BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25630_g4_i2 len=1423 path=[5227:0-36 @1928@!:37-77 2560:78-107
2482:108-163 5388:164-174 5399:175-239 6636:240-279 5504:280-313
7478:314-336 5561:337-488 5713:489-496 5721:497-710 5934:711-717
2022:718-768 5991:769-800 6023:801-836 6059:837-840 6063:841-893
6849:894-933 6156:934-1044 6262:1045-1056 2751:1057-1220
6434:1221-1422]

Length=1423
                                                                      Score     E

ref|XP_009591795.1|  PREDICTED: L-ascorbate oxidase homolog             702   0.0      
ref|XP_009766183.1|  PREDICTED: L-ascorbate oxidase homolog             701   0.0      
gb|AAQ90182.1|  ntp101                                                  699   0.0      Nicotiana tabacum [American tobacco]
ref|XP_006367595.1|  PREDICTED: L-ascorbate oxidase homolog             692   0.0      
ref|XP_006341879.1|  PREDICTED: L-ascorbate oxidase homolog             688   0.0      
dbj|BAO02510.1|  predicted pollen-specific protein ortholog             687   0.0      
sp|P29162.1|ASOL_TOBAC  RecName: Full=L-ascorbate oxidase homolog...    686   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009588330.1|  PREDICTED: L-ascorbate oxidase homolog             687   0.0      
ref|XP_009773470.1|  PREDICTED: L-ascorbate oxidase homolog             686   0.0      
ref|XP_009624631.1|  PREDICTED: L-ascorbate oxidase homolog             684   0.0      
ref|XP_004229062.1|  PREDICTED: L-ascorbate oxidase homolog             682   0.0      
gb|AAQ90185.1|  ntp805                                                  682   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009785667.1|  PREDICTED: L-ascorbate oxidase homolog             677   0.0      
ref|XP_004228635.1|  PREDICTED: L-ascorbate oxidase homolog             672   0.0      
ref|XP_006354116.1|  PREDICTED: L-ascorbate oxidase homolog             671   0.0      
gb|EYU32815.1|  hypothetical protein MIMGU_mgv1a003910mg                663   0.0      
gb|EYU32814.1|  hypothetical protein MIMGU_mgv1a003925mg                656   0.0      
gb|AAL87103.1|AF479568_1  1-ascorbate oxidase                           656   0.0      Petunia x hybrida [garden petunia]
gb|ABI52585.1|  pollen-specific protein                                 655   0.0      Camellia sinensis [black tea]
gb|EPS72881.1|  pollen-specific protein                                 647   0.0      
emb|CDP18567.1|  unnamed protein product                                639   0.0      
gb|EYU39285.1|  hypothetical protein MIMGU_mgv1a026945mg                632   0.0      
ref|XP_011089764.1|  PREDICTED: L-ascorbate oxidase homolog             628   0.0      
ref|XP_011089763.1|  PREDICTED: L-ascorbate oxidase homolog             626   0.0      
ref|XP_011089765.1|  PREDICTED: L-ascorbate oxidase homolog             620   0.0      
ref|XP_011089767.1|  PREDICTED: L-ascorbate oxidase homolog             618   0.0      
ref|XP_011089702.1|  PREDICTED: L-ascorbate oxidase homolog             617   0.0      
ref|XP_011089766.1|  PREDICTED: L-ascorbate oxidase homolog             616   0.0      
ref|XP_009339220.1|  PREDICTED: L-ascorbate oxidase homolog             610   0.0      
ref|XP_008449912.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    609   0.0      
emb|CDP04133.1|  unnamed protein product                                608   0.0      
ref|XP_010271079.1|  PREDICTED: L-ascorbate oxidase homolog             607   0.0      
ref|XP_009773307.1|  PREDICTED: L-ascorbate oxidase homolog             606   0.0      
ref|XP_007208287.1|  hypothetical protein PRUPE_ppa003715mg             606   0.0      
ref|XP_010247847.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    605   0.0      
ref|XP_010247849.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    605   0.0      
ref|XP_010247848.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    605   0.0      
ref|XP_008449913.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    605   0.0      
ref|XP_009376274.1|  PREDICTED: L-ascorbate oxidase homolog             603   0.0      
ref|XP_004164924.1|  PREDICTED: L-ascorbate oxidase homolog             603   0.0      
ref|XP_009626538.1|  PREDICTED: L-ascorbate oxidase homolog             602   0.0      
ref|XP_009600426.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    600   0.0      
ref|XP_010044910.1|  PREDICTED: L-ascorbate oxidase homolog             599   0.0      
ref|XP_007014658.1|  SKU5 similar 13                                    598   0.0      
ref|XP_002303974.1|  multi-copper oxidase type 1 family protein         597   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004164922.1|  PREDICTED: L-ascorbate oxidase homolog             597   0.0      
ref|XP_010034522.1|  PREDICTED: L-ascorbate oxidase homolog             596   0.0      
ref|XP_008438536.1|  PREDICTED: L-ascorbate oxidase homolog             595   0.0      
ref|XP_009803815.1|  PREDICTED: L-ascorbate oxidase homolog             596   0.0      
ref|XP_004137383.1|  PREDICTED: L-ascorbate oxidase homolog             595   0.0      
ref|XP_008374029.1|  PREDICTED: L-ascorbate oxidase homolog             595   0.0      
ref|XP_003635547.1|  PREDICTED: L-ascorbate oxidase homolog             594   0.0      
emb|CAN69061.1|  hypothetical protein VITISV_032605                     594   0.0      Vitis vinifera
ref|XP_008219681.1|  PREDICTED: L-ascorbate oxidase homolog             594   0.0      
ref|XP_004149637.1|  PREDICTED: L-ascorbate oxidase homolog             593   0.0      
ref|XP_004149634.1|  PREDICTED: L-ascorbate oxidase homolog             593   0.0      
ref|XP_004165665.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    593   0.0      
ref|XP_006352142.1|  PREDICTED: L-ascorbate oxidase homolog             593   0.0      
ref|XP_004164925.1|  PREDICTED: L-ascorbate oxidase homolog             592   0.0      
gb|KDP30647.1|  hypothetical protein JCGZ_16212                         591   0.0      
ref|XP_011025085.1|  PREDICTED: L-ascorbate oxidase homolog             590   0.0      
ref|XP_009611384.1|  PREDICTED: L-ascorbate oxidase homolog             590   0.0      
ref|XP_009135303.1|  PREDICTED: L-ascorbate oxidase homolog             588   0.0      
ref|XP_010465173.1|  PREDICTED: L-ascorbate oxidase homolog             588   0.0      
emb|CDX82540.1|  BnaA03g32810D                                          588   0.0      
gb|EYU39505.1|  hypothetical protein MIMGU_mgv1a003980mg                587   0.0      
ref|XP_010044914.1|  PREDICTED: L-ascorbate oxidase homolog             587   0.0      
ref|XP_006303856.1|  hypothetical protein CARUB_v10012595mg             587   0.0      
emb|CDY10549.1|  BnaC03g70650D                                          587   0.0      
ref|XP_010487093.1|  PREDICTED: L-ascorbate oxidase homolog             586   0.0      
ref|XP_009106861.1|  PREDICTED: L-ascorbate oxidase homolog             586   0.0      
ref|XP_002523382.1|  multicopper oxidase, putative                      585   0.0      Ricinus communis
ref|XP_002523381.1|  multicopper oxidase, putative                      585   0.0      Ricinus communis
ref|XP_008374030.1|  PREDICTED: L-ascorbate oxidase homolog             585   0.0      
emb|CDX75708.1|  BnaC03g37910D                                          585   0.0      
gb|KFK38673.1|  hypothetical protein AALP_AA3G145200                    585   0.0      
gb|KHG27164.1|  L-ascorbate oxidase                                     582   0.0      
ref|XP_002882820.1|  hypothetical protein ARALYDRAFT_478721             584   0.0      
emb|CDY56013.1|  BnaA08g29220D                                          584   0.0      
ref|XP_010673839.1|  PREDICTED: L-ascorbate oxidase homolog             584   0.0      
ref|XP_011048127.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    583   0.0      
ref|XP_011048126.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    583   0.0      
ref|XP_010500435.1|  PREDICTED: L-ascorbate oxidase homolog             583   0.0      
ref|XP_002894511.1|  hypothetical protein ARALYDRAFT_474617             583   0.0      
ref|XP_002299087.1|  multi-copper oxidase type 1 family protein         582   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004502172.1|  PREDICTED: L-ascorbate oxidase homolog             582   0.0      
gb|EPS68478.1|  hypothetical protein M569_06286                         581   0.0      
ref|XP_002297609.2|  multi-copper oxidase type 1 family protein         582   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004305574.1|  PREDICTED: L-ascorbate oxidase homolog             582   0.0      
ref|XP_004234818.1|  PREDICTED: L-ascorbate oxidase homolog             582   0.0      
ref|NP_187948.1|  protein SKU5-like 13                                  581   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006392622.1|  hypothetical protein EUTSA_v10011369mg             581   0.0      
gb|AAD10639.1|  putative pollen specific protein                        581   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006407227.1|  hypothetical protein EUTSA_v10020444mg             580   0.0      
ref|XP_009339221.1|  PREDICTED: L-ascorbate oxidase homolog             580   0.0      
emb|CDY23597.1|  BnaC05g39970D                                          580   0.0      
ref|XP_009146525.1|  PREDICTED: L-ascorbate oxidase homolog             580   0.0      
emb|CDY43994.1|  BnaA05g25890D                                          580   0.0      
ref|XP_011048128.1|  PREDICTED: L-ascorbate oxidase homolog             579   0.0      
ref|NP_564697.1|  SKU5 similar 14                                       579   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010034521.1|  PREDICTED: L-ascorbate oxidase homolog             578   0.0      
ref|XP_003556690.2|  PREDICTED: L-ascorbate oxidase homolog             579   0.0      
gb|KFK35575.1|  hypothetical protein AALP_AA4G008600                    578   0.0      
ref|XP_007157830.1|  hypothetical protein PHAVU_002G101700g             578   0.0      
ref|XP_004250092.1|  PREDICTED: L-ascorbate oxidase homolog             578   0.0      
ref|XP_011077090.1|  PREDICTED: L-ascorbate oxidase homolog             578   0.0      
gb|AGW80453.1|  pollen-specific protein                                 578   0.0      
ref|XP_009376784.1|  PREDICTED: L-ascorbate oxidase homolog             583   0.0      
ref|XP_003538519.1|  PREDICTED: L-ascorbate oxidase homolog             577   0.0      
gb|KHN44494.1|  L-ascorbate oxidase like                                577   0.0      
ref|XP_010480096.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    577   0.0      
ref|XP_006299973.1|  hypothetical protein CARUB_v10016186mg             577   0.0      
emb|CDY24188.1|  BnaC01g37680D                                          576   0.0      
ref|XP_007014661.1|  SKU5 similar 12                                    576   0.0      
ref|XP_010501174.1|  PREDICTED: L-ascorbate oxidase homolog             575   0.0      
ref|XP_010093150.1|  L-ascorbate oxidase-like protein                   575   0.0      
ref|XP_006353286.1|  PREDICTED: L-ascorbate oxidase homolog             575   0.0      
ref|XP_004149657.1|  PREDICTED: L-ascorbate oxidase homolog             575   0.0      
ref|XP_004505353.1|  PREDICTED: L-ascorbate oxidase homolog             575   0.0      
ref|XP_009399915.1|  PREDICTED: L-ascorbate oxidase homolog             574   0.0      
ref|XP_007163845.1|  hypothetical protein PHAVU_001G269200g             574   0.0      
ref|XP_010462411.1|  PREDICTED: L-ascorbate oxidase homolog             573   0.0      
gb|KFK35574.1|  hypothetical protein AALP_AA4G008500                    574   0.0      
ref|XP_010093149.1|  L-ascorbate oxidase-like protein                   573   0.0      
dbj|BAL41449.1|  SKU5 similar 1                                         573   0.0      
ref|XP_009384956.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    570   0.0      
ref|XP_009384957.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    570   0.0      
ref|XP_010534841.1|  PREDICTED: L-ascorbate oxidase homolog             570   0.0      
emb|CDX97352.1|  BnaA02g21430D                                          567   0.0      
ref|NP_175953.1|  protein SKU5 similar 12                               565   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010500423.1|  PREDICTED: L-ascorbate oxidase homolog             565   0.0      
ref|NP_187947.1|  protein SKU5-like 11                                  565   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010552291.1|  PREDICTED: L-ascorbate oxidase homolog             564   0.0      
ref|XP_006306349.1|  hypothetical protein CARUB_v10012235mg             564   0.0      
ref|XP_010501175.1|  PREDICTED: L-ascorbate oxidase homolog             564   0.0      
ref|XP_009420229.1|  PREDICTED: L-ascorbate oxidase homolog             564   0.0      
ref|XP_009417950.1|  PREDICTED: L-ascorbate oxidase homolog             564   0.0      
ref|XP_010465172.1|  PREDICTED: L-ascorbate oxidase homolog             564   0.0      
ref|XP_010462412.1|  PREDICTED: L-ascorbate oxidase homolog             563   0.0      
gb|KFK38671.1|  hypothetical protein AALP_AA3G145000                    563   0.0      
emb|CDY23596.1|  BnaC05g39980D                                          563   0.0      
ref|XP_002891844.1|  hypothetical protein ARALYDRAFT_892557             563   0.0      
ref|XP_007208285.1|  hypothetical protein PRUPE_ppa003733mg             563   0.0      
ref|XP_003607816.1|  L-ascorbate oxidase-like protein                   562   0.0      
ref|XP_006299300.1|  hypothetical protein CARUB_v10015454mg             562   0.0      
emb|CAA47177.1|  Bplo                                                   562   0.0      Brassica napus [oilseed rape]
ref|XP_003601595.1|  L-ascorbate oxidase-like protein                   562   0.0      
ref|XP_003601600.1|  L-ascorbate oxidase-like protein                   561   0.0      
ref|XP_006345828.1|  PREDICTED: L-ascorbate oxidase homolog             561   0.0      
ref|XP_006407228.1|  hypothetical protein EUTSA_v10020433mg             561   0.0      
ref|XP_009411781.1|  PREDICTED: L-ascorbate oxidase homolog             561   0.0      
gb|AFC88081.1|  skewed-like protein                                     561   0.0      
ref|XP_010480098.1|  PREDICTED: L-ascorbate oxidase homolog             561   0.0      
gb|AES71848.2|  L-ascorbate oxidase-like protein                        559   0.0      
sp|Q00624.1|ASOL_BRANA  RecName: Full=L-ascorbate oxidase homolog...    561   0.0      Brassica napus [oilseed rape]
ref|XP_008219577.1|  PREDICTED: L-ascorbate oxidase homolog             561   0.0      
emb|CDX82541.1|  BnaA03g32800D                                          560   0.0      
ref|XP_002884964.1|  hypothetical protein ARALYDRAFT_478720             560   0.0      
ref|XP_009402422.1|  PREDICTED: L-ascorbate oxidase homolog             560   0.0      
gb|EYU39761.1|  hypothetical protein MIMGU_mgv1a003754mg                561   0.0      
ref|XP_003607814.1|  L-ascorbate oxidase-like protein                   560   0.0      
ref|XP_006392621.1|  hypothetical protein EUTSA_v10011364mg             560   0.0      
ref|XP_009135302.1|  PREDICTED: L-ascorbate oxidase homolog             560   0.0      
ref|XP_009147500.1|  PREDICTED: L-ascorbate oxidase homolog             560   0.0      
ref|XP_003601597.1|  L-ascorbate oxidase-like protein                   559   0.0      
ref|XP_009416330.1|  PREDICTED: L-ascorbate oxidase homolog             559   0.0      
ref|XP_008219320.1|  PREDICTED: L-ascorbate oxidase homolog             559   0.0      
emb|CDX75707.1|  BnaC03g37900D                                          559   0.0      
emb|CAA47178.1|  Bplo                                                   559   0.0      Brassica napus [oilseed rape]
ref|XP_008219429.1|  PREDICTED: L-ascorbate oxidase homolog             558   0.0      
ref|XP_003601596.1|  L-ascorbate oxidase-like protein                   558   0.0      
ref|XP_003601601.1|  L-ascorbate oxidase-like protein                   557   0.0      
ref|XP_004505355.1|  PREDICTED: L-ascorbate oxidase homolog             556   0.0      
ref|XP_009387378.1|  PREDICTED: L-ascorbate oxidase homolog             556   0.0      
ref|XP_003601599.1|  L-ascorbate oxidase-like protein                   555   0.0      
ref|XP_009392060.1|  PREDICTED: L-ascorbate oxidase homolog             558   0.0      
ref|XP_009412658.1|  PREDICTED: L-ascorbate oxidase homolog             554   0.0      
ref|XP_003529456.1|  PREDICTED: L-ascorbate oxidase homolog             554   0.0      
ref|XP_009383852.1|  PREDICTED: L-ascorbate oxidase homolog             554   0.0      
gb|KHG03555.1|  L-ascorbate oxidase                                     552   0.0      
ref|XP_009124743.1|  PREDICTED: L-ascorbate oxidase homolog             552   0.0      
ref|XP_007163844.1|  hypothetical protein PHAVU_001G269100g             551   0.0      
ref|XP_010673838.1|  PREDICTED: L-ascorbate oxidase homolog             550   0.0      
emb|CDY43353.1|  BnaA01g29840D                                          550   0.0      
emb|CDY24189.1|  BnaC01g37690D                                          549   0.0      
gb|KHN20513.1|  L-ascorbate oxidase like                                548   0.0      
ref|XP_010938086.1|  PREDICTED: L-ascorbate oxidase homolog             548   0.0      
ref|XP_009600428.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    546   0.0      
emb|CAA47176.1|  Bplo                                                   547   0.0      Brassica napus [oilseed rape]
gb|KHG05644.1|  L-ascorbate oxidase                                     546   0.0      
ref|XP_004970369.1|  PREDICTED: L-ascorbate oxidase homolog             546   0.0      
ref|XP_008793387.1|  PREDICTED: L-ascorbate oxidase homolog             545   0.0      
ref|XP_007157831.1|  hypothetical protein PHAVU_002G101800g             543   0.0      
ref|XP_008788020.1|  PREDICTED: L-ascorbate oxidase homolog             543   0.0      
ref|XP_010921259.1|  PREDICTED: L-ascorbate oxidase homolog             542   0.0      
ref|XP_003567221.1|  PREDICTED: L-ascorbate oxidase homolog             542   0.0      
ref|XP_008804666.1|  PREDICTED: L-ascorbate oxidase homolog             541   0.0      
ref|XP_010552290.1|  PREDICTED: L-ascorbate oxidase homolog             541   0.0      
ref|NP_001132891.1|  uncharacterized protein LOC100194388               535   0.0      Zea mays [maize]
gb|ADK47981.1|  L-ascorbate oxidase-like protein                        539   0.0      
ref|XP_003529457.1|  PREDICTED: L-ascorbate oxidase homolog             539   0.0      
gb|KFK27206.1|  hypothetical protein AALP_AA8G349600                    539   0.0      
ref|XP_008782736.1|  PREDICTED: L-ascorbate oxidase homolog             537   0.0      
ref|XP_010922850.1|  PREDICTED: L-ascorbate oxidase homolog             536   0.0      
ref|XP_008449954.1|  PREDICTED: L-ascorbate oxidase homolog             531   0.0      
ref|XP_006644902.1|  PREDICTED: L-ascorbate oxidase homolog             534   0.0      
ref|NP_001044620.1|  Os01g0816700                                       534   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006838146.1|  hypothetical protein AMTR_s00106p00093220          534   0.0      
gb|ACN34077.1|  unknown                                                 534   0.0      Zea mays [maize]
ref|NP_001151662.1|  L-ascorbate oxidase precursor                      534   0.0      Zea mays [maize]
gb|EEE55579.1|  hypothetical protein OsJ_03867                          534   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008672229.1|  PREDICTED: uncharacterized protein LOC100194...    533   0.0      
ref|XP_010931432.1|  PREDICTED: L-ascorbate oxidase homolog             532   0.0      
dbj|BAK07214.1|  predicted protein                                      532   0.0      
gb|EEC79422.1|  hypothetical protein OsI_20394                          528   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006445540.1|  hypothetical protein CICLE_v10018007mg             530   0.0      
ref|XP_002456532.1|  hypothetical protein SORBIDRAFT_03g037970          529   2e-180   Sorghum bicolor [broomcorn]
ref|XP_009120150.1|  PREDICTED: L-ascorbate oxidase homolog             529   3e-180   
emb|CDY50029.1|  BnaA06g00300D                                          528   4e-180   
dbj|BAK05994.1|  predicted protein                                      528   8e-180   
gb|AAT01329.1|  putative L-ascorbate oxidase                            527   1e-179   Oryza sativa Japonica Group [Japonica rice]
gb|ACF86554.2|  unknown                                                 527   2e-179   Zea mays [maize]
ref|NP_001151772.1|  pollen-specific protein NTP303 precursor           527   2e-179   Zea mays [maize]
emb|CDM84722.1|  unnamed protein product                                526   2e-179   
ref|XP_003566121.2|  PREDICTED: L-ascorbate oxidase homolog             525   6e-179   
gb|EMT02825.1|  L-ascorbate oxidase-like protein                        525   7e-179   
gb|AFK44839.1|  unknown                                                 515   2e-177   
ref|XP_004961713.1|  PREDICTED: L-ascorbate oxidase homolog             515   7e-175   
ref|XP_006386039.1|  multi-copper oxidase type 1 family protein         513   2e-174   
gb|EMT12555.1|  L-ascorbate oxidase-like protein                        508   5e-174   
ref|NP_001151961.1|  pollen-specific protein NTP303 precursor           511   3e-173   Zea mays [maize]
gb|ACN26659.1|  unknown                                                 510   6e-173   Zea mays [maize]
ref|XP_002441281.1|  hypothetical protein SORBIDRAFT_09g023770          509   1e-172   Sorghum bicolor [broomcorn]
emb|CDY43352.1|  BnaA01g29830D                                          507   2e-172   
gb|EMS66047.1|  L-ascorbate oxidase-like protein                        508   9e-172   
emb|CDY54363.1|  BnaC06g07290D                                          491   7e-166   
gb|ABV89619.1|  Sku5-like 11                                            473   1e-158   Brassica rapa
gb|AFK33666.1|  unknown                                                 457   2e-153   
ref|XP_006850531.1|  hypothetical protein AMTR_s00159p00040990          456   4e-152   
gb|KGN54012.1|  hypothetical protein Csa_4G267470                       442   2e-147   
ref|XP_007047154.1|  SKU5 similar 17 isoform 3                          439   4e-147   
ref|XP_008466955.1|  PREDICTED: L-ascorbate oxidase homolog             431   3e-146   
ref|XP_007041705.1|  SKU5 similar 5                                     440   1e-145   
ref|XP_007047152.1|  SKU5 similar 17 isoform 1                          437   6e-145   
ref|XP_010028797.1|  PREDICTED: L-ascorbate oxidase homolog             437   1e-144   
gb|EYU36818.1|  hypothetical protein MIMGU_mgv1a004264mg                437   1e-144   
gb|KHG25743.1|  L-ascorbate oxidase                                     437   1e-144   
ref|XP_006364519.1|  PREDICTED: L-ascorbate oxidase homolog             436   3e-144   
ref|XP_007155969.1|  hypothetical protein PHAVU_003G247700g             436   3e-144   
ref|XP_004287955.1|  PREDICTED: L-ascorbate oxidase homolog             436   3e-144   
gb|KGN63948.1|  hypothetical protein Csa_1G031720                       434   4e-144   
gb|KHG21949.1|  L-ascorbate oxidase                                     436   5e-144   
gb|ABR18324.1|  unknown                                                 435   1e-143   Picea sitchensis
ref|XP_011099705.1|  PREDICTED: L-ascorbate oxidase homolog             434   3e-143   
ref|XP_007047153.1|  SKU5 similar 17 isoform 2                          433   3e-143   
gb|KHG11003.1|  L-ascorbate oxidase                                     433   5e-143   
gb|AGE09595.1|  SKU5-like protein                                       432   8e-143   
emb|CDX81353.1|  BnaC09g07640D                                          432   1e-142   
gb|KGN54013.1|  hypothetical protein Csa_4G267480                       430   1e-142   
ref|XP_004290036.1|  PREDICTED: L-ascorbate oxidase homolog             432   1e-142   
ref|XP_007215641.1|  hypothetical protein PRUPE_ppa003877mg             431   2e-142   
gb|KHG07318.1|  L-ascorbate oxidase                                     431   3e-142   
emb|CDY18626.1|  BnaA09g07690D                                          431   3e-142   
emb|CBI18560.3|  unnamed protein product                                431   3e-142   
ref|XP_002270831.1|  PREDICTED: L-ascorbate oxidase homolog             431   3e-142   Vitis vinifera
ref|XP_008236098.1|  PREDICTED: L-ascorbate oxidase homolog             431   3e-142   
gb|KDP47151.1|  hypothetical protein JCGZ_00042                         431   3e-142   
ref|XP_007200295.1|  hypothetical protein PRUPE_ppa004000mg             431   4e-142   
gb|AGT57427.1|  ascorbate oxidase                                       430   4e-142   
ref|XP_011088669.1|  PREDICTED: L-ascorbate oxidase homolog             430   5e-142   
ref|XP_004231076.1|  PREDICTED: L-ascorbate oxidase homolog             430   5e-142   
ref|XP_011085509.1|  PREDICTED: L-ascorbate oxidase homolog             430   6e-142   
ref|XP_009112343.1|  PREDICTED: L-ascorbate oxidase homolog             430   8e-142   
ref|XP_009407426.1|  PREDICTED: L-ascorbate oxidase homolog             429   9e-142   
ref|XP_009630901.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    430   1e-141   
ref|XP_002528421.1|  multicopper oxidase, putative                      430   1e-141   Ricinus communis
ref|XP_010266098.1|  PREDICTED: L-ascorbate oxidase homolog             429   1e-141   
ref|XP_010028301.1|  PREDICTED: L-ascorbate oxidase homolog             429   1e-141   
ref|XP_002282214.1|  PREDICTED: L-ascorbate oxidase homolog             429   2e-141   Vitis vinifera
ref|XP_006486657.1|  PREDICTED: L-ascorbate oxidase homolog             429   2e-141   
ref|XP_008229964.1|  PREDICTED: L-ascorbate oxidase homolog             429   2e-141   
ref|XP_004509176.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    429   3e-141   
ref|XP_007156841.1|  hypothetical protein PHAVU_002G021900g             428   4e-141   
ref|XP_004987010.1|  PREDICTED: L-ascorbate oxidase homolog             428   4e-141   
ref|XP_006422489.1|  hypothetical protein CICLE_v10028140mg             428   4e-141   
ref|XP_006469674.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    425   5e-141   
ref|XP_004170388.1|  PREDICTED: L-ascorbate oxidase homolog             425   6e-141   
gb|KCW55012.1|  hypothetical protein EUGRSUZ_I00988                     429   7e-141   
emb|CAN72538.1|  hypothetical protein VITISV_028749                     429   1e-140   
ref|XP_009758923.1|  PREDICTED: L-ascorbate oxidase homolog             427   1e-140   
ref|XP_010547509.1|  PREDICTED: L-ascorbate oxidase homolog             426   2e-140   
ref|XP_009413373.1|  PREDICTED: L-ascorbate oxidase homolog             427   2e-140   
ref|XP_006383902.1|  multi-copper oxidase type 1 family protein         426   2e-140   
ref|XP_004509174.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    426   2e-140   
ref|XP_008440238.1|  PREDICTED: L-ascorbate oxidase homolog             426   2e-140   
emb|CDP10787.1|  unnamed protein product                                426   2e-140   
gb|KDO54690.1|  hypothetical protein CISIN_1g009283mg                   424   2e-140   
ref|XP_004166771.1|  PREDICTED: L-ascorbate oxidase homolog             426   2e-140   
gb|EAZ02087.1|  hypothetical protein OsI_24168                          426   3e-140   
gb|EPS74059.1|  hypothetical protein M569_00695                         426   4e-140   
gb|EYU38005.1|  hypothetical protein MIMGU_mgv1a004001mg                426   5e-140   
emb|CDY01453.1|  BnaA07g12260D                                          426   5e-140   
ref|XP_010103300.1|  L-ascorbate oxidase-like protein                   426   5e-140   
ref|XP_003550083.1|  PREDICTED: L-ascorbate oxidase homolog             425   7e-140   
gb|EAZ38022.1|  hypothetical protein OsJ_22366                          424   7e-140   
ref|XP_006656379.1|  PREDICTED: L-ascorbate oxidase homolog             425   9e-140   
ref|NP_001058365.1|  Os06g0678800                                       424   1e-139   
ref|XP_008447902.1|  PREDICTED: L-ascorbate oxidase homolog             424   1e-139   
ref|XP_011099220.1|  PREDICTED: L-ascorbate oxidase homolog             424   1e-139   
ref|XP_010676489.1|  PREDICTED: L-ascorbate oxidase homolog             424   1e-139   
ref|XP_006447580.1|  hypothetical protein CICLE_v10014842mg             424   1e-139   
gb|KEH20500.1|  multi-copper oxidase-like protein                       424   2e-139   
ref|XP_003517277.1|  PREDICTED: L-ascorbate oxidase homolog             424   2e-139   
ref|XP_011046313.1|  PREDICTED: L-ascorbate oxidase homolog             424   2e-139   
gb|AGJ03718.1|  multicopper oxidase                                     424   2e-139   
gb|ABK25092.1|  unknown                                                 423   2e-139   
gb|KDP31876.1|  hypothetical protein JCGZ_12337                         423   3e-139   
ref|XP_004144874.1|  PREDICTED: L-ascorbate oxidase homolog             424   3e-139   
ref|XP_009397777.1|  PREDICTED: L-ascorbate oxidase homolog             423   4e-139   
ref|XP_004141928.1|  PREDICTED: L-ascorbate oxidase homolog             423   4e-139   
ref|XP_007046383.1|  SKU5 similar 5 isoform 1                           423   4e-139   
ref|XP_004144498.1|  PREDICTED: L-ascorbate oxidase homolog             423   4e-139   
gb|KEH29685.1|  multi-copper oxidase-like protein                       422   6e-139   
ref|XP_008241557.1|  PREDICTED: L-ascorbate oxidase homolog             422   8e-139   
ref|XP_010046372.1|  PREDICTED: L-ascorbate oxidase homolog             422   9e-139   
ref|XP_002522337.1|  multicopper oxidase, putative                      422   1e-138   
ref|XP_009794442.1|  PREDICTED: L-ascorbate oxidase homolog             422   1e-138   
ref|XP_007204826.1|  hypothetical protein PRUPE_ppa003926mg             421   2e-138   
ref|XP_006348131.1|  PREDICTED: L-ascorbate oxidase homolog             422   2e-138   
ref|XP_009103469.1|  PREDICTED: L-ascorbate oxidase homolog             421   2e-138   
ref|XP_003611825.1|  L-ascorbate oxidase-like protein                   421   2e-138   
ref|XP_008455444.1|  PREDICTED: L-ascorbate oxidase homolog             421   2e-138   
ref|XP_006449754.1|  hypothetical protein CICLE_v10014825mg             421   3e-138   
ref|XP_002310162.1|  multi-copper oxidase type 1 family protein         421   3e-138   
gb|KDP20733.1|  hypothetical protein JCGZ_21204                         421   3e-138   
ref|XP_011039228.1|  PREDICTED: L-ascorbate oxidase homolog             421   3e-138   
gb|KHG03845.1|  L-ascorbate oxidase                                     421   4e-138   
gb|KHN36198.1|  L-ascorbate oxidase like                                421   4e-138   
ref|XP_004506275.1|  PREDICTED: L-ascorbate oxidase homolog             420   4e-138   
ref|XP_006425823.1|  hypothetical protein CICLE_v10025326mg             420   4e-138   
ref|XP_009408654.1|  PREDICTED: L-ascorbate oxidase homolog             420   5e-138   
ref|XP_004232701.1|  PREDICTED: L-ascorbate oxidase homolog             420   6e-138   
ref|XP_003537368.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    420   6e-138   
gb|KHG04142.1|  L-ascorbate oxidase                                     420   6e-138   
gb|EPS57861.1|  hypothetical protein M569_16956                         417   6e-138   
ref|XP_004296148.1|  PREDICTED: L-ascorbate oxidase homolog             419   7e-138   
ref|XP_010244491.1|  PREDICTED: L-ascorbate oxidase homolog             420   7e-138   
gb|KHN42054.1|  L-ascorbate oxidase like                                419   8e-138   
ref|XP_006467415.1|  PREDICTED: L-ascorbate oxidase homolog             420   8e-138   
ref|XP_011013814.1|  PREDICTED: L-ascorbate oxidase homolog             419   8e-138   
ref|XP_004243477.1|  PREDICTED: L-ascorbate oxidase homolog             419   9e-138   
ref|XP_008382461.1|  PREDICTED: L-ascorbate oxidase homolog             419   1e-137   
ref|XP_003605947.1|  L-ascorbate oxidase-like protein                   419   1e-137   
gb|EYU44359.1|  hypothetical protein MIMGU_mgv1a004187mg                419   1e-137   
ref|XP_006592035.1|  PREDICTED: L-ascorbate oxidase homolog             419   1e-137   
ref|XP_008798222.1|  PREDICTED: L-ascorbate oxidase homolog             419   1e-137   
ref|XP_010918208.1|  PREDICTED: L-ascorbate oxidase homolog             419   2e-137   
ref|XP_009612547.1|  PREDICTED: L-ascorbate oxidase homolog             419   2e-137   
gb|EMT20871.1|  L-ascorbate oxidase-like protein                        417   2e-137   
ref|XP_009758924.1|  PREDICTED: L-ascorbate oxidase homolog             419   2e-137   
ref|XP_010444713.1|  PREDICTED: L-ascorbate oxidase homolog             418   4e-137   
emb|CDP07321.1|  unnamed protein product                                418   4e-137   
ref|XP_003537754.1|  PREDICTED: L-ascorbate oxidase homolog             418   5e-137   
gb|ACN28536.1|  unknown                                                 413   6e-137   
ref|XP_004506310.1|  PREDICTED: L-ascorbate oxidase homolog             417   6e-137   
gb|KCW68031.1|  hypothetical protein EUGRSUZ_F01712                     416   8e-137   
ref|XP_006393891.1|  hypothetical protein EUTSA_v10003952mg             417   9e-137   
ref|XP_006280268.1|  hypothetical protein CARUB_v10026189mg             417   9e-137   
gb|KHN05478.1|  L-ascorbate oxidase like                                417   1e-136   
ref|XP_010070498.1|  PREDICTED: L-ascorbate oxidase homolog             417   1e-136   
ref|XP_009400332.1|  PREDICTED: L-ascorbate oxidase homolog             417   1e-136   
ref|XP_010558427.1|  PREDICTED: L-ascorbate oxidase homolog             416   1e-136   
ref|XP_004171059.1|  PREDICTED: L-ascorbate oxidase homolog             414   1e-136   
ref|XP_009803721.1|  PREDICTED: L-ascorbate oxidase homolog             417   1e-136   
ref|XP_009381277.1|  PREDICTED: L-ascorbate oxidase homolog             417   1e-136   
ref|XP_009347125.1|  PREDICTED: L-ascorbate oxidase homolog             416   1e-136   
ref|XP_008362259.1|  PREDICTED: L-ascorbate oxidase homolog             416   1e-136   
dbj|BAJ91397.1|  predicted protein                                      416   2e-136   
gb|ACF85744.1|  unknown                                                 412   2e-136   
ref|XP_010061137.1|  PREDICTED: L-ascorbate oxidase homolog             416   2e-136   
ref|XP_010255119.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    416   2e-136   
ref|XP_009353293.1|  PREDICTED: L-ascorbate oxidase homolog             416   3e-136   
ref|XP_002524823.1|  multicopper oxidase, putative                      415   4e-136   
ref|XP_010109886.1|  L-ascorbate oxidase-like protein                   415   4e-136   
gb|EYU39394.1|  hypothetical protein MIMGU_mgv11b015886mg               415   4e-136   
ref|XP_010266952.1|  PREDICTED: L-ascorbate oxidase homolog             415   4e-136   
ref|XP_004505676.1|  PREDICTED: L-ascorbate oxidase homolog             415   5e-136   
ref|XP_007131584.1|  hypothetical protein PHAVU_011G025400g             415   5e-136   
ref|XP_010263761.1|  PREDICTED: L-ascorbate oxidase homolog             414   8e-136   
ref|XP_004232058.1|  PREDICTED: L-ascorbate oxidase homolog             414   1e-135   
ref|XP_009623446.1|  PREDICTED: L-ascorbate oxidase homolog             414   1e-135   
ref|XP_011008684.1|  PREDICTED: L-ascorbate oxidase homolog             411   1e-135   
ref|XP_003527501.1|  PREDICTED: L-ascorbate oxidase homolog             414   1e-135   
ref|XP_010923873.1|  PREDICTED: L-ascorbate oxidase homolog             414   1e-135   
ref|XP_010905243.1|  PREDICTED: L-ascorbate oxidase homolog             413   1e-135   
gb|KDP22727.1|  hypothetical protein JCGZ_01829                         414   1e-135   
gb|AAL09733.1|  At1g76160/T23E18_10                                     414   1e-135   
gb|KEH30611.1|  multi-copper oxidase-like protein                       414   2e-135   
ref|XP_004233429.1|  PREDICTED: L-ascorbate oxidase homolog             414   2e-135   
ref|XP_008789823.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    414   2e-135   
ref|XP_008791980.1|  PREDICTED: L-ascorbate oxidase homolog             414   2e-135   
dbj|BAK00459.1|  predicted protein                                      414   2e-135   
ref|XP_002306213.1|  hypothetical protein POPTR_0004s18730g             414   2e-135   
emb|CAA65634.1|  PS60                                                   413   2e-135   
gb|ABK95805.1|  unknown                                                 413   2e-135   
ref|XP_007026108.1|  SKU5 similar 4 isoform 1                           413   3e-135   
ref|XP_002889063.1|  hypothetical protein ARALYDRAFT_895494             413   3e-135   
ref|XP_002866726.1|  predicted protein                                  412   4e-135   
ref|XP_004300548.1|  PREDICTED: L-ascorbate oxidase homolog             412   5e-135   
ref|NP_001147597.1|  LOC100281206 precursor                             413   5e-135   
ref|XP_009596487.1|  PREDICTED: L-ascorbate oxidase homolog             412   7e-135   
ref|XP_008384084.1|  PREDICTED: L-ascorbate oxidase homolog             412   7e-135   
ref|XP_004142986.1|  PREDICTED: L-ascorbate oxidase homolog             412   7e-135   
ref|XP_009402576.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    408   7e-135   
ref|XP_002268020.2|  PREDICTED: L-ascorbate oxidase homolog             412   8e-135   
ref|XP_009785141.1|  PREDICTED: L-ascorbate oxidase homolog             412   9e-135   
ref|XP_008371076.1|  PREDICTED: L-ascorbate oxidase homolog             412   1e-134   
ref|XP_010484570.1|  PREDICTED: L-ascorbate oxidase homolog             412   1e-134   
ref|NP_177743.1|  SKU5-like 5 protein                                   411   1e-134   
ref|XP_008445302.1|  PREDICTED: L-ascorbate oxidase homolog             411   1e-134   
gb|ABK25324.1|  unknown                                                 411   2e-134   
ref|XP_011096053.1|  PREDICTED: L-ascorbate oxidase homolog             411   2e-134   
ref|XP_002320467.1|  hypothetical protein POPTR_0014s15260g             410   2e-134   
ref|XP_006302110.1|  hypothetical protein CARUB_v10020107mg             411   2e-134   
ref|XP_010471765.1|  PREDICTED: L-ascorbate oxidase homolog             411   2e-134   
ref|XP_004509178.1|  PREDICTED: L-ascorbate oxidase homolog             411   2e-134   
ref|XP_010416527.1|  PREDICTED: L-ascorbate oxidase homolog             411   2e-134   
ref|XP_006360232.1|  PREDICTED: L-ascorbate oxidase homolog             410   2e-134   
emb|CDY68812.1|  BnaAnng28440D                                          407   2e-134   
ref|XP_003563038.1|  PREDICTED: L-ascorbate oxidase homolog             411   2e-134   
ref|XP_011046956.1|  PREDICTED: L-ascorbate oxidase homolog             411   2e-134   
ref|XP_004487420.1|  PREDICTED: L-ascorbate oxidase homolog             410   3e-134   
gb|ACL53812.1|  unknown                                                 411   3e-134   
ref|XP_003563398.1|  PREDICTED: L-ascorbate oxidase homolog             410   3e-134   
ref|XP_010099197.1|  L-ascorbate oxidase-like protein                   407   4e-134   
ref|XP_010428667.1|  PREDICTED: L-ascorbate oxidase homolog             410   4e-134   
ref|XP_010530339.1|  PREDICTED: L-ascorbate oxidase homolog             410   4e-134   
ref|XP_009402575.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    407   4e-134   
ref|XP_009619786.1|  PREDICTED: L-ascorbate oxidase homolog             410   4e-134   
ref|XP_010529443.1|  PREDICTED: L-ascorbate oxidase homolog             410   5e-134   
gb|KFK28370.1|  hypothetical protein AALP_AA8G506600                    410   5e-134   
emb|CBI18561.3|  unnamed protein product                                412   5e-134   
ref|XP_010255117.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    410   6e-134   
emb|CDP19581.1|  unnamed protein product                                410   6e-134   
dbj|BAK04971.1|  predicted protein                                      410   6e-134   
ref|XP_009777142.1|  PREDICTED: L-ascorbate oxidase homolog             409   6e-134   
gb|AAM97070.1|  pectinesterase, putative                                409   7e-134   
ref|XP_010263764.1|  PREDICTED: L-ascorbate oxidase homolog             409   7e-134   
ref|XP_006283464.1|  hypothetical protein CARUB_v10004509mg             410   7e-134   
ref|XP_010923874.1|  PREDICTED: L-ascorbate oxidase homolog             409   8e-134   
ref|XP_006338228.1|  PREDICTED: L-ascorbate oxidase homolog             409   9e-134   
ref|XP_004966212.1|  PREDICTED: L-ascorbate oxidase homolog             409   1e-133   
gb|KHG02352.1|  L-ascorbate oxidase                                     409   1e-133   
ref|XP_010667350.1|  PREDICTED: L-ascorbate oxidase homolog             409   1e-133   
ref|XP_002438855.1|  hypothetical protein SORBIDRAFT_10g027270          409   1e-133   
gb|EMT15848.1|  L-ascorbate oxidase-like protein                        409   1e-133   
ref|XP_009630902.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    409   2e-133   
ref|XP_006393890.1|  hypothetical protein EUTSA_v10003952mg             409   2e-133   
gb|KDO85017.1|  hypothetical protein CISIN_1g009149mg                   406   2e-133   
ref|XP_007026110.1|  SKU5 similar 4 isoform 3                           408   2e-133   
ref|XP_008241558.1|  PREDICTED: L-ascorbate oxidase homolog             408   2e-133   
ref|XP_007213900.1|  hypothetical protein PRUPE_ppa003872mg             408   2e-133   
ref|XP_010436936.1|  PREDICTED: L-ascorbate oxidase homolog             409   2e-133   
emb|CDP04415.1|  unnamed protein product                                408   2e-133   
ref|XP_009630899.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    408   2e-133   
ref|XP_002301616.1|  hypothetical protein POPTR_0002s21400g             408   3e-133   
ref|XP_007203632.1|  hypothetical protein PRUPE_ppa003976mg             408   3e-133   
ref|XP_010680450.1|  PREDICTED: L-ascorbate oxidase homolog             408   3e-133   
ref|XP_008806482.1|  PREDICTED: L-ascorbate oxidase homolog             408   3e-133   
ref|XP_006390229.1|  hypothetical protein EUTSA_v10018373mg             407   4e-133   
ref|XP_003596959.1|  L-ascorbate oxidase-like protein                   405   4e-133   
ref|XP_008387887.1|  PREDICTED: L-ascorbate oxidase homolog             407   4e-133   
ref|NP_173604.1|  SKU5 similar 7 protein                                407   5e-133   
ref|XP_009594576.1|  PREDICTED: L-ascorbate oxidase homolog             407   6e-133   
dbj|BAB08634.1|  pectinesterase like protein                            407   6e-133   
emb|CDY43557.1|  BnaC02g16540D                                          407   6e-133   
ref|XP_010929557.1|  PREDICTED: L-ascorbate oxidase homolog             407   7e-133   
ref|XP_009402574.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    407   7e-133   
ref|XP_009348086.1|  PREDICTED: L-ascorbate oxidase homolog             407   8e-133   
ref|NP_569041.1|  protein SKU5 similar 17                               407   8e-133   
ref|XP_009359037.1|  PREDICTED: L-ascorbate oxidase homolog             407   8e-133   
ref|NP_001053555.1|  Os04g0561900                                       407   8e-133   
ref|XP_009366415.1|  PREDICTED: L-ascorbate oxidase homolog             407   9e-133   
ref|XP_002285913.1|  PREDICTED: L-ascorbate oxidase homolog             407   9e-133   
emb|CAH67167.1|  H0211B05.4                                             407   9e-133   
ref|XP_010539810.1|  PREDICTED: L-ascorbate oxidase homolog             407   9e-133   
ref|XP_010536445.1|  PREDICTED: L-ascorbate oxidase homolog             407   1e-132   
ref|XP_010028303.1|  PREDICTED: L-ascorbate oxidase homolog             406   1e-132   
gb|EEE61490.1|  hypothetical protein OsJ_15776                          407   1e-132   
gb|ACJ85585.1|  unknown                                                 406   1e-132   
gb|KEH36280.1|  multi-copper oxidase-like protein                       406   1e-132   
gb|EEC77800.1|  hypothetical protein OsI_16980                          407   2e-132   
ref|XP_009115829.1|  PREDICTED: L-ascorbate oxidase homolog             406   2e-132   
ref|XP_004293304.1|  PREDICTED: L-ascorbate oxidase homolog             406   2e-132   
gb|AAM61328.1|  pectinesterase-like protein                             406   2e-132   
ref|XP_003540295.1|  PREDICTED: L-ascorbate oxidase homolog             405   2e-132   
ref|XP_009794441.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    404   2e-132   
ref|XP_011047251.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    406   2e-132   
gb|KHN33820.1|  L-ascorbate oxidase like                                405   2e-132   
ref|XP_006657750.1|  PREDICTED: L-ascorbate oxidase homolog             406   2e-132   



>ref|XP_009591795.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=558

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/410 (80%), Positives = 366/410 (89%), Gaps = 2/410 (0%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKI-DP  178
             LIP+PFD PADE+NVF+ DWYNKGHKTLKKILD G TI RPDG+ INGK  KVGDK+ + 
Sbjct  150   LIPIPFDKPADEYNVFLGDWYNKGHKTLKKILDGGRTIGRPDGIHINGKSSKVGDKVAEA  209

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFTMEAGKTYRYR+CNVGMRTSVN R +GHTM LVEMEGSHT+QNVYDSLDLHVGQCLSV
Sbjct  210   LFTMEAGKTYRYRMCNVGMRTSVNVRIQGHTMKLVEMEGSHTVQNVYDSLDLHVGQCLSV  269

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             LVTAD+EPKDYY+VVSSRF KQ  S+VAI+ YANG G  AS ELP  PP+NTEGIAWS+N
Sbjct  270   LVTADQEPKDYYMVVSSRFLKQALSSVAILRYANGKG-PASSELPTPPPDNTEGIAWSMN  328

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYG+INITRT+K+VNS+S V GKLR+ALNG+SH++TDT
Sbjct  329   QFRSFRWNLTASAARPNPQGSYHYGKINITRTMKIVNSRSQVAGKLRFALNGISHMDTDT  388

Query  719   PLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             PLKL E+FG+ EK FKYD++ D PP +  KVT++PNV NATFRNFVEI+FEN EKTIQTY
Sbjct  389   PLKLVEFFGVPEKTFKYDLIADEPPSDLSKVTISPNVKNATFRNFVEIIFENQEKTIQTY  448

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAV+IE G+WSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS
Sbjct  449   HLDGYSFFAVSIEPGKWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  508

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1228
             +MWER YLGQQLYFSVLSP RSLRDE+NLPD   LCG+VKGM MP PY+ 
Sbjct  509   EMWERFYLGQQLYFSVLSPSRSLRDEYNLPDNHPLCGIVKGMPMPAPYTA  558



>ref|XP_009766183.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=558

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/410 (80%), Positives = 365/410 (89%), Gaps = 2/410 (0%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDK-IDP  178
             LIP+PFD PA+E+NVF+ DWYNKGH+TLKKILD G TI RPDG+ INGK  KVGDK  + 
Sbjct  150   LIPIPFDKPAEEYNVFLGDWYNKGHRTLKKILDGGRTIGRPDGIHINGKSSKVGDKATEA  209

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFTMEAGKTYRYR+CNVGMRTSVN R +GHTM LVEMEGSHT+QNVYDSLD+HVGQCLSV
Sbjct  210   LFTMEAGKTYRYRMCNVGMRTSVNVRIQGHTMKLVEMEGSHTVQNVYDSLDIHVGQCLSV  269

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             LVTAD+EPKDYY+VVSSRF KQE S+VAI+ YANG G  AS ELP  PP+NTEGIAWS+N
Sbjct  270   LVTADQEPKDYYMVVSSRFLKQELSSVAILRYANGKG-PASSELPAPPPDNTEGIAWSMN  328

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYG+INITRT+K+VNS+S V GKLR+ALNG+SH++TDT
Sbjct  329   QFRSFRWNLTASAARPNPQGSYHYGKINITRTMKIVNSRSQVAGKLRFALNGISHMDTDT  388

Query  719   PLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             PLKL E+FG+ EK FKYD+M D PP +  KVT++PNV NATFRNFVEI+FEN EKTIQTY
Sbjct  389   PLKLVEFFGVPEKTFKYDLMADEPPSDLSKVTISPNVKNATFRNFVEIIFENEEKTIQTY  448

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAV IE G+WSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS
Sbjct  449   HLDGYSFFAVGIEPGKWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  508

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1228
             +MWER YLGQQLYFSVLSP RSLRDE+NLPD   LCG+VKGM MP PY+ 
Sbjct  509   EMWERFYLGQQLYFSVLSPSRSLRDEYNLPDNHPLCGIVKGMPMPAPYTA  558



>gb|AAQ90182.1| ntp101 [Nicotiana tabacum]
 gb|AAQ90184.1| ntp302 [Nicotiana tabacum]
Length=558

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/410 (80%), Positives = 365/410 (89%), Gaps = 2/410 (0%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKI-DP  178
             LIP+PFD PADE+NVF+ DWYNKGHKTLKKILD G TI RPDG+ INGK  KVGDK+ + 
Sbjct  150   LIPIPFDKPADEYNVFLGDWYNKGHKTLKKILDGGRTIGRPDGIHINGKSSKVGDKVAEA  209

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFTMEAGKTYRYR+CNVGMRTSVN R +GHTM LVEMEGSHT+QNVYDSLDLHVGQCLSV
Sbjct  210   LFTMEAGKTYRYRMCNVGMRTSVNVRIQGHTMKLVEMEGSHTVQNVYDSLDLHVGQCLSV  269

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             LVTAD+EPKDYY+VVSSRF KQ  S+VAI+ YANG G  AS ELP  PP+NTEGIAWS+N
Sbjct  270   LVTADQEPKDYYMVVSSRFLKQALSSVAILRYANGKG-PASSELPTPPPDNTEGIAWSMN  328

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYG+INITRT+K+VNS+S V GKLR+ALNG+SH++TDT
Sbjct  329   QFRSFRWNLTASAARPNPQGSYHYGKINITRTMKIVNSRSQVAGKLRFALNGISHMDTDT  388

Query  719   PLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             PLKL E+FG+ EK FKYD++ D PP +  KVT++ NV NATFRNFVEI+FEN EKTIQTY
Sbjct  389   PLKLVEFFGVPEKTFKYDLIADEPPSDLSKVTISSNVKNATFRNFVEIIFENQEKTIQTY  448

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAV+IE G+WSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS
Sbjct  449   HLDGYSFFAVSIEPGKWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  508

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1228
             +MWER YLGQQLYFSVLSP RSLRDE+NLPD   LCG+VKGM MP PY+ 
Sbjct  509   EMWERFYLGQQLYFSVLSPSRSLRDEYNLPDNHPLCGIVKGMPMPAPYTA  558



>ref|XP_006367595.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=567

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/414 (78%), Positives = 361/414 (87%), Gaps = 7/414 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIP+PFD PADE+NVF+ DWYNKGHK LKK LD G TI RPDG+ INGK  K+GDK +PL
Sbjct  152   LIPIPFDKPADEYNVFLGDWYNKGHKALKKTLDGGRTIGRPDGIHINGKSNKLGDKAEPL  211

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             F+MEAGK YRYR+CNVGMRTSVN R +GH M LVEMEGSHT+QN+YDSLD+HVGQCLSVL
Sbjct  212   FSMEAGKIYRYRMCNVGMRTSVNVRIQGHAMKLVEMEGSHTVQNMYDSLDIHVGQCLSVL  271

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGI---TASPELPPSPPENTEGIAWS  532
             VTAD+EPKDYY+VVSSRF KQ  S+VAI+ YANG G+   + S  LP  PP NT+GIAWS
Sbjct  272   VTADQEPKDYYMVVSSRFLKQAISSVAILRYANGKGVGSTSISDHLPTPPPNNTQGIAWS  331

Query  533   INQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINT  712
             +NQFRSFRWNLTASAARPNPQGSYHYGQINITRTIK+VNS+S V+GKLR+ALNG+SH+++
Sbjct  332   MNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKIVNSRSQVNGKLRFALNGISHMDS  391

Query  713   DTPLKLAEYFGISEKVFKYDIMGDTPP----ENGEKVTLAPNVVNATFRNFVEIVFENHE  880
             DTPLKL EYFG++EK FKYD+MGD PP     N + VT+APNV NATFRNFVEI+FEN E
Sbjct  392   DTPLKLVEYFGVAEKTFKYDVMGDEPPTPSSNNNKVVTIAPNVKNATFRNFVEIIFENEE  451

Query  881   KTIQTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAG  1060
             KTIQTYHLDG+SFFAV IE G+W PEKRKNYNLVDAVSRHSIQVYPNSWAA+MTTLDNAG
Sbjct  452   KTIQTYHLDGYSFFAVGIEPGKWKPEKRKNYNLVDAVSRHSIQVYPNSWAAIMTTLDNAG  511

Query  1061  MWNLRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             +WNLRSDMWER YLGQQLYFSVLSP RSLRDE+NLPD   LCG+VK M MPPPY
Sbjct  512   IWNLRSDMWERNYLGQQLYFSVLSPSRSLRDEYNLPDNHPLCGIVKSMPMPPPY  565



>ref|XP_006341879.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=554

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/407 (77%), Positives = 362/407 (89%), Gaps = 1/407 (0%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD+PADE+NVF+ DWYNKGHKTLKK+LD GHT+ RPDG++INGK  KVG+  +PL
Sbjct  147   LIPVPFDNPADEYNVFVGDWYNKGHKTLKKVLDGGHTVGRPDGIIINGKSAKVGEAKEPL  206

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTMEAGKTYRYR CN+GMR+SVN RF+GH M LVE+EGSHT+QN+YDSLDLHVGQCLSVL
Sbjct  207   FTMEAGKTYRYRFCNLGMRSSVNVRFQGHPMKLVELEGSHTVQNIYDSLDLHVGQCLSVL  266

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+EPKDYYLVVSSRF KQE S+VAII YANG G  ASPELP SPP+NTEGIAWS+NQ
Sbjct  267   VTADQEPKDYYLVVSSRFLKQELSSVAIIRYANGKG-PASPELPASPPDNTEGIAWSMNQ  325

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYGQINITRTIK++NS   V+GKLRY LNG+SH +T+TP
Sbjct  326   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKIINSMGQVNGKLRYGLNGISHSDTETP  385

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKL EYFG ++K FKYD+M D  P +  K+T+APNV NAT+RNFVEI+FENHEK+I+TYH
Sbjct  386   LKLVEYFGAADKTFKYDLMADEAPADPSKLTVAPNVKNATYRNFVEIIFENHEKSIRTYH  445

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA+E G+WS EKRKNYNLVDA SR++IQVYPNSWAA+M T DNAGMWNLRS+
Sbjct  446   LDGYSFFAVAVEPGKWSAEKRKNYNLVDATSRNNIQVYPNSWAAIMLTFDNAGMWNLRSE  505

