: probable pectate lyase 3 isoform X1 [Tarenaya hassleriana]
Length=709

 Score =   368 bits (945),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 175/256 (68%), Positives = 203/256 (79%), Gaps = 6/256 (2%)
 Frame = -1

Query  766  RRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTD  587
            RR+LG     G C A NPIDRCWRCDP W+  RK+LADC+LGFG K  GGK G +Y VTD
Sbjct  344  RRNLG-----GKCVAYNPIDRCWRCDPGWSKNRKKLADCALGFGRKTTGGKAGPYYVVTD  398

Query  586  NSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGG  410
             SD  L NPK GTLRHAV + +PLWI+FA+SM IKL+QEL++ S KTIDGRG +VHI+GG
Sbjct  399  ASDDDLLNPKAGTLRHAVTREEPLWIVFAKSMVIKLQQELIMTSDKTIDGRGVRVHITGG  458

Query  409  AGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHL  230
            AG TLQFV NVIIH I + +IV G+GG+IRDS  HFGLRTRSDGDGI++FGAT++W+DH+
Sbjct  459  AGFTLQFVNNVIIHNIYIKNIVPGNGGLIRDSETHFGLRTRSDGDGINIFGATNVWIDHV  518

Query  229  SMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRL  50
            SM  C DG+IDAI+ ST ITISN H TDH EVMLFG  D    DK MQ+T+AFNHFGKRL
Sbjct  519  SMSHCSDGMIDAIQGSTGITISNCHLTDHQEVMLFGGTDKDVIDKKMQITVAFNHFGKRL  578

Query  49   VQRMPRCRYGYFHVVN  2
            VQRMPRCRYG  HVVN
Sbjct  579  VQRMPRCRYGLIHVVN  594



>ref|XP_004301165.1| PREDICTED: probable pectate lyase P59-like [Fragaria vesca subsp. 
vesca]
Length=445

 Score =   359 bits (922),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 192/342 (56%), Positives = 240/342 (70%), Gaps = 19/342 (6%)
 Frame = -1

Query  1006  KILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVV  827
             K+  ++   L +I IP    +I  FDDVW+ R++EA   A   Y+ DP      LN  V 
Sbjct  8     KLKLVILCLLMSIAIPVLKANIGMFDDVWEQRQKEAEQAAKAAYQHDPLKHVVHLNKQVH  67

Query  826   KVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCS  647
             K +  +             TRR+L +    GPC A NPID+CWRCDPNW   R++LADC+
Sbjct  68    KAMKGHN-----------DTRRNL-RHHVDGPCEAINPIDKCWRCDPNWHENRQKLADCA  115

Query  646   LGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQEL  470
             LGFG+   GGK G  Y VTD++D  + NPK GTLR+AV + +PLWIIF   M I+LKQEL
Sbjct  116   LGFGHGTTGGKGGKIYVVTDDTDEDMVNPKEGTLRYAVTRPEPLWIIFEEDMKIELKQEL  175

Query  469   MVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRT  290
             M+ S KTIDGRG  VHI GG  ITLQ+V+N+II  I V D +  +GGMIRDSINH+GLRT
Sbjct  176   MMASDKTIDGRGVNVHIQGGGQITLQYVRNIIISNIHVRDTIPKNGGMIRDSINHYGLRT  235

Query  289   RSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNE------VML  128
              SDGDGISLFGAT++W+DH+S   C DG+ID I+ASTAITISNSHFTDHN+      VML
Sbjct  236   ESDGDGISLFGATNVWIDHVSASNCADGLIDVIQASTAITISNSHFTDHNDVIINLSVML  295

Query  127   FGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             FG++D + KD+IMQ+T+AFNHFG+ LVQRMPRCR+G+FHVVN
Sbjct  296   FGSSDSNSKDEIMQITLAFNHFGQGLVQRMPRCRFGFFHVVN  337



>ref|XP_004233352.1| PREDICTED: pectate lyase-like [Solanum lycopersicum]
Length=397

 Score =   357 bits (917),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/258 (65%), Positives = 206/258 (80%), Gaps = 2/258 (1%)
 Frame = -1

Query  772  STRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTV  593
            STRRHL KK Y+GPC ATN ID+CWRCDP WA+ R++ ADC++GFG KA GGK G  Y V
Sbjct  31   STRRHLAKK-YKGPCMATNLIDKCWRCDPQWADNREKYADCAMGFGSKATGGKGGRVYVV  89

Query  592  TDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHIS  416
            +DNSD  + NP  GTLRHAVIQ +PLWIIF R M+IKL++EL++Q HKTIDGRG  +HI 
Sbjct  90   SDNSDSDVENPAPGTLRHAVIQTEPLWIIFERHMHIKLQRELLMQGHKTIDGRGFNIHIE  149

Query  415  GGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLD  236
             GAG+ +Q V NVII  + VH+IV   GGMIRDS  H G+R+  +GDGISLF ATDIW+D
Sbjct  150  KGAGLKMQGVSNVIISNLHVHNIVITPGGMIRDSAEHVGIRSEDEGDGISLFSATDIWID  209

Query  235  HLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGK  56
            H+SM +  DG+IDA++ ST ITISN HFTDH++VMLFGAND+  +DK MQ+T+A+NHFGK
Sbjct  210  HVSMSRATDGLIDAVKGSTGITISNCHFTDHDKVMLFGANDNHVEDKKMQITLAYNHFGK  269

Query  55   RLVQRMPRCRYGYFHVVN  2
            RL QRMPR R+G+FH+VN
Sbjct  270  RLDQRMPRVRFGFFHIVN  287



>ref|XP_011087066.1| PREDICTED: pectate lyase [Sesamum indicum]
Length=431

 Score =   358 bits (919),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 176/321 (55%), Positives = 224/321 (70%), Gaps = 28/321 (9%)
 Frame = -1

Query  961  PTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetet  782
            P S   I+++D+  Q + E A   ALK ++P+P  +   LN+ V +   D++        
Sbjct  26   PESRAAIAKYDEYLQKKAEVASEEALKAFDPNPEKLADDLNYQVSETEDDFK--------  77

Query  781  etNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDF  602
                               ATNPIDRCWRCD NWA  R++LADC+ GFG++A GGK G +
Sbjct  78   -------------------ATNPIDRCWRCDRNWAQNRQKLADCARGFGHRATGGKGGRY  118

Query  601  YTVTDNSDHPLN-PKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQV  425
            Y VTD SD  ++ PK GTLRHA IQ +PLWIIFA  M IKLK+EL+  S+KT+DGRGA+V
Sbjct  119  YVVTDPSDDDMDKPKPGTLRHAAIQKEPLWIIFANHMVIKLKEELLFASNKTLDGRGAKV  178

Query  424  HISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDI  245
            HI+ GAGITLQFV NVIIH IR+HDI    GGMIRD+++H GLRTRSDGDGIS+F + +I
Sbjct  179  HIAYGAGITLQFVHNVIIHNIRIHDIHPAPGGMIRDAVDHIGLRTRSDGDGISVFNSNNI  238

Query  244  WLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNH  65
            W+DH+S+ K  DG+ID IE STAITISN  F  HN+VML GA+D + KD IMQ+T+AFN 
Sbjct  239  WIDHVSLSKGTDGLIDVIEGSTAITISNCKFNHHNDVMLLGAHDSTAKDSIMQITVAFNR  298

Query  64   FGKRLVQRMPRCRYGYFHVVN  2
            FGK L+QRMPR R+G+ HV+N
Sbjct  299  FGKGLIQRMPRIRWGFVHVIN  319



>ref|XP_006344502.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=435

 Score =   358 bits (919),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 181/317 (57%), Positives = 227/317 (72%), Gaps = 14/317 (4%)
 Frame = -1

Query  949  GHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNS  770
             HI EFD+VW+ R ++A   A   Y P+P  V   LN+ V K +             +NS
Sbjct  23   AHIKEFDEVWKKRAQQAKKAARHAYNPNPKIVADHLNYQVDKAV-----------RGSNS  71

Query  769  TRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVT  590
             RR L   +Y G C ATNPID+CWRCDPNWA  R +L DC LGFG K  GGK G  Y V 
Sbjct  72   RRRDL--HRYSGKCMATNPIDQCWRCDPNWARNRMKLTDCVLGFGRKTTGGKGGKIYVVM  129

Query  589  DNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISG  413
            DNSD+ L NPK GTLRHAVIQ +PLWIIFA++M I+L QEL++ S+KTID RG QVHI+ 
Sbjct  130  DNSDNELVNPKPGTLRHAVIQPEPLWIIFAKNMVIRLNQELIMTSNKTIDARGRQVHIAH  189

Query  412  GAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDH  233
            G G+ LQFV NV+I  + +HD   G GG+IRDS++H+G R++SDGDGIS+FG+T++W+DH
Sbjct  190  GGGLMLQFVHNVLISNLHIHDTKAGSGGLIRDSVSHYGYRSKSDGDGISIFGSTNVWIDH  249

Query  232  LSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKR  53
            +SM  C DG+IDA+E STAITISN HFT HN+VMLFGA+D +  D +MQ+T+AFNHFG  
Sbjct  250  ISMSNCQDGLIDAVEGSTAITISNCHFTKHNDVMLFGASDTASGDSVMQITLAFNHFGHG  309

Query  52   LVQRMPRCRYGYFHVVN  2
            L QRMPR R+G+ H VN
Sbjct  310  LTQRMPRIRWGFVHAVN  326



>ref|XP_009126031.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
Length=481

 Score =   360 bits (923),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 188/366 (51%), Positives = 236/366 (64%), Gaps = 31/366 (8%)
 Frame = -1

Query  1006  KILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVV  827
             ++L L+F    A +IPT   ++SE D+ W  R  EA    L+ Y  +P  V    +    
Sbjct  5     RLLKLMFTFYIAGLIPTIRANLSELDEYWSKRAGEAREFTLQAYHSNPYEVVDHFHERHY  64

