BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25638_g3_i8 len=341 path=[10769:0-69 1476:70-176 1583:177-202
1609:203-340]

Length=341
                                                                      Score     E

gb|EYU19948.1|  hypothetical protein MIMGU_mgv1a015527mg              81.6    8e-17   
ref|XP_011076785.1|  PREDICTED: CASP-like protein 5B1                 80.1    3e-16   
emb|CDP00141.1|  unnamed protein product                              79.0    7e-16   
ref|XP_010105424.1|  hypothetical protein L484_009892                 79.0    8e-16   
ref|XP_011085012.1|  PREDICTED: CASP-like protein 5B1                 79.0    9e-16   
ref|XP_007218544.1|  hypothetical protein PRUPE_ppa012782mg           78.6    1e-15   
ref|XP_008233490.1|  PREDICTED: CASP-like protein At3g53850           78.6    1e-15   
ref|XP_004307576.1|  PREDICTED: CASP-like protein At3g53850-like      77.0    3e-15   
ref|XP_009594233.1|  PREDICTED: CASP-like protein 5B3 isoform X2      74.3    1e-14   
ref|XP_007009209.1|  CASP-like protein isoform 2                      75.1    2e-14   
ref|XP_006355687.1|  PREDICTED: CASP-like protein At5g02060-like      74.7    3e-14   
ref|XP_002524228.1|  conserved hypothetical protein                   74.3    4e-14   Ricinus communis
ref|XP_010256791.1|  PREDICTED: CASP-like protein 5B2                 73.9    6e-14   
ref|XP_009594232.1|  PREDICTED: CASP-like protein 5B1 isoform X1      73.6    9e-14   
ref|XP_009343937.1|  PREDICTED: CASP-like protein At3g53850           73.2    9e-14   
ref|XP_009351376.1|  PREDICTED: CASP-like protein At3g53850           73.2    1e-13   
ref|XP_008372089.1|  PREDICTED: CASP-like protein At3g53850           73.2    1e-13   
gb|KDP44882.1|  hypothetical protein JCGZ_01382                       73.2    1e-13   
ref|XP_004239915.1|  PREDICTED: CASP-like protein 5B1                 72.8    2e-13   
ref|XP_010658521.1|  PREDICTED: CASP-like protein 5B2 isoform X1      72.4    3e-13   
ref|XP_009777107.1|  PREDICTED: CASP-like protein 5B3 isoform X2      70.9    3e-13   
emb|CDP06571.1|  unnamed protein product                              71.6    4e-13   
ref|XP_009139285.1|  PREDICTED: CASP-like protein At3g53850           71.6    4e-13   
ref|XP_002272505.1|  PREDICTED: CASP-like protein 5B2                 71.6    5e-13   Vitis vinifera
ref|XP_007026921.1|  CASP-like protein                                71.2    5e-13   
ref|XP_006846373.1|  hypothetical protein AMTR_s00012p00262650        70.9    7e-13   
ref|XP_002877943.1|  hypothetical protein ARALYDRAFT_485778           70.9    7e-13   
ref|XP_011036069.1|  PREDICTED: CASP-like protein 5B2                 70.9    7e-13   
emb|CDY13152.1|  BnaC04g26830D                                        70.9    8e-13   
ref|XP_002315203.1|  hypothetical protein POPTR_0010s20610g           70.9    9e-13   Populus trichocarpa [western balsam poplar]
ref|XP_006291989.1|  hypothetical protein CARUB_v10018177mg           70.5    1e-12   
ref|XP_010515889.1|  PREDICTED: CASP-like protein 5B2                 70.5    1e-12   
ref|XP_010504163.1|  PREDICTED: CASP-like protein 5B2                 70.5    1e-12   
ref|XP_010427045.1|  PREDICTED: CASP-like protein 5B2                 70.5    1e-12   
ref|XP_010937546.1|  PREDICTED: CASP-like protein 5B3 isoform X3      69.3    2e-12   
ref|XP_009777106.1|  PREDICTED: CASP-like protein 5B1 isoform X1      69.7    2e-12   
ref|XP_010937545.1|  PREDICTED: CASP-like protein 5B3 isoform X2      69.3    2e-12   
ref|XP_009610009.1|  PREDICTED: CASP-like protein 5B2 isoform X4      69.7    2e-12   
ref|XP_010666491.1|  PREDICTED: CASP-like protein 5B2                 69.7    2e-12   
ref|XP_009411146.1|  PREDICTED: CASP-like protein Os09g0249400        69.7    2e-12   
ref|XP_002309085.1|  hypothetical protein POPTR_0006s09140g           69.3    2e-12   Populus trichocarpa [western balsam poplar]
ref|XP_002282400.1|  PREDICTED: CASP-like protein 5B2 isoform X2      69.3    2e-12   Vitis vinifera
ref|XP_006403645.1|  hypothetical protein EUTSA_v10010789mg           69.3    2e-12   
ref|XP_011006383.1|  PREDICTED: CASP-like protein 5B2                 69.3    3e-12   
ref|XP_011094908.1|  PREDICTED: CASP-like protein 5B2 isoform X2      68.2    3e-12   
ref|XP_009796741.1|  PREDICTED: CASP-like protein 5B2                 69.3    3e-12   
gb|AFK48759.1|  unknown                                               69.3    3e-12   
ref|XP_011094907.1|  PREDICTED: CASP-like protein 5B2 isoform X1      68.9    3e-12   
ref|XP_010931207.1|  PREDICTED: CASP-like protein 5B3                 68.9    4e-12   
gb|EPS58956.1|  hypothetical protein M569_15856                       68.9    4e-12   
gb|KHG16050.1|  hypothetical protein F383_22778                       68.9    4e-12   
ref|XP_010937544.1|  PREDICTED: CASP-like protein 5B3 isoform X1      68.9    4e-12   
emb|CDY70812.1|  BnaC06g42540D                                        68.9    4e-12   
emb|CDY55118.1|  BnaA03g54970D                                        68.6    4e-12   
ref|NP_566990.1|  uncharacterized protein                             68.6    5e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009130680.1|  PREDICTED: CASP-like protein At5g02060           68.6    5e-12   
ref|XP_010923221.1|  PREDICTED: CASP-like protein 5B3                 68.6    6e-12   
ref|XP_010529803.1|  PREDICTED: CASP-like protein 5B2                 68.6    6e-12   
emb|CDX67574.1|  BnaA07g16140D                                        68.2    8e-12   
ref|XP_008777618.1|  PREDICTED: CASP-like protein Os09g0249400        68.2    8e-12   
ref|XP_010262632.1|  PREDICTED: CASP-like protein 5B2 isoform X2      67.0    1e-11   
ref|XP_009388595.1|  PREDICTED: CASP-like protein Os09g0249400        67.8    1e-11   
gb|EYU41762.1|  hypothetical protein MIMGU_mgv1a015526mg              67.4    1e-11   
ref|XP_002462061.1|  hypothetical protein SORBIDRAFT_02g015330        67.4    1e-11   Sorghum bicolor [broomcorn]
ref|XP_006660449.1|  PREDICTED: CASP-like protein Os09g0249400-like   67.4    1e-11   
ref|NP_001143631.1|  CASP-like protein 5B3                            67.4    1e-11   Zea mays [maize]
gb|KGN45745.1|  hypothetical protein Csa_6G008760                     67.8    2e-11   
ref|NP_001062672.1|  Os09g0249400                                     67.0    2e-11   Oryza sativa Japonica Group [Japonica rice]
emb|CDX80801.1|  BnaC03g00550D                                        67.0    2e-11   
ref|XP_009398793.1|  PREDICTED: CASP-like protein Os09g0249400        67.0    2e-11   
ref|XP_010262631.1|  PREDICTED: CASP-like protein 5B2 isoform X1      66.6    3e-11   
gb|KDO48140.1|  hypothetical protein CISIN_1g031701mg                 66.6    3e-11   
ref|XP_009103882.1|  PREDICTED: CASP-like protein At3g53850           66.2    3e-11   
ref|XP_006429174.1|  hypothetical protein CICLE_v10012998mg           66.2    3e-11   
ref|XP_008803136.1|  PREDICTED: CASP-like protein Os09g0249400        66.2    4e-11   
gb|KDO48141.1|  hypothetical protein CISIN_1g031701mg                 65.1    4e-11   
ref|XP_008785512.1|  PREDICTED: CASP-like protein Os09g0249400        65.9    5e-11   
ref|XP_006398670.1|  hypothetical protein EUTSA_v10014817mg           65.9    6e-11   
gb|KFK24608.1|  hypothetical protein AALP_AA8G001300                  65.5    6e-11   
gb|KDP24559.1|  hypothetical protein JCGZ_25123                       65.5    6e-11   
ref|XP_010532632.1|  PREDICTED: CASP-like protein 5B3                 65.5    7e-11   
gb|KFK34633.1|  hypothetical protein AALP_AA5G171300                  65.5    7e-11   
ref|XP_008441395.1|  PREDICTED: CASP-like protein At5g02060           65.5    8e-11   
ref|XP_004138452.1|  PREDICTED: CASP-like protein At3g53850-like ...  65.5    8e-11   
ref|XP_007134065.1|  hypothetical protein PHAVU_010G016500g           65.1    8e-11   
ref|XP_008448240.1|  PREDICTED: CASP-like protein At3g53850           65.1    9e-11   
ref|XP_003604912.1|  hypothetical protein MTR_4g021340                65.1    9e-11   
ref|XP_004246449.1|  PREDICTED: CASP-like protein 5B2                 65.1    9e-11   
ref|NP_001044796.1|  Os01g0847300                                     65.1    1e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008391185.1|  PREDICTED: CASP-like protein At3g23200 isofo...  64.7    1e-10   
ref|XP_002870949.1|  hypothetical protein ARALYDRAFT_486984           64.7    1e-10   
ref|XP_006288846.1|  hypothetical protein CARUB_v10002192mg           64.3    1e-10   
ref|XP_008391184.1|  PREDICTED: CASP-like protein At3g23200 isofo...  64.3    2e-10   
ref|XP_009379002.1|  PREDICTED: CASP-like protein At3g23200           64.3    2e-10   
ref|XP_004956394.1|  PREDICTED: CASP-like protein 13-like             64.3    2e-10   
ref|XP_010490624.1|  PREDICTED: CASP-like protein 5B1                 63.9    2e-10   
sp|D5ACW4.2|CSPLB_PICSI  RecName: Full=CASP-like protein 5B1; Sho...  64.3    2e-10   
ref|NP_195826.1|  uncharacterized protein                             63.9    2e-10   Arabidopsis thaliana [mouse-ear cress]
gb|ADE77383.1|  unknown                                               63.9    3e-10   
ref|XP_004297815.1|  PREDICTED: CASP-like protein At3g23200-like      63.9    3e-10   
ref|XP_003520906.1|  PREDICTED: CASP-like protein At3g53850-like      63.9    3e-10   
ref|NP_001235139.1|  uncharacterized protein LOC100306188             63.5    3e-10   
ref|XP_004506625.1|  PREDICTED: CASP-like protein At3g53850-like      63.5    3e-10   
ref|XP_010452041.1|  PREDICTED: CASP-like protein 5B1                 63.5    3e-10   
ref|XP_002529873.1|  conserved hypothetical protein                   63.5    3e-10   Ricinus communis
ref|XP_009791582.1|  PREDICTED: CASP-like protein 5B2                 63.2    4e-10   
ref|XP_008224373.1|  PREDICTED: CASP-like protein At3g23200           63.2    5e-10   
ref|XP_010093419.1|  hypothetical protein L484_012817                 63.2    5e-10   
ref|XP_004142057.1|  PREDICTED: CASP-like protein At3g53850-like      63.2    5e-10   
ref|XP_007223725.1|  hypothetical protein PRUPE_ppa013068mg           62.4    7e-10   
ref|XP_004302711.1|  PREDICTED: CASP-like protein At3g53850-like      62.0    1e-09   
ref|XP_009351007.1|  PREDICTED: CASP-like protein At3g23200           61.6    1e-09   
ref|XP_010543269.1|  PREDICTED: CASP-like protein 5B1                 61.6    1e-09   
ref|XP_003564606.1|  PREDICTED: CASP-like protein 5B1                 61.6    2e-09   
ref|XP_006645005.1|  PREDICTED: CASP-like protein Os01g0847300-like   61.2    2e-09   
ref|XP_010423904.1|  PREDICTED: CASP-like protein 5B1                 60.8    3e-09   
ref|XP_002529297.1|  conserved hypothetical protein                   60.5    4e-09   Ricinus communis
ref|XP_010262291.1|  PREDICTED: CASP-like protein 5B3 isoform X1      60.5    4e-09   
emb|CAB88347.1|  putative protein                                     60.5    4e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010043998.1|  PREDICTED: CASP-like protein 5B2                 60.1    5e-09   
ref|XP_010088588.1|  hypothetical protein L484_016981                 59.7    8e-09   
gb|EPS72455.1|  hypothetical protein M569_02306                       59.7    8e-09   
gb|KDP40311.1|  hypothetical protein JCGZ_02309                       59.3    1e-08   
ref|XP_002284723.1|  PREDICTED: CASP-like protein 5B3 isoform X1      58.9    1e-08   Vitis vinifera
ref|XP_006420191.1|  hypothetical protein CICLE_v10006143mg           58.9    1e-08   
emb|CDY35509.1|  BnaA01g24030D                                        58.9    1e-08   
ref|XP_011099255.1|  PREDICTED: CASP-like protein 5C1                 58.9    2e-08   
ref|XP_007009208.1|  CASP-like protein, putative isoform 1            58.9    2e-08   
ref|XP_003632021.1|  PREDICTED: CASP-like protein 5B3 isoform X2      58.2    2e-08   
ref|XP_003635083.1|  PREDICTED: CASP-like protein 5C1                 58.5    2e-08   
ref|XP_006410900.1|  hypothetical protein EUTSA_v10017298mg           58.5    2e-08   
ref|XP_007016754.1|  Uncharacterized protein isoform 2                58.2    2e-08   
ref|NP_001136586.1|  CASP-like protein 5B1                            57.8    2e-08   Zea mays [maize]
ref|XP_009108147.1|  PREDICTED: CASP-like protein At3g23200           58.2    2e-08   
ref|XP_009759928.1|  PREDICTED: CASP-like protein ARALYDRAFT_485429   58.2    2e-08   
ref|XP_010671058.1|  PREDICTED: CASP-like protein 5B3 isoform X1      58.2    3e-08   
ref|XP_007016753.1|  Uncharacterized protein isoform 1                58.2    3e-08   
ref|XP_004141947.1|  PREDICTED: CASP-like protein At3g50810-like      57.8    3e-08   
ref|XP_009604682.1|  PREDICTED: CASP-like protein ARALYDRAFT_485429   57.8    3e-08   
emb|CDP02429.1|  unnamed protein product                              57.8    3e-08   
emb|CDY08982.1|  BnaC01g31090D                                        57.4    4e-08   
ref|XP_006654505.1|  PREDICTED: CASP-like protein Os05g0456500-like   57.4    4e-08   
ref|XP_004171998.1|  PREDICTED: CASP-like protein At3g23200-like      56.6    5e-08   
ref|NP_001055732.1|  Os05g0456500                                     57.0    6e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007206066.1|  hypothetical protein PRUPE_ppa012758mg           57.0    7e-08   
ref|XP_008240492.1|  PREDICTED: CASP-like protein At3g53850           56.6    8e-08   
ref|XP_010274801.1|  PREDICTED: CASP-like protein 5B3 isoform X2      56.6    8e-08   
gb|EYU25980.1|  hypothetical protein MIMGU_mgv1a021907mg              56.6    9e-08   
ref|XP_008672253.1|  PREDICTED: CASP-like protein 14 isoform X1       56.6    1e-07   
ref|XP_010274800.1|  PREDICTED: CASP-like protein 5B3 isoform X1      56.6    1e-07   
ref|XP_009392234.1|  PREDICTED: CASP-like protein Os03g0206600        56.2    1e-07   
ref|XP_009367068.1|  PREDICTED: CASP-like protein At2g28370           56.2    1e-07   
ref|XP_010553051.1|  PREDICTED: CASP-like protein 5B1                 56.2    1e-07   
gb|KHG22577.1|  hypothetical protein F383_29148                       56.2    1e-07   
ref|XP_002519533.1|  conserved hypothetical protein                   56.2    1e-07   Ricinus communis
ref|XP_006406066.1|  hypothetical protein EUTSA_v10021696mg           55.8    1e-07   
ref|XP_010023975.1|  PREDICTED: CASP-like protein 5B3 isoform X1      55.8    1e-07   
emb|CAN61826.1|  hypothetical protein VITISV_027628                   58.9    1e-07   Vitis vinifera
gb|KHG22616.1|  hypothetical protein F383_03339                       55.8    1e-07   
ref|XP_004134071.1|  PREDICTED: CASP-like protein At3g23200-like      55.8    2e-07   
emb|CDM85017.1|  unnamed protein product                              55.8    2e-07   
ref|XP_011091200.1|  PREDICTED: CASP-like protein 5B3 isoform X1      55.8    2e-07   
ref|XP_004142183.1|  PREDICTED: CASP-like protein At3g23200-like      55.8    2e-07   
dbj|BAJ92579.1|  predicted protein                                    55.8    2e-07   
ref|XP_010689546.1|  PREDICTED: CASP-like protein 5A2                 55.8    2e-07   
sp|P0DI71.1|CSPL3_GINBI  RecName: Full=CASP-like protein 5B1; Sho...  55.8    2e-07   
ref|XP_002881495.1|  hypothetical protein ARALYDRAFT_902856           55.8    2e-07   
ref|XP_011030518.1|  PREDICTED: CASP-like protein 5B3 isoform X2      55.5    2e-07   
gb|KHG25126.1|  hypothetical protein F383_04856                       55.8    2e-07   
ref|XP_010466636.1|  PREDICTED: CASP-like protein 5B3                 55.5    2e-07   
ref|XP_010512170.1|  PREDICTED: CASP-like protein 5B3                 55.5    2e-07   
ref|XP_009775130.1|  PREDICTED: CASP-like protein 5B3                 55.5    2e-07   
ref|XP_006338260.1|  PREDICTED: CASP-like protein Os03g0767900-like   55.5    2e-07   
ref|XP_011030517.1|  PREDICTED: CASP-like protein 5B3 isoform X1      55.1    3e-07   
ref|XP_002315710.1|  hypothetical protein POPTR_0010s08370g           55.1    3e-07   Populus trichocarpa [western balsam poplar]
gb|ACU20608.1|  unknown                                               55.1    3e-07   Glycine max [soybeans]
ref|XP_003556350.1|  PREDICTED: CASP-like protein At3g23200-like      55.1    3e-07   
ref|XP_010488367.1|  PREDICTED: CASP-like protein 5B3                 55.1    3e-07   
ref|XP_008807384.1|  PREDICTED: CASP-like protein 1                   55.1    3e-07   
ref|XP_010087817.1|  hypothetical protein L484_000635                 55.1    4e-07   
gb|EYU44324.1|  hypothetical protein MIMGU_mgv1a015618mg              54.7    4e-07   
ref|XP_007035081.1|  CASP-like protein, putative                      54.7    4e-07   
ref|XP_006349490.1|  PREDICTED: CASP-like protein At3g53850-like      54.7    4e-07   
ref|XP_002883411.1|  hypothetical protein ARALYDRAFT_898831           54.7    4e-07   
ref|NP_188961.2|  uncharacterized protein                             54.7    4e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008438541.1|  PREDICTED: CASP-like protein At3g23200           54.7    4e-07   
ref|XP_009102652.1|  PREDICTED: CASP-like protein At3g23200           54.7    4e-07   
ref|XP_006296632.1|  hypothetical protein CARUB_v10014835mg           54.7    4e-07   
ref|XP_004232082.1|  PREDICTED: CASP-like protein 5C1                 54.7    5e-07   
ref|XP_008385321.1|  PREDICTED: CASP-like protein At2g28370           54.7    5e-07   
ref|XP_007047092.1|  Uncharacterized protein TCM_000497               54.3    6e-07   
emb|CDX85066.1|  BnaC07g08400D                                        54.3    6e-07   
ref|XP_004961876.1|  PREDICTED: CASP-like protein 18-like             53.9    7e-07   
ref|XP_002522387.1|  conserved hypothetical protein                   53.9    7e-07   Ricinus communis
gb|ACJ86061.1|  unknown                                               53.9    8e-07   Medicago truncatula
ref|XP_004291713.1|  PREDICTED: CASP-like protein At2g28370-like      53.9    8e-07   
dbj|BAA95733.1|  unnamed protein product                              53.9    8e-07   Arabidopsis thaliana [mouse-ear cress]
gb|EYU36185.1|  hypothetical protein MIMGU_mgv1a014713mg              53.9    9e-07   
emb|CDO99216.1|  unnamed protein product                              53.5    9e-07   
ref|XP_008369938.1|  PREDICTED: CASP-like protein At3g53850           53.5    9e-07   
ref|XP_006827495.1|  hypothetical protein AMTR_s00009p00169200        53.5    1e-06   
ref|XP_007027335.1|  Uncharacterized protein TCM_022161               53.5    1e-06   
gb|KFK39608.1|  hypothetical protein AALP_AA3G266000                  53.1    1e-06   
ref|XP_008460631.1|  PREDICTED: CASP-like protein At3g23200 isofo...  53.1    1e-06   
ref|XP_006425777.1|  hypothetical protein CICLE_v10026699mg           53.1    1e-06   
gb|KEH42705.1|  CASP-like protein                                     53.1    1e-06   
ref|NP_001143693.1|  CASP-like protein 5B2                            53.1    1e-06   Zea mays [maize]
ref|XP_003536249.1|  PREDICTED: CASP-like protein At3g23200-like      53.1    1e-06   
ref|XP_007144099.1|  hypothetical protein PHAVU_007G128700g           52.8    2e-06   
ref|XP_002439909.1|  hypothetical protein SORBIDRAFT_09g022380        52.8    2e-06   Sorghum bicolor [broomcorn]
ref|XP_010414531.1|  PREDICTED: CASP-like protein 5A2                 53.1    2e-06   
ref|XP_010470090.1|  PREDICTED: CASP-like protein 5A2                 53.1    2e-06   
gb|KDP29115.1|  hypothetical protein JCGZ_16504                       53.1    2e-06   
ref|XP_010680953.1|  PREDICTED: CASP-like protein 5C1                 52.8    2e-06   
ref|XP_006379887.1|  hypothetical protein POPTR_0008s16540g           52.8    2e-06   
ref|XP_007131880.1|  hypothetical protein PHAVU_011G049100g           52.4    2e-06   
ref|XP_007131881.1|  hypothetical protein PHAVU_011G049100g           52.8    2e-06   
ref|XP_007041383.1|  Integral membrane protein, expressed, putative   52.4    2e-06   
gb|KFK36609.1|  hypothetical protein AALP_AA4G145800                  52.8    2e-06   
ref|XP_008359277.1|  PREDICTED: CASP-like protein At2g28370           52.8    2e-06   
ref|XP_011029843.1|  PREDICTED: CASP-like protein 5B3                 52.4    3e-06   
ref|XP_006591844.1|  PREDICTED: uncharacterized protein LOC100526...  52.8    3e-06   
gb|KHN38760.1|  CASP-like protein                                     52.4    3e-06   
ref|NP_001237047.1|  uncharacterized protein LOC100527764             52.4    3e-06   
ref|XP_009346416.1|  PREDICTED: CASP-like protein At3g53850           52.0    3e-06   
gb|AFK37981.1|  unknown                                               52.4    3e-06   
gb|AFK35149.1|  unknown                                               51.6    4e-06   
ref|XP_002969207.1|  hypothetical protein SELMODRAFT_410131           51.6    5e-06   
ref|XP_011089913.1|  PREDICTED: CASP-like protein 5A2                 51.6    5e-06   
gb|KDO79411.1|  hypothetical protein CISIN_1g031829mg                 51.6    5e-06   
ref|XP_006425776.1|  hypothetical protein CICLE_v10026699mg           51.2    5e-06   
ref|XP_009140898.1|  PREDICTED: CASP-like protein At2g28370           51.6    6e-06   
ref|XP_006424560.1|  hypothetical protein CICLE_v10029379mg           51.6    6e-06   
ref|XP_009341904.1|  PREDICTED: CASP-like protein ARALYDRAFT_485429   51.2    6e-06   
ref|XP_002960566.1|  hypothetical protein SELMODRAFT_270224           51.6    6e-06   
ref|XP_006354505.1|  PREDICTED: CASP-like protein At3g23200-like      51.2    6e-06   
ref|XP_009375319.1|  PREDICTED: CASP-like protein Os03g0767900        51.2    7e-06   
emb|CDX77175.1|  BnaC04g39700D                                        51.6    7e-06   
ref|NP_001236559.1|  uncharacterized protein LOC100526963             51.6    7e-06   
ref|XP_011037598.1|  PREDICTED: CASP-like protein 5C1                 50.8    8e-06   
ref|XP_003568321.1|  PREDICTED: CASP-like protein 5B2                 50.8    8e-06   
ref|XP_011094649.1|  PREDICTED: CASP-like protein 5A1                 51.2    8e-06   
ref|XP_010906503.1|  PREDICTED: CASP-like protein 5A1                 51.2    8e-06   
ref|XP_010264675.1|  PREDICTED: CASP-like protein 5A1                 51.2    9e-06   
ref|XP_004506017.1|  PREDICTED: CASP-like protein At2g28370-like ...  51.2    9e-06   
dbj|BAJ93956.1|  predicted protein                                    50.8    9e-06   
ref|XP_008387337.1|  PREDICTED: CASP-like protein Os03g0767900        50.8    9e-06   
ref|XP_010999514.1|  PREDICTED: CASP-like protein 5C1                 50.8    9e-06   
ref|NP_001275459.1|  uncharacterized protein LOC102577653             50.8    1e-05   
ref|XP_009379154.1|  PREDICTED: CASP-like protein ARALYDRAFT_4854...  50.4    1e-05   
gb|AFY26899.1|  membrane protein                                      50.8    1e-05   
ref|XP_002519114.1|  conserved hypothetical protein                   50.4    1e-05   Ricinus communis
ref|XP_002313821.2|  integral membrane family protein                 50.4    1e-05   Populus trichocarpa [western balsam poplar]
ref|XP_009382433.1|  PREDICTED: CASP-like protein Os03g0206600 is...  50.4    1e-05   
gb|AFK42616.1|  unknown                                               50.8    1e-05   
ref|XP_009376464.1|  PREDICTED: CASP-like protein ARALYDRAFT_485429   50.4    1e-05   
ref|XP_011007682.1|  PREDICTED: CASP-like protein 5A1                 50.4    1e-05   
ref|XP_007200720.1|  hypothetical protein PRUPE_ppa012837mg           50.1    1e-05   
ref|XP_008805189.1|  PREDICTED: CASP-like protein 1 isoform X2        50.4    1e-05   
ref|XP_003537907.1|  PREDICTED: CASP-like protein Os03g0767900-like   50.1    1e-05   
emb|CDY30491.1|  BnaA04g16420D                                        50.4    1e-05   
ref|XP_004247716.1|  PREDICTED: CASP-like protein 5B3                 50.1    2e-05   
ref|XP_009382424.1|  PREDICTED: CASP-like protein Os03g0206600 is...  50.4    2e-05   
gb|EYU39385.1|  hypothetical protein MIMGU_mgv1a023799mg              50.1    2e-05   
gb|AFK49578.1|  unknown                                               50.1    2e-05   
ref|XP_009618629.1|  PREDICTED: CASP-like protein 5C1                 50.1    2e-05   
ref|XP_009345788.1|  PREDICTED: CASP-like protein Os03g0767900        50.1    2e-05   
ref|XP_004495314.1|  PREDICTED: LOW QUALITY PROTEIN: CASP-like pr...  50.4    2e-05   
gb|AFK46060.1|  unknown                                               50.4    2e-05   
ref|XP_010103688.1|  hypothetical protein L484_011741                 49.7    2e-05   
ref|XP_008361376.1|  PREDICTED: CASP-like protein ARALYDRAFT_485429   49.7    2e-05   
gb|KDO79412.1|  hypothetical protein CISIN_1g031829mg                 49.7    2e-05   
ref|XP_009379153.1|  PREDICTED: CASP-like protein ARALYDRAFT_4854...  49.7    2e-05   
ref|XP_008338185.1|  PREDICTED: CASP-like protein ARALYDRAFT_485429   49.7    2e-05   
ref|XP_004249677.1|  PREDICTED: CASP-like protein 5A1                 50.1    2e-05   
ref|XP_007200719.1|  hypothetical protein PRUPE_ppa012837mg           49.3    2e-05   
ref|XP_004289631.1|  PREDICTED: CASP-like protein Os03g0767900-like   49.7    2e-05   
ref|XP_004143253.1|  PREDICTED: CASP-like protein 2-like              50.1    2e-05   
gb|KDO51406.1|  hypothetical protein CISIN_1g031666mg                 49.7    2e-05   
ref|XP_006423156.1|  hypothetical protein CICLE_v10029477mg           49.7    2e-05   
ref|XP_007145839.1|  hypothetical protein PHAVU_007G272500g           49.3    3e-05   
gb|KDO51407.1|  hypothetical protein CISIN_1g031666mg                 48.9    3e-05   
ref|XP_002284707.1|  PREDICTED: CASP-like protein 5C1                 49.3    3e-05   
ref|XP_008805188.1|  PREDICTED: CASP-like protein 1 isoform X1        50.1    3e-05   
ref|XP_010262293.1|  PREDICTED: CASP-like protein 5B3 isoform X2      49.3    3e-05   
sp|A9RKK4.2|CSPLF_PHYPA  RecName: Full=CASP-like protein 5A2; Sho...  49.3    3e-05   
ref|XP_008236766.1|  PREDICTED: CASP-like protein Os03g0767900        48.9    4e-05   
ref|XP_009798302.1|  PREDICTED: CASP-like protein 5C1                 48.9    5e-05   
ref|XP_006588547.1|  PREDICTED: CASP-like protein At3g23200-like ...  48.9    5e-05   
ref|XP_004507388.1|  PREDICTED: CASP-like protein Os03g0767900-like   48.9    5e-05   
ref|NP_001239705.1|  uncharacterized protein LOC100791311             48.5    5e-05   
ref|XP_002972249.1|  hypothetical protein SELMODRAFT_97617            48.9    5e-05   
ref|XP_009382690.1|  PREDICTED: CASP-like protein 1                   48.9    5e-05   
ref|XP_002984163.1|  hypothetical protein SELMODRAFT_119736           48.9    5e-05   
ref|XP_006591870.1|  PREDICTED: uncharacterized protein LOC100791...  48.5    5e-05   
emb|CDX91343.1|  BnaC04g08070D                                        48.9    6e-05   
ref|XP_006466691.1|  PREDICTED: CASP-like protein ARALYDRAFT_4854...  48.5    6e-05   
ref|XP_010531774.1|  PREDICTED: CASP-like protein ARALYDRAFT_485429   48.5    6e-05   
ref|XP_006591871.1|  PREDICTED: uncharacterized protein LOC100791...  48.1    7e-05   
ref|XP_001754693.1|  predicted protein                                48.1    7e-05   
ref|XP_008245666.1|  PREDICTED: CASP-like protein At2g28370           48.5    7e-05   
ref|XP_009342901.1|  PREDICTED: CASP-like protein Os03g0206600        48.1    9e-05   
ref|XP_009796294.1|  PREDICTED: CASP-like protein 5A1                 48.1    1e-04   
ref|XP_009610007.1|  PREDICTED: CASP-like protein 5B2 isoform X2      48.9    1e-04   
ref|XP_009612830.1|  PREDICTED: CASP-like protein 5A1                 48.1    1e-04   
ref|XP_010028545.1|  PREDICTED: CASP-like protein 5C1                 47.8    1e-04   
ref|XP_002323467.1|  hypothetical protein POPTR_0016s09130g           48.1    1e-04   
ref|XP_009610006.1|  PREDICTED: CASP-like protein 5B2 isoform X1      48.9    1e-04   
emb|CDX73786.1|  BnaC08g22170D                                        47.8    1e-04   
gb|KDP31832.1|  hypothetical protein JCGZ_12293                       47.4    1e-04   
gb|AFK37863.1|  unknown                                               47.4    1e-04   
gb|KHN00302.1|  CASP-like protein                                     47.4    1e-04   
gb|KHG06622.1|  hypothetical protein F383_32999                       48.1    1e-04   
ref|XP_006403996.1|  hypothetical protein EUTSA_v10010793mg           47.4    1e-04   
ref|XP_004985271.1|  PREDICTED: CASP-like protein 17-like             47.8    1e-04   
ref|XP_009115758.1|  PREDICTED: CASP-like protein ARALYDRAFT_485429   47.4    2e-04   
ref|XP_002529944.1|  conserved hypothetical protein                   47.8    2e-04   
ref|XP_008459268.1|  PREDICTED: CASP-like protein Os03g0767900        47.4    2e-04   
ref|XP_010557322.1|  PREDICTED: CASP-like protein 5A2                 47.4    2e-04   
ref|XP_010089982.1|  hypothetical protein L484_008060                 47.4    2e-04   
ref|XP_004145336.1|  PREDICTED: CASP-like protein Os03g0767900-like   47.0    2e-04   
ref|XP_010557840.1|  PREDICTED: CASP-like protein ARALYDRAFT_485429   47.0    2e-04   
ref|XP_002305408.2|  hypothetical protein POPTR_0004s15650g           47.0    2e-04   
ref|XP_010651166.1|  PREDICTED: CASP-like protein 5A2                 48.5    2e-04   
ref|XP_007205991.1|  hypothetical protein PRUPE_ppa012225mg           47.4    2e-04   
gb|EPS74086.1|  hypothetical protein M569_00670                       47.4    2e-04   
emb|CBI16319.3|  unnamed protein product                              48.1    2e-04   
ref|XP_004956397.1|  PREDICTED: CASP-like protein Os09g0249400-like   46.2    3e-04   
ref|XP_003611861.1|  hypothetical protein MTR_5g018680                46.6    3e-04   
ref|XP_011040885.1|  PREDICTED: CASP-like protein 5A2                 47.0    3e-04   
ref|XP_003637252.1|  Histone-lysine N-methyltransferase SETDB1        45.8    3e-04   
ref|NP_001235528.1|  uncharacterized protein LOC100306215             46.6    3e-04   
gb|KHN00578.1|  CASP-like protein                                     46.6    3e-04   
gb|KDP44044.1|  hypothetical protein JCGZ_05511                       46.6    4e-04   
ref|XP_003548007.1|  PREDICTED: CASP-like protein ARALYDRAFT_4854...  46.6    4e-04   
ref|XP_010424900.1|  PREDICTED: CASP-like protein ARALYDRAFT_485429   46.2    4e-04   
ref|XP_007155996.1|  hypothetical protein PHAVU_003G249900g           46.2    4e-04   
emb|CDO97104.1|  unnamed protein product                              46.2    4e-04   
gb|KDP46201.1|  hypothetical protein JCGZ_10041                       45.8    5e-04   
ref|XP_006574335.1|  PREDICTED: uncharacterized protein LOC100306...  45.8    5e-04   
ref|XP_007205819.1|  hypothetical protein PRUPE_ppa010839mg           46.2    5e-04   
emb|CDP07107.1|  unnamed protein product                              46.2    5e-04   
ref|XP_006649596.1|  PREDICTED: LOW QUALITY PROTEIN: CASP-like pr...  46.2    6e-04   
ref|XP_004956395.1|  PREDICTED: CASP-like protein Os09g0249400-like   45.8    6e-04   
ref|XP_001760264.1|  predicted protein                                46.2    6e-04   
emb|CDX73518.1|  BnaC08g24850D                                        45.4    7e-04   
gb|KHG05025.1|  hypothetical protein F383_03783                       46.2    7e-04   
gb|KFK36015.1|  hypothetical protein AALP_AA4G067000                  45.4    7e-04   
ref|XP_011091206.1|  PREDICTED: CASP-like protein 5B3 isoform X2      45.4    7e-04   
ref|XP_011025677.1|  PREDICTED: CASP-like protein ARALYDRAFT_485429   45.4    8e-04   
ref|XP_008243939.1|  PREDICTED: CASP-like protein 2                   46.6    8e-04   
ref|XP_010263835.1|  PREDICTED: CASP-like protein 5C1                 45.1    9e-04   
ref|XP_002458757.1|  hypothetical protein SORBIDRAFT_03g039750        45.8    0.001   