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             MWE+ YLG+QLYFSVLSP RSLRDE+NLPD   LCG+VKGM +P PY
Sbjct  506   MWEKTYLGEQLYFSVLSPGRSLRDEYNLPDNHPLCGVVKGMPLPTPY  552



>dbj|BAO02510.1| predicted pollen-specific protein ortholog [Nicotiana alata]
Length=555

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/407 (78%), Positives = 357/407 (88%), Gaps = 1/407 (0%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD+PADE+NVF+ DWYNKGHKTLKKILD G TI RPDG++INGK  KVG+  +PL
Sbjct  148   LIPVPFDNPADEYNVFVGDWYNKGHKTLKKILDGGRTIGRPDGIIINGKSAKVGEAKEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTMEAGKTYRYR CN+GMR+SVN RF+GH M LVE+EGSHT+QN+YDSLDLHVGQC SVL
Sbjct  208   FTMEAGKTYRYRFCNLGMRSSVNIRFQGHPMKLVELEGSHTVQNIYDSLDLHVGQCFSVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+EPKDYYLVVSSRF KQ  S+VAII YANG G  ASPELP  PPENTEGIAWS+NQ
Sbjct  268   VTADQEPKDYYLVVSSRFLKQALSSVAIIRYANGKG-PASPELPTPPPENTEGIAWSMNQ  326

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYGQINITRTIK+ NSKS VDGKLRY LNG+SH + +TP
Sbjct  327   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKIFNSKSQVDGKLRYGLNGISHTDGETP  386

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKL EYFG ++K FKYD+M D  P +  K+T+  NV NAT+RNFVEI+FENHEKTI+TYH
Sbjct  387   LKLVEYFGATDKAFKYDLMADEAPADATKLTITANVKNATYRNFVEIIFENHEKTIRTYH  446

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA+E GRWSPEKRKNYNLVD +SR++IQVYPNSWAA+M T DNAGMWNLRS+
Sbjct  447   LDGYSFFAVAVEPGRWSPEKRKNYNLVDGLSRNNIQVYPNSWAAIMLTFDNAGMWNLRSE  506

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             MWE+ YLG+QLYFSVLSP RSLRDE+N+PD   LCG+VKGM MP PY
Sbjct  507   MWEKTYLGEQLYFSVLSPSRSLRDEYNIPDNHPLCGIVKGMPMPAPY  553



>sp|P29162.1|ASOL_TOBAC RecName: Full=L-ascorbate oxidase homolog; AltName: Full=Pollen-specific 
protein NTP303; Flags: Precursor [Nicotiana tabacum]
 emb|CAA43454.1| pollen specific protein [Nicotiana tabacum]
Length=554

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/407 (78%), Positives = 357/407 (88%), Gaps = 1/407 (0%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD+PADE+NVF+ DWYNKGHKTLKKILD G TI RPDG++INGK  KVG+  +PL
Sbjct  147   LIPVPFDNPADEYNVFVGDWYNKGHKTLKKILDGGRTIGRPDGIIINGKSAKVGEAKEPL  206

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTMEAGKTYRYR CN+GMR+SVN RF+GH M LVE+EGSHT+QN+YDSLDLHVGQCLSVL
Sbjct  207   FTMEAGKTYRYRFCNLGMRSSVNIRFQGHPMKLVELEGSHTVQNIYDSLDLHVGQCLSVL  266

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+EPKDYYLVVSSRF KQ  S+VAII YANG G  ASPELP  PPENTEGIAWS+NQ
Sbjct  267   VTADQEPKDYYLVVSSRFLKQALSSVAIIRYANGKG-PASPELPTPPPENTEGIAWSMNQ  325

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYGQINITRTIK+ NS S V GKLRY LNG+SH N +TP
Sbjct  326   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKIFNSMSQVGGKLRYGLNGISHTNGETP  385

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKL EYFG + K FKYD+M D  P +  K+T+A NV NAT+RNFVEI+FENHEKTI+TYH
Sbjct  386   LKLVEYFGATNKAFKYDLMADEAPADPSKLTIATNVKNATYRNFVEIIFENHEKTIRTYH  445

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA+E GRWSPEKRKNYNLVD +SR++IQVYPNSWAA+M T DNAGMWNLRS+
Sbjct  446   LDGYSFFAVAVEPGRWSPEKRKNYNLVDGLSRNNIQVYPNSWAAIMLTFDNAGMWNLRSE  505

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             MWE+ YLG+QLYFSVLSP RSLRDE+N+PD   LCG+VKG+SMP PY
Sbjct  506   MWEKTYLGEQLYFSVLSPSRSLRDEYNIPDNHPLCGIVKGLSMPAPY  552



>ref|XP_009588330.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=589

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/407 (78%), Positives = 358/407 (88%), Gaps = 1/407 (0%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD+PADE+NVF+ DWYNKGHKTLKKILD G TI RPDG++INGK  KVG+  +PL
Sbjct  182   LIPVPFDNPADEYNVFVGDWYNKGHKTLKKILDGGRTIGRPDGIIINGKSAKVGEAKEPL  241

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTMEAGKTYRYR CN+GMR+SVN RF+GH M LVE+EGSHT+QN+YDSLDLHVGQCLSVL
Sbjct  242   FTMEAGKTYRYRFCNLGMRSSVNIRFQGHPMKLVELEGSHTVQNIYDSLDLHVGQCLSVL  301

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+EPKDYYLVVSSRF KQ  S+VAII YANG G  ASPELP  PPENTEGIAWS+NQ
Sbjct  302   VTADQEPKDYYLVVSSRFLKQALSSVAIIRYANGKG-PASPELPTPPPENTEGIAWSMNQ  360

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYGQINITRTIK+ NS S V GKLRY LNG+SH N +TP
Sbjct  361   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKIFNSMSQVGGKLRYGLNGISHTNGETP  420

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKL EYFG ++K FKYD+M D  P +  K+T+A NV NAT+RNFVEI+FENHEKTI+TYH
Sbjct  421   LKLVEYFGATDKAFKYDLMADEAPADPSKLTIATNVKNATYRNFVEIIFENHEKTIRTYH  480

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA+E GRWSPEKRKNYNLVD +SR++IQVYPNSWAA+M T DNAGMWNLRS+
Sbjct  481   LDGYSFFAVAVEPGRWSPEKRKNYNLVDGLSRNNIQVYPNSWAAIMLTFDNAGMWNLRSE  540

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             MWE+ YLG+QLYFSVLSP RSLRDE+N+PD   LCG+VKG+SMP PY
Sbjct  541   MWEKTYLGEQLYFSVLSPSRSLRDEYNIPDNHPLCGIVKGLSMPAPY  587



>ref|XP_009773470.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=554

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/407 (78%), Positives = 358/407 (88%), Gaps = 1/407 (0%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD+PADE+NVF+ DWYNKGHKTLKKILD G TI R DG++INGK  KVG+  + L
Sbjct  147   LIPVPFDNPADEYNVFVGDWYNKGHKTLKKILDGGRTIGRADGIIINGKSAKVGEAKESL  206

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTMEAGKTYRYR CN+GMR+SVN RF+GH M LVE+EGSHT+QN+YDSLDLHVGQCLSVL
Sbjct  207   FTMEAGKTYRYRFCNLGMRSSVNVRFQGHPMKLVELEGSHTVQNIYDSLDLHVGQCLSVL  266

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+EPKDYYLVVSSRF KQ  S+VAII YANG G  ASPELP  PPENTEGIAWS+NQ
Sbjct  267   VTADQEPKDYYLVVSSRFLKQALSSVAIIRYANGKG-PASPELPTPPPENTEGIAWSMNQ  325

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYGQINITRTIK+ NSKS VDGKLRY LNG+SH +++TP
Sbjct  326   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKIFNSKSQVDGKLRYGLNGISHTDSETP  385

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKL EYFG ++K FKYD+M D  P +  K+T+A NV NAT+RNFVEI+FENHEKTI+TYH
Sbjct  386   LKLVEYFGATDKAFKYDLMADEAPADSTKLTIAANVKNATYRNFVEIIFENHEKTIRTYH  445

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA+E GRWSPEKRKNYNLVD +SR++IQVYPNSWAA+M T DNAGMWNLRS+
Sbjct  446   LDGYSFFAVAVEPGRWSPEKRKNYNLVDGLSRNNIQVYPNSWAAIMLTFDNAGMWNLRSE  505

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             MWE+ YLG+QLYFSVLSP RSLRDE+N+PD   LCG+VKGM MP PY
Sbjct  506   MWEKTYLGEQLYFSVLSPSRSLRDEYNIPDNHPLCGIVKGMPMPAPY  552



>ref|XP_009624631.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=559

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/411 (80%), Positives = 365/411 (89%), Gaps = 5/411 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKI-DP  178
             LIPVPFD+PADE+NVF+ DWYNKG+K+LKKILD G TI RPDG+ INGK  KVGDK+ +P
Sbjct  148   LIPVPFDNPADEYNVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHINGKSVKVGDKVAEP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFTMEAGKTYRYRVCN GMRTSVNFR +GH M LVEMEGSHT+QNVY+SLDLHVGQCLSV
Sbjct  208   LFTMEAGKTYRYRVCNAGMRTSVNFRIQGHPMKLVEMEGSHTVQNVYESLDLHVGQCLSV  267

Query  359   LVTADKEPKDYYLVVSSRFFKQ-EFSTVAIISYANGNGITASPELPPSPPENTEGIAWSI  535
             LVTAD+EPKDYY++VSSRF KQ + S+VAII YANG G  AS +LP  PPENT+GIAWSI
Sbjct  268   LVTADQEPKDYYMIVSSRFLKQAQLSSVAIIRYANGKG-PASSDLPAPPPENTQGIAWSI  326

Query  536   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINT-  712
             NQFRSFRWNLTASAARPNPQGSYHYGQINITRT K+VNS+S VDGKLR+ALNG+SH N  
Sbjct  327   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKIVNSRSEVDGKLRFALNGISHTNAA  386

Query  713   DTPLKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTI  889
             +TP KLAEYFG++EK+FKYD+M D P  ++  KVT+APN+ NATFRNFVEI+FEN EKTI
Sbjct  387   ETPFKLAEYFGVTEKMFKYDLMADEPQTDDLNKVTVAPNIKNATFRNFVEIIFENREKTI  446

Query  890   QTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWN  1069
             QTYHLDG+SFFAVAIE G+WS EKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAG+WN
Sbjct  447   QTYHLDGYSFFAVAIEPGKWSAEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGLWN  506

Query  1070  LRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             LRS+MWER YLGQQLYFSVLSP RSLRDE+NLPD   LCG+VK M MP PY
Sbjct  507   LRSEMWERYYLGQQLYFSVLSPARSLRDEYNLPDNHPLCGIVKSMPMPSPY  557



>ref|XP_004229062.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=554

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/407 (77%), Positives = 360/407 (88%), Gaps = 1/407 (0%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD+PADE+NVF+ DWYNKGHKTLKK+LD GHT+ RPDG++INGK  KVG+  +PL
Sbjct  147   LIPVPFDNPADEYNVFVGDWYNKGHKTLKKVLDGGHTVGRPDGIIINGKSAKVGEAKEPL  206

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTMEAGKTYRYR CN+GMR+SVN R +GH M LVE+EGSHT+QN+YDSLD+HVGQCLSVL
Sbjct  207   FTMEAGKTYRYRFCNLGMRSSVNVRLQGHPMKLVELEGSHTVQNIYDSLDIHVGQCLSVL  266

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++EPKDYYLVVSSRF KQE S+VAII YANG G  ASPELP SPP+NTEGIAWS+NQ
Sbjct  267   VTANQEPKDYYLVVSSRFLKQELSSVAIIRYANGKG-PASPELPASPPDNTEGIAWSMNQ  325

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYGQINITRTIK+VNS   V+GKLRY LNG+SH +T+TP
Sbjct  326   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKIVNSMGQVNGKLRYGLNGISHSDTETP  385

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKL EYFG ++K FKYD+M D  P +  K+T+APNV N T+RNFVEI+FENHEK+I+TYH
Sbjct  386   LKLVEYFGAADKSFKYDLMADEAPADPSKLTVAPNVKNTTYRNFVEIIFENHEKSIRTYH  445

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA+E GRWS EKRKNYNLVDA SR++IQVYPNSWAA+M T DNAGMWNLRS+
Sbjct  446   LDGYSFFAVAVEPGRWSAEKRKNYNLVDATSRNNIQVYPNSWAAIMLTFDNAGMWNLRSE  505

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             MWE+ YLG+Q+YFSVLSP RSLRDE+NLPD   LCG+VKGM +P PY
Sbjct  506   MWEKTYLGEQMYFSVLSPSRSLRDEYNLPDNHPLCGVVKGMPLPAPY  552



>gb|AAQ90185.1| ntp805 [Nicotiana tabacum]
Length=559

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/411 (79%), Positives = 365/411 (89%), Gaps = 5/411 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKI-DP  178
             LIPVPFD+PADE+NVF+ DWYNKG+K+LKKILD G TI RPDG+ INGK  KVGDK+ +P
Sbjct  148   LIPVPFDNPADEYNVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHINGKSVKVGDKVAEP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFTMEAGKTYRYRVCN GMRTSVNFR +GH M LVEMEGSHT+QNVY+SLDLHVGQCLSV
Sbjct  208   LFTMEAGKTYRYRVCNAGMRTSVNFRIQGHPMKLVEMEGSHTVQNVYESLDLHVGQCLSV  267

Query  359   LVTADKEPKDYYLVVSSRFFKQ-EFSTVAIISYANGNGITASPELPPSPPENTEGIAWSI  535
             LVTAD+EPKDYY++VSSRF KQ + S+VAII YANG G  AS +LP  PPENT+GIAWSI
Sbjct  268   LVTADQEPKDYYMIVSSRFLKQAQLSSVAIIRYANGKG-PASSDLPAPPPENTQGIAWSI  326

Query  536   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINT-  712
             NQFRSFRWNLTASAARPNPQGSYHYGQINITRT K+VNS++ VDGKLR+ALNG+SH N  
Sbjct  327   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKIVNSRTEVDGKLRFALNGISHTNAA  386

Query  713   DTPLKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTI  889
             +TP KLAEYFG++EK+FKYD+M D P  ++  KVT+APN+ NATFRNFVEI+FEN EKTI
Sbjct  387   ETPFKLAEYFGVTEKMFKYDLMADEPQTDDLNKVTVAPNIKNATFRNFVEIIFENREKTI  446

Query  890   QTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWN  1069
             QTYHLDG+SFFAVAIE G+WS EKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAG+WN
Sbjct  447   QTYHLDGYSFFAVAIEPGKWSAEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGLWN  506

Query  1070  LRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             LRS+MWER YLGQQLYFSVLSP RSLRDE+NLPD   LCG+VK M MP PY
Sbjct  507   LRSEMWERYYLGQQLYFSVLSPARSLRDEYNLPDNHPLCGIVKSMPMPSPY  557



>ref|XP_009785667.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
 gb|AAQ90183.1| ntp201 [Nicotiana tabacum]
Length=559

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/411 (79%), Positives = 362/411 (88%), Gaps = 5/411 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKI-DP  178
             LIPVPFD+PADE+NVF+ DWYNKG+K+LKKILD G TI RPDG+ INGK  KVGDK+ +P
Sbjct  148   LIPVPFDNPADEYNVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHINGKSLKVGDKVAEP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFTMEAGKTYRYR+CN GMRTSVN R +GH M LVEMEGSHT+QNVY+SLDLHVGQCLSV
Sbjct  208   LFTMEAGKTYRYRMCNAGMRTSVNVRIQGHPMKLVEMEGSHTVQNVYESLDLHVGQCLSV  267

Query  359   LVTADKEPKDYYLVVSSRFFKQ-EFSTVAIISYANGNGITASPELPPSPPENTEGIAWSI  535
             LVTAD+EPKDYY++VSSRF KQ + S+VAII YANG G  AS +LP  PPENT+GIAWSI
Sbjct  268   LVTADQEPKDYYMIVSSRFLKQAQLSSVAIIRYANGKG-PASSDLPAPPPENTQGIAWSI  326

Query  536   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINT-  712
             NQFRSFRWNLTASAARPNPQGSYHYGQINITRT K+VNS+S VDGKLR+ALNG+SH    
Sbjct  327   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKIVNSRSEVDGKLRFALNGISHTAAG  386

Query  713   DTPLKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTI  889
             +TP KLAEYFG ++K+FKYD+M D P  E+  KVT+ PN+ NATFRNFVEI+FEN EKTI
Sbjct  387   ETPFKLAEYFGATDKLFKYDLMADEPQTEDLNKVTVVPNIKNATFRNFVEIIFENREKTI  446

Query  890   QTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWN  1069
             QTYHLDG+SFFAVAIE GRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAG+WN
Sbjct  447   QTYHLDGYSFFAVAIEPGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGLWN  506

Query  1070  LRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             LRS+MWER YLGQQLYFSVLSP RSLRDE+NLPD   LCG+VK M +P PY
Sbjct  507   LRSEMWERFYLGQQLYFSVLSPARSLRDEYNLPDNHPLCGIVKSMPLPSPY  557



>ref|XP_004228635.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=557

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/409 (77%), Positives = 362/409 (89%), Gaps = 3/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKI-DP  178
             LIPVPFD+PAD+++VF+ DWYNKG+K+LKKILD G TI RPDG+ INGK  KVG+K+ +P
Sbjct  148   LIPVPFDNPADDYSVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHINGKSEKVGEKVAEP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             L+ MEAGKTYRYR CNVGMRTSVN R +GH M LVE+EGSHT+QNVY+SLDLHVGQCLSV
Sbjct  208   LYKMEAGKTYRYRFCNVGMRTSVNVRIQGHPMKLVEIEGSHTVQNVYESLDLHVGQCLSV  267

Query  359   LVTADKEPKDYYLVVSSRFFKQ-EFSTVAIISYANGNGITASPELPPSPPENTEGIAWSI  535
             LVTAD+EPKDYY++VSSRF KQ E S+V+II Y NG G  AS +LP  PPENT+GIAWS+
Sbjct  268   LVTADQEPKDYYMIVSSRFLKQAELSSVSIIRYVNGKG-PASSDLPAPPPENTQGIAWSM  326

Query  536   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTD  715
             NQFRSFRWNLTASAARPNPQGSYHYGQINITRT K+VNS++ VDGKLRYALNG+SH +++
Sbjct  327   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKIVNSRTEVDGKLRYALNGISHTDSE  386

Query  716   TPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             TP KLAEYFG ++KVFKYD+M D P    +KVT+A N+ NATFRNFVEIVFENHEKTIQT
Sbjct  387   TPFKLAEYFGATDKVFKYDLMPDQPSTPDDKVTIASNIKNATFRNFVEIVFENHEKTIQT  446

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             YHLDG+SFFAVA+E G+W+PEKRKNYNLVDA+SRHSIQVYPNSWAAVMTTLDNAG+W+LR
Sbjct  447   YHLDGYSFFAVAVEPGKWTPEKRKNYNLVDAISRHSIQVYPNSWAAVMTTLDNAGLWSLR  506

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             S+MWER YLGQQLYFSVLSP RSLRDE+NLPD   LCG+VK M MP PY
Sbjct  507   SEMWERFYLGQQLYFSVLSPARSLRDEYNLPDNHPLCGIVKTMPMPSPY  555



>ref|XP_006354116.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=557

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/409 (77%), Positives = 361/409 (88%), Gaps = 3/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKI-DP  178
             LIPVPFD+PAD+++VF+ DWYNKG+K+LKKILD G TI RPDG+ INGK  KVGDK  +P
Sbjct  148   LIPVPFDNPADDYSVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHINGKSVKVGDKAAEP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             L+ MEAGKTYRYR CNVGMRTSVN R +GH M LVE+EGSHT+QNVY+SLDLHVGQCLSV
Sbjct  208   LYKMEAGKTYRYRFCNVGMRTSVNVRIQGHPMKLVEIEGSHTVQNVYESLDLHVGQCLSV  267

Query  359   LVTADKEPKDYYLVVSSRFFKQ-EFSTVAIISYANGNGITASPELPPSPPENTEGIAWSI  535
             LVTAD+EPKDYY++VSSRF KQ E S+V+II Y NG G  AS +LP  PPENT+GIAWS+
Sbjct  268   LVTADQEPKDYYMIVSSRFLKQAELSSVSIIRYTNGKG-PASSDLPAPPPENTKGIAWSM  326

Query  536   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTD  715
             NQFRSFRWNLTASAARPNPQGSYHYGQINITRT K+VNS+S VDGKLRYALNG+SH +++
Sbjct  327   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKIVNSRSEVDGKLRYALNGISHTDSE  386

Query  716   TPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             TP KLAEYFG ++KVFKYD+M D P  + +KVT+A N+ NATFRNFVEI+FENHEKTIQT
Sbjct  387   TPFKLAEYFGATDKVFKYDLMDDEPSTSSDKVTVASNIKNATFRNFVEIIFENHEKTIQT  446

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             YHLDG+SFFAV +E G+W+PEKRKNYNLVDA++RHSIQVYPNSWAAVMTTLDNAG+W+LR
Sbjct  447   YHLDGYSFFAVGVEPGKWTPEKRKNYNLVDAINRHSIQVYPNSWAAVMTTLDNAGLWSLR  506

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             S+MWER YLGQQLYFSVLSP RSLRDE+NLPD   LCG+VK M MP PY
Sbjct  507   SEMWERFYLGQQLYFSVLSPARSLRDEYNLPDNHPLCGIVKSMPMPSPY  555



>gb|EYU32815.1| hypothetical protein MIMGU_mgv1a003910mg [Erythranthe guttata]
Length=555

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/408 (76%), Positives = 350/408 (86%), Gaps = 2/408 (0%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKI-DP  178
             LIPVPFD PADEF V + DWYNKGHKTLK+ILDSG +I +PDG+ INGK   VGD    P
Sbjct  148   LIPVPFDMPADEFAVLLGDWYNKGHKTLKRILDSGRSIGKPDGIQINGKSSSVGDAAAQP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             L  ME GKTYRYRVCNVGM+ SVNFRF+GHTM LVE+EGSHT+QNVYDSLDLHVGQCLSV
Sbjct  208   LAVMEPGKTYRYRVCNVGMKLSVNFRFQGHTMKLVELEGSHTVQNVYDSLDLHVGQCLSV  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             LVTAD+ PKDYYLVVSSRF K+  STVA+I Y NGNG  AS  +PP P EN  GIAWS+N
Sbjct  268   LVTADQAPKDYYLVVSSRFSKKVMSTVAVIRYKNGNG-AASLSIPPPPAENRAGIAWSMN  326

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYG+INITRTIK+ NS + VDGKLR+ +NG+SH+NT+T
Sbjct  327   QFRSFRWNLTASAARPNPQGSYHYGKINITRTIKIANSHAVVDGKLRFGINGISHVNTET  386

Query  719   PLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             PLKLAEYFG+ +KVF Y++M D P E   K+ LAP+VVNATFRNFVEI+FEN EKTIQT+
Sbjct  387   PLKLAEYFGLGDKVFTYNLMKDEPTEGDNKLALAPSVVNATFRNFVEIIFENREKTIQTW  446

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVA+E GRW+PEKRKNYNL+DAVSRH+IQVYPNSWAAVMTTLDNAGMWNLRS
Sbjct  447   HLDGYSFFAVAVEPGRWAPEKRKNYNLLDAVSRHTIQVYPNSWAAVMTTLDNAGMWNLRS  506

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             DM ER YLGQQ YFSVLSPE SLRDE+N+   QQLCG+V G+ MP PY
Sbjct  507   DMLERTYLGQQFYFSVLSPENSLRDEYNIFPTQQLCGIVSGLPMPAPY  554



>gb|EYU32814.1| hypothetical protein MIMGU_mgv1a003925mg [Erythranthe guttata]
Length=555

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/408 (75%), Positives = 349/408 (86%), Gaps = 2/408 (0%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGD-KIDP  178
             LIPVPFD PADEF V + DWYNKGHKTLKKILDSG +I +PDG+ INGK  KVGD    P
Sbjct  148   LIPVPFDMPADEFAVLLGDWYNKGHKTLKKILDSGRSIGKPDGIQINGKSSKVGDVAAQP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             L  ME GKTYRYRVCNVGM+ SVNFRF+GHTM LVE+EGSHT+QNVYDSLDLHVGQCLSV
Sbjct  208   LAVMEPGKTYRYRVCNVGMKLSVNFRFQGHTMKLVELEGSHTVQNVYDSLDLHVGQCLSV  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             LVTA++ PKDYYLVVSSRF KQ  S+VA+I Y N NG  AS  +PP P EN  GIAWS+N
Sbjct  268   LVTANQAPKDYYLVVSSRFSKQVMSSVAVIKYKNANG-AASTVIPPPPAENRVGIAWSMN  326

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYG+INITRTIK+ N+ + VDGKLR+ +NG+SH+NT+T
Sbjct  327   QFRSFRWNLTASAARPNPQGSYHYGKINITRTIKIANTHAVVDGKLRFGINGISHVNTET  386

Query  719   PLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             PLKLAEYFG+ +KVF Y++M D P E   K+ +AP+VVNATFRNFVEI+FEN EKTIQT+
Sbjct  387   PLKLAEYFGLGDKVFTYNLMKDEPTEGDNKLVVAPSVVNATFRNFVEIIFENREKTIQTW  446

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVA+E GRWSPEKRK YNL+DAVSRH+IQVYPNSW+AVMTTLDNAGMWNLRS
Sbjct  447   HLDGYSFFAVAVEPGRWSPEKRKTYNLLDAVSRHTIQVYPNSWSAVMTTLDNAGMWNLRS  506

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             DM ER YLGQQ YFSVLSPE SLRDE+N+   QQLCG+V G+ MP PY
Sbjct  507   DMLERTYLGQQFYFSVLSPENSLRDEYNIFPTQQLCGIVSGLPMPAPY  554



>gb|AAL87103.1|AF479568_1 1-ascorbate oxidase [Petunia x hybrida]
Length=559

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/410 (78%), Positives = 354/410 (86%), Gaps = 5/410 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKI-DP  178
             LIP+PFDSPA E+NVF+ DWYNKG+K+LKKILD G TI RPDG+ INGK GKVGD   +P
Sbjct  150   LIPIPFDSPAAEYNVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHINGKSGKVGDNAAEP  209

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFTMEAGKTYRYR+CNVGMRTSVN R +GHTM LVEMEGSHT+QNVY+SLDLHVGQCLSV
Sbjct  210   LFTMEAGKTYRYRMCNVGMRTSVNVRIQGHTMKLVEMEGSHTVQNVYESLDLHVGQCLSV  269

Query  359   LVTADKEPKDYYLVVSSRFFKQ-EFSTVAIISYANGNGITASPELPPSPPENTEGIAWSI  535
             LVTAD+EPK YY+VVSSRF KQ E S+VAI+ YANG G  AS +LP  PP+NTEGIAWSI
Sbjct  270   LVTADQEPKGYYMVVSSRFLKQAELSSVAIVRYANGKG-PASSDLPAPPPDNTEGIAWSI  328

Query  536   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTD  715
             NQFRSFRWNLTASAARPNPQGSYHYGQINITRTIK+ NS+S V GKLR+ALNG+SH   +
Sbjct  329   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKIANSRSQVGGKLRFALNGISHSPAE  388

Query  716   TPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             TP KLAEYFG ++KVFKYD+M D PP +G+KVT+  N+ NAT+RN+VEI+FEN EKTIQT
Sbjct  389   TPFKLAEYFGATDKVFKYDLMADEPP-SGDKVTVDHNIKNATYRNYVEIIFENREKTIQT  447

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             YHLDG+SFFAVAIE G+WSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAG+WNLR
Sbjct  448   YHLDGYSFFAVAIEPGKWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGLWNLR  507

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQL-CGLVKGMSMPPPY  1222
             SDMWER YLGQQLYFSVL P RSLRDE        L   L KGM MPPPY
Sbjct  508   SDMWERYYLGQQLYFSVLLPTRSLRDELQPSLTTTLSVVLSKGMPMPPPY  557



>gb|ABI52585.1| pollen-specific protein [Camellia sinensis]
Length=566

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/411 (74%), Positives = 353/411 (86%), Gaps = 4/411 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD+PADE+ V   DWYNKGHK+++K LD+G ++ RPDG+ INGK GKVG   +P+
Sbjct  152   LIPVPFDAPADEYFVIAGDWYNKGHKSIQKQLDTGRSLGRPDGIQINGKSGKVGGSNEPM  211

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             F MEAGK YRYRVCNVGM+TS+NFR +GH++ LVEMEGSHT+QNVYDSLD+H+GQC SVL
Sbjct  212   FNMEAGKIYRYRVCNVGMKTSLNFRIQGHSLKLVEMEGSHTVQNVYDSLDVHIGQCFSVL  271

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             V A++EP DYY+V SSRF KQ  ++VA+I YANG   + S ELP  PPE   GIAWSINQ
Sbjct  272   VEANQEPNDYYMVFSSRFTKQPLTSVAVIRYANGKN-SPSSELPAPPPETATGIAWSINQ  330

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVNS++ VDGKLRYA+NGVSH+   TP
Sbjct  331   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNSRNNVDGKLRYAINGVSHVEPTTP  390

Query  722   LKLAEYFGISEKVFKYDIMGDTP---PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQ  892
             LKL EY+GI +KVFKYDI+ D P    E+ EK+ LAPNV+NATFRNFVEI+ ENHEKTIQ
Sbjct  391   LKLVEYYGIQDKVFKYDIIKDEPEAASESNEKIVLAPNVLNATFRNFVEIILENHEKTIQ  450

Query  893   TYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNL  1072
             T+HLDG+SFFAVAIE GRW+PEKRKNYNLVDAVSRH+IQVYP SWAA+MTTLDNAGMWN+
Sbjct  451   TWHLDGYSFFAVAIEPGRWTPEKRKNYNLVDAVSRHNIQVYPGSWAAIMTTLDNAGMWNM  510

Query  1073  RSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             RS+MWERAYLGQQ YFSVLSP RSLRDE+NLP+K  +CGLVK +  PPPYS
Sbjct  511   RSEMWERAYLGQQFYFSVLSPARSLRDEYNLPEKTPVCGLVKDLPEPPPYS  561



>gb|EPS72881.1| pollen-specific protein [Genlisea aurea]
Length=585

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/410 (75%), Positives = 353/410 (86%), Gaps = 1/410 (0%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD PADEF V + DWYNKGHKTLK ILDSG +I  PDGV INGK GKVG    P+
Sbjct  175   LIPVPFDRPADEFAVLVGDWYNKGHKTLKSILDSGRSIGFPDGVHINGKFGKVGGGSPPM  234

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FT+E GKTYRYRVCNVGMR SVNFR +GH + LVEMEGSHT+QNVYDSLDLHVGQC+SVL
Sbjct  235   FTVEKGKTYRYRVCNVGMRLSVNFRIQGHDLKLVEMEGSHTVQNVYDSLDLHVGQCMSVL  294

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             +TAD+ P DY+ VVSSRF K+  STVA+I Y+   G + S  +PP PPEN+ GIAWSINQ
Sbjct  295   ITADQAPADYHFVVSSRFTKKALSTVAVIRYSGSKGSSDSGAIPPPPPENSRGIAWSINQ  354

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIK+VN++  V+GKLR+ +NGVSH++ +TP
Sbjct  355   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKVVNARYQVNGKLRFGINGVSHVDGETP  414

Query  722   LKLAEYFGISEKVFKYDIMGDTPP-ENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEYFG+ +KVFKYD+M D P  ++ +K +LAPNVVNATFRNFVEIVFENHE+TIQT+
Sbjct  415   LKLAEYFGVGDKVFKYDVMKDEPTGQDEQKASLAPNVVNATFRNFVEIVFENHERTIQTW  474

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG++FFAVA+E GRWSPEKRKNYNL DAVSRH+IQVYPNSWAAVMTTLDNAG+WNLRS
Sbjct  475   HLDGYAFFAVAVEPGRWSPEKRKNYNLEDAVSRHTIQVYPNSWAAVMTTLDNAGLWNLRS  534

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1228
             +M ERAYLGQQ YFSVLSP RSLRDE+N+   Q LCG+VKG+ +P PYSG
Sbjct  535   EMRERAYLGQQFYFSVLSPARSLRDEYNILPDQPLCGIVKGLPLPMPYSG  584



>emb|CDP18567.1| unnamed protein product [Coffea canephora]
Length=557

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/411 (73%), Positives = 350/411 (85%), Gaps = 3/411 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD PADE+NV + DWY KGHK LK +LDSG ++ RPDG+ INGK  KVGD ++PL
Sbjct  148   LIPVPFDWPADEYNVLVGDWYTKGHKALKNMLDSGRSLGRPDGIQINGKSAKVGDNVEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTME GKTYRYRVCNVG++TS+NFR +GH + LVE+EGSHT+Q  +DSLD+HVGQCLSVL
Sbjct  208   FTMEPGKTYRYRVCNVGLKTSINFRIQGHPLKLVEIEGSHTVQYDFDSLDVHVGQCLSVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADKEPKDYY V SSRF +   S+V II Y NG G  ASPELPPSPP  + GIAWS+NQ
Sbjct  268   VTADKEPKDYYFVASSRFIQAPLSSVGIIRYTNGKG-PASPELPPSPPVGSAGIAWSMNQ  326

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNS+S V GKLRYA+NGVSHI+T TP
Sbjct  327   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSESRVGGKLRYAINGVSHIDTPTP  386

Query  722   LKLAEYFGISEKVFKYDIMGDTPPE-NGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LK AEYFG+++K+F+Y+++ D     N     +AP+VVNATFRNFVEI+FENHEKTIQTY
Sbjct  387   LKHAEYFGVADKLFQYNLVKDDGSAVNTPAPIIAPSVVNATFRNFVEIIFENHEKTIQTY  446

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             +LDG+SFFAVA+E G WSPEKRKNYNL+DA+SRH++QVYP SWAA+MTTLDNAGMWNLRS
Sbjct  447   NLDGYSFFAVAVEPGTWSPEKRKNYNLLDAISRHNVQVYPGSWAAIMTTLDNAGMWNLRS  506

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLC-GLVKGMSMPPPYSG  1228
             +M  RAYLGQQLYFSVLSP RSLRDE+NLPD Q LC G+V+ + +P PY+ 
Sbjct  507   EMQHRAYLGQQLYFSVLSPARSLRDEYNLPDNQPLCGGIVEKLPLPAPYTA  557



>gb|EYU39285.1| hypothetical protein MIMGU_mgv1a026945mg [Erythranthe guttata]
Length=558

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/409 (76%), Positives = 355/409 (87%), Gaps = 2/409 (0%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDK-IDP  178
             LIPVPFD+PADEF V + DWYNKGHKTLKKILDSG TI  P+G+ ING+ GKVG   + P
Sbjct  151   LIPVPFDTPADEFAVLLGDWYNKGHKTLKKILDSGATIGLPNGIHINGQSGKVGSAPLTP  210

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             L  +E GKTYRYRVCNVG+RTS+NFRF+ H M LVE+EGSHT+QNVYDSLDLH GQC+SV
Sbjct  211   LAIVEPGKTYRYRVCNVGLRTSINFRFQSHIMKLVEVEGSHTVQNVYDSLDLHAGQCVSV  270

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             LVTAD+ PKDYYLV SSRF K+  S+VAII YANG G  ASPELPP PPENT GIAWS+N
Sbjct  271   LVTADQAPKDYYLVASSRFSKKPLSSVAIIRYANGKGAPASPELPPPPPENTAGIAWSVN  330

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRS+RWNLTASAARPNPQGSYHYG+INITRTIK+ NS+  V+GKLR+ +NGVSHI ++T
Sbjct  331   QFRSYRWNLTASAARPNPQGSYHYGKINITRTIKIANSRYQVNGKLRFGINGVSHIESET  390

Query  719   PLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             PLKLAEYFG+++K F YD++ D  P N +KV LAP+VVNATFRNFVEI+FEN+E TIQT+
Sbjct  391   PLKLAEYFGLADKAFNYDLVKDE-PSNDKKVVLAPSVVNATFRNFVEIIFENNENTIQTW  449

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVAIEAG+W+PEKRKNYNL+DAVSRH+I VYP SWAAVMTTLDNAGMWNLRS
Sbjct  450   HLDGYSFFAVAIEAGKWNPEKRKNYNLLDAVSRHTIHVYPKSWAAVMTTLDNAGMWNLRS  509

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             DM ERAYLGQQLYFSVLSP RSLRDE+N+P  QQLCG+V+ +  P PYS
Sbjct  510   DMAERAYLGQQLYFSVLSPARSLRDEYNIPLTQQLCGIVQNLPKPTPYS  558



>ref|XP_011089764.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=554

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/409 (73%), Positives = 352/409 (86%), Gaps = 3/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGD-KIDP  178
             LIP+PFD PADE+ V + DWYNKGHK+LK ILDSG +I RPDG+ ING+  KVGD    P
Sbjct  148   LIPIPFDKPADEYPVLLGDWYNKGHKSLKNILDSGRSIGRPDGIQINGQSSKVGDANAKP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFT EAGKTYR+RVCNVG+R SVNFR + H+MT+VE+EGSHT+QNVYDSLDLHVGQC+SV
Sbjct  208   LFTFEAGKTYRFRVCNVGLRLSVNFRIQAHSMTVVEVEGSHTVQNVYDSLDLHVGQCMSV  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             LVTAD+ PKDYY V SSRF +   STVA+I YANGNG  +    PP P +NT GIAWSI+
Sbjct  268   LVTADQTPKDYYFVASSRFAQHPLSTVAVIRYANGNGPASPELPPPPP-QNTMGIAWSIS  326

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSY YG+INITRTIKLVN++S  +GKLR+ +NGVSH++T+T
Sbjct  327   QFRSFRWNLTASAARPNPQGSYKYGKINITRTIKLVNTRSSSNGKLRFGINGVSHVDTET  386

Query  719   PLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             PLKLAEY+G+++KVF Y++M D P E G KV +APNVVN T+RNFVEI+FENHEKTIQT+
Sbjct  387   PLKLAEYYGVADKVFTYNLMKDEPQE-GNKVEVAPNVVNGTYRNFVEIIFENHEKTIQTW  445

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVAIE GRWSPEKRKNYNL+DA+SR++IQVYPN+WAAVMTTLDNAGMWNLRS
Sbjct  446   HLDGYSFFAVAIEPGRWSPEKRKNYNLLDALSRNTIQVYPNTWAAVMTTLDNAGMWNLRS  505

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             +M ERAYLGQQ YFSV+S  RSLRDE++LP+ Q+LCG+VK +  P PY+
Sbjct  506   EMRERAYLGQQFYFSVVSEARSLRDEYSLPETQELCGIVKSLPKPAPYT  554



>ref|XP_011089763.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/409 (73%), Positives = 354/409 (87%), Gaps = 3/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGD-KIDP  178
             LIP+P+D+PA+E+ V + DWYNKGHKTLK ILDSG +I RPDG+ ING+  KVGD    P
Sbjct  149   LIPIPYDNPAEEYPVLLGDWYNKGHKTLKSILDSGRSIGRPDGIQINGQSSKVGDANAKP  208

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFT EAGKTY+ RVCNVG+R SVNFR +GHTM +VE+EGSHT+QN+YDSLDLHVGQC+SV
Sbjct  209   LFTFEAGKTYKLRVCNVGLRLSVNFRVQGHTMKVVEVEGSHTVQNLYDSLDLHVGQCMSV  268

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             LVTAD+ PKDYY V SSRF +   STVA+I YANGNG  ASPELPP PP++T+GIAWSI+
Sbjct  269   LVTADQTPKDYYFVASSRFAQHPLSTVAVIRYANGNG-AASPELPPPPPDSTKGIAWSIS  327

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLT++AARPNPQGSY YG+INITRTIK+ NS+S  +GKLR+ +NGVSH++ +T
Sbjct  328   QFRSFRWNLTSNAARPNPQGSYKYGKINITRTIKIANSRSSSNGKLRFGINGVSHVDAET  387

Query  719   PLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             PLKLAEY+G+++KVF Y++M D P E G KV +APNVVN T+RNFVEI+FENHEKTIQT+
Sbjct  388   PLKLAEYYGVADKVFTYNLMKDEPQE-GNKVEVAPNVVNGTYRNFVEIIFENHEKTIQTW  446

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG SFFAVAIE GRWS EKRKNYNL+DAVSR++IQVYPNSWAAVMTTLDNAGMWNLRS
Sbjct  447   HLDGFSFFAVAIEPGRWSAEKRKNYNLLDAVSRNTIQVYPNSWAAVMTTLDNAGMWNLRS  506

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             +M ERAYLGQQLY SV+S  RSLRDE++LP+ Q+LCG+VK +  P PY+
Sbjct  507   EMRERAYLGQQLYLSVVSEARSLRDEYSLPETQELCGIVKSLPKPAPYT  555



>ref|XP_011089765.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=554

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/409 (73%), Positives = 354/409 (87%), Gaps = 3/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGD-KIDP  178
             LIP+P+D+PA+E+ V + DWYNKGHKTLK ILDSG +I RPDG+ ING+  KVGD    P
Sbjct  148   LIPIPYDNPAEEYPVLLGDWYNKGHKTLKSILDSGRSIGRPDGIQINGQSSKVGDANAKP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFT EAGKTY+ RVCNVG+R SVNFR +GHTM +VE+EGSHT+QN+YDSLDLHVGQC+SV
Sbjct  208   LFTFEAGKTYKLRVCNVGLRLSVNFRVQGHTMKVVEVEGSHTVQNLYDSLDLHVGQCMSV  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             LVTAD+ PKDYY V SSRF +   STVA+I YANGNG  ASPELPP PPENT+GIAWSI+
Sbjct  268   LVTADQTPKDYYFVASSRFAQHPLSTVAVIRYANGNG-AASPELPPPPPENTKGIAWSIS  326

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLT++AARPNPQGSY YG+INITRTIK+ NS+S  +GKLR+ +NGVSH++ +T
Sbjct  327   QFRSFRWNLTSNAARPNPQGSYKYGKINITRTIKIANSRSSSNGKLRFGINGVSHVDAET  386

Query  719   PLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             PLKLAEY+G+++KVF Y++M D P E G KV +APNVVN T+RNFVEI+FENHEKTIQT+
Sbjct  387   PLKLAEYYGVADKVFTYNLMKDEPQE-GNKVEVAPNVVNGTYRNFVEIIFENHEKTIQTW  445

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG SFFAVAIE GRWS EKRKNYNL+DAVSR++IQVYPNSWAAVMTTLDNAGMWNLRS
Sbjct  446   HLDGFSFFAVAIEPGRWSAEKRKNYNLLDAVSRNTIQVYPNSWAAVMTTLDNAGMWNLRS  505

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             +M ERAYLGQQLY SV+S  RSLRDE++LP+ Q+LCG+VK +  P PY+
Sbjct  506   EMRERAYLGQQLYLSVVSEARSLRDEYSLPETQELCGIVKSLPKPAPYT  554



>ref|XP_011089767.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/409 (73%), Positives = 354/409 (87%), Gaps = 3/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGD-KIDP  178
             LIP+P+D+PA+E+ V + DWYNKGHKTLK ILDSG +I RPDG+ ING+  KVGD    P
Sbjct  149   LIPIPYDNPAEEYPVLLGDWYNKGHKTLKSILDSGRSIGRPDGIQINGQSSKVGDANAKP  208

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFT EAG TY+ RVCNVG+R SVNFR +GHTM +VE+EGSHT+QN+YDSLDLHVGQC+SV
Sbjct  209   LFTFEAGNTYKLRVCNVGLRLSVNFRVQGHTMKVVEVEGSHTVQNLYDSLDLHVGQCMSV  268

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             LVTAD+ PKDYY V SSRF +   STVA+I YANGNG  ASPELPP PPENT+GIAWSI+
Sbjct  269   LVTADQTPKDYYFVASSRFAQHPHSTVAVIRYANGNG-AASPELPPPPPENTKGIAWSIS  327

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLT++AARPNPQGSY YG+INITRTIK+ NS+S  +GKLR+ +NGVSH++ +T
Sbjct  328   QFRSFRWNLTSNAARPNPQGSYKYGKINITRTIKIANSRSSSNGKLRFGINGVSHVDAET  387

Query  719   PLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             PLKLAEY+G+++KVF Y++M D P E G+KV +APNVVN T+RNFVEI+FENHEKTIQT+
Sbjct  388   PLKLAEYYGVADKVFTYNLMKDEPQE-GDKVEVAPNVVNGTYRNFVEIIFENHEKTIQTW  446

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG SFFAVAIE GRWSPEKRKNYNL+DAVSR++IQVYPNSWAAVMTTLDNAGMWNLRS
Sbjct  447   HLDGFSFFAVAIEPGRWSPEKRKNYNLLDAVSRNTIQVYPNSWAAVMTTLDNAGMWNLRS  506

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             +M ERAYLGQQ Y SV+S  RSLRDE++LP+ Q+LCG+VK +  P PY+
Sbjct  507   EMRERAYLGQQFYLSVVSEARSLRDEYSLPETQELCGIVKSLPKPAPYT  555



>ref|XP_011089702.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/409 (71%), Positives = 351/409 (86%), Gaps = 3/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGD-KIDP  178
             LIP+P+D+PA+E+ V + DWYNKGHKTLK ILDSG +I RPDG+ ING+  KVGD    P
Sbjct  149   LIPIPYDNPAEEYPVLLGDWYNKGHKTLKSILDSGRSIGRPDGIQINGQSSKVGDANAKP  208

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFT EAGKTY+ RVCNVG+R SVNFR +GHTM +VE+EGSHT+QN+YDSLDLHVGQC+SV
Sbjct  209   LFTFEAGKTYKLRVCNVGLRLSVNFRVQGHTMKVVEVEGSHTVQNLYDSLDLHVGQCMSV  268

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             LVTAD+ PKDYY V SSRF +   STVA+I YANGNG  +    PP P ++T+GIAWSI+
Sbjct  269   LVTADQTPKDYYFVASSRFAQHPLSTVAVIRYANGNGPASPELPPPPP-DSTKGIAWSIS  327

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLT++AARPNPQGSY YG+INITRTIK+ NS+S  +GKLR+ +NGVSH++ +T
Sbjct  328   QFRSFRWNLTSNAARPNPQGSYKYGKINITRTIKIANSRSSSNGKLRFGINGVSHVDAET  387

Query  719   PLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             PLKLAEY+G+++KVF Y++M D P E G+KV +APNVVN T+RNFVEI+FENHEKTIQT+
Sbjct  388   PLKLAEYYGVADKVFTYNLMKDEPQE-GDKVEVAPNVVNGTYRNFVEIIFENHEKTIQTW  446

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG SFFAVAIE GRWSPEKRKNYNL+DAVSR++IQVYPNSWAAVMTTLDNAGMWNLRS
Sbjct  447   HLDGFSFFAVAIEPGRWSPEKRKNYNLLDAVSRNTIQVYPNSWAAVMTTLDNAGMWNLRS  506

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             +M ERAYLGQQLY SV+S  RSLRDE++LP+ Q+LCG+VK +  P PY+
Sbjct  507   EMRERAYLGQQLYLSVVSEARSLRDEYSLPETQELCGIVKSLPKPAPYT  555



>ref|XP_011089766.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/409 (72%), Positives = 354/409 (87%), Gaps = 3/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGD-KIDP  178
             LIP+P+D+PA+E+ V + DWYNKGHKTLK ILDSG +I RPDG+ ING+  KVGD    P
Sbjct  149   LIPIPYDNPAEEYPVLLGDWYNKGHKTLKSILDSGRSIGRPDGIQINGQSSKVGDANAKP  208

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFT EAGKTY+ RVCNVG+R SVNFR +GHT+ +VE+EGSH +QN+YDSLDLHVGQC+SV
Sbjct  209   LFTFEAGKTYKLRVCNVGLRLSVNFRVQGHTLKVVEVEGSHNVQNLYDSLDLHVGQCMSV  268

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             LVTAD+ PKDYY V SSRF +   STVA+I Y NGNG  ASPELPP PPENT+GIAWSI+
Sbjct  269   LVTADQTPKDYYFVASSRFAQHPLSTVAVIRYVNGNG-AASPELPPPPPENTKGIAWSIS  327

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLT++AARPNPQGSY YG+INITRTIK+ NS+S  +GKLR+ +NGVSH++ +T
Sbjct  328   QFRSFRWNLTSNAARPNPQGSYKYGKINITRTIKIANSRSSSNGKLRFGINGVSHVDAET  387

Query  719   PLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             PLKLAEY+G+++KVF Y++M D P E G+KV +APNVVN T+RNFVEI+FENHEKTIQT+
Sbjct  388   PLKLAEYYGVADKVFTYNLMKDEPQE-GDKVEVAPNVVNGTYRNFVEIIFENHEKTIQTW  446

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG SFFAVAIE GRWSPEKRKNYNL+DA+SR++IQVYPNSWAAVMTTLDNAGMWNLRS
Sbjct  447   HLDGFSFFAVAIEPGRWSPEKRKNYNLLDALSRNTIQVYPNSWAAVMTTLDNAGMWNLRS  506

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             +M ERAYLGQQLY SV+S  RSLRDE++LP+ Q+LCG+VK +  P PY+
Sbjct  507   EMRERAYLGQQLYLSVVSEARSLRDEYSLPETQELCGIVKSLPKPAPYT  555



>ref|XP_009339220.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=552

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/409 (70%), Positives = 337/409 (82%), Gaps = 6/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P DE+ V I DWY K H  LKKILDSG ++ RP GV+INGK+ K   K +PL
Sbjct  148   LIPVPYADPEDEYTVMIGDWYTKSHTALKKILDSGRSMGRPAGVLINGKNAKGDGKDEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YRVCNVG++ S+NFR +GH + LVEMEGSHT+QN Y+SLD+HVGQC S+L
Sbjct  208   FTMKPGKTYKYRVCNVGLKNSLNFRIQGHPLKLVEMEGSHTVQNTYESLDVHVGQCFSLL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADKEPKDYY+V S+RF K   +   II Y NGNG  ASPELP +P     G AWS+NQ
Sbjct  268   VTADKEPKDYYMVASTRFTKTVLTGKGIIRYENGNG-PASPELPEAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIK+VNS S VDGKLRYA+NGVSH+ ++TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKIVNSASRVDGKLRYAVNGVSHVESETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGE-KVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEYFG+++KVFKYD + D PP   E K+TLAPNVVN TFR+FVEI+FENHEK+IQ++
Sbjct  383   LKLAEYFGVADKVFKYDTIEDEPPATVEDKITLAPNVVNQTFRDFVEIIFENHEKSIQSW  442

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVAIE GRW+PEKRKNYNL+D VSRH+IQV+P SWAAVM T DNAGMWN+RS
Sbjct  443   HLDGYSFFAVAIEPGRWTPEKRKNYNLLDGVSRHTIQVFPKSWAAVMLTFDNAGMWNVRS  502

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             +  ER YLGQQ Y SVLSP RSLRDE+NLP+  QLCG+VK    PPPYS
Sbjct  503   EQPERRYLGQQFYVSVLSPARSLRDEYNLPETAQLCGIVKDSPKPPPYS  551



>ref|XP_008449912.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Cucumis melo]
Length=554

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/410 (70%), Positives = 340/410 (83%), Gaps = 7/410 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGH-TIARPDGVVINGKHGKVGDKIDP  178
             LIPVP+  P D++ V I DWY K H TLK+ILD+GH +IARP+GV+INGK  K     +P
Sbjct  149   LIPVPYADPEDDYTVLIGDWYTKSHTTLKQILDNGHRSIARPEGVLINGKTAKGDGTDEP  208

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFTM+ GKTY+YRVCNVG++TS+NFRF+GHTM LVEMEGSHT+QN Y SLD+HVGQC SV
Sbjct  209   LFTMKPGKTYKYRVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQNDYQSLDVHVGQCFSV  268

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             LVTA++EPKDYY+V S+RF K       II Y NG G  ASPE+P +P     G AWS+N
Sbjct  269   LVTANQEPKDYYMVASTRFIKNVIIGKGIIRYTNGKG-PASPEIPKAP----MGWAWSLN  323

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFR+FRWNLTASAARPNPQGSYHYG INITRTIKL NS + VDGKLRYA+NGVSHI+ +T
Sbjct  324   QFRTFRWNLTASAARPNPQGSYHYGSINITRTIKLFNSATKVDGKLRYAINGVSHIDPET  383

Query  719   PLKLAEYFGISEKVFKYDIMGDT-PPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             PLKLAEYFGI++KVFKYDI+ D  P E    VT+APNVVNATFRNF+EI+FENHEK++Q+
Sbjct  384   PLKLAEYFGIADKVFKYDIISDEGPTEGATAVTIAPNVVNATFRNFIEIIFENHEKSLQS  443

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG+SFFAVAIE GRWSPEKR NYNL+DAVSRH+IQV+PNSWAA++ T DNAGMWNLR
Sbjct  444   WHLDGYSFFAVAIEPGRWSPEKRSNYNLLDAVSRHTIQVFPNSWAAILLTFDNAGMWNLR  503

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             S++ E  YLGQQLY SVLSP RSLRDE+N+PD   LCGLVKGM +P PY+
Sbjct  504   SELTENRYLGQQLYMSVLSPARSLRDEYNIPDHTLLCGLVKGMPLPKPYT  553



>emb|CDP04133.1| unnamed protein product [Coffea canephora]
Length=557

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/412 (69%), Positives = 336/412 (82%), Gaps = 9/412 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD+P  ++ +   DWY+K H  L+K+LDSG T+ RPDGV+INGK GK   K +P+
Sbjct  150   LIPVPFDAPEADYTIMAGDWYSKSHVALRKLLDSGRTLGRPDGVLINGKSGKADGKDEPM  209

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM  GKTYRYRVCNVGM+ S+NFRF+GHTM LVEMEGSHT+Q +YDSLDLH+GQC SVL
Sbjct  210   FTMIPGKTYRYRVCNVGMKNSLNFRFQGHTMKLVEMEGSHTMQYLYDSLDLHLGQCASVL  269

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADKEPKDYY V S+RF KQ  S  A I Y  G G  ASPELPP+P     G AWS+NQ
Sbjct  270   VTADKEPKDYYFVASTRFTKQILSATATIRYTTGKG-PASPELPPAP----VGWAWSLNQ  324

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYGQINITRTI++VNS    DGKLRYA+NGVSH++ +TP
Sbjct  325   FRSFRWNLTASAARPNPQGSYHYGQINITRTIRIVNSAGEADGKLRYAINGVSHVDPETP  384

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENG----EKVTLAPNVVNATFRNFVEIVFENHEKTI  889
             LKLAEYFG+++KVFKY+I+ D P  +       +TLAPNVVNATFRNF+EI+ ENHEKT+
Sbjct  385   LKLAEYFGVADKVFKYNIIQDEPSADATAKNHAITLAPNVVNATFRNFIEIILENHEKTV  444

Query  890   QTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWN  1069
             Q++HLDG+SFFAVAIE G W+PE+RK YNL+DA+SR++IQVYP SWAA+M T+DNAGMWN
Sbjct  445   QSWHLDGYSFFAVAIEPGTWTPERRKVYNLLDAISRNTIQVYPKSWAAIMLTMDNAGMWN  504

Query  1070  LRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             LRS + ER YLGQQLYFSVLSP  SLRDE+N+PD   LCG+VK M  P PYS
Sbjct  505   LRSTLLERQYLGQQLYFSVLSPNYSLRDEYNVPDDALLCGIVKDMPKPKPYS  556



>ref|XP_010271079.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=552

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/410 (69%), Positives = 342/410 (83%), Gaps = 7/410 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKV-GDKIDP  178
             LIPVPF  P D++ V I DWY+KGH +LKK+LD+G ++ +PDGV+INGK GKV GDK +P
Sbjct  147   LIPVPFADPEDDYTVLIGDWYSKGHSSLKKLLDTGRSLGKPDGVLINGKSGKVEGDKDEP  206

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFTM+  K YRYRVCNVG++ S+NFR +GH++ LVEMEGSHT+QNVYDSLD+HVGQC SV
Sbjct  207   LFTMKPHKXYRYRVCNVGLKXSLNFRIQGHSLKLVEMEGSHTVQNVYDSLDVHVGQCYSV  266