Query  826   KVILDYRnnnnete----------------tetNSTRRHLGK--------------KKYR  737
                 D +    +++                 E NSTRR L                 K +
Sbjct  65    DNSTDVKETEEDSDDEKPEEVEDDVIEMVGNEMNSTRRILRGKPKGKGKGKRKGKWSKLK  124

Query  736   GPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPK  560
             GPC A+NPID+CWRC  NWA +RK L  C  GFG+   GGK G  Y VT N D  + NPK
Sbjct  125   GPCTASNPIDKCWRCRSNWAKRRKNLVKCVRGFGHSTIGGKRGRIYVVTSNLDEDMVNPK  184

Query  559   RGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKN  380
              GTLRHAVIQ +PLWIIF   M+I+L QELM+ S KTID RGA VHI+ GAGIT+QFV++
Sbjct  185   PGTLRHAVIQKEPLWIIFKNDMHIRLSQELMICSFKTIDARGADVHIAHGAGITIQFVRH  244

Query  379   VIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVI  200
             VIIHG+R+H I   +GGMIRDS +HFG+RT++DGDGIS++G++ IWLDH+SM KC DG+I
Sbjct  245   VIIHGLRIHHICQSNGGMIRDSTDHFGMRTKADGDGISIYGSSMIWLDHISMSKCQDGLI  304

Query  199   DAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYG  20
             DAI  STAITISNSHFT HN+VML GA + +  DK MQVT+A+NHFGK LVQRMPR R+G
Sbjct  305   DAIVGSTAITISNSHFTHHNDVMLLGAQNDNQGDKKMQVTVAYNHFGKGLVQRMPRIRWG  364

Query  19    YFHVVN  2
             + HVVN
Sbjct  365   FVHVVN  370



>emb|CDP00293.1| unnamed protein product [Coffea canephora]
Length=445

 Score =   358 bits (919),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 184/316 (58%), Positives = 228/316 (72%), Gaps = 16/316 (5%)
 Frame = -1

Query  946  HISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNST  767
            HI EFDD  + R E+A   +L+ Y PDP  VT      V K++              N T
Sbjct  35   HIGEFDDFLRKRAEDALQASLRAYNPDPEAVTDNFTRQVGKML-----------EGGNET  83

Query  766  RRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTD  587
            RR L      G C ATNPIDRCWRCDPNWA  RKRLA C+ GFG + KGG +G +Y V D
Sbjct  84   RRQLKA----GGCVATNPIDRCWRCDPNWAKNRKRLAKCARGFGRQTKGGMHGKYYVVVD  139

Query  586  NSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGG  410
             SD  + +P+ GTLRHAVIQ +PLWIIF  SM IKL QEL++ S KTIDGRG +VHI+ G
Sbjct  140  PSDDNVQDPEPGTLRHAVIQQEPLWIIFDTSMVIKLNQELLINSDKTIDGRGVEVHIAYG  199

Query  409  AGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHL  230
            AG+++QFV+NVIIH I++H IV  +GG++RDS +H GLRTRSDGDGIS+FG+  +W+DH+
Sbjct  200  AGLSIQFVQNVIIHNIKIHHIVPKNGGLVRDSTSHIGLRTRSDGDGISIFGSNHVWIDHV  259

Query  229  SMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRL  50
            S+ KC DG+IDAI ASTAITISN  F +HN+V+L GA+D   +D IMQVT+AFN FGK L
Sbjct  260  SLSKCSDGLIDAIMASTAITISNCKFNNHNDVILLGASDEHSEDAIMQVTVAFNRFGKGL  319

Query  49   VQRMPRCRYGYFHVVN  2
            VQRMPRCR+G+FH+VN
Sbjct  320  VQRMPRCRWGFFHIVN  335



>ref|XP_006357121.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=397

 Score =   356 bits (914),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 166/258 (64%), Positives = 208/258 (81%), Gaps = 2/258 (1%)
 Frame = -1

Query  772  STRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTV  593
            STRRHL KK Y+GPC ATN ID+CWRCDP+WA+ R++ ADC++GFG KA GGK G  Y V
Sbjct  31   STRRHLAKK-YKGPCMATNLIDKCWRCDPHWADHREKYADCAMGFGSKAIGGKGGRVYVV  89

Query  592  TDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHIS  416
            TDNSD  + NP  GTLRHAVIQ +PLWIIF R M+IKLK+EL++QSHKTIDGRG  +HI 
Sbjct  90   TDNSDKDVENPTPGTLRHAVIQKEPLWIIFERHMHIKLKRELLMQSHKTIDGRGFNIHIE  149

Query  415  GGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLD  236
             GAG+ +Q V N+II  + VH+I    GGMIRDS++H G+R+  +GDGISLF ATD+W+D
Sbjct  150  KGAGLKMQSVNNIIITNLHVHNIGITPGGMIRDSVDHVGIRSEDEGDGISLFAATDVWID  209

Query  235  HLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGK  56
            H+SM +  DG+IDA++ ST ITISN HFTDH++ MLFGAND+  +DK MQ+T+A+NHFGK
Sbjct  210  HVSMSRATDGLIDAVQGSTGITISNCHFTDHDKAMLFGANDNHVEDKKMQITLAYNHFGK  269

Query  55   RLVQRMPRCRYGYFHVVN  2
            RL QRMPR R+G+FH+VN
Sbjct  270  RLDQRMPRVRFGFFHIVN  287



>ref|XP_006299938.1| hypothetical protein CARUB_v10016149mg [Capsella rubella]
 gb|EOA32836.1| hypothetical protein CARUB_v10016149mg [Capsella rubella]
Length=472

 Score =   358 bits (920),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 193/357 (54%), Positives = 238/357 (67%), Gaps = 22/357 (6%)
 Frame = -1

Query  1006  KILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVV  827
             ++L L+ V   A  IPT   ++ E D+ W N+  EA  H L  Y PDP ++    +    
Sbjct  5     RLLKLVCVICIASFIPTIRANVPETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHY  64

Query  826   KVILDYRnnnnet-------------etetNSTRRHLGKK--------KYRGPCNATNPI  710
                 D      +               + TNSTRR L  K        K RGPC A+NPI
Sbjct  65    DNSTDVEETEEDKAVDSAEEEDIEMISSPTNSTRRSLSGKRRGRGKWSKLRGPCTASNPI  124

Query  709   DRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTD-NSDHPLNPKRGTLRHAVI  533
             D+CWRC P+WA +RK+L  C  GFGYK  GGK G  Y VT    D  +NP+ GTLRHAVI
Sbjct  125   DKCWRCQPDWAKRRKKLVHCVRGFGYKVTGGKRGRIYVVTSPRDDDTVNPRPGTLRHAVI  184

Query  532   QIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVH  353
             Q +PLWIIF   M+I+L QELM+ SHKTID RG+ VHI+ GAGIT+Q+V N+IIHG+ +H
Sbjct  185   QKEPLWIIFKHDMSIRLSQELMIASHKTIDARGSNVHIAYGAGITIQYVHNIIIHGLHIH  244

Query  352   DIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAI  173
              IV   GG+IRDSINHFG R ++DGDGIS+FGAT+IWLDH+SM +C DG+IDAI  STAI
Sbjct  245   HIVKSSGGLIRDSINHFGQRGQADGDGISIFGATNIWLDHISMSRCQDGLIDAIMGSTAI  304

Query  172   TISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             TISNSHFT HN+VML GA D++  DK MQVT+A+NHFGK LVQRMPR R+G+ HVVN
Sbjct  305   TISNSHFTHHNDVMLLGAQDNNQDDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVN  361



>gb|KEH24975.1| pectate lyase P59-like protein [Medicago truncatula]
Length=453

 Score =   357 bits (917),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 185/341 (54%), Positives = 230/341 (67%), Gaps = 16/341 (5%)
 Frame = -1

Query  1006  KILSLLFVSLAAIIIPTSLGHI---SEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNH  836
             KI  +L V+ A  I      H+   +E DD  + R EEA   A++TY P P  V   LN 
Sbjct  13    KIAFILLVTFAITIPCLEAAHVLSPAEIDDFVKARAEEAHKVAVETYVPIPEGVAHDLNV  72

Query  835   NVVKVILDYRnnnnetetetNSTRRHLGKK--KYRGPCNATNPIDRCWRCDPNWANKRKR  662
              V          +   E E N+TRR + +K  K+ GPC ATNPID CWRC  +WA  R +
Sbjct  73    AV----------HMSMEAEENNTRREMRQKGKKHDGPCEATNPIDSCWRCKADWAANRFQ  122

Query  661   LADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIK  485
             LA CS GFG K  GG  G  Y VTD SD+ + NPK GTLR   +Q  PLWI FARSM I+
Sbjct  123   LAKCSKGFGRKTTGGLGGPIYVVTDESDNDMVNPKPGTLRFGAVQKGPLWITFARSMVIR  182

Query  484   LKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINH  305
             L QELMV S KTIDGRGA V I  GAGIT+QFV NVIIHG+ + +I    GG+IRDS +H
Sbjct  183   LNQELMVSSDKTIDGRGANVQIRDGAGITMQFVNNVIIHGLHIQNIKAKPGGLIRDSFDH  242

Query  304   FGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLF  125
              G RTRSDGD IS++G+++IW+DHLS+ +C+DG++D I+ ST ITISN H T HN+VMLF
Sbjct  243   TGQRTRSDGDAISIYGSSNIWIDHLSLSECEDGLVDIIQGSTGITISNCHMTKHNDVMLF  302

Query  124   GANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             GA+D    DK+MQ+T+AFNHFG+ L+QRMPRCRYG+ HV+N
Sbjct  303   GASDSYTGDKLMQITVAFNHFGQGLIQRMPRCRYGFVHVLN  343



>ref|XP_009101245.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=459

 Score =   357 bits (917),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 195/340 (57%), Positives = 237/340 (70%), Gaps = 17/340 (5%)
 Frame = -1