>gb|EYU19948.1| hypothetical protein MIMGU_mgv1a015527mg [Erythranthe guttata]
Length=154

 Score = 81.6 bits (200),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 56/89 (63%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M++LFG  GK SGL++R  QCVF+ AS GVM  AS F   T+F  L   MG+  LWS  L
Sbjct  1    MKELFGSPGKKSGLILRTGQCVFAAASIGVMTSASGFSTTTAFCYLIASMGLQVLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
             CLD H++ F R  H+  ++ L  +GDWV
Sbjct  61   LCLDIHALRFNRDLHTNIIVSLFVVGDWV  89



>ref|XP_011076785.1| PREDICTED: CASP-like protein 5B1 [Sesamum indicum]
Length=154

 Score = 80.1 bits (196),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 56/89 (63%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+++FG  GK SGL++RI QCVF+ AS  VM  AS F   T+F  L   MG+  LWS  L
Sbjct  1    MKEVFGSPGKKSGLILRIGQCVFAAASIAVMASASGFSTTTAFCYLIASMGLQVLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
             CLD H++ F +  H+  ++ L  +GDWV
Sbjct  61   VCLDIHALRFNKDLHTNIIVSLFVVGDWV  89



>emb|CDP00141.1| unnamed protein product [Coffea canephora]
Length=154

 Score = 79.0 bits (193),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 55/89 (62%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+DLFG  GK SGLL+R+ QC F+ AS GVM  AS F   T+F  L   MG+  LWS  L
Sbjct  1    MKDLFGSPGKVSGLLLRMGQCFFAAASLGVMASASGFSTATAFCYLIASMGLQLLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +C D H++  +R  H+   + L  +GDWV
Sbjct  61   ACFDVHALRLKRDLHNHIFVSLFVVGDWV  89



>ref|XP_010105424.1| hypothetical protein L484_009892 [Morus notabilis]
 gb|EXC04699.1| hypothetical protein L484_009892 [Morus notabilis]
Length=154

 Score = 79.0 bits (193),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 56/89 (63%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+++FG  GK SGL +RI QC F+ AS G M+ A  F  +T+F  L   MG+  LWS  L
Sbjct  1    MKEMFGSPGKVSGLALRIGQCSFAAASIGTMISAPGFFNSTAFCYLIASMGLQVLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD H++  +R  H+  L+ L  +GDWV
Sbjct  61   ACLDLHALRSKRSLHNPVLVSLFVVGDWV  89



>ref|XP_011085012.1| PREDICTED: CASP-like protein 5B1 [Sesamum indicum]
Length=155

 Score = 79.0 bits (193),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M++LFG  G+ SGL++RI QCVF+ AS GVM  AS F   T+F  L   MG+  LWS  L
Sbjct  2    MKELFGSPGRKSGLILRIGQCVFASASIGVMTSASGFSTATAFCYLIASMGLQVLWSFGL  61

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD H++ F +  ++  ++ L  +GDWV
Sbjct  62   ACLDIHALRFNKDLYNHIVVSLFVVGDWV  90



>ref|XP_007218544.1| hypothetical protein PRUPE_ppa012782mg [Prunus persica]
 gb|EMJ19743.1| hypothetical protein PRUPE_ppa012782mg [Prunus persica]
Length=154

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 57/89 (64%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+++FG  GK SGL +RI QC F+ AS GVMV A  F  +T+F  L   MG+  LWSL L
Sbjct  1    MKEVFGSPGKVSGLALRIGQCSFAAASIGVMVSAHGFFNSTAFCYLIASMGLQVLWSLGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD H++  +R   +  L+ L  +GDWV
Sbjct  61   ACLDLHALRSKRSLQNPVLVSLFVVGDWV  89



>ref|XP_008233490.1| PREDICTED: CASP-like protein At3g53850 [Prunus mume]
Length=154

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 57/89 (64%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+++FG  GK SGL +RI QC F+ AS GVMV A  F  +T+F  L   MG+  LWSL L
Sbjct  1    MKEVFGSPGKVSGLALRIGQCSFAAASIGVMVSAHGFFNSTAFCYLIASMGLQVLWSLGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD H++  +R   +  L+ L  +GDWV
Sbjct  61   ACLDLHALRSKRSLQNPVLVSLFVVGDWV  89



>ref|XP_004307576.1| PREDICTED: CASP-like protein At3g53850-like [Fragaria vesca subsp. 
vesca]
Length=152

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 57/89 (64%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+  FG  G+ SGLL+RI QC F+ AS GVMV +  F  +T+F  L   MG+ FLWS  L
Sbjct  1    MKVFFGSPGRISGLLLRIGQCSFAAASIGVMVSSHGFYSSTAFCYLIASMGLEFLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLDFH++  +R   +  L+ L  +GDWV
Sbjct  61   ACLDFHALRSKRSLQNPVLVSLFVVGDWV  89



>ref|XP_009594233.1| PREDICTED: CASP-like protein 5B3 isoform X2 [Nicotiana tomentosiformis]
Length=99

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+++FG  GK SGL++R+ QC+F+ AS  VM  AS F  +T+F  L   MG+  LWS +L
Sbjct  1    MKEVFGSPGKVSGLILRMGQCLFASASIAVMASASGFSSSTAFCYLIASMGLQVLWSFAL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWVLQFP  58
            +CLD H++  +R   +   + L  +GDW+L F 
Sbjct  61   ACLDIHALRLKRDLRNHVFVSLFVVGDWLLIFK  93



>ref|XP_007009209.1| CASP-like protein isoform 2 [Theobroma cacao]
 gb|EOY18019.1| CASP-like protein isoform 2 [Theobroma cacao]
Length=152

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 54/86 (63%), Gaps = 0/86 (0%)
 Frame = -3

Query  327  LFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSLSCL  148
            LFG  GK SGLL+R+ QC F+ AS GVMV A  F  +T+F  L   MG+  LWS  L+CL
Sbjct  3    LFGSPGKLSGLLLRVGQCSFAAASIGVMVSAPGFFNSTAFCYLIASMGLQVLWSFGLACL  62

Query  147  DFHSIMFRRRGHSVFLLVLICIGDWV  70
            D H++  +R   +  L+ L  +GDWV
Sbjct  63   DLHALRSKRNLQNPILVSLFVVGDWV  88



>ref|XP_006355687.1| PREDICTED: CASP-like protein At5g02060-like [Solanum tuberosum]
Length=153

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 57/89 (64%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M++LFGG GK SGL++R+ QC+F+ AS  VM  +  F   T+F  L   MG+  +WS SL
Sbjct  1    MKELFGGPGKVSGLVLRMGQCLFAAASMVVMASSHGFATCTAFCYLIAAMGLQVIWSFSL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD H++  +R   +   L L+ IGDWV
Sbjct  61   ACLDIHALRLKRDLRNYVFLSLLVIGDWV  89



>ref|XP_002524228.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38152.1| conserved hypothetical protein [Ricinus communis]
Length=165

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 56/89 (63%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M++LFG  G+ SGL +R+ Q VF+ AS GVMV A  F  +T+F  L   MG+  LWS  L
Sbjct  1    MKELFGSPGRVSGLGLRVGQFVFAAASIGVMVSARGFFNSTAFCYLIASMGLQVLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD H++  +R   +  L+ L  +GDWV
Sbjct  61   ACLDMHALRSKRNLQNPVLVSLFVVGDWV  89



>ref|XP_010256791.1| PREDICTED: CASP-like protein 5B2 [Nelumbo nucifera]
Length=154

 Score = 73.9 bits (180),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 56/89 (63%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+DLFG  G  SGLL+R+ QC+F+ AS G MV A  F   T+F  L   MG+  LWSL L
Sbjct  1    MKDLFGSPGTVSGLLLRVGQCLFAAASIGAMVSAFGFSNYTAFCYLIASMGLQVLWSLGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R   +  L+ L  +GDWV
Sbjct  61   ACLDAYALRIKRDLRNPVLVSLFVVGDWV  89



>ref|XP_009594232.1| PREDICTED: CASP-like protein 5B1 isoform X1 [Nicotiana tomentosiformis]
Length=154

 Score = 73.6 bits (179),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 57/89 (64%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+++FG  GK SGL++R+ QC+F+ AS  VM  AS F  +T+F  L   MG+  LWS +L
Sbjct  1    MKEVFGSPGKVSGLILRMGQCLFASASIAVMASASGFSSSTAFCYLIASMGLQVLWSFAL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD H++  +R   +   + L  +GDWV
Sbjct  61   ACLDIHALRLKRDLRNHVFVSLFVVGDWV  89



>ref|XP_009343937.1| PREDICTED: CASP-like protein At3g53850 [Pyrus x bretschneideri]
Length=153

 Score = 73.2 bits (178),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ LFG  GK SGL +RI QC F+ A+ GVM+ A  F   T+F  L   MG+  +WS  L
Sbjct  1    MKKLFGSPGKVSGLALRIGQCCFAAAAIGVMLSAHGFFNATAFCYLIASMGLQVVWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD H++  +R   +  L+ L  +GDWV
Sbjct  61   ACLDLHALRSKRSLQNPILVSLFVVGDWV  89



>ref|XP_009351376.1| PREDICTED: CASP-like protein At3g53850 [Pyrus x bretschneideri]
Length=154

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ LFG  GK SGL +RI QC F+ A+ GVM+ A  F   T+F  L   MG+  +WS  L
Sbjct  1    MKKLFGSPGKVSGLALRIGQCCFAAAAIGVMLSAHGFFNATAFCYLIASMGLQVVWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD H++  +R   +  L+ L  +GDWV
Sbjct  61   ACLDLHALRSKRSLQNPILVSLFVVGDWV  89



>ref|XP_008372089.1| PREDICTED: CASP-like protein At3g53850 [Malus domestica]
Length=154

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ LFG  GK SGL +RI QC F+ A+ GVM+ A  F   T+F  L   MG+  +WS  L
Sbjct  1    MKKLFGSPGKVSGLALRIGQCCFAAAAIGVMLSAHGFFNATAFCYLIASMGLQVVWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD H++  +R   +  L+ L  +GDWV
Sbjct  61   ACLDLHALRSKRSLQNPILVSLFVVGDWV  89



>gb|KDP44882.1| hypothetical protein JCGZ_01382 [Jatropha curcas]
Length=154

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 55/89 (62%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M++LFG  G+ SG  +R+ Q VF+ AS GVMV A  F  +T+F  L   MG+  LWS  L
Sbjct  1    MKELFGSPGRVSGFGLRVGQFVFAAASIGVMVSARGFFNSTAFCYLIASMGLQVLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD HS+  +R   +  L+ L  +GDWV
Sbjct  61   ACLDLHSLRSKRNLQNPVLVSLFVVGDWV  89



>ref|XP_004239915.1| PREDICTED: CASP-like protein 5B1 [Solanum lycopersicum]
Length=153

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 57/89 (64%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M++LFGG G+ SGL++R+ QC+F+ AS  VM  +  F   T+F  L   MG+  +WS SL
Sbjct  1    MKELFGGPGRVSGLVLRMGQCLFAAASMVVMASSHGFATCTAFCYLIASMGLQVIWSFSL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD H++  +R   +   L L+ IGDWV
Sbjct  61   ACLDIHALRLKRDLRNYVFLSLLVIGDWV  89



>ref|XP_010658521.1| PREDICTED: CASP-like protein 5B2 isoform X1 [Vitis vinifera]
Length=183

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 54/90 (60%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M  LFGG G  SG ++R+ QC+F+ +S GVMV AS    N +F  L   MG+  LWS +
Sbjct  29   EMNMLFGGPGSMSGFVLRLGQCLFAASSIGVMVFASEVPINRTFCYLIASMGLQILWSFT  88

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            L+C+D  ++  RR      LL L  +GDWV
Sbjct  89   LACVDMQALRLRRNLQHPVLLSLFVVGDWV  118