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             LVTA++ PKDYY+V S+RF K   S   II Y NG G  ASP LP +P     G AWS+N
Sbjct  267   LVTANQTPKDYYMVASTRFTKYMISATRIIRYTNGKG-PASPVLPEAP----VGWAWSLN  321

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYG INITRTIKLVN+   VDGKLRYA+NG+SH++ DT
Sbjct  322   QFRSFRWNLTASAARPNPQGSYHYGAINITRTIKLVNTAGTVDGKLRYAINGMSHVDKDT  381

Query  719   PLKLAEYFGISEKVFKYDIMGDTPPENG-EKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             PLKLAEYFG+++KVFKYD + D P   G EK+ + PNV+NATFRNFVEI+ ENHEK+IQ+
Sbjct  382   PLKLAEYFGVADKVFKYDSIPDEPKGKGSEKIVMGPNVLNATFRNFVEIILENHEKSIQS  441

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG+SFFAV IE G+W+PE+RKNYNL+DAVSRH++QV+P SWAA++ T DNAGMWNLR
Sbjct  442   WHLDGYSFFAVGIEPGKWTPERRKNYNLLDAVSRHTVQVFPKSWAAILLTFDNAGMWNLR  501

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             S++W+R YLGQQLY SVLSP RSLRDE+N+PD  +LCG+VKG+  PPPY+
Sbjct  502   SEIWDRFYLGQQLYVSVLSPARSLRDEYNIPDGTKLCGIVKGLPKPPPYT  551



>ref|XP_009773307.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=557

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/413 (68%), Positives = 343/413 (83%), Gaps = 9/413 (2%)
 Frame = +2

Query  2     LIPVPFD-SPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDP  178
             LIPVPFD +PADEF V +SDWY K H  ++K+LDSG  + RP+GV+INGK GK  +K +P
Sbjct  148   LIPVPFDVNPADEFFVLVSDWYTKSHSQMRKLLDSGRALGRPNGVIINGKSGKGDNKDEP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             +FTM  GKTYRYR CNVGM+ S+N R +GH M LVE+EGSHT+QN+YDSLD+H+GQC+SV
Sbjct  208   MFTMTPGKTYRYRFCNVGMKDSINVRIQGHVMKLVEIEGSHTVQNMYDSLDVHLGQCMSV  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             LVTADK+PKDY+LV S+RF K+  +  A I YANG G  AS ELP +P     G AWS+N
Sbjct  268   LVTADKDPKDYFLVASTRFTKEPHTATATIRYANGKGAPASLELPKAP----IGWAWSLN  323

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYGQIN TRTIKLVN+   VDGKLRYA+NGVSH+N +T
Sbjct  324   QFRSFRWNLTASAARPNPQGSYHYGQINFTRTIKLVNAAGSVDGKLRYAINGVSHVNPET  383

Query  719   PLKLAEYFGISEKVFKYDIMGDT----PPENGEKVTLAPNVVNATFRNFVEIVFENHEKT  886
             P+KLAEY+G++ KVFKYD++ D       +  EK+TLAPNVVN T+RNFVEI+FENHEK+
Sbjct  384   PIKLAEYYGVANKVFKYDLIKDDYEAPTAKTEEKITLAPNVVNGTYRNFVEIIFENHEKS  443

Query  887   IQTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMW  1066
             +Q++HL G+SFFAVAIE G+W+PEKRKNYNL+DAVSR++IQVYPNSWAA+MTT+DNAG+W
Sbjct  444   VQSFHLAGYSFFAVAIEPGKWTPEKRKNYNLLDAVSRNTIQVYPNSWAAIMTTIDNAGLW  503

Query  1067  NLRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             NLRS+  ER YLGQQLYFSVLSP+R L+DE+N+PD   LCG++K M +P PYS
Sbjct  504   NLRSNSLERQYLGQQLYFSVLSPKRDLKDEYNMPDNDILCGIIKDMPLPKPYS  556



>ref|XP_007208287.1| hypothetical protein PRUPE_ppa003715mg [Prunus persica]
 gb|EMJ09486.1| hypothetical protein PRUPE_ppa003715mg [Prunus persica]
Length=554

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/410 (69%), Positives = 339/410 (83%), Gaps = 6/410 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I DWY KGH  LKK LDSG ++ARPDGV+INGK  K   K +PL
Sbjct  148   LIPVPYADPEDDYTVLIGDWYAKGHTALKKHLDSGRSMARPDGVIINGKSAKGDGKDEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG++ S+NFR +GH M LVEMEGSHT+QN Y+SLD+HVGQC SVL
Sbjct  208   FTMKPGKTYKYRICNVGLKNSLNFRIQGHPMKLVEMEGSHTVQNTYESLDVHVGQCFSVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADK+PKDYY+V S+RF K+  +   I+ Y NGNG  ASPELP +P     G AWS+NQ
Sbjct  268   VTADKDPKDYYMVASTRFTKKVLTGKGIMRYENGNG-PASPELPEAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRT+K+VNS + VDGKLRYA+NGVSH++ +TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGKINITRTLKIVNSATKVDGKLRYAINGVSHVDPETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGE-KVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEY+G+++KVFKYD + D PP   E KVTLAPNVVN TFRNFVEI+FENHEK+IQ++
Sbjct  383   LKLAEYYGVADKVFKYDTIQDDPPATVEDKVTLAPNVVNQTFRNFVEIIFENHEKSIQSW  442

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             +LDG+SFFAVAIE GRW+PEKRKNYNL+D VSRH+IQV+P SWAA+M T DNAGMWN+RS
Sbjct  443   NLDGYSFFAVAIEPGRWAPEKRKNYNLLDGVSRHTIQVFPKSWAAIMLTFDNAGMWNVRS  502

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1228
             +  ER YLGQQ Y SVLSP RSLRDE+NLPD   +CG+VK +  PPPYS 
Sbjct  503   EQSERRYLGQQFYVSVLSPARSLRDEYNLPDNTLVCGIVKDLPKPPPYSA  552



>ref|XP_010247847.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nelumbo nucifera]
Length=552

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/410 (69%), Positives = 342/410 (83%), Gaps = 7/410 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKV-GDKIDP  178
             LIPVPF  P D++ V I DWY+KGH +LKK+LD+G ++ +PDGV+INGK GKV G K +P
Sbjct  147   LIPVPFADPEDDYTVLIGDWYSKGHSSLKKLLDTGRSLGKPDGVLINGKSGKVEGHKDEP  206

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFTM+  K YRYRVCNVG++ S+NFR +GH++ LVEMEGSHT+QNVYDSLD+HVGQC SV
Sbjct  207   LFTMKPHKXYRYRVCNVGLKXSLNFRIQGHSLKLVEMEGSHTVQNVYDSLDVHVGQCYSV  266

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             LVTA++ PKDYY+V S+RF K   S   II Y NG G  ASP LP +P     G AWS+N
Sbjct  267   LVTANQXPKDYYMVASTRFTKYMISATRIIRYTNGKG-PASPVLPEAP----VGWAWSLN  321

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYG INITRTIKLVN+   VDGKLRYA+NG+SH++ DT
Sbjct  322   QFRSFRWNLTASAARPNPQGSYHYGAINITRTIKLVNTAGTVDGKLRYAINGMSHVDKDT  381

Query  719   PLKLAEYFGISEKVFKYDIMGDTPPENG-EKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             PLKLAEYFG+++KVFKYD + D P   G EK+ + PNV+NATFRNFVEI+ ENHEK+IQ+
Sbjct  382   PLKLAEYFGVADKVFKYDSIPDEPKGKGSEKIVMGPNVLNATFRNFVEIILENHEKSIQS  441

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG+SFFAV IE G+W+PE+RKNYNL+DAVSRH++QV+PNSWAA++ T DNAGMWNLR
Sbjct  442   WHLDGYSFFAVGIEPGKWTPERRKNYNLLDAVSRHTVQVFPNSWAAILLTFDNAGMWNLR  501

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             S++W+R YLGQQLY SVLSP RSLRDE+N+PD  +LCG+VKG+  PPPY+
Sbjct  502   SEIWDRFYLGQQLYVSVLSPARSLRDEYNIPDGTKLCGIVKGLPKPPPYT  551



>ref|XP_010247849.1| PREDICTED: L-ascorbate oxidase homolog isoform X3 [Nelumbo nucifera]
Length=553

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/410 (69%), Positives = 342/410 (83%), Gaps = 7/410 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKV-GDKIDP  178
             LIPVPF  P D++ V I DWY+KGH +LKK+LD+G ++ +PDGV+INGK GKV G K +P
Sbjct  148   LIPVPFADPEDDYTVLIGDWYSKGHSSLKKLLDTGRSLGKPDGVLINGKSGKVEGHKDEP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFTM+  K YRYRVCNVG++ S+NFR +GH++ LVEMEGSHT+QNVYDSLD+HVGQC SV
Sbjct  208   LFTMKPHKXYRYRVCNVGLKXSLNFRIQGHSLKLVEMEGSHTVQNVYDSLDVHVGQCYSV  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             LVTA++ PKDYY+V S+RF K   S   II Y NG G  ASP LP +P     G AWS+N
Sbjct  268   LVTANQXPKDYYMVASTRFTKYMISATRIIRYTNGKG-PASPVLPEAP----VGWAWSLN  322

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYG INITRTIKLVN+   VDGKLRYA+NG+SH++ DT
Sbjct  323   QFRSFRWNLTASAARPNPQGSYHYGAINITRTIKLVNTAGTVDGKLRYAINGMSHVDKDT  382

Query  719   PLKLAEYFGISEKVFKYDIMGDTPPENG-EKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             PLKLAEYFG+++KVFKYD + D P   G EK+ + PNV+NATFRNFVEI+ ENHEK+IQ+
Sbjct  383   PLKLAEYFGVADKVFKYDSIPDEPKGKGSEKIVMGPNVLNATFRNFVEIILENHEKSIQS  442

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG+SFFAV IE G+W+PE+RKNYNL+DAVSRH++QV+PNSWAA++ T DNAGMWNLR
Sbjct  443   WHLDGYSFFAVGIEPGKWTPERRKNYNLLDAVSRHTVQVFPNSWAAILLTFDNAGMWNLR  502

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             S++W+R YLGQQLY SVLSP RSLRDE+N+PD  +LCG+VKG+  PPPY+
Sbjct  503   SEIWDRFYLGQQLYVSVLSPARSLRDEYNIPDGTKLCGIVKGLPKPPPYT  552



>ref|XP_010247848.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Nelumbo nucifera]
Length=551

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/410 (69%), Positives = 342/410 (83%), Gaps = 7/410 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKV-GDKIDP  178
             LIPVPF  P D++ V I DWY+KGH +LKK+LD+G ++ +PDGV+INGK GKV G K +P
Sbjct  146   LIPVPFADPEDDYTVLIGDWYSKGHSSLKKLLDTGRSLGKPDGVLINGKSGKVEGHKDEP  205

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFTM+  K YRYRVCNVG++ S+NFR +GH++ LVEMEGSHT+QNVYDSLD+HVGQC SV
Sbjct  206   LFTMKPHKXYRYRVCNVGLKXSLNFRIQGHSLKLVEMEGSHTVQNVYDSLDVHVGQCYSV  265

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             LVTA++ PKDYY+V S+RF K   S   II Y NG G  ASP LP +P     G AWS+N
Sbjct  266   LVTANQXPKDYYMVASTRFTKYMISATRIIRYTNGKG-PASPVLPEAP----VGWAWSLN  320

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYG INITRTIKLVN+   VDGKLRYA+NG+SH++ DT
Sbjct  321   QFRSFRWNLTASAARPNPQGSYHYGAINITRTIKLVNTAGTVDGKLRYAINGMSHVDKDT  380

Query  719   PLKLAEYFGISEKVFKYDIMGDTPPENG-EKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             PLKLAEYFG+++KVFKYD + D P   G EK+ + PNV+NATFRNFVEI+ ENHEK+IQ+
Sbjct  381   PLKLAEYFGVADKVFKYDSIPDEPKGKGSEKIVMGPNVLNATFRNFVEIILENHEKSIQS  440

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG+SFFAV IE G+W+PE+RKNYNL+DAVSRH++QV+PNSWAA++ T DNAGMWNLR
Sbjct  441   WHLDGYSFFAVGIEPGKWTPERRKNYNLLDAVSRHTVQVFPNSWAAILLTFDNAGMWNLR  500

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             S++W+R YLGQQLY SVLSP RSLRDE+N+PD  +LCG+VKG+  PPPY+
Sbjct  501   SEIWDRFYLGQQLYVSVLSPARSLRDEYNIPDGTKLCGIVKGLPKPPPYT  550



>ref|XP_008449913.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Cucumis melo]
Length=554

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/410 (70%), Positives = 338/410 (82%), Gaps = 7/410 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGH-TIARPDGVVINGKHGKVGDKIDP  178
             LIPVP+  P D++ V I DWY K H TLK+ILD+GH +IARP+GV+INGK  K     +P
Sbjct  149   LIPVPYADPEDDYTVLIGDWYTKSHTTLKQILDNGHRSIARPEGVLINGKTAKGDGTDEP  208

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFTM+ GKTY+YRVCNVG++TS+NFRF+GHTM LVEMEGSHT+QN Y SLD+HVGQC SV
Sbjct  209   LFTMKPGKTYKYRVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQNDYQSLDVHVGQCFSV  268

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             LVTA++EPKDYY+V S+RF K       II Y NG G  ASPE+P +P     G AWS+N
Sbjct  269   LVTANQEPKDYYMVASTRFIKNVIIGKGIIRYTNGKG-PASPEIPKAP----MGWAWSLN  323

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFR+FRWNLTASAARPNPQGSYHYG INITRTIKL NS + VDGKLRYA+NGVSHI+ +T
Sbjct  324   QFRTFRWNLTASAARPNPQGSYHYGSINITRTIKLFNSATKVDGKLRYAINGVSHIDPET  383

Query  719   PLKLAEYFGISEKVFKYDIMGDT-PPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             PLKLAEYFGI++KVFKYDI+ D  P E    VT+APNVVNATFRNF+EI+FENHEK++Q+
Sbjct  384   PLKLAEYFGIADKVFKYDIISDEGPTEGATAVTIAPNVVNATFRNFIEIIFENHEKSLQS  443

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG+SFFAVAIE GRWSPEKR NYNL+DAVSRH+IQV+PNSWAA++ T DNAGMWNLR
Sbjct  444   WHLDGYSFFAVAIEPGRWSPEKRSNYNLLDAVSRHTIQVFPNSWAAILLTFDNAGMWNLR  503

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             S++ E  YLG QLY SVLSP RSLRDE+N+PD   LCGLVK M MP PY+
Sbjct  504   SELTENRYLGSQLYISVLSPARSLRDEYNIPDNTLLCGLVKDMPMPKPYT  553



>ref|XP_009376274.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=552

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/410 (69%), Positives = 336/410 (82%), Gaps = 6/410 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P DE+ V I DWY K H  LKK+LDSG T+ RPDG++INGK+ K   K +PL
Sbjct  148   LIPVPYADPEDEYTVMIGDWYTKSHTALKKLLDSGRTMGRPDGILINGKNAKGDGKDEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YRVCNVG++ S+NFR +GH + LVEMEGSHT+QN Y+SLD+HVGQC S+L
Sbjct  208   FTMKPGKTYKYRVCNVGLKNSLNFRIQGHPLKLVEMEGSHTVQNTYESLDVHVGQCFSLL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADKE KDYY+V S+RF K   +   II Y NGNG  ASPELP +P     G AWS+NQ
Sbjct  268   VTADKERKDYYMVASTRFTKTVLTGKGIIRYENGNG-PASPELPEAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIK+VNS S V+GKLRYA+NGVSH+ ++TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKIVNSASRVNGKLRYAINGVSHVESETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGE-KVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEYFG+++KVFKYD + D P    E KVTLAPNVVN TFR+FVEI+FENHEK+IQ++
Sbjct  383   LKLAEYFGVADKVFKYDTIQDEPRATVEDKVTLAPNVVNQTFRDFVEIIFENHEKSIQSW  442

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVAIE GRW+PEKRKNYNL+D VSRH+IQV+P SWAA+M T DNAGMWN+RS
Sbjct  443   HLDGYSFFAVAIEPGRWTPEKRKNYNLLDGVSRHTIQVFPKSWAAIMLTFDNAGMWNVRS  502

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1228
             +  ER YLGQQ Y SVLSP  SLRDE+NLP+  QLCG+VK +  PPPYS 
Sbjct  503   EQPERRYLGQQFYVSVLSPAHSLRDEYNLPETTQLCGIVKDLPKPPPYSA  552



>ref|XP_004164924.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/410 (70%), Positives = 338/410 (82%), Gaps = 7/410 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGH-TIARPDGVVINGKHGKVGDKIDP  178
             LIPVP+  P D++ V I DWY K H TLK+ILD+GH +IARP+GV+INGK  K     +P
Sbjct  148   LIPVPYADPEDDYTVLIGDWYTKSHTTLKQILDNGHRSIARPEGVLINGKTAKGDGTDEP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFTM+  KTY+YRVCNVG++TS+NFRF+GHTM LVEMEGSHT+QN Y SLD+HVGQC SV
Sbjct  208   LFTMKPEKTYKYRVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQNDYQSLDVHVGQCFSV  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             LVTA++EPKDYY+V S+RF K       II Y NG G  ASPE+P +P     G AWS+N
Sbjct  268   LVTANQEPKDYYMVASTRFIKNVLIGKGIIRYTNGKG-PASPEIPKAP----MGWAWSLN  322

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFR+FRWNLTASAARPNPQGSYHYG INITRTIKL NS + VDGKLRYA+NGVSH++ +T
Sbjct  323   QFRTFRWNLTASAARPNPQGSYHYGSINITRTIKLFNSATKVDGKLRYAINGVSHVDPET  382

Query  719   PLKLAEYFGISEKVFKYDIMGDT-PPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             PLKLAEYF I+EKVFKYD++ D  P E    VT+APNVVNATFRNF+EI+FENHEK++Q+
Sbjct  383   PLKLAEYFEIAEKVFKYDMISDEGPTEGATAVTIAPNVVNATFRNFIEIIFENHEKSLQS  442

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG+SFFAVAIE GRWSPEKR NYNL+DAVSRH+IQV+PNSWAA++ T DNAGMWNLR
Sbjct  443   WHLDGYSFFAVAIEPGRWSPEKRSNYNLLDAVSRHTIQVFPNSWAAILLTFDNAGMWNLR  502

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             S++ E  YLGQQLY SVLSP RSLRDE+N+PD   LCGLVKGM +P PY+
Sbjct  503   SELIENRYLGQQLYISVLSPARSLRDEYNIPDHTLLCGLVKGMPLPKPYT  552



>ref|XP_009626538.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=557

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/413 (68%), Positives = 342/413 (83%), Gaps = 9/413 (2%)
 Frame = +2

Query  2     LIPVPFD-SPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDP  178
             LIP+PFD +PADEF V +SDWY K H  L+K+LDSG +  RP+GV+INGK GK  +K +P
Sbjct  148   LIPIPFDVNPADEFFVLVSDWYTKSHSQLRKLLDSGRSAGRPNGVIINGKSGKGDNKDEP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             +FTM  GKTYRYR CNVGM+ S+N R +GH M LVE+EGSHT+QN+YDSLD+H+GQC+SV
Sbjct  208   MFTMTPGKTYRYRFCNVGMKDSINVRIQGHIMKLVEIEGSHTVQNMYDSLDVHLGQCMSV  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             LVTADK+PKDY+LV S+RF K+  +  A I Y NG G  AS ELP +P     G AWS+N
Sbjct  268   LVTADKDPKDYFLVASTRFTKEPHTATATIRYGNGKGAPASLELPKAP----IGWAWSLN  323

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVN+   VDGKLRYA+NGVSH+N +T
Sbjct  324   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNTAGSVDGKLRYAINGVSHVNPET  383

Query  719   PLKLAEYFGISEKVFKYDIMGDT----PPENGEKVTLAPNVVNATFRNFVEIVFENHEKT  886
             P+KLAEY+ +++KVFKYDI+ D       +  EK+TLAPNVVN T+RNFVEI+FENHEK+
Sbjct  384   PIKLAEYYSVADKVFKYDIIKDDYEAPTAKTEEKITLAPNVVNGTYRNFVEIIFENHEKS  443

Query  887   IQTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMW  1066
             +Q++HL G+SFFAVAIE G+W+ EKRKNYNL+DAVSR++IQVYPNSWAA+MTT+DNAG+W
Sbjct  444   VQSFHLAGYSFFAVAIEPGKWTAEKRKNYNLLDAVSRNTIQVYPNSWAAIMTTIDNAGLW  503

Query  1067  NLRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             NLRS+  ER YLGQQLYFSVLSP+R L+DE+N+PD   LCG++K M +P PYS
Sbjct  504   NLRSNSLERQYLGQQLYFSVLSPKRDLKDEYNMPDNDILCGIIKDMPLPKPYS  556



>ref|XP_009600426.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nicotiana 
tomentosiformis]
Length=549

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/410 (68%), Positives = 342/410 (83%), Gaps = 9/410 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFDSP +EF+VF+SDWY K HKTL+ ILD G +I RP+G++INGK+GK   K +P+
Sbjct  146   LIPVPFDSPEEEFSVFVSDWYTKSHKTLRSILDEGRSIGRPEGIIINGKNGKGDGKDEPM  205

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             F+M +GKTYRYR CNVGM+ S+N RF+GHTM LVEMEGSHT+QN+Y+SLD+H+GQCLSVL
Sbjct  206   FSMVSGKTYRYRFCNVGMKDSINVRFQGHTMKLVEMEGSHTVQNMYESLDIHLGQCLSVL  265

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+EPKDY+LV SSRF K+     A I Y N     ASPELP +P    EG  WS+NQ
Sbjct  266   VTADQEPKDYFLVASSRFTKEPHIATATIRYTND---PASPELPKAP----EGWEWSLNQ  318

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYGQINITRTI+LV++   VDGK RYA+NGVSH++  TP
Sbjct  319   FRSFRWNLTASAARPNPQGSYHYGQINITRTIRLVSTAGDVDGKRRYAINGVSHVDPTTP  378

Query  722   LKLAEYFGISEKVFKYDIMGD--TPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             +KLAE +G+++KVFKYD++ D    P   EK+TLAPNVVNAT+RNFVEI+ ENHEK++Q+
Sbjct  379   IKLAELYGVADKVFKYDLIKDEYIAPSGNEKITLAPNVVNATYRNFVEIILENHEKSVQS  438

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HL G++FFAVAIEAGRW PE+R+NYNL+DAVSR++IQVYPNSWAA+MTTLDNAG+WNLR
Sbjct  439   WHLAGYNFFAVAIEAGRWKPERRQNYNLLDAVSRNTIQVYPNSWAAIMTTLDNAGLWNLR  498

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             S+  ER YLG QLYFSVLSP  SL+DE+N+PD   LCG++K + +P PYS
Sbjct  499   SNSLERQYLGHQLYFSVLSPSCSLKDEYNMPDNDILCGIIKDLPLPKPYS  548



>ref|XP_010044910.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW87033.1| hypothetical protein EUGRSUZ_B03580 [Eucalyptus grandis]
Length=551

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/409 (67%), Positives = 334/409 (82%), Gaps = 6/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I DWY+K H TL K LDSG  + RPDGV+INGK  K   K +PL
Sbjct  147   LIPVPYADPEDDYTVLIGDWYSKSHTTLHKFLDSGRALGRPDGVLINGKSSKSKGKEEPL  206

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG++ S+NFR +GH M LVEMEGSHTIQN YDSLD+HVGQC +VL
Sbjct  207   FTMKPGKTYKYRICNVGLKNSLNFRIQGHPMKLVEMEGSHTIQNSYDSLDVHVGQCFAVL  266

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADKEPKDYY+V S+R+ K   +T A+ISY NG G  ASP LP +P     G AW++NQ
Sbjct  267   VTADKEPKDYYMVASTRYTKTVLTTTAVISYTNGKG-PASPVLPEAP----VGWAWTLNQ  321

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNS S   GKLRYA+NG+SH N  TP
Sbjct  322   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSASREGGKLRYAINGISHANPATP  381

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENG-EKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEY+G+++K+FKYD M D  P    +K+T+ PNV N T+R FVE++FENHEK+IQ++
Sbjct  382   LKLAEYYGVADKIFKYDTMSDDAPATASDKITVEPNVANITYRTFVEVIFENHEKSIQSW  441

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVA+E GRW+PEKRK+YNL+DAVSRH++QV+P SWAA+M T DNAGMWNLRS
Sbjct  442   HLDGYSFFAVAVEPGRWTPEKRKSYNLLDAVSRHTVQVFPKSWAAIMLTFDNAGMWNLRS  501

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             ++ ER YLGQ+LY SVLSPERSLRDE+N+PD   LCG+VK ++ PPPY+
Sbjct  502   ELAERRYLGQELYISVLSPERSLRDEYNIPDDALLCGIVKDLAKPPPYT  550



>ref|XP_007014658.1| SKU5 similar 13 [Theobroma cacao]
 gb|EOY32277.1| SKU5 similar 13 [Theobroma cacao]
Length=553

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/408 (67%), Positives = 327/408 (80%), Gaps = 4/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P  ++ V I DWY K H  LKK LDSG ++ RPDGV+INGK  K   K  PL
Sbjct  149   LIPVPYSDPEADYTVLIGDWYTKSHTMLKKFLDSGRSLGRPDGVLINGKVAKGNGKDKPL  208

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG++ S+NFR +GH M LVEMEGSHT+QNVY+SLD+HVGQC +VL
Sbjct  209   FTMKPGKTYKYRICNVGLKNSLNFRIQGHRMKLVEMEGSHTVQNVYESLDVHVGQCFAVL  268

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+ PKDY++V S+RF K   +   II Y NG G  ASP+LPP+P     G AWS+NQ
Sbjct  269   VTADQGPKDYFMVASTRFTKNVLTATGIIRYTNGKGAAASPKLPPAP----VGWAWSLNQ  324

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FR+FRWNLTASAARPNPQGSYHYG INITRTIKLVN+ S   GKLRY +NGVSHIN  TP
Sbjct  325   FRTFRWNLTASAARPNPQGSYHYGAINITRTIKLVNTASRAGGKLRYGINGVSHINPPTP  384

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEY+ ++ KVFKYD++GD PP     VT+ PNV+N TFRNFVEI+ ENHEK+IQ+YH
Sbjct  385   LKLAEYYNVANKVFKYDVIGDEPPAKITGVTVQPNVLNMTFRNFVEIILENHEKSIQSYH  444

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVAIE GRW+PEKR+NYNL+DAVSRH+IQV+P SWAA++ T DNAGMWN+RS+
Sbjct  445   LDGYSFFAVAIEPGRWTPEKRRNYNLLDAVSRHTIQVFPKSWAAILLTFDNAGMWNIRSE  504

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             +WER YLGQQLY SV SP RSLRDE+N+PD   LCG+V  +  PPPY+
Sbjct  505   IWERTYLGQQLYASVASPVRSLRDEYNIPDNAPLCGVVTNLPKPPPYT  552



>ref|XP_002303974.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE78953.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=553

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/410 (67%), Positives = 337/410 (82%), Gaps = 7/410 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V ++DWY+K H  L+K+LDSG T+ARPDGV++NGK+ K   K +PL
Sbjct  148   LIPVPYADPEDDYTVILNDWYSKSHTALQKLLDSGRTLARPDGVLVNGKNAKGDGKDEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CN G++ ++NFR +GHTM LVEMEGSH +QNVY+SLD+HVGQC SVL
Sbjct  208   FTMKPGKTYKYRICNAGLKNTLNFRIQGHTMKLVEMEGSHVVQNVYESLDVHVGQCFSVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA+++PKDYY+V S+RF KQ  +   II Y NG G  ASPELP +P     G AWS+NQ
Sbjct  268   VTANQDPKDYYMVASTRFNKQVLTGKGIIRYTNGKG-PASPELPEAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG INITRTIKL+NS S   GKLRYALNGVSH+N +TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGSINITRTIKLINSASQEGGKLRYALNGVSHVNPETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPEN--GEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             LKLAEY+G+++KVFKYD + D+P  N    K+   PNV+N TFRNFVEI+FENHEK++Q+
Sbjct  383   LKLAEYYGVADKVFKYDTILDSPQANVANAKIVTQPNVLNLTFRNFVEIIFENHEKSMQS  442

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             YHLDG+SFFAVA+E G W+PEKRK+YNL+DAVSR ++QVYP SWAA++ T DNAG+WN+R
Sbjct  443   YHLDGYSFFAVAVEPGTWTPEKRKHYNLLDAVSRTTVQVYPKSWAAILLTFDNAGLWNIR  502

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             S+MWERAYLGQQLY SVLSP RSLRDE+NLPD   LCG+VK M  P PYS
Sbjct  503   SEMWERAYLGQQLYASVLSPARSLRDEYNLPDNSLLCGIVKDMPKPAPYS  552



>ref|XP_004164922.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/409 (69%), Positives = 333/409 (81%), Gaps = 6/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I DWY K H TLK+ LDSG +IARPDGV+INGK  K     +PL
Sbjct  149   LIPVPYADPEDDYTVLIGDWYTKSHTTLKQFLDSGRSIARPDGVLINGKTSKDDGIDEPL  208

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YRVCNVG++TS+NFRF+GHTM LVEMEGSHT+QN Y SLD+HVGQC SVL
Sbjct  209   FTMKPGKTYKYRVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQNDYKSLDVHVGQCFSVL  268

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+EPKDYY+V S+RF K       I+ Y NG G  ASPE+P +P     G AWS+NQ
Sbjct  269   VTADQEPKDYYMVASTRFIKSALVGKGIVRYTNGKG-PASPEIPNAP----MGWAWSLNQ  323

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FR+FRWNLTASAARPNPQGSYHYG INITRTIKLVNS + VDGKLRYA+NGVSH++ +TP
Sbjct  324   FRTFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSATKVDGKLRYAINGVSHVDPETP  383

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENG-EKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEYF I++KVFKYD + D     G   VT+APNVVN TFRNF+EI+FENHEK++Q++
Sbjct  384   LKLAEYFEITDKVFKYDTISDEGLAEGVTTVTVAPNVVNTTFRNFIEIIFENHEKSLQSW  443

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVAIE GRWSPEKR NYNL+DAVSRH+IQV+P SWAA++ T DNAGMWNLRS
Sbjct  444   HLDGYSFFAVAIEPGRWSPEKRSNYNLLDAVSRHTIQVFPKSWAAILLTFDNAGMWNLRS  503

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             ++ E  YLGQQLY SV SP RSLRDE+N+PDK  LCGLVK + +P PY+
Sbjct  504   ELTENRYLGQQLYMSVQSPARSLRDEYNIPDKTLLCGLVKDLPLPKPYT  552



>ref|XP_010034522.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW52300.1| hypothetical protein EUGRSUZ_J01720 [Eucalyptus grandis]
Length=552

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/409 (68%), Positives = 333/409 (81%), Gaps = 6/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I DWY+K HK LK  LDSG ++ARPDGVVINGK GK      P+
Sbjct  148   LIPVPYADPEDDYTVLIGDWYSKTHKQLKTFLDSGRSLARPDGVVINGKSGKGPGGDKPV  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG++ S+NFR +GH M LVEMEGSH +QNVY+SLD+HVGQC SVL
Sbjct  208   FTMKPGKTYKYRICNVGLKNSLNFRIQGHPMKLVEMEGSHVVQNVYESLDVHVGQCFSVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+EP+DYY+V S+RF K+  +   I+ Y NG G  AS  LP +P    EG AWS+NQ
Sbjct  268   VTADQEPRDYYMVASTRFTKEVITATRILRYTNGKG-PASTVLPKAP----EGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNS S   GKLRYA+NGVSH+N  TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSASRAGGKLRYAINGVSHVNPTTP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEK-VTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LK AEYFG ++KVFKYD++ D+PPE   K VTL PNV N TFR FVEI+FENHEK+IQ++
Sbjct  383   LKFAEYFGTADKVFKYDVIPDSPPEQEPKLVTLEPNVGNITFRTFVEIIFENHEKSIQSW  442

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVA+E GRW+PEKRK+YNL+DAVSRH++QV+P SWAA+M T DNAGMWNLRS
Sbjct  443   HLDGYSFFAVAVEPGRWTPEKRKSYNLLDAVSRHTVQVFPKSWAAIMLTFDNAGMWNLRS  502

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             ++ ER YLGQ++Y SVLSPERSLRDE+NLPD   LCG V G+ +P PY+
Sbjct  503   ELLERRYLGQEMYISVLSPERSLRDEYNLPDNAPLCGSVVGLPLPAPYT  551



>ref|XP_008438536.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=553

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/409 (68%), Positives = 333/409 (81%), Gaps = 6/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I DWY K H TLKK LDSG +IARPDGV+INGK  K     +PL
Sbjct  149   LIPVPYVDPEDDYTVLIGDWYTKSHSTLKKFLDSGRSIARPDGVLINGKIAKGDGTDEPL  208

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM  GKTY+YR+CNVG++ S+NFR +GHTM LVEMEGSHT+QNVY SLD+HVGQC SVL
Sbjct  209   FTMNPGKTYKYRICNVGLKISLNFRIQGHTMKLVEMEGSHTVQNVYQSLDVHVGQCFSVL  268

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD++P+DYY+V SSRF K       I+ Y NG    ASPE+P +P     G AWS+NQ
Sbjct  269   VTADQDPRDYYMVASSRFTKNILVGKGIVRYTNGKA-PASPEIPEAP----RGWAWSLNQ  323

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FR+FRWNLTA+AARPNPQGSYHYG INITRTIK+VNS + +DGKLRYA+NGVSHI+ +TP
Sbjct  324   FRTFRWNLTANAARPNPQGSYHYGSINITRTIKIVNSATNIDGKLRYAINGVSHIDPETP  383

Query  722   LKLAEYFGISEKVFKYDIMGDT-PPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEYF +++KVFKYD + D    +    VT+APNVVNATFRNFVEI+FENHEK++Q++
Sbjct  384   LKLAEYFEVADKVFKYDTISDEGSAKTANTVTIAPNVVNATFRNFVEIIFENHEKSLQSW  443

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVAIE GRWSPEKRKNYNL+DAVSRH+IQV+P SW A++ TLDNAGMWNLRS
Sbjct  444   HLDGYSFFAVAIEPGRWSPEKRKNYNLLDAVSRHTIQVFPKSWGAILLTLDNAGMWNLRS  503

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             ++ E  YLGQQLYFSV SP RSLRDE+N+PD   LCGLVK MS+P PY+
Sbjct  504   ELTENRYLGQQLYFSVQSPARSLRDEYNIPDNALLCGLVKDMSLPQPYT  552



>ref|XP_009803815.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=557

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/412 (67%), Positives = 339/412 (82%), Gaps = 10/412 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD+P D+F V ++DWY K H  LK +LD+G  + RP GV+INGK GK   K +P+
Sbjct  148   LIPVPFDTPEDDFMVLVADWYTKSHTELKNLLDNGRALGRPQGVIINGKSGKGDGKDEPM  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             +T+  GKTYR+R CNVGM+ S+N RF+GHTM LVE+EGSHT+QNVY+SLD+H+GQC+SVL
Sbjct  208   YTLTPGKTYRFRFCNVGMKDSINVRFQGHTMKLVEIEGSHTVQNVYESLDVHLGQCMSVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             +TAD++PKDY+LV S+RF K+     A I YANG G  ASPELP +P    EG AWS+NQ
Sbjct  268   ITADQDPKDYFLVASTRFTKEPHVATATIRYANGKG-PASPELPKAP----EGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLV S   VDGKLRYA+NGVSH++  TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVTSAGNVDGKLRYAINGVSHVDPATP  382

Query  722   LKLAEYFGISEKVFKYDIMGD-----TPPENGEKVTLAPNVVNATFRNFVEIVFENHEKT  886
             +KLAEY+G+ +KVFKYD++ D     +  E  +K+TLAPNVVNAT+RNFVEI+FENH K+
Sbjct  383   IKLAEYYGVGDKVFKYDLIKDDYEPASGKEAQDKITLAPNVVNATYRNFVEIIFENHGKS  442

Query  887   IQTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMW  1066
             +Q++HL G+SFFAV IE GRW+PEKR+NYNL+DAVSR++IQVYPNSWAAVMTTLDNAG+W
Sbjct  443   VQSWHLSGYSFFAVGIEPGRWTPEKRRNYNLLDAVSRNTIQVYPNSWAAVMTTLDNAGLW  502

Query  1067  NLRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             NLRS+  ER YLG QLYFSVLSP RS++DE+N+PD + LCGLVK M  P PY
Sbjct  503   NLRSNSLERNYLGHQLYFSVLSPNRSIKDEYNMPDNELLCGLVKDMPRPTPY  554



>ref|XP_004137383.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/409 (68%), Positives = 334/409 (82%), Gaps = 6/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I DWY K H TLKK LDSG +IARPDGV+ING+  K     +PL
Sbjct  149   LIPVPYADPEDDYTVLIGDWYTKSHSTLKKFLDSGRSIARPDGVLINGRIAKGDGTDEPL  208

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+  KTY+YR+CNVG++TS+NFR +GHTM LVEMEGSHT+QNVY SLD+HVGQC SVL
Sbjct  209   FTMKPEKTYKYRICNVGLKTSLNFRIQGHTMKLVEMEGSHTVQNVYQSLDVHVGQCFSVL  268

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADK+PKDYY+V S+RF K       II Y NG    ASPE+P +P     G AWS+NQ
Sbjct  269   VTADKDPKDYYMVASTRFTKNILVGKGIIRYTNGKA-PASPEIPEAP----RGWAWSLNQ  323

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FR+FRWNLTASAARPNPQGSYHYG INITRTIK+VNS + VDGKLRYA+NGVSH++ +TP
Sbjct  324   FRTFRWNLTASAARPNPQGSYHYGSINITRTIKIVNSATNVDGKLRYAINGVSHVDPETP  383

Query  722   LKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEYF +++KVFKYD + D    +    VT+APNV+NATFRNFVEIVFEN EK++Q++
Sbjct  384   LKLAEYFEVADKVFKYDTISDEGLSKTANIVTVAPNVLNATFRNFVEIVFENQEKSLQSW  443

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVA+E GRWSPEKRKNYNL+DAVSRH+IQV+P SWAA++ TLDNAGMWNLRS
Sbjct  444   HLDGYSFFAVAVEPGRWSPEKRKNYNLLDAVSRHTIQVFPKSWAAILLTLDNAGMWNLRS  503

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             ++ E  YLGQQ+YFSV SP RSLRDE+N+PD   LCGLVK M +PPPY+
Sbjct  504   ELTENRYLGQQMYFSVQSPARSLRDEYNIPDNTLLCGLVKDMPLPPPYT  552



>ref|XP_008374029.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=552

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/408 (69%), Positives = 333/408 (82%), Gaps = 6/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P DE+ V I DWY K H  LKK+LDSG T+ RPD ++INGK+ K   K +PL
Sbjct  148   LIPVPYADPEDEYTVMIGDWYTKSHTALKKLLDSGRTMGRPDXILINGKNAKGDGKDEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YRVCNVG + S+NFR +GH + LVEMEGSHT+QN Y+SLD+H+GQC S+L
Sbjct  208   FTMKPGKTYKYRVCNVGFKNSLNFRIQGHPLKLVEMEGSHTVQNTYESLDVHLGQCFSLL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADKE KDYY+V S+RF K   +   II Y N NG  ASPELP +P     G AWS+NQ
Sbjct  268   VTADKERKDYYMVASTRFTKTVLTGKGIIRYENXNG-PASPELPEAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIK+VNS S V+GKLRYA+NGVS++ ++TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKIVNSASXVNGKLRYAINGVSYVESETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGE-KVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLA+YFG+++KVFKYD + D PP   E KVTLAPNVVN TFR FVEI+FENHEK+IQ++
Sbjct  383   LKLAQYFGVADKVFKYDTIQDEPPATVEDKVTLAPNVVNQTFRXFVEIIFENHEKSIQSW  442

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVAIE GRW+PEKRKNYNL+D VSRH+IQV+P SWAA+M T DNAGMWN+RS
Sbjct  443   HLDGYSFFAVAIEPGRWTPEKRKNYNLLDGVSRHTIQVFPKSWAAIMLTFDNAGMWNVRS  502

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             +  ER YLGQQ Y SVLSP RSLRDE+NLP+  QLCG+VK +  PPPY
Sbjct  503   EQPERRYLGQQFYVSVLSPARSLRDEYNLPETTQLCGIVKDLPKPPPY  550



>ref|XP_003635547.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 ref|XP_003635599.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI18839.3| unnamed protein product [Vitis vinifera]
 emb|CBI41110.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/409 (68%), Positives = 335/409 (82%), Gaps = 9/409 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD P D++ V I DWY K H  LKK LDSGH+I RPDGV INGK     DK +PL
Sbjct  149   LIPVPFDDPEDDYTVLIGDWYKKSHTVLKKKLDSGHSIGRPDGVQINGKSE---DKDEPL  205

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ G TYRYR+CNVG+++S+NFR +GHTM LVE+EGSHT+QNVYDSLD+H+GQC SVL
Sbjct  206   FTMKPGLTYRYRICNVGIKSSLNFRIQGHTMKLVELEGSHTVQNVYDSLDVHLGQCYSVL  265

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA+++PKDYY+V S+RF KQ ++   II Y NG G  ASPELP  P     G  WS+NQ
Sbjct  266   VTANQDPKDYYMVASTRFLKQVYTAKRIIRYTNGKG-PASPELPEPP----SGWIWSLNQ  320

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG INITRTIK+VNS S VDGKLRYA+NGVSH +  TP
Sbjct  321   FRSFRWNLTASAARPNPQGSYHYGFINITRTIKIVNSASTVDGKLRYAINGVSHTDPTTP  380

Query  722   LKLAEYFGISEKVFKYDIM-GDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
              KLAEYFG+ +KVFKY+ M  D PPE+ EK+ + PNV+N TFR FVEI+FENHEK+IQ++
Sbjct  381   PKLAEYFGVVDKVFKYNTMVDDPPPESAEKIVITPNVLNITFRTFVEIIFENHEKSIQSW  440

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HL+G+SFFAVA+E GRW+P+KRKNYNL+DAVSR++IQVYP SW A++ T DNAG+WNLRS
Sbjct  441   HLNGYSFFAVAMEPGRWNPDKRKNYNLLDAVSRNTIQVYPGSWTAILLTFDNAGLWNLRS  500

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             + WER YLGQQLY SVLSP RSLRDE+N+PD  +LCG+VKG+  P PY+
Sbjct  501   ETWERNYLGQQLYVSVLSPARSLRDEYNIPDVAELCGIVKGLPKPQPYT  549



>emb|CAN69061.1| hypothetical protein VITISV_032605 [Vitis vinifera]
Length=562

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/409 (68%), Positives = 335/409 (82%), Gaps = 9/409 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD P D++ V I DWY K H  LKK LDSGH+I RPDGV INGK     DK +PL
Sbjct  161   LIPVPFDDPEDDYTVLIGDWYKKSHTVLKKKLDSGHSIGRPDGVQINGKSE---DKDEPL  217

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ G TYRYR+CNVG+++S+NFR +GHTM LVE+EGSHT+QNVYDSLD+H+GQC SVL
Sbjct  218   FTMKPGLTYRYRICNVGIKSSLNFRIQGHTMKLVELEGSHTVQNVYDSLDVHLGQCYSVL  277

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA+++PKDYY+V S+RF KQ ++   II Y NG G  ASPELP  P     G  WS+NQ
Sbjct  278   VTANQDPKDYYMVASTRFLKQVYTAKRIIRYTNGKG-PASPELPEPP----SGWIWSLNQ  332

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG INITRTIK+VNS S VDGKLRYA+NGVSH +  TP
Sbjct  333   FRSFRWNLTASAARPNPQGSYHYGFINITRTIKIVNSASTVDGKLRYAINGVSHTDPTTP  392

Query  722   LKLAEYFGISEKVFKYDIM-GDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
              KLAEYFG+ +KVFKY+ M  D PPE+ EK+ + PNV+N TFR FVEI+FENHEK+IQ++
Sbjct  393   PKLAEYFGVVDKVFKYNTMVDDPPPESAEKIVITPNVLNITFRTFVEIIFENHEKSIQSW  452

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HL+G+SFFAVA+E GRW+P+KRKNYNL+DAVSR++IQVYP SW A++ T DNAG+WNLRS
Sbjct  453   HLNGYSFFAVAMEPGRWNPDKRKNYNLLDAVSRNTIQVYPGSWTAILLTFDNAGLWNLRS  512

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             + WER YLGQQLY SVLSP RSLRDE+N+PD  +LCG+VKG+  P PY+
Sbjct  513   ETWERNYLGQQLYVSVLSPARSLRDEYNIPDVAELCGIVKGLPKPQPYT  561



>ref|XP_008219681.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=554

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/410 (68%), Positives = 334/410 (81%), Gaps = 6/410 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I DWY K H  LKK LDSG ++ RPDGV+INGK  K   K +PL
Sbjct  148   LIPVPYADPEDDYTVLIGDWYAKSHTALKKHLDSGRSMGRPDGVIINGKSAKGDGKDEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG++ S+NFR +GH M LVEMEGSHT+QN Y+SLD+H+GQC SVL
Sbjct  208   FTMKPGKTYKYRICNVGLKNSLNFRIQGHPMKLVEMEGSHTMQNTYESLDVHLGQCFSVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADK+P DYY+V S+RF K+  +   I+ Y NGNG  ASPELP +P     G AWS+NQ
Sbjct  268   VTADKDPMDYYMVASTRFTKKVLTGKGIMRYENGNG-PASPELPEAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRT+K+VNS + VDGKLRYA+NGVSH++ +TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGKINITRTMKIVNSATKVDGKLRYAINGVSHVDPETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGE-KVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEY+G+++KVFKYD + D PP   E KVTLAPNVVN TFRNFVEI+FENHEK+IQ++
Sbjct  383   LKLAEYYGVADKVFKYDTIQDEPPATVEDKVTLAPNVVNQTFRNFVEIIFENHEKSIQSW  442

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             +LDG+SFF VAIE GRW+PEKR NYNL+D VSRH+IQV+P SWAA+M T DNAGMWN+RS
Sbjct  443   NLDGYSFFTVAIEPGRWTPEKRNNYNLLDGVSRHTIQVFPKSWAAIMLTFDNAGMWNVRS  502

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1228
             +  ER YLGQQ Y SVLSP RSLRDE+NLPD   +CG+VK +  PPPYS 
Sbjct  503   EQSERRYLGQQFYVSVLSPARSLRDEYNLPDNTLVCGVVKDLPKPPPYSA  552



>ref|XP_004149637.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/409 (68%), Positives = 334/409 (82%), Gaps = 6/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I DWY K H  LK++LDSG +IARPDGV+INGK  K     +PL
Sbjct  149   LIPVPYADPEDDYTVLIGDWYTKSHTALKQLLDSGRSIARPDGVLINGKSAKGDGTDEPL  208

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YRVCNVG+++S+NFRF+GHTM LVEMEGSHT+QN Y+SLD+HVGQC SVL
Sbjct  209   FTMKPGKTYKYRVCNVGLKSSLNFRFQGHTMKLVEMEGSHTVQNDYESLDVHVGQCFSVL  268

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++EPKDYY+V S+RF K       I+ Y +G G  ASPE+P +P     G AWS+NQ
Sbjct  269   VTANQEPKDYYMVASTRFIKNVLVGKGIVRYIDGKG-PASPEIPEAP----MGWAWSLNQ  323

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FR+FRWNLTASAARPNPQGSYHYG INITRTIKLVNS S VDGKLRYA+NGVSH++ +TP
Sbjct  324   FRTFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSISKVDGKLRYAINGVSHVDPETP  383

Query  722   LKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEYF +++KVFKYD + D    E    VT+APNVVNATFRNF+EI+FENHEK++Q++
Sbjct  384   LKLAEYFEVADKVFKYDTISDEGLAEGATTVTVAPNVVNATFRNFIEIIFENHEKSLQSW  443

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVAIE GRWSPEKR NYNL+DAVSRH+IQV+P SWAA++ T DNAGMWNLRS
Sbjct  444   HLDGYSFFAVAIEPGRWSPEKRANYNLLDAVSRHTIQVFPKSWAAILLTFDNAGMWNLRS  503

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             ++ E  YLG QLY SVLSP RSLRDE+N+PD   LCGLVK M +P PY+
Sbjct  504   ELLENRYLGSQLYVSVLSPARSLRDEYNIPDNTLLCGLVKDMPLPKPYT  552



>ref|XP_004149634.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/409 (68%), Positives = 333/409 (81%), Gaps = 6/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I DWY K H TLK+ LDSG +IARPDGV+INGK  K     +PL
Sbjct  149   LIPVPYADPEDDYTVLIGDWYTKSHTTLKQFLDSGRSIARPDGVLINGKTSKDDGIDEPL  208

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YRVCNVG+++S+NFRF+GHTM LVEMEGSHT+QN Y SLD+HVGQC SVL
Sbjct  209   FTMKPGKTYKYRVCNVGLKSSLNFRFQGHTMKLVEMEGSHTVQNDYKSLDVHVGQCFSVL  268

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++EPKDYY+V S+RF K       I+ Y NG G  ASPE+P +P     G AWS+NQ
Sbjct  269   VTANQEPKDYYMVASTRFIKSALVGKGIVRYTNGKG-PASPEIPNAP----MGWAWSLNQ  323

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FR+FRWNLTASAARPNPQGSYHYG INITRTIKLVNS + VDGKLRYA+NGVSH++ +TP
Sbjct  324   FRTFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSATKVDGKLRYAINGVSHVDPETP  383

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENG-EKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEYF I++KVFKYD + D     G   VT+APNVVN TFRNF+EI+FENHEK++Q++
Sbjct  384   LKLAEYFEITDKVFKYDTISDEGLAEGVTTVTVAPNVVNTTFRNFIEIIFENHEKSLQSW  443

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVAIE GRWSPEKR NYNL+DAVSRH+IQV+P SWAA++ T DNAGMWNLRS
Sbjct  444   HLDGYSFFAVAIEPGRWSPEKRSNYNLLDAVSRHTIQVFPKSWAAILLTFDNAGMWNLRS  503

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             ++ E  YLGQQLY SV SP RSLRDE+N+PDK  LCGLVK + +P PY+
Sbjct  504   ELTENRYLGQQLYMSVQSPARSLRDEYNIPDKTLLCGLVKDLPLPKPYT  552



>ref|XP_004165665.1| PREDICTED: LOW QUALITY PROTEIN: L-ascorbate oxidase homolog [Cucumis 
sativus]
Length=553

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/409 (68%), Positives = 333/409 (81%), Gaps = 6/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I DWY K H TLKK LDSG +IARPDGV+ING+  K     +PL
Sbjct  149   LIPVPYADPEDDYTVLIGDWYTKSHSTLKKFLDSGRSIARPDGVLINGRIAKGDGTDEPL  208

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+  KTY+YR+CNVG++TS+NFR +GHTM LVEMEGSHT+QNVY SLD+HVGQC SVL
Sbjct  209   FTMKPEKTYKYRICNVGLKTSLNFRIQGHTMKLVEMEGSHTVQNVYQSLDVHVGQCFSVL  268

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADK+PKDYY+V S+RF K       II Y NG    ASPE+P +P     G AWS+NQ
Sbjct  269   VTADKDPKDYYMVASTRFTKNILVGKGIIRYTNGKA-PASPEIPEAP----RGWAWSLNQ  323

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FR+FRWNLTASAARPNPQGSYHYG INITRTIK+VNS + VDGKLRYA+NGVSH++ +TP
Sbjct  324   FRTFRWNLTASAARPNPQGSYHYGSINITRTIKIVNSATNVDGKLRYAINGVSHVDPETP  383

Query  722   LKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEYF +++KVFKYD + D    +    VT+APNV+NATFRNFVEIVFEN EK++Q++
Sbjct  384   LKLAEYFEVADKVFKYDTISDEGLSKTANIVTVAPNVLNATFRNFVEIVFENQEKSLQSW  443

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVA+E GRWSPEKRKNYNL+DAVSRH+IQ +P SWAA++ TLDNAGMWNLRS
Sbjct  444   HLDGYSFFAVAVEPGRWSPEKRKNYNLLDAVSRHTIQXFPKSWAAILLTLDNAGMWNLRS  503

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             ++ E  YLGQQ+YFSV SP RSLRDE+N+PD   LCGLVK M +PPPY+
Sbjct  504   ELTENRYLGQQMYFSVQSPARSLRDEYNIPDNTLLCGLVKDMPLPPPYT  552



>ref|XP_006352142.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=556

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/413 (69%), Positives = 340/413 (82%), Gaps = 10/413 (2%)
 Frame = +2

Query  2     LIPVPFD-SPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDP  178
             LIP+PFD +PADEF V +SDWY K H  L+K LDSG ++ RPDG++INGK GK   K +P
Sbjct  148   LIPIPFDINPADEFFVLVSDWYTKSHTQLRKFLDSGRSMGRPDGIIINGKGGKGDGKDEP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LF+M  GKTYRYR CN GM+ S+N R +GHTM LVEMEGSH +QN+YDSLD+H+GQC+SV
Sbjct  208   LFSMTPGKTYRYRFCNAGMKDSINVRIQGHTMKLVEMEGSHVVQNMYDSLDIHLGQCVSV  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             LVTADK+PKDY LV S+RF K+  +  +II Y NGNG  ASPELP +P     G AWS+N
Sbjct  268   LVTADKDPKDYLLVASTRFTKEPHTATSIIRYTNGNG-PASPELPKAP----IGWAWSLN  322

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVN+   VDGKLRYA+NGVSH+N  T
Sbjct  323   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNTAGTVDGKLRYAINGVSHVNPTT  382

Query  719   PLKLAEYFGISEKVFKYDIMGDT--PPENG--EKVTLAPNVVNATFRNFVEIVFENHEKT  886
             P+KL EY+G+ +K+FKYD+M D   PP     EK+TLAPNVV  T+RNFVEI+FENHEK+
Sbjct  383   PIKLVEYYGVEDKIFKYDLMKDEYEPPAGKAEEKITLAPNVVKVTYRNFVEIIFENHEKS  442

Query  887   IQTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMW  1066
             +Q++HL G+SFFAVAIE G+W+PEKRKNYNL+DAVSR++IQVYPNSWAA+MTTLDNAG+W
Sbjct  443   VQSFHLAGYSFFAVAIEPGKWTPEKRKNYNLLDAVSRNTIQVYPNSWAAIMTTLDNAGLW  502

Query  1067  NLRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             NLRS+  ER YLGQQLYFS LSP+R L+DE+N+PD   LCG++K M +P PYS
Sbjct  503   NLRSNSVERQYLGQQLYFSALSPKRDLKDEYNMPDNDVLCGIIKDMPLPKPYS  555



>ref|XP_004164925.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/409 (68%), Positives = 332/409 (81%), Gaps = 6/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I DWY K H  LK+ LDSG +IARPDGV+INGK  K     +PL
Sbjct  149   LIPVPYADPEDDYTVLIGDWYTKSHTALKQFLDSGRSIARPDGVLINGKTAKGDGTDEPL  208

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YRVCNVG+++S+NFRF+GHTM LVEMEGSHT+QN Y SLD+HVGQC SVL
Sbjct  209   FTMKPGKTYKYRVCNVGLKSSLNFRFQGHTMKLVEMEGSHTVQNDYQSLDVHVGQCFSVL  268

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++EPKDYY+V S+RF K       I+ Y +G G  ASPE+P +P     G AWS+NQ
Sbjct  269   VTANQEPKDYYMVASTRFIKNVLVGKGIVRYIDGKG-PASPEIPEAP----MGWAWSLNQ  323

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FR+FRWNLTASAARPNPQGSYHYG INITRTIKLVNS S VDGKLRYA+NGVSH++ +TP
Sbjct  324   FRTFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSISKVDGKLRYAINGVSHVDPETP  383

Query  722   LKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEYF +++KVFKYD + D    E    VT+APNVVNATFRNF+EI+FENHEK++Q++
Sbjct  384   LKLAEYFEVADKVFKYDTISDEGLAEGATTVTVAPNVVNATFRNFIEIIFENHEKSLQSW  443

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVAIE GRWSPEKR NYNL+DAVSRH+IQV+P SWAA++ T DNAGMWNLRS
Sbjct  444   HLDGYSFFAVAIEPGRWSPEKRANYNLLDAVSRHTIQVFPKSWAAILLTFDNAGMWNLRS  503