Query  994  LLFVSLA-AIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVI  818
              FVSL+ A++ P+  GH++ +D+ W  R+ +A    +K+Y+P+P NVT   NH+    +
Sbjct  13   FAFVSLSLAVVAPSVQGHVAVYDEYWTQRQTDALRETIKSYDPNPFNVTDHFNHHAALAM  72

Query  817  LDYRnnnnetetetNSTRRHLGK-------KKYRGPCNATNPIDRCWRCDPNWANKRKRL  659
                    ET    N TRR L +       ++  G  ++ N ID+CWR D NW   RK+L
Sbjct  73   --------ETTGADNGTRRELRQVRRGRKTRRRGGRHHSLNAIDKCWRGDKNWHKNRKKL  124

Query  658  ADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKL  482
            ADC LGFG K  GGK G FY VTD SDH L NPK GTLRHAV + +PLWIIF RSM IKL
Sbjct  125  ADCVLGFGRKTTGGKKGQFYVVTDASDHDLINPKPGTLRHAVTRDRPLWIIFGRSMIIKL  184

Query  481  KQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHF  302
            +QEL++   KTIDGRGA VHI GGAG+TLQFVKNVIIH I +  I  G GGMIRD  +H 
Sbjct  185  QQELIITHDKTIDGRGANVHIMGGAGLTLQFVKNVIIHNIHIKHIKCGAGGMIRDCEHHV  244

Query  301  GLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFG  122
            G R++SDGDGI++FGAT+IW+DH+SM  C DG+IDAI  STAITISNSH TDHNEV+LFG
Sbjct  245  GQRSKSDGDGINIFGATNIWIDHVSMTHCSDGMIDAIMGSTAITISNSHLTDHNEVLLFG  304

Query  121  ANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
              D    DK MQ+T+AFNHFGKRLVQRMPR RYG  HVVN
Sbjct  305  GKDGDVIDKKMQITVAFNHFGKRLVQRMPRVRYGLVHVVN  344



>ref|XP_004489374.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=447

 Score =   357 bits (915),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 183/337 (54%), Positives = 227/337 (67%), Gaps = 14/337 (4%)
 Frame = -1

Query  1006  KILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVV  827
             KI  +L V+   I IP     I+EFDD  + + EEA   AL +Y P P +V   LN +V 
Sbjct  13    KIALILLVTFT-ITIPCLEAGIAEFDDFLRAQAEEAHKLALASYVPIPGDVAHDLNFHVH  71

Query  826   KVILDYRnnnnetetetNSTRRHLGKKKYRG-PCNATNPIDRCWRCDPNWANKRKRLADC  650
               +              N TRR L +K   G  C ATNPID CWRC  +WAN R +LA C
Sbjct  72    LAL-----------EGANDTRRELKQKHAAGEACEATNPIDSCWRCQKDWANDRFKLAKC  120

Query  649   SLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQE  473
             S GFG +A GG  G  Y VTD SD+ + NPK GTLR+  +Q  PLWI F RSM I+L QE
Sbjct  121   SKGFGRRATGGLGGPIYVVTDESDNDMQNPKPGTLRYGAVQKGPLWITFQRSMIIRLNQE  180

Query  472   LMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLR  293
             L+V S KTIDGRGA V I  G GIT+QFV NVIIHG+ + +I    G MIRDS NH G R
Sbjct  181   LLVSSDKTIDGRGANVQIRDGGGITMQFVNNVIIHGLHISNIKSKPGAMIRDSYNHVGQR  240

Query  292   TRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGAND  113
             TRSDGD +S+FG+++IW+DH+S+ +C+DG+ID I+ STAITISN H T HN+VMLFGA+D
Sbjct  241   TRSDGDALSIFGSSNIWIDHVSLSQCEDGLIDVIQGSTAITISNCHMTKHNDVMLFGASD  300

Query  112   HSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
                 DK+MQ+T+AFNHFG+ L+QRMPRCR+G+ HVVN
Sbjct  301   TYNGDKLMQITVAFNHFGQGLIQRMPRCRFGFVHVVN  337



>gb|EYU28712.1| hypothetical protein MIMGU_mgv1a006498mg [Erythranthe guttata]
Length=442

 Score =   356 bits (914),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 185/335 (55%), Positives = 239/335 (71%), Gaps = 15/335 (4%)
 Frame = -1

Query  1003  ILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVK  824
             IL LL +     +IP S   I+++DD  + +  E++  +LK ++P+P  V   LN  V +
Sbjct  11    ILLLLSMIYFVTLIPKSHAAIAKYDDYLRKKANESFAESLKAFDPNPEKVADELNEQVGE  70

Query  823   VILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSL  644
              ++               +RRHL   K    C ATNPIDRCWRCD +W+  RK+LA+C  
Sbjct  71    TLVHENL-----------SRRHL---KEENDCKATNPIDRCWRCDGDWSKNRKKLAECVR  116

Query  643   GFGYKAKGGKNGDFYTVTDNSDHPLN-PKRGTLRHAVIQIKPLWIIFARSMNIKLKQELM  467
             GFG++  GGK+G +Y VTD SD  ++ PK GTLRHAVIQ +PLWIIFARSM I+LKQEL+
Sbjct  117   GFGHRTTGGKDGRYYLVTDPSDDDMDKPKNGTLRHAVIQSEPLWIIFARSMVIRLKQELI  176

Query  466   VQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTR  287
               S KT+DGRG +V I+ GAG+TLQFV NVIIH IR+H+IV   GGMIRD+++H GLRT 
Sbjct  177   FASDKTVDGRGVRVRIAYGAGLTLQFVHNVIIHNIRIHNIVSTPGGMIRDAVDHIGLRTV  236

Query  286   SDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHS  107
             SDGDGI++F + +IW+DH+S+ K  DG+ID IE STAITISN  F +HN VML GA+D+S
Sbjct  237   SDGDGINVFSSNNIWIDHVSLSKGTDGLIDVIEGSTAITISNCKFNNHNTVMLLGAHDNS  296

Query  106   PKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
              KD IMQVT+AFN FGK LVQRMPRCR+G+FHV+N
Sbjct  297   TKDTIMQVTVAFNRFGKGLVQRMPRCRWGFFHVIN  331



>gb|AAA16476.1| pectate lyase homolog [Zea mays]
 gb|AFW85884.1| hypothetical protein ZEAMMB73_308319 [Zea mays]
Length=438

 Score =   356 bits (913),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 174/316 (55%), Positives = 222/316 (70%), Gaps = 20/316 (6%)
 Frame = -1

Query  946  HISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNST  767
            +++  ++ W  R E A    L  Y  DP   T+  N +V++                 +T
Sbjct  33   NVTSDEEYWAERAEVARSRNLAAYVSDPVAATNRFNADVLRA----------------TT  76

Query  766  RRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTD  587
            RR L +  Y GPC ATNPIDRCWRC  +WA  RKRLA C+ GFG++  GG  G  Y V D
Sbjct  77   RRALAR--YDGPCMATNPIDRCWRCRADWATDRKRLAQCARGFGHRTVGGAAGKLYVVRD  134

Query  586  NSDHPLN-PKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGG  410
             SD  +  P++GTLRHAVIQ +PLWI+FAR M I+L+QEL+V  +KTIDGRGAQVHI   
Sbjct  135  PSDDEMIIPRKGTLRHAVIQDRPLWIVFARDMVIELRQELIVNHNKTIDGRGAQVHIMF-  193

Query  409  AGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHL  230
            A ITLQ V+NVI+H + +HD     GGMIRDS  H+GLRTRSDGDG+S+  ++++W+DH+
Sbjct  194  AQITLQNVQNVILHNLHIHDSKAHSGGMIRDSKRHYGLRTRSDGDGVSVLSSSNVWIDHV  253

Query  229  SMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRL  50
            SM  C DG+ID +  STAIT+SNSHFTDH+ VMLFGA++ SP+D +MQVT+AFNHFG+ L
Sbjct  254  SMSSCSDGLIDVVNGSTAITVSNSHFTDHDHVMLFGASNDSPQDAVMQVTVAFNHFGRGL  313

Query  49   VQRMPRCRYGYFHVVN  2
            VQRMPRCRYG+FHVVN
Sbjct  314  VQRMPRCRYGFFHVVN  329



>ref|XP_004302354.1| PREDICTED: probable pectate lyase P59-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score =   356 bits (913),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 200/344 (58%), Positives = 251/344 (73%), Gaps = 20/344 (6%)
 Frame = -1

Query  1009  IKILSLLFVSLAAIIIP-------TSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVT  851
             +K   +LF+    +I+P       +  G I+ FD V Q R++ A + ALK Y+PDP +VT
Sbjct  4     MKFSLVLFMCSFCVILPCLKAGADSDDGTIAVFDPVLQEREKRAEIAALKAYQPDPESVT  63

Query  850   STLNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANK  671
               L  +V   I             +N+TRRHL KK  +  C ATNPIDRCWRC+P+WA  
Sbjct  64    DELIKDVETSI-----------ERSNTTRRHLAKK-IKAECTATNPIDRCWRCNPDWAKN  111

Query  670   RKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSM  494
             RK+LA+C LGFG + +GGK G  Y V D+SD+ + NPK GTLRHAVIQ  PLWIIF  SM
Sbjct  112   RKQLANCVLGFGRRTRGGKRGPIYVVHDSSDNDMANPKPGTLRHAVIQTGPLWIIFKHSM  171

Query  493   NIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDS  314
              IKL +EL++ SHKTIDGRGA VHI+ GAGIT+QFV+NVIIHGI +HDIV   GG+IRDS
Sbjct  172   TIKLNKELIMTSHKTIDGRGANVHIAHGAGITIQFVENVIIHGIHIHDIVSVGGGLIRDS  231

Query  313   INHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEV  134
             ++H GLR +SDGDGI++FG++ IWLDHLSM  C DG+ D ++ STAITISN HFT HN+V
Sbjct  232   LDHIGLRGQSDGDGITVFGSSHIWLDHLSMWNCYDGLTDVVQGSTAITISNCHFTRHNDV  291