>ref|XP_009777107.1| PREDICTED: CASP-like protein 5B3 isoform X2 [Nicotiana sylvestris]
Length=99

 Score = 70.9 bits (172),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+++FG  GK SGL++R+ QC+ + AS  VM  AS F  +T+F  L   MG+  LWS  L
Sbjct  1    MKEVFGSPGKVSGLILRMGQCLLASASIAVMASASGFSSSTAFCYLIASMGLQVLWSFVL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWVLQFP  58
            +CLD H++  +R   +   + L  +GDW+L F 
Sbjct  61   ACLDIHALRLKRDLRNHVFVSLFVVGDWLLIFK  93



>emb|CDP06571.1| unnamed protein product [Coffea canephora]
Length=154

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M++L G  G   GLL+RI QCVF  AS GVMV A  F   T+F  L   MG+  LWSL L
Sbjct  1    MKELIGSPGTVCGLLLRIGQCVFGAASIGVMVSAYGFSNYTAFCYLIASMGLQVLWSLGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R   +  L+ L  +GDWV
Sbjct  61   ACLDVYALRIKRDLRNPVLVSLFVVGDWV  89



>ref|XP_009139285.1| PREDICTED: CASP-like protein At3g53850 [Brassica rapa]
 emb|CDX76186.1| BnaA04g04500D [Brassica napus]
Length=154

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 55/89 (62%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ +FGG G   GLL+RI QC  S AS GVMV A+ F   T+F  L   MG+  LWS +L
Sbjct  1    MKKIFGGPGTVCGLLLRIGQCASSAASIGVMVSAADFSGRTAFCYLIASMGLQLLWSFAL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  ++   +  L+ L  +GDWV
Sbjct  61   ACLDVYALRTKKDLQNPILVSLFVVGDWV  89



>ref|XP_002272505.1| PREDICTED: CASP-like protein 5B2 [Vitis vinifera]
 emb|CBI30500.3| unnamed protein product [Vitis vinifera]
Length=154

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 55/89 (62%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M++L G  G  SGL++RI QC+F+ AS GVMV A  F   T+F  L   MG+  LWS  L
Sbjct  1    MKELIGSPGTASGLVLRIGQCMFAAASIGVMVSAIGFSNYTAFCYLIASMGLQVLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R   +  L+ L  +GDWV
Sbjct  61   ACLDVYALKIKRDLQNPVLVSLFVVGDWV  89



>ref|XP_007026921.1| CASP-like protein [Theobroma cacao]
 gb|EOY07423.1| CASP-like protein [Theobroma cacao]
Length=154

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M++L G  G  SGL +RI QC F+ AS GVMV  S F   T+F  L   MG+  LWS  L
Sbjct  1    MKELIGSPGTVSGLTLRIAQCAFAAASIGVMVSTSDFSTYTAFCYLIASMGLQLLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R   +  L+ L  +GDWV
Sbjct  61   ACLDVYALRRKRDLQNPVLVSLFVVGDWV  89



>ref|XP_006846373.1| hypothetical protein AMTR_s00012p00262650 [Amborella trichopoda]
 gb|ERN08048.1| hypothetical protein AMTR_s00012p00262650 [Amborella trichopoda]
Length=155

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 56/89 (63%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+DL G  G  SGLL+R+ QC+F+ AS GVMV AS F   T+F  L   MG+  LWS+ L
Sbjct  1    MKDLPGTPGTLSGLLLRLGQCLFAAASMGVMVTASGFSNYTAFCYLMASMGLQMLWSMGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD +++  +R   +  L+ L  +GDWV
Sbjct  61   AGLDAYALRIKRDLQNPVLVSLFVVGDWV  89



>ref|XP_002877943.1| hypothetical protein ARALYDRAFT_485778 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54202.1| hypothetical protein ARALYDRAFT_485778 [Arabidopsis lyrata subsp. 
lyrata]
Length=154

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ LFGG G   GLL+RI QC  + AS GVMV A  F  +T+F  L   MG+  LWS  L
Sbjct  1    MKKLFGGPGTVCGLLLRIGQCASAAASIGVMVSAKEFSVHTAFCYLIASMGLQLLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  ++   +  L+ L  +GDWV
Sbjct  61   ACLDVYALRGKKDLQNPILVSLFVVGDWV  89



>ref|XP_011036069.1| PREDICTED: CASP-like protein 5B2 [Populus euphratica]
Length=154

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 55/89 (62%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+++FGG GK SGL +R+ Q VF+ AS  VMV A  F   T+F  L   MG+  LWS  L
Sbjct  1    MKEMFGGPGKVSGLGLRVGQFVFAAASIVVMVSARGFFNATAFCYLIASMGLQLLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD H++  ++   +  L+ L  +GDWV
Sbjct  61   ACLDLHALRSKKNLQNPVLVSLFVVGDWV  89



>emb|CDY13152.1| BnaC04g26830D [Brassica napus]
Length=154

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 55/89 (62%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ +FGG G   GLL+RI QC  + AS GVMV A+ F   T+F  L   MG+  LWS +L
Sbjct  1    MKKIFGGPGTVCGLLLRIGQCASAAASIGVMVSATDFSGRTAFCYLIASMGLQLLWSFAL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  ++   +  L+ L  +GDWV
Sbjct  61   ACLDVYALRTKKDLQNPILVSLFVVGDWV  89



>ref|XP_002315203.1| hypothetical protein POPTR_0010s20610g [Populus trichocarpa]
 gb|EEF01374.1| hypothetical protein POPTR_0010s20610g [Populus trichocarpa]
Length=154

 Score = 70.9 bits (172),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 55/89 (62%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+++FGG GK SGL +R+ Q VF+ AS  VMV A  F   T+F  L   MG+  LWS  L
Sbjct  1    MKEMFGGPGKVSGLGLRVGQFVFAAASIVVMVSARGFFNATAFCYLIASMGLQLLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD H++  ++   +  L+ L  +GDWV
Sbjct  61   ACLDLHALRSKKNLQNPVLVSLFVVGDWV  89



>ref|XP_006291989.1| hypothetical protein CARUB_v10018177mg [Capsella rubella]
 gb|EOA24887.1| hypothetical protein CARUB_v10018177mg [Capsella rubella]
Length=154

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ LFGG G   GLL+RI QC  + AS GVMV A  F  +T+F  L   MG+  LWS  L
Sbjct  1    MKKLFGGPGTLCGLLLRIGQCASAAASIGVMVSAKQFSVHTAFCYLIASMGLQLLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  ++   +  L+ L  +GDWV
Sbjct  61   ACLDVYALRGKKDLQNPILVSLFVVGDWV  89



>ref|XP_010515889.1| PREDICTED: CASP-like protein 5B2 [Camelina sativa]
Length=154

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ LFGG G   GLL+RI QC  + AS GVMV A  F  +T+F  L   MG+  LWS  L
Sbjct  1    MKKLFGGPGTLCGLLLRIGQCASAAASIGVMVSAKQFSVHTAFCYLIASMGLQLLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  ++   +  L+ L  +GDWV
Sbjct  61   ACLDVYALRGKKDLQNPILVSLFVVGDWV  89



>ref|XP_010504163.1| PREDICTED: CASP-like protein 5B2 [Camelina sativa]
Length=154

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ LFGG G   GLL+RI QC  + AS GVMV A  F  +T+F  L   MG+  LWS  L
Sbjct  1    MKKLFGGPGTLCGLLLRIGQCASAAASIGVMVSAKEFSVHTAFCYLIASMGLQLLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  ++   +  L+ L  +GDWV
Sbjct  61   ACLDVYALRGKKDLQNPILVSLFVVGDWV  89



>ref|XP_010427045.1| PREDICTED: CASP-like protein 5B2 [Camelina sativa]
Length=156

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ LFGG G   GLL+RI QC  + AS GVMV A  F  +T+F  L   MG+  LWS  L
Sbjct  1    MKKLFGGPGTLCGLLLRIGQCASAAASIGVMVSAKEFSVHTAFCYLIASMGLQLLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  ++   +  L+ L  +GDWV
Sbjct  61   ACLDVYALRGKKDLQNPILVSLFVVGDWV  89



>ref|XP_010937546.1| PREDICTED: CASP-like protein 5B3 isoform X3 [Elaeis guineensis]
Length=117

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 55/89 (62%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ + G  G  SGLL+R  QCVF+ AS GVM+ A  F   T+F  L   MG+  LWSL L
Sbjct  1    MKVVVGSPGTWSGLLLRTGQCVFAGASIGVMLSAFGFSNYTAFCYLIASMGLQALWSLGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  RR  H+  L+ L  +GDWV
Sbjct  61   ACLDIYALRIRRDLHNPVLVSLFVVGDWV  89



>ref|XP_009777106.1| PREDICTED: CASP-like protein 5B1 isoform X1 [Nicotiana sylvestris]
Length=154

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 55/89 (62%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+++FG  GK SGL++R+ QC+ + AS  VM  AS F  +T+F  L   MG+  LWS  L
Sbjct  1    MKEVFGSPGKVSGLILRMGQCLLASASIAVMASASGFSSSTAFCYLIASMGLQVLWSFVL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD H++  +R   +   + L  +GDWV
Sbjct  61   ACLDIHALRLKRDLRNHVFVSLFVVGDWV  89



>ref|XP_010937545.1| PREDICTED: CASP-like protein 5B3 isoform X2 [Elaeis guineensis]
Length=121

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 55/89 (62%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ + G  G  SGLL+R  QCVF+ AS GVM+ A  F   T+F  L   MG+  LWSL L
Sbjct  1    MKVVVGSPGTWSGLLLRTGQCVFAGASIGVMLSAFGFSNYTAFCYLIASMGLQALWSLGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  RR  H+  L+ L  +GDWV
Sbjct  61   ACLDIYALRIRRDLHNPVLVSLFVVGDWV  89



>ref|XP_009610009.1| PREDICTED: CASP-like protein 5B2 isoform X4 [Nicotiana tomentosiformis]
Length=154

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M++L G  G  SGLL+R  QC+F+  S GVMV AS F   T+F  L   MG+  LWS  L
Sbjct  1    MKELVGSPGSVSGLLLRFGQCLFAGGSIGVMVSASGFSNYTAFCYLIASMGLQVLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R   +  L+ L  +GDWV
Sbjct  61   ACLDIYALRIKRDLQNPVLVSLFVVGDWV  89



>ref|XP_010666491.1| PREDICTED: CASP-like protein 5B2 [Beta vulgaris subsp. vulgaris]
Length=153

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+D+ G  G  +GL++RI QC F+ AS  +MV A+ F   T+F  L   MG+  LWS  L
Sbjct  1    MKDVVGSPGTKTGLILRIGQCGFATASIALMVCAAGFSNYTAFCYLIASMGLQMLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R   S  L+ L  +GDWV
Sbjct  61   ACLDVYALRIKRDLQSPVLVSLFVVGDWV  89



>ref|XP_009411146.1| PREDICTED: CASP-like protein Os09g0249400 [Musa acuminata subsp. 
malaccensis]
Length=154

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 55/89 (62%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ + G  G  SGLL+R  QCVF+ AS GVMV A  F   T+F  L   MG+  LWSL L
Sbjct  1    MKVVVGSPGTWSGLLLRTGQCVFAGASIGVMVSALGFSNYTAFCYLIASMGLQVLWSLGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R  H+  L+ L  +GDWV
Sbjct  61   ACLDVYALKIKRDLHNPVLVSLFVVGDWV  89



>ref|XP_002309085.1| hypothetical protein POPTR_0006s09140g [Populus trichocarpa]
 gb|EEE92608.1| hypothetical protein POPTR_0006s09140g [Populus trichocarpa]
Length=154

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+++ GG G  SGLL+RI QCVF+ AS  +M  A  F   TSF  L   MG+  LWS  L
Sbjct  1    MKEIIGGPGTVSGLLLRIGQCVFAAASISIMTSAIGFSSYTSFCYLIASMGLQLLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  ++   +  L+ L  +GDWV
Sbjct  61   ACLDIYALRRKKDLQNPVLVSLFVVGDWV  89



>ref|XP_002282400.1| PREDICTED: CASP-like protein 5B2 isoform X2 [Vitis vinifera]
 emb|CBI31614.3| unnamed protein product [Vitis vinifera]
Length=154

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 56/89 (63%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ LFG  G+ SGL++R+ QC F+ +S G+M+ AS +  +T+F  L   MG+  LWS +L
Sbjct  1    MKVLFGSPGRLSGLVLRMGQCSFAASSIGIMLSASGYSASTAFCYLIASMGLQILWSFTL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +C+D  ++  RR      LL L  +GDWV
Sbjct  61   ACVDMQALRLRRNLQHPVLLSLFVVGDWV  89



>ref|XP_006403645.1| hypothetical protein EUTSA_v10010789mg [Eutrema salsugineum]
 gb|ESQ45098.1| hypothetical protein EUTSA_v10010789mg [Eutrema salsugineum]
Length=154

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ +FGG G   GLL+RI QC  S AS GVMV ++ F   T+F  L   MG+  LWS  L
Sbjct  1    MKKIFGGPGTVCGLLLRIGQCASSAASIGVMVSSTDFSLRTAFCYLIASMGLQLLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  ++   +  L+ L  +GDWV
Sbjct  61   ACLDVYALRSKKDLQNPILISLFVVGDWV  89



>ref|XP_011006383.1| PREDICTED: CASP-like protein 5B2 [Populus euphratica]
Length=154

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+++ GG G  SGLL+RI QCVF+ AS  +M  A  F   TSF  L   MG+  LWS  L
Sbjct  1    MKEIIGGPGTVSGLLLRIGQCVFAAASISIMTSAIGFSSYTSFCYLIASMGLQLLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  ++   +  L+ L  +GDWV
Sbjct  61   ACLDIYALRRKKDLQNPVLVSLFVVGDWV  89



>ref|XP_011094908.1| PREDICTED: CASP-like protein 5B2 isoform X2 [Sesamum indicum]
Length=90

 Score = 68.2 bits (165),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 53/88 (60%), Gaps = 0/88 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+DL G  G  SGLL+RI QC+F+  S GVMV A  F   T++  L   MG+  LWS  L
Sbjct  1    MKDLLGSPGTVSGLLLRIGQCLFAAGSIGVMVSALGFSNFTAYCYLIASMGLQALWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDW  73
            +CLD +++  +R   +  L+ L  +GDW
Sbjct  61   ACLDIYALRIKRDLRNPVLVSLFVVGDW  88



>ref|XP_009796741.1| PREDICTED: CASP-like protein 5B2 [Nicotiana sylvestris]
Length=154

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M++L G  G  SGLL+R  QC+F+  S GVMV AS F   T+F  L   MG+  LWS  L
Sbjct  1    MKELVGSPGSVSGLLLRFGQCLFAGGSIGVMVSASGFSSYTAFCYLIASMGLQVLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R   +  L+ L  +GDWV
Sbjct  61   ACLDIYALRIKRDLQNPVLVSLFVVGDWV  89



>gb|AFK48759.1| unknown [Lotus japonicus]
Length=154

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ L GG G  SG L+R+ QC F  AS G+MV A  F   T+F  L   MG+  LWSL L
Sbjct  1    MKHLLGGPGTVSGCLLRVGQCAFGAASIGLMVTAFGFSTYTAFCYLIASMGLQVLWSLGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R   +  L+ L  +GDWV
Sbjct  61   ACLDIYALRKKRDLQNPILVSLFVVGDWV  89



>ref|XP_011094907.1| PREDICTED: CASP-like protein 5B2 isoform X1 [Sesamum indicum]
Length=154

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+DL G  G  SGLL+RI QC+F+  S GVMV A  F   T++  L   MG+  LWS  L
Sbjct  1    MKDLLGSPGTVSGLLLRIGQCLFAAGSIGVMVSALGFSNFTAYCYLIASMGLQALWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R   +  L+ L  +GDWV
Sbjct  61   ACLDIYALRIKRDLRNPVLVSLFVVGDWV  89



>ref|XP_010931207.1| PREDICTED: CASP-like protein 5B3 [Elaeis guineensis]
Length=154

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 55/89 (62%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ + G  G  SGL++RI QC F+ AS G+MV A  F   T+F  L   MG+  LWSL L
Sbjct  1    MKVVVGSPGTWSGLVLRIGQCAFAGASIGIMVSALGFSNYTAFCYLVASMGLQALWSLGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R  H+  L+ L  +GDWV
Sbjct  61   ACLDIYALKIKRDLHNPVLVSLFVVGDWV  89



>gb|EPS58956.1| hypothetical protein M569_15856 [Genlisea aurea]
Length=154

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+DL G  G  +G L+RI QC F+  SAGVMV A  F   T++  L   MG+  LWS  L
Sbjct  1    MKDLLGSPGTVTGFLLRIGQCSFAAGSAGVMVSAIGFSNFTAYCYLIASMGLQLLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +S+  ++   +  L+ L  +GDWV
Sbjct  61   ACLDIYSLCIKKDLRNPVLVSLFVVGDWV  89



>gb|KHG16050.1| hypothetical protein F383_22778 [Gossypium arboreum]
Length=154

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M++L G  G  SGL +R+ QC F+ AS  +MV AS F   T+F  L   MG+  LWS  L
Sbjct  1    MKELIGSPGTVSGLTLRVTQCAFAAASIALMVSASGFSTYTAFCYLIASMGLQLLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R   +  L+ L  +GDWV
Sbjct  61   ACLDVYALRRKRDLQNPVLVSLFVVGDWV  89



>ref|XP_010937544.1| PREDICTED: CASP-like protein 5B3 isoform X1 [Elaeis guineensis]
Length=154

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 55/89 (62%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ + G  G  SGLL+R  QCVF+ AS GVM+ A  F   T+F  L   MG+  LWSL L
Sbjct  1    MKVVVGSPGTWSGLLLRTGQCVFAGASIGVMLSAFGFSNYTAFCYLIASMGLQALWSLGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  RR  H+  L+ L  +GDWV
Sbjct  61   ACLDIYALRIRRDLHNPVLVSLFVVGDWV  89



>emb|CDY70812.1| BnaC06g42540D [Brassica napus]
Length=154

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ +FGG G   GLL+RI QC  + AS GVM+ ++ F   T+F  L   MG+  LWS  L
Sbjct  1    MKKIFGGPGTVCGLLLRIGQCASAAASIGVMLSSTEFYNRTAFCYLIASMGLQLLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  ++   +  L+ L  +GDWV
Sbjct  61   ACLDVYALRGKKDLQNPILVSLFVVGDWV  89



>emb|CDY55118.1| BnaA03g54970D [Brassica napus]
Length=151

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ + G  G  SGL++R+ QC  + AS GVMV A  F   T+F  L   MG+  +WSL L
Sbjct  1    MKKMIGSPGTVSGLMLRLGQCATAAASIGVMVSAPGFSSYTAFCFLVASMGLQMIWSLGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD ++I  R    S  LL L  +GDWV
Sbjct  61   ACLDVYAIRRRSDLQSPILLSLFAVGDWV  89



>ref|NP_566990.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q945M8.1|CSPLI_ARATH RecName: Full=CASP-like protein 5B2; Short=AtCASPL5B2 [Arabidopsis 
thaliana]
 gb|AAL06511.1|AF412058_1 AT4g31460/F3L17_30 [Arabidopsis thaliana]
 gb|AAM52240.1| AT4g31460/F3L17_30 [Arabidopsis thaliana]
 gb|AEE79150.1| uncharacterized protein AT3G53850 [Arabidopsis thaliana]
Length=154

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ L GG G   GLL+RI QC  + AS GVMV A  F  +T+F  L   MG+  LWS  L
Sbjct  1    MKKLLGGPGTVCGLLLRIGQCASAAASIGVMVSAKEFSVHTAFCYLIASMGLQLLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  ++   +  L+ L  +GDWV
Sbjct  61   ACLDVYALRGKKDLQNPILVSLFVVGDWV  89



>ref|XP_009130680.1| PREDICTED: CASP-like protein At5g02060 [Brassica rapa]
 ref|XP_009130681.1| PREDICTED: CASP-like protein At5g02060 [Brassica rapa]
Length=151

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ + G  G  SGL++R+ QC  + AS GVMV A  F   T+F  L   MG+  +WSL L
Sbjct  1    MKKMIGSPGTVSGLMLRLGQCATAAASIGVMVSAPGFSSYTAFCFLVASMGLQMIWSLGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD ++I  R    S  LL L  +GDWV
Sbjct  61   ACLDVYAIRRRSDLQSPILLSLFAVGDWV  89



>ref|XP_010923221.1| PREDICTED: CASP-like protein 5B3 [Elaeis guineensis]
Length=154

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 55/89 (62%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ + G  G  SGLL+RI QC F+ AS GVMV A  F   T+F  L   MG+  LWSL L
Sbjct  1    MKVVVGSPGTWSGLLLRIGQCAFAGASIGVMVSALGFSNFTAFCYLISSMGLQALWSLGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +C+D +++  +R  H+  LL L  +GDWV
Sbjct  61   ACVDIYALKIKRDLHNPMLLSLFVVGDWV  89



>ref|XP_010529803.1| PREDICTED: CASP-like protein 5B2 [Tarenaya hassleriana]
Length=154

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M++L GG G   GL++RI QC  +  S GVMV A  F  +T+F  L   MG+  LWS  L
Sbjct  1    MKELLGGPGTVGGLVMRIGQCASAATSIGVMVSAKDFASHTAFCYLIASMGLQLLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  ++   +  L+ L  +GDWV
Sbjct  61   ACLDVYALRRKKDLQNPILVSLFVVGDWV  89



>emb|CDX67574.1| BnaA07g16140D [Brassica napus]
Length=154

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ +FGG G   GLL+RI QC  + AS GVM+ ++ F   T+F  L   MG+  LWS  L
Sbjct  1    MKKIFGGPGTVFGLLLRIGQCASAAASIGVMLSSTEFYNRTAFCYLIASMGLQLLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  ++   +  L+ L  +GDWV
Sbjct  61   ACLDVYALRGKKDLQNPILVSLFVVGDWV  89



>ref|XP_008777618.1| PREDICTED: CASP-like protein Os09g0249400 [Phoenix dactylifera]
Length=154

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 55/89 (62%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ + G  G  +GL++RI QC F+ AS G+MV A  F   T+F  L   MG+  LWSL L
Sbjct  1    MKVVVGSPGTWTGLVLRIGQCAFAGASIGIMVSALGFSNYTAFCYLVASMGLQALWSLGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R  H+  L+ L  +GDWV
Sbjct  61   ACLDIYALKIKRDLHNPVLVSLFVVGDWV  89



>ref|XP_010262632.1| PREDICTED: CASP-like protein 5B2 isoform X2 [Nelumbo nucifera]
Length=117

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ LFG  G  SGLL+R+ QC+ + AS G M  A  F   T+F  L   MG+  LWS  L
Sbjct  1    MKYLFGAPGTVSGLLLRVGQCLVASASIGAMASAFGFSNYTAFCYLIASMGLQVLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R   S  L+ L  +GDWV
Sbjct  61   ACLDAYALRIKRNLQSPVLVSLFVVGDWV  89



>ref|XP_009388595.1| PREDICTED: CASP-like protein Os09g0249400 [Musa acuminata subsp. 
malaccensis]
Length=154

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+   G  G  SGLL+R+ QC F+ AS GVM+ A  F   T+F  L   M +  LWS  L
Sbjct  1    MKVAVGSPGTWSGLLLRVGQCAFAGASIGVMLSAFGFSSYTAFCYLVASMALQILWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
             CLD H++ F+R  H+  L+ L  +GDWV
Sbjct  61   LCLDLHALKFKRDLHNPLLVSLFVVGDWV  89



>gb|EYU41762.1| hypothetical protein MIMGU_mgv1a015526mg [Erythranthe guttata]
Length=154

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+DL G  G  SGLL+R  QC F+ +S GVMV A  F   T++  L   MG+  LWS  L
Sbjct  1    MKDLLGSPGSVSGLLLRTGQCFFAASSIGVMVSAIGFSNFTAYCYLIASMGLQVLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R   +  L+ L  +GDWV
Sbjct  61   ACLDIYALRIKRDLRNPVLVSLFVVGDWV  89