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             ++ E  YLG QLY SVLSP RSLRDE+N+PD   LCGLVK M +P PY+
Sbjct  504   ELLENRYLGSQLYVSVLSPARSLRDEYNIPDNTLLCGLVKDMPLPKPYT  552



>gb|KDP30647.1| hypothetical protein JCGZ_16212 [Jatropha curcas]
Length=551

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/407 (67%), Positives = 326/407 (80%), Gaps = 5/407 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I+DWY K HK L+  LD G  + RPDGV+INGK+ K   K +PL
Sbjct  148   LIPVPYAPPEDDYTVIINDWYTKDHKALRSFLDEGRVLGRPDGVLINGKNAKGDGKDEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             F M+  K Y+YR+CN G++ S+NFR +GHTM LVEMEGSHT+QNVY+SLD+HVGQC SVL
Sbjct  208   FEMKPEKVYKYRICNAGLKASLNFRIQGHTMMLVEMEGSHTVQNVYESLDVHVGQCFSVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADKEPKDYY+V S+RF K   +   II Y NG G  ASPELP +P     G AWS+NQ
Sbjct  268   VTADKEPKDYYMVASTRFLKTVLTAKGIIRYTNGKG-PASPELPEAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGS+HYG INITRTIK ++  +   GKLRYA+NGVSH N +TP
Sbjct  323   FRSFRWNLTASAARPNPQGSFHYGSINITRTIKFISQATKAGGKLRYAVNGVSHTNPETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYFGI++KVFKYD + D PP   E+ TLAPNV+N TFR+FVEI+FEN EKTIQ++H
Sbjct  383   LKLAEYFGIADKVFKYDTIKDDPPAKVEEATLAPNVMNMTFRDFVEIIFENPEKTIQSWH  442

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA+E G W+PEKR NYNL+DAVSRH++QVYP SWAA++ T DNAGMWN+RS+
Sbjct  443   LDGYSFFAVAVEPGTWTPEKRNNYNLLDAVSRHTVQVYPKSWAAILLTFDNAGMWNIRSE  502

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             +WE+ YLGQQLY SVLSP RSLRDE+N+PD   LCGLVK +  PPPY
Sbjct  503   IWEKTYLGQQLYASVLSPARSLRDEYNIPDNALLCGLVKDLPKPPPY  549



>ref|XP_011025085.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=553

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/410 (67%), Positives = 334/410 (81%), Gaps = 7/410 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V ++DWY+K H  L+K+LDSG T+ARPDGV++NGK+ K   K +PL
Sbjct  148   LIPVPYADPEDDYTVILNDWYSKSHTALQKLLDSGRTLARPDGVLVNGKNAKGDGKDEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             F M+  KTY+YR+CN G++ ++NFR +GHTM LVEMEGSH +QNVY+SLD+HVGQC SVL
Sbjct  208   FKMKPEKTYKYRICNAGIKNTLNFRIQGHTMKLVEMEGSHVVQNVYESLDVHVGQCFSVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA+++PKDYY+V S+RF KQ  +   II Y NG G  ASPELP +P     G AWS+NQ
Sbjct  268   VTANQDPKDYYMVASTRFNKQVLTAKGIIRYTNGKG-PASPELPEAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG INITRTIKLVNS S   GKLRYALNGVSH+N +TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASRAGGKLRYALNGVSHVNPETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPEN--GEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             LKLAEY+G+++KVFKYD + D+P  N    K+   PNV+N TFRNFVEI+FENHEK++Q+
Sbjct  383   LKLAEYYGVADKVFKYDTILDSPQANVANAKIVTQPNVLNLTFRNFVEIIFENHEKSMQS  442

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             YHLDG+SFFAVA+E G W+PEKRK+YNL+DAVSR ++QV+P SWAA++ T DNAG+WN+R
Sbjct  443   YHLDGYSFFAVAVEPGTWTPEKRKHYNLLDAVSRTTVQVFPKSWAAILLTFDNAGLWNIR  502

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             S+MWER YLGQQLY SVLSP RSLRDE+NLPD   LCG+VK M  P PYS
Sbjct  503   SEMWERVYLGQQLYASVLSPARSLRDEYNLPDNSLLCGIVKDMPKPAPYS  552



>ref|XP_009611384.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=557

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/412 (67%), Positives = 336/412 (82%), Gaps = 10/412 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD+P D+F V ++DWY K H  LK +LD+G  + RP GV+INGK GK   K +P+
Sbjct  148   LIPVPFDTPEDDFMVLVADWYTKSHTELKNLLDNGRALGRPQGVIINGKSGKGDGKDEPM  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             +T+  GKTYR+R CNVGM+ S+N RF+GHTM LVE+EGSHT+QNVY+SLD+H+GQC+SVL
Sbjct  208   YTLTPGKTYRFRFCNVGMKDSINVRFQGHTMKLVEIEGSHTVQNVYESLDVHLGQCMSVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             +TAD++PKDY+LV S+RF K+     A I YANG G  ASP+LP +P    EG AWS+NQ
Sbjct  268   ITADQDPKDYFLVASTRFTKEPHVATATIRYANGKG-PASPQLPKAP----EGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLV S   VDGKLRYA+NGVSH++  TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVTSAGNVDGKLRYAINGVSHVDPATP  382

Query  722   LKLAEYFGISEKVFKYDIMGD-----TPPENGEKVTLAPNVVNATFRNFVEIVFENHEKT  886
             +KLAEY+G+ +KVFKYD++ D     +  E  +K+TLAPNVVNAT+RNFVEI+FENH K+
Sbjct  383   IKLAEYYGVGDKVFKYDLIKDDYEPASGKEAQDKITLAPNVVNATYRNFVEIIFENHGKS  442

Query  887   IQTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMW  1066
             +Q++HL GHSFFAV IE GRW+PEKR+NYNL+DAVSR++IQVYPNSWAA+MTTLDNAG+W
Sbjct  443   VQSWHLSGHSFFAVGIEPGRWTPEKRRNYNLLDAVSRNTIQVYPNSWAAIMTTLDNAGLW  502

Query  1067  NLRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             NLRS+  ER YLG QLYFSVLSP  S++DE+N+PD   +CG VK M  P PY
Sbjct  503   NLRSNSLERNYLGHQLYFSVLSPNHSVKDEYNMPDNDLVCGFVKDMPRPTPY  554



>ref|XP_009135303.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=551

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/408 (66%), Positives = 334/408 (82%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I+DWY K H  LK  LDSG T+  PDGV+INGK GKVG +  PL
Sbjct  148   LIPVPYADPEDDYTVLINDWYTKSHTALKNFLDSGRTLGSPDGVLINGKSGKVGGQDKPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG ++++NFR +GH M LVEMEGSH +QN YDSLD+HVGQC +VL
Sbjct  208   FTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+  K+YY+V S+RF K+E STV ++SY  G+ +  S ELP +P     G AWS+NQ
Sbjct  268   VTADQAAKNYYMVASTRFLKKEVSTVGVMSY-EGSTVQPSSELPKAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             +RSFRWNLTASAARPNPQGSYHYG+INITRTIKL N+KS V+GK+R+  NGVSH++T+TP
Sbjct  323   YRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKSVVNGKVRFGFNGVSHVDTETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYF +SEKVFKY+++ D P      +T+ PNV+N TFR FVEIVFENHEK++Q++H
Sbjct  383   LKLAEYFEMSEKVFKYNVIKDEPAAKVTTLTVEPNVLNITFRTFVEIVFENHEKSMQSFH  442

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA E GRW+PEKRKNYNL+DAVSRH++QVYPNSW+A++ T DNAGMWN+RS+
Sbjct  443   LDGYSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPNSWSAILLTFDNAGMWNIRSE  502

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
              WER YLGQQLY SVLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  503   NWERRYLGQQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPTPYT  550



>ref|XP_010465173.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=551

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/408 (65%), Positives = 334/408 (82%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D+  + I+DW+ K H  LK  LDSG T+  PDGV+INGK GKVG+K + L
Sbjct  148   LIPVPYADPEDDHTILINDWFTKSHTALKNFLDSGRTLGSPDGVLINGKFGKVGEKNEAL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG ++S+NFR +GH M LVEMEGSH +QN YDSLD+HVGQC +VL
Sbjct  208   FTMKPGKTYKYRICNVGFKSSLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+  K+YY+V S+RF K+E STV ++SY  G+ + AS ELP +P     G AWS+NQ
Sbjct  268   VTADQVAKNYYMVASTRFLKKEVSTVGVLSY-EGSNVEASAELPKAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKL NSK+ V+GK+R+  NGVSH++T+TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANSKNVVNGKVRFGFNGVSHVDTETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYFG++EKVFKY+++ D P      +T+ PNV+N TFR FVEI+FENHEK++Q++H
Sbjct  383   LKLAEYFGMAEKVFKYNVIKDEPAAKITALTVEPNVLNITFRTFVEIIFENHEKSMQSFH  442

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDGHSFFAVA E GRW+PEKR NYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+
Sbjct  443   LDGHSFFAVASEPGRWTPEKRSNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNVRSE  502

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
              WER YLG+QLY SVLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  503   NWERRYLGEQLYISVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPTPYT  550



>emb|CDX82540.1| BnaA03g32810D [Brassica napus]
Length=551

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/408 (65%), Positives = 333/408 (82%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I+DWY K H  LK  LDSG T+  PDGV+INGK GKVG +  PL
Sbjct  148   LIPVPYADPEDDYTVLINDWYTKSHTALKNFLDSGRTLGSPDGVLINGKSGKVGGQDKPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG ++++NFR +GH M LVEMEGSH +QN YDSLD+HVGQC +VL
Sbjct  208   FTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+  K+YY+V S+RF K+E STV ++SY  G+ +  S ELP +P     G AWS+NQ
Sbjct  268   VTADQAAKNYYMVASTRFLKKEVSTVGVMSY-EGSTVQPSSELPKAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             +RSFRWNLTASAARPNPQGSYHYG+INITRTIKL N+KS V+GK+R+  NGVSH++T+TP
Sbjct  323   YRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKSVVNGKVRFGFNGVSHVDTETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYF +SEKVFKY+++ D P      +T+ PNV+N TFR FVEIVFENHEK++Q++H
Sbjct  383   LKLAEYFEMSEKVFKYNVIKDEPAAKATTLTVEPNVLNITFRTFVEIVFENHEKSMQSFH  442

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA E GRW+PEKRKNYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+
Sbjct  443   LDGYSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  502

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
              WER YLGQQLY SVLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  503   NWERRYLGQQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPTPYT  550



>gb|EYU39505.1| hypothetical protein MIMGU_mgv1a003980mg [Erythranthe guttata]
Length=551

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/410 (69%), Positives = 329/410 (80%), Gaps = 8/410 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDP-  178
             LIPVPFD P +E+ V   DWY K H  LK+ +D+G TI R DGV+INGK GK GD  DP 
Sbjct  147   LIPVPFDWPEEEYIVLTGDWYRKSHTELKRHMDNGKTIGRTDGVIINGKQGK-GDGSDPP  205

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             +FTM  GKTYRYR CNVGM+ S+N R +GHTM LVE+EGSHT+QNVYDSLD+H+GQC SV
Sbjct  206   MFTMIPGKTYRYRFCNVGMKNSLNVRIQGHTMKLVEIEGSHTVQNVYDSLDVHMGQCYSV  265

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             LVTAD++PKDYYLV S+RF K    T A I Y   N   ASP LP +P     G AWS+N
Sbjct  266   LVTADQKPKDYYLVSSTRFTKTVLMTTATIRYTGSNE-PASPVLPEAP----TGWAWSLN  320

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYG+INITRTIK VN+   VD KLRYA+NG+SH+NTDT
Sbjct  321   QFRSFRWNLTASAARPNPQGSYHYGKINITRTIKFVNTAGTVDRKLRYAINGLSHMNTDT  380

Query  719   PLKLAEYFGISEKVFKYDIMGDTPPEN-GEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             PLKLAEY+GI ++VFKYDI+ D PP + G KVT+APNV+   FRNFVEI+FENHEK++Q+
Sbjct  381   PLKLAEYYGIQDQVFKYDIITDDPPADVGTKVTIAPNVITGIFRNFVEIIFENHEKSVQS  440

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HL G+SFFAVAIE G WSPEKRKNYNLVDAVSRH+IQVYP  WAA+MTTLDNAGMWN+R
Sbjct  441   WHLSGYSFFAVAIEPGTWSPEKRKNYNLVDAVSRHTIQVYPKGWAAIMTTLDNAGMWNMR  500

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             S + ER YLGQQLY SVLSP RSLRDE+N+P+ Q LCG VK +  P PYS
Sbjct  501   SLLLERNYLGQQLYVSVLSPARSLRDEYNMPETQLLCGKVKNLPFPAPYS  550



>ref|XP_010044914.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW87034.1| hypothetical protein EUGRSUZ_B03581 [Eucalyptus grandis]
Length=552

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/410 (67%), Positives = 329/410 (80%), Gaps = 6/410 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGK-VGDKIDP  178
             LIPVP+  P D++ V I DWY+K H  L++ LD+G  +ARPDGV+ING+ GK  G  + P
Sbjct  146   LIPVPYADPEDDYTVLIGDWYSKSHTVLRQKLDAGRPLARPDGVLINGQTGKGKGKDVKP  205

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFTM+ GKTY+YR+CNVG++ S+NFR +GH M LVEMEGSHT+QN YDSLD+HVGQC SV
Sbjct  206   LFTMKPGKTYKYRICNVGLKNSLNFRIQGHQMKLVEMEGSHTVQNTYDSLDVHVGQCFSV  265

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             L+TADK+P+DYY+V S+RF K   +   II Y NGNG  AS  LP +P    EG AWS+N
Sbjct  266   LITADKDPRDYYMVASTRFTKSVLTATGIIRYTNGNGAPASSILPKAP----EGWAWSLN  321

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLV+S S   GKLRY +NGVSH+N  T
Sbjct  322   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVSSASSAGGKLRYGINGVSHVNPPT  381

Query  719   PLKLAEYFGISEKVFKYDIMGDTPP-ENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             PLKLAEY+G+++KVFKYD + D P  E    VT APNV+N TFR FVEI+ ENHEK++Q+
Sbjct  382   PLKLAEYYGVADKVFKYDTIPDEPLLEKATPVTPAPNVMNITFRTFVEIILENHEKSVQS  441

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG+SFF VAIE GRW+PEKRK+YNL+DAVSRH+IQV+P SWAA+M T DNAGMWNLR
Sbjct  442   WHLDGYSFFGVAIEPGRWTPEKRKSYNLLDAVSRHTIQVFPKSWAAIMLTFDNAGMWNLR  501

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             S++ ER YLGQ+LY SVLSPERSLRDE+N+PD  +LCG V  +  P PYS
Sbjct  502   SELAERRYLGQELYISVLSPERSLRDEYNMPDDAELCGAVTSLPKPTPYS  551



>ref|XP_006303856.1| hypothetical protein CARUB_v10012595mg [Capsella rubella]
 gb|EOA36754.1| hypothetical protein CARUB_v10012595mg [Capsella rubella]
Length=549

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/408 (65%), Positives = 334/408 (82%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V + DWY  GH  LKK+LDSG T+  P+GV+INGK GKVG K +PL
Sbjct  147   LIPVPYADPEDDYTVLLGDWYTTGHTALKKLLDSGRTLGLPNGVLINGKSGKVGGKNEPL  206

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG ++++NFR + H M LVEMEGSH +QN YDSLD+HVGQC SVL
Sbjct  207   FTMKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVL  266

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+  KDYY+V S+RF K+E STV +I Y  G+ + AS ELP +P     G AWS+NQ
Sbjct  267   VTADQAAKDYYMVASTRFLKKELSTVGVIRY-EGSNVQASTELPKTP----VGWAWSLNQ  321

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITR+IKLVNSKS VDGK+R+  NGVSH++T+TP
Sbjct  322   FRSFRWNLTASAARPNPQGSYHYGKINITRSIKLVNSKSVVDGKVRFGFNGVSHVDTETP  381

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYF ++EKVFKY+++ D P      +T+ PNV+N TFR FVEI+FENHEK++Q++H
Sbjct  382   LKLAEYFQMAEKVFKYNVIKDEPEAKITALTVQPNVLNITFRTFVEIIFENHEKSMQSFH  441

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA EAG+W+PEKR NYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+R++
Sbjct  442   LDGYSFFAVASEAGKWTPEKRSNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRAE  501

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
              WER YLG+QLY SVLSPE+SLRDE+N+P    LCG+VKG+ +P  Y+
Sbjct  502   NWERRYLGEQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPAVYT  549



>emb|CDY10549.1| BnaC03g70650D [Brassica napus]
Length=549

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/408 (66%), Positives = 334/408 (82%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I+DWY  GH  LK  LDSG T+  P+GV+INGK GKVG K +PL
Sbjct  147   LIPVPYADPEDDYTVLINDWYTSGHTALKNFLDSGRTLGLPNGVLINGKSGKVGGKNEPL  206

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG ++++NFR + H M LVEMEGSH +QN YDSLD+HVGQC SVL
Sbjct  207   FTMKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVL  266

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++E KDYY+V S+RF K+E STV +I YA G+ + AS ELP +P     G AWS+NQ
Sbjct  267   VTANQEAKDYYMVASTRFLKKELSTVGVIRYA-GSNVQASTELPKTP----VGWAWSLNQ  321

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITR+IKLVN+K+ VDGK+RY  NGVSH++T+TP
Sbjct  322   FRSFRWNLTASAARPNPQGSYHYGKINITRSIKLVNTKNVVDGKVRYGFNGVSHVDTETP  381

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYF ++EKVFKYD++ D P      +T+ PNV+N TFR FVEI+FENHEK+++++H
Sbjct  382   LKLAEYFQMAEKVFKYDVIKDEPAAQITALTVQPNVLNITFRTFVEIIFENHEKSMESFH  441

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA E GRW+PEKRKNYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+
Sbjct  442   LDGYSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  501

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
               ER YLGQQLY SVLSPE+SLRDE+N+P    LCG+VKG+ +P  Y+
Sbjct  502   NLERRYLGQQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPASYT  549



>ref|XP_010487093.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=551

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/408 (65%), Positives = 334/408 (82%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D+  + I+DW+ K H  LK  LDSG T+  PDGV+INGK GKVG+K + L
Sbjct  148   LIPVPYADPEDDHTILINDWFTKSHTALKNFLDSGRTLGSPDGVLINGKSGKVGEKNEAL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY++R+CNVG ++++NFR +GH M LVEMEGSH +QN YDSLD+HVGQC +VL
Sbjct  208   FTMKPGKTYKFRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+  K+YY+V S+RF K+E STV ++SY  G+ + AS ELP +P     G AWS+NQ
Sbjct  268   VTADQVAKNYYMVASTRFLKKEVSTVGVLSY-EGSNVEASAELPKAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKL NSK+ V+GK+R+  NGVSH++T+TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANSKNVVNGKVRFGFNGVSHVDTETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYFG++EKVFKY+++ D P      +T+ PNV+N TFR FVEI+FENHEK++Q++H
Sbjct  383   LKLAEYFGMAEKVFKYNVIKDEPAAKITALTVEPNVLNITFRTFVEIIFENHEKSMQSFH  442

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDGHSFFAVA E GRW+PEKR NYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+
Sbjct  443   LDGHSFFAVASEPGRWTPEKRSNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  502

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
              WER YLG+QLY SVLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  503   NWERRYLGEQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPAPYT  550



>ref|XP_009106861.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=549

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/408 (65%), Positives = 335/408 (82%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I+DWY  GH  LK  LDSG T+  P+GV+INGK GKVG K +PL
Sbjct  147   LIPVPYADPEDDYTVLINDWYTSGHTALKNFLDSGRTLGLPNGVLINGKSGKVGGKNEPL  206

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG ++++NFR + H M LVEMEGSH +QN YDSLD+HVGQC SVL
Sbjct  207   FTMKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVL  266

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++E KDYY+V S+RF K+E STV +I YA G+ + AS ELP +P     G AWS+NQ
Sbjct  267   VTANQEAKDYYMVASTRFLKKELSTVGVIRYA-GSNVQASAELPKTP----VGWAWSLNQ  321

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLT++AARPNPQGSYHYG+INITR+IKLVN+KS+VDGK+RY  NGVSH++T+TP
Sbjct  322   FRSFRWNLTSNAARPNPQGSYHYGKINITRSIKLVNTKSFVDGKVRYGFNGVSHVDTETP  381

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYF ++EKVFKYD++ D P      +T+ PNV+N TFR FVEI+FENHEK+++++H
Sbjct  382   LKLAEYFQMAEKVFKYDVIKDEPAAQITALTVQPNVLNITFRTFVEIIFENHEKSMESFH  441

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA E GRW+PEKRKNYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+
Sbjct  442   LDGYSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  501

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
               ER YLGQQLY SVLSPE+SLRDE+N+P    LCG+VKG+ +P  Y+
Sbjct  502   NLERRYLGQQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPARYT  549



>ref|XP_002523382.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF38961.1| multicopper oxidase, putative [Ricinus communis]
Length=551

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/408 (66%), Positives = 324/408 (79%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V ++DWY K H +L+K LDSG +I RP+GV+INGK  K   K  PL
Sbjct  148   LIPVPYPDPEDDYTVIVNDWYTKSHTSLRKSLDSGVSIGRPEGVLINGKTAKGNGKDKPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CN G++TS+NFR +GHTM LVEMEGSH +QN+Y+SLD+HVGQC SVL
Sbjct  208   FTMKPGKTYKYRICNAGLKTSINFRIQGHTMKLVEMEGSHVVQNIYESLDVHVGQCFSVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++ PKDYY+V S+RF K       I+ Y NG G  ASP LP +P     G AWS+NQ
Sbjct  268   VTANQAPKDYYMVASTRFLKTVLVGKGIVRYTNGKG-QASPVLPKAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG INITRTIKLVNS S   GKLRYA+N VSH+  +TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASTTGGKLRYAINSVSHVEPETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYFG++ KVFKYD   D PP    K+   PNV+N TFRNFVEI+FEN EK+IQ++H
Sbjct  383   LKLAEYFGVANKVFKYDTFQDNPPAKIGKIVSQPNVLNMTFRNFVEIIFENPEKSIQSWH  442

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFF VA+E G W+PEKRKNYNL+DAVSR ++QV+P SWAA++ T DNAGMWN+RS+
Sbjct  443   LDGYSFFVVAVEPGTWTPEKRKNYNLLDAVSRTTVQVFPKSWAAILLTFDNAGMWNIRSE  502

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             MWER YLGQQLY SVLSP RSLRDE+N+PD   LCGLVKG+  PPPY+
Sbjct  503   MWERTYLGQQLYASVLSPARSLRDEYNIPDNALLCGLVKGLPKPPPYT  550



>ref|XP_002523381.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF38960.1| multicopper oxidase, putative [Ricinus communis]
Length=551

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/408 (67%), Positives = 329/408 (81%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V ++DWY K HK+L+  LDSG ++ RPDGV+INGK+ K   K +PL
Sbjct  148   LIPVPYPDPEDDYTVVLNDWYTKSHKSLRTFLDSGRSLGRPDGVLINGKNAKGDGKDEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+  KTY+YRVCN G++TS+NFR +GH M LVEMEGSH +QNVY+SLD+HVGQCLSVL
Sbjct  208   FTMKPDKTYKYRVCNAGIKTSLNFRIQGHEMKLVEMEGSHVVQNVYESLDVHVGQCLSVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             V A++ PKDYY+V S+RF K   +   II Y NG G  ASPELP +P     G AWS+NQ
Sbjct  268   VRANQAPKDYYMVASTRFMKTVQTAKGIIRYTNGKG-PASPELPEAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG INITRTIKLVNS S   GKLRYA+NGVSH +T+TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSPSRAGGKLRYAINGVSHTDTETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEY+GI++KVFKYD + D PP    +V   PNV+N TFRNFVEI+FEN EK+IQ++H
Sbjct  383   LKLAEYYGIADKVFKYDTIKDDPPPKITEVVTQPNVLNMTFRNFVEIIFENPEKSIQSWH  442

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA+E G W+PEKRKNYNL+DAVSR ++QV+P SWAA+  T DNAGMWN+RS+
Sbjct  443   LDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRTTVQVFPKSWAAIFLTFDNAGMWNIRSE  502

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             +WER YLGQQLY SV+SP RSLRDE+N+PD   LCGLVK +  PPPYS
Sbjct  503   VWERTYLGQQLYASVISPARSLRDEYNIPDNALLCGLVKDLPKPPPYS  550



>ref|XP_008374030.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=551

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/408 (66%), Positives = 332/408 (81%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+ +P D++ V I DWY K H  L+K LDSG ++ARPDGV+INGK  K   K +PL
Sbjct  148   LIPVPYAAPEDDYTVIIGDWYTKSHSQLRKFLDSGRSMARPDGVLINGKSAKGDGKDEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+AGKTY+YR+CNVG++ S+NFR +GH M LVEMEGSHT+QN YDSLD+H+GQC S+L
Sbjct  208   FTMKAGKTYKYRICNVGLKNSLNFRIQGHQMKLVEMEGSHTVQNTYDSLDVHIGQCFSML  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADKEPKDYY+V S+RF K   +   II Y NG G   SPE+P +P     G AWS+NQ
Sbjct  268   VTADKEPKDYYMVASTRFTKSVLTGKGIIRYENGXG-PVSPEVPKAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKL+NS S  DGKLRYA+NG+SH++ +TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLINSASKADGKLRYAINGISHVDPETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLA+Y+GI EKVFK+D M   P    EK+T+ PNV+N T ++FVEI+FEN EK++QT+H
Sbjct  383   LKLADYYGIREKVFKFDTMKVDPQSPAEKITMEPNVLNITIKDFVEIIFENPEKSLQTWH  442

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             L+G++FFAVA+E G+W+PEKRKNYNL+DA+SRH+IQV+P SWAA++ T DNAGMWNLRS+
Sbjct  443   LNGYAFFAVAVEPGKWTPEKRKNYNLLDAMSRHTIQVFPKSWAAILLTFDNAGMWNLRSE  502

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
               ER YLGQQLY  V + +RSLR+E+N+PD   +CGLVKGM MPPPYS
Sbjct  503   QPERRYLGQQLYVGVENIKRSLRNEYNMPDNALVCGLVKGMPMPPPYS  550



>emb|CDX75708.1| BnaC03g37910D [Brassica napus]
Length=551

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/408 (65%), Positives = 333/408 (82%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I+DWY K H  LK  LDSG T+  PDGV+INGK GKVG +  PL
Sbjct  148   LIPVPYADPEDDYTVLINDWYTKSHTALKNFLDSGRTLGSPDGVLINGKSGKVGGQDKPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG ++++NFR +GH M LVEMEGSH +QN YDSLD+HVGQC +VL
Sbjct  208   FTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+  K+YY+V S+RF K+E STV ++SY  G+ +  S ELP +P     G AWS+NQ
Sbjct  268   VTADQAAKNYYMVASTRFLKKEVSTVGVMSY-EGSNVQPSSELPKAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             +RSFRWNLTASAARPNPQGSYHYG+INITRTIKL N+KS V+GK+R+  NGVSH++T+TP
Sbjct  323   YRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKSVVNGKVRFGFNGVSHVDTETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYF +SEKVFKY+++ D P      +T+ PNV+N TFR FVEIVFENHEK++Q++H
Sbjct  383   LKLAEYFEMSEKVFKYNVIEDEPAAKVTTLTVEPNVLNITFRTFVEIVFENHEKSMQSFH  442

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA E G+W+PEKRKNYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+
Sbjct  443   LDGYSFFAVASEPGKWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  502

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
              WER YLGQQLY SVLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  503   NWERRYLGQQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPTPYT  550



>gb|KFK38673.1| hypothetical protein AALP_AA3G145200 [Arabis alpina]
Length=551

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/408 (64%), Positives = 334/408 (82%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P ++  + I+DWY K H  LK  LDSG T+  PDGV+INGK GKVG K +PL
Sbjct  148   LIPVPYADPEEDHTILINDWYTKSHTALKNFLDSGRTLGLPDGVLINGKSGKVGGKNEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FT++ GKTY++R+CNVG ++++NFR +GH M LVEMEGSH +QN YDSLD+HVGQC +VL
Sbjct  208   FTLKPGKTYKFRICNVGFKSTLNFRVQGHKMKLVEMEGSHVLQNDYDSLDIHVGQCFAVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+  K+YY+V S+RF K+E ST+ ++SYA G+ + AS  +P +P     G AWS+NQ
Sbjct  268   VTADQTAKNYYMVASTRFLKKEVSTIGVMSYA-GSKVEASAVIPKAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKL N+K+ VDGK+R+  NGVSH++T+TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNMVDGKIRFGFNGVSHVDTETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYFG++EK+FKY+++ D P      +T+ PNV+N TFR FVEI+FENHEK++ ++H
Sbjct  383   LKLAEYFGMAEKIFKYNVIKDEPAAKITTLTVEPNVLNVTFRTFVEIIFENHEKSMASFH  442

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDGHSFFAVA E GRW+PEKRKNYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+
Sbjct  443   LDGHSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  502

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
              WER YLGQQLY SVLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  503   NWERRYLGQQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPTPYT  550



>gb|KHG27164.1| L-ascorbate oxidase [Gossypium arboreum]
Length=475

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/408 (66%), Positives = 330/408 (81%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  PAD++ + + D++NKGH +LKKILDSG  + R DGV +NGK  K   K +PL
Sbjct  72    LIPVPYADPADDYTLLVGDFFNKGHTSLKKILDSGRNLGRCDGVHLNGKVAKGDGKDEPL  131

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTMEAGKTY+YR+CN G +TS+N RF+GHTM LVEMEGSHT+QN YDSLD+HVGQC SVL
Sbjct  132   FTMEAGKTYKYRICNTGTKTSLNVRFQGHTMKLVEMEGSHTMQNDYDSLDVHVGQCFSVL  191

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++EP+DYY+V S+RF K+E +   II Y NG G  AS ELPP P     G AWS+NQ
Sbjct  192   VTANQEPRDYYVVASTRFTKREVTATGIIRYKNGKG-AASSELPPPP----VGWAWSLNQ  246

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FR+FRWNLT++AARPNPQGSY YG INITRTIKL N+   VDGKLRYALNGVS++   TP
Sbjct  247   FRTFRWNLTSNAARPNPQGSYKYGSINITRTIKLANTAQIVDGKLRYALNGVSYVEPTTP  306

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEY+G+++KVFKYD + D PP +  KVTLAP V+N T RNFVEI+FENHE  IQ+YH
Sbjct  307   LKLAEYYGVADKVFKYDTIPDEPPSDNTKVTLAPIVLNMTHRNFVEIIFENHETAIQSYH  366

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             L G+SFFAV ++ G+WSPEKR NYNL+DAVSRH+IQV+PNSW+A++ T DN GMWNLRS+
Sbjct  367   LSGYSFFAVGMDIGKWSPEKRMNYNLLDAVSRHTIQVFPNSWSAILLTFDNCGMWNLRSE  426

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             +W+R YLGQQLY SV+SP RSL+DE+NLP+    CG+V+GM  PPP+S
Sbjct  427   IWDRHYLGQQLYASVISPNRSLKDEYNLPEGVLTCGIVQGMPRPPPFS  474



>ref|XP_002882820.1| hypothetical protein ARALYDRAFT_478721 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59079.1| hypothetical protein ARALYDRAFT_478721 [Arabidopsis lyrata subsp. 
lyrata]
Length=551

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/408 (65%), Positives = 333/408 (82%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D+  + I+DWY K H  LK  LDSG T+  PDGV+INGK GK+G    PL
Sbjct  148   LIPVPYADPEDDRTILINDWYTKSHTALKNFLDSGRTLGSPDGVLINGKSGKIGGNNAPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG ++++NFR +GH M LVEMEGSH +QN YDSLD+HVGQC +VL
Sbjct  208   FTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+  K+YY+V S+RF K+E STV ++SY  G+ + AS E+P +P     G AWS+NQ
Sbjct  268   VTADQVAKNYYMVASTRFLKKEVSTVGVMSY-EGSNVQASNEIPKAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKL N+K+ V+GK+R+  NGVSH++T+TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVNGKVRFGFNGVSHVDTETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYFG+SEKVFKY+++ D P      +T+ PNV+N TFR FVE++FENHEK++Q++H
Sbjct  383   LKLAEYFGMSEKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVEVIFENHEKSMQSFH  442

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA E GRW+PEKRKNYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+
Sbjct  443   LDGYSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  502

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
              WER YLGQQLY SVLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  503   NWERRYLGQQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPTPYT  550



>emb|CDY56013.1| BnaA08g29220D [Brassica napus]
Length=549

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/408 (65%), Positives = 334/408 (82%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I+DWY  GH  LK  LDSG T+  P+GV+INGK GKVG K +PL
Sbjct  147   LIPVPYADPEDDYTVLINDWYTSGHTALKNFLDSGRTLGLPNGVLINGKSGKVGGKNEPL  206

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG ++++NFR + H M LVEMEGSH +QN YDSLD+HVGQC SVL
Sbjct  207   FTMKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVL  266

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++E KDYY+V S+RF K+E STV +I YA G+ + AS ELP +P     G AWS+NQ
Sbjct  267   VTANQEAKDYYMVASTRFLKKELSTVGVIRYA-GSNVQASAELPKTP----VGWAWSLNQ  321

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLT++AARPNPQGSYHYG+INITR+IKLVN+K+ VDGK+RY  NGVSH++T+TP
Sbjct  322   FRSFRWNLTSNAARPNPQGSYHYGKINITRSIKLVNTKNVVDGKVRYGFNGVSHVDTETP  381

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYF ++EKVFKYD++ D P      +T+ PNV+N TFR FVEI+FENHEK+++++H
Sbjct  382   LKLAEYFQMAEKVFKYDVIKDEPAAQITALTVQPNVLNITFRTFVEIIFENHEKSMESFH  441

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA E GRW+PEKRKNYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+
Sbjct  442   LDGYSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  501

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
               ER YLGQQLY SVLSPE+SLRDE+N+P    LCG+VKG+ +P  Y+
Sbjct  502   NLERRYLGQQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPASYT  549



>ref|XP_010673839.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=558

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/412 (66%), Positives = 330/412 (80%), Gaps = 9/412 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGD-KIDP  178
             LIPVPF  P D++ + + DWY + H  L+K L++G ++ARPD V++NGK GKVGD K +P
Sbjct  151   LIPVPFADPEDDYTIMVGDWYKESHAVLRKHLENGKSLARPDAVLMNGKQGKVGDPKEEP  210

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFTM+ GKTYRYR+CNVGM+ S+NFR +GHTM LVE+EGSHT+QN+YDSLD+H+GQC SV
Sbjct  211   LFTMKPGKTYRYRICNVGMKNSINFRMQGHTMKLVEVEGSHTVQNMYDSLDIHLGQCYSV  270

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             LVTADKEPKDYY+V S+RF K       I+ Y  G G   S  LP +P     G AWS+N
Sbjct  271   LVTADKEPKDYYMVASTRFTKYHLQATGIVRYEGGKG-APSTVLPEAP----VGWAWSLN  325

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRS RWNLTASAARPNPQGSYHYGQINITRTIKL N+   VDGKLRYA+NG SH + DT
Sbjct  326   QFRSLRWNLTASAARPNPQGSYHYGQINITRTIKLANTAGTVDGKLRYAINGHSHTDVDT  385

Query  719   PLKLAEYFGISEKVFKYDIMGDTPPENGE---KVTLAPNVVNATFRNFVEIVFENHEKTI  889
             PLKL EY+ +++K FKYD++ D PP N E   K T  PNV+N TFRNF+EI+FENHEK+I
Sbjct  386   PLKLLEYYQVAQKAFKYDVIKDEPPANVETLDKFTTGPNVLNGTFRNFIEIIFENHEKSI  445

Query  890   QTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWN  1069
             Q++HLDG+SFF VAIE G+W+PEKRKNYNL+DAVSR++IQVYP SWAA+M T DNAGMW+
Sbjct  446   QSWHLDGYSFFPVAIEVGQWTPEKRKNYNLLDAVSRYTIQVYPKSWAAIMLTTDNAGMWH  505

Query  1070  LRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             LR++  ER++LGQQ+Y SVLSPERSLRDE+NLPD   +CGLVK M  PPPYS
Sbjct  506   LRNEAPERSFLGQQMYISVLSPERSLRDEYNLPDNSLICGLVKDMPKPPPYS  557



>ref|XP_011048127.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Populus euphratica]
Length=537

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/410 (66%), Positives = 333/410 (81%), Gaps = 7/410 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V ++DWY K H  L+K+LDSG ++ARPDGV+INGK+     K +PL
Sbjct  132   LIPVPYADPEDDYTVVLNDWYTKSHTALQKLLDSGRSLARPDGVLINGKNAMGDGKDEPL  191

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+  KTY+YR+CN G++ ++NFR +GHTM LVEMEGSH +QNVY+SLD+HVGQC SVL
Sbjct  192   FTMKPEKTYKYRICNAGLKNTLNFRIQGHTMKLVEMEGSHVVQNVYESLDVHVGQCFSVL  251

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++ PKDYY++ S+RF KQ  + + II Y NG G  ASPE P +P     G AWS+NQ
Sbjct  252   VTANQAPKDYYMMASTRFNKQVLTYMGIIRYTNGKG-PASPEFPEAP----VGWAWSLNQ  306

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG INITRTIKLVNS S   GKLRYALNGVSH++ +TP
Sbjct  307   FRSFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASREGGKLRYALNGVSHVDPETP  366

Query  722   LKLAEYFGISEKVFKYDIMGDTPPEN--GEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             LK+AEY+G+++K+FKYD M D+P  N    K+   PNV+N TFRNFVEI+FENHEK++Q+
Sbjct  367   LKIAEYYGVADKLFKYDTMQDSPQANIAHAKIVSQPNVLNLTFRNFVEIIFENHEKSMQS  426

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             YHLDG+SFFAVA+E G W+PEKRK+YNL+DAVSR ++QV+P SWAA++ T DNAGMWN+R
Sbjct  427   YHLDGYSFFAVAVEPGTWTPEKRKHYNLLDAVSRTTVQVFPKSWAAILLTFDNAGMWNIR  486

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             S+MWERAYLGQQLY SVLSP RSLRDE+N+PD   LCGLVK +  P PYS
Sbjct  487   SEMWERAYLGQQLYASVLSPARSLRDEYNIPDNTLLCGLVKDLPKPEPYS  536



>ref|XP_011048126.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Populus euphratica]
Length=553

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/410 (66%), Positives = 332/410 (81%), Gaps = 7/410 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V ++DWY K H  L+K+LDSG ++ARPDGV+INGK+     K +PL
Sbjct  148   LIPVPYADPEDDYTVVLNDWYTKSHTALQKLLDSGRSLARPDGVLINGKNAMGDGKDEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+  KTY+YR+CN G++ ++NFR +GHTM LVEMEGSH +QNVY+SLD+HVGQC SVL
Sbjct  208   FTMKPEKTYKYRICNAGLKNTLNFRIQGHTMKLVEMEGSHVVQNVYESLDVHVGQCFSVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++ PKDYY++ S+RF KQ  +   II Y NG G  ASPE P +P     G AWS+NQ
Sbjct  268   VTANQAPKDYYMMASTRFNKQVLTAKGIIRYTNGKG-PASPEFPEAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG INITRTIKLVNS S   GKLRYALNGVSH++ +TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASREGGKLRYALNGVSHVDPETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPEN--GEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             LK+AEY+G+++K+FKYD M D+P  N    K+   PNV+N TFRNFVEI+FENHEK++Q+
Sbjct  383   LKIAEYYGVADKLFKYDTMQDSPQANIAHAKIVSQPNVLNLTFRNFVEIIFENHEKSMQS  442

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             YHLDG+SFFAVA+E G W+PEKRK+YNL+DAVSR ++QV+P SWAA++ T DNAGMWN+R
Sbjct  443   YHLDGYSFFAVAVEPGTWTPEKRKHYNLLDAVSRTTVQVFPKSWAAILLTFDNAGMWNIR  502

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             S+MWERAYLGQQLY SVLSP RSLRDE+N+PD   LCGLVK +  P PYS
Sbjct  503   SEMWERAYLGQQLYASVLSPARSLRDEYNIPDNTLLCGLVKDLPKPEPYS  552



>ref|XP_010500435.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=551

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/408 (64%), Positives = 334/408 (82%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D+  + I+DW+ K H  LK  LDSG T+  PDGV+INGK GKVG+K + L
Sbjct  148   LIPVPYADPEDDRTILINDWFTKSHTALKNFLDSGRTLGSPDGVLINGKSGKVGEKNEAL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY++R+CNVG ++++NFR +GH M LVEMEGSH +QN YDSLD+HVGQC +VL
Sbjct  208   FTMKPGKTYKFRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+  K+YY+V S+RF K+E STV ++SY  G+ + AS ELP +P     G AWS+NQ
Sbjct  268   VTADQVAKNYYMVASTRFLKKEVSTVGVLSY-EGSNVEASAELPKAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKL NSK+ V+GK+R+  NGVSH++T+TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANSKNVVNGKVRFGFNGVSHVDTETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYFG++EKVFKY+++ D P      +T+ PNV+N TFR FVEI+FENHEK++Q++H
Sbjct  383   LKLAEYFGMAEKVFKYNVIKDEPAAKITALTVEPNVLNITFRTFVEIIFENHEKSMQSFH  442

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA E GRW+PEKR NYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+
Sbjct  443   LDGYSFFAVASEPGRWTPEKRSNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  502

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
              WER YLG+QLY SVLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  503   NWERRYLGEQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPAPYT  550



>ref|XP_002894511.1| hypothetical protein ARALYDRAFT_474617 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70770.1| hypothetical protein ARALYDRAFT_474617 [Arabidopsis lyrata subsp. 
lyrata]
Length=549

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/408 (66%), Positives = 331/408 (81%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V + DWY  GH  LK  LDSG T+  P+GV+INGK GKVG K +PL
Sbjct  147   LIPVPYADPEDDYTVLLGDWYTAGHTALKNFLDSGRTLGLPNGVLINGKSGKVGGKNEPL  206

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG ++++NFR + H M LVEMEGSH +QN YDSLD+HVGQC SVL
Sbjct  207   FTMKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVL  266

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+  KDYY+V S+RF K+E STV +I Y  G+ + AS ELP +P     G AWS+NQ
Sbjct  267   VTADQAAKDYYMVASTRFLKKELSTVGVIRY-EGSNVQASAELPKAPI----GWAWSLNQ  321

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITR+IKLVNSKS VDGK+R+  NGVSH++T+TP
Sbjct  322   FRSFRWNLTASAARPNPQGSYHYGKINITRSIKLVNSKSVVDGKVRFGFNGVSHVDTETP  381

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYF +SEKVFKY+++ D P      +T+ PNV+N TFR FVEI+FENHEK++Q++H
Sbjct  382   LKLAEYFQMSEKVFKYNVIKDEPAAKITALTVQPNVLNITFRTFVEIIFENHEKSMQSFH  441

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA E GRW+PEKRKNYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+
Sbjct  442   LDGYSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  501

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
               ER YLG+QLY SVLSPE+SLRDE+N+P    LCG+VKG+ +P  YS
Sbjct  502   NLERRYLGEQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPAHYS  549



>ref|XP_002299087.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE83892.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=551

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/408 (66%), Positives = 328/408 (80%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V ++DWY   H TL+K LD G ++ARP GV+INGK+ K   K +PL
Sbjct  148   LIPVPYADPEDDYTVILNDWYTSSHATLRKYLDDGRSLARPTGVLINGKNAKGDGKDEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CN G++ ++NFR +GHTM LVEMEGSH +QNVY++LD+HVGQC SVL
Sbjct  208   FTMKPGKTYKYRICNAGIKNTLNFRIQGHTMKLVEMEGSHVVQNVYEALDVHVGQCFSVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++ PKDYY+V ++RF KQ  +   II Y NG G  ASPELP +P     G AWS+NQ
Sbjct  268   VTANQAPKDYYMVTTTRFNKQILTAKGIIRYTNGKG-PASPELPEAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG INITRTIKLVNS S   GKLRYALNGVSH++ +TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASREGGKLRYALNGVSHVDPETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LK+AEY+GI++KVFKY+ + D P     KV   PNV+N TFRNFVEI+FENHEK++Q+YH
Sbjct  383   LKIAEYYGIADKVFKYNTIKDMPSAKIGKVVTQPNVLNQTFRNFVEIIFENHEKSMQSYH  442

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVAIE G W+PEKRKNYNL+DAVSR +IQV+P SWAA+  T DNAGMWN+RS+
Sbjct  443   LDGYSFFAVAIEPGTWTPEKRKNYNLLDAVSRTTIQVFPKSWAAIFLTFDNAGMWNIRSE  502

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             MWE+ YLGQQLY SVLSPE SLRDE+N+PD   LCG VKG+  P PY+
Sbjct  503   MWEKTYLGQQLYVSVLSPELSLRDEYNIPDNALLCGKVKGLPKPKPYT  550



>ref|XP_004502172.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=545

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/406 (67%), Positives = 331/406 (82%), Gaps = 9/406 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P DE+ V I DWYNKGHKTLK +LDSG +I RPDGV++NGK        +PL
Sbjct  146   LIPVPYPDPEDEYWVIIGDWYNKGHKTLKMMLDSGRSIGRPDGVIMNGK----ATNEEPL  201

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             +TM+ GKTY+YR+CNVG++ ++NFRF+GH M LVE EGSH +Q+ YDSLD+HVGQC +VL
Sbjct  202   YTMKPGKTYKYRICNVGLKDALNFRFQGHAMKLVETEGSHVVQSFYDSLDVHVGQCYTVL  261

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADK+PKDYY+V S+RF K   +   II Y NG G  AS  LPP+P     G AWS+NQ
Sbjct  262   VTADKDPKDYYMVASTRFTKYTHTATGIIRYTNGAG-PASNVLPPAP----VGWAWSLNQ  316

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNS + VDGKLRYA+NGVSH++ +TP
Sbjct  317   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSVAKVDGKLRYAINGVSHVDGETP  376

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEY+G+++KVFKY+I+GD PP +   +T+APNV+NATFR F+E++ EN  K+IQ+Y+
Sbjct  377   LKLAEYYGVADKVFKYNIIGDEPPADLTAITIAPNVINATFRTFIEVILENSGKSIQSYN  436

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA E G+WSPEKRKNYNL+DA+SRH+IQV+P SWAA+M T DNAGMWNLRS+
Sbjct  437   LDGYSFFAVACEPGKWSPEKRKNYNLLDAISRHTIQVFPKSWAAIMLTFDNAGMWNLRSE  496

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPP  1219
               E  YLGQQLY SVLSPE SLRDE+NLP+ Q +CG+VK +  P P
Sbjct  497   QAENRYLGQQLYISVLSPELSLRDEYNLPETQIVCGIVKSLPKPAP  542



>gb|EPS68478.1| hypothetical protein M569_06286, partial [Genlisea aurea]
Length=533

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/409 (67%), Positives = 333/409 (81%), Gaps = 10/409 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPF  P  E+NV + DWY KG  +LKK+LD+G T+ RPDGV+INGKH    D  +P+
Sbjct  133   LIPVPFPWPHAEYNVLVGDWYKKGQGSLKKLLDTGRTLGRPDGVIINGKH----DSNEPM  188

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             F+ EAGKT+R+RVCNVG++ S+NFR + HT+TLVE+EGSHT+QNVYDSLDLH+GQC SVL
Sbjct  189   FSFEAGKTHRFRVCNVGLKNSINFRIQAHTLTLVEIEGSHTVQNVYDSLDLHLGQCASVL  248

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+ PKDYY V S+RF K   +T AII Y NG+   ASPELP +P     G AWS+NQ
Sbjct  249   VTADQTPKDYYFVASTRFTKTVLTTKAIIRY-NGSSTPASPELPEAP----VGWAWSVNQ  303

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIK VN+   VDGKLRY++NGVSH +  TP
Sbjct  304   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKFVNAPGTVDGKLRYSVNGVSHTDPATP  363

Query  722   LKLAEYFGISEKVFKYDIMGDTPP-ENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEYFG+ +K+FKYDI+ D P  +   K+T+AP V+NATFRNFVEI+FEN EK++Q++
Sbjct  364   LKLAEYFGVGDKLFKYDIIKDDPSVDANSKITIAPIVLNATFRNFVEIIFENQEKSVQSW  423

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HL G+SFFAVAI+ G+W+P +R  YNLVDAVSRH+I VYP SWAA+MTTLDNAGMWNLRS
Sbjct  424   HLSGYSFFAVAIQPGKWTPARRAVYNLVDAVSRHTIHVYPKSWAAIMTTLDNAGMWNLRS  483

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
              M ER YLGQQLYFSVLSP +SLRDE+N+P+ Q  CG+V+G+  P PY+
Sbjct  484   MMLERQYLGQQLYFSVLSPAKSLRDEYNIPETQLQCGIVEGLPKPMPYT  532



>ref|XP_002297609.2| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE82414.2| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=553

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/410 (66%), Positives = 332/410 (81%), Gaps = 7/410 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V ++DWY K H  L+K+LDSG ++ARPDGV+INGK+     K +PL
Sbjct  148   LIPVPYADPEDDYTVVLNDWYTKSHTALQKLLDSGRSLARPDGVLINGKNAMGDGKDEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+  KTY+YR+CN G++ ++NFR + HTM LVEMEGSH +QNVY+SLD+HVGQC SVL
Sbjct  208   FTMKPEKTYKYRICNAGLKNTLNFRIQDHTMKLVEMEGSHVVQNVYESLDVHVGQCFSVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++ PKDYY+V S+RF KQ  +   II Y NG G  ASPELP +P     G AWS+NQ
Sbjct  268   VTANQAPKDYYMVASTRFNKQVLTAKGIIRYTNGKG-PASPELPEAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG INITRTIKLVNS S   GKLRYALNGVSH++ +TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASREGGKLRYALNGVSHVDPETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPEN--GEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             LK+AEY+G+++K+FKYD M D+P  +    K+   PNV+N TFRNFVEI+FENHEK++Q+
Sbjct  383   LKIAEYYGVADKLFKYDTMQDSPQADIAHAKIVSQPNVLNLTFRNFVEIIFENHEKSMQS  442

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             YHLDG+SFFAVA+E G W+PEKRK+YNL+DAVSR ++QV+P SWAA++ T DNAGMWN+R
Sbjct  443   YHLDGYSFFAVAVEPGTWTPEKRKHYNLLDAVSRTTVQVFPKSWAAILLTFDNAGMWNIR  502

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             S+MWERAYLGQQLY SVLSP RSLRDE+N+PD   LCGLVK +  P PYS
Sbjct  503   SEMWERAYLGQQLYASVLSPARSLRDEYNIPDNTLLCGLVKDLPKPEPYS  552



>ref|XP_004305574.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=553

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/409 (67%), Positives = 331/409 (81%), Gaps = 6/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I DWY K H +L+K LD G ++ RP+GV+INGK+ +     +PL
Sbjct  149   LIPVPYADPEDDYTVLIGDWYTKSHNSLRKQLDMGRSLGRPEGVLINGKNARGDGTDEPL  208

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY++RVCNVG++ S+NFR +GHTM LVEMEGSH +QN Y+SLD+H+GQC S L
Sbjct  209   FTMKPGKTYKFRVCNVGLKNSLNFRIQGHTMKLVEMEGSHVVQNTYESLDVHLGQCFSAL  268

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADKEPKDY++V  +RF K   + + +I Y NGNG  A+PELP  P    EG+AWS+NQ
Sbjct  269   VTADKEPKDYWMVADTRFTKTMLTGLGLIRYTNGNG-PANPELPLPP----EGLAWSLNQ  323

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
              RSFRWNLTASAARPNPQGSYHYG INITRTIKLVNS S VDGKLRYA+NGVSHI+T+TP
Sbjct  324   ARSFRWNLTASAARPNPQGSYHYGAINITRTIKLVNSASKVDGKLRYAVNGVSHIDTETP  383

Query  722   LKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LK AEYFG+++KVFKYDI+ D P PE   K+TLAPNVVN T+R+FVEI+FENH K+IQ++
Sbjct  384   LKYAEYFGVADKVFKYDIIKDDPSPEAEAKITLAPNVVNQTYRDFVEIIFENHGKSIQSW  443

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG++FF VAIE GRW+PEKR+NYNL+DA+SRH++QVYP SWAA+M T DNAGMWNLRS
Sbjct  444   HLDGYAFFPVAIEFGRWAPEKRRNYNLLDAISRHTVQVYPGSWAAIMLTFDNAGMWNLRS  503

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
                ERAYLGQQLY SV +  RSLRDE+ L D   LCG+VKG+  PPPY 
Sbjct  504   AQAERAYLGQQLYLSVENVARSLRDEYMLLDTTPLCGVVKGLPKPPPYG  552



>ref|XP_004234818.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=556

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/413 (67%), Positives = 336/413 (81%), Gaps = 10/413 (2%)
 Frame = +2

Query  2     LIPVPFD-SPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDP  178
             LIP+PFD +PADEF V +SDWY K H  L+K LDSG ++ RPDGV+INGK G    K +P
Sbjct  148   LIPIPFDINPADEFFVLVSDWYTKSHTQLRKFLDSGRSMGRPDGVIINGKGGNGDGKDEP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             +F+M  GKTYRYR CN G + S+N R +GHTM LVE+EGSH +QN+YDSLD+H+GQC+SV
Sbjct  208   MFSMTPGKTYRYRFCNAGNKDSINVRIQGHTMKLVEIEGSHVVQNMYDSLDIHLGQCVSV  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             LVTADK+PKDY LV S+RF K+  +  +II Y NG G  ASPELP +P     G AWS+N
Sbjct  268   LVTADKDPKDYLLVASTRFTKEPHTATSIIRYTNGKG-PASPELPKAP----IGWAWSLN  322

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVN+   VDGKLRYA NG+SH+N  T
Sbjct  323   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNTAGTVDGKLRYAFNGISHVNPTT  382

Query  719   PLKLAEYFGISEKVFKYDIMGDT--PPENG--EKVTLAPNVVNATFRNFVEIVFENHEKT  886
             P+KLAEY+G+ +KVFKYD+M D   PP     EK+TLAPNVV   +RN+VEI+FENHEK+
Sbjct  383   PIKLAEYYGVEDKVFKYDLMKDEYEPPAGKAEEKITLAPNVVKVIYRNYVEIIFENHEKS  442

Query  887   IQTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMW  1066
             +Q++HL G+SFFAVAIE G+W+PEKRKNYNL+DAVSR++IQVYPNSWAA+MTTLDNAG+W
Sbjct  443   VQSFHLAGYSFFAVAIEPGKWTPEKRKNYNLLDAVSRNTIQVYPNSWAAIMTTLDNAGLW  502

Query  1067  NLRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             NLRS+  ER YLGQQLYFS LSP+R L+DE+N+PD   LCG++K M +P PYS
Sbjct  503   NLRSNSLERQYLGQQLYFSALSPKRDLKDEYNMPDNDVLCGIIKDMPLPKPYS  555



>ref|NP_187948.1| protein SKU5-like 13 [Arabidopsis thaliana]
 dbj|BAB01745.1| BNH protein; pectinesterase-like protein; pollen-secific protein-like 
[Arabidopsis thaliana]
 gb|AAL08265.1| AT3g13400/MRP15_3 [Arabidopsis thaliana]
 gb|AAL60046.1| putative pollen specific protein [Arabidopsis thaliana]
 gb|AAM20113.1| putative pollen-specific protein [Arabidopsis thaliana]
 gb|AEE75342.1| protein SKU5-like 13 [Arabidopsis thaliana]
Length=551

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/408 (64%), Positives = 332/408 (81%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D+  + I+DWY K H  LK  LDSG T+  PDGV+INGK GK+G    PL
Sbjct  148   LIPVPYADPEDDRTILINDWYAKSHTALKNFLDSGRTLGSPDGVLINGKSGKLGGNNAPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG ++++NFR +GH M LVEMEGSH +QN YDSLD+HVGQC +VL
Sbjct  208   FTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+  K+YY+V S+RF K+E STV ++SY  G+ + AS ++P +P     G AWS+NQ
Sbjct  268   VTADQVAKNYYMVASTRFLKKEVSTVGVMSY-EGSNVQASSDIPKAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKL N+K+ V+GK+R+  NGVSH++T+TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVNGKVRFGFNGVSHVDTETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYFG+SEKVFKY+++ D P      +T+ PNV+N TFR FVE+VFENHEK++Q++H
Sbjct  383   LKLAEYFGMSEKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVEVVFENHEKSMQSFH  442

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA E GRW+PEKR NYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+
Sbjct  443   LDGYSFFAVASEPGRWTPEKRNNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  502

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
              WER YLGQQLY SVLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  503   NWERRYLGQQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPTPYT  550



>ref|XP_006392622.1| hypothetical protein EUTSA_v10011369mg [Eutrema salsugineum]
 gb|ESQ29908.1| hypothetical protein EUTSA_v10011369mg [Eutrema salsugineum]
Length=549

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/408 (65%), Positives = 331/408 (81%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V + DWY  GH  LK  LDSG T+  P+GV+INGK GKVG   +PL
Sbjct  147   LIPVPYADPEDDYTVLLGDWYTSGHTALKNFLDSGRTLGLPNGVLINGKSGKVGGNNEPL  206

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG ++++NFR + H M LVEMEGSH +QN YDSLD+HVGQC SVL
Sbjct  207   FTMKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVL  266

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+  KDYY+V S+RF K+E STV +I YA G+ + AS ELP +P     G AWS+NQ
Sbjct  267   VTADQAAKDYYMVASTRFLKKELSTVGVIRYA-GSNVQASAELPKAP----VGWAWSLNQ  321

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITR+IKLV+SK+ V+GK+R+  N VSH++T+TP
Sbjct  322   FRSFRWNLTASAARPNPQGSYHYGKINITRSIKLVSSKNMVNGKVRFGFNSVSHVDTETP  381

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYF ++EKVFKY+++ D P      +T+ PNV+N TFR FVEI+FENHEK++Q++H
Sbjct  382   LKLAEYFQMAEKVFKYNVIKDEPAAKITALTVEPNVLNITFRTFVEIIFENHEKSMQSFH  441

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA E GRW+PEKRKNYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+
Sbjct  442   LDGYSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  501

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
              WER YLGQQLY SVLSPE+SLRDE+N+P    LCG+VKG+ MP  Y+
Sbjct  502   NWERRYLGQQLYASVLSPEKSLRDEYNIPLNTNLCGIVKGLPMPAIYT  549



>gb|AAD10639.1| putative pollen specific protein [Arabidopsis thaliana]
Length=558

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/408 (65%), Positives = 331/408 (81%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V + DWY  GH  LK  LDSG T+  P+GV+INGK GKVG K +PL
Sbjct  156   LIPVPYADPEDDYTVLLGDWYTAGHTALKNFLDSGRTLGLPNGVLINGKSGKVGGKNEPL  215

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG ++++NFR + H M LVEMEGSH IQN YDSLD+HVGQC SVL
Sbjct  216   FTMKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVIQNDYDSLDVHVGQCFSVL  275

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++  KDYY+V S+RF K+E STV +I Y  G+ + AS ELP +P     G AWS+NQ
Sbjct  276   VTANQAAKDYYMVASTRFLKKELSTVGVIRY-EGSNVQASTELPKAP----VGWAWSLNQ  330

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLT++AARPNPQGSYHYG+INITR+IKLVNSKS VDGK+R+  NGVSH++T+TP
Sbjct  331   FRSFRWNLTSNAARPNPQGSYHYGKINITRSIKLVNSKSVVDGKVRFGFNGVSHVDTETP  390

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYF +SEKVFKY+++ D P      +T+ PNV+N TFR FVEI+FENHEKT+Q++H
Sbjct  391   LKLAEYFQMSEKVFKYNVIKDEPAAKITALTVQPNVLNITFRTFVEIIFENHEKTMQSFH  450

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA E GRW+PEKR+NYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+
Sbjct  451   LDGYSFFAVASEPGRWTPEKRENYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  510

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
               ER YLG+QLY SVLSPE+SLRDE+N+P    LCG+VKG+ +P  YS
Sbjct  511   NLERKYLGEQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPAHYS  558



>ref|XP_006407227.1| hypothetical protein EUTSA_v10020444mg [Eutrema salsugineum]
 gb|ESQ48680.1| hypothetical protein EUTSA_v10020444mg [Eutrema salsugineum]
Length=551

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/408 (65%), Positives = 333/408 (82%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I+DWY K H  LK  LDSG T+  PDGV+INGK GKVG   +PL
Sbjct  148   LIPVPYADPEDDYTVLINDWYTKSHTALKNFLDSGRTLGSPDGVLINGKSGKVGGNNEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG ++++NFR +GH M LVEMEGSH IQN YDSLD+HVGQC +VL
Sbjct  208   FTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVIQNDYDSLDVHVGQCFAVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+  K+YY+V S+RF K+E STV ++SY  G+ + AS ELP +P     G AWS+NQ
Sbjct  268   VTADQVAKNYYMVASTRFLKKEVSTVGVMSY-EGSNVQASNELPKAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKL N+K+ V+GK+R+ LNGVSH++ +TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVNGKVRFGLNGVSHVDPETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYFG++EKVFKY+++ D P      + + PNV+N TFR FVEIVFENHEK++Q+++
Sbjct  383   LKLAEYFGLAEKVFKYNVIKDEPAAKITTLVVEPNVLNITFRTFVEIVFENHEKSMQSFN  442

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFF VA E GRW+PEKRKNYNL+DAVSRH++QV+P SW+A++ T DNAGMWN+RS+
Sbjct  443   LDGYSFFNVASEPGRWTPEKRKNYNLLDAVSRHTVQVFPKSWSAILLTFDNAGMWNIRSE  502

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
              WER YLGQQ+Y SVLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  503   NWERRYLGQQMYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPTPYT  550



>ref|XP_009339221.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=552

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/409 (66%), Positives = 331/409 (81%), Gaps = 6/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+ +P D++ V I DWY+K H  LKK LDSG  +ARPDGV+INGK  K   K +PL
Sbjct  148   LIPVPYAAPEDDYTVMIGDWYSKSHSQLKKFLDSGRAMARPDGVLINGKSAKGDGKDEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+AGKTY+YR+CNVG++ S+NFR +GH M LVE EGSHT+QN YDSLD+H+GQC +VL
Sbjct  208   FTMKAGKTYKYRICNVGLKNSLNFRIQGHQMKLVETEGSHTVQNTYDSLDVHIGQCFAVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADKEPKDYY+V S+RF K   +   II Y NG G  ASPE+P +P     G AWS+NQ
Sbjct  268   VTADKEPKDYYMVASTRFSKSVLTGKGIIRYENGKG-PASPEVPKAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKL+NS S  DGKLRYA+NG+SH++ +TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLINSASKADGKLRYAINGISHVDPETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPEN-GEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLA+Y+GI EKVFK+D M   P     EK+T+ PNV+N T ++FVEI+FEN EK++QT+
Sbjct  383   LKLADYYGIREKVFKFDTMKVDPQSTPAEKITMEPNVLNITIKDFVEIIFENPEKSLQTW  442

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HL+G++FFAVA+E G+W+PEKRKNYNL+DAVSRH+IQV+P SWAA++ T DNAGMWNLRS
Sbjct  443   HLNGYAFFAVAVEPGKWTPEKRKNYNLLDAVSRHTIQVFPKSWAAILLTFDNAGMWNLRS  502

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             +  ER YLGQQLY  V + +RSLR+E+N+PD   +CGLVKGM  PPPYS
Sbjct  503   EQPERRYLGQQLYVGVENIKRSLRNEYNMPDNALVCGLVKGMPKPPPYS  551



>emb|CDY23597.1| BnaC05g39970D [Brassica napus]
Length=552

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/408 (65%), Positives = 332/408 (81%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I+DWY K H  LK  LDSG T+  PDGV+INGK GKVG    PL
Sbjct  149   LIPVPYADPEDDYTVLINDWYTKSHTALKTFLDSGRTLGSPDGVLINGKSGKVGGPNVPL  208

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG ++++NFR +GH M LVEMEGSH +QN YDSLD+HVGQC +VL
Sbjct  209   FTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVL  268

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+  K+YY+V S+RF K+E STV ++SY  G+ + AS ELP +P     G AWS+NQ
Sbjct  269   VTADQTAKNYYMVASTRFLKKEVSTVGVMSY-EGSNVQASSELPKAP----VGWAWSLNQ  323

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKL N+K+ V+GK+R+ LNGVSH++T+TP
Sbjct  324   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVNGKVRFGLNGVSHVDTETP  383

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYF +SEKVFKY+++ D P      +T+ PNV+N TFR FVEIVFENHEK++Q++H
Sbjct  384   LKLAEYFEMSEKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVEIVFENHEKSMQSFH  443

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFF+VA E G W+PEKR NYNL+DAVSRH++QV+P SW+A++ T DNAGMWN+RS+
Sbjct  444   LDGYSFFSVASEPGTWTPEKRNNYNLLDAVSRHTVQVFPKSWSAILLTFDNAGMWNIRSE  503

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
              WER YLGQQ+Y SVLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  504   NWERRYLGQQMYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPTPYT  551



>ref|XP_009146525.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=552

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/408 (65%), Positives = 332/408 (81%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I+DWY K H  LK  LDSG T+  PDGV+INGK GKVG    PL
Sbjct  149   LIPVPYADPEDDYTVLINDWYTKSHTALKTFLDSGRTLGSPDGVLINGKSGKVGGPNVPL  208

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG ++++NFR +GH M LVEMEGSH +QN YDSLD+HVGQC +VL
Sbjct  209   FTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVL  268

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+  K+YY+V S+RF K+E STV ++SY  G+ + AS ELP +P     G AWS+NQ
Sbjct  269   VTADQNAKNYYMVASTRFLKKEVSTVGVMSY-EGSNVQASSELPKAP----VGWAWSLNQ  323

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKL N+K+ V+GK+R+ LNGVSH++T+TP
Sbjct  324   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVNGKVRFGLNGVSHVDTETP  383

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYF +SEKVFKY+++ D P      +T+ PNV+N TFR FVEIVFENHEK++Q++H
Sbjct  384   LKLAEYFEMSEKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVEIVFENHEKSMQSFH  443

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFF+VA E G W+PEKR NYNL+DAVSRH++QV+P SW+A++ T DNAGMWN+RS+
Sbjct  444   LDGYSFFSVASEPGTWTPEKRNNYNLLDAVSRHTVQVFPKSWSAILLTFDNAGMWNIRSE  503

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
              WER YLGQQ+Y SVLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  504   NWERRYLGQQMYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPTPYT  551



>emb|CDY43994.1| BnaA05g25890D [Brassica napus]
Length=552

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/408 (65%), Positives = 332/408 (81%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I+DWY K H  LK  LDSG T+  PDGV+INGK GKVG    PL
Sbjct  149   LIPVPYADPEDDYTVLINDWYTKSHTALKTFLDSGRTLGSPDGVLINGKSGKVGGPNVPL  208

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG ++++NFR +GH M LVEMEGSH +QN YDSLD+HVGQC +VL
Sbjct  209   FTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVL  268

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+  K+YY+V S+RF K+E STV ++SY  G+ + AS ELP +P     G AWS+NQ
Sbjct  269   VTADQNAKNYYMVASTRFLKKEVSTVGVMSY-EGSNVQASSELPKAP----VGWAWSLNQ  323

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKL N+K+ V+GK+R+ LNGVSH++T+TP
Sbjct  324   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVNGKVRFGLNGVSHVDTETP  383

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYF +SEKVFKY+++ D P      +T+ PNV+N TFR FVEIVFENHEK++Q++H
Sbjct  384   LKLAEYFEMSEKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVEIVFENHEKSMQSFH  443

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFF+VA E G W+PEKR NYNL+DAVSRH++QV+P SW+A++ T DNAGMWN+RS+
Sbjct  444   LDGYSFFSVASEPGTWTPEKRNNYNLLDAVSRHTVQVFPKSWSAILLTFDNAGMWNIRSE  503

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
              WER YLGQQ+Y SVLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  504   NWERRYLGQQMYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPTPYT  551



>ref|XP_011048128.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=551

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/408 (66%), Positives = 327/408 (80%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V ++DWY   H TL+K LD G ++ARP GV+INGK+ K   K +PL
Sbjct  148   LIPVPYADPEDDYTVILNDWYTSSHATLRKYLDDGRSLARPTGVLINGKNAKGDGKDEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             F M+  KTY+YR+CN G++ ++NFR +GHTM LVEMEGSH +QNVY+SLD+HVGQC SVL
Sbjct  208   FKMKPEKTYKYRICNAGIKNTLNFRIQGHTMKLVEMEGSHVVQNVYESLDVHVGQCFSVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++ PKDYY+V S+RF KQ  +   II Y NG G  ASPE P +P     G AWS+NQ
Sbjct  268   VTANQAPKDYYMVASTRFNKQVLTAKGIIRYTNGKG-PASPEFPEAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG INITRTIKLVNS S   GKLRY+LNGVSH++ +TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASREGGKLRYSLNGVSHVDPETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LK+AEY+GI++KVFKY+ + D P     KV   PNV+N TFRNFVEI+FENHEK++Q+YH
Sbjct  383   LKIAEYYGIADKVFKYNTIKDMPSAKIGKVVTQPNVLNQTFRNFVEIIFENHEKSMQSYH  442

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVAIE G W+PEKRKNYNL+DAVSR +IQV+P SWAA++ T DNAGMWN+RS+
Sbjct  443   LDGYSFFAVAIEPGTWTPEKRKNYNLLDAVSRTTIQVFPKSWAAILLTFDNAGMWNIRSE  502

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             MWE+AYLGQQLY SVLSPE SLRDE+N+PD   LCG VKG+  P PY+
Sbjct  503   MWEKAYLGQQLYVSVLSPELSLRDEYNIPDNALLCGKVKGLPKPKPYT  550



>ref|NP_564697.1| SKU5 similar 14 [Arabidopsis thaliana]
 emb|CAB59910.1| BNH protein [Arabidopsis thaliana]
 dbj|BAC43197.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64845.1| At1g55560 [Arabidopsis thaliana]
 gb|AEE33266.1| SKU5 similar 14 [Arabidopsis thaliana]
Length=549

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/408 (65%), Positives = 331/408 (81%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V + DWY  GH  LK  LDSG T+  P+GV+INGK GKVG K +PL
Sbjct  147   LIPVPYADPEDDYTVLLGDWYTAGHTALKNFLDSGRTLGLPNGVLINGKSGKVGGKNEPL  206

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG ++++NFR + H M LVEMEGSH IQN YDSLD+HVGQC SVL
Sbjct  207   FTMKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVIQNDYDSLDVHVGQCFSVL  266

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++  KDYY+V S+RF K+E STV +I Y  G+ + AS ELP +P     G AWS+NQ
Sbjct  267   VTANQAAKDYYMVASTRFLKKELSTVGVIRY-EGSNVQASTELPKAP----VGWAWSLNQ  321

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLT++AARPNPQGSYHYG+INITR+IKLVNSKS VDGK+R+  NGVSH++T+TP
Sbjct  322   FRSFRWNLTSNAARPNPQGSYHYGKINITRSIKLVNSKSVVDGKVRFGFNGVSHVDTETP  381

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYF +SEKVFKY+++ D P      +T+ PNV+N TFR FVEI+FENHEKT+Q++H
Sbjct  382   LKLAEYFQMSEKVFKYNVIKDEPAAKITALTVQPNVLNITFRTFVEIIFENHEKTMQSFH  441

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA E GRW+PEKR+NYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+
Sbjct  442   LDGYSFFAVASEPGRWTPEKRENYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  501

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
               ER YLG+QLY SVLSPE+SLRDE+N+P    LCG+VKG+ +P  YS
Sbjct  502   NLERKYLGEQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPAHYS  549



>ref|XP_010034521.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW52299.1| hypothetical protein EUGRSUZ_J01719 [Eucalyptus grandis]
Length=551

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/409 (67%), Positives = 325/409 (79%), Gaps = 6/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I DWY K H  LK  LDSG  + RPDGV+INGK  K   K +PL
Sbjct  147   LIPVPYADPKDDYTVMIGDWYTKSHTQLKSFLDSGRALGRPDGVLINGKSNKSRGKDEPL  206

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG++ S+NFR + H M LVEMEGSHT+QN Y+SLD+HVGQC  VL
Sbjct  207   FTMKPGKTYKYRICNVGLKNSLNFRIQDHPMKLVEMEGSHTVQNNYESLDVHVGQCFGVL  266

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADK+PKDY +V S+RF K   +T A++SY NG G  ASPE+P +P     G AWS+NQ
Sbjct  267   VTADKKPKDYLMVASTRFTKTVLTTTAVVSYTNGKG-QASPEIPKAP----VGWAWSLNQ  321

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG INITRTIKLVNS S V+ KLRYA+NGVSH    TP
Sbjct  322   FRSFRWNLTASAARPNPQGSYHYGHINITRTIKLVNSASKVNDKLRYAINGVSHEEPKTP  381

Query  722   LKLAEYFGISEKVFKYDIMGDTPPEN-GEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEY+ + +KVFKY+ + D PP   G+KVT+ PNV N TFR FVEI+ ENHE +IQ++
Sbjct  382   LKLAEYYNVVDKVFKYNAIQDDPPATVGDKVTVEPNVANITFRTFVEIILENHENSIQSW  441

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVAIE GRW+P+KRKNYNL+DAVSRH++ V+P SWAA+M T DNAG+WNLRS
Sbjct  442   HLDGYSFFAVAIEPGRWTPDKRKNYNLLDAVSRHTVPVFPKSWAAIMLTFDNAGIWNLRS  501

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             ++ ER YLGQQ+Y SVLSPERSLRDE+N+PD   LCG+VK M  PPPYS
Sbjct  502   ELLERRYLGQQMYLSVLSPERSLRDEYNIPDNALLCGIVKDMPKPPPYS  550



>ref|XP_003556690.2| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=557

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/408 (66%), Positives = 334/408 (82%), Gaps = 9/408 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  PADE+ V I DW+ K H  LK+ LDSG +I RP GV INGK+G     ++PL
Sbjct  158   LIPVPYADPADEYWVLIGDWFGKSHTALKQKLDSGRSIGRPVGVHINGKNGG----LEPL  213

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             +TME GKTY+YR+CNVG++ S+NFR +GH + LVE EGSH +QN YDSLD+HVGQC +VL
Sbjct  214   YTMEPGKTYKYRICNVGLKDSLNFRIQGHPLKLVETEGSHVVQNNYDSLDVHVGQCYTVL  273

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+EPKDY++V S+RF K+  +   +I Y+NG G  AS  LPP+P    +G AWSINQ
Sbjct  274   VTADQEPKDYFMVASTRFTKKVLTATRVIRYSNGVG-PASGGLPPAP----QGWAWSINQ  328

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVN+ S  +GKLRY LNGVSH++T TP
Sbjct  329   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNTVSRANGKLRYGLNGVSHVDTQTP  388

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEY+G+++KVFKY+++ D+P      +T+APNV+NATFR+F+E++FEN  K IQ+Y+
Sbjct  389   LKLAEYYGVADKVFKYNLISDSPDTAFPDLTVAPNVINATFRDFIEVIFENPGKVIQSYN  448

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFA+A+E G+W+PEKRKNYNL+DA+SRH+IQV+PNSWAA+M T DNAGMWNLRS+
Sbjct  449   LDGYSFFALAVEPGKWTPEKRKNYNLLDAISRHTIQVFPNSWAAIMLTFDNAGMWNLRSE  508

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             M E  YLGQQLY SVLSP RSLRDE+NLP+ Q LCG+VK M  PPPYS
Sbjct  509   MAENRYLGQQLYVSVLSPNRSLRDEYNLPETQLLCGIVKDMPKPPPYS  556



>gb|KFK35575.1| hypothetical protein AALP_AA4G008600 [Arabis alpina]
Length=549

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/408 (65%), Positives = 330/408 (81%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V + DWY  GH  LK +LDSG T+  P+GV+INGK GKVG   +PL
Sbjct  147   LIPVPYADPEDDYTVILGDWYTSGHTALKNLLDSGRTLGLPNGVLINGKSGKVGGNNEPL  206

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM  GKTY+YR+CNVG ++++NFR + H M LVEMEGSH +QN YDSLD+HVGQC +VL
Sbjct  207   FTMNPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVL  266

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++  KDYY+V S+RF K+E STV +I YA G+ + AS ELP +P     G AWS+NQ
Sbjct  267   VTANQAAKDYYMVASTRFLKKELSTVGVIRYA-GSNVQASSELPKTP----IGWAWSLNQ  321

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITR+IKLVNSKS V+GK R+  NGVSH++TDTP
Sbjct  322   FRSFRWNLTASAARPNPQGSYHYGRINITRSIKLVNSKSSVNGKTRFGFNGVSHVDTDTP  381

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYF +SEKVFKY+++ D P      +T+ PNV+N TFR FVEI+FENHEK++Q++H
Sbjct  382   LKLAEYFQMSEKVFKYNVIKDEPASKITTLTVQPNVLNITFRTFVEIIFENHEKSMQSFH  441

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA E GRW+PEKRKNYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+
Sbjct  442   LDGYSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  501

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
               ER YLG+QLY SVLSPE+SLRDE+N+P    LCG+VKG+ +P  Y+
Sbjct  502   NSERKYLGEQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPASYT  549



>ref|XP_007157830.1| hypothetical protein PHAVU_002G101700g [Phaseolus vulgaris]
 gb|ESW29824.1| hypothetical protein PHAVU_002G101700g [Phaseolus vulgaris]
Length=547

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/408 (66%), Positives = 328/408 (80%), Gaps = 9/408 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  PADEF V I DW+ K H+TLK+ LDSG +I RP GV INGK+G     ++P 
Sbjct  148   LIPVPYADPADEFWVLIGDWFGKSHQTLKQFLDSGRSIGRPSGVHINGKNGG----LEPA  203

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             +TME GKTY+YR+CNVG++ S+NFR +GH++ LVEMEGSH +QN YDSLD+HVGQC SVL
Sbjct  204   YTMEPGKTYKYRICNVGLKDSLNFRIQGHSLKLVEMEGSHVVQNQYDSLDVHVGQCFSVL  263

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+EPKDYY+V S+RF K+      II Y+NG G  ASPELPP+P    EG AWS+NQ
Sbjct  264   VTADQEPKDYYMVASTRFAKKTLGATRIIRYSNGVG-PASPELPPAP----EGWAWSLNQ  318

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVN+ S   GKLRY LNGVSH++ +TP
Sbjct  319   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNTLSRTGGKLRYGLNGVSHVDPETP  378

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEY+G+S++VFKY+I+ D P      +  APNV+NATFR+F+EI+FEN  K  Q+Y+
Sbjct  379   LKLAEYYGVSDQVFKYNIISDDPASPIGDLACAPNVINATFRDFIEIIFENPTKVPQSYN  438

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAV +E G+WSPEKRKNYN +D VSRH+IQV+P SW+A+M T DNAGMWNLRS+
Sbjct  439   LDGYSFFAVGMEPGKWSPEKRKNYNNLDGVSRHTIQVFPKSWSAIMLTFDNAGMWNLRSE  498

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             + E  YLGQQLY SVLSP RSLRDE+N+PD Q LCG+V  +  PPPYS
Sbjct  499   LGENRYLGQQLYVSVLSPNRSLRDEYNMPDTQVLCGIVTDLPEPPPYS  546



>ref|XP_004250092.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=555

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/409 (67%), Positives = 330/409 (81%), Gaps = 7/409 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPF++P  +  V   DWY K H  LK++LDSG  + RP GV+INGK GK   K +P+
Sbjct  149   LIPVPFETPEADHMVLAGDWYTKSHVELKRMLDSGRALGRPTGVLINGKSGKGDGKDEPM  208

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FT+ AGKTYR+R CNVGM+ S+N R +GHTM LVE+EGSHT+QNVY+S+D+H+GQC SVL
Sbjct  209   FTVIAGKTYRFRFCNVGMKDSINVRMQGHTMKLVEIEGSHTVQNVYESIDIHLGQCFSVL  268

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++EPKDYYLVVS+RF K      A I YANG G  ASPELP +P    EG AWS+NQ
Sbjct  269   VTANQEPKDYYLVVSTRFTKDSHVATATIRYANGKG-PASPELPKAP----EGWAWSLNQ  323

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLV S   VDGKLRYALNGVSH++T TP
Sbjct  324   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVTSAGQVDGKLRYALNGVSHVDTATP  383

Query  722   LKLAEYFGISEKVFKYDIMGDT--PPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             +KLAEY+G  +KVFKY+++ D   P    +K+T+APNVVNAT+RN+VEIV ENH KT+Q+
Sbjct  384   IKLAEYYGAGDKVFKYNLIKDEYEPNPGQDKITVAPNVVNATYRNYVEIVIENHGKTVQS  443

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HL GHSFFAV IE GRW+PE+RKNYNL+DAVSR++IQVYP S+A +MTTLDNAG+WNLR
Sbjct  444   WHLSGHSFFAVGIEPGRWAPERRKNYNLLDAVSRNTIQVYPKSFAVIMTTLDNAGLWNLR  503

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             S+  ER YLG QLYFSVLSP +S++DE+N+PD   LCG+VK M  P PY
Sbjct  504   SNSLERNYLGHQLYFSVLSPNKSIKDEYNMPDNDLLCGIVKDMPKPTPY  552



>ref|XP_011077090.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=558

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/402 (69%), Positives = 328/402 (82%), Gaps = 6/402 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIP+PF+SP  EFNV + DWY+KGH TLKK LDSG ++ RPDGVVINGK G       P 
Sbjct  149   LIPIPFNSPEAEFNVLVGDWYSKGHVTLKKFLDSGRSLGRPDGVVINGKSGNEA----PK  204

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             + +  GKTYRYR+CNVGM+ SVN R +GHTM LVE+EGSHT+QNVYDSLD+H+GQC SVL
Sbjct  205   WNLIPGKTYRYRICNVGMKNSVNVRIQGHTMKLVEIEGSHTVQNVYDSLDIHLGQCNSVL  264

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+ PKDY  VVS+RF K   +T   I Y  G+ I AS ELP +P    EGIAWSINQ
Sbjct  265   VTADQTPKDYAFVVSTRFTKTVLTTTGTIHY-EGSNIPASTELPAAPGNAPEGIAWSINQ  323

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRS RWNLTASAARPNPQGSYHYG+INITRTIK+VNS S  + KLRYA+NGVSH + +TP
Sbjct  324   FRSLRWNLTASAARPNPQGSYHYGKINITRTIKIVNSASRGEDKLRYAVNGVSHTDPETP  383

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEK-VTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEYFG+S+KVFKYD++ D P  + E  +T+APNVVN TFRNF+EI+FENHEK+IQ++
Sbjct  384   LKLAEYFGVSDKVFKYDLIKDEPSADAEDHITIAPNVVNGTFRNFIEIIFENHEKSIQSW  443

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVAIE GRW+P KR NYNL+DA+SRH+IQVYPNSWAA+MTTLDN GMWNLRS
Sbjct  444   HLDGYSFFAVAIEPGRWAPAKRANYNLIDAISRHTIQVYPNSWAAIMTTLDNCGMWNLRS  503

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGM  1204
                ER YLGQQLYFSV+SPE SLRDE+ LP+ Q LCG+VK +
Sbjct  504   VSLERNYLGQQLYFSVVSPEHSLRDEYLLPEGQLLCGIVKDL  545



>gb|AGW80453.1| pollen-specific protein [Gossypium hirsutum]
Length=551

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/408 (65%), Positives = 330/408 (81%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  PAD++ + + D++NKGH +LKKILDSG  + R DGV +NGK  K   K +PL
Sbjct  148   LIPVPYADPADDYTLLVGDFFNKGHTSLKKILDSGRNLGRCDGVHLNGKVAKGDRKDEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTMEAGKTY+YR+CN G++TS+N RF+GHTM LVEMEGSHT+QN YDSLD+HVGQC SVL
Sbjct  208   FTMEAGKTYKYRICNTGIKTSLNVRFQGHTMKLVEMEGSHTMQNDYDSLDVHVGQCFSVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++EP+DYY+V S+RF ++E +   II Y NG G  AS ELPP P     G AWS+NQ
Sbjct  268   VTANQEPRDYYVVASTRFTRREVTATGIIRYKNGKG-AASSELPPPP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FR+FRWNLT++AARPNPQGSY YG INITRTIKL N+   VDGKLRYALNGVS++   TP
Sbjct  323   FRTFRWNLTSNAARPNPQGSYKYGSINITRTIKLANTAQKVDGKLRYALNGVSYVEPTTP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEY+G+++KVFKYD + D P  +  KVTLAP V+N T RNFVEI+FENHE  IQ+YH
Sbjct  383   LKLAEYYGVADKVFKYDTIPDEPQSDNTKVTLAPIVLNMTHRNFVEIIFENHESAIQSYH  442

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             L G+SFFAV ++ G+WSPEKR NYNL+DAVSRH+IQV+PNSW+A++ T DN GMWNLRS+
Sbjct  443   LSGYSFFAVGMDVGKWSPEKRMNYNLLDAVSRHTIQVFPNSWSAILLTFDNCGMWNLRSE  502

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             +W+R YLGQQLY SV+SP RSL+DE+NLP+    CG+V+GM  PPP+S
Sbjct  503   IWDRHYLGQQLYASVISPNRSLKDEYNLPEGVLTCGIVQGMPRPPPFS  550



>ref|XP_009376784.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=706

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/410 (65%), Positives = 332/410 (81%), Gaps = 5/410 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+ +P D++ V I DWY K H  L+K LDSG ++ARPDGV+INGK  K   K +PL
Sbjct  148   LIPVPYAAPEDDYTVIIGDWYTKSHSQLRKFLDSGRSMARPDGVLINGKSAKGDGKDEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+AGKTY+YR+CNVG++ S+NFR +GH M LVEMEGSHT+QN YDSLD+H+GQC S+L
Sbjct  208   FTMKAGKTYKYRICNVGLKNSLNFRIQGHQMKLVEMEGSHTVQNTYDSLDVHIGQCFSML  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADKEPKDYY+V S+RF K   +   II Y NG G   SPE+P +P     G AWS+NQ
Sbjct  268   VTADKEPKDYYMVASTRFTKSVLTGKGIIRYENGKG-PVSPEVPKAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKL+NS S  DGKLRYA+NG+SH++ +TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLINSASKADGKLRYAINGISHVDPETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLA+Y+GI EKVFK+D M   P    EK+T+ PNV+N T ++FVEI+FEN EK++QT+H
Sbjct  383   LKLADYYGIREKVFKFDTMKVDPQSPAEKITMEPNVLNITIKDFVEIIFENPEKSLQTWH  442

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             L+G++FFAVA+E G+W+PEKRKNYNL+DA+SRH+IQV+P SWAA++ T DNAGMWNLRS+
Sbjct  443   LNGYAFFAVAVEPGKWTPEKRKNYNLLDAMSRHTIQVFPKSWAAILLTFDNAGMWNLRSE  502

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSGF  1231
               ER YLGQQLY  V + +RSLR+E+N+PD   +CGLVKGM  PPPYS F
Sbjct  503   QPERRYLGQQLYVGVENIKRSLRNEYNMPDNALVCGLVKGMPKPPPYSTF  552



>ref|XP_003538519.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=552

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/409 (67%), Positives = 325/409 (79%), Gaps = 6/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P DE+ V I DWY K H  L+K+LDSG ++ RP+GV+INGK  K   K +PL
Sbjct  149   LIPVPYPDPEDEYTVLIGDWYTKSHTILRKLLDSGRSLGRPEGVLINGKTAKGDGKDEPL  208

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+  KTY+YR+CNVG++ S+N+R +GH+M LVEMEGSH +QN+YDSLD+HVG+C SVL
Sbjct  209   FTMKPAKTYKYRICNVGLKNSLNYRIQGHSMKLVEMEGSHVVQNMYDSLDVHVGECFSVL  268

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADKEPKDYY+V S+RF K       II Y NG G  ASP++PP+P     G AWS+NQ
Sbjct  269   VTADKEPKDYYMVASTRFTKTVLIGKGIIRYTNGKG-PASPDIPPAP----VGWAWSLNQ  323

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             F +FRWNLTASAARPNPQGSY YGQINITRTIKLVNS S  +GKLRYALNGVSH++ +TP
Sbjct  324   FHTFRWNLTASAARPNPQGSYKYGQINITRTIKLVNSVSKSNGKLRYALNGVSHVDPETP  383

Query  722   LKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEYFGIS+KVFKYD + D P P  G  VT+ PNV+N T RNF+EI+FEN EKTIQ+Y
Sbjct  384   LKLAEYFGISDKVFKYDTIPDNPSPNIGNAVTVQPNVLNITHRNFIEIIFENPEKTIQSY  443

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFF + IE G W+PEKRK+YNL+DAVSRH++ V+P  WAA+M T DNAGMWNLRS
Sbjct  444   HLDGYSFFVLGIEPGTWTPEKRKSYNLLDAVSRHTVHVFPKCWAAIMLTFDNAGMWNLRS  503

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             D+ E  YLGQQLY SVLSPE SLRDE+N+PD   LCGLVK +  P PYS
Sbjct  504   DIAESRYLGQQLYISVLSPEHSLRDEYNMPDSNLLCGLVKNLPKPAPYS  552



>gb|KHN44494.1| L-ascorbate oxidase like [Glycine soja]
Length=551

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/409 (67%), Positives = 325/409 (79%), Gaps = 6/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P DE+ V I DWY K H  L+K+LDSG ++ RP+GV+INGK  K   K +PL
Sbjct  148   LIPVPYPDPEDEYTVLIGDWYTKSHTILRKLLDSGRSLGRPEGVLINGKTAKGDGKDEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+  KTY+YR+CNVG++ S+N+R +GH+M LVEMEGSH +QN+YDSLD+HVG+C SVL
Sbjct  208   FTMKPAKTYKYRICNVGLKNSLNYRIQGHSMKLVEMEGSHVVQNMYDSLDVHVGECFSVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADKEPKDYY+V S+RF K       II Y NG G  ASP++PP+P     G AWS+NQ
Sbjct  268   VTADKEPKDYYMVASTRFTKTVLIGKGIIRYTNGKG-PASPDIPPAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             F +FRWNLTASAARPNPQGSY YGQINITRTIKLVNS S  +GKLRYALNGVSH++ +TP
Sbjct  323   FHTFRWNLTASAARPNPQGSYKYGQINITRTIKLVNSVSKSNGKLRYALNGVSHVDPETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEYFGIS+KVFKYD + D P P  G  VT+ PNV+N T RNF+EI+FEN EKTIQ+Y
Sbjct  383   LKLAEYFGISDKVFKYDTIPDNPSPNIGNAVTVQPNVLNITHRNFIEIIFENPEKTIQSY  442

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFF + IE G W+PEKRK+YNL+DAVSRH++ V+P  WAA+M T DNAGMWNLRS
Sbjct  443   HLDGYSFFVLGIEPGTWTPEKRKSYNLLDAVSRHTVHVFPKCWAAIMLTFDNAGMWNLRS  502

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             D+ E  YLGQQLY SVLSPE SLRDE+N+PD   LCGLVK +  P PYS
Sbjct  503   DIAESRYLGQQLYISVLSPEHSLRDEYNMPDSNLLCGLVKNLPKPAPYS  551



>ref|XP_010480096.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Camelina sativa]
 ref|XP_010480097.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Camelina sativa]
Length=549

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/408 (64%), Positives = 330/408 (81%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P DE+ V + DWY  GH  LK +LDSG T+  P+GV+INGK GKVG   +PL
Sbjct  147   LIPVPYADPEDEYTVLLGDWYTTGHTALKSLLDSGRTLGLPNGVLINGKSGKVGGNNEPL  206

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG ++++NFR + H M LVEMEGSH +QN YDSLD+HVGQC SVL
Sbjct  207   FTMKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVL  266

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++  KDYY+V S+RF K+E STV +I Y  G+ + AS ELP +P     G AWS+NQ
Sbjct  267   VTANQAAKDYYMVASTRFLKKELSTVGVIRY-EGSNVQASAELPKAP----VGWAWSLNQ  321

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITR+IKLVN+KS VDGKLR+  NGVSH++T+TP
Sbjct  322   FRSFRWNLTASAARPNPQGSYHYGKINITRSIKLVNTKSMVDGKLRFGFNGVSHVDTETP  381

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYF +++KVFKY+++ D P      +T+ PNV+N TFR FVEI+FENHEK++Q++H
Sbjct  382   LKLAEYFQMADKVFKYNVIKDEPAAKITALTVEPNVLNITFRTFVEIIFENHEKSMQSFH  441

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA E G+W+PE RKNYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+R++
Sbjct  442   LDGYSFFAVASEPGKWTPESRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRAE  501

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
              WER YLG+QLY SV SPE+SLRDE+N+P    LCG+VKG+ +P  Y+
Sbjct  502   NWERRYLGEQLYVSVQSPEKSLRDEYNIPLNTNLCGIVKGLPLPTVYT  549



>ref|XP_006299973.1| hypothetical protein CARUB_v10016186mg [Capsella rubella]
 gb|EOA32871.1| hypothetical protein CARUB_v10016186mg [Capsella rubella]
Length=551

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/408 (64%), Positives = 330/408 (81%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P ++  + I+DW+ K H  LK  LDSG T+  PDGV+INGK GKVG K +PL
Sbjct  148   LIPVPYADPEEDNTILINDWFTKSHTALKNFLDSGRTLGSPDGVLINGKSGKVGHKNEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM  GKTY++R+CNVG ++++NFR +GH M LVEMEGSH +QN YDSLD+HVGQC +VL
Sbjct  208   FTMNPGKTYKFRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+  K+YY+V S+RF K+E STV ++SY  G+ +  S ELP +P     G AWS+NQ
Sbjct  268   VTADQVAKNYYMVASTRFLKKEVSTVGVLSY-EGSNVEPSTELPKAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKL N+K+ V+GK+R+  NGVSH++T+TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNVVNGKVRFGFNGVSHVDTETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKL EYFG ++KVFKY+++ D P      +T+ PNV+N TFR FVEIVFENHEK++Q++H
Sbjct  383   LKLVEYFGFADKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVEIVFENHEKSMQSFH  442

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDGHSFFAVA E GRW+PEKR NYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+
Sbjct  443   LDGHSFFAVASEPGRWTPEKRNNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  502

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
              WER YLG+Q+Y SVLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  503   NWERRYLGEQMYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPAPYT  550



>emb|CDY24188.1| BnaC01g37680D [Brassica napus]
Length=550

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/408 (64%), Positives = 330/408 (81%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D+  + I+DWY K H  LK  LDSG T+  PDGV+INGK GKVG +  PL
Sbjct  147   LIPVPYADPEDDHTILINDWYTKSHTALKNFLDSGRTLGSPDGVLINGKSGKVGGQDKPL  206

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG ++++NFR +GH M LVEMEGSH +QN YDSLD+HVGQC +VL
Sbjct  207   FTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVL  266

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+  K+YY+V S+RF K+E STV ++SY  G+ +  S  LP +P     G AWS+NQ
Sbjct  267   VTADQNAKNYYMVASTRFLKKEVSTVGVMSY-EGSNVQPSNVLPKAP----VGWAWSLNQ  321

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKL N+K+ VDGK+R+ LNGVSH++T+TP
Sbjct  322   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVDGKVRFGLNGVSHVDTETP  381

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYF +SEKVFKY+++ D P      +T+ PNV+N TFR FVEIVFENHEK++Q++H
Sbjct  382   LKLAEYFEMSEKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVEIVFENHEKSMQSFH  441

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFF+VA E G W+PEKR NYNL+DAVSRH++QV+P SW+A++ T DNAGMWN+RS+
Sbjct  442   LDGYSFFSVASEPGTWTPEKRNNYNLLDAVSRHTVQVFPKSWSAILLTFDNAGMWNIRSE  501

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
              WER YLGQQ+Y SVLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  502   NWERRYLGQQMYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPTPYT  549



>ref|XP_007014661.1| SKU5 similar 12 [Theobroma cacao]
 gb|EOY32280.1| SKU5 similar 12 [Theobroma cacao]
Length=552

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/409 (65%), Positives = 327/409 (80%), Gaps = 6/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ +   DW++KGH TLKK+LDSG  + R DGV INGK  K   K +PL
Sbjct  148   LIPVPYPDPEDDYTILAGDWFSKGHTTLKKMLDSGRNLGRCDGVHINGKVAKGDGKDEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTME GKTY+YR+CNVG++TS+N RF+GH M LVEMEGSHT+QN Y+SLD+HVGQC  VL
Sbjct  208   FTMEPGKTYKYRICNVGIKTSLNVRFQGHNMKLVEMEGSHTVQNTYESLDVHVGQCFGVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+EP+DYY+V S+RF K+  +   II Y NG G  ASPELPP+P     G AWS+NQ
Sbjct  268   VTADQEPRDYYVVASTRFTKRVITATGIIRYTNGKG-PASPELPPAP----IGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FR+FRWNLTASAARPNPQGSYHYG I+ITRTIKL N+   V GKLRYA+NG+SH++  TP
Sbjct  323   FRTFRWNLTASAARPNPQGSYHYGAIDITRTIKLANTAGKVGGKLRYAINGISHVDPPTP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPEN-GEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEY+ +++K FKYDI+ D PP    E++T+ P VVN T+R FVEI+FEN E  IQ++
Sbjct  383   LKLAEYYNVADKSFKYDILRDDPPAKISEEITVQPIVVNLTYRTFVEIIFENRETAIQSW  442

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HL G+SFFAVA+E G W+PEKRKNYNL+DAVSRH+IQV+PNSWAA++ T DN GMWN+RS
Sbjct  443   HLSGYSFFAVAVETGTWTPEKRKNYNLLDAVSRHTIQVFPNSWAAILLTFDNCGMWNIRS  502

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             ++W+R YLGQQLY SVLSPE SLRDE+N+PD   LCG+V+ M  PPPYS
Sbjct  503   EIWDRHYLGQQLYASVLSPEHSLRDEYNIPDNALLCGVVESMPKPPPYS  551



>ref|XP_010501174.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=549

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/408 (64%), Positives = 330/408 (81%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+ +P DE+ V + DWY  GH  LK +LDSG T+  P+GV+INGK GKVG   +PL
Sbjct  147   LIPVPYAAPEDEYTVLLGDWYTTGHTALKNLLDSGRTLGLPNGVLINGKSGKVGGNNEPL  206

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG ++++NFR + H M LVEMEGSH +QN YDSLD+HVGQC SVL
Sbjct  207   FTMKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVL  266

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++  KDYY+V S+RF K+E  TV +I Y  G+ + AS +LP +P     G AWS+NQ
Sbjct  267   VTANQAAKDYYMVASTRFLKKELGTVGVIRY-EGSNVQASTKLPKAP----VGWAWSLNQ  321

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITR+IKLVN+KS VDGKLR+  NGVSH++T+TP
Sbjct  322   FRSFRWNLTASAARPNPQGSYHYGKINITRSIKLVNTKSMVDGKLRFGFNGVSHVDTETP  381

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYF ++EKVFKY+++ D P      +T+ PNV+N TFR FVEI+FENHEK++Q++H
Sbjct  382   LKLAEYFQMAEKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVEIIFENHEKSMQSFH  441

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA E G+W+PE RKNYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+R++
Sbjct  442   LDGYSFFAVASEPGKWTPESRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRAE  501

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
              WER YLG+QLY SV SPE+SLRDE+N+P    LCG+VKG+ +P  Y+
Sbjct  502   NWERRYLGEQLYVSVQSPEKSLRDEYNIPLNTNLCGIVKGLPLPTVYT  549



>ref|XP_010093150.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB53609.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=535

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/409 (65%), Positives = 325/409 (79%), Gaps = 5/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ + I DWY + H TL+K LD G ++ RPDGV+INGK  K     +PL
Sbjct  130   LIPVPYADPEDDYTILIGDWYTESHSTLRKFLDIGRSLGRPDGVLINGKSAKSDGSDEPL  189

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GK Y+YR+CNVG++ S+NFR +GH + LVEMEGSHT+QN Y+SLD+HVGQC +VL
Sbjct  190   FTMKPGKIYKYRICNVGLKNSLNFRIQGHPLKLVEMEGSHTVQNTYESLDVHVGQCFAVL  249

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADK PKDY +V S+RF K   +   II Y N      SP++  +P     G AWS+NQ
Sbjct  250   VTADKAPKDYLVVASTRFTKNVLTGKGIIRYTNAKPAPPSPDVVEAP----VGWAWSLNQ  305

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLT+SAARPNPQGSYHYG+INITRTIKLVNS   V GKLRYA+NGVSH++  TP
Sbjct  306   FRSFRWNLTSSAARPNPQGSYHYGKINITRTIKLVNSAVRVQGKLRYAINGVSHVDPYTP  365

Query  722   LKLAEYFGISEKVFKYDIMGDTPPEN-GEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEY+ +++KVFKYDI+ D PP N G+K+T+A NVVN TFRNFVEI+FENHEK++QT+
Sbjct  366   LKLAEYYQVADKVFKYDIISDEPPANAGDKITVATNVVNQTFRNFVEIIFENHEKSLQTW  425

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVAIE GRWSP+KR  YNL+DAVSRH+IQV+P SWAA+M T DNAGMWNLRS
Sbjct  426   HLDGYSFFAVAIEPGRWSPDKRSRYNLLDAVSRHTIQVFPKSWAAIMLTFDNAGMWNLRS  485

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             ++ ER YLGQQLY SV SP RSLRDE+N+PD   LCG+VK +  PPPYS
Sbjct  486   ELTERRYLGQQLYISVQSPARSLRDEYNMPDNALLCGVVKDLPWPPPYS  534



>ref|XP_006353286.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=558

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/412 (66%), Positives = 331/412 (80%), Gaps = 10/412 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPF++P  +  V + DWY K H  LK++LDSG  + RP GVVINGK GK   K +P+
Sbjct  149   LIPVPFETPEADHMVLVGDWYTKSHTELKRLLDSGRALGRPQGVVINGKSGKGDGKDEPM  208

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FT+  GKTYR+R+CNVG++ S+N R +GHT+ LVE+EGSHT+QNVY+SLD+H+GQC SVL
Sbjct  209   FTVTPGKTYRFRICNVGLKDSINVRMQGHTLKLVEIEGSHTVQNVYESLDIHLGQCFSVL  268

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++EPKDY+LV S+RF K        I YANG G  ASPELP +P    EG AWS+NQ
Sbjct  269   VTANQEPKDYFLVASTRFTKDSHVATTTIRYANGKG-PASPELPKAP----EGWAWSLNQ  323

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLV S   VDGKLRYALNGVSH++  TP
Sbjct  324   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVTSAGQVDGKLRYALNGVSHVDPTTP  383

Query  722   LKLAEYFGISEKVFKYDIMGD----TPPENGE-KVTLAPNVVNATFRNFVEIVFENHEKT  886
             +KLAEY+G  +KVFKYD++ D    +P + G+ K+T+APNVVNAT+RNFVEIV ENH K+
Sbjct  384   IKLAEYYGAGDKVFKYDLIKDEYEPSPGQAGQDKITVAPNVVNATYRNFVEIVIENHGKS  443

Query  887   IQTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMW  1066
             +Q++HL GHSFFAV IE GRW+PEKR+NYNL+DAVSR++IQVYP S+A +MTTLDNAG+W
Sbjct  444   VQSWHLSGHSFFAVGIEPGRWTPEKRRNYNLLDAVSRNTIQVYPKSFAVIMTTLDNAGLW  503

Query  1067  NLRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             NLRS+  ER YLG QLYFSVLSP +S++DE+N+PD   LCG+VK M  P PY
Sbjct  504   NLRSNSLERNYLGHQLYFSVLSPNKSIKDEYNMPDNDLLCGIVKDMPKPTPY  555



>ref|XP_004149657.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=546

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/410 (67%), Positives = 329/410 (80%), Gaps = 14/410 (3%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGH-TIARPDGVVINGKHGKVGDKIDP  178
             LIPVP+  P D++ V I DWY K H TLK+ILD+GH +IARP+GV+INGK  K     +P
Sbjct  148   LIPVPYADPEDDYTVLIGDWYTKSHTTLKQILDNGHRSIARPEGVLINGKTAKGDGTDEP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFTM+  KTY+YRVCNVG++TS+NFRF+GHTM LVEMEGSHT+QN Y SLD+HVGQC SV
Sbjct  208   LFTMKPEKTYKYRVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQNDYQSLDVHVGQCFSV  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             LVTA++EPKDYY+V S+RF K       II Y NG G  ASPE+P +P     G AWS+N
Sbjct  268   LVTANQEPKDYYMVASTRFIKNVLIGKGIIRYTNGKG-PASPEIPKAP----MGWAWSLN  322

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFR+F       +  PNPQGSYHYG INITRTIKL NS + VDGKLRYA+NGVSH++ +T
Sbjct  323   QFRTF-------SLEPNPQGSYHYGSINITRTIKLFNSATKVDGKLRYAINGVSHVDPET  375

Query  719   PLKLAEYFGISEKVFKYDIMGDT-PPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             PLKLAEYF I+EKVFKYD++ D  P E    VT+APNVVNATFRNF+EI+FENHEK++Q+
Sbjct  376   PLKLAEYFEIAEKVFKYDMISDEGPTEGATAVTIAPNVVNATFRNFIEIIFENHEKSLQS  435

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG+SFFAVAIE GRWSPEKR NYNL+DAVSRH+IQV+PNSWAA++ T DNAGMWNLR
Sbjct  436   WHLDGYSFFAVAIEPGRWSPEKRSNYNLLDAVSRHTIQVFPNSWAAILLTFDNAGMWNLR  495

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             S++ E  YLGQQLY SVLSP RSLRDE+N+PD   LCGLVKGM +P PY+
Sbjct  496   SELIENRYLGQQLYISVLSPARSLRDEYNIPDHTLLCGLVKGMPLPKPYT  545



>ref|XP_004505353.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=545

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/404 (66%), Positives = 326/404 (81%), Gaps = 9/404 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  PADE+ V I DW+ K H TLKK LDSG ++ RPDGV I GK     + ++PL
Sbjct  146   LIPVPYADPADEYWVLIGDWFGKSHTTLKKFLDSGRSMGRPDGVHIMGKS----NSVEPL  201

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             +TME+GKTY+YR+CNVG++ ++NFR +GH+M LVEMEGSHT+QN+YDSLD+HVGQC SVL
Sbjct  202   YTMESGKTYKYRICNVGLKDTLNFRIQGHSMKLVEMEGSHTVQNMYDSLDVHVGQCYSVL  261

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADKEPKDYYLV S+RF K   +T A+I Y+NG G  +             G AWS+NQ
Sbjct  262   VTADKEPKDYYLVASTRFTKNVLTTTAVIRYSNGVGPASPIIP-----PAPVGWAWSLNQ  316

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
              RSFRWNLTASAARPNPQGSYHYGQINITRTIKLVN+ S V+GKLRYA+NGVSH++++TP
Sbjct  317   LRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNTASRVNGKLRYAINGVSHVDSETP  376

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEY+G+++KVFKYDI+ D PP     +TLAPNV+NATFR F+EI+ EN  KTIQ+Y+
Sbjct  377   LKLAEYYGVADKVFKYDIISDDPPTVITDITLAPNVINATFRTFIEIILENPTKTIQSYN  436

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA+E G+W+PEKRKNYNL+D VSRH+IQV+P SWAA+M T DNAGMWNLRS+
Sbjct  437   LDGYSFFAVAVEPGKWTPEKRKNYNLLDGVSRHTIQVFPKSWAAIMLTFDNAGMWNLRSE  496

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMP  1213
               E  YLGQQLY SVLSPE S RDE+NLPD Q +CG+VK +  P
Sbjct  497   NTENKYLGQQLYISVLSPEFSNRDEYNLPDTQLVCGIVKDLPRP  540



>ref|XP_009399915.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=550

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/409 (66%), Positives = 323/409 (79%), Gaps = 7/409 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID--  175
             LIPVPFD PAD++ V I DWY K HK L+KILD+G  + RP G++ING  GK G   D  
Sbjct  146   LIPVPFDDPADDYTVLIGDWYTKSHKILEKILDAGRAVGRPAGLLINGHSGKNGAGKDEP  205

Query  176   PLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLS  355
             PLFTMEA KTYRYR+CN+GM+ ++NFR + H+MTLVEM+GSHT+QN YDSLD+HVGQCLS
Sbjct  206   PLFTMEAKKTYRYRICNIGMKVTLNFRIQSHSMTLVEMDGSHTVQNNYDSLDIHVGQCLS  265

Query  356   VLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSI  535
             VLVTA++ P+DYY+V SSRF K   +   I+ YA G+    S +LP +P     G AWS 
Sbjct  266   VLVTANQSPRDYYMVASSRFTKYMLTVTGIVRYA-GSQTPPSQDLPEAP----AGWAWSF  320

Query  536   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTD  715
             NQ+RSFRWNLTASAARPNPQGSYHYG INITRTI+LVN+   VDGK RYALNGVSH +TD
Sbjct  321   NQWRSFRWNLTASAARPNPQGSYHYGSINITRTIRLVNTIGNVDGKRRYALNGVSHQDTD  380

Query  716   TPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             TPLKLAEY+GI++KVFKYDI+ D PP +G ++ LAPNVVN TFR FVEI+FEN E+++Q 
Sbjct  381   TPLKLAEYYGIADKVFKYDIISDEPPADGAQIKLAPNVVNTTFRTFVEIIFENPERSMQA  440

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             YHLDG+SFF V +  G+W+P  RK YNL+DAVSRH+IQVY  SW+AVM T DNAGMWNLR
Sbjct  441   YHLDGYSFFPVGMGHGKWTPASRKTYNLLDAVSRHTIQVYQRSWSAVMLTFDNAGMWNLR  500

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             S++WER YLGQQLYF+V SP RSLRDE+N+PD   LCG V  +  PP Y
Sbjct  501   SELWERRYLGQQLYFTVQSPARSLRDEYNMPDNALLCGDVANLPKPPSY  549



>ref|XP_007163845.1| hypothetical protein PHAVU_001G269200g [Phaseolus vulgaris]
 gb|ESW35839.1| hypothetical protein PHAVU_001G269200g [Phaseolus vulgaris]
Length=549

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/408 (66%), Positives = 330/408 (81%), Gaps = 6/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P DE+ V + DWY K H +L+K+LDSG +I RP+GV+INGK  K      PL
Sbjct  147   LIPVPYADPEDEYWVIMGDWYTKSHTSLQKLLDSGRSIGRPNGVLINGKTAKGDGSDQPL  206

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             +TM  GKTY+YR+CNVG++ ++NFR +GH++ LVE EGSH +QNVYDSLD+HVGQC +VL
Sbjct  207   YTMIPGKTYKYRLCNVGLKDALNFRIQGHSLKLVETEGSHVVQNVYDSLDVHVGQCFTVL  266

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADK+PKDYY+V S+RF K + S  AII Y N +   ASPELPPSP     G AWS+NQ
Sbjct  267   VTADKDPKDYYMVASTRFTKYDLSAKAIIHYTN-SAAPASPELPPSP----VGWAWSLNQ  321

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYGQINITRTIK  NS S   G LRYA+NGVSH++ +TP
Sbjct  322   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKFANSVSRGQG-LRYAINGVSHVDPETP  380

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEY+G+++KVFKY+ + D PP +   +T APNV+NATFR+F+EI+FEN  KT+Q+Y+
Sbjct  381   LKLAEYYGVADKVFKYNTISDEPPVDLSSITKAPNVINATFRDFIEIIFENDGKTVQSYN  440

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA+E G+WSP KRKNYNL+DAVSRH++QV+P SW+A+M T DNAGMWNLRS+
Sbjct  441   LDGYSFFAVAMEPGKWSPVKRKNYNLLDAVSRHTVQVFPKSWSAIMLTFDNAGMWNLRSE  500

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
               E  YLGQQLY SVLSP+RSLRDE+NLPD Q LCG+VK +  PPPYS
Sbjct  501   HAENRYLGQQLYISVLSPQRSLRDEYNLPDTQLLCGIVKDLPKPPPYS  548



>ref|XP_010462411.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=549

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/408 (64%), Positives = 329/408 (81%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P DE+ V + DWY  GH  LK +LDSG T+  P+GV+INGK GKVG   +PL
Sbjct  147   LIPVPYADPEDEYTVLLGDWYTTGHTALKNLLDSGRTLGLPNGVLINGKSGKVGGNNEPL  206