Query  133   MLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             MLFGAND   +D+IMQ+T+AFNHFGK L+QRMPRCR+G+FHVVN
Sbjct  292   MLFGANDLYERDQIMQITVAFNHFGKGLIQRMPRCRFGFFHVVN  335



>gb|EAY99621.1| hypothetical protein OsI_21600 [Oryza sativa Indica Group]
Length=448

 Score =   356 bits (913),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 181/318 (57%), Positives = 228/318 (72%), Gaps = 11/318 (3%)
 Frame = -1

Query  952  LGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetN  773
            +G+I+  ++ W  R E A       Y  DP  V +  N +V+            T T   
Sbjct  32   VGNITADEEYWAKRSEVARSFNRAAYVSDPVAVLNRFNEDVLNT---------TTATAAA  82

Query  772  STRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTV  593
            + R  + + + RGPC  TNPID CWRC  NWA++RKRLA C++GFG+KA GG  G  Y V
Sbjct  83   ARRSLMRRYRRRGPCTVTNPIDLCWRCRKNWASRRKRLAKCAMGFGHKATGGLAGKIYIV  142

Query  592  TDNSD-HPLNPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHIS  416
            TD  D H + P+RGTLRHAVIQ +PLWI+FARSM I+L +EL+V S KTIDGRGAQVH++
Sbjct  143  TDAGDEHLVIPRRGTLRHAVIQERPLWIVFARSMVIRLAKELIVTSDKTIDGRGAQVHVT  202

Query  415  GGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLD  236
            G A IT+Q V NVIIH + +H+ V   GG+IRDS++HFG+R  SDGDGIS+ G+++IW+D
Sbjct  203  G-AQITVQAVSNVIIHNLHIHNSVPRSGGLIRDSMHHFGIRGESDGDGISVMGSSNIWID  261

Query  235  HLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGK  56
            H+SM  C DG+ID  + STAITISNSHFT H+ VMLFGA+D SPKDKIMQVT+AFNHFGK
Sbjct  262  HVSMSNCSDGLIDITDGSTAITISNSHFTKHDHVMLFGASDDSPKDKIMQVTLAFNHFGK  321

Query  55   RLVQRMPRCRYGYFHVVN  2
             LVQRMPRCR+G+FH VN
Sbjct  322  GLVQRMPRCRFGFFHTVN  339



>ref|NP_001056784.1| Os06g0144900 [Oryza sativa Japonica Group]
 dbj|BAD68407.1| putative pectate lyase homolog [Oryza sativa Japonica Group]
 dbj|BAD68762.1| putative pectate lyase homolog [Oryza sativa Japonica Group]
 dbj|BAF18698.1| Os06g0144900 [Oryza sativa Japonica Group]
 gb|EAZ35811.1| hypothetical protein OsJ_20103 [Oryza sativa Japonica Group]
 dbj|BAG91996.1| unnamed protein product [Oryza sativa Japonica Group]
Length=448

 Score =   355 bits (912),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 181/318 (57%), Positives = 228/318 (72%), Gaps = 11/318 (3%)
 Frame = -1

Query  952  LGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetN  773
            +G+I+  ++ W  R E A       Y  DP  V +  N +V+            T T   
Sbjct  32   VGNITADEEYWAKRSEVARSFNRAAYVSDPVAVLNRFNEDVLNT---------TTATAAA  82

Query  772  STRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTV  593
            + R  + + + RGPC  TNPID CWRC  NWA++RKRLA C++GFG+KA GG  G  Y V
Sbjct  83   ARRSLMRRYRRRGPCTVTNPIDLCWRCRKNWASRRKRLAKCAMGFGHKATGGLAGKIYIV  142

Query  592  TDNSD-HPLNPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHIS  416
            TD  D H + P+RGTLRHAVIQ +PLWI+FARSM I+L +EL+V S KTIDGRGAQVH++
Sbjct  143  TDAGDEHLVIPRRGTLRHAVIQERPLWIVFARSMVIRLAKELIVTSDKTIDGRGAQVHVT  202

Query  415  GGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLD  236
            G A IT+Q V NVIIH + +H+ V   GG+IRDS++HFG+R  SDGDGIS+ G+++IW+D
Sbjct  203  G-AQITVQAVSNVIIHNLHIHNSVPRSGGLIRDSMHHFGIRGESDGDGISVMGSSNIWID  261

Query  235  HLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGK  56
            H+SM  C DG+ID  + STAITISNSHFT H+ VMLFGA D SPKDKIMQVT+AFNHFGK
Sbjct  262  HVSMSNCSDGLIDITDGSTAITISNSHFTKHDHVMLFGARDDSPKDKIMQVTLAFNHFGK  321

Query  55   RLVQRMPRCRYGYFHVVN  2
             LVQRMPRCR+G+FH+VN
Sbjct  322  GLVQRMPRCRFGFFHMVN  339



>ref|XP_010453638.1| PREDICTED: probable pectate lyase 19 [Camelina sativa]
Length=490

 Score =   357 bits (915),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 196/374 (52%), Positives = 247/374 (66%), Gaps = 40/374 (11%)
 Frame = -1

Query  1003  ILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDP-------------  863
             +L L+F+   A +IPT  G+ISE D+ W  R +EA    L+ Y  DP             
Sbjct  6     LLKLMFMFCIAGLIPTIRGNISELDEYWSRRADEAREFTLQAYHSDPYEIVDHFHERHYD  65

Query  862   --SNVTSTLNHNVVKVILDYRnnnnete------------------tetNSTRRHL---G  752
               ++ T T     V++  ++     E E                    TNSTRR L   G
Sbjct  66    NSTDATETEEDGAVQLEEEHVGAQVEEEHGGAKPEEEEEEGIKMVGNSTNSTRRSLRGKG  125

Query  751   KKKY---RGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNS  581
             K K+   +GPC A+NPID+CWRC  NWA +RK+L  C  GFG++  GGK G  Y VT N 
Sbjct  126   KGKWSKLKGPCTASNPIDKCWRCRSNWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNL  185

Query  580   DHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAG  404
             D  + NPK GTLRHAVIQ +PLWIIF   M+I+L QEL++ SHKTID RGA VHI+ GAG
Sbjct  186   DEDMVNPKPGTLRHAVIQKEPLWIIFKNDMSIRLNQELLINSHKTIDARGANVHIAHGAG  245

Query  403   ITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSM  224
             IT+QFVKNVIIHG+ +H I    GGMIRDS++HFG+RTR+DGDG+S++G+++IWLDH+SM
Sbjct  246   ITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGSSNIWLDHISM  305

Query  223   RKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQ  44
              KC DG+IDAI  ST ITISNSHFT HN+VML GA + +  DK MQVT+A+NHFGK LVQ
Sbjct  306   SKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVAYNHFGKGLVQ  365

Query  43    RMPRCRYGYFHVVN  2
             RMPR R+G+ HVVN
Sbjct  366   RMPRIRWGFVHVVN  379



>emb|CDY45202.1| BnaA06g34060D [Brassica napus]
Length=459

 Score =   355 bits (912),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 193/340 (57%), Positives = 235/340 (69%), Gaps = 17/340 (5%)
 Frame = -1

Query  994  LLFVSLA-AIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVI  818
              FVSL+ A++ P+  GH++ +D+ W  R+ +A    +K+Y+P+P NVT   N++    +
Sbjct  13   FAFVSLSLAVVAPSVQGHVAVYDEYWTQRQTDALRETIKSYDPNPFNVTDHFNYHAALAM  72

Query  817  LDYRnnnnetetetNSTRRHLGKKKYRGPC-------NATNPIDRCWRCDPNWANKRKRL  659
                    ET    N TRR L + +            ++ N ID+CWR D NW   RK+L
Sbjct  73   --------ETTGADNGTRRELRQVRRGRKTRRRGGRHHSLNAIDKCWRGDKNWHKNRKKL  124

Query  658  ADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKL  482
            ADC LGFG K  GGK G FY VTD SDH L NPK GTLRHAV + +PLWIIF RSM IKL
Sbjct  125  ADCVLGFGRKTTGGKKGQFYVVTDASDHDLINPKPGTLRHAVTRDRPLWIIFGRSMIIKL  184

Query  481  KQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHF  302
            +QEL++   KTIDGRGA VHI GGAG+TLQFVKNVIIH I +  I  G GGMIRD  +H 
Sbjct  185  QQELIITHDKTIDGRGANVHIMGGAGLTLQFVKNVIIHNIHIKHIKCGAGGMIRDCEHHV  244

Query  301  GLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFG  122
            G R++SDGDGI++FGAT+IW+DH+SM  C DG+IDAI  STAITISNSH TDHNEV+LFG
Sbjct  245  GQRSKSDGDGINIFGATNIWIDHVSMTHCSDGMIDAIMGSTAITISNSHLTDHNEVLLFG  304

Query  121  ANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
              D    DK MQ+T+AFNHFGKRLVQRMPR RYG  HVVN
Sbjct  305  GKDGDVIDKKMQITVAFNHFGKRLVQRMPRVRYGLVHVVN  344



>gb|EYU22437.1| hypothetical protein MIMGU_mgv1a006496mg [Erythranthe guttata]
Length=442

 Score =   353 bits (906),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 184/337 (55%), Positives = 235/337 (70%), Gaps = 18/337 (5%)
 Frame = -1

Query  1000 LSLLFVSLA---AIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNV  830
            LSLLF  +A   A+ +P +    +  D+  Q + EEA+  +L+ Y P P  +T   N  V
Sbjct  8    LSLLFFCIALALAVTLPRAHAQNATMDEYLQKKAEEAYQESLQAYNPHPEELTEEFNELV  67

Query  829  VKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADC  650
             + ++             N+TRR L   K  G C ATNPIDRCWRCD NWA  RK+LADC
Sbjct  68   GETLIG-----------QNATRRQL---KQTGECMATNPIDRCWRCDRNWAKNRKKLADC  113