>ref|XP_002462061.1| hypothetical protein SORBIDRAFT_02g015330 [Sorghum bicolor]
 gb|EER98582.1| hypothetical protein SORBIDRAFT_02g015330 [Sorghum bicolor]
Length=154

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+D+ G  G  SG+ +R+ QCV + AS G M  A  F   T+F  L   MG+  LWS  L
Sbjct  1    MKDVVGSPGTWSGMALRLSQCVSAGASMGAMATAYGFSNYTAFCYLIASMGLQLLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +S+  +R  H+  L+ L  +GDWV
Sbjct  61   ACLDIYSLKTKRDLHNPVLVSLFVVGDWV  89



>ref|XP_006660449.1| PREDICTED: CASP-like protein Os09g0249400-like [Oryza brachyantha]
Length=154

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+D+ G  G  SG+ +R+ QCVF+ AS   M  A  F   T+F  L   MG+  LWS  L
Sbjct  1    MKDVVGSPGTWSGMSLRVSQCVFAGASVVAMASAYGFPNYTAFCYLIASMGLQLLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +S+  +R  H+  L+ L  +GDWV
Sbjct  61   ACLDIYSLQTKRDLHNPVLVSLFVVGDWV  89



>ref|NP_001143631.1| CASP-like protein 5B3 [Zea mays]
 sp|B6T990.1|CSPLI_MAIZE RecName: Full=CASP-like protein 5B3; Short=ZmCASPL5B3 [Zea mays]
 gb|ACG33673.1| hypothetical protein [Zea mays]
Length=154

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+D+ G  G  SG+ +R+ QCV + AS G M  A  F   T+F  L   MG+  LWS  L
Sbjct  1    MKDVVGSPGTWSGMALRLSQCVSAGASMGAMATAYGFSNYTAFCYLIASMGLQLLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +S+  +R  H+  L+ L  +GDWV
Sbjct  61   ACLDVYSLKTKRDLHNPVLVSLFVVGDWV  89



>gb|KGN45745.1| hypothetical protein Csa_6G008760 [Cucumis sativus]
Length=224

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 54/92 (59%), Gaps = 0/92 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +  ++FG  G+ SGL++R  Q +F+  S G MV A  F  +T+F  L   MG+  LWS  
Sbjct  70   EQAEMFGSPGRMSGLVLRCAQWLFAAVSIGFMVTAPGFFNSTAFCYLIASMGLQILWSFG  129

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWVLQ  64
            L+CLD H++  ++   +  LL L  IGDWV+ 
Sbjct  130  LACLDLHALRMKKSLRNSVLLCLFAIGDWVVS  161



>ref|NP_001062672.1| Os09g0249400 [Oryza sativa Japonica Group]
 sp|Q6K478.1|CSPLQ_ORYSJ RecName: Full=CASP-like protein 5B3; Short=OsCASPL5B3 [Oryza 
sativa Japonica Group]
 sp|B8BD96.1|CSPLQ_ORYSI RecName: Full=CASP-like protein 5B3; Short=OsCASPL5B3 [Oryza 
sativa Indica Group]
 dbj|BAD19907.1| integral membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAF24586.1| Os09g0249400 [Oryza sativa Japonica Group]
 dbj|BAG88775.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84160.1| hypothetical protein OsI_30532 [Oryza sativa Indica Group]
 gb|EEE69262.1| hypothetical protein OsJ_28518 [Oryza sativa Japonica Group]
Length=154

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+D+ G  G  SG+ +R+ QCVF+ AS   M  A  F   T+F  L   MG+  LWS  L
Sbjct  1    MKDVVGSPGTWSGMSLRVSQCVFAGASVVAMASAYGFSNYTAFCYLIASMGLQLLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +S+  +R  H+  L+ L  +GDWV
Sbjct  61   ACLDIYSLQTKRDLHNPVLVSLFVVGDWV  89



>emb|CDX80801.1| BnaC03g00550D [Brassica napus]
Length=151

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ + G  G  SGL++R+ QC  + AS GVMV A  F   T+F  L   MG+  +WS  L
Sbjct  1    MKKMIGSPGTMSGLILRLGQCATAAASIGVMVSAPGFSSYTAFCFLVASMGLQMIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD ++I  R    S  LL L  +GDWV
Sbjct  61   ACLDVYAIRRRSDLQSPILLSLFAVGDWV  89



>ref|XP_009398793.1| PREDICTED: CASP-like protein Os09g0249400 [Musa acuminata subsp. 
malaccensis]
Length=154

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 55/89 (62%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ +FG  G  SGLL+R  Q VF+ AS GVM+ A  F   T+F  L   MG+  LWSL L
Sbjct  1    MKVVFGSPGTWSGLLLRTGQWVFAGASIGVMLSAFGFSNYTAFCYLIASMGLQALWSLGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R  H+  L+ L  +GDWV
Sbjct  61   ACLDIYALKVKRDLHNPLLVSLFVVGDWV  89



>ref|XP_010262631.1| PREDICTED: CASP-like protein 5B2 isoform X1 [Nelumbo nucifera]
Length=154

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ LFG  G  SGLL+R+ QC+ + AS G M  A  F   T+F  L   MG+  LWS  L
Sbjct  1    MKYLFGAPGTVSGLLLRVGQCLVASASIGAMASAFGFSNYTAFCYLIASMGLQVLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R   S  L+ L  +GDWV
Sbjct  61   ACLDAYALRIKRNLQSPVLVSLFVVGDWV  89



>gb|KDO48140.1| hypothetical protein CISIN_1g031701mg [Citrus sinensis]
Length=154

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M++L G  G  SGL++RI QC F+ A+ G M  A+ F   T+F  L   MG+  LWS  L
Sbjct  1    MKELVGSPGTVSGLMLRIGQCGFAAAAIGAMTSAAGFSSYTAFCYLIASMGLQMLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R   +  L+ L  +GDWV
Sbjct  61   ACLDIYALRRKRDLQNPVLVSLFVVGDWV  89



>ref|XP_009103882.1| PREDICTED: CASP-like protein At3g53850 [Brassica rapa]
Length=154

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ + GG G   GLL+RI QC  + AS GVM+ ++ F   T+F  L   MG+  LWS  L
Sbjct  1    MKKIIGGPGTVCGLLLRIGQCASAAASIGVMLSSTEFYNRTAFCYLIASMGLQLLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  ++   +  L+ L  +GDWV
Sbjct  61   ACLDVYALRGKKDLQNPILVSLFVVGDWV  89



>ref|XP_006429174.1| hypothetical protein CICLE_v10012998mg [Citrus clementina]
 ref|XP_006493573.1| PREDICTED: CASP-like protein At3g53850-like [Citrus sinensis]
 gb|ESR42414.1| hypothetical protein CICLE_v10012998mg [Citrus clementina]
Length=154

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M++L G  G  SGL++RI QC F+ A+ G M  A+ F   T+F  L   MG+  LWS  L
Sbjct  1    MKELVGSPGTVSGLMLRIGQCGFAAAAIGAMTSAAGFSSYTAFCYLIASMGLQMLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R   +  L+ L  +GDWV
Sbjct  61   ACLDIYALRRKRDLQNPVLVSLFVVGDWV  89



>ref|XP_008803136.1| PREDICTED: CASP-like protein Os09g0249400 [Phoenix dactylifera]
 ref|XP_008803138.1| PREDICTED: CASP-like protein Os09g0249400 [Phoenix dactylifera]
Length=154

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ + G  G  SGLL+R  QC F+ AS GVM+ A  F   T+F  L   MG+  LWSL L
Sbjct  1    MKVVVGSPGTWSGLLLRTGQCAFAGASIGVMLSAFGFSNYTAFCYLIASMGLQALWSLGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R  H+  L+ L  +GDWV
Sbjct  61   ACLDVYALRIKRDLHNPVLVSLFVVGDWV  89



>gb|KDO48141.1| hypothetical protein CISIN_1g031701mg [Citrus sinensis]
Length=109

 Score = 65.1 bits (157),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 52/88 (59%), Gaps = 0/88 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M++L G  G  SGL++RI QC F+ A+ G M  A+ F   T+F  L   MG+  LWS  L
Sbjct  1    MKELVGSPGTVSGLMLRIGQCGFAAAAIGAMTSAAGFSSYTAFCYLIASMGLQMLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDW  73
            +CLD +++  +R   +  L+ L  +GDW
Sbjct  61   ACLDIYALRRKRDLQNPVLVSLFVVGDW  88



>ref|XP_008785512.1| PREDICTED: CASP-like protein Os09g0249400 [Phoenix dactylifera]
Length=154

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ + G  G  SGLL+RI QC F+ AS G MV A  F   T+F  L   MG+  LWSL L
Sbjct  1    MKVVVGSPGTWSGLLLRIGQCAFAGASIGFMVSALGFSNYTAFCYLISSMGLQALWSLGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +C+D +++  +R  H+  L+ L  +GDWV
Sbjct  61   ACVDIYALKIKRDLHNPMLVSLFLVGDWV  89



>ref|XP_006398670.1| hypothetical protein EUTSA_v10014817mg [Eutrema salsugineum]
 gb|ESQ40123.1| hypothetical protein EUTSA_v10014817mg [Eutrema salsugineum]
Length=178

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 51/90 (57%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
             M+ + G  G  SGL++RI QC  + AS GVMV A  F   T+F  L   MG+  +WS  
Sbjct  27   SMKKMIGSPGTMSGLILRIGQCATAAASIGVMVSAPGFSSYTAFCFLVASMGLQLIWSFG  86

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            L+CLD ++I  +    +  LL L  +GDWV
Sbjct  87   LACLDVYAIRRKSDLQTPILLSLFTVGDWV  116



>gb|KFK24608.1| hypothetical protein AALP_AA8G001300 [Arabis alpina]
Length=152

 Score = 65.5 bits (158),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 50/89 (56%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ + G  G  SGL++R+ QC  S  S GVMV A  F   T+F  L   MG+  +WS  L
Sbjct  1    MKKMIGSPGTMSGLILRLGQCATSATSIGVMVSAPGFSSYTAFCFLVASMGLQMIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD ++I  +    S  LL L  +GDWV
Sbjct  61   ACLDVYAIRRKSDLQSPILLSLFTVGDWV  89



>gb|KDP24559.1| hypothetical protein JCGZ_25123 [Jatropha curcas]
Length=154

 Score = 65.5 bits (158),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M++L G  G  SGL +RI QC F+ AS G+M  A+ F   T+F  L   MG+  LWS  L
Sbjct  1    MKELIGSPGTISGLFLRISQCAFAAASIGLMASATGFSSYTAFCYLIASMGLQVLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD ++   +R   +  L+ L  +GDWV
Sbjct  61   ACLDIYAFRRKRDLLNPVLVSLFVVGDWV  89



>ref|XP_010532632.1| PREDICTED: CASP-like protein 5B3 [Tarenaya hassleriana]
Length=152

 Score = 65.5 bits (158),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            MRD  G  G P+GL++RI QCVF+  S   MV +  F   T+F  L   MG+  +WSL L
Sbjct  1    MRDFPGTPGTPTGLVLRISQCVFAAGSISYMVTSGGFFSYTAFCYLIAAMGLQVIWSLGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD  +++  +   S  L+ L  +GDWV
Sbjct  61   ALLDTFALLRNKALRSAVLVSLFVVGDWV  89



>gb|KFK34633.1| hypothetical protein AALP_AA5G171300 [Arabis alpina]
Length=154

 Score = 65.5 bits (158),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ LFGG G   GLL+RI QCV +  S  VMV A  F  +T+F  L   M +  LWS  L
Sbjct  1    MKKLFGGPGTLCGLLLRIGQCVSAAGSIAVMVSAKDFFLHTAFCYLIASMALQLLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  ++   +  L+ L  +GDWV
Sbjct  61   ACLDVYALRSKKDLQNPILVSLFVVGDWV  89



>ref|XP_008441395.1| PREDICTED: CASP-like protein At5g02060 [Cucumis melo]
 ref|XP_008441396.1| PREDICTED: CASP-like protein At5g02060 [Cucumis melo]
Length=151

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 52/88 (59%), Gaps = 0/88 (0%)
 Frame = -3

Query  327  LFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSLSCL  148
            +FG  G+ SGL++R  Q +F+  S G MV A  F  +T+F  L   MG+  LWS  L+CL
Sbjct  1    MFGSPGRMSGLVLRCAQWLFAAVSIGFMVTAPGFFNSTAFCYLIASMGLQILWSFGLACL  60

Query  147  DFHSIMFRRRGHSVFLLVLICIGDWVLQ  64
            D H++  ++   +  LL L  IGDWV+ 
Sbjct  61   DLHALRMKKSLRNSVLLCLFAIGDWVVS  88



>ref|XP_004138452.1| PREDICTED: CASP-like protein At3g53850-like isoform 1 [Cucumis 
sativus]
 ref|XP_004138453.1| PREDICTED: CASP-like protein At3g53850-like isoform 2 [Cucumis 
sativus]
 ref|XP_004154738.1| PREDICTED: CASP-like protein At3g53850-like isoform 1 [Cucumis 
sativus]
 ref|XP_004154739.1| PREDICTED: CASP-like protein At3g53850-like isoform 2 [Cucumis 
sativus]
Length=151

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 52/88 (59%), Gaps = 0/88 (0%)
 Frame = -3

Query  327  LFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSLSCL  148
            +FG  G+ SGL++R  Q +F+  S G MV A  F  +T+F  L   MG+  LWS  L+CL
Sbjct  1    MFGSPGRMSGLVLRCAQWLFAAVSIGFMVTAPGFFNSTAFCYLIASMGLQILWSFGLACL  60

Query  147  DFHSIMFRRRGHSVFLLVLICIGDWVLQ  64
            D H++  ++   +  LL L  IGDWV+ 
Sbjct  61   DLHALRMKKSLRNSVLLCLFAIGDWVVS  88



>ref|XP_007134065.1| hypothetical protein PHAVU_010G016500g [Phaseolus vulgaris]
 gb|ESW06059.1| hypothetical protein PHAVU_010G016500g [Phaseolus vulgaris]
Length=155

 Score = 65.1 bits (157),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 50/89 (56%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ L GG G  SG L+R  QC F  AS  +MV    F   T+F  L   MG+ FLWS  L
Sbjct  2    MKRLLGGPGTISGFLLRFGQCAFGAASITLMVTGYGFSSYTAFCYLIASMGLQFLWSFGL  61

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R   +  L+ L  +GDWV
Sbjct  62   ACLDIYALRRKRDLQNPILVSLFVVGDWV  90



>ref|XP_008448240.1| PREDICTED: CASP-like protein At3g53850 [Cucumis melo]
Length=155

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+DL G  G  SGL +RI Q  F+ AS GVMV A  F   T+F  L   MG+  LWS  L
Sbjct  1    MKDLIGRPGTMSGLALRIGQSAFAAASIGVMVSALGFSSFTAFCYLIASMGLQVLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R   +  L+ L  +GDWV
Sbjct  61   ACLDMYALRRKRDLQNPILVSLFVVGDWV  89



>ref|XP_003604912.1| hypothetical protein MTR_4g021340 [Medicago truncatula]
 gb|AES87109.1| CASP-like protein [Medicago truncatula]
 gb|AFK46601.1| unknown [Medicago truncatula]
Length=155

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ L GG G  SG L+R+ QC F  AS  VMV +  F   T+F  L   MG+  LWS  L
Sbjct  2    MQRLLGGPGTVSGFLLRLGQCAFGAASISVMVTSFGFSTYTAFCYLTASMGLQVLWSFGL  61

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R   +  L+ L  +GDWV
Sbjct  62   ACLDIYALRRKRDLQNPILVSLFVVGDWV  90



>ref|XP_004246449.1| PREDICTED: CASP-like protein 5B2 [Solanum lycopersicum]
 ref|XP_006340996.1| PREDICTED: CASP-like protein At3g53850-like [Solanum tuberosum]
Length=154

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M++L G  G  SGL +R+ QC+F++ S  VMV AS F   T+F  L   MG+  LWS  L
Sbjct  1    MKELVGSPGSVSGLFLRLGQCLFAVGSIVVMVSASGFSNYTAFCYLIASMGLQVLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  ++   +  L+ L  +GDWV
Sbjct  61   ACLDVYALRIKQDLQNPVLVSLFVVGDWV  89



>ref|NP_001044796.1| Os01g0847300 [Oryza sativa Japonica Group]
 sp|Q5N794.1|CSPLR_ORYSJ RecName: Full=CASP-like protein 5B1; Short=OsCASPL5B1 [Oryza 
sativa Japonica Group]
 sp|B8AC36.1|CSPLR_ORYSI RecName: Full=CASP-like protein 5B1; Short=OsCASPL5B1 [Oryza 
sativa Indica Group]
 dbj|BAD82664.1| integral membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAD81835.1| integral membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAF06710.1| Os01g0847300 [Oryza sativa Japonica Group]
 dbj|BAG92348.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71797.1| hypothetical protein OsI_04425 [Oryza sativa Indica Group]
Length=153

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            MR+L G  G  SGL +R+ Q VF+ AS      A  F   T+F  L   MG+  LWSL L
Sbjct  1    MRELAGSPGTWSGLSLRVGQLVFAAASVCATASALGFAAYTAFCYLIASMGLQALWSLGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++ F++  HS  LL L  +GDWV
Sbjct  61   ACLDCYALKFKKDLHSAVLLSLFVVGDWV  89



>ref|XP_008391185.1| PREDICTED: CASP-like protein At3g23200 isoform X2 [Malus domestica]
Length=147

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            MRD  G  G  +GLL+RI QCVF+  S   M   + F   T+F  L   MG+  +WSL L
Sbjct  1    MRDFPGTPGTLTGLLLRISQCVFAAGSIASMATTASFFNFTAFCYLIASMGLQLIWSLVL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD +S++ ++  H+  L+ L  +GDWV
Sbjct  61   ALLDAYSLVKKKVLHNPVLVSLFVVGDWV  89



>ref|XP_002870949.1| hypothetical protein ARALYDRAFT_486984 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47208.1| hypothetical protein ARALYDRAFT_486984 [Arabidopsis lyrata subsp. 
lyrata]
Length=152

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ + G  G  SGL++R+ QC  + AS GVMV +  F   T+F  L   MG+  +WS  L
Sbjct  1    MKKMIGSPGTMSGLILRLGQCATAAASIGVMVSSYDFSNYTAFCFLVASMGLQLIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD ++I  +    S  LL L  +GDWV
Sbjct  61   ACLDVYAIRRKSDLQSPILLSLFTVGDWV  89



>ref|XP_006288846.1| hypothetical protein CARUB_v10002192mg [Capsella rubella]
 ref|XP_006288847.1| hypothetical protein CARUB_v10002192mg [Capsella rubella]
 gb|EOA21744.1| hypothetical protein CARUB_v10002192mg [Capsella rubella]
 gb|EOA21745.1| hypothetical protein CARUB_v10002192mg [Capsella rubella]
Length=152

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ + G  G  SGL++R+ QC  + AS GVMV A  F   T+F  L   MG+  +WS  L
Sbjct  1    MKKIIGSPGTMSGLILRLGQCATAAASIGVMVSAYGFSNYTAFCFLVASMGLQLIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD ++I  +    S  LL L  +GDWV
Sbjct  61   ACLDVYAIRRKSDLRSPVLLSLFTVGDWV  89



>ref|XP_008391184.1| PREDICTED: CASP-like protein At3g23200 isoform X1 [Malus domestica]
 ref|XP_008351305.1| PREDICTED: CASP-like protein At3g23200 [Malus domestica]
Length=152

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            MRD  G  G  +GLL+RI QCVF+  S   M   + F   T+F  L   MG+  +WSL L
Sbjct  1    MRDFPGTPGTLTGLLLRISQCVFAAGSIASMATTASFFNFTAFCYLIASMGLQLIWSLVL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD +S++ ++  H+  L+ L  +GDWV
Sbjct  61   ALLDAYSLVKKKVLHNPVLVSLFVVGDWV  89



>ref|XP_009379002.1| PREDICTED: CASP-like protein At3g23200 [Pyrus x bretschneideri]
Length=152

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            MRD  G  G  +GLL+RI QCVF+  S   M   + F   T+F  L   MG+  +WSL L
Sbjct  1    MRDFPGTPGTLTGLLLRISQCVFAAGSIASMATTASFFNFTAFCYLIASMGLQLIWSLVL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD +S++ ++  H+  L+ L  +GDWV
Sbjct  61   ALLDAYSLVKKKVLHNPVLVSLFVVGDWV  89



>ref|XP_004956394.1| PREDICTED: CASP-like protein 13-like [Setaria italica]
Length=154

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 50/89 (56%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+D+ G  G  SG+ +R+ QCV +  S   M  A  F   T+F  L   MG+  LWS  L
Sbjct  1    MKDVLGSPGTWSGMALRLSQCVSAGGSMAAMATAYGFSNYTAFCYLIASMGLQLLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +S+  +R  H+  L+ L  +GDWV
Sbjct  61   ACLDIYSLKTKRDLHNPVLVSLFVVGDWV  89



>ref|XP_010490624.1| PREDICTED: CASP-like protein 5B1 [Camelina sativa]
Length=152

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ + G  G  SGL++R+ QC  + AS GVMV A  F   T+F  L   MG+  +WS  L
Sbjct  1    MKRIIGSPGTMSGLILRLGQCATAAASIGVMVSAYGFSNYTAFCFLVASMGLQLIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD ++I  +    S  LL L  +GDWV
Sbjct  61   ACLDVYAIRRKSDLRSPVLLSLFTVGDWV  89



>sp|D5ACW4.2|CSPLB_PICSI RecName: Full=CASP-like protein 5B1; Short=PsCASPL5B1, partial 
[Picea sitchensis]
Length=182

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
             M+DL G  G   GL +R+ Q +F+ AS  +MV +  FI  T+F  LA  M + FLWS  
Sbjct  31   PMKDLPGTPGTVGGLALRMGQFIFAAASVVIMVTSDEFINFTAFCYLAAAMALQFLWSFV  90

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            L+ +D ++++ +R   +  LL L  +GDWV
Sbjct  91   LATIDVYALLIKRGLPNSILLSLFVVGDWV  120



>ref|NP_195826.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9LZM5.1|CSPLU_ARATH RecName: Full=CASP-like protein 5B1; Short=AtCASPL5B1 [Arabidopsis 
thaliana]
 emb|CAB82979.1| putative protein [Arabidopsis thaliana]
 gb|AAT47789.1| At5g02060 [Arabidopsis thaliana]
 dbj|BAD43123.1| unknown protein [Arabidopsis thaliana]
 gb|AED90427.1| uncharacterized protein AT5G02060 [Arabidopsis thaliana]
Length=152

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ + G  G  SGL++R+ QC  + AS GVMV +  F   T+F  L   MG+  +WS  L
Sbjct  1    MKKMIGSPGTMSGLILRLGQCATAAASIGVMVSSYDFSNYTAFCFLVASMGLQLIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD ++I  +    S  LL L  +GDWV
Sbjct  61   ACLDVYAIRRKSDLRSPILLSLFTVGDWV  89



>gb|ADE77383.1| unknown [Picea sitchensis]
Length=151

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+DL G  G   GL +R+ Q +F+ AS  +MV +  FI  T+F  LA  M + FLWS  L
Sbjct  1    MKDLPGTPGTVGGLALRMGQFIFAAASVVIMVTSDEFINFTAFCYLAAAMALQFLWSFVL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + +D ++++ +R   +  LL L  +GDWV
Sbjct  61   ATIDVYALLIKRGLPNSILLSLFVVGDWV  89



>ref|XP_004297815.1| PREDICTED: CASP-like protein At3g23200-like [Fragaria vesca subsp. 
vesca]
Length=189

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+D  G  G  + LL+RI QCV + AS   M  +S F   T+F  L   MG+  +WS  L
Sbjct  1    MKDFPGTPGTLTALLLRISQCVLAAASIASMATSSSFFNFTAFCYLIASMGLQVIWSFVL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD +S+M ++  H+  L+ L  +GDWV
Sbjct  61   ALLDAYSLMKKKALHNPVLVSLFVVGDWV  89



>ref|XP_003520906.1| PREDICTED: CASP-like protein At3g53850-like [Glycine max]
Length=155