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+  KTY+YR+CNVG ++++NFR + H M LVEMEGSH +QN YDSLD+HVGQC SVL
Sbjct  207   FTMKPRKTYKYRLCNVGFKSTLNFRIQNHMMKLVEMEGSHVLQNDYDSLDVHVGQCFSVL  266

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++  KDYY+V S+RF K+E STV +I Y  G+ + AS ELP +P     G AWS+NQ
Sbjct  267   VTANQAAKDYYMVASTRFLKKELSTVGVIRY-EGSNVQASTELPKAP----VGWAWSLNQ  321

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITR+IKLVN+KS VDGKLR+ LNGVSH++ +TP
Sbjct  322   FRSFRWNLTASAARPNPQGSYHYGKINITRSIKLVNTKSMVDGKLRFGLNGVSHVDPETP  381

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYF ++EKVFKY+++ D P      +T+ PNV+N TFR FVEI+FENHEK++Q++H
Sbjct  382   LKLAEYFQMAEKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVEIIFENHEKSMQSFH  441

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA E G+W+PE RKNYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+R++
Sbjct  442   LDGYSFFAVASEPGKWTPESRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRAE  501

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
              WER YLG+QLY SV SPE+SLRDE+N+P    LCG+VKG+ +P  Y+
Sbjct  502   NWERRYLGEQLYVSVQSPEKSLRDEYNIPLNTNLCGIVKGLPLPTVYT  549



>gb|KFK35574.1| hypothetical protein AALP_AA4G008500 [Arabis alpina]
Length=555

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/410 (65%), Positives = 326/410 (80%), Gaps = 6/410 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I+DWY K H  LKK LDSG TI RPDG++INGK GK      PL
Sbjct  150   LIPVPYADPEDDYTVLINDWYTKSHTQLKKFLDSGRTIGRPDGILINGKAGKGDGSDQPL  209

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FT++ GKTYR R+CNVG+++S+NFR + H M LVEMEGSH +QN YDSLD+HVGQC  V+
Sbjct  210   FTLKQGKTYRVRICNVGLKSSLNFRIQNHKMRLVEMEGSHVLQNDYDSLDVHVGQCYGVI  269

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+EPKDYY+  S+RF K   ST  ++ Y  G G  AS +LP +P     G AWS+NQ
Sbjct  270   VTADQEPKDYYMAASTRFLKNALSTTGLLRYEGGKG-PASSQLPAAP----VGWAWSLNQ  324

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYALNGVSH +++TP
Sbjct  325   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGVSHTDSETP  384

Query  722   LKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEYFG+++KVFKYDI+ D P PE  +K+ + PNV+N T R F+E++FENHEK++Q++
Sbjct  385   LKLAEYFGVADKVFKYDIISDNPTPEQIKKIKMEPNVLNITHRTFIEVIFENHEKSVQSW  444

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVA+E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS
Sbjct  445   HLDGYSFFAVAVEPGVWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRS  504

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1228
             +  ER YLGQQLY SVLSPE+SLRDE+N+P+    CGLVKG     PY+G
Sbjct  505   ENSERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGKPKVNPYAG  554



>ref|XP_010093149.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB53608.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=550

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/410 (68%), Positives = 331/410 (81%), Gaps = 9/410 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I DWY K HKTLK  LDSG ++ RPDGV+INGK G   DK  PL
Sbjct  147   LIPVPYADPEDDYTVLIGDWYVKSHKTLKNFLDSGRSLGRPDGVLINGKSGN--DK-KPL  203

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG++ S+NFR + H M LVEMEGSHT+QN Y+SLD+HVGQC SVL
Sbjct  204   FTMKPGKTYKYRICNVGLKDSLNFRIQDHPMKLVEMEGSHTVQNTYESLDVHVGQCFSVL  263

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADK PK+YY+V S+RF K   +  AII Y NG   +AS +   + PE   G AWS+NQ
Sbjct  264   VTADKAPKEYYMVASTRFTKTVLTGKAIIRYTNGRKGSASLK---NIPEAPVGWAWSLNQ  320

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+I ITRTIK+VNS S V GKLRY +NGVSH+N  TP
Sbjct  321   FRSFRWNLTASAARPNPQGSYHYGKIPITRTIKIVNSASRVKGKLRYGINGVSHVNPVTP  380

Query  722   LKLAEYFGISEKVFKYDIMGDTPPE--NGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             LKLAEY+G+++KVFKYD++ D PP+  +GE VTLAPNVVN TFRNFVEI+FENHEK++Q+
Sbjct  381   LKLAEYYGVADKVFKYDLIKDEPPKKLSGE-VTLAPNVVNQTFRNFVEIIFENHEKSLQS  439

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HL G+SFFAV+IE GRW PEKRKNYNL+DAVSRH+IQVYP S+AAV+ T DNAGMWNLR
Sbjct  440   WHLAGYSFFAVSIEPGRWRPEKRKNYNLLDAVSRHTIQVYPKSYAAVLLTFDNAGMWNLR  499

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             S++ E  YLGQQLY SVLSP RSLRDE+N+PD   LCG+VK +  P PY+
Sbjct  500   SELTENRYLGQQLYISVLSPARSLRDEYNMPDNALLCGIVKDLPKPHPYT  549



>dbj|BAL41449.1| SKU5 similar 1 [Linum grandiflorum]
Length=552

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/409 (64%), Positives = 329/409 (80%), Gaps = 6/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P  ++ V I+DW++K H  L+ +LDSG T+ARP+GV++NGK+ K   K +PL
Sbjct  148   LIPVPYADPEADYTVIINDWFSKTHSALRTMLDSGRTLARPEGVLLNGKNAKGDGKDEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+AGKTY+YR+CN G++TS+NFR +GHTM LVEMEGSH +QN+YDSLD+HVG C++VL
Sbjct  208   FTMKAGKTYKYRICNAGLKTSLNFRIQGHTMKLVEMEGSHVVQNMYDSLDVHVGGCMAVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD++PKDYY++ S+RF K   +   II Y  G G  A  E+P +P     G AWS+NQ
Sbjct  268   VTADQDPKDYYMIASTRFTKTVTTGKGIIRYEGGKG-PADTEIPAAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYGQINITRT++L N+    +GKLRYA NG+SH++  TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGQINITRTLRLANTAGRSNGKLRYAFNGISHVDPPTP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGE-KVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEY+G+++KVFKYD M DTPP + +  + + PNV+N TFRNFVEI+FENHEK+IQ+Y
Sbjct  383   LKLAEYYGVADKVFKYDTMKDTPPSSDKVDIVMQPNVMNFTFRNFVEIIFENHEKSIQSY  442

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG++FFAV IE G WSPEKRKNYNL+DAVSR +IQVYP SWAA++ T DNAGMWN+RS
Sbjct  443   HLDGYAFFAVGIEPGIWSPEKRKNYNLLDAVSRTTIQVYPKSWAAILLTFDNAGMWNVRS  502

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             +MWER YLGQQ Y S LSP RSLRDE++LP+   LCG+VK M  P PY+
Sbjct  503   EMWERTYLGQQFYVSTLSPGRSLRDEYSLPEGTLLCGIVKDMPKPAPYT  551



>ref|XP_009384956.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=550

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/409 (64%), Positives = 324/409 (79%), Gaps = 7/409 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGK--VGDKID  175
             LIPVPFD PAD++ V I DWY K HK L ++LD+G +I  P GV+ING  GK   G    
Sbjct  146   LIPVPFDDPADDYTVLIGDWYTKSHKVLAQLLDAGRSIGNPAGVIINGSPGKDAAGKDDA  205

Query  176   PLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLS  355
             PLFTMEAGKTYRYR+CNVG++ S+NFR + H M LVEM+GSHT+QN Y SLD+HVGQC S
Sbjct  206   PLFTMEAGKTYRYRICNVGLKVSLNFRIQSHLMKLVEMDGSHTVQNDYKSLDIHVGQCFS  265

Query  356   VLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSI  535
             VLVTA++EPKDYY+V S+RF K   +   II YA G+ +  SPELP  P     G AWS 
Sbjct  266   VLVTANQEPKDYYMVASTRFTKYMRTATGIIRYA-GSSVPPSPELPAGP----VGWAWSF  320

Query  536   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTD  715
             NQ+RSFRWNLTASAARPNPQGSYHYG INITRTIKL +S   V+GK R+ALNG SH+ + 
Sbjct  321   NQWRSFRWNLTASAARPNPQGSYHYGSINITRTIKLASSVGLVNGKRRFALNGASHVESP  380

Query  716   TPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             TPLKLAEY+G+++KVFKYD +GD PPE+   +T+APNV+NATFR+++EI+ EN E++IQ+
Sbjct  381   TPLKLAEYYGVADKVFKYDTIGDEPPESSATITVAPNVLNATFRDYIEIILENPERSIQS  440

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             YHLDG+SFFAV +  G+W+P  R++YNL+DAVSRH+IQVYP SW+A+M T DNAGMW+LR
Sbjct  441   YHLDGYSFFAVGMGHGKWTPASRRSYNLLDAVSRHTIQVYPRSWSAIMLTFDNAGMWSLR  500

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             S++WER YLGQQLY SV+SP RSLRDE+N+PD   LCG+V  +  PPPY
Sbjct  501   SELWERHYLGQQLYISVVSPARSLRDEYNIPDNTLLCGVVASLPKPPPY  549



>ref|XP_009384957.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=556

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/409 (64%), Positives = 324/409 (79%), Gaps = 7/409 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGK--VGDKID  175
             LIPVPFD PAD++ V I DWY K HK L ++LD+G +I  P GV+ING  GK   G    
Sbjct  152   LIPVPFDDPADDYTVLIGDWYTKSHKVLAQLLDAGRSIGNPAGVIINGSPGKDAAGKDDA  211

Query  176   PLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLS  355
             PLFTMEAGKTYRYR+CNVG++ S+NFR + H M LVEM+GSHT+QN Y SLD+HVGQC S
Sbjct  212   PLFTMEAGKTYRYRICNVGLKVSLNFRIQSHLMKLVEMDGSHTVQNDYKSLDIHVGQCFS  271

Query  356   VLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSI  535
             VLVTA++EPKDYY+V S+RF K   +   II YA G+ +  SPELP  P     G AWS 
Sbjct  272   VLVTANQEPKDYYMVASTRFTKYMRTATGIIRYA-GSSVPPSPELPAGP----VGWAWSF  326

Query  536   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTD  715
             NQ+RSFRWNLTASAARPNPQGSYHYG INITRTIKL +S   V+GK R+ALNG SH+ + 
Sbjct  327   NQWRSFRWNLTASAARPNPQGSYHYGSINITRTIKLASSVGLVNGKRRFALNGASHVESP  386

Query  716   TPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             TPLKLAEY+G+++KVFKYD +GD PPE+   +T+APNV+NATFR+++EI+ EN E++IQ+
Sbjct  387   TPLKLAEYYGVADKVFKYDTIGDEPPESSATITVAPNVLNATFRDYIEIILENPERSIQS  446

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             YHLDG+SFFAV +  G+W+P  R++YNL+DAVSRH+IQVYP SW+A+M T DNAGMW+LR
Sbjct  447   YHLDGYSFFAVGMGHGKWTPASRRSYNLLDAVSRHTIQVYPRSWSAIMLTFDNAGMWSLR  506

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             S++WER YLGQQLY SV+SP RSLRDE+N+PD   LCG+V  +  PPPY
Sbjct  507   SELWERHYLGQQLYISVVSPARSLRDEYNIPDNTLLCGVVASLPKPPPY  555



>ref|XP_010534841.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=549

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/408 (65%), Positives = 323/408 (79%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V ISDWY K H +LK +LDSG  +  PDGV+INGK  K+  K  PL
Sbjct  147   LIPVPYPDPEDDYTVLISDWYTKSHTSLKNLLDSGRALGSPDGVLINGKSAKMDGKDQPL  206

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG ++++NFR + H M LVEMEGSH +QN YDSLD+HVGQC +VL
Sbjct  207   FTMKLGKTYKYRICNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVL  266

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+   DYY+V SSRF K++ S   +I Y  G G  ASP LP +P     G AWS+NQ
Sbjct  267   VTADQTATDYYMVASSRFLKKQLSGTGLIRYEGGQG-QASPVLPKAP----VGWAWSLNQ  321

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVNS+  VD KLR+  NGVSHI+T+TP
Sbjct  322   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNSQKVVDRKLRFGFNGVSHIDTETP  381

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYF ++EKVFKY+++ D P      +T+ PNV+N TFR FVE++FENHEK++Q+YH
Sbjct  382   LKLAEYFQMAEKVFKYNVIKDEPAGKITGLTVEPNVLNITFRTFVEVIFENHEKSMQSYH  441

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA E GRWSP KR+NYNL+DAVSRH++QVYPNSW+A++ T DNAGMWN+RS+
Sbjct  442   LDGYSFFAVATEPGRWSPAKRENYNLLDAVSRHTVQVYPNSWSAILLTFDNAGMWNIRSE  501

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
              WER YLGQQLY SVLSPE+SLRDE+N+P    LCG+VK +  P  YS
Sbjct  502   NWERRYLGQQLYVSVLSPEKSLRDEYNIPLNAGLCGIVKDLPKPSIYS  549



>emb|CDX97352.1| BnaA02g21430D [Brassica napus]
Length=488

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/410 (64%), Positives = 325/410 (79%), Gaps = 6/410 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I+DWY K H  LKK LDSG TI RPDG++INGK GK      PL
Sbjct  83    LIPVPYADPEDDYTVLINDWYTKSHTQLKKFLDSGRTIGRPDGILINGKAGKGDGSDQPL  142

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FT++ GKTYR R+CNVG++TS+NFR + H M LVEMEGSH +QN YDSLD+HVGQC  V+
Sbjct  143   FTLKQGKTYRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVI  202

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++EPKDYY+V S+RF K+  +T  ++ Y  G G+ ASP+LP +P     G AWS+NQ
Sbjct  203   VTANQEPKDYYMVASTRFLKKALATTGLLRYEGGKGL-ASPQLPAAP----VGWAWSLNQ  257

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVN++  +DGKLRYAL+GVSH + +TP
Sbjct  258   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLRYALSGVSHTDPETP  317

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEK-VTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEYFG+++KVFKYDI+ D P  +  K + + PNV+N T R F+E+VFENHEK++Q++
Sbjct  318   LKLAEYFGVADKVFKYDIISDNPTSDQIKNIKIEPNVLNITHRTFIEVVFENHEKSVQSW  377

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVA+E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS
Sbjct  378   HLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRS  437

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1228
             +  ER YLGQQLY SVLSPE+SLR E+N+P+    CGLVK      PY+G
Sbjct  438   ENSERRYLGQQLYASVLSPEKSLRGEYNMPESSLQCGLVKDKPKINPYAG  487



>ref|NP_175953.1| protein SKU5 similar 12 [Arabidopsis thaliana]
 gb|AAK32912.1|AF367325_1 At1g55570/T5A14_1 [Arabidopsis thaliana]
 gb|AAD10638.1| putative pollen specific protein [Arabidopsis thaliana]
 gb|AAM91432.1| At1g55570/T5A14_1 [Arabidopsis thaliana]
 gb|AEE33267.1| protein SKU5 similar 12 [Arabidopsis thaliana]
Length=555

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/410 (63%), Positives = 324/410 (79%), Gaps = 6/410 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ + I+DWY K H  LKK LDSG TI RPDG++INGK GK      PL
Sbjct  150   LIPVPYADPEDDYTILINDWYTKSHTQLKKFLDSGRTIGRPDGILINGKSGKTDGSDKPL  209

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FT++ GKTYR R+CNVG++ S+NFR + H M LVEMEGSH +QN YDSLD+HVGQC  V+
Sbjct  210   FTLKPGKTYRVRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVI  269

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+EPKDYY++ S+RF K+  +T  ++ Y  G G  AS +LP +P     G AWS+NQ
Sbjct  270   VTADQEPKDYYMIASTRFLKKPLTTTGLLRYEGGKG-PASSQLPAAP----VGWAWSLNQ  324

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             +RSFRWNLTASAARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYAL+GVSH + +TP
Sbjct  325   YRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALSGVSHTDPETP  384

Query  722   LKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEYFG+++KVFKYD + D P P+  + + + PNV+N T R F+E+VFENHE+++Q++
Sbjct  385   LKLAEYFGVADKVFKYDTISDNPNPDQIKNIKIEPNVLNITHRTFIEVVFENHERSVQSW  444

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVA+E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS
Sbjct  445   HLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRS  504

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1228
             +  ER YLGQQLY SVLSPE+SLRDE+N+P+    CGLVKG     PY+G
Sbjct  505   ENAERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGKPKVNPYAG  554



>ref|XP_010500423.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=554

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/411 (65%), Positives = 323/411 (79%), Gaps = 8/411 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID-P  178
             LIPVP+  P D++ V I DWY K H  LKK LD G T+ RPDG++INGK GK GD  D P
Sbjct  149   LIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILINGKSGK-GDGSDAP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFT++ GKTYR R+CNVGM+TS+NFR + H + LVEMEGSH +QN YDSLD+HVGQC   
Sbjct  208   LFTLKPGKTYRVRICNVGMKTSLNFRIQNHKLKLVEMEGSHVLQNDYDSLDVHVGQCYGT  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             ++TAD+E KDYY+V SSRF K   +T  ++ Y  G G  AS +LP  P     G AWS+N
Sbjct  268   ILTADQEAKDYYMVASSRFLKSVITTTGLLRYEGGKG-PASSQLPAGP----VGWAWSLN  322

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYALNGVSH + +T
Sbjct  323   QFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGVSHTDPET  382

Query  719   PLKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             PLKLAEYFGI++KVFKYD + D P PE  + + + PNV+N T R F+E+VFENHEK++Q+
Sbjct  383   PLKLAEYFGIADKVFKYDTITDNPTPEQIKTIKIEPNVLNITHRTFIEVVFENHEKSVQS  442

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG+SFFAVA+E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+R
Sbjct  443   WHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIR  502

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1228
             S+  ER YLGQQLY SVLSPE+SLRDE+N+P+    CGLVKG   P PY+G
Sbjct  503   SENTERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGTPKPNPYAG  553



>ref|NP_187947.1| protein SKU5-like 11 [Arabidopsis thaliana]
 dbj|BAB01744.1| l-ascorbate oxidase; pectinesterase-like protein; pollen-specific 
protein-like [Arabidopsis thaliana]
 gb|AAO42003.1| putative pectinesterase (pectin methylesterase) family protein 
[Arabidopsis thaliana]
 gb|AAO50591.1| putative pectinesterase (pectin methylesterase) family protein 
[Arabidopsis thaliana]
 gb|AEE75341.1| protein SKU5-like 11 [Arabidopsis thaliana]
Length=554

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/411 (64%), Positives = 325/411 (79%), Gaps = 8/411 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID-P  178
             LIPVP+  P D++ V I DWY K H  LKK LDSG T+ RPDG++INGK GK GD  D P
Sbjct  149   LIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDSGRTLGRPDGILINGKSGK-GDGSDAP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFT++ GKTYR R+CNVG++TS+NFR + H + LVEMEGSH +QN YDSLD+HVGQC   
Sbjct  208   LFTLKPGKTYRVRICNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDYDSLDVHVGQCYGT  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             ++TA++E KDYY+V SSRF K   +T  ++ Y  G G  AS +LPP P     G AWS+N
Sbjct  268   ILTANQEAKDYYMVASSRFLKSVITTTGLLRYEGGKG-PASSQLPPGP----VGWAWSLN  322

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYALNGVSH + +T
Sbjct  323   QFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGVSHTDPET  382

Query  719   PLKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             PLKLAEYFG+++KVFKYD + D P PE  + + + PNV+N T R F+E+VFENHEK++Q+
Sbjct  383   PLKLAEYFGVADKVFKYDSITDNPTPEQIKSIKIVPNVLNITHRTFIEVVFENHEKSVQS  442

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG+SFFAVA+E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+R
Sbjct  443   WHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNVR  502

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1228
             S+  ER YLGQQLY SVLSPE+SLRDE+N+P+    CGLVKG   P PY+G
Sbjct  503   SENSERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGTPKPNPYAG  553



>ref|XP_010552291.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=549

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/408 (63%), Positives = 328/408 (80%), Gaps = 5/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I+DWY K H ++K +LDSG  +  PDGV+INGK  K+  K  PL
Sbjct  147   LIPVPYADPEDDYTVLINDWYTKSHTSIKNLLDSGRALGSPDGVLINGKSAKMDGKDQPL  206

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY++R+CNVG ++++NFR + H M LVEMEGSH +QN YDSLD+HVGQC +VL
Sbjct  207   FTMKPGKTYKFRICNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVL  266

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+  KDYY+V S+RF K+E ++  ++ Y  G+   AS  LP +P     G AWS+NQ
Sbjct  267   VTADQAAKDYYMVASTRFLKKEMTSTGVLRYVGGSA-QASTVLPKAP----VGWAWSLNQ  321

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVNS+  V+GKL++ LNGVSHI+T+TP
Sbjct  322   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNSQQVVNGKLKFGLNGVSHIDTETP  381

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYF ++EKVFKY+++ D P    +++T+ PNV+N TFR FVE++FEN EK++Q+YH
Sbjct  382   LKLAEYFQMAEKVFKYNVIKDEPGAMIKQLTVEPNVLNITFRTFVEVIFENREKSMQSYH  441

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA E GRW+P KR+NYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+
Sbjct  442   LDGYSFFAVATEPGRWTPAKRENYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSE  501

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
              WER YLGQQ+Y SVLSPE+SLRDE+N+P    LCG+VKG+S P  YS
Sbjct  502   NWERRYLGQQMYVSVLSPEKSLRDEYNIPLNAGLCGIVKGLSKPIIYS  549



>ref|XP_006306349.1| hypothetical protein CARUB_v10012235mg [Capsella rubella]
 gb|EOA39247.1| hypothetical protein CARUB_v10012235mg [Capsella rubella]
Length=555

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/410 (63%), Positives = 325/410 (79%), Gaps = 6/410 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I+DWY K H  LKK LDSG T+ RPDG++INGK GK      PL
Sbjct  150   LIPVPYADPEDDYTVLINDWYTKSHTQLKKFLDSGRTLGRPDGILINGKSGKTDGSDKPL  209

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FT++ GKTYR R+CNVG++TS+NFR + H M LVEMEGSH +QN YDSLD+HVGQC  V+
Sbjct  210   FTLKPGKTYRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVI  269

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++E KDYY+V S+RF K+  +T  ++ Y  G G  AS +LP +P     G AWS+NQ
Sbjct  270   VTANQEAKDYYMVASTRFLKKPLTTTGLLRYEGGKG-PASSQLPAAP----VGWAWSLNQ  324

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYA++GVSH + +TP
Sbjct  325   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYAMSGVSHTDPETP  384

Query  722   LKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEYFG+++KVFKY+I+ D P PE  + + + PNV+N T R F+E+VFENHEK++Q++
Sbjct  385   LKLAEYFGVADKVFKYNIITDNPNPEQIKTIKIEPNVLNITHRTFIEVVFENHEKSVQSW  444

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVA+E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS
Sbjct  445   HLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRS  504

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1228
             +  ER YLGQQLY SVLSPE+SLRDE+N+P+    CGLVKG     PY+G
Sbjct  505   ENSERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGKPKVNPYAG  554



>ref|XP_010501175.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=555

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/410 (63%), Positives = 324/410 (79%), Gaps = 6/410 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I+DWY K H  LKK LDSG T+ RPDG++INGK GK      PL
Sbjct  150   LIPVPYADPEDDYTVLINDWYTKSHTQLKKFLDSGRTLGRPDGILINGKSGKTDGSDKPL  209

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FT++ GKTYR R+CNVG++ S+NFR + H M LVEMEGSH +QN YDSLD+HVGQC  V+
Sbjct  210   FTLKPGKTYRVRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDYDSLDIHVGQCFGVI  269

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++EPKDYY+V S+RF K+  +T  ++ Y  G G  AS +LP +P     G AWS+NQ
Sbjct  270   VTANQEPKDYYMVASTRFLKKPLTTTGLLLYEGGKG-PASSQLPAAP----VGWAWSLNQ  324

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYAL+GVSH + +TP
Sbjct  325   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALSGVSHTDPETP  384

Query  722   LKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEYFG+++KVFKYD + D P P+  + + + PNV+N T R F+E+VFENHEK++Q++
Sbjct  385   LKLAEYFGVTDKVFKYDSISDNPNPDQIKTIKIEPNVLNITHRTFIEVVFENHEKSVQSW  444

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVA+E G W+PEKRKNYNL+DAVSRH++QV+P  WAA++ T DN GMWN+RS
Sbjct  445   HLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVFPKCWAAILLTFDNCGMWNIRS  504

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1228
             +  ER YLGQQLY SVLSPE+SLRDE+NLP+    CGLVKG     PY+G
Sbjct  505   ENSERRYLGQQLYVSVLSPEKSLRDEYNLPESSLQCGLVKGKPKINPYAG  554



>ref|XP_009420229.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=551

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/409 (64%), Positives = 323/409 (79%), Gaps = 7/409 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGK--VGDKID  175
             LIPVPFD PAD++ V I DWY K HK L  ILD+G +I  P GV++NG  GK   G    
Sbjct  147   LIPVPFDDPADDYTVLIGDWYTKSHKVLAGILDAGRSIGNPAGVLMNGLSGKDATGKDDP  206

Query  176   PLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLS  355
             PLFTMEAGKTYRYR+CNVG++ S+NFR +GH M LVEM+GSHT+QN Y+SLD+HVGQCLS
Sbjct  207   PLFTMEAGKTYRYRICNVGLKLSLNFRIQGHLMKLVEMDGSHTVQNDYESLDVHVGQCLS  266

Query  356   VLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSI  535
             VLVTA++EPKDYY+V S+RF K   +   ++ YA G+ +  SPELP  P     G AWS+
Sbjct  267   VLVTANQEPKDYYMVASTRFTKYMRTATGVVRYA-GSKVPPSPELPAGP----VGWAWSL  321

Query  536   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTD  715
             NQ+RS RWNLTASAARPNPQGSYHYG INITRTIKL +S   V+GK R+ LNGVSH+++ 
Sbjct  322   NQWRSLRWNLTASAARPNPQGSYHYGSINITRTIKLASSVGLVNGKRRFGLNGVSHVDSP  381

Query  716   TPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             TPLKLAEY+GIS+KVFKYD +GD PP +G  +T+APNV+NAT+R+++EI+ EN E++IQ 
Sbjct  382   TPLKLAEYYGISDKVFKYDSIGDEPPASGASITVAPNVLNATYRDYIEIILENPERSIQC  441

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             YHLDG+SFFA  +  G+W+P  R+ YNL+DAVSRH+IQVYP SW+A+M T DNAGMW+LR
Sbjct  442   YHLDGYSFFAAGMGHGKWTPASRRTYNLLDAVSRHTIQVYPRSWSAIMLTFDNAGMWSLR  501

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             S++WER YLGQQLY SV+SP RSLRDE+N+PD   LCG V G+  PP Y
Sbjct  502   SELWERHYLGQQLYISVVSPARSLRDEYNMPDNTLLCGDVVGLPKPPSY  550



>ref|XP_009417950.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=560

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/409 (65%), Positives = 321/409 (78%), Gaps = 7/409 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGK--VGDKID  175
             LIPVPF  PAD++ V I DWY K HK L K+LDSG TI RP GV+ING+ GK   G    
Sbjct  156   LIPVPFADPADDYTVLIGDWYTKSHKILAKLLDSGRTIGRPAGVLINGRSGKDSTGKDDP  215

Query  176   PLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLS  355
             PLFTMEAGKTYRYR+CNVGM+ ++NFR + H+M LVEM+GSHT+QNVY+SLD+HVGQCLS
Sbjct  216   PLFTMEAGKTYRYRICNVGMKVTLNFRIQSHSMKLVEMDGSHTMQNVYESLDIHVGQCLS  275

Query  356   VLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSI  535
              LV A + PKDYY+V SSRF K   +   +I YA G+    S +LP +P     G AWS 
Sbjct  276   ALVEATQAPKDYYMVASSRFTKYTLTASGLIRYA-GSNTPPSQDLPAAP----VGWAWSF  330

Query  536   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTD  715
             NQ+RSFRWNLTASAARPNPQGSYHYG I+ITRTIKLVNS  +V+GK RYALN VSH +T 
Sbjct  331   NQWRSFRWNLTASAARPNPQGSYHYGSIDITRTIKLVNSVGHVNGKRRYALNAVSHQDTA  390

Query  716   TPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             TPLKLAEYFGI++KVFKY+I+GD PP +   + +APNV+NATFRNF+EI+FEN E+++Q 
Sbjct  391   TPLKLAEYFGIADKVFKYNIIGDDPPASTAPIKIAPNVMNATFRNFIEIIFENPERSMQA  450

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             YHLDG+SFF V +  G+W+P+ RK YNL+D VSRH+IQVY  SW+A+M T DNAGMWNLR
Sbjct  451   YHLDGYSFFPVGMGHGKWTPQSRKTYNLLDTVSRHTIQVYQRSWSAIMLTFDNAGMWNLR  510

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             S++WER YLGQQLY SVLSP RSLRDE+N+P+K  +CG V  +  PP Y
Sbjct  511   SELWERRYLGQQLYISVLSPARSLRDEYNMPEKALICGDVVNLPRPPSY  559



>ref|XP_010465172.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
 ref|XP_010487091.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Camelina sativa]
 ref|XP_010487092.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Camelina sativa]
Length=554

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/411 (64%), Positives = 323/411 (79%), Gaps = 8/411 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID-P  178
             LIPVP+  P D++ V I DWY K H  LKK LD G T+ RPDG++INGK GK GD  D P
Sbjct  149   LIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILINGKSGK-GDGSDAP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFT++ GKTYR R+CNVG++TS+NFR + H + LVEMEGSH +QN YDSLD+HVGQC   
Sbjct  208   LFTLKPGKTYRVRICNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDYDSLDVHVGQCYGT  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             ++TAD+E KDYY+V SSRF K   +T  ++ Y  G G  AS +LP  P     G AWS+N
Sbjct  268   ILTADQEAKDYYMVASSRFLKSVITTTGLLRYEGGKG-PASSQLPAGP----VGWAWSLN  322

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYALNGVSH + +T
Sbjct  323   QFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGVSHTDPET  382

Query  719   PLKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             PLKLAEYFGI++KVFKYD + D P PE  + + + PNV+N T R F+E+VFENHEK++Q+
Sbjct  383   PLKLAEYFGIADKVFKYDTITDNPTPEQIKTIKIEPNVLNITHRTFIEVVFENHEKSVQS  442

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG+SFFAVA+E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+R
Sbjct  443   WHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIR  502

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1228
             S+  ER YLGQQLY SVLSPE+SLRDE+N+P+    CGLVKG   P PY+G
Sbjct  503   SENTERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGTPKPNPYAG  553



>ref|XP_010462412.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=555

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/410 (63%), Positives = 324/410 (79%), Gaps = 6/410 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I+DWY K H  LKK LDSG T+ RPDG++INGK GK      PL
Sbjct  150   LIPVPYADPEDDYTVLINDWYTKSHTQLKKFLDSGRTLGRPDGILINGKSGKTDGSDKPL  209

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FT++ GKTYR R+CNVG++ S+NFR + H M LVEMEGSH +QN YDSLD+HVGQC  V+
Sbjct  210   FTLKPGKTYRVRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDYDSLDIHVGQCFGVI  269

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++EPKDYY+V S+RF K+  +T  ++ Y  G G  AS +LP +P     G AWS+NQ
Sbjct  270   VTANQEPKDYYMVASTRFLKKPLTTTGLLRYEGGKG-PASSQLPAAP----VGWAWSLNQ  324

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYAL+GVSH + +TP
Sbjct  325   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALSGVSHTDPETP  384

Query  722   LKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEYFG+++KVFKYD + D P P+  + + + PNV+N T R F+E+VFENHEK++Q++
Sbjct  385   LKLAEYFGVTDKVFKYDSISDNPNPDQIKTIKIEPNVLNITHRTFIEVVFENHEKSVQSW  444

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVA+E G W+PEKRKNYNL+DAVSRH++QV+P  WAA++ T DN GMWN+RS
Sbjct  445   HLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVFPKCWAAILLTFDNCGMWNIRS  504

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1228
             +  ER YLGQQLY SVLSPE+SLRDE+N+P+    CGLVKG     PY+G
Sbjct  505   ENSERRYLGQQLYASVLSPEKSLRDEYNMPESSLQCGLVKGKPKINPYAG  554



>gb|KFK38671.1| hypothetical protein AALP_AA3G145000 [Arabis alpina]
Length=554

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/411 (64%), Positives = 324/411 (79%), Gaps = 8/411 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID-P  178
             LIPVP+  P D++ V I DWY K H  LKK LD G T+ RPDG++INGK GK GD  D P
Sbjct  149   LIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILINGKSGK-GDGSDAP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFT++ GKTYR R+CNVG++TS+NFR + H + LVEMEGSH +QN YDSLD+HVGQC   
Sbjct  208   LFTLKPGKTYRLRICNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDYDSLDVHVGQCYGT  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             +++AD++ KDYY+V SSRF K   +T  ++ Y  G G  AS +LPP P     G AWS+N
Sbjct  268   ILSADQQAKDYYMVASSRFLKSVITTTGLLRYEGGKG-PASSQLPPGP----VGWAWSLN  322

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRS+RWNLTASAARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYALNG+SH + +T
Sbjct  323   QFRSYRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGISHTDPET  382

Query  719   PLKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             PLKLAEYFGI +KVFKYD + D P PE  + + + PNV+N T R FVE+VFENHEK++Q+
Sbjct  383   PLKLAEYFGIGDKVFKYDSITDNPTPEQIKSIKILPNVLNITHRTFVEVVFENHEKSVQS  442

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG+SFFAVA+E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+R
Sbjct  443   WHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIR  502

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1228
             S+  ER YLGQQ+Y SVLSPE+SLRDE+N+P+    CGLVKGM  P PY+G
Sbjct  503   SENSERRYLGQQMYASVLSPEKSLRDEYNMPETSLQCGLVKGMPKPNPYAG  553



>emb|CDY23596.1| BnaC05g39980D [Brassica napus]
Length=555

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/412 (65%), Positives = 324/412 (79%), Gaps = 9/412 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID-P  178
             LIPVP+  P D++ V I DWY K H  LKK LD G TI RPDG+VINGK GK GD  D P
Sbjct  149   LIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTIGRPDGIVINGKSGK-GDGSDAP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFT++ GKTYR R+CNVG++TS+NFR + H M LVEMEGSH +QN YDSLD+HVGQC   
Sbjct  208   LFTLKPGKTYRVRICNVGLKTSINFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGT  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             +VTA++EPKDYY+V SSRF K   +T  ++ Y  G G  AS +LP  P     G AWS+N
Sbjct  268   IVTANQEPKDYYMVASSRFLKTVITTTGLLRYEGGKG-PASSQLPAGP----VGWAWSLN  322

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVN++  VDGKLR+ALNGVSH + +T
Sbjct  323   QFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRFALNGVSHTDPET  382

Query  719   PLKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             PLKLAEYFGIS+KVFKYD + D P PE  + + + PNV+N T RNF+E+VFENHEK++Q+
Sbjct  383   PLKLAEYFGISDKVFKYDTITDDPTPEQIKNIKIEPNVLNITHRNFIEVVFENHEKSVQS  442

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG+SFF+VA+E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+R
Sbjct  443   WHLDGYSFFSVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNVR  502

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMP-PPYSG  1228
             S+  ER YLGQQLY SVLSPE+SLRDE+N+P+    CGLVK    P  PY+G
Sbjct  503   SENTERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKNTPKPVNPYAG  554



>ref|XP_002891844.1| hypothetical protein ARALYDRAFT_892557 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68103.1| hypothetical protein ARALYDRAFT_892557 [Arabidopsis lyrata subsp. 
lyrata]
Length=555

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/410 (63%), Positives = 323/410 (79%), Gaps = 6/410 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I+DWY K H  LKK LDSG TI RPDG++INGK GK      PL
Sbjct  150   LIPVPYADPEDDYTVLINDWYTKSHTQLKKFLDSGRTIGRPDGILINGKSGKTDGSDKPL  209

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FT++ GKTYR R+CNVG++ S+NFR + H M LVEMEGSH +QN YDSLD+HVGQC  V+
Sbjct  210   FTLKPGKTYRVRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVI  269

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+E KDYY+V S+RF K+  +T  ++ Y  G G  AS +LP +P     G AWS+NQ
Sbjct  270   VTADQELKDYYMVASTRFLKKPLTTTGLLRYEGGKG-PASSQLPAAP----VGWAWSLNQ  324

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYAL+GVSH + +TP
Sbjct  325   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALSGVSHTDPETP  384

Query  722   LKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEYFG+++KVFKYD + D P P+  + + + PNV+N T R F+E+VFENHE+++Q++
Sbjct  385   LKLAEYFGVADKVFKYDTISDNPNPDQIKNIKIEPNVLNITHRTFIEVVFENHERSVQSW  444

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVA+E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS
Sbjct  445   HLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRS  504

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1228
             +  ER YLGQQLY SVLSPE+SLRDE+N+P+    CGLVKG     PY+G
Sbjct  505   ENSERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGKPKVNPYAG  554



>ref|XP_007208285.1| hypothetical protein PRUPE_ppa003733mg [Prunus persica]
 gb|EMJ09484.1| hypothetical protein PRUPE_ppa003733mg [Prunus persica]
Length=552

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/409 (64%), Positives = 325/409 (79%), Gaps = 6/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I DWY K H  LKK+LDSG ++ARPDGV+INGK  K   K +PL
Sbjct  148   LIPVPYADPEDDYTVLIGDWYTKSHTQLKKLLDSGRSMARPDGVLINGKSSKGDGKDEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             F M+ GKTY+YR+CNVG++ S+NFR +GH+M LVE+EGSHT+QN YDS+D+H+GQC SVL
Sbjct  208   FVMKPGKTYKYRICNVGLKNSLNFRIQGHSMKLVELEGSHTVQNTYDSMDVHLGQCFSVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADK+PKDYY+V S+RF K   +   II Y NG G  ASPELP +P     G AWS+NQ
Sbjct  268   VTADKDPKDYYMVASTRFTKSVLTGKGIIRYENGKG-PASPELPKAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INI+RTIKLVNS S VDGKLRYA+NG+SH++++TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGKINISRTIKLVNSASKVDGKLRYAINGISHVDSETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPEN-GEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLA+Y+ + +KVFK D M DTPP    +K+T+  NVVN T ++FVEI+FEN EK++QT+
Sbjct  383   LKLADYYKVWDKVFKPDTMKDTPPATAADKITMVTNVVNITIKDFVEIIFENPEKSLQTW  442

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFF+VA E G W+P KR NYNL+DAVSR+S+QV+P SWAA+M T DNAGMWN+RS
Sbjct  443   HLDGYSFFSVASEPGTWTPAKRSNYNLLDAVSRYSVQVFPKSWAAIMLTFDNAGMWNIRS  502

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             D  ER YLGQQ Y  V +  RSLR+E+N+PD   +CG+VK M  P PYS
Sbjct  503   DQPERRYLGQQFYVDVENIARSLRNEYNMPDNALVCGIVKDMPKPAPYS  551



>ref|XP_003607816.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES90013.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=545

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/404 (66%), Positives = 319/404 (79%), Gaps = 9/404 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  PADE+ V + DWY K H  L+K LDSG ++ RPDGV I GK     +  +PL
Sbjct  146   LIPVPYADPADEYWVLMGDWYGKSHTQLQKFLDSGRSMGRPDGVHIMGK----SNSAEPL  201

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             + ME GKTY+YR+CNVG++ S+NFR + H M LVEMEGSHT+QNVYDSLD+HVGQC SVL
Sbjct  202   YKMEPGKTYKYRLCNVGLKDSLNFRIQDHPMKLVEMEGSHTVQNVYDSLDVHVGQCFSVL  261

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADKEPK Y +V S+RF K   +T A+ISY NGNG  ASP LPP+P     G AWS+NQ
Sbjct  262   VTADKEPKQYKMVASTRFTKTVLTTTAVISYTNGNG-PASPVLPPAP----VGWAWSLNQ  316

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
              RSFRWNLTASAARPNPQGSYHYGQINITRTIKLVN+   +DGKLRY LNGVSH + +TP
Sbjct  317   VRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNNPFNIDGKLRYTLNGVSHEDDETP  376

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEY+G++ KVF+YD+  D PP     + +  NV+N TFR FVEI+FEN  K IQ+Y+
Sbjct  377   LKLAEYYGVANKVFQYDLTSDNPPAVIGNLRVEANVLNVTFRTFVEIIFENPTKVIQSYN  436

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVA+E G+W+PEKRKNYNL+DAVSRH++QV+P SWAA+M T DNAGMWNLRS+
Sbjct  437   LDGYSFFAVAVEPGKWTPEKRKNYNLLDAVSRHTVQVFPKSWAAIMLTFDNAGMWNLRSE  496

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMP  1213
             M E  YLGQQ+Y SVLSPE+S RDE+NLPD  Q+CG+VK M  P
Sbjct  497   MAENRYLGQQMYMSVLSPEKSNRDEYNLPDTHQVCGIVKDMPRP  540



>ref|XP_006299300.1| hypothetical protein CARUB_v10015454mg [Capsella rubella]
 gb|EOA32198.1| hypothetical protein CARUB_v10015454mg [Capsella rubella]
Length=554

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/411 (64%), Positives = 323/411 (79%), Gaps = 8/411 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID-P  178
             LIPVP+  P D++ V I DWY K H  LKK LD G T+ RPDG++INGK GK GD  D P
Sbjct  149   LIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILINGKSGK-GDGSDAP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LF ++ GKTYR R+CNVG++TS+NFR + H + LVEMEGSH +QN YDSLD+HVGQC   
Sbjct  208   LFNLKPGKTYRVRICNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDYDSLDVHVGQCYGT  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             ++TA++E KDYY+V SSRF K   +T  ++ Y  G G  AS +LP  P     G AWS+N
Sbjct  268   ILTANQEAKDYYMVASSRFLKSVITTTGLLRYEGGKG-PASSQLPAGP----VGWAWSLN  322

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYALNGVSH + +T
Sbjct  323   QFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGVSHTDPET  382

Query  719   PLKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             PLKLAEYFGI++KVFKYD + D P PE  + + + PNV+N T RNF+E+VFENHEK++Q+
Sbjct  383   PLKLAEYFGIADKVFKYDTITDNPTPEQTKNIKIEPNVLNITHRNFIEVVFENHEKSVQS  442

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG+SFFAVA+E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+R
Sbjct  443   WHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIR  502

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1228
             S+  ER YLGQQLY SVLSPE+SLRDE+N+P+    CGLVKG   P PY+G
Sbjct  503   SENTERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGKPKPNPYAG  553



>emb|CAA47177.1| Bplo [Brassica napus]
Length=555

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/412 (65%), Positives = 324/412 (79%), Gaps = 9/412 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID-P  178
             LIPVP+  P D++ V I DW+ K H  LKK LD G TI RPDG+VINGK GK GD  D P
Sbjct  149   LIPVPYADPEDDYTVLIGDWFTKSHTQLKKFLDGGRTIGRPDGIVINGKSGK-GDGSDAP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFT++ GKTYR R+CNVG++TS+NFR + H M LVEMEGSH +QN YDSLD+HVGQC   
Sbjct  208   LFTLKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCYGT  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             +VTA++EPKDYY+V S+RF K+  +T  ++ Y  G G  AS +LP  P     G AWS+N
Sbjct  268   IVTANQEPKDYYMVASTRFLKKVITTTGLLRYEGGKG-PASSQLPAGP----VGWAWSLN  322

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVN++  +DGKLRYALNGVSH   +T
Sbjct  323   QFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLRYALNGVSHTEPET  382

Query  719   PLKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             PLKLAEYFGI++KVFKYDI+ D P PE  + + + PNV+N T R FVE+VFENHEK++Q+
Sbjct  383   PLKLAEYFGITDKVFKYDIITDNPTPEQIKNIKIEPNVLNITHRTFVEVVFENHEKSVQS  442

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG+SFFAVA+E G W+PEKRKNYNL+DAVSRH+IQVYP  WAA++ T DN GMWN+R
Sbjct  443   WHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTIQVYPKCWAAILLTFDNCGMWNIR  502

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMP-PPYSG  1228
             S+  ER YLGQQLY SVLSPE+SLRDE+N+P+    CGLVK    P  PY+G
Sbjct  503   SENSERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKNTPKPVNPYAG  554



>ref|XP_003601595.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71846.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/406 (64%), Positives = 321/406 (79%), Gaps = 5/406 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P DE+ V I DWY K HKTLK  LDSG +I RP GV+INGK+ K   + +PL
Sbjct  146   LIPVPYADPEDEYWVLIGDWYGKSHKTLKMELDSGRSIGRPAGVIINGKNAKGDGRDEPL  205

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             +TM+ GKTY+YR+CN G++ ++NFRF+GH M LVE EGSH +QNVYDSLD+HVGQC +VL
Sbjct  206   YTMKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVL  265

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADKEP+DYY++ S+R  K       I+ Y NG G  ASP LPP+P     G AWS+NQ
Sbjct  266   VTADKEPRDYYMIASTRMTKYNLLGKGIVRYTNGKG-PASPVLPPAP----VGWAWSLNQ  320

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYGQINITRTIK VNS S V+GKLRYA+NGVSH++ +TP
Sbjct  321   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKFVNSVSNVNGKLRYAINGVSHVDPETP  380

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             +KLAEY+G+++KVFKY+I+ D PP +   +T+APNV+  TFR F+EI+FEN EK +Q+Y+
Sbjct  381   VKLAEYYGVADKVFKYNIISDEPPTDLRAITIAPNVMQTTFRTFIEIIFENPEKVLQSYN  440

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             L G+SFFAVA E G W+PEKRK YNL+DA+SRH+IQV+P SWAA+M T DNAGMW LRS+
Sbjct  441   LGGYSFFAVAGEPGTWTPEKRKGYNLLDAISRHTIQVFPKSWAAIMLTFDNAGMWQLRSE  500

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPP  1219
               E  YLGQQLY SV S E+S RDE+NLP+ Q +CG+VK M  PPP
Sbjct  501   HAEHRYLGQQLYLSVESEEKSTRDEYNLPETQLVCGIVKDMPRPPP  546



>ref|XP_003601600.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71851.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/406 (65%), Positives = 321/406 (79%), Gaps = 5/406 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P DE+ V I DWY K HKTLK  LDSG +I RP GV+INGK+ K     +PL
Sbjct  146   LIPVPYADPEDEYWVLIGDWYGKSHKTLKMELDSGRSIGRPAGVIINGKNAKGDGSDEPL  205

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             +TM+ GKTY+YR+CN G++ ++NFRF+GH M LVE EGSH +QNVYDSLD+HVGQC +VL
Sbjct  206   YTMKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVL  265

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADKEP+DYY++ S+R  K       II Y NG G  ASP LPP+P     G AWS+NQ
Sbjct  266   VTADKEPRDYYMIASTRMTKYNLLGKGIIRYTNGKG-PASPVLPPAP----VGWAWSLNQ  320

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYGQINITRTIK VNS S V+GKLRYA+NGVSH++ +TP
Sbjct  321   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKFVNSVSNVNGKLRYAINGVSHVDPETP  380

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             +KLAEY+G+++KVFKY+I+ D PP + + +T+APNV+  TFR F+EI+FEN EK +Q+Y+
Sbjct  381   VKLAEYYGVADKVFKYNIISDEPPTDLKAITIAPNVMQTTFRTFIEIIFENPEKVLQSYN  440

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             L G+SFFAVA E G W+PEKRK YNL+DA+SRH+IQV+P SWAA+M T DNAGMW LRS+
Sbjct  441   LGGYSFFAVAGEPGTWTPEKRKGYNLLDAISRHTIQVFPKSWAAIMLTFDNAGMWQLRSE  500

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPP  1219
               E  YLGQQLY SV S E+S RDE+NLP+ Q +CG+VK M  PPP
Sbjct  501   HAEHRYLGQQLYLSVESEEKSTRDEYNLPETQLVCGIVKDMPRPPP  546



>ref|XP_006345828.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=552

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/410 (63%), Positives = 324/410 (79%), Gaps = 6/410 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD+PAD+F V +SDWY   HK+LK +LD+G ++ RPDG+VINGK GK   K +P+
Sbjct  146   LIPVPFDTPADDFTVLVSDWYTNSHKSLKGLLDTGRSLGRPDGIVINGKSGKGDGKDEPM  205

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM  GKTYR+R CNVGM+ ++N R +GHTM LVEMEGSHT+QN+Y+ LD+H+GQCLSVL
Sbjct  206   FTMVKGKTYRFRFCNVGMKDTINVRIQGHTMKLVEMEGSHTVQNLYELLDIHLGQCLSVL  265

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             +TAD+ PKDY++V +SRF K+     A I YANG G    P  P    E  EG  WS+NQ
Sbjct  266   ITADQNPKDYFIVATSRFTKESRVATATIRYANGKG----PASPLEKKEAPEGWEWSLNQ  321

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             F SFRWNLTAS+ARPNPQGSYHYGQINITRTI+LV++   V+GK RYA+NGVSH + +TP
Sbjct  322   FNSFRWNLTASSARPNPQGSYHYGQINITRTIRLVSTAGVVNGKHRYAINGVSHTDPETP  381

Query  722   LKLAEYFGISEKVFKYDIMGD--TPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             +KLA+Y+G+++KVFKY +  D   PP   E +T+APNVVN T+RNFVEI+ ENHEK++Q+
Sbjct  382   IKLAQYYGVADKVFKYGLCKDEYIPPSGNEVITIAPNVVNVTYRNFVEIILENHEKSVQS  441

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG +FFAVAI  GRW PE R+NYNL+DAVSR +IQVYPNSWAA++TTLDNAG+WNLR
Sbjct  442   WHLDGFNFFAVAIAPGRWKPEMRQNYNLLDAVSRSTIQVYPNSWAAIITTLDNAGLWNLR  501

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             S+  E+ YLG QLYFSV +P  SL+DE+N+PD    CG++K +  P PYS
Sbjct  502   SNALEKQYLGHQLYFSVNAPNTSLKDEYNMPDNDISCGIIKDLPHPKPYS  551



>ref|XP_006407228.1| hypothetical protein EUTSA_v10020433mg [Eutrema salsugineum]
 gb|ESQ48681.1| hypothetical protein EUTSA_v10020433mg [Eutrema salsugineum]
Length=554

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/411 (64%), Positives = 323/411 (79%), Gaps = 8/411 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID-P  178
             LIPVP+  P D++ V I DWY K H  LKK LD G T+ RPDG++INGK GK GD  D P
Sbjct  149   LIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILINGKAGK-GDGSDAP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFT++ GKTYR R+CNVG++TS+NFR + H M LVEMEGSH +QN YDSLD+HVGQC   
Sbjct  208   LFTLKPGKTYRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCYGT  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             +VTA++EPKDYY+V SSRF K   +T  ++ Y  G G  AS +LP  P     G AWS+N
Sbjct  268   IVTANQEPKDYYMVASSRFLKSVITTTGLLRYEGGKG-PASSQLPAGP----VGWAWSLN  322

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYG+INI+RTI L N++  VDGKLRYALNGVSHI+ +T
Sbjct  323   QFRSFRWNLTASAARPNPQGSYHYGKINISRTIVLKNTQGKVDGKLRYALNGVSHIDPET  382

Query  719   PLKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             PLKLAEYFGI++KVFKYD + D P PE  + + + PNV+N T R F+E+VFENHEK++Q+
Sbjct  383   PLKLAEYFGIADKVFKYDSITDNPTPEQIKTIKIEPNVLNITHRTFIEVVFENHEKSVQS  442

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG+SFFAVA+E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+R
Sbjct  443   WHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIR  502

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1228
             S+  ER YLGQQLY SVLSPE+SLRDE+N+P+    CGLVKG   P PY+G
Sbjct  503   SENTERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGTPKPNPYAG  553



>ref|XP_009411781.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=548

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/408 (63%), Positives = 315/408 (77%), Gaps = 8/408 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD PAD++ V I DWY K HKTL +ILD+G +I  P GV+INGK GK     +PL
Sbjct  149   LIPVPFDPPADDYTVMIGDWYTKDHKTLARILDTGRSIGLPAGVLINGKAGK---DDEPL  205

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             F MEAGK YRYRVCN+G +TS+NFR +GH+M LVEM+GSHT+QN Y+SLD+HVGQC SVL
Sbjct  206   FVMEAGKVYRYRVCNIGTKTSLNFRIQGHSMLLVEMDGSHTMQNTYESLDIHVGQCFSVL  265

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++ P DYY+V S+RF ++E +   +I Y+ G+    SP LP +P     G AWS+NQ
Sbjct  266   VTANQAPGDYYMVASTRFLRKELTATGVIRYS-GSHTLPSPVLPKAP----SGWAWSLNQ  320

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             +RSFRWNLTASAARPNPQGSYHYG I+ITRTIKL +S++ + GK RY LNGVSH+  DTP
Sbjct  321   WRSFRWNLTASAARPNPQGSYHYGSIDITRTIKLASSRAIIAGKNRYTLNGVSHVEADTP  380

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYFGI  K FKY++  D PP  G    LA NV+   FR FVEI+FEN EK +Q+YH
Sbjct  381   LKLAEYFGIGGKSFKYNLTSDEPPSGGAPAILATNVITIEFRTFVEIIFENPEKNVQSYH  440

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             L+G+SFF V +  G+W+PE RK YNL+DAVSRH++QVYP SWAA+M T DNAGMWNLRS+
Sbjct  441   LNGYSFFLVGMGPGKWTPESRKTYNLLDAVSRHAVQVYPKSWAAIMLTFDNAGMWNLRSE  500

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             +WER YLGQQLY SV SP RSLRDE+NLPD   LCG V+G+  P PY+
Sbjct  501   LWERRYLGQQLYISVQSPARSLRDEYNLPDTALLCGAVEGLPKPAPYT  548



>gb|AFC88081.1| skewed-like protein [Brassica rapa subsp. oleifera]
Length=555

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/412 (65%), Positives = 322/412 (78%), Gaps = 9/412 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID-P  178
             LIPVP+  P D++ V I DWY K H  LKK LD G TI RPDG+VINGK GK GD  D P
Sbjct  149   LIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTIGRPDGIVINGKSGK-GDGSDAP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFT++ GKTYR R+CNVG++TS+NFR + H M LVEMEGSH +QN YDSLD+HVGQC   
Sbjct  208   LFTLKPGKTYRVRICNVGLKTSINFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGT  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             +VTA++EPKDYY+V SSRF K   +T  ++ Y  G G  AS +LP  P     G AWS+N
Sbjct  268   IVTANQEPKDYYMVASSRFLKTVITTTGLLRYEGGKG-PASSQLPAGP----VGWAWSLN  322

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVN++  VDGKLR+ALNGVSH   +T
Sbjct  323   QFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRFALNGVSHTEPET  382

Query  719   PLKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             PLKLAEYFGIS+KVFKYD + D P PE  + + + PNV+N T R FVE+VFENHEK++Q+
Sbjct  383   PLKLAEYFGISDKVFKYDTITDDPTPEQIKNIKIEPNVLNITHRTFVEVVFENHEKSVQS  442

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG+SFF+VA+E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+R
Sbjct  443   WHLDGYSFFSVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNVR  502

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMP-PPYSG  1228
             S+  ER YLGQQLY SVLSPE+SLRDE+N+P+    CGLVK    P  PY+G
Sbjct  503   SENTERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKNTPKPVNPYAG  554



>ref|XP_010480098.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=555

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/410 (63%), Positives = 323/410 (79%), Gaps = 6/410 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I+DWY K H  LKK LDSG T+ RPDG++INGK GK      PL
Sbjct  150   LIPVPYADPEDDYTVLINDWYTKSHTQLKKFLDSGRTLGRPDGILINGKSGKTDGSDKPL  209

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FT++ GKTYR R+CNVG++ S+NFR + H M LVEMEGSH +QN YDSLD+HVGQC  V+
Sbjct  210   FTLKPGKTYRVRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDYDSLDIHVGQCFGVI  269

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++EPKDYY+V S+RF K+  +T  ++ Y  G G  AS +LP +P     G AWS+NQ
Sbjct  270   VTANQEPKDYYMVASTRFLKKPLTTTGLLRYEGGKG-PASSQLPAAP----VGWAWSLNQ  324

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYAL+GVSH + +TP
Sbjct  325   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALSGVSHTDPETP  384

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEK-VTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEYFG+++KVFKYD + D P  +  K + + PNV+N T R F+E+VFENHEK++Q++
Sbjct  385   LKLAEYFGVTDKVFKYDSISDNPNADQIKTIKIEPNVLNITHRTFIEVVFENHEKSVQSW  444

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVA+E G W+PEKRKNYNL+DAVSRH++QV+P  WAA++ T DN GMWN+RS
Sbjct  445   HLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVFPKCWAAILLTFDNCGMWNIRS  504

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1228
             +  ER YLGQQLY SVLSPE+SLRDE+N+P+    CGLVKG     PY+G
Sbjct  505   ENSERRYLGQQLYASVLSPEKSLRDEYNMPESSLQCGLVKGKPKINPYAG  554



>gb|AES71848.2| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=513

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/406 (65%), Positives = 320/406 (79%), Gaps = 5/406 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P DE+ V I DWY K HKTLK  LDSG +I RP GV+INGK+ K     +PL
Sbjct  110   LIPVPYADPEDEYWVLICDWYGKSHKTLKMELDSGRSIGRPAGVIINGKNAKGDGSDEPL  169

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             +TM+ GKTY+YR+CN G++ ++NFRF+GH M LVE EGSH +QNVYDSLD+HVGQC +VL
Sbjct  170   YTMKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVL  229

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADKEP+DYY++ S+R  K       II Y NG G  ASP LPP+P     G AWS+NQ
Sbjct  230   VTADKEPRDYYMIASTRMTKYNLLGKGIIRYTNGKG-PASPVLPPAP----VGWAWSLNQ  284

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYGQINITRTIK VNS S V+GKL YA+NGVSH++ +TP
Sbjct  285   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKFVNSVSNVNGKLCYAINGVSHVDPETP  344

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             +KLAEY+GI++KVFKY+I+ D PP + + +T+APNV+  TFR F+EI+FEN EK +Q+Y+
Sbjct  345   VKLAEYYGIADKVFKYNIISDEPPTDLKAITIAPNVMQTTFRTFIEIIFENPEKVLQSYN  404

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             L G+SFFAVA E G W+PEKRK YNL+DA+SRH+IQV+P SWAA+M T DNAGMW LRS+
Sbjct  405   LGGYSFFAVAGEPGTWTPEKRKGYNLLDAISRHTIQVFPKSWAAIMLTFDNAGMWQLRSE  464

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPP  1219
               E  YLGQQLY SV S E+S RDE+NLP+ Q +CG+VK M  PPP
Sbjct  465   HAEHRYLGQQLYLSVESEEKSTRDEYNLPETQLVCGIVKDMPRPPP  510



>sp|Q00624.1|ASOL_BRANA RecName: Full=L-ascorbate oxidase homolog; Flags: Precursor [Brassica 
napus]
 emb|CAA45554.1| Bp10 [Brassica napus]
 emb|CDY43995.1| BnaA05g25900D [Brassica napus]
Length=555

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/412 (65%), Positives = 322/412 (78%), Gaps = 9/412 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID-P  178
             LIPVP+  P D++ V I DWY K H  LKK LD G TI RPDG+VINGK GK GD  D P
Sbjct  149   LIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTIGRPDGIVINGKSGK-GDGSDAP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFT++ GKTYR R+CNVG++TS+NFR + H M LVEMEGSH +QN YDSLD+HVGQC   
Sbjct  208   LFTLKPGKTYRVRICNVGVKTSINFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGT  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             +VTA++EPKDYY+V SSRF K   +T  ++ Y  G G  AS +LP  P     G AWS+N
Sbjct  268   IVTANQEPKDYYMVASSRFLKTVITTTGLLRYEGGKG-PASSQLPAGP----VGWAWSLN  322

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVN++  VDGKLR+ALNGVSH   +T
Sbjct  323   QFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRFALNGVSHTEPET  382

Query  719   PLKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             PLKLAEYFGIS+KVFKYD + D P PE  + + + PNV+N T R FVE+VFENHEK++Q+
Sbjct  383   PLKLAEYFGISDKVFKYDTITDDPTPEQIKNIKIEPNVLNITHRTFVEVVFENHEKSVQS  442

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG+SFF+VA+E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+R
Sbjct  443   WHLDGYSFFSVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNVR  502

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMP-PPYSG  1228
             S+  ER YLGQQLY SVLSPE+SLRDE+N+P+    CGLVK    P  PY+G
Sbjct  503   SENTERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKNTPKPVNPYAG  554



>ref|XP_008219577.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=552

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/409 (64%), Positives = 325/409 (79%), Gaps = 6/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P DE+ V I DW+ K H  LKK+LD G ++ARPDGV+INGK  K   K +PL
Sbjct  148   LIPVPYADPEDEYTVLIGDWFTKSHTQLKKLLDGGRSMARPDGVLINGKSSKGDGKDEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             F M+ GKTY+YR+CNVG++ ++NFR +GH+M LVE+EGSHT+QN YDS+D+H+GQC SVL
Sbjct  208   FVMKPGKTYKYRICNVGLKNTLNFRIQGHSMKLVELEGSHTVQNTYDSMDVHLGQCFSVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADK+PKDYY+V S+RF K   +   II Y NG G  ASPELP +P     G AWS+NQ
Sbjct  268   VTADKDPKDYYMVASTRFTKSVLTGKGIIRYENGKG-PASPELPKAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVNS S VDGKLRYA+NG+SH++ +TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNSASKVDGKLRYAINGISHVDPETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPEN-GEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLA+Y+ + +KVFK+D M DTPP    +K+T+ PNVVN T R+FVEI+FEN EK+ QT+
Sbjct  383   LKLADYYKVYDKVFKFDTMKDTPPATAADKITMEPNVVNITIRDFVEIIFENPEKSPQTW  442

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFF+VA E G W+PEKR NYNL+DAVSR+++QV+P SWAA+M T D+AGMWN+RS
Sbjct  443   HLDGYSFFSVASEPGTWTPEKRSNYNLLDAVSRYTVQVFPKSWAAIMLTFDSAGMWNVRS  502

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             +  ER YLGQQ Y  V +  RSLR+E+N+PD   +CG+VK M  P P+S
Sbjct  503   EQPERRYLGQQFYVGVENIARSLRNEYNMPDNALVCGIVKDMPKPAPFS  551



>emb|CDX82541.1| BnaA03g32800D [Brassica napus]
Length=555

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/412 (65%), Positives = 323/412 (78%), Gaps = 9/412 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID-P  178
             LIPVP+  P D++ V I DW+ K H  LKK LD G TI RPDG+VINGK GK GD  D P
Sbjct  149   LIPVPYADPEDDYTVLIGDWFTKSHTQLKKFLDGGRTIGRPDGIVINGKSGK-GDGSDAP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFT++ GKTYR R+CNVG++TS+NFR + H M LVEMEGSH +QN YDSLD+HVGQC   
Sbjct  208   LFTLKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCYGT  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             +V A++EPKDYY+V S+RF K+  +T  ++ Y  G G  AS +LP  P     G AWS+N
Sbjct  268   IVAANQEPKDYYMVASTRFLKKVITTTGLLRYEGGKG-PASSQLPAGP----VGWAWSLN  322

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVN++  +DGKLRYALNGVSH   +T
Sbjct  323   QFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLRYALNGVSHTEPET  382

Query  719   PLKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             PLKLAEYFGI++KVFKYDI+ D P PE  + + + PNV+N T R FVE+VFENHEK++Q+
Sbjct  383   PLKLAEYFGITDKVFKYDIITDNPTPEQIKNIKIEPNVLNITHRTFVEVVFENHEKSVQS  442

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG+SFFAVA+E G W+PEKRKNYNL+DAVSRH+IQVYP  WAA++ T DN GMWN+R
Sbjct  443   WHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTIQVYPKCWAAILLTFDNCGMWNIR  502

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMP-PPYSG  1228
             S+  ER YLGQQLY SVLSPE+SLRDE+N+P+    CGLVK    P  PY+G
Sbjct  503   SENSERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKNTPKPVNPYAG  554



>ref|XP_002884964.1| hypothetical protein ARALYDRAFT_478720 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61223.1| hypothetical protein ARALYDRAFT_478720 [Arabidopsis lyrata subsp. 
lyrata]
Length=554

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/411 (64%), Positives = 324/411 (79%), Gaps = 8/411 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID-P  178
             LIPVP+  P D++ V I DWY K H  LKK LD G T+ RPDG++INGK GK GD  D P
Sbjct  149   LIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILINGKAGK-GDGSDAP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFT++ GKTYR RVCNVG++TS+NFR + H + LVEMEGSH +QN YDSLD+HVGQC   
Sbjct  208   LFTLKPGKTYRVRVCNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDYDSLDVHVGQCYGT  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             +++A++E KDYY+V SSRF K   +T  ++ Y  G G  AS +LPP P     G AWS+N
Sbjct  268   ILSANQEAKDYYMVASSRFLKSVITTTGLLRYEGGKG-PASSQLPPGP----VGWAWSLN  322

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVN++  V+GKLRYALNGVSH + +T
Sbjct  323   QFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVNGKLRYALNGVSHTDPET  382

Query  719   PLKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             PLKLAEYFG+++KVFKYD + D P PE  + + + PNV+N T R F+E+VFENHEK++Q+
Sbjct  383   PLKLAEYFGVADKVFKYDSITDNPTPEQIKSIKIEPNVLNITHRTFIEVVFENHEKSVQS  442

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG+SFFAVA+E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+R
Sbjct  443   WHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIR  502

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1228
             S+  ER YLGQQLY SVLSPE+SLRDE+N+P+    CGLVKG   P PY+G
Sbjct  503   SENSERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGTPKPNPYAG  553



>ref|XP_009402422.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=550

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/409 (64%), Positives = 319/409 (78%), Gaps = 7/409 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGK--VGDKID  175
             LIPVPFD PAD++ V I DWY K HK L  ILD+G +I  P G+++NG  GK   G    
Sbjct  146   LIPVPFDDPADDYTVLIGDWYTKSHKALAGILDAGRSIGNPTGILMNGSPGKNAAGKDDA  205

Query  176   PLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLS  355
             PLF MEAGKTYRYR+CNVG++ S+NFR + H M LVEM+GSHT+QN Y+SLD+HVGQCLS
Sbjct  206   PLFAMEAGKTYRYRICNVGLKVSLNFRIQNHLMKLVEMDGSHTVQNDYESLDVHVGQCLS  265

Query  356   VLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSI  535
             VLVTA++EPKDYY+V S+RF K   +   I+ YA G+ +  S ELP  P     G AWS 
Sbjct  266   VLVTANQEPKDYYMVASTRFTKYMLTATGIVRYA-GSNVPPSSELPAGP----VGWAWSF  320

Query  536   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTD  715
             NQ+RSFRWNLTASAARPNPQGSYHYG INITRTIKL +S   V+GK R+ALNGVSH+ T+
Sbjct  321   NQWRSFRWNLTASAARPNPQGSYHYGSINITRTIKLASSVGLVNGKRRFALNGVSHVETE  380

Query  716   TPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             TPLKLAEY+GI++KVFKYD + D PP     +T APNV+NATFR+++EI+ EN E++IQ+
Sbjct  381   TPLKLAEYYGIADKVFKYDSISDEPPAASATITAAPNVLNATFRDYIEIILENPERSIQS  440

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG+SFFAV +  G+W+P  RK YNL+DAVSRH+IQVYP SW+A+M T DNAGMW+LR
Sbjct  441   FHLDGYSFFAVGMGHGKWTPASRKTYNLLDAVSRHTIQVYPRSWSAIMLTFDNAGMWSLR  500

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             S++WER YLGQQLY SVLSP RSLRDE+++PD   LCG V  +  PPPY
Sbjct  501   SELWERHYLGQQLYISVLSPARSLRDEYSIPDNTLLCGDVTTLPKPPPY  549



>gb|EYU39761.1| hypothetical protein MIMGU_mgv1a003754mg [Erythranthe guttata]
Length=566

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/417 (64%), Positives = 333/417 (80%), Gaps = 13/417 (3%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHG-----KVGD  166
             LIPVPFD P D++ VF+ DWY KGH +L+K+LD G ++ RPDGV+INGK       K G 
Sbjct  153   LIPVPFDLPEDDYFVFVGDWYKKGHASLRKLLDGGRSLGRPDGVIINGKGSFGTGNKTGG  212

Query  167   KIDPLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQ  346
             +  P+FTM A KTYRYR CNVGM+ SVN R +GHTM +VE+EGSHT+QNVYDSLD+H+GQ
Sbjct  213   EDSPMFTMIAKKTYRYRFCNVGMKDSVNVRIQGHTMKIVEIEGSHTVQNVYDSLDVHLGQ  272

Query  347   CLSVLVTADKEPK-DYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGI  523
             C SVLVTAD++P+ DYYLV S+RF K+  ++ AII Y  G  +  SPELP        G+
Sbjct  273   CYSVLVTADQKPESDYYLVASTRFSKKALTSTAIIRYVGGGQVPPSPELP----PAPVGL  328

Query  524   AWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLV-NSKSYVDGKLRYALNGVS  700
              WSINQFRSFRWNLTASAARPNPQGSYHYG+I+ITRTIK V    S V GK RY++NGVS
Sbjct  329   PWSINQFRSFRWNLTASAARPNPQGSYHYGKIDITRTIKFVLKPFSKVGGKRRYSINGVS  388

Query  701   HINTDTPLKLAEYFGISEKVFKYDIMGDTPPEN--GEKVTLAPNVVNATFRNFVEIVFEN  874
             H++ +TPLKLAEY+G+++KVFKYD++ D P ++    +V +APNV+N TFRNFVEI+ EN
Sbjct  389   HVDPETPLKLAEYYGVADKVFKYDMIKDQPSDSDLAAEVIVAPNVINGTFRNFVEIILEN  448

Query  875   HEKTIQTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDN  1054
             H+K++QT+H+ G+SFFAVA+E GRW+ EKRKNYNL+DA+S+H++QVYPNSW A+MTTLDN
Sbjct  449   HDKSVQTFHVSGYSFFAVAVEPGRWTEEKRKNYNLIDAISKHTVQVYPNSWTAIMTTLDN  508

Query  1055  AGMWNLRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             AGMWN+RS   ER YLG+Q+Y SVLSP RSLRDE+NLPD Q LCG+VK M  PPPYS
Sbjct  509   AGMWNMRSMSLERQYLGEQIYVSVLSPNRSLRDEYNLPDTQLLCGIVKDMPKPPPYS  565



>ref|XP_003607814.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES90011.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=550

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/407 (64%), Positives = 318/407 (78%), Gaps = 5/407 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I DW+ K H TL K+LDSG  + RP  V++NG++ K      PL
Sbjct  148   LIPVPYADPEDDYTVLIGDWFTKSHSTLSKLLDSGRALGRPQAVLVNGQNAKGDGSDKPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG++ S+NF  + H M LVE EGSHT+QN YDSLD+HVGQC  VL
Sbjct  208   FTMKPGKTYKYRICNVGLKNSLNFGIQNHPMKLVEFEGSHTVQNSYDSLDVHVGQCFGVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADKEPKDYY+V S+RF K   +   I+ YANG G  ASPELP +P     G AWS+NQ
Sbjct  268   VTADKEPKDYYMVASTRFTKTVITGKGIMRYANGKG-PASPELPEAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYGQINITRT+KL+N+ S   GKLRYALNGVSH++T+TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGQINITRTVKLINTVSREGGKLRYALNGVSHVDTETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEY+ ++EKVFKYD + D P   G  VTLAPNV+    R F+EIVFENHEK++Q+Y+
Sbjct  383   LKLAEYYNVAEKVFKYDTIPDMPENLGTSVTLAPNVLKFKHRTFIEIVFENHEKSVQSYN  442

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVAIE G W+PEKRK YNL+DAVSRH+IQV+P SWAA+M + DN G+WNLRS+
Sbjct  443   LDGYSFFAVAIEPGLWTPEKRKTYNLLDAVSRHTIQVFPKSWAAIMLSFDNVGVWNLRSE  502

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             + E  YLGQQLY SV +PERSLRDE+NLP+   LCG+VK +  PP Y
Sbjct  503   IAENRYLGQQLYISVPTPERSLRDEYNLPENSLLCGIVKDLPKPPSY  549



>ref|XP_006392621.1| hypothetical protein EUTSA_v10011364mg [Eutrema salsugineum]
 gb|ESQ29907.1| hypothetical protein EUTSA_v10011364mg [Eutrema salsugineum]
Length=553

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/410 (63%), Positives = 321/410 (78%), Gaps = 6/410 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ + I+DWY K H  LKK LDSG TI RPDG++INGK GK      PL
Sbjct  148   LIPVPYADPEDDYTILINDWYTKSHTQLKKFLDSGRTIGRPDGILINGKAGKGDGSDQPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FT++ GKTYR R+CNVG++ S+NFR + H M LVEMEGSH +QN YDSLD+HVGQC  VL
Sbjct  208   FTLKQGKTYRVRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++EPKDYY+V S+RF K   +T  ++ Y  G G  AS +LP +P     G AWS+NQ
Sbjct  268   VTANQEPKDYYMVASTRFLKNALTTTGLLRYEGGKG-PASSQLPAAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVN++  +DGKLRYAL+GVSH + +TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLRYALSGVSHTDPETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEK-VTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEYFG+ +KVFKYD + D P  +  K + + PNV+N T RNF+EIVFENHE+++Q++
Sbjct  383   LKLAEYFGVVDKVFKYDSISDNPTSDQIKNIKIEPNVLNITHRNFIEIVFENHERSVQSW  442

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVA+E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS
Sbjct  443   HLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRS  502

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1228
             +  ER YLGQQLY SVLSPE+SLRDE+N+P+    CGLVK      PY+G
Sbjct  503   ENSERRYLGQQLYASVLSPEKSLRDEYNMPESSLQCGLVKDKPKINPYAG  552



>ref|XP_009135302.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=555

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/412 (65%), Positives = 323/412 (78%), Gaps = 9/412 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID-P  178
             LIPVP+  P D++ V I DW+ K H  LKK LD G TI RPDG+VINGK GK GD  D P
Sbjct  149   LIPVPYADPEDDYTVLIGDWFTKSHTQLKKFLDGGRTIGRPDGIVINGKSGK-GDGSDAP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFT++ GKTYR R+CNVG++TS+NFR + H M LVEMEGSH +QN YDSLD+HVGQC   
Sbjct  208   LFTLKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCYGT  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             +V A++EPKDYY+V S+RF K+  +T  ++ Y  G G  AS +LP  P     G AWS+N
Sbjct  268   IVAANQEPKDYYMVASTRFLKKVITTTGLLRYEGGKG-PASSQLPAGP----VGWAWSLN  322

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVN++  +DGKLRYALNGVSH   +T
Sbjct  323   QFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLRYALNGVSHTEPET  382

Query  719   PLKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             PLKLAEYFGI++KVFKYDI+ D P PE  + + + PNV+N T R FVE+VFENHEK++Q+
Sbjct  383   PLKLAEYFGITDKVFKYDIITDNPTPEQIKNIKIEPNVLNITHRTFVEVVFENHEKSVQS  442

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG+SFFAVA+E G W+PEKRKNYNL+DAVSRH+IQVYP  WAA++ T DN GMWN+R
Sbjct  443   WHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTIQVYPKCWAAILLTFDNCGMWNIR  502

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMP-PPYSG  1228
             S+  ER YLGQQLY S+LSPE+SLRDE+N+P+    CGLVK    P  PY+G
Sbjct  503   SENSERRYLGQQLYASILSPEKSLRDEYNMPETSLQCGLVKNTPKPVNPYAG  554



>ref|XP_009147500.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=555

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/410 (63%), Positives = 322/410 (79%), Gaps = 6/410 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I+DWY K H  LK  LDSG TI RPDG++INGK GK      PL
Sbjct  150   LIPVPYADPEDDYTVLINDWYTKSHTQLKNFLDSGRTIGRPDGILINGKAGKGDGSDQPL  209

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FT++ GKTYR R+CNVG++ S+NFR +   M LVEMEGSH +QN YDSLD+HVGQC  V+
Sbjct  210   FTLKQGKTYRIRICNVGLKASLNFRIQNLKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVI  269

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             +TA++EPKDYY+V S+RF K   +T  ++ Y  G G+ AS +LP +P     G AWS+NQ
Sbjct  270   LTANQEPKDYYIVASTRFLKNALTTTGLLRYEGGKGL-ASSQLPAAP----VGWAWSLNQ  324

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVN++  VD KLRYALNGVSHI+T+TP
Sbjct  325   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDSKLRYALNGVSHIDTETP  384

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEK-VTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEYFG+++KVFKYD + D P  +  K + + PNV+N T RNF+E+VFENHE+++Q++
Sbjct  385   LKLAEYFGVTDKVFKYDSISDNPTSDQIKNIKIEPNVLNITHRNFIEVVFENHERSVQSW  444

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVA+E G W+PEKRKNYNL+DAVSRH+IQVYP  WAA++ T DN GMWN+RS
Sbjct  445   HLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTIQVYPKCWAAILLTFDNCGMWNIRS  504

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1228
             +  ER YLGQQLY SVLSPE+SLRDE+N+P+    CGLVK      PY+G
Sbjct  505   ENSERRYLGQQLYASVLSPEKSLRDEYNMPESSLQCGLVKDKPKINPYAG  554



>ref|XP_003601597.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=554

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/406 (65%), Positives = 320/406 (79%), Gaps = 5/406 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P DE+ V I DWY K HKTLK  LDSG +I RP GV+INGK+ K     +PL
Sbjct  151   LIPVPYADPEDEYWVLICDWYGKSHKTLKMELDSGRSIGRPAGVIINGKNAKGDGSDEPL  210

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             +TM+ GKTY+YR+CN G++ ++NFRF+GH M LVE EGSH +QNVYDSLD+HVGQC +VL
Sbjct  211   YTMKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVL  270

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADKEP+DYY++ S+R  K       II Y NG G  ASP LPP+P     G AWS+NQ
Sbjct  271   VTADKEPRDYYMIASTRMTKYNLLGKGIIRYTNGKG-PASPVLPPAP----VGWAWSLNQ  325

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYGQINITRTIK VNS S V+GKL YA+NGVSH++ +TP
Sbjct  326   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKFVNSVSNVNGKLCYAINGVSHVDPETP  385

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             +KLAEY+GI++KVFKY+I+ D PP + + +T+APNV+  TFR F+EI+FEN EK +Q+Y+
Sbjct  386   VKLAEYYGIADKVFKYNIISDEPPTDLKAITIAPNVMQTTFRTFIEIIFENPEKVLQSYN  445

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             L G+SFFAVA E G W+PEKRK YNL+DA+SRH+IQV+P SWAA+M T DNAGMW LRS+
Sbjct  446   LGGYSFFAVAGEPGTWTPEKRKGYNLLDAISRHTIQVFPKSWAAIMLTFDNAGMWQLRSE  505

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPP  1219
               E  YLGQQLY SV S E+S RDE+NLP+ Q +CG+VK M  PPP
Sbjct  506   HAEHRYLGQQLYLSVESEEKSTRDEYNLPETQLVCGIVKDMPRPPP  551



>ref|XP_009416330.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=552

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/409 (64%), Positives = 316/409 (77%), Gaps = 7/409 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID--  175
             LIPVPF  P D++ V I DWY K HK L  ILD+GH I  P GV+ING+ GK     D  
Sbjct  148   LIPVPFADPTDDYTVLIGDWYAKSHKALAAILDAGHGIGNPAGVLINGRTGKDASGKDDT  207

Query  176   PLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLS  355
             PLFTMEAGKTYRYR+CNVGM+ S+NFR + H M LVEM+GSHT+QN Y+SLD+HVGQCLS
Sbjct  208   PLFTMEAGKTYRYRICNVGMKVSLNFRMQNHRMKLVEMDGSHTVQNDYESLDVHVGQCLS  267

Query  356   VLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSI  535
             VLVTA++EPKDYY+V S+RF K   +   +I YA G+ +  SPELP +P     G AWS 
Sbjct  268   VLVTANQEPKDYYMVASTRFTKYMRTATGVIRYA-GSSVPPSPELPAAP----VGWAWSF  322

Query  536   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTD  715
             NQ+RSFRWNLTASAARPNPQGSYHYG INITRTIKL +S   V+GK R+ALNGVSH+ + 
Sbjct  323   NQWRSFRWNLTASAARPNPQGSYHYGGINITRTIKLASSVGLVNGKRRFALNGVSHVESP  382

Query  716   TPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             TPLKLAEY+GI++KVFKYD + D PP     +T  PNV+NAT+R ++EI+ EN E++IQ 
Sbjct  383   TPLKLAEYYGIADKVFKYDSINDEPPAASAPITATPNVLNATYRTYIEIILENPERSIQC  442

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             YHLDG+SFF V +  G+W+PE RK YNL+DAVSRH+IQVYP SW+A+M T DNAGMWNLR
Sbjct  443   YHLDGYSFFPVGMGHGKWTPESRKTYNLLDAVSRHTIQVYPRSWSAIMLTFDNAGMWNLR  502

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             S+MWER YLGQQ+Y SV SPERSLRDE+N+PD   LCG V  +  PP Y
Sbjct  503   SEMWERHYLGQQIYISVTSPERSLRDEYNIPDNTLLCGDVADLPKPPSY  551



>ref|XP_008219320.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=552

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/409 (63%), Positives = 324/409 (79%), Gaps = 6/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P DE+ V I DW+ K H  LKK+LD G ++ARPDGV+INGK  K   K +PL
Sbjct  148   LIPVPYADPEDEYTVLIGDWFTKSHTQLKKLLDGGRSMARPDGVLINGKSSKGDGKDEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             F M+ GKTY+YR+CNVG++ ++NFR +GH+M LVE+EGSHT+QN YDS+D+H+GQC SVL
Sbjct  208   FVMKPGKTYKYRICNVGLKNTLNFRIQGHSMKLVELEGSHTVQNTYDSMDVHLGQCFSVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADK+PKDYY+V S+RF     +   II Y NG G  ASPELP +P     G AWS+NQ
Sbjct  268   VTADKDPKDYYMVASTRFTNSVLTGKGIIRYENGKG-PASPELPKAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVNS S VDGKLRYA+NG+SH++ +TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNSASKVDGKLRYAINGISHVDPETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPEN-GEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLA+Y+ + +KVFK+D M DTPP    +K+T+ PNVVN T R+FVEI+FEN EK++QT+
Sbjct  383   LKLADYYKVYDKVFKFDTMKDTPPATAADKITMEPNVVNITIRDFVEIIFENPEKSLQTW  442

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFF+V  E G W+PEKR NYNL+DAVSR+++QV+P SWAA+M T D+AGMWN+RS
Sbjct  443   HLDGYSFFSVGSEPGTWTPEKRSNYNLLDAVSRYTVQVFPKSWAAIMLTFDSAGMWNVRS  502

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             +  ER YLGQQ Y  V +  RSLR+E+N+PD   +CG+VK M  P P+S
Sbjct  503   EQPERRYLGQQFYVGVENIARSLRNEYNMPDNALVCGIVKDMPKPAPFS  551



>emb|CDX75707.1| BnaC03g37900D [Brassica napus]
Length=555

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/412 (64%), Positives = 324/412 (79%), Gaps = 9/412 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID-P  178
             LIPVP+  P D++ V I DW+ K H  +KK LD G TI RPDG+VINGK GK GD  D P
Sbjct  149   LIPVPYADPEDDYTVLIGDWFTKSHTQVKKFLDGGRTIGRPDGIVINGKSGK-GDGSDAP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFT++ GKTYR R+CNVG++TS+NFR + H M LVEMEGSH +QN YDSLD+HVGQC   
Sbjct  208   LFTLKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCYGT  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             +V+A++EPKDYY+V SSRF K+  +T  ++ Y  G G  AS +LP  P     G AWS+N
Sbjct  268   IVSANQEPKDYYMVASSRFLKKVITTTGLLRYEGGKG-PASSQLPAGP----VGWAWSLN  322

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVN++  +DGKLRYALNGVSH   +T
Sbjct  323   QFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLRYALNGVSHTEPET  382

Query  719   PLKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             PLKLAEYFGI++KVFKYDI+ D P PE  + + + PNV+N T R FVE+VFENHEK++Q+
Sbjct  383   PLKLAEYFGITDKVFKYDIITDDPTPEQIKNIKIEPNVLNITHRTFVEVVFENHEKSVQS  442

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG+SFFAVA+E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+R
Sbjct  443   WHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIR  502

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMP-PPYSG  1228
             S+  ER YLGQQLY S+LSPE+SLRDE+N+P+    CGLVK    P  PY+G
Sbjct  503   SENSERRYLGQQLYASILSPEKSLRDEYNMPETSLQCGLVKNTPKPVNPYAG  554



>emb|CAA47178.1| Bplo [Brassica napus]
Length=555

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/412 (64%), Positives = 324/412 (79%), Gaps = 9/412 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID-P  178
             LIPVP+  P D++ V I DW+ K H  +KK LD G TI RPDG+VINGK GK GD  D P
Sbjct  149   LIPVPYADPEDDYTVLIGDWFTKSHTQVKKFLDGGRTIGRPDGIVINGKAGK-GDGSDAP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFT++ GKTYR R+CNVG++TS+NFR + H M LVEMEGSH +QN YDSLD+HVGQC   
Sbjct  208   LFTLKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCYGT  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             +V+A++EPKDYY+V SSRF K+  +T  ++ Y  G G  AS +LP  P     G AWS+N
Sbjct  268   IVSANQEPKDYYMVASSRFLKKVITTTGLLRYEGGKG-PASSQLPAGP----VGWAWSLN  322

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVN++  +DGKLRYALNGVSH   +T
Sbjct  323   QFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLRYALNGVSHTEPET  382

Query  719   PLKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             PLKLAEYFGI++KVFKYDI+ D P PE  + + + PNV+N T R FVE+VFENHEK++Q+
Sbjct  383   PLKLAEYFGITDKVFKYDIITDDPTPEQIKNIKIEPNVLNITHRTFVEVVFENHEKSVQS  442

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG+SFFAVA+E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+R
Sbjct  443   WHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIR  502

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMP-PPYSG  1228
             S+  ER YLGQQLY S+LSPE+SLRDE+N+P+    CGLVK    P  PY+G
Sbjct  503   SENSERRYLGQQLYASILSPEKSLRDEYNMPETSLQCGLVKNTPKPVNPYAG  554



>ref|XP_008219429.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=552

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/409 (63%), Positives = 324/409 (79%), Gaps = 6/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P DE+ V I DW+ K H  LKK+LD G ++ARPDGV+INGK  K   K +PL
Sbjct  148   LIPVPYADPEDEYTVLIGDWFTKSHTQLKKLLDGGRSMARPDGVLINGKSSKGDGKDEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             F M+ GKTY+YR+CNVG++ ++NFR +GH+M LVE+EGSHT+QN YDS+D+H+GQC SVL
Sbjct  208   FVMKPGKTYKYRICNVGLKNTLNFRIQGHSMKLVELEGSHTVQNTYDSMDVHLGQCFSVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADK+PKDYY+V S+RF     +   II Y NG G  ASPELP +P     G AWS+NQ
Sbjct  268   VTADKDPKDYYMVASTRFTNSVLTGKGIIRYENGKG-PASPELPKAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVNS S VDGKLRYA+NG+SH++ +TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNSASKVDGKLRYAINGISHVDPETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPEN-GEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLA+Y+ + +KVFK+D M DTPP    +K+T+ PNVVN T R+FVEI+FEN E ++QT+
Sbjct  383   LKLADYYKVYDKVFKFDTMKDTPPATAADKITMEPNVVNITIRDFVEIIFENPENSLQTW  442

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFF+VA E G W+PEKR NYNL+DAVSR+++QV+P SWAA+M T D+AGMWN+RS
Sbjct  443   HLDGYSFFSVASEPGTWTPEKRSNYNLLDAVSRYTVQVFPKSWAAIMLTFDSAGMWNVRS  502

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             +  ER YLGQQ Y  V +  RSLR+E+N+PD   +CG+VK M  P P+S
Sbjct  503   EQPERRYLGQQFYVGVENIARSLRNEYNMPDNALVCGIVKDMPKPAPFS  551



>ref|XP_003601596.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71847.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/406 (64%), Positives = 320/406 (79%), Gaps = 5/406 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P DE+ V I DWY K HKTLK  LDSG +I RP GV+INGK+ K     +PL
Sbjct  146   LIPVPYADPEDEYWVLIGDWYGKSHKTLKMELDSGRSIGRPAGVIINGKNAKGDGSDEPL  205

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             +TM+ GKTY+YR+CN G++ ++NFRF+GH M LVE EGSH +QNVYDSLD+HVGQC +VL
Sbjct  206   YTMKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVL  265

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADKEP+DYY++ S+R  K       I+ Y NG G  ASP LPP+P     G AWS+NQ
Sbjct  266   VTADKEPRDYYMIASTRMTKYNLLGKGIVRYTNGKG-PASPVLPPAP----VGWAWSLNQ  320

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYGQINITRTIK VNS S V+GKL YA+NGVSH++ +TP
Sbjct  321   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKFVNSVSNVNGKLCYAINGVSHVDPETP  380

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             +KLAEY+G+++KVFKY+I+ D PP + + +T+APNV+  TFR F+EI+FEN EK +Q+Y+
Sbjct  381   VKLAEYYGVADKVFKYNIISDEPPTDLKAITIAPNVMQTTFRTFIEIIFENPEKVLQSYN  440

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             L G+SFFAVA E G W+PEKRK YNL+DA+SRH+IQV+P SWAA+M T DNAGMW LRS+
Sbjct  441   LGGYSFFAVAGEPGTWTPEKRKGYNLLDAISRHTIQVFPKSWAAIMLTFDNAGMWQLRSE  500

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPP  1219
               E  YLGQQLY SV S E+S RDE+NLP+ Q +CG+VK M  PPP
Sbjct  501   HAEHRYLGQQLYLSVESEEKSTRDEYNLPETQLVCGIVKDMPRPPP  546



>ref|XP_003601601.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71852.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=550

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/406 (65%), Positives = 318/406 (78%), Gaps = 5/406 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P DE+ V I DWY K HKTLK  LDSG +I RP GV+INGK+ K     +PL
Sbjct  147   LIPVPYADPEDEYWVLIGDWYGKSHKTLKMELDSGRSIGRPAGVIINGKNAKGDGSDEPL  206

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             +TM+ GKTY+YR+CN G++ ++NFRF+GH M LVE EGSH +QNVYDSLD+HVGQC +VL
Sbjct  207   YTMKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVL  266

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADKEPKDYY+V S+R  K       II Y NG G  ASP LPP+P     G AWS+NQ
Sbjct  267   VTADKEPKDYYMVASTRMTKYNLLGKGIIRYTNGKG-PASPMLPPAP----VGWAWSLNQ  321

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYGQINITRTIK VNS S V+GKLRYA+NGVSH++ +TP
Sbjct  322   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKFVNSVSNVNGKLRYAINGVSHVDPETP  381

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             +KLAEY+G+++KVFKY+I+ D PP +   +T+APNV+  TFR F+EI+FEN  K +Q+Y+
Sbjct  382   VKLAEYYGVADKVFKYNIISDEPPIDLRAITIAPNVMQTTFRTFIEIIFENPGKVLQSYN  441

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             L G+SFF VA E G W+PEKRK YNL+DA+SRH+IQV+P SWAA+M T DNAGMW LRS+
Sbjct  442   LGGYSFFVVAGEPGTWTPEKRKGYNLLDAISRHTIQVFPKSWAAIMLTFDNAGMWQLRSE  501

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPP  1219
               E  YLGQQLY SV S E+S RDE+NLP+ Q +CG+VK M  PPP
Sbjct  502   HAEHRYLGQQLYLSVESEEKSTRDEYNLPETQLVCGIVKDMPRPPP  547



>ref|XP_004505355.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=550

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/407 (63%), Positives = 317/407 (78%), Gaps = 5/407 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I DWY K H  L K+LDSG ++ RP  V++NG+  K      PL
Sbjct  148   LIPVPYADPEDDYTVLIGDWYTKSHTALAKLLDSGRSLGRPQAVLVNGQVAKGDGSDKPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG++ S+NFR +GH M LVE EGSHT+QN YDSLD+H+GQC  VL
Sbjct  208   FTMKPGKTYKYRICNVGLKNSLNFRIQGHPMKLVEFEGSHTVQNSYDSLDVHLGQCFGVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADK+PKDYY+V S+RF K   +   II Y NG G  ASPELP +P     G AWS+NQ
Sbjct  268   VTADKDPKDYYMVASTRFTKSIVTGKGIIRYTNGKG-PASPELPEAP----VGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSF WNLTASAARPNPQGSYHYGQINITRT+KL+NS S  + KLRYALNG+SH++ +TP
Sbjct  323   FRSFHWNLTASAARPNPQGSYHYGQINITRTVKLINSVSRDNSKLRYALNGISHVDPETP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYFGI+EKVFKYD + D P      VTL PNV+N   R F+EI+FENHEK++Q+++
Sbjct  383   LKLAEYFGIAEKVFKYDSIPDMPQSVPSSVTLQPNVLNFKHRTFIEIIFENHEKSVQSFN  442

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             L+G+SFF VAIE G W+PEKRK YNL+DAVSRH++QV+P SWAA+M T DN G+WNLRS+
Sbjct  443   LNGYSFFKVAIEPGTWTPEKRKCYNLLDAVSRHTVQVFPKSWAAIMLTFDNVGVWNLRSE  502

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             + E  YLGQQLY SV++PERSLRDE+N+P+   LCGLVKG+  PP Y
Sbjct  503   LAENRYLGQQLYISVITPERSLRDEYNIPENSLLCGLVKGLPKPPSY  549



>ref|XP_009387378.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=550

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/410 (63%), Positives = 312/410 (76%), Gaps = 7/410 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGK--VGDKID  175
             LIPVPFD PAD++ V I DWY K HK L  ILD+G +I  PDGV+INGK GK   G    
Sbjct  146   LIPVPFDPPADDYTVLIGDWYAKDHKALAGILDAGRSIGLPDGVIINGKTGKDRTGKDGK  205

Query  176   PLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLS  355
             PLF ME+GK YRYR+CN G+R S+NFR +GH+M LVE++GSHT+QN+YDSLD+HVGQC S
Sbjct  206   PLFVMESGKVYRYRICNTGIRASLNFRIQGHSMELVEIDGSHTMQNLYDSLDVHVGQCYS  265

Query  356   VLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSI  535
             VLVTA++ P DYYLV S+RF K+E +   I+ YA G+ +  S  LP +P     G AWS 
Sbjct  266   VLVTANQAPGDYYLVASTRFMKKELTATGIVRYA-GSKVPPSAVLPKAP----TGWAWSF  320

Query  536   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTD  715
             NQ+RSFRWNLTASAARPNPQGS+HYG INITRTIK  NS++ V GK R+ALNGVSH++ D
Sbjct  321   NQWRSFRWNLTASAARPNPQGSFHYGSINITRTIKFANSRAVVGGKSRFALNGVSHVDVD  380

Query  716   TPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             TPLK  EYFG+++K FKY++ GD P E    V LAPNV+   FR FVE++FEN EK  Q 
Sbjct  381   TPLKHLEYFGVADKFFKYNLTGDEPREGSGPVNLAPNVITVEFRTFVEVIFENPEKGPQF  440

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             YHLDG+SFFAV +  G+W PE RK YNL+DAVSRH+IQVYP SW A+M T DNAGMWNLR
Sbjct  441   YHLDGYSFFAVGMGPGKWKPESRKRYNLLDAVSRHAIQVYPKSWTAIMLTFDNAGMWNLR  500

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             S++WER YLGQQLY SV SP RSLRDE++LPD   LCG V  +  PPPY+
Sbjct  501   SELWERRYLGQQLYISVQSPARSLRDEYSLPDTVLLCGAVASLPKPPPYT  550



>ref|XP_003601599.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71850.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/406 (64%), Positives = 318/406 (78%), Gaps = 5/406 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P DE+ V I DWY K HKTLK  LDSG +I RP GV+INGK+ K     +PL
Sbjct  146   LIPVPYADPEDEYWVLIGDWYGKSHKTLKMELDSGRSIGRPAGVIINGKNAKGDGSDEPL  205

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             +TM+ GKTY+YR+CN G++ ++NFRF+GH M LVE EGSH +QNVYDSLD+HVGQC +VL
Sbjct  206   YTMKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVL  265

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTADKEP+DYY++ S+R  K       I+ Y NG G  ASP LP +P     G AWS+NQ
Sbjct  266   VTADKEPRDYYMIASTRMTKYNLVGKGIVRYTNGKG-PASPLLPSAP----VGWAWSLNQ  320

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYGQINITRTIK VNS S V+GKLRYA+NGVSH++ +TP
Sbjct  321   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKFVNSVSNVNGKLRYAINGVSHVDPETP  380

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             +KLAEY+G+++KVFKY+I+ D PP +   +T+APNV+  TFR F+EI+FEN  K +Q+Y+
Sbjct  381   VKLAEYYGVADKVFKYNIISDEPPTDLRAITIAPNVMQTTFRTFIEIIFENPGKVLQSYN  440

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             L G+SFFAVA E G W+PEKRK YNL+DA+SRH+IQV+P SWAA+M T DNAGMW LRS+
Sbjct  441   LGGYSFFAVAGEPGTWTPEKRKGYNLLDAISRHTIQVFPKSWAAIMLTFDNAGMWQLRSE  500

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPP  1219
               E  YLGQQLY SV S E+S RDE+NLP+ Q +CG+VK M  PPP
Sbjct  501   HAEHRYLGQQLYLSVESEEKSTRDEYNLPETQLVCGIVKDMPRPPP  546



>ref|XP_009392060.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=639

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/409 (64%), Positives = 314/409 (77%), Gaps = 7/409 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGK--VGDKID  175
             LIPVPF  PAD++ V + DWY K HK L ++LD+G TI RP G++ING+ GK   G    
Sbjct  235   LIPVPFADPADDYTVLVGDWYTKSHKNLARLLDAGRTIGRPSGILINGRPGKDSTGKDDP  294

Query  176   PLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLS  355
             PLFTM++GKTYRYRVCNVGM+ S+NFR + H M LVEM+GSHT+QNVYDSLD+HVGQCLS
Sbjct  295   PLFTMKSGKTYRYRVCNVGMKVSLNFRIQSHAMKLVEMDGSHTVQNVYDSLDVHVGQCLS  354

Query  356   VLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSI  535
             VLVTA +E +DYY+V SSRF K   S   +I YA G+    SP+LP +P     G AWS 
Sbjct  355   VLVTAHQEHRDYYMVASSRFTKYALSATGVIRYA-GSNTPPSPDLPAAP----SGWAWSF  409

Query  536   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTD  715
             NQ+RSFR NLTASAARPNPQGSYHYG INITRTIKLVNS   VDGK RYALN VSH +  
Sbjct  410   NQWRSFRLNLTASAARPNPQGSYHYGSINITRTIKLVNSVGLVDGKRRYALNAVSHSDAA  469

Query  716   TPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             TPLKLAEY+GI++KVFKYD + D P  +   + + PNVVNAT+R F+EIVFEN ++++Q 
Sbjct  470   TPLKLAEYYGIADKVFKYDTIADEPAASDAPIKIVPNVVNATYRTFIEIVFENPDRSMQA  529

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             YHLDG+SFFA  +  G+W+PE RK YNL DAVSRH+IQVY  SW+A++ T DNAGMWNLR
Sbjct  530   YHLDGYSFFAAGMGHGKWTPESRKRYNLADAVSRHTIQVYQRSWSAILLTFDNAGMWNLR  589

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             S++WER YLGQQLY SV+SPERSLRDE N+PD   LCG V  +  PP Y
Sbjct  590   SELWERRYLGQQLYISVVSPERSLRDESNMPDNALLCGAVAKLPRPPSY  638



>ref|XP_009412658.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=545

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/407 (64%), Positives = 318/407 (78%), Gaps = 8/407 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPF  PAD++ V ISDWY K HK L  +LD+G +I  P GV+ING  GK      PL
Sbjct  146   LIPVPFADPADDYTVLISDWYTKSHKALAGLLDAGRSIGNPAGVLINGLTGK---DNAPL  202

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTMEAGKTYRYR+CNVG++ S+NFR + H M LVEM+GSHT+QN Y+SLD+HVGQCLSVL
Sbjct  203   FTMEAGKTYRYRICNVGLKVSLNFRIQSHLMKLVEMDGSHTVQNDYESLDVHVGQCLSVL  262

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++E KDYY+V S+RF K   S   II YA G+ +  SPELP +P     G AWS NQ
Sbjct  263   VTANQEAKDYYMVASTRFTKYSLSATGIIRYA-GSVVPPSPELPKAP----VGWAWSFNQ  317

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             +RS RWNLTASAARPNPQGSYHYG INITRTI+L +S   V+GK R+ALNGVSH++  TP
Sbjct  318   WRSLRWNLTASAARPNPQGSYHYGGINITRTIRLASSVGLVNGKRRFALNGVSHVDPPTP  377

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEY+GI++KVFKYD + D PPE    +T+APNV+NAT+R+++EI+ EN E++IQ YH
Sbjct  378   LKLAEYYGIADKVFKYDSISDDPPETNAPITVAPNVLNATYRDYIEIILENPERSIQCYH  437

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAV +  G+W+P  R+ YNL+DAVSRH+IQVYP SW+A+M T DNAGMW+LRS+
Sbjct  438   LDGYSFFAVGMGHGKWTPASRRTYNLLDAVSRHTIQVYPRSWSAIMLTFDNAGMWSLRSE  497

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             MWER YLGQQLY SV+SP RSLRDE+N+PD   LCG V  +  PP Y
Sbjct  498   MWERHYLGQQLYVSVVSPARSLRDEYNMPDNALLCGDVASLPKPPSY  544



>ref|XP_003529456.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=550

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/410 (63%), Positives = 322/410 (79%), Gaps = 10/410 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  PADE+ V I DW+ K H  LK+ LDSG +I RP GV INGK+G     ++ L
Sbjct  148   LIPVPYADPADEYWVLIGDWFGKSHTALKQTLDSGRSIGRPSGVHINGKNGG----LEAL  203

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             +TME GKTY+YR+CNVG++ ++NFR +GH M LVE EGSH +QN YDSLD+HVGQC +VL
Sbjct  204   YTMEPGKTYKYRICNVGLKEALNFRIQGHPMKLVETEGSHVVQNTYDSLDVHVGQCFTVL  263

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+EP+DY++V S+RF K+  +   +I Y+NG G  +    P       +G AWS+NQ
Sbjct  264   VTADQEPRDYFMVASTRFTKKVITATRVIRYSNGVGPASPLLPP----APHQGWAWSLNQ  319

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLV ++S + GKLRYALNGVSH++ +TP
Sbjct  320   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVGTRSKIGGKLRYALNGVSHVDPETP  379

Query  722   LKLAEYFGISEKVFKYDIMGDTPPEN--GEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             LKLAEY+G+++KVFKY+++ D P          +APNV+NATFRNF+E++ EN  K  Q+
Sbjct  380   LKLAEYYGVADKVFKYNLISDAPDAAIASRDPIIAPNVINATFRNFIEVILENPTKVTQS  439

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             Y+LDG+SFFAVA+E G+WSPEKRK YNL+DAVSRH+IQV+P SWAA+M T DNAGMWNLR
Sbjct  440   YNLDGYSFFAVAVEPGQWSPEKRKCYNLLDAVSRHTIQVFPKSWAAIMLTFDNAGMWNLR  499

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             S+M E  YLGQQLY SVLSP RSLRDE+NLP+ Q +CG+VK M  PPPYS
Sbjct  500   SEMAENRYLGQQLYVSVLSPNRSLRDEYNLPETQLVCGIVKDMPKPPPYS  549



>ref|XP_009383852.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=552

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/412 (62%), Positives = 312/412 (76%), Gaps = 11/412 (3%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID--  175
             LIPVPFD PAD++ V + DWY K HK L K LD G +I  P GV+INGK GK G   D  
Sbjct  148   LIPVPFDPPADDYTVLVGDWYAKDHKALAKTLDMGRSIGLPSGVLINGKSGKHGSGKDDK  207

Query  176   PLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLS  355
             PLF MEAGK YRYR+CN G++ S+NFR +GHTM LVEM+GSHT+QN+YDSLD+HVGQC S
Sbjct  208   PLFVMEAGKVYRYRICNTGIKASINFRIQGHTMELVEMDGSHTMQNMYDSLDIHVGQCFS  267

Query  356   VLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSP--PENTEGIAW  529
             VLVTAD+ PKDYYLV S+RF ++E +  A++ YA  N        PPS   P+   G  W
Sbjct  268   VLVTADRAPKDYYLVASTRFLRKEITATAVVRYAGSN-------TPPSAVLPKGPTGWGW  320

Query  530   SINQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHIN  709
             S+NQ+RSFRWNLTASAARPNPQGSYHYG INITRTIKL +S+    GK+R+ LNG+SH++
Sbjct  321   SLNQWRSFRWNLTASAARPNPQGSYHYGSINITRTIKLSSSRVVDGGKIRFTLNGLSHVD  380

Query  710   TDTPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTI  889
             TDTPLK  EYFG+ +K FKY+++GD PP +    TLAPNV+   FR +VEI+ EN E+ +
Sbjct  381   TDTPLKHGEYFGVGDKFFKYNLIGDVPPASKAPFTLAPNVITIEFRTYVEIILENPERNL  440

Query  890   QTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWN  1069
             Q+YHLDG+SFF V +  G+W+P  RK YNL+DAVSRH+IQVYP SW+A+M T DNAGMWN
Sbjct  441   QSYHLDGYSFFPVGMGPGKWTPASRKGYNLLDAVSRHTIQVYPRSWSAIMLTFDNAGMWN  500

Query  1070  LRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             LRS++WER Y GQQLY SV SP RSLRDE++LPD   LCG V  +  PPPY+
Sbjct  501   LRSELWERRYQGQQLYISVQSPARSLRDEYSLPDTVLLCGAVASLPKPPPYT  552



>gb|KHG03555.1| L-ascorbate oxidase [Gossypium arboreum]
 gb|KHG09844.1| L-ascorbate oxidase [Gossypium arboreum]
Length=551

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/406 (62%), Positives = 316/406 (78%), Gaps = 5/406 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  PAD++ +   D++NKGH TLKKIL+SG  + R DGV INGK  K     +PL
Sbjct  148   LIPVPYADPADDYTIIAGDFFNKGHTTLKKILESGRNLGRCDGVHINGKVAKGDGSDEPL  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTMEAGKTY+YR+CN G++TS+N RF+GH M LVEMEGSHT+QN Y+SLD+HVGQC SVL
Sbjct  208   FTMEAGKTYKYRICNAGLKTSLNVRFQGHNMKLVEMEGSHTVQNDYESLDVHVGQCFSVL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+EP DY++V S+RF KQE +   +I Y NG G  +             G AWS+NQ
Sbjct  268   VTADQEPMDYFVVASTRFTKQEVTATGVIRYTNGKGAPSPKLP-----PPPVGWAWSLNQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FR+FRWNLTASAARPNPQGSY YG +NITRTIKL N+   VDGKLRYA+NG S++   TP
Sbjct  323   FRTFRWNLTASAARPNPQGSYKYGSVNITRTIKLANTAQKVDGKLRYAINGASYVEPTTP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEY+G+++KVFKYD + D PP    K+T+ P V+N T RNF+EI+FEN E  IQ+YH
Sbjct  383   LKLAEYYGVADKVFKYDTIPDDPPAEITKITMEPVVLNLTHRNFMEIIFENRETAIQSYH  442

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             L G++FFAVA+E G+WSPEKRKNYNL+DAVSRH+IQV+P SWAA++ + DN GMWN+RS+
Sbjct  443   LCGYAFFAVAVETGQWSPEKRKNYNLLDAVSRHTIQVFPKSWAAILLSFDNCGMWNIRSE  502

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPP  1219
             +W+R YLGQQLY SVLSP +SLRDE+N+P+   +CG+V+ M  PPP
Sbjct  503   IWDRRYLGQQLYVSVLSPNKSLRDEYNMPEGALVCGVVENMPRPPP  548



>ref|XP_009124743.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=554

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/411 (63%), Positives = 324/411 (79%), Gaps = 8/411 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID-P  178
             LIP+P+D P D++ V I DWY K H  LKK LD G T+ RP+GV+INGK GK GD  D P
Sbjct  149   LIPIPYDVPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPNGVLINGKAGK-GDGSDAP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFT++ GK+YR R+CNVG++TS+NFR + H M LVEMEGSH +QN +DSLD+HVGQC   
Sbjct  208   LFTLKPGKSYRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDFDSLDVHVGQCFGT  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             +VTA++EPKDYY+V SSRF K   +T  ++ Y  G G  AS +LP  P     G AWS+N
Sbjct  268   IVTANQEPKDYYMVASSRFLKSVITTTGLLRYEGGKG-PASSQLPAGP----VGWAWSLN  322

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLT++AARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYALNG+SH + +T
Sbjct  323   QFRSFRWNLTSNAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGISHTDLET  382

Query  719   PLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             PLKLAEYFGI++KVFKY+ + +  PE  + + + P+V+N T RNF+E+VFENHEK++Q++
Sbjct  383   PLKLAEYFGIADKVFKYNSVDNPTPEQTKSIKIEPHVLNITHRNFIEVVFENHEKSVQSW  442

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HL+G+SFFAVA+E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS
Sbjct  443   HLNGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRS  502

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPP-PYSG  1228
             +  ER YLGQQLY SVLSPE+SLRDE+N+P+    CGLVK    P  PY+G
Sbjct  503   ENTERRYLGQQLYVSVLSPEKSLRDEYNMPETSLQCGLVKNTPKPANPYAG  553



>ref|XP_007163844.1| hypothetical protein PHAVU_001G269100g [Phaseolus vulgaris]
 gb|ESW35838.1| hypothetical protein PHAVU_001G269100g [Phaseolus vulgaris]
Length=549

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/409 (63%), Positives = 319/409 (78%), Gaps = 6/409 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V ISDWY K H TLKK LDSG +I RP+GV+INGK  K      P+
Sbjct  146   LIPVPYHDPEDDYTVLISDWYTKSHTTLKKFLDSGRSIGRPEGVLINGKTAKGDGSDKPM  205

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVGM+ S+N RF+GH M LVEMEGSH +QN YDSLD+HVG C SVL
Sbjct  206   FTMKPGKTYKYRICNVGMKNSLNLRFQGHLMKLVEMEGSHVVQNNYDSLDVHVGGCFSVL  265

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             +TADK+PKDYY+V S+RF K   +  AI+ Y NG G   SP++P SP     G AWS+NQ
Sbjct  266   ITADKDPKDYYIVASTRFSKTVLTGKAIMRYTNGKG-APSPDIPESP----LGWAWSLNQ  320

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             F++FRWNL+ASAARPNPQGSY Y +I+ITRTIKLVNS S  +GKLRYALNGVSH++ +TP
Sbjct  321   FKTFRWNLSASAARPNPQGSYKYSKIDITRTIKLVNSVSRENGKLRYALNGVSHVDPETP  380

Query  722   LKLAEYFGISEKVFKYDIMGDTPPEN-GEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEYFG+S+KVFKY+ + D PP + G  V + PNV+N T R F+EI+FEN EK+IQ+Y
Sbjct  381   LKLAEYFGVSDKVFKYNTIQDEPPADLGASVKIQPNVLNVTHRKFIEIIFENPEKSIQSY  440

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG++FF V IE G W+P+KRK+YN  DAVSRH++QV+P  WAA++ + DN GMWNLRS
Sbjct  441   HLDGYAFFVVGIEPGTWTPDKRKSYNPFDAVSRHTVQVFPKCWAAILLSTDNVGMWNLRS  500

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
                E  YLGQQLY S++SPE SLRDE+N+PD   LCG+VKG+  PPPY+
Sbjct  501   LTAENMYLGQQLYISIMSPEGSLRDEYNMPDDNLLCGVVKGLPKPPPYT  549