Query  649  SLGFGYKAKGGKNGDFYTVTDNSDHPLN-PKRGTLRHAVIQIKPLWIIFARSMNIKLKQE  473
            + GFG++  GGK G +Y VTD SD+ ++ PK GTLRHAVIQ +PLWIIFA SM I+LKQE
Sbjct  114  ARGFGHQTTGGKKGRYYLVTDPSDNDMDHPKPGTLRHAVIQTEPLWIIFAHSMVIRLKQE  173

Query  472  LMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLR  293
            L+  S KT+DGRG QVHI+ GAG+TLQFV NVIIH I +H+I+  +GG+IRD+INH G R
Sbjct  174  LIFTSDKTVDGRGVQVHIAYGAGLTLQFVHNVIIHNIWIHNIIPRNGGLIRDAINHLGFR  233

Query  292  TRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGAND  113
            T+SDGD IS++ +  IW+DH+S+ +  DG+ID IE STAITISN     HN+VML GA+D
Sbjct  234  TQSDGDAISIYSSNRIWIDHVSLSRATDGLIDIIEGSTAITISNCKLNHHNDVMLLGAHD  293

Query  112  HSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
               +D IMQVT+AFN FG  L+QRMPRCR+G+FHVVN
Sbjct  294  AQSRDAIMQVTVAFNRFGIGLIQRMPRCRWGFFHVVN  330



>ref|XP_010420163.1| PREDICTED: probable pectate lyase 19 isoform X1 [Camelina sativa]
Length=499

 Score =   354 bits (908),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 195/384 (51%), Positives = 247/384 (64%), Gaps = 49/384 (13%)
 Frame = -1

Query  1006  KILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDP------------  863
             ++L L+F+   A +IPT  G+ISE D+ W  R +EA    L+ Y  DP            
Sbjct  5     RLLKLMFMFCIAGLIPTIRGNISELDEYWSRRADEAREFTLQAYHSDPYEIVDHFHERHY  64

Query  862   ---SNVTSTLNHNVVKVILDYRnnnnete---------------------------tetN  773
                ++ T T     V++  ++     E E                             T 
Sbjct  65    DNSTDATETEEDGAVQLEEEHGGAQPEEEHSGAQLEEEHGGAKPEEEEEEGIKMVGNSTK  124

Query  772   STRRHL---GKKKY---RGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKN  611
             STRR L   GK K+   +GPC A+NPID+CWRC  NWA +RK+L  C  GFG++  GGK 
Sbjct  125   STRRSLRGKGKGKWSKLKGPCTASNPIDKCWRCRTNWAKRRKKLTRCVRGFGHRTTGGKR  184

Query  610   GDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRG  434
             G  Y VT N D  + NPK GTLRHAVIQ +PLWIIF   M+I+L QEL++ SHKTID RG
Sbjct  185   GRIYVVTSNLDEDMVNPKPGTLRHAVIQKEPLWIIFKNDMSIRLSQELLINSHKTIDARG  244

Query  433   AQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGA  254
             A VHI+ GAGIT+QFVKNVIIHG+ +H I    GGMIRDS++HFG+RTR+DGDG+S++G+
Sbjct  245   ANVHIAHGAGITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGS  304

Query  253   TDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIA  74
             ++IWLDH+SM KC DG+IDAI  ST ITISNSHFT HN+VML GA + +  DK MQVT+A
Sbjct  305   SNIWLDHISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVA  364

Query  73    FNHFGKRLVQRMPRCRYGYFHVVN  2
             +NHFGK LVQRMPR R+G+ HVVN
Sbjct  365   YNHFGKGLVQRMPRIRWGFVHVVN  388



>ref|XP_002437815.1| hypothetical protein SORBIDRAFT_10g003090 [Sorghum bicolor]
 gb|EER89182.1| hypothetical protein SORBIDRAFT_10g003090 [Sorghum bicolor]
Length=444

 Score =   351 bits (901),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 170/308 (55%), Positives = 217/308 (70%), Gaps = 20/308 (6%)
 Frame = -1

Query  922  WQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNSTRRHLGKKK  743
            W  R E A       Y  DP    +  N +V++                 +TRR L +  
Sbjct  47   WAERAEAARSRNRAAYVSDPVAAMNRFNADVLRA----------------TTRRALAR--  88

Query  742  YRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-N  566
            Y GPC ATNPIDRCWRC  +WA  RKRLA C+ GFG++  GG  G  Y VTD SD  +  
Sbjct  89   YSGPCMATNPIDRCWRCRSDWAADRKRLARCARGFGHRTTGGAAGKLYVVTDPSDDEMIV  148

Query  565  PKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFV  386
            P++GTLRHAVIQ +PLWI+FAR M I+L+QEL+V S KTIDGRGAQVH+ G A +TLQ V
Sbjct  149  PRKGTLRHAVIQDRPLWIVFARDMVIRLRQELIVTSDKTIDGRGAQVHVVG-AQVTLQSV  207

Query  385  KNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDG  206
             +VI+H + +HD V   GGMIRDS  H G+RTRSDGDGIS+  ++++W+DH+SM +C DG
Sbjct  208  HDVILHNLHIHDAVAHSGGMIRDSKRHTGMRTRSDGDGISVLSSSNVWIDHVSMSRCADG  267

Query  205  VIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCR  26
            +ID +  STAIT+SNSHFT H+ VMLFGA++ +P+D++MQ+T+AFNHFG+ LVQRMPRCR
Sbjct  268  LIDVVNGSTAITVSNSHFTHHDHVMLFGASNDNPQDEVMQITVAFNHFGRGLVQRMPRCR  327

Query  25   YGYFHVVN  2
            YG+FHVVN
Sbjct  328  YGFFHVVN  335



>ref|NP_001057945.1| Os06g0583900 [Oryza sativa Japonica Group]
 dbj|BAD68734.1| putative pectate lyase [Oryza sativa Japonica Group]
 dbj|BAF19859.1| Os06g0583900 [Oryza sativa Japonica Group]
 dbj|BAG93046.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80871.1| hypothetical protein OsI_23497 [Oryza sativa Indica Group]
Length=448

 Score =   351 bits (901),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 187/338 (55%), Positives = 235/338 (70%), Gaps = 19/338 (6%)
 Frame = -1

Query  1003  ILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVK  824
             +L  +F+ L+A    TS  +I E+D+ WQ RK  A   A  TY+ DP  VT++ N  V +
Sbjct  17    VLYAVFLLLSAA--ATSEANIGEYDEYWQKRKLMADAAAEATYKRDPFEVTNSFNRAVHR  74

Query  823   VILDYRnnnnetetetNSTRRHLG---KKKYRGPCNATNPIDRCWRCDPNWANKRKRLAD  653
                          +E  S RR L    +KK+ GPC ATNPIDRCWRC  +W   RKRLA 
Sbjct  75    -------------SEEESGRRELAMTKRKKFAGPCKATNPIDRCWRCRADWVTDRKRLAR  121

Query  652   CSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQ  476
             C+ GFG    GG  G FY VTD +D  + NP+ GTLR  VIQ +PLWIIFA+ M I LK+
Sbjct  122   CAQGFGRNTTGGLAGKFYLVTDGTDDDVENPRPGTLRWGVIQDEPLWIIFAKDMIINLKE  181

Query  475   ELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGL  296
             E+M+ S KTIDGRGAQV I+ GA +T+Q   NVIIH I +HDI+ G GGMIRDS  HFG 
Sbjct  182   EMMINSDKTIDGRGAQVRITNGAQVTVQNSNNVIIHNIHIHDILQGKGGMIRDSPEHFGF  241

Query  295   RTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGAN  116
             RT+SDGDGIS+FG+T++WLDHLS+  C DG+ID I  ST +TISN H T+HN+VMLFG++
Sbjct  242   RTQSDGDGISIFGSTNVWLDHLSLSNCQDGLIDVIAKSTGVTISNCHLTNHNDVMLFGSS  301

Query  115   DHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             D   +D+IMQ+T+AFNHFG+ LVQRMPRCR+G+FHVVN
Sbjct  302   DSFSEDQIMQITVAFNHFGRGLVQRMPRCRWGFFHVVN  339



>ref|XP_010492335.1| PREDICTED: probable pectate lyase 19 [Camelina sativa]
Length=499

 Score =   353 bits (905),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 193/384 (50%), Positives = 242/384 (63%), Gaps = 49/384 (13%)
 Frame = -1

Query  1006  KILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLN----  839
             ++L L+F+   A +IPT  G+ISE D+ W  R +EA    L+ Y  DP  +    +    
Sbjct  5     RLLKLMFMFCIAGLIPTIRGNISELDEYWSRRADEAREFTLQAYHSDPYEIVDHFHERHY  64

Query  838   --------------------------------------HNVVKVILDYRnnnnetetetN  773
                                                   H   K   +           TN
Sbjct  65    DNSTDDATETEDGVAQLEEEHGGAKPEEEHGGVQLEEEHGGAKPEEEEEEGIKMVGNSTN  124

Query  772   STRRHL---GKKKY---RGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKN  611
             STRR L   GK K+   +GPC A+NPID+CWRC  NWA +RK+L  C  GFG++  GGK 
Sbjct  125   STRRSLRGKGKGKWSKLKGPCTASNPIDKCWRCRTNWAKRRKKLTRCVRGFGHRTTGGKR  184

Query  610   GDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRG  434
             G  Y VT N D  + NPK GTLRHAVIQ +PLWIIF   M+I+L QEL++ SHKTID RG
Sbjct  185   GRIYVVTSNLDEDMVNPKPGTLRHAVIQKEPLWIIFKNDMSIRLNQELLINSHKTIDARG  244

Query  433   AQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGA  254
             A VHI+ GAGIT+QFVKNVIIHG+ +H I    GGMIRDS++HFG+RTR+DGDG+S++G+
Sbjct  245   ANVHIAHGAGITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLSIYGS  304