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 50/89 (56%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ L GG G  SG L+R  QC F  AS  +MV +  F   T+F  L   MG+  LWS  L
Sbjct  2    MKRLLGGPGTISGFLLRFGQCAFGAASIAIMVTSFGFSSYTAFCYLIASMGLQVLWSFGL  61

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R   +  L+ L  +GDWV
Sbjct  62   ACLDIYALRRKRDLQNPILVSLFVVGDWV  90



>ref|NP_001235139.1| uncharacterized protein LOC100306188 [Glycine max]
 gb|ACU14250.1| unknown [Glycine max]
 gb|KHN43837.1| CASP-like protein [Glycine soja]
Length=155

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 50/89 (56%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ L GG G  SG L+R  QC F  AS  +MV +  F   T+F  L   MG+  LWS  L
Sbjct  2    MKRLLGGPGTISGFLLRFGQCAFGAASIAIMVTSFGFSSYTAFCYLIASMGLQVLWSFGL  61

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R   +  L+ L  +GDWV
Sbjct  62   ACLDIYALRRKRDLQNPILVSLFVVGDWV  90



>ref|XP_004506625.1| PREDICTED: CASP-like protein At3g53850-like [Cicer arietinum]
Length=155

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ L GG G  +G L+R+ QC F  AS  +MV +  F   T+F  L   MG+  LWS  L
Sbjct  2    MKRLLGGPGTVTGFLLRLGQCAFGAASISIMVTSLGFSTFTAFCYLTASMGLQVLWSFGL  61

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R   +  L+ L  +GDWV
Sbjct  62   ACLDIYALRRKRDLQNPILVSLFVVGDWV  90



>ref|XP_010452041.1| PREDICTED: CASP-like protein 5B1 [Camelina sativa]
Length=152

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ + G  G  SGL++R+ QC  + AS GVMV A  F   T+F  L   MG+  +WS  L
Sbjct  1    MKRIIGSPGTMSGLILRLGQCATAAASIGVMVSAYGFSNYTAFCFLVASMGLQLVWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD ++I  +    S  LL L  +GDWV
Sbjct  61   ACLDVYAIRRKSDLRSPVLLSLFTVGDWV  89



>ref|XP_002529873.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32523.1| conserved hypothetical protein [Ricinus communis]
Length=154

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M++L G  G  SGL++RI QC  + AS  +M  A  F   T+F  L   MG+  LWS  L
Sbjct  1    MKELIGSPGTVSGLVLRIGQCALAAASISIMASARGFSSYTAFCYLIASMGLQVLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R   +  L+ L  +GDWV
Sbjct  61   ACLDVYALRRKRDLQNPVLVSLFVVGDWV  89



>ref|XP_009791582.1| PREDICTED: CASP-like protein 5B2 [Nicotiana sylvestris]
Length=154

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M++  G  G  SGL +R+ QC F++ S   MV AS F   T+F  L   MG+  LWS  L
Sbjct  1    MKEPVGSPGSVSGLFLRLGQCFFAVGSIVFMVSASGFSNYTAFCYLIASMGLQVLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  ++  H+  L+ L  +GDWV
Sbjct  61   ACLDVYALRIKQDLHNPVLVSLFVVGDWV  89



>ref|XP_008224373.1| PREDICTED: CASP-like protein At3g23200 [Prunus mume]
Length=152

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+D  G  G  +GLL+RI QCVF+  S   M   + F   T+F  L   MG+  +WSL L
Sbjct  1    MKDFPGTPGTLTGLLLRISQCVFAAGSIASMATTASFFNFTAFCYLIASMGLQVIWSLVL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD +S++ ++  H+  L+ L  +GDWV
Sbjct  61   ALLDAYSLVKKKVLHNPVLVSLFVVGDWV  89



>ref|XP_010093419.1| hypothetical protein L484_012817 [Morus notabilis]
 gb|EXB54025.1| hypothetical protein L484_012817 [Morus notabilis]
Length=152

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+D  G  G  +GLL+RI QCVF+  S   M   + F   T+F  L   MG+  +WS  L
Sbjct  1    MKDFPGTPGTLTGLLLRISQCVFAAGSIASMATTTSFFNFTAFCYLIASMGLQVIWSFVL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD ++++ R+  H++ L+ L  +GDWV
Sbjct  61   ALLDAYALVRRKAFHNLLLVSLFVVGDWV  89



>ref|XP_004142057.1| PREDICTED: CASP-like protein At3g53850-like [Cucumis sativus]
 ref|XP_004166561.1| PREDICTED: CASP-like protein At3g53850-like [Cucumis sativus]
 gb|KGN54278.1| hypothetical protein Csa_4G296310 [Cucumis sativus]
Length=155

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ L G  G  SGL +RI Q  F+ AS GVMV A  F   T+F  L   MG+  LWS  L
Sbjct  1    MKHLIGKPGTVSGLALRIGQSAFAAASIGVMVSALGFSSFTAFCYLIASMGLQVLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R   +  L+ L  +GDWV
Sbjct  61   ACLDMYALRRKRDLQNPILVSLFVVGDWV  89



>ref|XP_007223725.1| hypothetical protein PRUPE_ppa013068mg [Prunus persica]
 gb|EMJ24924.1| hypothetical protein PRUPE_ppa013068mg [Prunus persica]
Length=141

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+D  G  G  +GLL+RI QCVF+  S   M   + F   T+F  L   MG+  +WSL L
Sbjct  1    MKDFPGTPGTLTGLLLRISQCVFAAGSIASMATTASFFNFTAFCYLIASMGLQVIWSLVL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD +S++ ++  H+  L+ L  +GDWV
Sbjct  61   AFLDAYSLVKKKVLHNPVLVSLFVVGDWV  89



>ref|XP_004302711.1| PREDICTED: CASP-like protein At3g53850-like [Fragaria vesca subsp. 
vesca]
Length=155

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M++L G  G  +GLL+RI Q  F+ A+ GVM+ A  F   T+F  L   MG+  LWS  L
Sbjct  1    MKELIGRPGSVTGLLLRIGQFGFASAAIGVMLSADRFATFTAFCYLIASMGLQVLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R   +  L+ L  +GDWV
Sbjct  61   ACLDIYALRRKRDLQNPILVSLFVVGDWV  89



>ref|XP_009351007.1| PREDICTED: CASP-like protein At3g23200 [Pyrus x bretschneideri]
Length=151

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 51/89 (57%), Gaps = 1/89 (1%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            MRD  G  G  +GLL+RI QCVF+  S   M   + F   T+F C    MG+  +WSL L
Sbjct  1    MRDFPGTPGTLTGLLLRISQCVFAAGSIAFMATTASFFNFTAF-CYLTSMGLQLIWSLVL  59

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD +S++  +  H+  L+ L  +GDWV
Sbjct  60   ALLDVYSLVKMKVLHNPALVSLFVVGDWV  88



>ref|XP_010543269.1| PREDICTED: CASP-like protein 5B1 [Tarenaya hassleriana]
Length=149

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 49/89 (55%), Gaps = 0/89 (0%)
 Frame = -3

Query  327  LFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSLSCL  148
            + G  G  SGL++R+ QC  S AS GVM+    F   T+F  L   MG+  +WS  L+CL
Sbjct  1    MIGSPGTMSGLMLRLGQCASSAASIGVMISTFGFSGYTAFCFLVASMGLQLMWSFGLACL  60

Query  147  DFHSIMFRRRGHSVFLLVLICIGDWVLQF  61
            D ++I  +    S  LL L  +GDWV  F
Sbjct  61   DVYAIRRKTELQSPILLSLFTVGDWVTAF  89



>ref|XP_003564606.1| PREDICTED: CASP-like protein 5B1 [Brachypodium distachyon]
Length=154

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 50/89 (56%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            MR+L G  G  SGL +R+ Q  F+ AS  VM  A  F   T+F  L   MG+  LWSL L
Sbjct  1    MRELAGSPGSWSGLALRLSQFAFAAASVCVMASARDFANYTAFCYLIASMGLQALWSLGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++   +   S  L+ L  +GDWV
Sbjct  61   ACLDGYALKLEKDLRSAVLVSLFVVGDWV  89



>ref|XP_006645005.1| PREDICTED: CASP-like protein Os01g0847300-like [Oryza brachyantha]
Length=154

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            MR+L G  G  SGL +R+ Q VF+ AS      A  F   T+F  L   MG+  LWSL L
Sbjct  1    MRELAGSPGTWSGLSLRVGQLVFAAASVCATASALGFAAYTAFCYLIASMGLQALWSLGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++ F++   S  L+ L  +GDWV
Sbjct  61   ACLDCYALKFKKDLQSAVLVSLFVVGDWV  89



>ref|XP_010423904.1| PREDICTED: CASP-like protein 5B1 [Camelina sativa]
Length=152

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 50/89 (56%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ + G  G  SG ++R+ QC  + AS GVMV +  F   T+F  L   MG+  +WS  L
Sbjct  1    MKRIIGSPGTMSGFILRLGQCATAAASIGVMVSSYGFSNYTAFCFLVASMGLQLVWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD ++I  +    S  LL L  +GDWV
Sbjct  61   ACLDVYAIRRKSDLRSPVLLSLFTVGDWV  89



>ref|XP_002529297.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33066.1| conserved hypothetical protein [Ricinus communis]
Length=152

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+D  G  G  + L++RI QC+F+  S   M   S F   T+F  L   MG+  +WSL L
Sbjct  1    MKDFAGTPGTLTALVLRISQCIFAAGSITAMATTSTFFNFTAFCYLIASMGLQVIWSLGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD ++++ ++  H+  L+ L  +GDWV
Sbjct  61   ALLDAYALIRKKVLHNSILVSLFVVGDWV  89



>ref|XP_010262291.1| PREDICTED: CASP-like protein 5B3 isoform X1 [Nelumbo nucifera]
Length=164

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+D  G  G  + L++RILQC+F+  S   M  A  F  +T+F  L   MG+  +WS  L
Sbjct  1    MKDFPGTPGTLTALILRILQCLFAGGSIITMATAPTFFNSTAFCYLIASMGLQVIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD +++  ++  H+  L+ L  +GDWV
Sbjct  61   ASLDAYALARKKILHNTTLVSLFVVGDWV  89



>emb|CAB88347.1| putative protein [Arabidopsis thaliana]
Length=176

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 54/111 (49%), Gaps = 22/111 (20%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFW----------------  205
            M+ L GG G   GLL+RI QC  + AS GVMV A  F  +T+FW                
Sbjct  1    MKKLLGGPGTVCGLLLRIGQCASAAASIGVMVSAKEFSVHTAFWYGFAFFNTSLVDVDYD  60

Query  204  ------CLALVMGVLFLWSLSLSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
                   L   MG+  LWS  L+CLD +++  ++   +  L+ L  +GDWV
Sbjct  61   FGVGFSYLIASMGLQLLWSFGLACLDVYALRGKKDLQNPILVSLFVVGDWV  111



>ref|XP_010043998.1| PREDICTED: CASP-like protein 5B2 [Eucalyptus grandis]
 ref|XP_010043999.1| PREDICTED: CASP-like protein 5B2 [Eucalyptus grandis]
 gb|KCW86004.1| hypothetical protein EUGRSUZ_B02710 [Eucalyptus grandis]
Length=154

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+++ G  G  SG+ +R+ QC  + AS G MV A  F   T+F  L   MG+  LWS  L
Sbjct  1    MKEIVGSPGTVSGMALRVGQCACAGASIGFMVSALGFSSYTAFCYLIASMGLQVLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R   +  L+ L  +GDWV
Sbjct  61   ACLDIYALKRKRDLQNPVLVSLFVVGDWV  89



>ref|XP_010088588.1| hypothetical protein L484_016981 [Morus notabilis]
 gb|EXB36729.1| hypothetical protein L484_016981 [Morus notabilis]
Length=155

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+ L G  G  SGL++R+ Q   + AS G+MV AS F   T+F  L   MG+  LWS  L
Sbjct  1    MKQLVGRPGSGSGLVLRLGQASCAAASIGLMVSASGFATFTAFCYLIASMGLQVLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD + +  +R   +  L+ L  +GDWV
Sbjct  61   ACLDIYGLRRKRDLQNPILVSLFVVGDWV  89



>gb|EPS72455.1| hypothetical protein M569_02306, partial [Genlisea aurea]
Length=150

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M +L G +G  +GL +R+ Q  F++AS   M L   F   TSF  L +VM ++  WSL+L
Sbjct  1    MDELPGAMGTSAGLALRLGQASFAIASLLFMCLEIQFYSYTSFCFLVIVMALIVPWSLTL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
              +D  +I F+R      LL ++ +GDWV
Sbjct  61   GIVDIVTIFFKRSSRRSGLLAIVVVGDWV  89



>gb|KDP40311.1| hypothetical protein JCGZ_02309 [Jatropha curcas]
Length=152

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 48/89 (54%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+D  G  G  + L +RI QC+F+  S   M   S F   T+F  L   MG+  +WS  L
Sbjct  1    MKDFAGTPGTVTALALRISQCIFAAGSITAMATTSTFFNFTAFCYLIASMGLQVIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD +S+  ++  H+  L+ L  +GDWV
Sbjct  61   ALLDAYSLARKKVLHNSILVSLFVVGDWV  89



>ref|XP_002284723.1| PREDICTED: CASP-like protein 5B3 isoform X1 [Vitis vinifera]
 ref|XP_010650064.1| PREDICTED: CASP-like protein 5B3 isoform X1 [Vitis vinifera]
 emb|CBI23606.3| unnamed protein product [Vitis vinifera]
Length=152

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+D  G  G  +GL++RI QC+F+  S   M   S F   T+F  L   MG+  +WS  L
Sbjct  1    MKDFPGTPGTWTGLILRISQCMFAAGSIASMATTSSFFSVTAFCYLIASMGLQVIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD ++++ ++  H+  L+ L  +GDWV
Sbjct  61   AFLDAYALVKKKVLHNPVLVSLFVVGDWV  89



>ref|XP_006420191.1| hypothetical protein CICLE_v10006143mg [Citrus clementina]
 ref|XP_006489575.1| PREDICTED: CASP-like protein At3g23200-like [Citrus sinensis]
 gb|ESR33431.1| hypothetical protein CICLE_v10006143mg [Citrus clementina]
 gb|KDO57627.1| hypothetical protein CISIN_1g031826mg [Citrus sinensis]
Length=152

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 48/89 (54%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            MR   G  G  +GL +RI QC+F+  S   M     F   T+F  L   MG+  +WS  L
Sbjct  1    MRVFAGTPGTATGLFLRIAQCIFAAGSIASMASTHSFFNFTAFCYLIAAMGLQVIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + +D ++I+ ++  HS  L+ L  +GDWV
Sbjct  61   ALIDAYAIVQKKVLHSPVLISLFVVGDWV  89



>emb|CDY35509.1| BnaA01g24030D [Brassica napus]
Length=152

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M D+ G  G  +GL++RI QCVF+ AS   MV +  F   TSF  L   MG+  +WS  L
Sbjct  1    MIDIPGTPGTLTGLVLRICQCVFAAASISYMVTSGGFFSYTSFCYLIAAMGLQVIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + +D  ++  +++  S  L+ L  +GDWV
Sbjct  61   AIIDTFALARKKKLVSPVLISLFVVGDWV  89



>ref|XP_011099255.1| PREDICTED: CASP-like protein 5C1 [Sesamum indicum]
Length=151

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M +L G LG    L +R+ Q +F++ S   M L   F   T+F  L  +MG++  WSL+L
Sbjct  1    MEELPGALGTSGSLALRLGQAIFAVGSLLFMCLDVEFYSYTAFCFLVTIMGLVIPWSLTL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWVLQF  61
            + +D  S+  RR      +L ++ +GDWVL F
Sbjct  61   AVVDVFSVFIRRPSRQRGILSIVVLGDWVLSF  92



>ref|XP_007009208.1| CASP-like protein, putative isoform 1 [Theobroma cacao]
 gb|EOY18018.1| CASP-like protein, putative isoform 1 [Theobroma cacao]
Length=200

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 56/134 (42%), Gaps = 48/134 (36%)
 Frame = -3

Query  327  LFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFW--------C----------  202
            LFG  GK SGLL+R+ QC F+ AS GVMV A  F  +T+FW        C          
Sbjct  3    LFGSPGKLSGLLLRVGQCSFAAASIGVMVSAPGFFNSTAFWKPSEDNVTCSSKNKKWGDI  62

Query  201  ------------------------------LALVMGVLFLWSLSLSCLDFHSIMFRRRGH  112
                                          L   MG+  LWS  L+CLD H++  +R   
Sbjct  63   AKMAPNRQSIIKSDEEPIVPSLAYFYIISYLIASMGLQVLWSFGLACLDLHALRSKRNLQ  122

Query  111  SVFLLVLICIGDWV  70
            +  L+ L  +GDWV
Sbjct  123  NPILVSLFVVGDWV  136



>ref|XP_003632021.1| PREDICTED: CASP-like protein 5B3 isoform X2 [Vitis vinifera]
Length=124

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 50/88 (57%), Gaps = 0/88 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+D  G  G  +GL++RI QC+F+  S   M   S F   T+F  L   MG+  +WS  L
Sbjct  1    MKDFPGTPGTWTGLILRISQCMFAAGSIASMATTSSFFSVTAFCYLIASMGLQVIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDW  73
            + LD ++++ ++  H+  L+ L  +GDW
Sbjct  61   AFLDAYALVKKKVLHNPVLVSLFVVGDW  88



>ref|XP_003635083.1| PREDICTED: CASP-like protein 5C1 [Vitis vinifera]
 emb|CBI38359.3| unnamed protein product [Vitis vinifera]
Length=152

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 54/92 (59%), Gaps = 0/92 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M +L G LG  + L +R+ Q +FS A+   M L   F   T+F  L  VMG++  WSL+L
Sbjct  1    MDELPGALGTSASLSLRMGQTIFSSAALLFMCLDVEFYSYTAFCFLVTVMGLVIPWSLTL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWVLQF  61
            S +D +S+  +   H   +++++ IGDWVL F
Sbjct  61   SLVDAYSVFVKCPLHQPGIMLVVIIGDWVLSF  92



>ref|XP_006410900.1| hypothetical protein EUTSA_v10017298mg [Eutrema salsugineum]
 gb|ESQ52353.1| hypothetical protein EUTSA_v10017298mg [Eutrema salsugineum]
Length=180

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 56/99 (57%), Gaps = 0/99 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+D+ G  G   GL++R+ Q V +L S  VMV  S F   T+F CL L +G+  +WSLS
Sbjct  30   RMKDVQGMPGTTGGLILRLSQFVPALISVSVMVTTSDFRSATAFCCLVLAVGLQSMWSLS  89

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWVLQFPYFLYA  43
            L  +D ++++ RR   + F++    +GD +     F  A
Sbjct  90   LFVIDAYALLVRRSLRNHFVVQCFTVGDGITSTLTFAAA  128



>ref|XP_007016754.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
 gb|EOY34373.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
Length=151

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 50/88 (57%), Gaps = 0/88 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+D  G  G P GL +RI Q VF++A   VM   S F   T+F  L    G+  LWSLS
Sbjct  39   RMKDTRGMPGTPGGLALRICQFVFAVAGLCVMATTSDFPSVTAFCYLVAATGLQSLWSLS  98

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGD  76
            L+ +D ++++ RR   +  ++ L  +GD
Sbjct  99   LAIIDIYALLVRRSLQNYRVVTLFTLGD  126



>ref|NP_001136586.1| CASP-like protein 5B1 [Zea mays]
 gb|ACF82224.1| unknown [Zea mays]
 tpg|DAA56848.1| TPA: hypothetical protein ZEAMMB73_892603 [Zea mays]
Length=102

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 51/102 (50%), Gaps = 1/102 (1%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M ++ G  G   GL +R  Q VF+ AS   M  A  F   T+F  L   MG+  LWSL L
Sbjct  1    MTEVAGRPGTSGGLALRAGQFVFAAASICAMASAPGFTNYTAFCYLVASMGLQALWSLGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWVLQF-PYFLYARTH  34
             CLD++++  RR      L+ L  +GD V    P F++   H
Sbjct  61   GCLDYYALTLRRDLQQALLMSLFVVGDCVNYLRPPFIHVVHH  102



>ref|XP_009108147.1| PREDICTED: CASP-like protein At3g23200 [Brassica rapa]
Length=152

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 50/89 (56%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M D+ G  G  +GL++RI QCVF+ AS   MV +  F   TSF  L   MG+  +WS  L
Sbjct  1    MIDIPGTPGTLTGLVLRICQCVFAAASISYMVTSGGFFSYTSFCYLIAAMGLQVIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD  ++  ++   S  L+ L  +GDWV
Sbjct  61   AILDTFALARKKTLVSPVLISLFVVGDWV  89



>ref|XP_009759928.1| PREDICTED: CASP-like protein ARALYDRAFT_485429 [Nicotiana sylvestris]
Length=152

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M ++ G LG  + L +R+ Q +FS+AS   M L   F   TSF  L  VMG++  WSL+L
Sbjct  1    MDEIPGALGTSASLALRLGQSLFSVASLLFMCLDVAFYSYTSFCFLVTVMGLVISWSLTL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWVLQF  61
            + +D  S+  +R      ++ ++ +GDWVL F
Sbjct  61   AMVDAFSVFIKRPSRQPGIISVVVLGDWVLSF  92



>ref|XP_010671058.1| PREDICTED: CASP-like protein 5B3 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=165

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 49/90 (54%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            KM+D  G  G  +GL +RI Q +F+  S   M   S F   T+F  L   MG+  +WS  
Sbjct  13   KMKDFAGTPGTLTGLALRIAQFMFAAGSIASMATTSSFFNFTAFCYLIASMGLQVIWSFG  72

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            L+ +D +++  +R  H+  L+ L  IGDWV
Sbjct  73   LALMDAYALAKKRVLHNPILVSLFVIGDWV  102



>ref|XP_007016753.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY34372.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=190

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 51/90 (57%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+D  G  G P GL +RI Q VF++A   VM   S F   T+F  L    G+  LWSLS
Sbjct  39   RMKDTRGMPGTPGGLALRICQFVFAVAGLCVMATTSDFPSVTAFCYLVAATGLQSLWSLS  98

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            L+ +D ++++ RR   +  ++ L  +GD +
Sbjct  99   LAIIDIYALLVRRSLQNYRVVTLFTLGDGI  128



>ref|XP_004141947.1| PREDICTED: CASP-like protein At3g50810-like [Cucumis sativus]
 ref|XP_004160492.1| PREDICTED: CASP-like protein At3g50810-like [Cucumis sativus]
 ref|XP_008440180.1| PREDICTED: CASP-like protein ARALYDRAFT_485429 [Cucumis melo]
 gb|KGN48463.1| hypothetical protein Csa_6G488330 [Cucumis sativus]
Length=152

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 50/92 (54%), Gaps = 0/92 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M +L G LG  + L +R+ Q +F+ AS   M L   F   T+F  L  VMG++  WSL+L
Sbjct  1    MEELPGALGTSASLALRLGQAIFASASLFFMCLEIEFYSYTAFCYLVTVMGLMVPWSLTL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWVLQF  61
            + +D +S+  R       +  +I  GDWVL F
Sbjct  61   AVVDGYSVFVRHLPPQTRVTSIIVTGDWVLSF  92



>ref|XP_009604682.1| PREDICTED: CASP-like protein ARALYDRAFT_485429 [Nicotiana tomentosiformis]
Length=152

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M ++ G LG  + L +R+ Q +FS+AS   M L   F   TSF  L  VMG++  WSL+L
Sbjct  1    MDEVPGALGTSASLALRLGQSLFSVASLLFMCLDVAFYSYTSFCFLVTVMGLVISWSLTL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWVLQF  61
            + +D  S+  +R      ++ ++ +GDWVL F
Sbjct  61   AMVDAFSVFIKRPSRQPGIISVVVLGDWVLSF  92



>emb|CDP02429.1| unnamed protein product [Coffea canephora]
Length=152

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M +L G LG  + L +R+ Q +FS+AS   M L   F   T+F  L  +MG++  WSL+L
Sbjct  1    MDELPGALGTSASLALRLGQAIFSIASLLFMCLDVEFYSYTAFCFLVTIMGLVIPWSLTL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWVLQF  61
            + +D  S+  +R      ++ ++ +GDWVL F
Sbjct  61   AMVDAFSVFVKRPSRQPGIMSIVVMGDWVLCF  92



>emb|CDY08982.1| BnaC01g31090D [Brassica napus]
Length=152

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 50/89 (56%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M D+ G  G  +GL++RI QCVF+ AS   MV +  F   TSF  L   MG+  +WS  L
Sbjct  1    MIDIPGTPGTLTGLVLRICQCVFAAASISYMVTSGGFFSYTSFCYLIAAMGLQVIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + +D  ++  ++   S  L+ L  +GDWV
Sbjct  61   AIIDTFALARKKTLVSPVLISLFVVGDWV  89



>ref|XP_006654505.1| PREDICTED: CASP-like protein Os05g0456500-like [Oryza brachyantha]
Length=154

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 47/81 (58%), Gaps = 0/81 (0%)
 Frame = -3

Query  312  GKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSLSCLDFHSI  133
            G   GL +R+ Q  F+ AS GVM   + F   T+F  L   MG+  LWSL L+CLD +++
Sbjct  9    GTWGGLAMRVGQVAFAGASIGVMASGTGFANYTAFCYLIASMGLQSLWSLGLACLDVYAL  68

Query  132  MFRRRGHSVFLLVLICIGDWV  70
              +R  ++  L+ L  IGDWV
Sbjct  69   TVKRDLNNALLVSLFVIGDWV  89



>ref|XP_004171998.1| PREDICTED: CASP-like protein At3g23200-like, partial [Cucumis 
sativus]
Length=101

 Score = 56.6 bits (135),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+D  G  G  +GL++RILQCVF+ AS   M   +YF + T+F  L   +G+   WS  L
Sbjct  1    MKDFPGTPGTVTGLILRILQCVFAAASVASMASTAYFFKFTAFCYLIASLGLQITWSFML  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + +D ++++  +   S  L+ L  +GDW+
Sbjct  61   ALIDAYALVRNKALQSTVLVSLFVVGDWI  89



>ref|NP_001055732.1| Os05g0456500 [Oryza sativa Japonica Group]
 sp|Q0DHM7.1|CSPLS_ORYSJ RecName: Full=CASP-like protein 5B2; Short=OsCASPL5B2 [Oryza 
sativa Japonica Group]
 sp|B8AYU8.1|CSPLS_ORYSI RecName: Full=CASP-like protein 5B2; Short=OsCASPL5B2 [Oryza 
sativa Indica Group]
 dbj|BAF17646.1| Os05g0456500 [Oryza sativa Japonica Group]
 gb|EEC79339.1| hypothetical protein OsI_20198 [Oryza sativa Indica Group]
 gb|EEE63962.1| hypothetical protein OsJ_18787 [Oryza sativa Japonica Group]
Length=155

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 47/81 (58%), Gaps = 0/81 (0%)
 Frame = -3

Query  312  GKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSLSCLDFHSI  133
            G   GL +R+ Q  F+ AS GVM   + F   T+F  L   MG+  LWSL L+CLD +++
Sbjct  10   GTWGGLAMRVGQVAFAGASIGVMASGAGFANYTAFCYLIASMGLQSLWSLGLACLDVYAL  69

Query  132  MFRRRGHSVFLLVLICIGDWV  70
              +R  ++  L+ L  IGDWV
Sbjct  70   TVKRDLNNALLVSLFVIGDWV  90



>ref|XP_007206066.1| hypothetical protein PRUPE_ppa012758mg [Prunus persica]
 gb|EMJ07265.1| hypothetical protein PRUPE_ppa012758mg [Prunus persica]
Length=155

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 52/91 (57%), Gaps = 4/91 (4%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAG--VMVLASYFIRNTSFWCLALVMGVLFLWSL  163
            M++L G  G  SGLL+RI Q  FS AS    VMV    F   T+F  L   MG+  LWSL
Sbjct  1    MKELIGRPGSVSGLLLRIGQ--FSCASIAISVMVTTDGFATFTAFCYLIASMGLQLLWSL  58

Query  162  SLSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
             L+CLD +++  +R   +  L+ L  +GDWV
Sbjct  59   GLACLDIYALWKKRDLQNPILVSLFVVGDWV  89



>ref|XP_008240492.1| PREDICTED: CASP-like protein At3g53850 [Prunus mume]
Length=155

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 52/91 (57%), Gaps = 4/91 (4%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAG--VMVLASYFIRNTSFWCLALVMGVLFLWSL  163
            M++L G  G  SGLL+RI Q  FS AS    VMV    F   T+F  L   MG+  LWSL
Sbjct  1    MKELIGRPGSVSGLLLRIGQ--FSCASIAISVMVTTDGFATFTAFCYLIASMGLQLLWSL  58

Query  162  SLSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
             L+CLD +++  +R   +  L+ L  +GDWV
Sbjct  59   GLACLDIYALWKKRDLQNPILVSLFVVGDWV  89



>ref|XP_010274801.1| PREDICTED: CASP-like protein 5B3 isoform X2 [Nelumbo nucifera]
Length=162

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 56/90 (62%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            KM+DL G  G  +GL++RI QC+F++ S   M  AS F  +T+F  L   MG+  +WS  
Sbjct  26   KMKDLPGTPGTLTGLILRISQCLFAVGSIISMATASTFFNSTAFCYLIASMGLQVIWSFG  85

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            L+ LD +++  ++  H++ L+ L  +GDWV
Sbjct  86   LALLDAYALARKKILHNIILVSLFVVGDWV  115



>gb|EYU25980.1| hypothetical protein MIMGU_mgv1a021907mg [Erythranthe guttata]
Length=152

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M++  G  G  +GL++R+ QC+F+  S   M   + F   T+F  L   MG+  +WS  L
Sbjct  1    MKNFPGTPGTWTGLILRMAQCLFAAGSIASMATTTSFFNYTAFCYLIASMGLQVIWSCGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + +D +S++ ++  HS  L+ L  +GDWV
Sbjct  61   ALMDAYSLLRKKVLHSPALVSLFLVGDWV  89



>ref|XP_008672253.1| PREDICTED: CASP-like protein 14 isoform X1 [Zea mays]
 sp|B6TM88.1|CSPLJ_MAIZE RecName: Full=CASP-like protein 5B1; Short=ZmCASPL5B1 [Zea mays]
 gb|ACG38221.1| hypothetical protein [Zea mays]
 tpg|DAA56847.1| TPA: hypothetical protein ZEAMMB73_892603 [Zea mays]
Length=154

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 46/89 (52%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M ++ G  G   GL +R  Q VF+ AS   M  A  F   T+F  L   MG+  LWSL L
Sbjct  1    MTEVAGRPGTSGGLALRAGQFVFAAASICAMASAPGFTNYTAFCYLVASMGLQALWSLGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
             CLD++++  RR      L+ L  +GD V
Sbjct  61   GCLDYYALTLRRDLQQALLMSLFVVGDCV  89



>ref|XP_010274800.1| PREDICTED: CASP-like protein 5B3 isoform X1 [Nelumbo nucifera]
Length=177

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 56/90 (62%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            KM+DL G  G  +GL++RI QC+F++ S   M  AS F  +T+F  L   MG+  +WS  
Sbjct  26   KMKDLPGTPGTLTGLILRISQCLFAVGSIISMATASTFFNSTAFCYLIASMGLQVIWSFG  85

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            L+ LD +++  ++  H++ L+ L  +GDWV
Sbjct  86   LALLDAYALARKKILHNIILVSLFVVGDWV  115



>ref|XP_009392234.1| PREDICTED: CASP-like protein Os03g0206600 [Musa acuminata subsp. 
malaccensis]
Length=178

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 53/90 (59%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+D+ G  G P GL +R+ Q  F++A+ GVMV  S F   T+F  L   + +  LWS+S
Sbjct  27   RMKDIQGMPGTPGGLALRLFQFAFAVAALGVMVSTSDFASVTAFCYLVAAVILQCLWSIS  86

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            L+ LD ++++ +R   +   L L  IGD +
Sbjct  87   LAFLDIYALLVKRSLRNSRALCLFTIGDGI  116



>ref|XP_009367068.1| PREDICTED: CASP-like protein At2g28370 [Pyrus x bretschneideri]
Length=179

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 51/90 (57%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+DL G  G P GL++R+ Q +FS AS  VM   S F   T+F  L    G+  LWS S
Sbjct  28   RMKDLPGMPGTPGGLVLRLAQFLFSAASLVVMATTSDFPSVTAFCYLVAATGLQCLWSFS  87

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            L  +D ++++ RR   +  ++ L  +GD V
Sbjct  88   LGIVDVYALLVRRSLQNHRVVCLFTLGDGV  117



>ref|XP_010553051.1| PREDICTED: CASP-like protein 5B1 [Tarenaya hassleriana]
Length=149

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = -3

Query  327  LFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSLSCL  148
            + G  G  SGL++R+ QC  + AS GVM+    F   T+F  L   M +  +WS  L+CL
Sbjct  1    MIGSPGTMSGLILRLGQCASAAASIGVMISTFGFSSYTAFCFLVASMSLQLIWSFGLACL  60

Query  147  DFHSIMFRRRGHSVFLLVLICIGDWV  70
            D ++I  +    S+ LL L  +GDWV
Sbjct  61   DVYAIRRKTDLRSLILLSLFAVGDWV  86



>gb|KHG22577.1| hypothetical protein F383_29148 [Gossypium arboreum]
Length=152

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M  + G LG  + L +R+ Q VFS AS   M L   F   TSF  L  VMG++  WS+SL
Sbjct  1    MEAVPGALGTSASLALRLGQTVFSAASLLFMCLDVEFYSYTSFSYLVTVMGLVTPWSVSL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWVLQF  61
            + +D +S+  +       +L+++ +GDW L F
Sbjct  61   ALVDAYSVFVKGLPRQPRVLLVVIVGDWALSF  92



>ref|XP_002519533.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42947.1| conserved hypothetical protein [Ricinus communis]
Length=179

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 53/99 (54%), Gaps = 0/99 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+++ G  G   GL +RI Q VF +AS  VM   S F   T+F  L + + +  LWSLS
Sbjct  28   RMKEVQGMPGTHGGLTLRIGQLVFGIASVSVMASTSDFRSVTAFCYLVIAVSLQILWSLS  87

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWVLQFPYFLYA  43
            L+ LD ++++ RR      L+ L  IGD +     F  A
Sbjct  88   LAILDVYALLVRRSLRKRILIRLFAIGDGITSTLTFAAA  126



>ref|XP_006406066.1| hypothetical protein EUTSA_v10021696mg [Eutrema salsugineum]
 gb|ESQ47519.1| hypothetical protein EUTSA_v10021696mg [Eutrema salsugineum]
Length=152

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 50/89 (56%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M D+ G  G  +GLL+RI QCVF+  S   MV +  F   T+F  L   MG+  +WS  L
Sbjct  1    MIDIPGTPGTLTGLLLRISQCVFAAGSISYMVTSGGFFSFTAFCYLIAAMGLQLIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD  +++ ++   S  L+ L  +GDWV
Sbjct  61   AILDTFALVRKKTLLSPVLVSLFVVGDWV  89



>ref|XP_010023975.1| PREDICTED: CASP-like protein 5B3 isoform X1 [Eucalyptus grandis]
 ref|XP_010023976.1| PREDICTED: CASP-like protein 5B3 isoform X1 [Eucalyptus grandis]
 gb|KCW60379.1| hypothetical protein EUGRSUZ_H03094 [Eucalyptus grandis]
Length=152

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 46/89 (52%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            MRD  G  G  +GL +R+ Q VF+  S   M     F   T+F  L   MG+  +WS  L
Sbjct  1    MRDFAGTPGTLTGLALRVSQFVFAAGSIASMATTDSFFEFTAFCYLIASMGLQLVWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD ++I  ++  H   L+ L  +GDWV
Sbjct  61   AILDAYAIFKKKVLHGPVLVSLFVVGDWV  89



>emb|CAN61826.1| hypothetical protein VITISV_027628 [Vitis vinifera]
Length=688

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 54/92 (59%), Gaps = 0/92 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M +L G LG  + L +R+ Q +FS A+   M L   F   T+F  L  VMG++  WSL+L
Sbjct  1    MDELPGALGTSASLSLRMGQTIFSSAALLFMCLDVEFYSYTAFCFLVTVMGLVIPWSLTL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWVLQF  61
            S +D +S+  +   H   +++++ IGDWVL F
Sbjct  61   SLVDAYSVFVKCPLHQPGIMLVVIIGDWVLSF  92



>gb|KHG22616.1| hypothetical protein F383_03339 [Gossypium arboreum]
Length=152

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 50/89 (56%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            MR + G  G  + L +RI+QCVF+  S   M   S F   T+F  L   MG+  +WS +L
Sbjct  1    MRAIPGSPGTLTSLFLRIMQCVFAAGSIASMSTTSNFFNFTAFCYLIASMGLQVVWSFAL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD  +++ ++  H+  L+ L  +GDWV
Sbjct  61   AILDGIALVKKKVLHNPVLVSLYVVGDWV  89



>ref|XP_004134071.1| PREDICTED: CASP-like protein At3g23200-like [Cucumis sativus]
 gb|KGN56870.1| hypothetical protein Csa_3G135670 [Cucumis sativus]
Length=152

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+D  G  G  +GL++RILQCVF+ AS   M   +YF + T+F  L   +G+   WS  L
Sbjct  1    MKDFPGTPGTVTGLILRILQCVFAAASVASMASTAYFFKFTAFCYLIASLGLQITWSFML  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + +D ++++  +   S  L+ L  +GDW+
Sbjct  61   ALIDAYALVRNKALQSTVLVSLFVVGDWI  89



>emb|CDM85017.1| unnamed protein product [Triticum aestivum]
Length=153

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 51/87 (59%), Gaps = 0/87 (0%)
 Frame = -3

Query  330  DLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSLSC  151
            +L G  G  SGL +R+ Q +F+ AS  VM  A  F   T+F  L   MG+  LWSL L+C
Sbjct  2    ELSGSPGTWSGLSLRLGQFLFAAASVCVMSSAIGFANYTAFCYLIASMGLQALWSLGLAC  61

Query  150  LDFHSIMFRRRGHSVFLLVLICIGDWV  70
            LD +++  ++  +S  L+ L  +GDWV
Sbjct  62   LDGYALRMKKELNSAVLVSLFVVGDWV  88



>ref|XP_011091200.1| PREDICTED: CASP-like protein 5B3 isoform X1 [Sesamum indicum]
 ref|XP_011091201.1| PREDICTED: CASP-like protein 5B3 isoform X1 [Sesamum indicum]
 ref|XP_011091202.1| PREDICTED: CASP-like protein 5B3 isoform X1 [Sesamum indicum]
 ref|XP_011091203.1| PREDICTED: CASP-like protein 5B3 isoform X1 [Sesamum indicum]
 ref|XP_011091204.1| PREDICTED: CASP-like protein 5B3 isoform X1 [Sesamum indicum]
Length=152

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 50/89 (56%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M++  G  G  +GL++R+ QC+F+  S   M     F   T+F  L   MG+  +WS  L
Sbjct  1    MKNFAGAPGTWTGLVLRMAQCLFAAGSIASMATTKTFFSYTAFCFLIASMGLQVIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + +D ++++ ++  H+  L+ L  +GDWV
Sbjct  61   AFMDAYALLTKKVLHNPVLVSLFVVGDWV  89



>ref|XP_004142183.1| PREDICTED: CASP-like protein At3g23200-like [Cucumis sativus]
 ref|XP_004166055.1| PREDICTED: CASP-like protein At3g23200-like [Cucumis sativus]
 gb|KGN61613.1| hypothetical protein Csa_2G179230 [Cucumis sativus]
Length=152

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 50/89 (56%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M D  G  G  +G ++RILQCVF+  S   M  +  F   T+F  +   MG+   WSL L
Sbjct  1    MLDFPGTPGTLTGFVLRILQCVFAAGSIASMATSIGFYNFTAFCYVIASMGLQVTWSLML  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD ++++ ++  H+  L+ L  +GDWV
Sbjct  61   ALLDAYALVRKKMLHNPILVSLFVVGDWV  89



>dbj|BAJ92579.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96605.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=153

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 51/87 (59%), Gaps = 0/87 (0%)
 Frame = -3

Query  330  DLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSLSC  151
            +L G  G  SGL +R+ Q +F+ AS  VM  A  F   T+F  L   MG+  LWSL L+C
Sbjct  2    ELSGSPGTWSGLSLRLGQFLFAAASVCVMSSAIGFANYTAFCYLIASMGLQALWSLGLAC  61

Query  150  LDFHSIMFRRRGHSVFLLVLICIGDWV  70
            LD +++  ++  +S  L+ L  +GDWV
Sbjct  62   LDGYALRMKKELNSAVLVSLFVVGDWV  88



>ref|XP_010689546.1| PREDICTED: CASP-like protein 5A2 [Beta vulgaris subsp. vulgaris]
Length=179

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 50/90 (56%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+DL G  G P GL++R+ Q  F++ +  +M   S F   T+F  L    G+  +WSLS
Sbjct  28   RMKDLQGMAGTPGGLVLRLFQSFFAIGALLIMSTTSDFPSVTAFRYLVAASGLQIIWSLS  87

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            L+ LD ++I+ +RR  +   +     GD +
Sbjct  88   LAVLDIYAILVKRRFRNHQAVSFFAAGDGI  117



>sp|P0DI71.1|CSPL3_GINBI RecName: Full=CASP-like protein 5B1; Short=GbCASPL5B1 [Ginkgo 
biloba]
Length=178

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 50/90 (56%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
             M++L G  G   GL +R+ Q +F+ A+  +MV    F   T+F  L   M + FLWS  
Sbjct  27   TMKELPGMPGTIGGLALRVGQFLFAAAAIVIMVTGDEFTNYTAFCYLVAAMSLQFLWSFM  86

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            L+ LD ++++ +R   +  LL L  +GDWV
Sbjct  87   LAILDTYALLIKRGLRNSVLLSLFVVGDWV  116



>ref|XP_002881495.1| hypothetical protein ARALYDRAFT_902856 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57754.1| hypothetical protein ARALYDRAFT_902856 [Arabidopsis lyrata subsp. 
lyrata]
Length=180

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 56/101 (55%), Gaps = 4/101 (4%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+D+ G  G   GL++R+ Q V +L S  VMV  S F   T+F CL L + +  +WSLS
Sbjct  30   RMKDVQGMPGTTGGLILRLSQFVPALISVSVMVTTSDFRSATAFCCLVLAVSLQSMWSLS  89

Query  159  LSCLDFHSIMFRR--RGHSVFLLVLICIGDWVLQFPYFLYA  43
            L  +D ++++ RR  R HSV  +    IGD V     F  A
Sbjct  90   LFLVDAYALLVRRSLRNHSV--VQCFTIGDGVTSTLTFAAA  128



>ref|XP_011030518.1| PREDICTED: CASP-like protein 5B3 isoform X2 [Populus euphratica]
Length=133

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            MRD  G  G  +GL +R+ QCVF+  S   M   + F  +TSF  L   MG+  +WS  L
Sbjct  1    MRDFAGAPGTLTGLALRLSQCVFAAGSIAAMTTTTNFFNSTSFCYLIASMGLQIIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD ++++ +R  H+  LL L  +GDWV
Sbjct  61   TLLDAYALVRKRTLHNTVLLSLFVVGDWV  89



>gb|KHG25126.1| hypothetical protein F383_04856 [Gossypium arboreum]
Length=178

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 52/90 (58%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+D+ G  G   GL +R+ Q +FS+ S  VM   + F   T+F  L L +G+  LWSLS
Sbjct  27   RMKDIQGMPGTKGGLFLRLSQFIFSIISVSVMATTNDFRSATAFCYLVLAVGLQSLWSLS  86

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            L+ +D ++++ +R   +   + L  IGD +
Sbjct  87   LAFVDMYALLVKRSLRNYLAIRLFTIGDGI  116



>ref|XP_010466636.1| PREDICTED: CASP-like protein 5B3 [Camelina sativa]
Length=152

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M D+ G  G  +GL++RI QCVF+  S   MV +  F   T+F  L   MG+  +WS  L
Sbjct  1    MIDIPGTPGTVTGLVLRISQCVFAAGSISYMVTSGGFFSFTAFCYLVAAMGLQVIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD  +++ ++   S  L+ L  +GDWV
Sbjct  61   AILDTFALVRKKTLLSPVLVSLFVVGDWV  89



>ref|XP_010512170.1| PREDICTED: CASP-like protein 5B3 [Camelina sativa]
Length=152

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M D+ G  G  +GL++RI QCVF+  S   MV +  F   T+F  L   MG+  +WS  L
Sbjct  1    MIDIPGTPGTVTGLVLRISQCVFAAGSISYMVTSGGFFSFTAFCYLVAAMGLQVIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD  +++ ++   S  L+ L  +GDWV
Sbjct  61   AILDTFALVRKKTLLSPVLVSLFVVGDWV  89



>ref|XP_009775130.1| PREDICTED: CASP-like protein 5B3 [Nicotiana sylvestris]
Length=152

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 47/88 (53%), Gaps = 0/88 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            MRD  G  G  +GL +R+ QC F+  S   MV +  F   T+F  L   M +  +WS+ L
Sbjct  1    MRDFAGTPGTLTGLFLRMAQCFFAAGSIASMVTSKNFFNVTAFCYLIASMALQVIWSIGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDW  73
            + LD + +  ++  H+  LL L  +GDW
Sbjct  61   AFLDAYFLAKKKAFHNHVLLSLFVVGDW  88



>ref|XP_006338260.1| PREDICTED: CASP-like protein Os03g0767900-like [Solanum tuberosum]
Length=154

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M +L G LG    L +R+ Q +FS+AS   M     F   T+F  L  VMG+L  WSL+L
Sbjct  1    MDELPGALGSSGSLALRLGQAIFSVASLLFMCFDIPFYSYTAFCYLVTVMGLLMAWSLTL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWVLQF  61
            + +D  S++ +       ++ L+ +GDWVL F
Sbjct  61   AMVDAFSVLIKLPTRLPGIISLVVLGDWVLSF  92



>ref|XP_011030517.1| PREDICTED: CASP-like protein 5B3 isoform X1 [Populus euphratica]
Length=152

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            MRD  G  G  +GL +R+ QCVF+  S   M   + F  +TSF  L   MG+  +WS  L
Sbjct  1    MRDFAGAPGTLTGLALRLSQCVFAAGSIAAMTTTTNFFNSTSFCYLIASMGLQIIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD ++++ +R  H+  LL L  +GDWV
Sbjct  61   TLLDAYALVRKRTLHNTVLLSLFVVGDWV  89



>ref|XP_002315710.1| hypothetical protein POPTR_0010s08370g [Populus trichocarpa]
 gb|EEF01881.1| hypothetical protein POPTR_0010s08370g [Populus trichocarpa]
Length=152

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            MRD  G  G  +GL +R+ QCVF+  S   M   + F  +TSF  L   MG+  +WS  L
Sbjct  1    MRDFAGAPGTLTGLALRLSQCVFAAGSIAAMTTTTNFFNSTSFCYLIASMGLQIIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD ++++ +R  H+  LL L  +GDWV
Sbjct  61   TLLDAYALVRKRTLHNTVLLSLFVVGDWV  89



>gb|ACU20608.1| unknown [Glycine max]
Length=152

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 48/89 (54%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+D  G  G   GL +RI Q VF+  S   M     F   T+F  L   MG+L +WS  L
Sbjct  1    MKDFPGTPGTGLGLALRISQFVFAAGSIASMATTPSFFNFTAFCYLIASMGLLVIWSFVL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD ++++ ++  H+  L+ L  +GDWV
Sbjct  61   ALLDAYALVKKKVLHNAVLVSLFVVGDWV  89



>ref|XP_003556350.1| PREDICTED: CASP-like protein At3g23200-like [Glycine max]
Length=152