Query  253   TDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIA  74
             ++IWLDH+SM KC DG+IDAI  ST ITISNSHFT HN+VML GA + +  DK MQVT+A
Sbjct  305   SNIWLDHISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVTVA  364

Query  73    FNHFGKRLVQRMPRCRYGYFHVVN  2
             +NHFGK LVQRMPR R+G+ HVVN
Sbjct  365   YNHFGKGLVQRMPRIRWGFVHVVN  388



>emb|CAN77957.1| hypothetical protein VITISV_021245 [Vitis vinifera]
Length=407

 Score =   350 bits (897),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 185/342 (54%), Positives = 226/342 (66%), Gaps = 44/342 (13%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             ME   ++++ L+      +I+P    +I +FD+VWQ R EEA   AL+ Y P P  VT  
Sbjct  1     MEAVNMRLVILIPF---LVIVPAVTANIGDFDEVWQTRAEEARKAALQAYNPHPEKVTDN  57

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRK  665
              N  V K                                        CWRC  +WA+ R 
Sbjct  58    FNKKVHK----------------------------------------CWRCRSDWASNRM  77

Query  664   RLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNI  488
             +LADC LGFG K  GGK G  Y VTD SD+ + NPK GTLRHA IQ +PLWIIFA SM I
Sbjct  78    KLADCVLGFGQKTTGGKGGKIYVVTDPSDNDMVNPKPGTLRHAAIQEEPLWIIFAHSMAI  137

Query  487   KLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSIN  308
             +L +EL++ S+KTID RGA VHI+ GAG+TLQFV N+IIHG+ +HDI  G+GG+IRDS +
Sbjct  138   RLNEELIMTSNKTIDARGANVHIANGAGLTLQFVHNIIIHGLHIHDIKVGNGGLIRDSAS  197

Query  307   HFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVML  128
             H+G RTRSDGDGIS+FGAT+IW+DH+SM  C DG+IDAI ASTAITISN HFT HNEVML
Sbjct  198   HYGFRTRSDGDGISIFGATNIWIDHISMSNCADGLIDAIMASTAITISNCHFTHHNEVML  257

Query  127   FGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             FGA+D    D IMQ+TI FNHFG+ L QRMPRCR+G+FHVVN
Sbjct  258   FGASDGYSGDAIMQITITFNHFGQGLTQRMPRCRWGFFHVVN  299



>emb|CDY03043.1| BnaC07g21840D [Brassica napus]
Length=459

 Score =   351 bits (901),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 191/340 (56%), Positives = 232/340 (68%), Gaps = 17/340 (5%)
 Frame = -1

Query  994  LLFVSL-AAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVI  818
              F SL  AI+ P+  GH++ +D+ W  R+ +A    +K+Y+P+P NVT   N++    +
Sbjct  13   FAFASLFVAIVAPSVQGHVAVYDEYWTQRQTDALRQTIKSYDPNPFNVTDHFNYHAALAM  72

Query  817  LDYRnnnnetetetNSTRRHLGKKKYRGPC-------NATNPIDRCWRCDPNWANKRKRL  659
                    ET    N TRR L + +            ++ N ID+CWR D NW   RK+L
Sbjct  73   --------ETTGADNGTRRELRQVRRGRRTKRRGGRHHSLNAIDKCWRGDKNWHKNRKKL  124

Query  658  ADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKL  482
            ADC LGFG +  GGK G FY VTD SDH L NPK GTLRHAV + +PLWIIF RSM IKL
Sbjct  125  ADCVLGFGRRTTGGKKGQFYVVTDASDHDLVNPKPGTLRHAVTRDRPLWIIFGRSMIIKL  184

Query  481  KQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHF  302
            +QEL++   KTIDGRG  VHI GGAG+TLQFVKNVIIH I +  I  G GGMIRD  +H 
Sbjct  185  QQELIITHDKTIDGRGENVHIMGGAGLTLQFVKNVIIHNIHIKHIKCGAGGMIRDCEHHV  244

Query  301  GLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFG  122
            G R++SDGDGI++FGAT+IW+DH+SM  C DG+IDAI  STAITISNSH TDHNEV+LFG
Sbjct  245  GQRSKSDGDGINIFGATNIWIDHVSMTHCSDGMIDAIMGSTAITISNSHLTDHNEVLLFG  304

Query  121  ANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
              D    DK MQ+T+AFNHFGKRLVQRMPR RYG  HVVN
Sbjct  305  GKDGDVIDKKMQITVAFNHFGKRLVQRMPRVRYGLVHVVN  344



>ref|XP_006482544.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=435

 Score =   350 bits (898),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 187/339 (55%), Positives = 237/339 (70%), Gaps = 15/339 (4%)
 Frame = -1

Query  1015  FQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNH  836
              ++  L L+F+    I+IP  L  I+E D+VW+ R EEA     + Y+PDP  V S LN 
Sbjct  1     MELARLKLIFLFSFIILIPC-LSAIAEADEVWRRRAEEAMQTTEQYYDPDPVAVASNLNM  59

Query  835   NVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLA  656
              V  +            ++  + RR L   +  G C ATNPID+CWRC  NWA  R+ LA
Sbjct  60    KVQDL------------SKQTAARRGLLNAE-SGQCEATNPIDKCWRCKENWAEDRQALA  106

Query  655   DCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLK  479
              C+LGFG KA GGK G  Y VTD+SD+ + NPK GTLRHAVIQ +PLWIIFA+ MNIKL+
Sbjct  107   GCALGFGSKATGGKGGKIYEVTDSSDNNMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQ  166

Query  478   QELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFG  299
             QEL+VQ +KTIDGRGA VHI+ GAGI LQFV+NVIIHGI +H+I    GGMIRDS++H G
Sbjct  167   QELVVQGNKTIDGRGANVHIANGAGIRLQFVQNVIIHGIHIHNISPASGGMIRDSVDHVG  226

Query  298   LRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGA  119
              R  SDGD +S+FG+++IWLDHL++ K  DG+IDAI+ STAITISN H ++H++ +L GA
Sbjct  227   NRGPSDGDAVSVFGSSNIWLDHLTLSKAQDGLIDAIQGSTAITISNCHLSNHDKAILLGA  286

Query  118   NDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
              D   +DK MQVT+AFN F K LVQRMP  R+G+ HVVN
Sbjct  287   TDTFTEDKKMQVTVAFNRFDKGLVQRMPCIRFGFAHVVN  325



>ref|XP_002436463.1| hypothetical protein SORBIDRAFT_10g003080 [Sorghum bicolor]
 gb|EER87830.1| hypothetical protein SORBIDRAFT_10g003080 [Sorghum bicolor]
Length=465

 Score =   351 bits (900),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 178/322 (55%), Positives = 221/322 (69%), Gaps = 12/322 (4%)
 Frame = -1

Query  958  TSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetete  779
              L +++   + W  R E A  +    YE DP  V    N  V + +        ET T 
Sbjct  44   AQLVNVTANQEYWAERAEVAHAYNRAAYESDPVGVMDRFNDGVRRAM--------ETSTP  95

Query  778  tNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFY  599
            T S  R L  K   GPC ATNPID+CWRC  +WA  RKRLA C +GFG++  GG  G  Y
Sbjct  96   TRSRSRSLAHKARGGPCTATNPIDQCWRCRGDWARNRKRLARCGMGFGHRTTGGLAGRIY  155

Query  598  TVTDNSDHPLN---PKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQ  428
             VTD SD P N   P++GTLR+AVIQ +PLWI FAR M I L +EL+V S KTIDGRGAQ
Sbjct  156  VVTDPSDEPANLVVPRKGTLRYAVIQDRPLWITFARDMVINLCRELLVTSDKTIDGRGAQ  215

Query  427  VHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATD  248
            VH+ G A ITLQ V+NVI+H + +HD     GG+IRDS +H+GLR  SDGDG+S+ G++D
Sbjct  216  VHVVG-AQITLQNVRNVILHNLHIHDAAPRGGGVIRDSKHHWGLRGESDGDGVSVMGSSD  274

Query  247  IWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFN  68
            IW+DH+SMR C DG++D ++ STA+TISN HFT H+ VMLFGA+D + KDK MQVT+AFN
Sbjct  275  IWIDHVSMRSCADGLVDVVDGSTAVTISNGHFTRHDHVMLFGASDAAVKDKAMQVTVAFN  334

Query  67   HFGKRLVQRMPRCRYGYFHVVN  2
            HFGK LVQRMPRCR+G+FHVVN
Sbjct  335  HFGKGLVQRMPRCRHGFFHVVN  356



>ref|XP_006428983.1| hypothetical protein CICLE_v10013750mg [Citrus clementina]
 gb|ESR42223.1| hypothetical protein CICLE_v10013750mg [Citrus clementina]
Length=438

 Score =   350 bits (897),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 185/339 (55%), Positives = 236/339 (70%), Gaps = 14/339 (4%)
 Frame = -1

Query  1015  FQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNH  836
              ++  L L F+   A +IP    +ISE D+VW+ R EEA     + Y+P+P  + S LN 
Sbjct  3     MELTKLRLFFLFSFAALIPCLSANISEVDEVWRRRAEEAMQTTEQYYDPNPVAIASHLNM  62

Query  835   NVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLA  656
              V  +            ++  + RR L   +  G C ATNPID CWRC  NWA  R+ LA
Sbjct  63    KVQDL------------SKQTAARRGLLNAE-SGQCEATNPIDNCWRCKENWAENRQALA  109

Query  655   DCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLK  479
              C+LGFG KA GGK G  Y VTD SD+ + NPK GTLRHAVIQ +PLWIIFA+ MNIKL+
Sbjct  110   GCALGFGIKATGGKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQ  169

Query  478   QELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFG  299
             QEL+VQ  KTIDGRGA VHI+ GAG  LQFV+NVIIHGI +H+I    GGMIRDS++H G
Sbjct  170   QELIVQGKKTIDGRGANVHIANGAGFMLQFVQNVIIHGIHIHNISPRSGGMIRDSVDHVG  229