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 48/89 (54%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+D  G  G   GL +RI Q VF+  S   M     F   T+F  L   MG+L +WS  L
Sbjct  1    MKDFPGTPGTGLGLALRISQFVFAAGSIASMATTPSFFNFTAFCYLIASMGLLVIWSFVL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD ++++ ++  H+  L+ L  +GDWV
Sbjct  61   ALLDAYALVKKKVLHNAVLVSLFVVGDWV  89



>ref|XP_010488367.1| PREDICTED: CASP-like protein 5B3 [Camelina sativa]
Length=152

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M D+ G  G  +GL++RI QCVF+  S   MV +  F   T+F  L   MG+  +WS  L
Sbjct  1    MIDIPGTPGTVTGLVLRISQCVFAAGSISYMVTSGGFFSFTAFCYLIAAMGLQVIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD  +++ ++   S  L+ L  +GDWV
Sbjct  61   AILDTFALVRKKTLLSPVLVSLFVVGDWV  89



>ref|XP_008807384.1| PREDICTED: CASP-like protein 1 [Phoenix dactylifera]
Length=178

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 52/90 (58%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+D+ G  G P GL +R+ Q +F+ A+  VM   S F   T+F  L   + +  LWSLS
Sbjct  27   RMKDIQGMPGTPGGLALRLCQFIFAAAALSVMASTSDFTSVTAFCYLVAAVILQSLWSLS  86

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            L+ LD ++++ +RR  +   + L  IGD +
Sbjct  87   LAFLDIYALLVKRRLRNSRAVCLFTIGDAI  116



>ref|XP_010087817.1| hypothetical protein L484_000635 [Morus notabilis]
 gb|EXB30188.1| hypothetical protein L484_000635 [Morus notabilis]
Length=186

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 50/90 (56%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+D+ G  G PSGL +R+ Q  FS  +  VM   S F   T+F  L +   +  +WSLS
Sbjct  35   RMKDVQGMPGTPSGLALRLFQFAFSAVALSVMASTSDFPSVTAFRYLVVASSLQSIWSLS  94

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            L+ +D ++I+ +R   +  +  L  +GD +
Sbjct  95   LAIVDVYAILVKRSLRNFRVATLFAVGDGI  124



>gb|EYU44324.1| hypothetical protein MIMGU_mgv1a015618mg [Erythranthe guttata]
Length=151

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 50/89 (56%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M +L G LG  + L +R+ Q +F++AS   M L   F   T+F  L  VMG++  WSL+L
Sbjct  1    MEELPGTLGTSASLALRLGQAIFAVASLLFMCLDVEFYSYTAFCFLVTVMGLVVPWSLTL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + +D  S+  +       ++ ++ IGDWV
Sbjct  61   AVVDIFSVFIKNPARQRGIISIVVIGDWV  89



>ref|XP_007035081.1| CASP-like protein, putative [Theobroma cacao]
 gb|EOY06007.1| CASP-like protein, putative [Theobroma cacao]
Length=165

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 47/89 (53%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            MR   G  G  + L +R+ QCVF+  S   M   S F   T+F  L   MG+  +WS  L
Sbjct  1    MRVFPGSPGTLTSLFLRVAQCVFAAGSIASMATTSSFFNFTAFCYLIASMGLQAVWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD  +++ R+  HS  L+ L  +GDWV
Sbjct  61   ALLDGIALVKRKVLHSPVLVSLFVVGDWV  89



>ref|XP_006349490.1| PREDICTED: CASP-like protein At3g53850-like [Solanum tuberosum]
Length=171

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+ L G  G  SGLL+R+ QC+ +  S G+MV AS F   T+F  L   MG+  LWS  
Sbjct  17   RMKHLVGSPGTVSGLLLRLGQCLLAAGSIGIMVSASGFSNYTAFCYLIASMGLQVLWSSG  76

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            L+CLD +++  +R   +  L+ L  +GDWV
Sbjct  77   LACLDIYALRIKRDLQNPVLVSLFVVGDWV  106



>ref|XP_002883411.1| hypothetical protein ARALYDRAFT_898831 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59670.1| hypothetical protein ARALYDRAFT_898831 [Arabidopsis lyrata subsp. 
lyrata]
Length=152

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M D+ G  G  +GL++RI QCVF+  S   MV +  F   T+F  L   MG+  +WS  L
Sbjct  1    MIDIPGTPGTLTGLVLRISQCVFAAGSISYMVTSGGFFSFTAFCYLIAAMGLQVIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD  +++ ++   S  L+ L  +GDWV
Sbjct  61   AILDTFALVRKKTLLSPVLVSLFVVGDWV  89



>ref|NP_188961.2| uncharacterized protein [Arabidopsis thaliana]
 sp|Q8L7R5.1|CSPLG_ARATH RecName: Full=CASP-like protein 5B3; Short=AtCASPL5B3 [Arabidopsis 
thaliana]
 gb|AAM91511.1| ethylene responsive element binding protein, putative [Arabidopsis 
thaliana]
 gb|AAP21348.1| At3g23220 [Arabidopsis thaliana]
 gb|AEE76734.1| uncharacterized protein AT3G23200 [Arabidopsis thaliana]
Length=152

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M D+ G  G  +GL++RI QCVF+  S   MV +  F   T+F  L   MG+  +WS  L
Sbjct  1    MIDIPGTPGTLTGLVLRISQCVFAAGSISYMVTSGGFFSFTAFCYLIAAMGLQVIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD  +++ ++   S  L+ L  +GDWV
Sbjct  61   AILDTFALVRKKTLLSPVLVSLFVVGDWV  89



>ref|XP_008438541.1| PREDICTED: CASP-like protein At3g23200 [Cucumis melo]
Length=152

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+D  G  G   GL++R+LQCVF+ AS   M   +YF + T+F  L   +G+   WS  L
Sbjct  1    MKDFPGTPGTAMGLILRVLQCVFAAASIASMASTAYFFKFTAFCYLIASLGLQITWSFVL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + +D ++++  +   S  L+ L  +GDW+
Sbjct  61   ALIDAYALVRNKALQSTVLVSLFVVGDWI  89



>ref|XP_009102652.1| PREDICTED: CASP-like protein At3g23200 [Brassica rapa]
 emb|CDX77540.1| BnaA07g06780D [Brassica napus]
Length=154

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 49/87 (56%), Gaps = 0/87 (0%)
 Frame = -3

Query  330  DLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSLSC  151
            D+ G  G  +GL++RI QCVF+ AS   MV +  F   T+F  L   MG+  +WS  L+ 
Sbjct  4    DIPGTPGTFTGLVLRISQCVFAAASISYMVSSGSFFNYTAFCYLIAAMGLQVIWSFGLAI  63

Query  150  LDFHSIMFRRRGHSVFLLVLICIGDWV  70
            LD  +++ ++   S   + L  +GDWV
Sbjct  64   LDTFALVRKKTLLSPVFVSLFVVGDWV  90



>ref|XP_006296632.1| hypothetical protein CARUB_v10014835mg [Capsella rubella]
 gb|EOA29530.1| hypothetical protein CARUB_v10014835mg [Capsella rubella]
Length=152

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M D+ G  G  +GL++RI QCVF+  S   MV +  F   T+F  L   MG+  +WS  L
Sbjct  1    MIDIPGTPGTLTGLVLRISQCVFAAGSISYMVTSGGFFSFTAFCYLIAAMGLQVIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD  +++ ++   S  L+ L  +GDWV
Sbjct  61   AILDTFALVRKKTLLSPVLVSLFVVGDWV  89



>ref|XP_004232082.1| PREDICTED: CASP-like protein 5C1 [Solanum lycopersicum]
Length=154

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M +L G LG    L +R+ Q +FS+AS   M     F   T+F  L  VMG+L  WS++L
Sbjct  1    MDELPGALGSSGSLALRLGQAIFSVASLLFMCYDIPFYSYTAFCFLVTVMGLLMAWSVTL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWVLQF  61
            + +D  S++ +       +L L+ +GDWVL F
Sbjct  61   AMVDAFSVLIKLPTRLPGILSLVVLGDWVLSF  92



>ref|XP_008385321.1| PREDICTED: CASP-like protein At2g28370 [Malus domestica]
 ref|XP_008349755.1| PREDICTED: CASP-like protein At2g28370 [Malus domestica]
 ref|XP_008358304.1| PREDICTED: CASP-like protein At2g28370 [Malus domestica]
 ref|XP_008359131.1| PREDICTED: CASP-like protein At2g28370 [Malus domestica]
Length=179

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 50/90 (56%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+DL G  G P GL++R+ Q  FS A+  VM   S F   T+F  L    G+  LWS S
Sbjct  28   RMKDLPGMPGTPGGLVLRLAQFFFSAAALVVMATTSDFPSVTAFCYLVAATGLQCLWSFS  87

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            L  +D ++++ RR   +  ++ L  +GD V
Sbjct  88   LGIVDVYALLVRRSLQNHGVVCLFTLGDGV  117



>ref|XP_007047092.1| Uncharacterized protein TCM_000497 [Theobroma cacao]
 gb|EOX91249.1| Uncharacterized protein TCM_000497 [Theobroma cacao]
Length=154

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M  + G LG  + L +R+ Q +FS AS   M L   F   TSF  L  VMG++  WS+SL
Sbjct  2    MERVPGALGTSASLALRLGQTIFSSASLLFMCLDVEFYSYTSFSYLVTVMGLVTPWSVSL  61

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWVLQF  61
            + +D +S+  +       +L++I +GDW L F
Sbjct  62   ALVDAYSVFVKCLPRHPRVLLIIIVGDWALSF  93



>emb|CDX85066.1| BnaC07g08400D [Brassica napus]
Length=154

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 49/87 (56%), Gaps = 0/87 (0%)
 Frame = -3

Query  330  DLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSLSC  151
            D+ G  G  +GL++RI QCVF+ AS   MV +  F   T+F  L   MG+  +WS  L+ 
Sbjct  4    DIPGTPGTFTGLVLRISQCVFAAASISYMVSSGAFFNYTAFCYLIAAMGLQVIWSSGLAI  63

Query  150  LDFHSIMFRRRGHSVFLLVLICIGDWV  70
            LD  +++ ++   S   + L  +GDWV
Sbjct  64   LDTFALLRKKTLLSPVFVSLFVVGDWV  90



>ref|XP_004961876.1| PREDICTED: CASP-like protein 18-like [Setaria italica]
Length=154

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 48/89 (54%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M  L G  G   GL++R+ Q  F+ A  GVM  +  F   T+F  L   MG+  LWS  L
Sbjct  1    MPGLAGRPGSWGGLVLRVGQAFFAAACIGVMGSSLGFASYTAFCYLVASMGLQMLWSSGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD ++I  ++   S  LL L  +GDWV
Sbjct  61   ACLDGYAIKVKKDLTSPILLSLFVVGDWV  89



>ref|XP_002522387.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40071.1| conserved hypothetical protein [Ricinus communis]
Length=153

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 49/92 (53%), Gaps = 0/92 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M  + G +G  + L +R+ Q +FS AS   M L   F   T+F  L  VMG++  WS++L
Sbjct  2    MERVPGAMGTSASLALRLGQTIFSTASLLFMCLGIDFYSYTAFCYLVTVMGLVIPWSITL  61

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWVLQF  61
              +D + +  +   H   +L  I IGDWVL F
Sbjct  62   VLVDVYCVFVKCLPHQPKILSAIIIGDWVLSF  93



>gb|ACJ86061.1| unknown [Medicago truncatula]
 gb|AFK45687.1| unknown [Medicago truncatula]
Length=152

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M++  G  G   GL++R+ Q +F+  S G MV  + F+  T+F  L   MG+  +WS  L
Sbjct  1    MKEFPGTPGTVLGLILRMSQFIFATPSIGYMVTTTSFMDITAFCYLVAAMGLQAIWSFLL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + +D ++++ ++  H+  L+ L  +GDWV
Sbjct  61   ALMDAYAVVRKKVLHNPALVSLYLVGDWV  89



>ref|XP_004291713.1| PREDICTED: CASP-like protein At2g28370-like [Fragaria vesca subsp. 
vesca]
Length=180

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 49/88 (56%), Gaps = 0/88 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+DL G  G P+GL +R+ Q +FS A+  VM   S F   T+F  L    G+  LWS S
Sbjct  29   RMKDLPGMPGTPAGLALRLSQFLFSAAALAVMASTSDFPSVTAFCYLVAATGLQTLWSFS  88

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGD  76
            L+  D ++++  R   S  ++ L  +GD
Sbjct  89   LAIADVYALLVGRSLQSHKVVCLFTLGD  116



>dbj|BAA95733.1| unnamed protein product [Arabidopsis thaliana]
Length=162

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 53/97 (55%), Gaps = 4/97 (4%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M D+ G  G  +GL++RI QCVF+  S   MV +  F   T+F  L   MG+  +WS  L
Sbjct  1    MIDIPGTPGTLTGLVLRISQCVFAAGSISYMVTSGGFFSFTAFCYLIAAMGLQVIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDW----VLQFP  58
            + LD  +++ ++   S  L+ L  +GDW    VL+ P
Sbjct  61   AILDTFALVRKKTLLSPVLVSLFVVGDWFRSRVLEVP  97



>gb|EYU36185.1| hypothetical protein MIMGU_mgv1a014713mg [Erythranthe guttata]
Length=181

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 52/90 (58%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+D+ G  G   GL++R+ Q +F++ +  VM   S F   T+F  L    G+  LWSL+
Sbjct  30   RMKDIQGTPGTVGGLVLRVFQLLFAVVALSVMATTSDFPSVTAFCYLVAAAGLQSLWSLA  89

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            L+ +D ++++  RR  +  ++ L  IGD V
Sbjct  90   LALVDAYALLVGRRLQNPRIVSLFAIGDGV  119



>emb|CDO99216.1| unnamed protein product [Coffea canephora]
Length=152

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 45/89 (51%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+D  G  G  +  ++R+ QC F+  S   M     F   T+F  L   MG+  +WS  L
Sbjct  1    MKDFAGTPGTLTSFVLRVAQCFFAAGSITSMATTESFFNVTAFCYLIASMGLQLIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD +++  ++  H   L+ L  +GDWV
Sbjct  61   ALLDGYAMARKKIPHKPVLVSLFVVGDWV  89



>ref|XP_008369938.1| PREDICTED: CASP-like protein At3g53850 [Malus domestica]
Length=155

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 48/89 (54%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M++L G  G  SGLL+R+ Q   +  +  VMV    F   T F  L   M +  LWSL L
Sbjct  1    MKELLGRPGSVSGLLLRVSQFSCAGIAIAVMVTTDRFAEFTCFCYLVSSMALQVLWSLGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R   +  L+ L  +GDWV
Sbjct  61   ACLDIYALSKKRDLQNKLLVRLFVVGDWV  89



>ref|XP_006827495.1| hypothetical protein AMTR_s00009p00169200 [Amborella trichopoda]
 gb|ERM94911.1| hypothetical protein AMTR_s00009p00169200 [Amborella trichopoda]
Length=151

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 49/89 (55%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+D  G  G  +GL++R+ Q  F+ AS   +     F   T+F  L   MG+  LWSL L
Sbjct  1    MKDFPGTPGTLTGLMLRVGQFTFAAASIAFVATGVRFQEFTAFCYLIASMGLQVLWSLWL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD ++++  R   +  L+ L  +GDWV
Sbjct  61   ACLDAYAMLAPRDLRNPRLVSLFVVGDWV  89



>ref|XP_007027335.1| Uncharacterized protein TCM_022161 [Theobroma cacao]
 gb|EOY07837.1| Uncharacterized protein TCM_022161 [Theobroma cacao]
Length=178

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 53/90 (59%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+D+ G  G   GL +R+ Q +F++ S  VM   + F   T+F  L L +G+  LWSLS
Sbjct  27   RMKDVQGMPGTKGGLFLRLSQFMFAIISVSVMATTNDFRSATAFCYLVLAVGLQSLWSLS  86

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            L+ +D ++++ +R   +  ++ L  IGD +
Sbjct  87   LAFVDIYALLVKRSLRNNIVIRLFTIGDGI  116



>gb|KFK39608.1| hypothetical protein AALP_AA3G266000 [Arabis alpina]
Length=152

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 50/89 (56%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M ++ G  G  +GL++RI QCV ++ S   MV +  F   T+F  L   MG+  +WS  L
Sbjct  1    MIEIPGTPGTLTGLVLRITQCVLAVGSISYMVTSGGFFSYTAFCYLIAAMGLQVIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD  +++ ++   S  L+ L  +GDWV
Sbjct  61   AVLDTFALVRKKTLLSPVLVSLFVVGDWV  89



>ref|XP_008460631.1| PREDICTED: CASP-like protein At3g23200 isoform X1 [Cucumis melo]
Length=152

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 48/84 (57%), Gaps = 0/84 (0%)
 Frame = -3

Query  321  GGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSLSCLDF  142
            G  G  +G ++RILQCVF+  S   M  +  F   T+F  +   MG+   WSL L+ LD 
Sbjct  6    GTPGTLTGFVLRILQCVFAAGSIASMATSVGFYNFTAFCYVIASMGLQVTWSLMLALLDA  65

Query  141  HSIMFRRRGHSVFLLVLICIGDWV  70
            ++++ ++  H+  L+ L  +GDWV
Sbjct  66   YALVRKKMLHNPILVSLFVVGDWV  89



>ref|XP_006425777.1| hypothetical protein CICLE_v10026699mg [Citrus clementina]
 ref|XP_006466692.1| PREDICTED: CASP-like protein ARALYDRAFT_485429-like isoform X2 
[Citrus sinensis]
 gb|ESR39017.1| hypothetical protein CICLE_v10026699mg [Citrus clementina]
Length=152

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 49/92 (53%), Gaps = 0/92 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M ++ G LG  + L +R  Q +FS AS   M     F   TSF  L  VMG++  WS++L
Sbjct  1    MDEVPGALGSSASLALRFGQTIFSSASILFMSFHVEFYSYTSFCYLVTVMGLVIPWSMAL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWVLQF  61
              +D +++ F+       +++ +  GDWVL F
Sbjct  61   GLVDGYAVFFKNLPRRPRVMLFVIAGDWVLAF  92



>gb|KEH42705.1| CASP-like protein [Medicago truncatula]
Length=152

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 50/88 (57%), Gaps = 0/88 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+D  G  G   GL++R+ Q +F+  S   MV +S F   T+F  L   MG+  +WS  L
Sbjct  1    MKDFPGTPGTVLGLILRLSQFIFAAGSIAFMVSSSSFFNFTAFCYLIAAMGLQAIWSFVL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDW  73
            + +D ++++ R+  H+  L+ L  +GDW
Sbjct  61   ALMDAYAVVRRKVLHNPVLVCLYLVGDW  88



>ref|NP_001143693.1| CASP-like protein 5B2 [Zea mays]
 sp|B6TAX2.1|CSPLN_MAIZE RecName: Full=CASP-like protein 5B2; Short=ZmCASPL5B2 [Zea mays]
 gb|ACG34255.1| hypothetical protein [Zea mays]
 gb|AFW81691.1| hypothetical protein ZEAMMB73_137268, partial [Zea mays]
Length=154

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 48/89 (54%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M  L G  G   GL++R+ Q +F+ A  GVM  +  F   T+F  L   MG+  LWS  L
Sbjct  1    MAGLAGRPGSWGGLVLRVGQALFAAACIGVMGSSLGFASYTAFCYLIASMGLQMLWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD ++I   +   S  LL L  +GDWV
Sbjct  61   ACLDGYAIRANKDLTSPILLSLFVVGDWV  89



>ref|XP_003536249.1| PREDICTED: CASP-like protein At3g23200-like [Glycine max]
 gb|KHN30740.1| CASP-like protein [Glycine soja]
Length=152

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 47/89 (53%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+D  G  G   GL +RI Q VF+  S   M     F   T+F  L   MG+  +WS  L
Sbjct  1    MKDFPGTPGTVLGLALRISQFVFAAGSIASMATTPSFFNFTAFCYLIASMGLQVIWSFVL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD ++++ ++  H+  L+ L  +GDWV
Sbjct  61   ALLDAYALVKKKVLHNAVLVSLFVVGDWV  89



>ref|XP_007144099.1| hypothetical protein PHAVU_007G128700g [Phaseolus vulgaris]
 gb|ESW16093.1| hypothetical protein PHAVU_007G128700g [Phaseolus vulgaris]
Length=152

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 47/89 (53%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+D  G  G   GL +R+ Q VF+  S   M     F   T+F  L   MG+  +WS  L
Sbjct  1    MKDFHGTPGTALGLALRMSQFVFAAGSIASMATTPSFFNFTAFCYLIASMGLQVIWSFVL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD ++++ ++  H+  L+ L  +GDWV
Sbjct  61   ALLDAYALVRKKVLHNAVLVSLFVVGDWV  89



>ref|XP_002439909.1| hypothetical protein SORBIDRAFT_09g022380 [Sorghum bicolor]
 gb|EES18339.1| hypothetical protein SORBIDRAFT_09g022380 [Sorghum bicolor]
Length=154

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 49/87 (56%), Gaps = 3/87 (3%)
 Frame = -3

Query  321  GGLGKPS---GLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSLSC  151
            G LG+P    GL++R+ Q  F+ A  GVM  +  F   T+F  L   MG+  LWS +L+C
Sbjct  3    GMLGRPGSWGGLVLRVGQTFFAAACIGVMGSSLGFASYTAFCYLIASMGLQMLWSFALAC  62

Query  150  LDFHSIMFRRRGHSVFLLVLICIGDWV  70
            LD ++I   +   S  L+ L  +GDWV
Sbjct  63   LDGYAITTNKDLTSPILVSLFVVGDWV  89



>ref|XP_010414531.1| PREDICTED: CASP-like protein 5A2 [Camelina sativa]
Length=179

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 49/90 (54%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M D+ G  G   GL +R  Q +F+ AS  VM   S F   T+F  L    G+  LWSL+
Sbjct  28   RMDDMEGMPGTLLGLALRFFQFLFAAASLSVMATTSDFPSVTAFCYLVAATGLQSLWSLT  87

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            L+ +D ++IM +R   +  L+ L  IGD V
Sbjct  88   LAMVDVYAIMVKRSLQNRRLVSLFAIGDGV  117



>ref|XP_010470090.1| PREDICTED: CASP-like protein 5A2 [Camelina sativa]
 ref|XP_010470091.1| PREDICTED: CASP-like protein 5A2 [Camelina sativa]
 ref|XP_010470092.1| PREDICTED: CASP-like protein 5A2 [Camelina sativa]
 ref|XP_010470093.1| PREDICTED: CASP-like protein 5A2 [Camelina sativa]
Length=179

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 49/90 (54%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M D+ G  G   GL +R  Q +F+ AS  VM   S F   T+F  L    G+  LWSL+
Sbjct  28   RMDDMEGMPGTLLGLALRFFQFLFAAASLSVMATTSDFPSVTAFCYLVAATGLQSLWSLT  87

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            L+ +D ++IM +R   +  L+ L  IGD V
Sbjct  88   LAMVDVYAIMVKRSLQNRRLVSLFAIGDGV  117



>gb|KDP29115.1| hypothetical protein JCGZ_16504 [Jatropha curcas]
Length=178

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 50/90 (56%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+D+ G  G P GL +R+ Q VF L S  VM   S F   T+F  L + + +  LWS S
Sbjct  27   RMKDVQGMPGTPGGLALRVTQFVFGLISLCVMATTSDFRSVTAFCYLVIAVSLQILWSFS  86

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            ++ +D ++++ +R      ++ L  IGD +
Sbjct  87   VAIVDVYALLVKRSLRKRIIVRLFAIGDGI  116



>ref|XP_010680953.1| PREDICTED: CASP-like protein 5C1 [Beta vulgaris subsp. vulgaris]
Length=153

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            + ++ G LG  + L +R+ Q +FS A+   M L   F   T+F  L  VMG++  WS++L
Sbjct  2    VEEVPGSLGTSASLALRLGQTLFSSAALFFMCLDVNFYGYTAFCFLVTVMGLVIPWSMTL  61

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWVLQF  61
              +D +S+  +       ++ +I +GDWVL F
Sbjct  62   GLVDAYSVFVKSPSRQPGVMTVIVVGDWVLSF  93



>ref|XP_006379887.1| hypothetical protein POPTR_0008s16540g [Populus trichocarpa]
 gb|ERP57684.1| hypothetical protein POPTR_0008s16540g [Populus trichocarpa]
Length=152

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            MRD  G  G  +GL +R+ QCVF+  S   M   + F   T+F  L   MG+  +WS  L
Sbjct  1    MRDFAGTPGTLTGLALRLSQCVFAAGSITAMTTTTSFFDFTAFCYLIASMGLQVIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD ++++ ++  H+  LL L  +GDWV
Sbjct  61   ALLDVYALVKKKALHNTVLLSLFVVGDWV  89



>ref|XP_007131880.1| hypothetical protein PHAVU_011G049100g [Phaseolus vulgaris]
 gb|ESW03874.1| hypothetical protein PHAVU_011G049100g [Phaseolus vulgaris]
Length=129

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 51/91 (56%), Gaps = 0/91 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M ++ G LG  +   +RI Q +FS AS   M L   F   T+F  L  +MG++  WS SL
Sbjct  1    MDEVPGSLGTSASFSLRIGQTMFSSASLLFMSLGVEFYSYTAFCYLVTIMGLVIPWSFSL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWVLQ  64
            + +D +S++ +       +L++I +GDWVL 
Sbjct  61   ALVDGYSVLLKCPIRQPGILLIIVVGDWVLS  91



>ref|XP_007131881.1| hypothetical protein PHAVU_011G049100g [Phaseolus vulgaris]
 gb|ESW03875.1| hypothetical protein PHAVU_011G049100g [Phaseolus vulgaris]
Length=152

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 51/91 (56%), Gaps = 0/91 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M ++ G LG  +   +RI Q +FS AS   M L   F   T+F  L  +MG++  WS SL
Sbjct  1    MDEVPGSLGTSASFSLRIGQTMFSSASLLFMSLGVEFYSYTAFCYLVTIMGLVIPWSFSL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWVLQ  64
            + +D +S++ +       +L++I +GDWVL 
Sbjct  61   ALVDGYSVLLKCPIRQPGILLIIVVGDWVLS  91



>ref|XP_007041383.1| Integral membrane protein, expressed, putative [Theobroma cacao]
 gb|EOX97214.1| Integral membrane protein, expressed, putative [Theobroma cacao]
Length=152

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 51/91 (56%), Gaps = 0/91 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M ++ G +G  +G  +R+ Q +FS AS   M L   F   T+F  L  +MG++  WS +L
Sbjct  1    MNEVPGSVGTSAGFSLRLAQALFSSASLLFMSLGVEFYSYTAFCYLVTIMGLVIPWSFTL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWVLQ  64
            + +D +S++ +       +L++I  GDWVL 
Sbjct  61   ALVDGYSVLVKCPVRQPGILLIIAAGDWVLS  91



>gb|KFK36609.1| hypothetical protein AALP_AA4G145800 [Arabis alpina]
Length=180

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 56/101 (55%), Gaps = 4/101 (4%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+D+ G  G   GL++R+ Q V +L S  VM+  S F   T+F  L L +G+  LWSLS
Sbjct  30   RMKDVQGMPGTTGGLILRLSQFVPALISVSVMLTTSDFRSATAFCFLVLAVGLQTLWSLS  89

Query  159  LSCLDFHSIMFRR--RGHSVFLLVLICIGDWVLQFPYFLYA  43
            L  +D +++M +R  R H+V  +    IGD +     F  A
Sbjct  90   LFLVDVYALMVKRSLRNHAV--VQCFTIGDGITSMLTFAAA  128



>ref|XP_008359277.1| PREDICTED: CASP-like protein At2g28370 [Malus domestica]
 ref|XP_008363508.1| PREDICTED: CASP-like protein At2g28370 [Malus domestica]
Length=179

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 49/90 (54%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+DL G  G P GL++R+ Q  FS AS  VM   S F   T+F  L    G+  LWS S
Sbjct  28   RMKDLPGMPGTPGGLVLRLAQFFFSAASLVVMATTSDFPSVTAFCYLVAATGLQCLWSFS  87

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            L  +D ++++  R   +  ++ L  +GD V
Sbjct  88   LGVVDVYALLVGRSLQNHRVVCLFTLGDGV  117



>ref|XP_011029843.1| PREDICTED: CASP-like protein 5B3 [Populus euphratica]
Length=152

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            MRD  G  G  +GL +R+ QCVF+  S   M   + F   T+F  L   MG+  +WS  L
Sbjct  1    MRDFAGTPGTLTGLALRLSQCVFAAGSITAMTTTTSFFDFTAFCYLIASMGLQVIWSFGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD ++++ ++  H+  LL L  +GDWV
Sbjct  61   ALLDAYALVKKKALHNTVLLSLFVVGDWV  89



>ref|XP_006591844.1| PREDICTED: uncharacterized protein LOC100526963 isoform X1 [Glycine 
max]
 ref|XP_006591845.1| PREDICTED: uncharacterized protein LOC100526963 isoform X2 [Glycine 
max]
 gb|KHN05681.1| CASP-like protein [Glycine soja]
Length=183

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 51/99 (52%), Gaps = 0/99 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+D+ G  G   GL +R+ Q VF+ A+  +M   S F   T+F  L    G+  +WS S
Sbjct  32   RMKDIQGMPGTAGGLSLRVSQFVFAAAALSIMASTSDFPSVTAFCYLVAAAGLQAMWSFS  91

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWVLQFPYFLYA  43
            L+  D ++++ RR   +  ++ L  IGD V     F  A
Sbjct  92   LAITDVYALLVRRSLQNYRIVSLFTIGDGVTSTLTFAAA  130



>gb|KHN38760.1| CASP-like protein [Glycine soja]
Length=182

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 51/99 (52%), Gaps = 0/99 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+D+ G  G   GL +R+ Q VF+ A+  +M   S F   T+F  L    G+  LWS S
Sbjct  31   RMKDVQGMPGTAGGLSLRVSQFVFAAAALSIMASTSDFPSVTAFCYLVAAAGLQALWSFS  90

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWVLQFPYFLYA  43
            L+  D ++++ RR   +  ++ L  +GD V     F  A
Sbjct  91   LAITDVYALLVRRSLQNYRIVSLFTVGDGVTSTLTFAAA  129



>ref|NP_001237047.1| uncharacterized protein LOC100527764 [Glycine max]
 gb|ACU16925.1| unknown [Glycine max]
Length=182

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 51/99 (52%), Gaps = 0/99 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+D+ G  G   GL +R+ Q VF+ A+  +M   S F   T+F  L    G+  LWS S
Sbjct  31   RMKDVQGMPGTAGGLSLRVSQFVFAAAALSIMASTSDFPSVTAFCYLVAAAGLQALWSFS  90

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWVLQFPYFLYA  43
            L+  D ++++ RR   +  ++ L  +GD V     F  A
Sbjct  91   LAITDVYALLVRRSLQNYRIVSLFTVGDGVTSTLTFAAA  129



>ref|XP_009346416.1| PREDICTED: CASP-like protein At3g53850 [Pyrus x bretschneideri]
Length=155

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 0/88 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M++L G  G  SGLL+R+ Q   +  +  VMV    F   T F  L   M +  LWSL L
Sbjct  1    MKELLGRPGSVSGLLLRVSQFSCAGIAIAVMVTTDGFAEFTCFCYLVASMALQVLWSLGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDW  73
            +CLD +++  +R   +  L+ L  +GDW
Sbjct  61   ACLDIYALSKKRDLQNKLLVRLFVVGDW  88



>gb|AFK37981.1| unknown [Medicago truncatula]
 gb|KEH30036.1| CASP-like protein [Medicago truncatula]
Length=185

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 49/90 (54%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+D+ G  G   GL +R+ Q VF+ A+  VM   S F   T+F  L    G+  LWS++
Sbjct  34   RMKDIQGMPGTIGGLALRVSQFVFAAAALSVMASTSDFPSVTAFCFLVAAAGLQTLWSIA  93

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            L+  D ++I+ RR   +  L+    IGD V
Sbjct  94   LAITDVYAILVRRSLQNYRLVSSFTIGDGV  123



>gb|AFK35149.1| unknown [Lotus japonicus]
Length=152

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 47/89 (53%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+D  G  G   GL +R+ Q +F+  S   M     F   T+F  L   MG+  +WS  L
Sbjct  1    MKDFPGTPGTGLGLALRMAQFIFAAGSIASMTTTPSFFNFTAFCYLIASMGLQVIWSFML  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD ++++ ++  H+  L+ L  +GDWV
Sbjct  61   ALLDAYALVKKKVLHNPLLVSLFVVGDWV  89



>ref|XP_002969207.1| hypothetical protein SELMODRAFT_410131 [Selaginella moellendorffii]
 gb|EFJ29295.1| hypothetical protein SELMODRAFT_410131 [Selaginella moellendorffii]
Length=147

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 50/90 (56%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+D  G      GL++R  Q   ++ +  +M+    F   T+F  L   M +  LWS+S
Sbjct  25   RMKDYEGMPSTLGGLVLRSGQFACAVTALSIMISIPDFSSVTAFCYLVAAMALQLLWSVS  84

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            L+ +D ++++ RR  H+  LL L+ IGDWV
Sbjct  85   LAVVDGYALLLRRTLHNPVLLSLLVIGDWV  114



>ref|XP_011089913.1| PREDICTED: CASP-like protein 5A2 [Sesamum indicum]
Length=181

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 51/90 (57%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+DL G  G   GL++R+ Q +F++ +  VM   S F   T+F  L    G+  LWSL 
Sbjct  30   RMKDLQGMPGTVGGLVLRVSQFLFAIVALSVMATTSDFPSVTAFCYLVAAAGLQSLWSLV  89

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            L+ LD ++++  RR  +  ++ L  +GD V
Sbjct  90   LAILDAYALLVGRRLQNPRVVSLFAVGDGV  119



>gb|KDO79411.1| hypothetical protein CISIN_1g031829mg [Citrus sinensis]
Length=152

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 48/92 (52%), Gaps = 0/92 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M ++ G LG  + L +R  Q +FS  S   M     F   TSF  L  VMG++  WS++L
Sbjct  1    MDEVPGALGSSASLALRFGQTIFSSGSILFMSFHVEFYSYTSFCYLVTVMGLVIPWSMAL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWVLQF  61
              +D +++ F+       +++ +  GDWVL F
Sbjct  61   GLVDGYAVFFKNLPRRPRVMLFVIAGDWVLAF  92



>ref|XP_006425776.1| hypothetical protein CICLE_v10026699mg [Citrus clementina]
 gb|ESR39016.1| hypothetical protein CICLE_v10026699mg [Citrus clementina]
Length=130

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 48/90 (53%), Gaps = 0/90 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M ++ G LG  + L +R  Q +FS AS   M     F   TSF  L  VMG++  WS++L
Sbjct  1    MDEVPGALGSSASLALRFGQTIFSSASILFMSFHVEFYSYTSFCYLVTVMGLVIPWSMAL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWVL  67
              +D +++ F+       +++ +  GDWVL
Sbjct  61   GLVDGYAVFFKNLPRRPRVMLFVIAGDWVL  90



>ref|XP_009140898.1| PREDICTED: CASP-like protein At2g28370 [Brassica rapa]
 ref|XP_009140899.1| PREDICTED: CASP-like protein At2g28370 [Brassica rapa]
Length=181

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 49/90 (54%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M D+ G  G   G+ +R  Q +F+ AS  VM   S F   T+F  L    G+  LWSLS
Sbjct  30   RMDDIEGMPGTLLGVALRFFQFLFAAASLSVMASTSDFPSVTAFCYLVAATGLQSLWSLS  89

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            L+ +D ++IM +R   +  L+ +  IGD V
Sbjct  90   LAAVDVYAIMVKRSLQNRRLVSVFAIGDGV  119



>ref|XP_006424560.1| hypothetical protein CICLE_v10029379mg [Citrus clementina]
 ref|XP_006488082.1| PREDICTED: CASP-like protein At2g28370-like isoform X1 [Citrus 
sinensis]
 ref|XP_006488083.1| PREDICTED: CASP-like protein At2g28370-like isoform X2 [Citrus 
sinensis]
 gb|ESR37800.1| hypothetical protein CICLE_v10029379mg [Citrus clementina]
 gb|KDO73304.1| hypothetical protein CISIN_1g0304392mg [Citrus sinensis]
Length=177

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 50/90 (56%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+D+ G    P GL +R+ Q +F++A+  VM   S F   T+F  L    G+  LWSLS
Sbjct  26   RMKDIQGMPATPGGLALRVSQFIFAVAALCVMATTSDFPSVTAFCFLVAAAGLQSLWSLS  85

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            L+ +D +++   R   +  ++ L  +GD +
Sbjct  86   LAIVDIYALSVMRSLQNSRIVNLFTVGDGI  115



>ref|XP_009341904.1| PREDICTED: CASP-like protein ARALYDRAFT_485429 [Pyrus x bretschneideri]
 ref|XP_009341923.1| PREDICTED: CASP-like protein ARALYDRAFT_485429 [Pyrus x bretschneideri]
Length=152

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 49/92 (53%), Gaps = 0/92 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M +L G LG  + L +R  Q +FS AS   M L   F   T+F  L  VMG++  WS++L
Sbjct  1    MDELPGSLGTSASLALRFGQTIFSTASLLFMCLDVEFYSYTAFCYLVTVMGLVVPWSMTL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWVLQF  61
              +D +S+  R   H   ++ +I +GD  L +
Sbjct  61   VIVDAYSVFVRCLHHQPRIITIIILGDLALSY  92



>ref|XP_002960566.1| hypothetical protein SELMODRAFT_270224 [Selaginella moellendorffii]
 sp|D8QNI1.1|CSPLH_SELML RecName: Full=CASP-like protein 5A1; Short=SmCASPL5A1 [Selaginella 
moellendorffii]
 gb|EFJ38105.1| hypothetical protein SELMODRAFT_270224 [Selaginella moellendorffii]
Length=176

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 50/90 (56%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+D  G      GL++R  Q   ++ +  +M+    F   T+F  L   M +  LWS+S
Sbjct  25   RMKDYEGMPSTLGGLVLRSGQFACAVTALSIMISIPDFSSVTAFCYLVAAMALQLLWSVS  84

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            L+ +D ++++ RR  H+  LL L+ IGDWV
Sbjct  85   LAVVDGYALLLRRTLHNPVLLSLLVIGDWV  114



>ref|XP_006354505.1| PREDICTED: CASP-like protein At3g23200-like [Solanum tuberosum]
Length=152

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 46/88 (52%), Gaps = 0/88 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M+D  G  G  +GL +R+ QC F+  +   MV +  F   T+F  L   M +  +WS  L
Sbjct  1    MKDFAGTPGTLTGLFLRMAQCFFAAGAIASMVTSKGFFNVTAFCYLIASMALQVIWSSGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDW  73
            + LD + +  ++  H+  LL L  +GDW
Sbjct  61   AFLDAYFLAKKKSFHNHVLLSLFVVGDW  88



>ref|XP_009375319.1| PREDICTED: CASP-like protein Os03g0767900 [Pyrus x bretschneideri]
Length=158

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 50/92 (54%), Gaps = 0/92 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
             M ++ G +G  +   +R+ Q +FS AS   M L   F   T+F  L  VMG++  WS +
Sbjct  6    TMDEVPGSVGTSASFSLRLGQAIFSSASLLFMSLGVEFYSYTAFCYLVTVMGLVIPWSFT  65

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWVLQ  64
            L+ +D +S++         +L++I +GDWVL 
Sbjct  66   LALVDGYSVLVNYPLRQPGILLIIVVGDWVLS  97



>emb|CDX77175.1| BnaC04g39700D [Brassica napus]
Length=181

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 49/90 (54%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M D+ G  G   G+ +R  Q +F+ AS  VM   S F   T+F  L    G+  LWSL+
Sbjct  30   RMDDIEGMPGTLLGVALRFFQFLFAAASLSVMAFTSDFPSVTAFCYLVAATGLQSLWSLA  89

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            L+ +D ++IM +R   +  L+ +  IGD V
Sbjct  90   LAAVDVYAIMVKRSLQNRRLVSVFAIGDGV  119



>ref|NP_001236559.1| uncharacterized protein LOC100526963 [Glycine max]
 gb|ACU15997.1| unknown [Glycine max]
Length=183

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 52/99 (53%), Gaps = 0/99 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+D+ G  G   GL +R+ + VF+ A+  +M   S F+  T+F  L    G+  +WS S
Sbjct  32   RMKDIQGMPGTAGGLSLRVSRFVFAAAALSIMASTSDFLSVTAFCYLVAAAGLQAMWSFS  91

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWVLQFPYFLYA  43
            L+  D ++++ RR   +  ++ L  IGD V     F  A
Sbjct  92   LAITDVYALLVRRSLQNYRIVSLFTIGDGVTSTLTFAAA  130



>ref|XP_011037598.1| PREDICTED: CASP-like protein 5C1 [Populus euphratica]
Length=152

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 50/91 (55%), Gaps = 0/91 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M D+ G +G  +   +R+ Q +FS AS   M L   F   T+F  L  +MG+   WS +L
Sbjct  1    MDDVPGSVGTSASFSLRLGQTIFSSASLLFMSLGVEFYTYTAFCYLVTIMGLTIPWSFTL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWVLQ  64
            + +D +S++ +       +L++I +GDWVL 
Sbjct  61   AIVDGYSVLVKCPVRQPGILLIIVLGDWVLS  91



>ref|XP_003568321.1| PREDICTED: CASP-like protein 5B2 [Brachypodium distachyon]
Length=154

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            MR+L GG G   GL +R  Q  F+ AS GVM  A+ F   T+F  L   MG+  LWSL L
Sbjct  1    MRELLGGPGTWGGLWLRAAQVAFAAASIGVMASAAGFAGYTAFCYLIASMGLQALWSLGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            + LD +++  +   ++  L+ L  +GDWV
Sbjct  61   AFLDGYALKVKMDLNNAVLVSLFVVGDWV  89



>ref|XP_011094649.1| PREDICTED: CASP-like protein 5A1 [Sesamum indicum]
Length=175

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 51/99 (52%), Gaps = 0/99 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+D+ G  G    L +R+ Q VF+  S  VM   S F   T+F  L   +G+  LWSLS
Sbjct  24   RMKDVQGMAGTTGALFLRLCQFVFAAVSLCVMATTSDFPSVTAFRYLVAAVGLQSLWSLS  83

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWVLQFPYFLYA  43
            L+  D ++++ RR   +  ++ L  IGD +     F  A
Sbjct  84   LALADIYALLVRRSFRNTGVVSLFAIGDGITSTLTFAAA  122



>ref|XP_010906503.1| PREDICTED: CASP-like protein 5A1 [Elaeis guineensis]
Length=178

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 51/90 (57%), Gaps = 0/90 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+D+ G  G P GL +R+ Q +F+ A+  VM   S F   T+F  L   + +  LWSLS
Sbjct  27   RMKDIQGMPGTPGGLALRLCQFIFAAAALSVMASTSDFTSVTAFCYLVAAVILQSLWSLS  86

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            L+ LD ++++ +R   +   + L  IGD +
Sbjct  87   LAFLDIYALLVKRCLRNSRAVCLFTIGDAI  116



>ref|XP_010264675.1| PREDICTED: CASP-like protein 5A1 [Nelumbo nucifera]
Length=178

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 55/99 (56%), Gaps = 0/99 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+D+ G  G   G+ +R+ Q VF++A+  VM   + F   T+F  L   +G+  +WSLS
Sbjct  27   RMKDIQGMPGTSGGVALRLSQSVFAVAAVCVMASTNDFTSVTAFCYLVAAVGLQSVWSLS  86

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWVLQFPYFLYA  43
            L+ +D ++++ RR   +  ++ L  IGD +     F  A
Sbjct  87   LAFVDIYALLVRRCLRNSRVISLFTIGDGITSTLTFAAA  125



>ref|XP_004506017.1| PREDICTED: CASP-like protein At2g28370-like isoform X1 [Cicer 
arietinum]
 ref|XP_004506018.1| PREDICTED: CASP-like protein At2g28370-like isoform X2 [Cicer 
arietinum]
Length=185

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 49/99 (49%), Gaps = 0/99 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+D+ G  G   GL +R  Q VF  A+  +M   S F   T+F  L    G+  LWS+S
Sbjct  34   RMKDIQGMPGTVGGLSLRASQFVFGAAALSIMASTSDFPSVTAFCFLVAAAGLQTLWSIS  93

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWVLQFPYFLYA  43
            L+  D ++I+ RR   +  L+    IGD V     F  A
Sbjct  94   LAITDVYAILVRRSLQNSRLVSFFTIGDGVTSTLMFAAA  132



>dbj|BAJ93956.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=154

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 49/89 (55%), Gaps = 0/89 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            MR+L G  G   GL +R+ Q   + AS  VM  A  F   T+F  L   MG+  LWSL L
Sbjct  1    MRELVGRPGTWGGLWLRLGQAALAAASIAVMASAYGFAGYTAFCYLIASMGLQALWSLGL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWV  70
            +CLD +++  +R   +  L+ L  +GDWV
Sbjct  61   ACLDGYALKVKRDLGNAVLVSLFVVGDWV  89



>ref|XP_008387337.1| PREDICTED: CASP-like protein Os03g0767900 [Malus domestica]
Length=158

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
             M ++ G +G  +   +R+ Q +FS AS   M L   F   T+F  L  VMG++  WS +
Sbjct  6    AMDEVPGSVGTSASFSLRLGQAIFSSASLLFMSLGVEFYSYTAFCYLVTVMGLVIPWSFT  65

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGDWVLQ  64
            L+ +D +S++ +       +L++I +GDWVL 
Sbjct  66   LALVDGYSVLVKCPLRQPGILLIIVVGDWVLS  97



>ref|XP_010999514.1| PREDICTED: CASP-like protein 5C1 [Populus euphratica]
Length=152

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 50/91 (55%), Gaps = 0/91 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M D+ G +G  +   +R+ Q +FS AS   M L   F   T+F  L  +MG+   WS +L
Sbjct  1    MDDVPGSVGTSASFSLRLGQTIFSSASLLFMSLGVEFYSYTAFCYLVTIMGLAIPWSFTL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWVLQ  64
            + +D +S++ +       +L++I +GDWVL 
Sbjct  61   AIVDGYSVLVKCPIRQPGILLIIVLGDWVLS  91



>ref|NP_001275459.1| uncharacterized protein LOC102577653 [Solanum tuberosum]
 gb|ABB16987.1| unknown [Solanum tuberosum]
Length=174

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 49/88 (56%), Gaps = 0/88 (0%)
 Frame = -3

Query  339  KMRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLS  160
            +M+D  G  G    L +R+ Q VF++ S  VMV  S F   T+F  L   +G+  +WSL 
Sbjct  23   RMKDFQGMPGTLGSLFLRLCQFVFAVISICVMVTTSDFPSVTAFSYLVAAVGLQIIWSLV  82

Query  159  LSCLDFHSIMFRRRGHSVFLLVLICIGD  76
            L+  D ++I+ +R   +V ++ L  IGD
Sbjct  83   LAIADVYAILVKRSYRNVAIVSLFAIGD  110



>ref|XP_009379154.1| PREDICTED: CASP-like protein ARALYDRAFT_485429 isoform X2 [Pyrus 
x bretschneideri]
Length=118

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 48/92 (52%), Gaps = 0/92 (0%)
 Frame = -3

Query  336  MRDLFGGLGKPSGLLVRILQCVFSLASAGVMVLASYFIRNTSFWCLALVMGVLFLWSLSL  157
            M +L G LG  + L +R  Q +FS AS   M L   F   T+F  L  VMG++  WS++L
Sbjct  1    MDELPGSLGTSASLALRFGQTIFSTASLLFMCLDVEFYSYTAFCYLVTVMGLVVPWSMTL  60

Query  156  SCLDFHSIMFRRRGHSVFLLVLICIGDWVLQF  61
              +D +S+ FR       +  +I +GD  L +
Sbjct  61   VIVDVYSVFFRCLPRRPRITTVIILGDLALSY  92



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 513730317888