Query  298   LRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGA  119
              R +SDGD +S+FG+++IWLDHL++ +  DG+IDAI+ASTAITISN HF++H++ +L GA
Sbjct  230   KRGQSDGDAVSIFGSSNIWLDHLTLSQAHDGLIDAIQASTAITISNCHFSNHDKAILLGA  289

Query  118   NDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             +D   +DK MQVT+AFN F K LVQRMP  R+G+ HVVN
Sbjct  290   SDTFTEDKKMQVTVAFNRFDKGLVQRMPCVRFGFAHVVN  328



>gb|AAA86241.1| pectate lyase homolog [Medicago sativa]
Length=450

 Score =   350 bits (897),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 179/342 (52%), Positives = 231/342 (68%), Gaps = 3/342 (1%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             M    +KI  +L V   AI IP   G I EFDD  + + + A   A K+Y P+P N+T+ 
Sbjct  1     MAAIAMKISFILLV--LAITIPCLEGRIGEFDDYLKAQADLARQIAFKSYVPNPENITTE  58

Query  844   LNHNVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRK  665
             +N +V   +                +++  G K  R  C ATNPID CWRC  +WA  R+
Sbjct  59    INIHVHLAMEAAMKAEANDTRRELMSQKSRGGKGRRARCMATNPIDSCWRCRKDWAENRQ  118

Query  664   RLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNI  488
              LA C+ GFG +  GG  G  Y VTD SD+ + NP+ GTLR   +Q  PLWIIF RSM I
Sbjct  119   LLAKCAKGFGRRTTGGLGGRIYVVTDPSDNDMVNPRPGTLRFGAVQRGPLWIIFQRSMVI  178

Query  487   KLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSIN  308
              L QELMV S KTIDGRGA V I  GAGIT+QFV NVIIHG+R+ +I   +GG+IRDS +
Sbjct  179   TLTQELMVSSDKTIDGRGANVQIRDGAGITMQFVNNVIIHGLRIKNIKARNGGLIRDSFD  238

Query  307   HFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVML  128
             H G+RTRSDGD IS+FG+++IW+DH+S+  C+DG++D I+ STA+TISN H T HN+VML
Sbjct  239   HIGVRTRSDGDAISVFGSSNIWIDHISLSDCEDGLVDVIQGSTAVTISNCHMTKHNDVML  298

Query  127   FGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             FGA+D    DKIMQ+T+AFNHFG+ L+QRMPRCR+G+FHV+N
Sbjct  299   FGASDTYQDDKIMQITVAFNHFGQGLIQRMPRCRWGFFHVLN  340



>ref|XP_006480843.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=436

 Score =   349 bits (896),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 185/339 (55%), Positives = 236/339 (70%), Gaps = 14/339 (4%)
 Frame = -1

Query  1015  FQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNH  836
              ++  L L F+   A +IP    +ISE D+VW+ R EEA     + Y+P+P  + S LN 
Sbjct  1     MELTKLRLFFLFSFAALIPCLSANISEVDEVWRRRAEEAMQTTEQYYDPNPVAIASHLNM  60

Query  835   NVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLA  656
              V  +            ++  + RR L   +  G C ATNPID CWRC  NWA  R+ LA
Sbjct  61    KVQDL------------SKQTAARRGLLNAE-SGQCEATNPIDNCWRCKENWAENRQALA  107

Query  655   DCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLK  479
              C+LGFG KA GGK G  Y VTD SD+ + NPK GTLRHAVIQ +PLWIIFA+ MNIKL+
Sbjct  108   GCALGFGIKATGGKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQ  167

Query  478   QELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFG  299
             QEL+VQ  KTIDGRGA VHI+ GAG  LQFV+NVIIHGI +H+I    GGMIRDS++H G
Sbjct  168   QELIVQGKKTIDGRGANVHIANGAGFMLQFVQNVIIHGIHIHNISPRSGGMIRDSVDHVG  227

Query  298   LRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGA  119
              R +SDGD +S+FG+++IWLDHL++ +  DG+IDAI+ASTAITISN HF++H++ +L GA
Sbjct  228   KRGQSDGDAVSIFGSSNIWLDHLTLSQAHDGLIDAIQASTAITISNCHFSNHDKAILLGA  287

Query  118   NDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             +D   +DK MQVT+AFN F K LVQRMP  R+G+ HVVN
Sbjct  288   SDTFTEDKKMQVTVAFNRFDKGLVQRMPCVRFGFAHVVN  326



>ref|XP_010551866.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=475

 Score =   350 bits (898),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 188/369 (51%), Positives = 248/369 (67%), Gaps = 33/369 (9%)
 Frame = -1

Query  1024  MEGFQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTST  845
             MEG ++  L  +F  +AA+I     G+++EFD+ WQ R EEA  H+L+ Y  DP  +   
Sbjct  1     MEGARLLHLICMFC-IAALI----RGNVAEFDEYWQKRSEEAHNHSLEAYHSDPFEIVDH  55

Query  844   LNHN---------------------------VVKVILDYRnnnnetetetNSTRRHLGKK  746
              +                              + ++    N+   +    +   R     
Sbjct  56    FHERHYDNSTDIEAEREEEDDHEEEEEEEEYSIAMLTGTTNSTRRSLRGRSRRGRRGKWS  115

Query  745   KYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-  569
             K +GPC A+NPID+CWRC  +WAN+RK+LADC  GFG+K  GGK G  Y VT N D  + 
Sbjct  116   KLKGPCTASNPIDKCWRCRADWANRRKKLADCVRGFGFKTTGGKLGRIYVVTSNLDSDVV  175

Query  568   NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQF  389
             NP+ GTLRHAVIQ  PLWIIF + M+I+L+QEL++ SHKTID RGA VHI+ GAGIT+QF
Sbjct  176   NPRPGTLRHAVIQKVPLWIIFKKDMHIRLQQELLINSHKTIDARGANVHIAYGAGITMQF  235

Query  388   VKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDD  209
             V N+IIHG+ +H IV  +GGMIRDS++H+G RTR+DGDG+S+FGA++IW+DH+SM +C D
Sbjct  236   VTNIIIHGLHIHHIVSSNGGMIRDSVDHYGFRTRADGDGLSIFGASNIWIDHVSMSRCQD  295

Query  208   GVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRC  29
             G+IDAI+ ST ITISNSHFT HN+VML GA++   KDK MQVT+A+NHFGK LVQRMPR 
Sbjct  296   GLIDAIDGSTGITISNSHFTHHNDVMLLGAHNVIDKDKRMQVTVAYNHFGKGLVQRMPRV  355

Query  28    RYGYFHVVN  2
             R+G+ HVVN
Sbjct  356   RWGFVHVVN  364



>ref|XP_003571658.1| PREDICTED: pectate lyase-like [Brachypodium distachyon]
Length=432

 Score =   348 bits (893),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 172/304 (57%), Positives = 213/304 (70%), Gaps = 18/304 (6%)
 Frame = -1

Query  904  EAWMHALKTYEPDPSNVTSTLNHNVVKVILDYRnnnnetetetNSTRRHLG--KKKYRGP  731
            +A   AL  Y PDP  V ++ N  V +               + S RR L   KK+  GP
Sbjct  35   DAKARALAAYHPDPIAVANSFNRAVHR---------------STSPRRALKGKKKQSNGP  79

Query  730  CNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRG  554
            C ATNPIDRCWRC  +WA  R RLA C+ GFG    GG  G  Y VTD +D  + NP+ G
Sbjct  80   CEATNPIDRCWRCRKDWATDRMRLARCAKGFGQNTTGGLGGQIYIVTDPTDADVQNPRPG  139

Query  553  TLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVI  374
            T+R  VIQ +P+WIIFA++M I L QEL++ S  TIDGRGAQVHI+ GAG+T+Q   NVI
Sbjct  140  TIRFGVIQPQPIWIIFAKNMVITLTQELIINSDTTIDGRGAQVHIAKGAGLTVQNRSNVI  199

Query  373  IHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDA  194
            IH + VHDI H DGGM+RDS +H G RTR+DGDGISLF AT++W+DH+S   C+DG++D 
Sbjct  200  IHNLHVHDIKHTDGGMVRDSPDHIGYRTRADGDGISLFTATNVWIDHISTSMCEDGLVDI  259

Query  193  IEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYF  14
            +++STAITISN H T HN+VMLFGA+D  P DKIMQVT+AF HFG+ LVQRMPRCR+G+F
Sbjct  260  VQSSTAITISNCHLTSHNDVMLFGASDSYPDDKIMQVTVAFTHFGRGLVQRMPRCRWGFF  319

Query  13   HVVN  2
            HVVN
Sbjct  320  HVVN  323



>ref|XP_006431087.1| hypothetical protein CICLE_v10011762mg [Citrus clementina]
 ref|XP_006431088.1| hypothetical protein CICLE_v10011763mg [Citrus clementina]
 gb|ESR44327.1| hypothetical protein CICLE_v10011762mg [Citrus clementina]
 gb|ESR44328.1| hypothetical protein CICLE_v10011763mg [Citrus clementina]
Length=435

 Score =   348 bits (893),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 186/339 (55%), Positives = 236/339 (70%), Gaps = 15/339 (4%)
 Frame = -1

Query  1015  FQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNH  836
              ++  L L+F+    I+IP  L  I+E D+VW+ R EEA     + Y+PDP  V S LN 
Sbjct  1     MELARLKLIFLFSFIILIPC-LSAIAEADEVWRRRAEEAMQTTEQYYDPDPVAVASNLNM  59

Query  835   NVVKVILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLA  656
              V  +            ++  + RR L   +  G C ATNPID+CWRC  NWA  R+ LA
Sbjct  60    KVQDL------------SKQTAARRGLLNAE-SGQCEATNPIDKCWRCKENWAEDRQALA  106

Query  655   DCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLK  479
              C+LGFG KA GGK G  Y VTD+SD+ + NPK GTLRHAVIQ +PLWIIFA+ MNIKL+
Sbjct  107   GCALGFGSKATGGKGGKIYEVTDSSDNNMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQ  166

Query  478   QELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSINHFG  299
             QEL+VQ +KTIDGRGA VHI+ GAGI LQFV+NVIIHGI +H+I    GGMIRDS++H G
Sbjct  167   QELVVQGNKTIDGRGANVHIANGAGIRLQFVQNVIIHGIHIHNISPASGGMIRDSVDHVG  226

Query  298   LRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGA  119
              R  SDGD +S+F +++IWLDHL++ K  DG+IDAI+ STAITISN H ++H++ +L GA
Sbjct  227   NRGPSDGDAVSVFSSSNIWLDHLTLSKAQDGLIDAIQGSTAITISNCHLSNHDKAILLGA  286

Query  118   NDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
              D   +DK MQVT+AFN F K LVQRMP  R+G+ HVVN
Sbjct  287   TDTFTEDKKMQVTVAFNRFDKGLVQRMPCIRFGFAHVVN  325



>dbj|BAH20311.1| AT3G01270 [Arabidopsis thaliana]
Length=365

 Score =   345 bits (886),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/249 (65%), Positives = 195/249 (78%), Gaps = 1/249 (0%)
 Frame = -1

Query  745  KYRGPCNATNPIDRCWRCDPNWANKRKRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-  569
            K  GPC A+NPID+CWRC P+WA +RK+L  C  GFGY+  GGK G  Y VT   D  + 
Sbjct  6    KLTGPCTASNPIDKCWRCQPDWARRRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDMV  65

Query  568  NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELMVQSHKTIDGRGAQVHISGGAGITLQF  389
            NP+ GTLRHAVIQ +PLWI+F   M+I+L QELM+ S KTID RGA VHI+ GAGIT+Q+
Sbjct  66   NPRPGTLRHAVIQKEPLWIVFKHDMSIRLSQELMITSDKTIDARGANVHIAYGAGITMQY  125

Query  388  VKNVIIHGIRVHDIVHGDGGMIRDSINHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDD  209
            V N+IIHG+ VH IV   GG+IRDSINHFG R  +DGDGIS+FGAT+IWLDH+SM KC D
Sbjct  126  VHNIIIHGLHVHHIVKSSGGLIRDSINHFGHRGEADGDGISIFGATNIWLDHISMSKCQD  185

Query  208  GVIDAIEASTAITISNSHFTDHNEVMLFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRC  29
            G+IDAI  STAITISNSHFT HN+VML GA +++  DK MQVT+A+NHFGK LVQRMPR 
Sbjct  186  GLIDAIMGSTAITISNSHFTHHNDVMLLGAQNNNMDDKKMQVTVAYNHFGKGLVQRMPRV  245

Query  28   RYGYFHVVN  2
            R+G+ HVVN
Sbjct  246  RWGFVHVVN  254



>gb|AFW87059.1| pectate lyase [Zea mays]
Length=451

 Score =   348 bits (893),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 184/337 (55%), Positives = 236/337 (70%), Gaps = 11/337 (3%)
 Frame = -1

Query  1003  ILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVK  824
             +L L+F  L+A +   S  +I +FD+ WQ RK  A   A  TY+ DP  V + LN  V +
Sbjct  14    VLYLVFFFLSAAL---SEANIGDFDEYWQQRKLMADAAAEATYKHDPVEVANQLNRAVHR  70

Query  823   VILDYRnnnnetetetNSTRRHLGKKKYRGPCNATNPIDRCWRCDPNWANKRKRLADCSL  644
              + +  +     E    +TR    K K+ GPC ATNPIDRCWRC  +WA  RKRLA C+ 
Sbjct  71    SV-EKEDIGTRREMMGTTTR----KSKFSGPCRATNPIDRCWRCRQDWATDRKRLARCAK  125

Query  643   GFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKLKQELM  467
             GFG    GG  G FY VTD +D  + NP+ GTLR  VIQI+PLWI FA++M I LK+EL+
Sbjct  126   GFGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWGVIQIEPLWITFAKTMIITLKEELI  185

Query  466   VQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHG--DGGMIRDSINHFGLR  293
             ++  KTIDGRG QV I+ GA +TLQFV NVIIH I ++DIV    DGG +RDS +HFG R
Sbjct  186   IRGDKTIDGRGVQVRITNGAQLTLQFVNNVIIHNIHINDIVSSNKDGGYVRDSPDHFGWR  245

Query  292   TRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVMLFGAND  113
             T SDGDGI++FG+T++WLDHLS+  C DG+ID I  ST +TISN H T+HN+VMLF ++D
Sbjct  246   TVSDGDGITVFGSTNVWLDHLSLSNCQDGLIDVIAKSTGVTISNCHLTNHNDVMLFSSSD  305

Query  112   HSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
               P+D+IMQ+T+AFNHFG+ LVQRMPRCR+G+FHVVN
Sbjct  306   KHPEDQIMQITVAFNHFGRGLVQRMPRCRWGFFHVVN  342



>ref|NP_001150723.1| pectate lyase precursor [Zea mays]
 gb|ACG40127.1| pectate lyase precursor [Zea mays]
Length=451

 Score =   348 bits (892),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 185/342 (54%), Positives = 236/342 (69%), Gaps = 21/342 (6%)
 Frame = -1

Query  1003  ILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNHNVVK  824
             +L L+F  L+A +   S  +I +FD+ WQ RK  A   A  TY+ DP  V + LN  V +
Sbjct  14    VLYLVFFFLSAAL---SEANIGDFDEYWQQRKLMADAAAEATYKHDPVEVANQLNRAVHR  70

Query  823   VILDYRnnnnetetetNSTRRHL-----GKKKYRGPCNATNPIDRCWRCDPNWANKRKRL  659
              +          E +   TRR +      K K+ GPC ATNPIDRCWRC  +WA  RKRL
Sbjct  71    SV----------EKDDIGTRREMMGTTTRKSKFSGPCRATNPIDRCWRCRQDWATDRKRL  120

Query  658   ADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMNIKL  482
             A C+ GFG    GG  G FY VTD +D  + NP+ GTLR  VIQI+PLWI FA++M I L
Sbjct  121   ARCAKGFGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWGVIQIEPLWITFAKTMIITL  180

Query  481   KQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHG--DGGMIRDSIN  308
             K+EL+++  KTIDGRG QV I+ GA +TLQFV NVIIH I ++DIV    DGG +RDS +
Sbjct  181   KEELIIRGDKTIDGRGVQVRITNGAQLTLQFVNNVIIHNIHINDIVSSNKDGGYVRDSPD  240

Query  307   HFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVML  128
             HFG RT SDGDGI++FG+T++WLDHLS+  C DG+ID I  ST +TISN H T+HN+VML
Sbjct  241   HFGWRTVSDGDGITVFGSTNVWLDHLSLSNCQDGLIDVIAKSTGVTISNCHLTNHNDVML  300

Query  127   FGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             F ++D  P+D+IMQ+T+AFNHFG+ LVQRMPRCR+G+FHVVN
Sbjct  301   FSSSDKHPEDQIMQITVAFNHFGRGLVQRMPRCRWGFFHVVN  342



>ref|XP_006484673.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=436

 Score =   347 bits (891),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 182/343 (53%), Positives = 238/343 (69%), Gaps = 22/343 (6%)
 Frame = -1

Query  1015  FQIKILSLLFVSLAAIIIPTSLGHISEFDDVWQNRKEEAWMHALKTYEPDPSNVTSTLNH  836
              ++  L L+F+   A ++P    HI+E ++VW+ R EEA     + Y+P+P  V + LN 
Sbjct  1     MELAGLRLIFLFSFATLMPCLSAHIAEVNEVWRRRAEEAMQTTEQYYDPNPVAVANHLNM  60

Query  835   NVVKVILDYRnnnnetetetNSTRRHLGKK----KYRGPCNATNPIDRCWRCDPNWANKR  668
              V  +                 +++ + K+       G C ATNPID+CWRC  NWA  R
Sbjct  61    KVQDL-----------------SKQAIAKRGLLNAESGQCEATNPIDKCWRCKENWAEDR  103

Query  667   KRLADCSLGFGYKAKGGKNGDFYTVTDNSDHPL-NPKRGTLRHAVIQIKPLWIIFARSMN  491
             + LA C+LGFG KA GGK G  Y VTD SD+ + NPK GTLRHAVIQ +PLWIIFA+ MN
Sbjct  104   QALAGCALGFGSKATGGKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMN  163

Query  490   IKLKQELMVQSHKTIDGRGAQVHISGGAGITLQFVKNVIIHGIRVHDIVHGDGGMIRDSI  311
             IKL+QEL+VQ  KTIDGRGA+VHI+ GAGI LQFVKNVIIHGI +H+I    GGMIRDS+
Sbjct  164   IKLQQELIVQGSKTIDGRGAKVHIANGAGIMLQFVKNVIIHGIHIHNISPCSGGMIRDSV  223

Query  310   NHFGLRTRSDGDGISLFGATDIWLDHLSMRKCDDGVIDAIEASTAITISNSHFTDHNEVM  131
             +H G R +SDGD +S+FG+++IWLDHL++ +  DG+IDAI+ASTAITISN H ++H++ +
Sbjct  224   DHVGKRGQSDGDAVSIFGSSNIWLDHLTLSQAHDGLIDAIQASTAITISNCHLSNHDKAI  283

Query  130   LFGANDHSPKDKIMQVTIAFNHFGKRLVQRMPRCRYGYFHVVN  2
             L GA+D   +DK MQVT+AFN F K LVQRMP  R+G+ HVVN
Sbjct  284   LLGASDTFTEDKKMQVTVAFNRFDKGLVQRMPCVRFGFAHVVN  326



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2953106737764