>ref|XP_010673838.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=557

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/412 (62%), Positives = 322/412 (78%), Gaps = 9/412 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGD-KIDP  178
             LIPVP+  P D++ V I DWY + H  L+K+LDSG ++ RPDGV++NGK GKVGD K +P
Sbjct  150   LIPVPYPDPEDDYTVLIGDWYKQSHTALRKVLDSGKSLGRPDGVLMNGKQGKVGDAKEEP  209

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFTM+ GKTY+YR+CNVG++ ++NFR +GH + LVE+EGSH++QN YDSLD+H+GQC +V
Sbjct  210   LFTMKPGKTYKYRICNVGLKNTLNFRIQGHKIKLVEVEGSHSVQNSYDSLDVHLGQCYAV  269

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             LVTAD++PKDYY+V S RF K        I Y NG G  AS  LP +P     G AWS+N
Sbjct  270   LVTADQDPKDYYMVASVRFTKYHLQATGKIRYENGKG-PASNILPEAP----TGWAWSLN  324

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYGQINITRT+KL  + + VDGKLRYA+NGVSH + +T
Sbjct  325   QFRSFRWNLTASAARPNPQGSYHYGQINITRTVKLATTANTVDGKLRYAVNGVSHTDPET  384

Query  719   PLKLAEYFGISEKVFKYDIMGDTPPENGEK---VTLAPNVVNATFRNFVEIVFENHEKTI  889
             P+KLAEY+    KVFKYD +GD PP N EK   +T+AP V+N   R+F+E++FENHEK++
Sbjct  385   PMKLAEYYEAPAKVFKYDPIGDEPPANIEKLDKITIAPIVLNFKHRDFIEVIFENHEKSV  444

Query  890   QTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWN  1069
             Q++ L G++FF VAIE G WSP KRKNYNL+DAVS+++IQVYP SWAA++ T DN GMWN
Sbjct  445   QSFRLAGYAFFPVAIEVGTWSPAKRKNYNLMDAVSKYNIQVYPKSWAAILLTFDNVGMWN  504

Query  1070  LRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             +R++  ERAYLGQQLY SV +PER LRDE+NLPD   LCG+VK M  P PY+
Sbjct  505   VRNECMERAYLGQQLYISVPTPERVLRDEYNLPDNALLCGMVKNMPKPKPYT  556



>emb|CDY43353.1| BnaA01g29840D [Brassica napus]
Length=554

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/411 (62%), Positives = 323/411 (79%), Gaps = 8/411 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID-P  178
             LIP+P+D P D++ V I DWY K H  LKK LD G T+ RP+GV+INGK GK GD  D P
Sbjct  149   LIPIPYDVPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPNGVLINGKAGK-GDGSDAP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFT++ GK+YR R+CNVG++TS+NFR + H M LVEMEGSH +QN +DSLD+HVGQC   
Sbjct  208   LFTLKPGKSYRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDFDSLDVHVGQCFGT  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             +VTA++E KDYY+V SSRF K   +T  ++ Y  G G  AS +LP  P     G AWS+N
Sbjct  268   IVTANQEAKDYYMVASSRFLKSVITTTGLLRYEGGKG-PASSQLPAGP----VGWAWSLN  322

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLT++AARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYALNG+SH + +T
Sbjct  323   QFRSFRWNLTSNAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGISHTDLET  382

Query  719   PLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             PLKLAEYFGI++KVFKY+ + +  PE  + + + P+V+N T RNF+E+VFENHEK++Q++
Sbjct  383   PLKLAEYFGIADKVFKYNSVDNPTPEQTKSIKIEPHVLNITHRNFIEVVFENHEKSVQSW  442

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HL+G+SFFAVA+E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS
Sbjct  443   HLNGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRS  502

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPP-PYSG  1228
             +  ER YLGQQLY SVLSPE+SLRDE+N+P+    CGLVK    P  PY+G
Sbjct  503   ENTERRYLGQQLYVSVLSPEKSLRDEYNMPETSLQCGLVKNTPKPANPYAG  553



>emb|CDY24189.1| BnaC01g37690D [Brassica napus]
Length=554

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/411 (62%), Positives = 323/411 (79%), Gaps = 8/411 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID-P  178
             LIP+P+D P D++ V I DWY K H  LKK LD G T+ RP+GV+INGK GK GD  D P
Sbjct  149   LIPIPYDVPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPNGVLINGKAGK-GDGSDAP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFT++ GK++R R+CNVG++TS+NFR + H M LVEMEGSH +QN +DSLD+HVGQC   
Sbjct  208   LFTLKPGKSHRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDFDSLDVHVGQCFGT  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             +VTA++EPKDYY+V SSRF K   +T  ++ Y  G G  AS +LP  P     G AWS+N
Sbjct  268   IVTANQEPKDYYMVASSRFLKSVITTTGLLRYEGGKG-PASSQLPAGP----VGWAWSLN  322

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLT+SAARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYALNG+SH + +T
Sbjct  323   QFRSFRWNLTSSAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGISHTDLET  382

Query  719   PLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             PLKLAEYFGI++KVFKY+ + +   E  + + + P+V+N T RNF+E+VFENHEK++Q++
Sbjct  383   PLKLAEYFGIADKVFKYNSVDNPTAEQTKSIKIEPHVLNITHRNFIEVVFENHEKSVQSW  442

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HL+G+SFFAVA+E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS
Sbjct  443   HLNGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRS  502

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPP-PYSG  1228
             +  ER YLGQQLY SVLSPE+SLRDE+N+P+    CGLVK    P  PY+G
Sbjct  503   ENTERRYLGQQLYVSVLSPEKSLRDEYNMPETSLQCGLVKNTPKPANPYAG  553



>gb|KHN20513.1| L-ascorbate oxidase like [Glycine soja]
Length=516

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/388 (66%), Positives = 320/388 (82%), Gaps = 9/388 (2%)
 Frame = +2

Query  62    YNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPLFTMEAGKTYRYRVCNVGMRT  241
             +++ H  LK+ LDSG +I RP GV INGK+G     ++PL+TME GKTY+YR+CNVG++ 
Sbjct  137   FSRLHTALKQKLDSGRSIGRPVGVHINGKNGG----LEPLYTMEPGKTYKYRICNVGLKD  192

Query  242   SVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVLVTADKEPKDYYLVVSSRFFK  421
             S+NFR +GH + LVE EGSH +QN YDSLD+HVGQC +VLVTAD+EPKDY++V S+RF K
Sbjct  193   SLNFRIQGHPLKLVETEGSHVVQNNYDSLDVHVGQCYTVLVTADQEPKDYFMVASTRFTK  252

Query  422   QEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQFRSFRWNLTASAARPNPQGS  601
             +  +   +I Y+NG G  AS  LPP+P    +G AWS+NQFRSFRWNLTASAARPNPQGS
Sbjct  253   KVLTATRVIRYSNGVG-PASGGLPPAP----QGWAWSLNQFRSFRWNLTASAARPNPQGS  307

Query  602   YHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVFKYDIMG  781
             YHYGQINITRTIKLVN+ S  +GKLRY LNGVSH++T TPLKLAEY+G+++KVFKY+++ 
Sbjct  308   YHYGQINITRTIKLVNTVSRANGKLRYGLNGVSHVDTQTPLKLAEYYGVADKVFKYNLIS  367

Query  782   DTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAGRWSPEK  961
             D+P      +T+APNV+NATFR+F+E++FEN  K IQ+Y+LDG+SFFA+A+E G+W+PEK
Sbjct  368   DSPDTAFPDLTVAPNVINATFRDFIEVIFENPGKVIQSYNLDGYSFFALAVEPGKWTPEK  427

Query  962   RKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSDMWERAYLGQQLYFSVLSPER  1141
             RKNYNL+DA+SRH+IQV+PNSWAA+M T DNAGMWNLRS+M E  YLGQQLY SVLSP R
Sbjct  428   RKNYNLLDAISRHTIQVFPNSWAAIMLTFDNAGMWNLRSEMAENRYLGQQLYVSVLSPNR  487

Query  1142  SLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             SLRDE+NLP+ Q LCG+VK M  PPPYS
Sbjct  488   SLRDEYNLPETQLLCGIVKDMPKPPPYS  515



>ref|XP_010938086.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=550

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/410 (62%), Positives = 311/410 (76%), Gaps = 7/410 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID--  175
             LIPVP+  PA+EFNV   DWY K HK L ++LDSG  + RP GV+INGKHGK     D  
Sbjct  146   LIPVPYADPAEEFNVLAGDWYTKSHKVLARLLDSGRGVGRPAGVLINGKHGKDASGKDEP  205

Query  176   PLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLS  355
             P+FTMEAGKTYRYRVCNVG++TS++FR + H + LVEMEGSHTIQNVYDSLD+H+GQC S
Sbjct  206   PMFTMEAGKTYRYRVCNVGIKTSLSFRIQKHALRLVEMEGSHTIQNVYDSLDIHIGQCFS  265

Query  356   VLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSI  535
             V VTAD++P DYY+V+S+RF K      AII YA  N   +             G AWS 
Sbjct  266   VFVTADQQPGDYYMVISTRFTKYNCGGTAIIRYAGSNTPPSPDLP-----PAPSGWAWSF  320

Query  536   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTD  715
             NQ+RSFRWNLTASAARPNPQGSYHYG INITRTI+L  S   V+GK RYALNGVSH N  
Sbjct  321   NQWRSFRWNLTASAARPNPQGSYHYGSINITRTIRLRGSTGLVNGKRRYALNGVSHENPA  380

Query  716   TPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             TPLKL+EY+GI+EK FKY+I+GD PP +   + ++PNVVN TFR F+EI+ EN E++I  
Sbjct  381   TPLKLSEYYGIAEKEFKYNIIGDEPPADKSTIVISPNVVNCTFRTFIEIILENPERSIHA  440

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             YHLDG+SFF V +  G W+PE+R+ YNL+DAVSRH++QVYP SW+AVM T DNAGMWNLR
Sbjct  441   YHLDGYSFFPVGMGHGEWTPERRRTYNLLDAVSRHTVQVYPKSWSAVMLTFDNAGMWNLR  500

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             + +W++ YLGQQLY SV+SP RSLRDE+N+P+   LCG V  +  PPPY+
Sbjct  501   TLIWDKQYLGQQLYISVVSPARSLRDEYNIPENTLLCGNVVNLPKPPPYT  550



>ref|XP_009600428.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Nicotiana 
tomentosiformis]
Length=520

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/410 (63%), Positives = 318/410 (78%), Gaps = 38/410 (9%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFDSP +EF+VF+SDWY K HKTL+ ILD G +I RP+G++INGK+GK   K +P+
Sbjct  146   LIPVPFDSPEEEFSVFVSDWYTKSHKTLRSILDEGRSIGRPEGIIINGKNGKGDGKDEPM  205

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             F+M +GKTYRYR CNVGM+ S+N RF+GHTM LVEMEGSHT+QN+Y+SLD+H+GQCLSVL
Sbjct  206   FSMVSGKTYRYRFCNVGMKDSINVRFQGHTMKLVEMEGSHTVQNMYESLDIHLGQCLSVL  265

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+EPKDY+LV SSRF K+     A I Y N                           
Sbjct  266   VTADQEPKDYFLVASSRFTKEPHIATATIRYTN---------------------------  298

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
                      ASAARPNPQGSYHYGQINITRTI+LV++   VDGK RYA+NGVSH++  TP
Sbjct  299   ---------ASAARPNPQGSYHYGQINITRTIRLVSTAGDVDGKRRYAINGVSHVDPTTP  349

Query  722   LKLAEYFGISEKVFKYDIMGD--TPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             +KLAE +G+++KVFKYD++ D    P   EK+TLAPNVVNAT+RNFVEI+ ENHEK++Q+
Sbjct  350   IKLAELYGVADKVFKYDLIKDEYIAPSGNEKITLAPNVVNATYRNFVEIILENHEKSVQS  409

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HL G++FFAVAIEAGRW PE+R+NYNL+DAVSR++IQVYPNSWAA+MTTLDNAG+WNLR
Sbjct  410   WHLAGYNFFAVAIEAGRWKPERRQNYNLLDAVSRNTIQVYPNSWAAIMTTLDNAGLWNLR  469

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             S+  ER YLG QLYFSVLSP  SL+DE+N+PD   LCG++K + +P PYS
Sbjct  470   SNSLERQYLGHQLYFSVLSPSCSLKDEYNMPDNDILCGIIKDLPLPKPYS  519



>emb|CAA47176.1| Bplo [Brassica napus]
Length=554

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/411 (62%), Positives = 322/411 (78%), Gaps = 8/411 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID-P  178
             LIP+P+D P D++ V I DWY K H  LKK LD G T+ RP+GV+INGK GK GD  D P
Sbjct  149   LIPIPYDVPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPNGVLINGKAGK-GDGSDAP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFT++ GK+YR R+CNVG++TS+NFR + H M LVEMEGSH +QN +DSLD+HVGQC   
Sbjct  208   LFTLKPGKSYRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDFDSLDVHVGQCFGT  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             +VTA++EPKDYY+V SSRF K   +T  ++ Y  G G  AS +LP  P     G AWS+N
Sbjct  268   IVTANQEPKDYYMVASSRFLKSVITTTGLLRYEGGKG-PASSQLPAGP----VGWAWSLN  322

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLT++AARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYALNG+SH + +T
Sbjct  323   QFRSFRWNLTSNAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGISHTDLET  382

Query  719   PLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             PLKLAEYFGI++KVFKY+ + +   E  + + + P+V+N T RNF+E+VFENHEK++Q++
Sbjct  383   PLKLAEYFGIADKVFKYNSVDNPTAEQTKSIKIEPHVLNITHRNFIEVVFENHEKSVQSW  442

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HL+G+SFFAVA+E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+ S
Sbjct  443   HLNGYSFFAVAVEPGSWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIAS  502

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPP-PYSG  1228
             +  ER YLGQQLY SVLSPE+SLRDE+N+P+    CGLVK    P  PY+G
Sbjct  503   ENTERRYLGQQLYVSVLSPEKSLRDEYNMPETSLQCGLVKNTPKPANPYAG  553



>gb|KHG05644.1| L-ascorbate oxidase [Gossypium arboreum]
Length=535

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/406 (63%), Positives = 316/406 (78%), Gaps = 5/406 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  PAD++ +   D++NKG+ +LKK+L SG  + R DGV INGK  K     +PL
Sbjct  132   LIPVPYADPADDYTLIAGDFFNKGYTSLKKVLLSGRNLGRCDGVHINGKVAKGDGNDEPL  191

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTMEAGKTY+YR+CN G++TS+N RF+GHTM LVEMEGSHT+QN Y+SLD+HVGQC SVL
Sbjct  192   FTMEAGKTYKYRICNAGIKTSLNVRFQGHTMKLVEMEGSHTVQNDYESLDVHVGQCFSVL  251

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA++EPKDY++V S+RF K+E     +I Y NG G  +               AWS+NQ
Sbjct  252   VTANQEPKDYFVVASTRFTKREVIATGVIRYNNGKGAPSPKLP-----PPPVSWAWSLNQ  306

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FR+FRWNLTASAARPNPQGSY YG INITRTIKL N+   VDGKLRYALNGVS++   TP
Sbjct  307   FRTFRWNLTASAARPNPQGSYKYGSINITRTIKLANTAHKVDGKLRYALNGVSYVEPTTP  366

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEY+ +++KVFKYD + D PP    KVT+ P V+N T RNF+EI+FEN E  IQ+YH
Sbjct  367   LKLAEYYNVADKVFKYDNIPDDPPAEITKVTMEPIVLNMTHRNFIEIIFENRETAIQSYH  426

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAVAIE G+WSPEKRKNYNL+DAVSRH+IQV+P SWAA++ T DN GMWN+RS+
Sbjct  427   LDGYSFFAVAIETGKWSPEKRKNYNLLDAVSRHTIQVFPKSWAAILLTFDNCGMWNIRSE  486

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPP  1219
             +W+R YLGQQLY SV+SP +SL+DE+N+PD   +CG+V+ M  PPP
Sbjct  487   VWDRHYLGQQLYASVVSPNKSLKDEYNMPDGALVCGVVESMPRPPP  532



>ref|XP_004970369.1| PREDICTED: L-ascorbate oxidase homolog [Setaria italica]
Length=557

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/408 (63%), Positives = 311/408 (76%), Gaps = 8/408 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD+PAD+F V +SDWY K H  L K LDSG  I RP G+VINGK+ K      P+
Sbjct  154   LIPVPFDTPADDFPVLVSDWYTKDHTVLAKNLDSGKGIGRPAGLVINGKNEKDASN-PPM  212

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             + MEAGKTYR+RVCN+G++ S N R + H + LVEMEGSHT+QN YDSLDLH+GQCLS L
Sbjct  213   YNMEAGKTYRFRVCNLGIKASFNVRIQKHILKLVEMEGSHTVQNTYDSLDLHIGQCLSFL  272

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSP-PENTEGIAWSIN  538
             VTAD+ P DY LV S+RF K+  +  A+I Y   N    +P  PPS  PE   G AWSIN
Sbjct  273   VTADQAPGDYLLVASTRFIKEVSTITAVIRYKGSN----TP--PPSQLPEAPSGWAWSIN  326

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             Q+RSFRWNLTASAARPNPQGSYHYGQINITRTIKL  SK  VDGK RYALNGVSH++T+T
Sbjct  327   QWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLATSKGKVDGKERYALNGVSHVDTET  386

Query  719   PLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             PLKLAEYF  ++ VF+Y+IMGD PP  G  + +APNV++A FR F+E+VFEN EK+I T+
Sbjct  387   PLKLAEYFNATDGVFQYNIMGDVPPAAGTPIKMAPNVISAEFRTFIEVVFENPEKSIDTF  446

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             H++G++FFA  +  G WSP  RK YNL+D VSRH+IQVYP SW AVM T DNAGMWN+RS
Sbjct  447   HINGYAFFAAGMGPGTWSPASRKTYNLLDTVSRHTIQVYPRSWTAVMLTFDNAGMWNIRS  506

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             ++WER YLG+QLY SV SP RSLRDE+N+P+    CG V G+ MPP Y
Sbjct  507   NLWERHYLGEQLYVSVTSPARSLRDEYNMPETSLRCGKVVGLPMPPSY  554



>ref|XP_008793387.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=550

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/410 (62%), Positives = 308/410 (75%), Gaps = 7/410 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID--  175
             LIPVP+  PADEFNV   DWY K HK L ++LD G  I RP GV+INGKHGK     D  
Sbjct  146   LIPVPYADPADEFNVLAGDWYTKSHKVLARLLDRGRGIGRPAGVLINGKHGKDASGKDEP  205

Query  176   PLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLS  355
             P+FTMEAGKTYRYRVCNVG++TS+N R + H + LVEMEGSHTIQNVYDSLDLH GQC S
Sbjct  206   PMFTMEAGKTYRYRVCNVGIKTSLNLRIQKHKLRLVEMEGSHTIQNVYDSLDLHTGQCFS  265

Query  356   VLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSI  535
             V VTAD++P DYY+V+S+RF K      AII YA  N   +          +  G AWS 
Sbjct  266   VFVTADQQPGDYYMVISTRFTKYNCGGTAIIRYAGSNMPPSPDLP-----PSPSGWAWSF  320

Query  536   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTD  715
             NQ+RSFRWNLTASAARPNPQGSYHYG INITRTI+L  S   V+GK RYALNGVSH N  
Sbjct  321   NQWRSFRWNLTASAARPNPQGSYHYGSINITRTIRLRGSTGLVNGKRRYALNGVSHENPA  380

Query  716   TPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             TPLKL+EY+ I++K FKY+I+GD PP +   + +APNV+  TFR F+EI+ EN E++I +
Sbjct  381   TPLKLSEYYSITDKEFKYNIIGDEPPADKSPIVIAPNVIKCTFRTFIEIILENPERSIHS  440

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             YHLDG+SFF   +  G WSPEKR+ YNL+DAVSRH++QVYP SW+A+M T DNAGMWNLR
Sbjct  441   YHLDGYSFFPAGMGHGEWSPEKRRTYNLLDAVSRHTVQVYPKSWSAIMLTFDNAGMWNLR  500

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             + +W++ YLGQQLY SV+SPERSLRDE+N+P+   LCG V  +  PPPY+
Sbjct  501   TMIWDKQYLGQQLYISVISPERSLRDEYNIPENSLLCGNVVNLPKPPPYA  550



>ref|XP_007157831.1| hypothetical protein PHAVU_002G101800g [Phaseolus vulgaris]
 gb|ESW29825.1| hypothetical protein PHAVU_002G101800g [Phaseolus vulgaris]
Length=553

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/409 (63%), Positives = 316/409 (77%), Gaps = 8/409 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID-P  178
             LIPVP+  P D++ V   DWY K H TL K+LDSG  + RP  +++NG++ K GD  D P
Sbjct  150   LIPVPYADPEDDYTVLAGDWYTKSHSTLAKLLDSGRALGRPQALLVNGQNAK-GDGTDKP  208

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFTM  GKTY+YR+CNVG++ S+NFR + H M LVEMEGSHT+QNVYDSLD+H+GQC  V
Sbjct  209   LFTMLPGKTYKYRLCNVGLKNSINFRIQNHQMKLVEMEGSHTVQNVYDSLDVHLGQCFGV  268

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             LVTAD+E KDYY+V S+RF K   +   II YANG G  ASPE+P +P     G AWS+N
Sbjct  269   LVTADQEAKDYYIVASTRFTKTVLTGKGIIRYANGKG-PASPEIPEAP----VGWAWSLN  323

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYGQINITRT+K VNS S  +GKLRYA+NGVSH++ DT
Sbjct  324   QFRSFRWNLTASAARPNPQGSYHYGQINITRTLKFVNSVSRDNGKLRYAINGVSHVDGDT  383

Query  719   PLKLAEYFGISEKVFKYDIMGDTPPEN-GEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             PLKL++Y+GI  K FK D + D P  + G  VTLAPNV+   +R F+EI+FENHEK++Q+
Sbjct  384   PLKLSDYYGIGSKFFKNDTIPDQPAADLGSAVTLAPNVMKFEYRTFIEIIFENHEKSVQS  443

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             Y+L+G+SFFAVAIE G W+PEKRK YNL+D VSRH++QV+P SWAA+M T DN GMWNLR
Sbjct  444   YNLNGYSFFAVAIEPGTWTPEKRKGYNLLDGVSRHTVQVFPKSWAAIMLTFDNVGMWNLR  503

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             S++ E  YLGQQLY SV +PE SLRDE+N+P+   LCG V G+  P PY
Sbjct  504   SEIAENRYLGQQLYISVPTPEGSLRDEYNIPENAVLCGAVVGLPKPAPY  552



>ref|XP_008788020.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=551

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/412 (61%), Positives = 308/412 (75%), Gaps = 11/412 (3%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGK--VGDKID  175
             LIPVPF  PA EFNV   DW+ K HK L + LD+G  +  P GV+ING+ GK   G    
Sbjct  147   LIPVPFAPPAQEFNVLAGDWFTKSHKVLARQLDAGRGLGLPAGVLINGRLGKDAAGRDEP  206

Query  176   PLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLS  355
             P+FTM+AG  YR+R CNVG++TS+NFR + H++ LVEMEGSHT+QN+YDSLD+HVGQCLS
Sbjct  207   PMFTMQAGNVYRFRFCNVGLKTSLNFRLQKHSLKLVEMEGSHTVQNLYDSLDVHVGQCLS  266

Query  356   VLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSP--PENTEGIAW  529
             VLVTAD+ P DYYLV S+RF K+  +  A++ YA  N        PPSP  P+   G AW
Sbjct  267   VLVTADQAPGDYYLVASTRFTKEILAATAVLRYAGSNA-------PPSPVIPDGPSGWAW  319

Query  530   SINQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHIN  709
             S NQ+R+FRWNLTASAARPNPQGSYHYGQINITRTIKLVN  S VDGK R+ +NG+SH++
Sbjct  320   SFNQWRTFRWNLTASAARPNPQGSYHYGQINITRTIKLVNGHSVVDGKRRHFINGISHVD  379

Query  710   TDTPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTI  889
              DTPLKLAEYF +S+  F+Y++MGD PP     VTLAPNV+ A FR F+EI+FEN E++I
Sbjct  380   PDTPLKLAEYFNLSKPAFEYNLMGDVPPAPDAPVTLAPNVITAEFRTFIEIIFENTERSI  439

Query  890   QTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWN  1069
             Q+YHLDG++FF   +  G+WSPE RK YN +D VSRHSIQV+P SW A+M T DNAGMWN
Sbjct  440   QSYHLDGYAFFPAGMGPGKWSPESRKRYNHLDTVSRHSIQVFPRSWTAIMLTFDNAGMWN  499

Query  1070  LRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             LRS  WE  YLGQQLY SV SP RSLRDE+N+P     CG V G+ +PP Y+
Sbjct  500   LRSMNWENKYLGQQLYVSVTSPARSLRDEYNMPANALRCGAVVGLPLPPSYT  551



>ref|XP_010921259.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=550

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/410 (61%), Positives = 311/410 (76%), Gaps = 7/410 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID--  175
             LIPVP+  PADEFN+   +WY K HK L + LDSG  I RP GV+INGKHGK     D  
Sbjct  146   LIPVPYTDPADEFNILAGEWYTKSHKVLARFLDSGRGIGRPAGVLINGKHGKDASGKDEP  205

Query  176   PLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLS  355
             P+FT+EAGKTYR+RVCN+G++ S+NFR + H + LVEMEGSH +QN+YDSLDLH+GQC S
Sbjct  206   PMFTVEAGKTYRFRVCNIGIKNSLNFRIQKHALRLVEMEGSHVVQNMYDSLDLHIGQCFS  265

Query  356   VLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSI  535
             V VTAD++P DYY++ S+RF K +    AII YA G+    S +LPP P     G AWS 
Sbjct  266   VFVTADQQPGDYYILASTRFTKYKCDGSAIIRYA-GSNTPPSKDLPPGP----SGWAWSF  320

Query  536   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTD  715
             NQ+RSFRWNLTASAARPNPQGSYHYGQINITRTI+L      V+GK RYA+NGVSH N  
Sbjct  321   NQWRSFRWNLTASAARPNPQGSYHYGQINITRTIRLRGGTGLVNGKRRYAINGVSHDNPV  380

Query  716   TPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             TP KL+EYFGI++K FKY+I+GD PP     +T+APNVVN TFR F+EI+ EN E++I  
Sbjct  381   TPFKLSEYFGIADKEFKYNIIGDEPPTGKSPITIAPNVVNCTFRTFIEIILENPERSIHA  440

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             YH+DG++FF V +  G W PEKR+ YNL+DA SRH++QVYP SW+A+M T DNAGMWNLR
Sbjct  441   YHIDGYAFFPVGMGHGEWDPEKRRTYNLLDASSRHTVQVYPKSWSAIMLTFDNAGMWNLR  500

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             + +W++ YLGQQLYFSV+SP RSLRDE+N+P+   LCG V  +  P PY+
Sbjct  501   TLVWDKQYLGQQLYFSVVSPARSLRDEYNIPENALLCGNVVKLPQPAPYT  550



>ref|XP_003567221.1| PREDICTED: L-ascorbate oxidase homolog [Brachypodium distachyon]
Length=557

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/407 (61%), Positives = 319/407 (78%), Gaps = 6/407 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD PAD+F+V + DWY K    L+K +D+G +I RP G++INGK+ K      P+
Sbjct  154   LIPVPFDPPADDFSVLVGDWYTKDFAVLEKHIDTGKSIGRPAGLLINGKNEKDASN-PPM  212

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             + +EAGKTYR+RVCNVG+++S+N R +GH + LVEMEGSHT+QN YDSLD+HVGQCLS L
Sbjct  213   YNVEAGKTYRFRVCNVGIKSSLNVRVQGHMIKLVEMEGSHTVQNEYDSLDVHVGQCLSFL  272

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTA+++P DY LV S+RF K+  +  AII Y  G+ + ASP+LP +P     G AWSINQ
Sbjct  273   VTANQKPGDYLLVASTRFIKEVSTITAIIRY-KGSSVPASPKLPEAP----NGWAWSINQ  327

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             +RSFRWNLTASAARPNPQGSYHYGQINITRTIKL  S++ VDGK RYALNGVSH++ DTP
Sbjct  328   WRSFRWNLTASAARPNPQGSYHYGQINITRTIKLSTSRAKVDGKERYALNGVSHVDPDTP  387

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
              KLAEYF  +  VF+Y+++GDTPP+ G  + +APN++ A FR F+E+VFEN EK+I ++H
Sbjct  388   PKLAEYFNATTGVFEYNLIGDTPPKEGTPIKVAPNILTAEFRTFIEVVFENPEKSIDSFH  447

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             L+G++FFA  +  G W+P+ RK YNL+D VSRH+IQVYP SW A+M T DNAGMWNLR++
Sbjct  448   LNGYAFFAAGMGPGLWTPDCRKTYNLLDTVSRHTIQVYPRSWTAIMLTFDNAGMWNLRTN  507

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             +WER Y+G+QLY SV SP RSLRDE+N+PD    CG V GM +PPPY
Sbjct  508   IWERYYMGEQLYMSVTSPARSLRDEYNMPDNGLRCGKVVGMPLPPPY  554



>ref|XP_008804666.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=551

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/412 (62%), Positives = 306/412 (74%), Gaps = 11/412 (3%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGK--VGDKID  175
             LIPVPFD PA+EFNV   DW+ K HK L   LD+G ++  P GV+ING+ GK   G    
Sbjct  147   LIPVPFDPPAEEFNVLAGDWFTKSHKVLAGQLDAGRSVGHPAGVLINGRRGKDAAGHDEP  206

Query  176   PLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLS  355
             P+FTM+AG  YR+R CNVG++TS+NFR + H + LVEMEGSHT+QN+Y SLD+HVGQCLS
Sbjct  207   PMFTMQAGDVYRFRFCNVGLKTSLNFRIQKHPLKLVEMEGSHTVQNLYTSLDVHVGQCLS  266

Query  356   VLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSP--PENTEGIAW  529
             VLVTAD+ P DYYLV S+RF K+  +  A++ YA  N        PPSP  PE   G AW
Sbjct  267   VLVTADQAPGDYYLVASTRFTKKVLTATAVLRYAGSN-------TPPSPVIPEGPTGWAW  319

Query  530   SINQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHIN  709
             S NQ+R+FRWNLTASAARPNPQGSYHYGQINITR+I+LVN  S VDGK R  +NGVSH++
Sbjct  320   SFNQWRTFRWNLTASAARPNPQGSYHYGQINITRSIRLVNGHSIVDGKRRNFINGVSHVD  379

Query  710   TDTPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTI  889
              DTPLKLAEYF +S  VFKY +MGD PP     VTLAPNV+   FR F+EI+FEN EK+I
Sbjct  380   PDTPLKLAEYFNLSNPVFKYSLMGDAPPAPDTPVTLAPNVIAVEFRTFIEIIFENTEKSI  439

Query  890   QTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWN  1069
             Q+YHLDG++FF   +  G+WSPE RK YNL+D VSRHS+ V+P SW A++ T DNAGMWN
Sbjct  440   QSYHLDGYAFFPAGMGPGKWSPESRKRYNLLDTVSRHSVHVFPKSWTAILLTFDNAGMWN  499

Query  1070  LRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             LRS  WE  YLGQQLY SV SPERSLRDE+N+P     CG V G+ +PP Y+
Sbjct  500   LRSMNWENKYLGQQLYVSVTSPERSLRDEYNMPLNALRCGAVVGLPLPPSYT  551



>ref|XP_010552290.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=553

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/410 (62%), Positives = 320/410 (78%), Gaps = 7/410 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID-P  178
             LIPVP+  P D++ V I DWY K H  LKK LDSG ++ RPDG++INGK GK     D P
Sbjct  149   LIPVPYADPEDDYTVLIGDWYAKSHTALKKFLDSGRSLGRPDGILINGKSGKGSSGSDAP  208

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFTM+ GKTYR R+CNVG++TS+NFR + H M LVEMEGSH +QN YDSLD+HVGQC   
Sbjct  209   LFTMKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCYGT  268

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
             +VTAD++PKDY +V SSRF K   ST  ++ Y  G G  AS E+P +P     G AWS+N
Sbjct  269   IVTADQDPKDYLMVASSRFLKSVISTTGVLRYDGGKG-PASSEIPAAP----VGWAWSLN  323

Query  539   QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
             QFRSFRWNLTASAARPNPQGSYHYG+INITRTIK VN++   DGKLRYAL+GVSH + +T
Sbjct  324   QFRSFRWNLTASAARPNPQGSYHYGKINITRTIKFVNTQGKADGKLRYALSGVSHTDPET  383

Query  719   PLKLAEYFGISEKVFKYDIMGDTPPENGEK-VTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             P+KLAEYFG+++KVFKY+I+ D+P  +  K + + PN++N T R FVE++FENHE+++Q+
Sbjct  384   PVKLAEYFGMADKVFKYNIISDSPTSDQTKTIKIEPNILNVTHRTFVEVIFENHERSVQS  443

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +H+DG++FFAVA+E G W+PEKR+NYNL+DAVSRH++QV+P  WAAV+ + DN GMWN+R
Sbjct  444   WHIDGYAFFAVAVEPGTWTPEKRENYNLLDAVSRHTVQVFPKCWAAVLLSFDNCGMWNVR  503

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             S+  ER YLGQQLY SVLSPE SLRDE+N+P     CGLVKG+  P PY+
Sbjct  504   SENMERRYLGQQLYLSVLSPESSLRDEYNMPQNSLQCGLVKGLPKPQPYA  553



>ref|NP_001132891.1| uncharacterized protein LOC100194388 [Zea mays]
 gb|ACF81925.1| unknown [Zea mays]
Length=421

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/407 (61%), Positives = 304/407 (75%), Gaps = 6/407 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD+PAD+F V + DWY K H  L K LD+G  I RP G+VINGK+ K      P+
Sbjct  18    LIPVPFDTPADDFPVLVGDWYTKDHTVLAKNLDAGKGIGRPAGLVINGKNEKDASN-PPM  76

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             + +EAGKTYR+RVCNVG++ S N R + H M LVEMEGSHT+QN YDSLDLH+GQCLS L
Sbjct  77    YNVEAGKTYRFRVCNVGIKASFNIRIQNHIMKLVEMEGSHTMQNDYDSLDLHIGQCLSFL  136

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD++P DY L VS+RF K+  S  A+I Y   N   A P  P   PE+  G AWSINQ
Sbjct  137   VTADQKPGDYLLAVSTRFIKEVNSITAVIRYKGSN---APP--PAKVPESPSGWAWSINQ  191

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
              RSFRWNLTASAARPNPQGSYHYGQINITRTIKL   +  VDGK R+  NGVSH++ +TP
Sbjct  192   CRSFRWNLTASAARPNPQGSYHYGQINITRTIKLAMGRGKVDGKERFGFNGVSHVDPETP  251

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             +KLAEYF  ++ VF+YDI+GD PP       +APNV+ A FR F+E+VFEN EK+I T H
Sbjct  252   VKLAEYFNTTDGVFQYDIIGDVPPSKSAPTKMAPNVIRAEFRTFIEVVFENPEKSIDTIH  311

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             +DG++FFAV +  G+W+P  R  YNL+D VSRH+IQVYP SW AVM T DNAGMW++RS+
Sbjct  312   IDGYAFFAVGMGPGKWTPASRSTYNLLDTVSRHTIQVYPRSWTAVMMTFDNAGMWSIRSN  371

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             +WER YLG+QLY SV+SPERSLRDE+N+P+    CG V G+ MPP Y
Sbjct  372   IWERQYLGEQLYVSVISPERSLRDEYNMPETSLRCGKVVGLPMPPSY  418



>gb|ADK47981.1| L-ascorbate oxidase-like protein [Cynodon dactylon]
Length=550

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/407 (61%), Positives = 313/407 (77%), Gaps = 6/407 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPV FD+PAD+F V + DWY K H  L K LD+G  I RP G++INGK+ K      P+
Sbjct  147   LIPVLFDAPADDFPVLVGDWYTKDHTVLAKHLDAGKGIGRPAGLIINGKNDKDAASA-PM  205

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             +  EAGKTYR+RVCNVG++ S+N R  GH + LVEMEGSHT+QN+YDSLD+HVGQCLS L
Sbjct  206   YNFEAGKTYRFRVCNVGIKASLNVRVPGHNLKLVEMEGSHTVQNMYDSLDVHVGQCLSFL  265

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD++P DY+LVVS+RF K+  +  A+I Y  G+    SP+LP  P     G AWSINQ
Sbjct  266   VTADQKPADYFLVVSTRFIKEVSTITALIRY-KGSSTPPSPKLPEGP----SGWAWSINQ  320

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             +RSFRWNLTASAARPNPQGSYHYGQINITRTIKL  S+  VDGK RYALNGVSH++ +TP
Sbjct  321   WRSFRWNLTASAARPNPQGSYHYGQINITRTIKLSTSRGKVDGKERYALNGVSHVDAETP  380

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYF  ++ VF+Y+++ D PP+ G  + LAPNV++A FR F+E+VFEN EK+I ++H
Sbjct  381   LKLAEYFNATDGVFQYNLISDVPPKAGTPIKLAPNVLSAEFRTFIEVVFENPEKSIDSFH  440

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             +DG++FF   +  G WSP+ RK YNL+D VSRH+IQVYP SW AVM T DNAGMWN+RS+
Sbjct  441   IDGYAFFTAGMGPGTWSPQSRKTYNLLDTVSRHTIQVYPRSWTAVMLTFDNAGMWNVRSN  500

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             +WER YLG+Q+Y SV+SP RSLRDE+N+P+    CG V G+ MPP Y
Sbjct  501   LWERQYLGEQMYISVISPARSLRDEYNMPETSLRCGKVVGLPMPPSY  547



>ref|XP_003529457.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=552

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/411 (61%), Positives = 318/411 (77%), Gaps = 12/411 (3%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID-P  178
             LIPVP+  P D++ V   DW+ K H TL+K+LD G ++ RP  V++NG++ K GD  D P
Sbjct  149   LIPVPYADPEDDYTVLAGDWFTKSHSTLRKLLDGGRSLGRPQAVLLNGQNAK-GDGTDKP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
             LFTM  GKTY+YR+CNVG++ ++NFR + H M LVEMEGSHT+QN Y+SLD+H+GQC  V
Sbjct  208   LFTMIPGKTYKYRICNVGLKNTINFRIQNHPMKLVEMEGSHTVQNTYNSLDVHLGQCFGV  267

Query  359   LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSP--PENTEGIAWS  532
             LVTA++EPKDYY+V S+RF K   +   I+ Y  G         PPSP  PE   G AWS
Sbjct  268   LVTANQEPKDYYMVASTRFTKSILTGKGIMRYTTGKA-------PPSPEIPEAPVGWAWS  320

Query  533   INQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINT  712
             +NQFRSFRWNLTASAARPNPQGSYHYGQ+NITRT+K +NS S   GKLRYA+NGVSH++ 
Sbjct  321   LNQFRSFRWNLTASAARPNPQGSYHYGQVNITRTVKFINSVSRDSGKLRYAINGVSHVDG  380

Query  713   DTPLKLAEYFGISEKVFKYDIMGDTPPEN-GEKVTLAPNVVNATFRNFVEIVFENHEKTI  889
             +TP+KLAEYFG+ EKVFKYDI+ D P ++ G+ V L PNV+    R F+EI+FEN EK++
Sbjct  381   ETPIKLAEYFGVPEKVFKYDIISDNPSQDVGKNVVLQPNVIRFKHRTFIEIIFENPEKSV  440

Query  890   QTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWN  1069
             Q+YHL+G++FFAVAIE G W+PEKRKNYNL+DAVSRH++ V+P SWAA++ + DN G+WN
Sbjct  441   QSYHLNGYAFFAVAIEPGTWTPEKRKNYNLLDAVSRHTMPVFPKSWAAILLSFDNVGVWN  500

Query  1070  LRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             LRS++ E  YLGQQLY SVL+PERSLRDE+N+P+   LCG+VKG+  P PY
Sbjct  501   LRSELAENRYLGQQLYISVLTPERSLRDEYNIPEYALLCGVVKGLPKPEPY  551



>gb|KFK27206.1| hypothetical protein AALP_AA8G349600 [Arabis alpina]
Length=559

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/408 (62%), Positives = 315/408 (77%), Gaps = 7/408 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIP+P+  P D++ V I DWY K H TLK  LDSG +I RP GV+INGK GK     +P+
Sbjct  152   LIPIPYADPEDDYTVLIGDWYTKTHVTLKNNLDSGRSIGRPAGVLINGKSGKPDGTGEPI  211

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTYRYR+CNVGM+ ++NFR + H + LVE+EGSHT+QN+YDSLDLHVGQC  VL
Sbjct  212   FTMKPGKTYRYRICNVGMKMALNFRIQNHKIKLVELEGSHTLQNLYDSLDLHVGQCFGVL  271

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+EPKDYY+V S+RF K   ++ AI+ Y  G G  ASP+LP SP     G AWS+NQ
Sbjct  272   VTADQEPKDYYMVASTRFLKSVLTSTAILRYEGGKG-AASPQLPKSP----VGWAWSLNQ  326

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDG-KLRYALNGVSHINTDT  718
             FRSFRWNLT++AARPNPQGSYHYG+INITR+IKLVN+    DG KLRYAL+GVSH+ TDT
Sbjct  327   FRSFRWNLTSNAARPNPQGSYHYGKINITRSIKLVNTIGKDDGKKLRYALSGVSHVETDT  386

Query  719   PLKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             P+KLA+YFG+++KVFKYD + D P      K+ + PNV+N   R FVEIVFENHEKT Q+
Sbjct  387   PVKLAQYFGVADKVFKYDTIKDEPTAAETSKILVQPNVLNIEHRAFVEIVFENHEKTTQS  446

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG+SFFAVA+E G W+PEKRKNYNL+DAVSRH+IQVYP  W A++ T DN GMWN+R
Sbjct  447   WHLDGYSFFAVAVEPGNWTPEKRKNYNLLDAVSRHTIQVYPKCWGAILLTFDNCGMWNIR  506

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPP  1219
             S++ E+ YLGQQLY +V  PE S+RDE++ P     CG+VK +  P P
Sbjct  507   SEILEKRYLGQQLYVNVGPPELSMRDEYSFPANGLRCGIVKDLPHPHP  554



>ref|XP_008782736.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=550

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/410 (61%), Positives = 307/410 (75%), Gaps = 7/410 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID--  175
             LIPVP+  PADEFN+   DWY K HK L   LDSG +I RP GV+INGKHGK     D  
Sbjct  146   LIPVPYADPADEFNILAGDWYTKSHKVLAGRLDSGRSIGRPAGVLINGKHGKDASGKDEP  205

Query  176   PLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLS  355
             P+FTMEAGKTYR+RVCN+G++ S+NFR + H++ LVEMEGSH +QN YDSLDLH+GQC S
Sbjct  206   PMFTMEAGKTYRFRVCNIGIKDSLNFRIQKHSLRLVEMEGSHVVQNTYDSLDLHIGQCFS  265

Query  356   VLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSI  535
             V VTAD++P DYY+++S+RF K      AI+ YA  N    S +LPP+P     G AWS 
Sbjct  266   VFVTADQQPGDYYILMSTRFTKYSCGGSAIVRYAGSNA-PPSKDLPPAP----SGWAWSF  320

Query  536   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTD  715
             NQ+RSFRWNLTASAARPNPQGSYHYGQINITRTIKL      V+GK RYA+NGVSH N  
Sbjct  321   NQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLRGGTGLVNGKRRYAINGVSHENPV  380

Query  716   TPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             TPLKL+EY+GI++K FKY I+GD PP     +T+APNV+N TFR F+E++ EN E++I  
Sbjct  381   TPLKLSEYYGIADKEFKYSIIGDEPPNGKSLITIAPNVINCTFRTFIEVILENPERSIHA  440

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             YHLDG++FF   +  G W+PEKR  YNL+DA SRH++QVYP SW+A+M T DNAGMWNLR
Sbjct  441   YHLDGYAFFPAGMGHGEWTPEKRVTYNLLDAASRHTVQVYPKSWSAIMLTFDNAGMWNLR  500

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             + +W++ YLGQQLY SV SP RSLRDE+N+P+    CG V  +  P PY+
Sbjct  501   TLVWDKQYLGQQLYISVASPARSLRDEYNMPENALHCGNVVNLPKPAPYT  550



>ref|XP_010922850.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=551

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/411 (61%), Positives = 307/411 (75%), Gaps = 11/411 (3%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGK--VGDKID  175
             LIPVPF  PA+EFNV   DW+ +GHK L + LD+G  +  P GV+ING+ G+   G    
Sbjct  147   LIPVPFAPPAEEFNVLAGDWFTRGHKVLARKLDAGRRLGLPAGVLINGRSGRNAAGHDDL  206

Query  176   PLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLS  355
             P+FTM+AG  YR+R CNVG++ S+NFR + H++ LVEMEGSHT+QN+YDSLD+HVGQC+S
Sbjct  207   PMFTMQAGNVYRFRFCNVGLKASLNFRIQKHSLKLVEMEGSHTVQNLYDSLDVHVGQCMS  266

Query  356   VLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSP--PENTEGIAW  529
             VLVTAD+ P DYYLV S+RF K+  +  A++ YA  N        PPS   P    G AW
Sbjct  267   VLVTADQAPGDYYLVASTRFTKKVHTATAVLRYAGSNS-------PPSRVIPRGPSGWAW  319

Query  530   SINQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHIN  709
             S NQ+R+FRWNLTASAARPNPQGSYHYGQINITRTI+LVN  + VDGKLRY +NG+SH+ 
Sbjct  320   SFNQWRTFRWNLTASAARPNPQGSYHYGQINITRTIRLVNGHNVVDGKLRYFINGISHVE  379

Query  710   TDTPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTI  889
             +DTPLKLAEYF  S  VFKY++MGD PP     +TL PNV+ A FR F+EI+FEN E++I
Sbjct  380   SDTPLKLAEYFNASSPVFKYNLMGDVPPAPDAPLTLVPNVITAEFRTFIEIIFENTERSI  439

Query  890   QTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWN  1069
             Q+YHLDG++FF V +  G+WSPE RK YNL+D VSRHSI+V+P SW A++ T DNAGMWN
Sbjct  440   QSYHLDGYAFFPVGMGPGKWSPESRKRYNLLDTVSRHSIEVFPRSWTAILLTFDNAGMWN  499

Query  1070  LRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             LRS  WE  YLGQQLY SV SP RSLRDE+N+P     CG V G+ +PP Y
Sbjct  500   LRSMNWENKYLGQQLYVSVTSPARSLRDEYNMPLNALRCGQVIGLPLPPSY  550



>ref|XP_008449954.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=446

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/352 (70%), Positives = 294/352 (84%), Gaps = 6/352 (2%)
 Frame = +2

Query  173   DPLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCL  352
             +PLFTM+ GKTY+YRVCNVG++TS+NFRF+GHTM LVEMEGSHT+QN Y SLD+HVGQC 
Sbjct  99    NPLFTMKPGKTYKYRVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQNDYKSLDVHVGQCF  158

Query  353   SVLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWS  532
             SVLVTAD+EPKDYY+V S+RF K       I+ Y NG G  ASPELP +P     G AWS
Sbjct  159   SVLVTADQEPKDYYMVASTRFIKSALVGKGIVRYTNGKG-PASPELPNAP----MGWAWS  213

Query  533   INQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINT  712
             +NQFR+FRWNLTASAARPNPQGSYHYG INITRTIKLVNS S VDGKLRYA+NGVSH++ 
Sbjct  214   LNQFRTFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASKVDGKLRYAINGVSHVDP  273

Query  713   DTPLKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTI  889
             +TPLKLAEYFG+++KVFKYD + D    E    VT+APNVVN TFRNF+EI+FENHEK++
Sbjct  274   ETPLKLAEYFGVTDKVFKYDTISDEGLAEGATTVTVAPNVVNTTFRNFIEIIFENHEKSL  333

Query  890   QTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWN  1069
             Q++HLDG+SFFAVAIE GRW+PEKR +YNL+DAVSRH+IQV+P SWAA++ T DNAGMWN
Sbjct  334   QSWHLDGYSFFAVAIEPGRWTPEKRSDYNLLDAVSRHTIQVFPKSWAAILLTFDNAGMWN  393

Query  1070  LRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             LRS++ E  YLGQQLY SV SP RSLRDE+N+PD   LCGLVK + +P PY+
Sbjct  394   LRSELAENRYLGQQLYMSVQSPARSLRDEYNIPDNTLLCGLVKDLPLPKPYT  445



>ref|XP_006644902.1| PREDICTED: L-ascorbate oxidase homolog [Oryza brachyantha]
Length=555

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/407 (61%), Positives = 309/407 (76%), Gaps = 6/407 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD PA ++ V + DWY K H  L K L++G +I RP G+VINGK+ K      P+
Sbjct  152   LIPVPFDEPAGDYPVLVGDWYTKDHTVLAKNLEAGKSIGRPAGLVINGKNEKDASN-PPM  210

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             +TMEAGK YRYRVCNVG++TS+N R + H + LVEMEGSHT+QN YDSLD+HV QC+S L
Sbjct  211   YTMEAGKVYRYRVCNVGIKTSLNVRIQSHIIKLVEMEGSHTVQNTYDSLDVHVAQCVSFL  270

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             V AD++P DY LV S+RF K+  S  AII Y NG+   ASP+LP  P     G AWSINQ
Sbjct  271   VAADQKPGDYLLVASTRFMKETSSITAIIRY-NGSNTPASPKLPEGP----SGWAWSINQ  325

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             +RSFRWNLTASAARPNPQGSYHYGQINITRTI+L   ++ V GK R+A+NGVSH++ +TP
Sbjct  326   WRSFRWNLTASAARPNPQGSYHYGQINITRTIRLSAGRAKVGGKERFAINGVSHVDAETP  385

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYF  +  VF+Y+++GD PP  G  V LAPNV+   FR F+E+VFEN EK+I ++H
Sbjct  386   LKLAEYFNATAGVFEYNLIGDVPPAAGAAVKLAPNVIQTEFRTFIEVVFENPEKSIDSFH  445

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             ++G++FFA  +  G W+P+ RK YNL+D VSRH+IQVYP SW AVM T DNAGMWN+RS+
Sbjct  446   INGYAFFAAGMGPGTWTPDCRKTYNLLDTVSRHTIQVYPRSWTAVMLTFDNAGMWNIRSN  505

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             MWER YLG+QLY SV+SP RSLRDE+N+P+    CG V GM MPP Y
Sbjct  506   MWERFYLGEQLYVSVISPARSLRDEYNMPENGLRCGKVVGMPMPPSY  552



>ref|NP_001044620.1| Os01g0816700 [Oryza sativa Japonica Group]
 dbj|BAB64824.1| putative L-ascorbate oxidase [Oryza sativa Japonica Group]
 dbj|BAF06534.1| Os01g0816700 [Oryza sativa Japonica Group]
Length=553

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/408 (62%), Positives = 311/408 (76%), Gaps = 7/408 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD PA ++ V + DWY K H  L K LD+G +I RP G+VINGK+ K      P+
Sbjct  149   LIPVPFDEPAGDYPVLVGDWYTKDHTVLAKNLDAGKSIGRPAGLVINGKNEKDASN-PPM  207

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             +TMEAGK YR+RVCNVG++TS+N R +GH++ LVEMEGSHT+QN YDSLD+HV QC+S L
Sbjct  208   YTMEAGKVYRFRVCNVGIKTSLNVRIQGHSLKLVEMEGSHTVQNSYDSLDVHVAQCVSFL  267

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD++P DY LV S+RF K+  +  AI+ Y NG+   ASP+LP  P     G AWSINQ
Sbjct  268   VTADQKPGDYLLVASTRFLKEYSAITAIVRY-NGSNTPASPKLPEGP----SGWAWSINQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHIN-TDT  718
             +RSFRWNLTASAARPNPQGSYHYGQINITRTIKL  SK  VDGK R+ALNGVSH++   T
Sbjct  323   WRSFRWNLTASAARPNPQGSYHYGQINITRTIKLCTSKGKVDGKERFALNGVSHVDDAQT  382

Query  719   PLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             PLKLAEYF  S  VF+Y+++GD PP       LAPNV++A FR F+E+VFEN EK+I ++
Sbjct  383   PLKLAEYFNASSGVFEYNLIGDVPPATTVPQKLAPNVISAEFRTFIEVVFENPEKSIDSF  442

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             H++G++FFA  +  G W+PE RK YNL+D VSRH+IQVYP SW AVM T DNAGMWN+RS
Sbjct  443   HINGYAFFAAGMGPGIWTPECRKTYNLLDTVSRHTIQVYPRSWTAVMLTFDNAGMWNIRS  502

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             +MWER YLG QLY SV+SP RSLRDE+N+P+    CG V G+ MPP Y
Sbjct  503   NMWERYYLGAQLYVSVVSPARSLRDEYNMPEIALRCGKVVGLPMPPSY  550



>ref|XP_006838146.1| hypothetical protein AMTR_s00106p00093220 [Amborella trichopoda]
 gb|ERN00715.1| hypothetical protein AMTR_s00106p00093220 [Amborella trichopoda]
Length=546

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/408 (61%), Positives = 312/408 (76%), Gaps = 8/408 (2%)
 Frame = +2

Query  5     IPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPLF  184
             IPVPFD PAD++ V I DWY   H TL++ LDSG +I +PDGV+ING + K      PLF
Sbjct  146   IPVPFDDPADDYTVLIGDWYASDHNTLRRRLDSGRSIGQPDGVLINGMN-KPNKANKPLF  204

Query  185   TMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVLV  364
              ME GKTYRYR+CNVG++TS+NFR +GHT+ LVE+EGSHT+QN+Y+SLD+HVGQC SVLV
Sbjct  205   NMEPGKTYRYRICNVGLKTSLNFRIQGHTLKLVEIEGSHTVQNIYESLDVHVGQCYSVLV  264

Query  365   TADKEPKDYYLVVSSRFF-KQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             TA+K P+DYY+V S+RF  K   +  A+I Y                     G+AWS+NQ
Sbjct  265   TANKVPRDYYIVASTRFTNKYTHTATALIHYTGSKKPAPLMLP-----PAPTGVAWSLNQ  319

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGS+HYGQINITRTIKL NS  +V  KLRYA+NGVS++   TP
Sbjct  320   FRSFRWNLTASAARPNPQGSFHYGQINITRTIKLSNSVGFVKSKLRYAMNGVSYVRPSTP  379

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEY+G++ +VF    + D PP +  ++ LAP VV   FR+F+EIVFEN EK+IQ++H
Sbjct  380   LKLAEYYGVAARVFDTKAIADMPPAS-PQIKLAPAVVKGNFRDFIEIVFENREKSIQSWH  438

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+SFFAV +  G+W+P  RK YNL+DAVS+H+IQVYPNSW AV+ T+DNAGMW+LRS+
Sbjct  439   LDGYSFFAVGMSGGQWTPASRKVYNLLDAVSKHTIQVYPNSWTAVLLTIDNAGMWSLRSE  498

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             +WER YLGQQLY SV+SP RSLRDE+N+PD  +LCG+VK M  P PY+
Sbjct  499   LWERQYLGQQLYLSVVSPARSLRDEYNMPDNARLCGIVKRMPKPAPYT  546



>gb|ACN34077.1| unknown [Zea mays]
 gb|AFW84771.1| L-ascorbate oxidase [Zea mays]
Length=559

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/407 (62%), Positives = 307/407 (75%), Gaps = 6/407 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD+PAD+F V I DWY K H  L K LD+G  I RP G+VINGK+ K      P+
Sbjct  156   LIPVPFDTPADDFPVLIGDWYTKDHAVLAKNLDAGKGIGRPAGLVINGKNEKDASN-PPM  214

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             + +EAGKTYR+RVCNVG++ S N R + H M LVEMEGSHT+QN YDSLDLH+GQCLS L
Sbjct  215   YNVEAGKTYRFRVCNVGIKASFNVRIQDHIMKLVEMEGSHTMQNDYDSLDLHIGQCLSFL  274

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD++P DY LV S+RF K++ ST A+I Y    G +A P  P   PE   G AWSINQ
Sbjct  275   VTADQKPGDYLLVASTRFIKEKSSTTAVIRY---KGSSAPP--PAKLPEGPSGWAWSINQ  329

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
              RSFRWNLTASAARPNPQGSYHYGQINITRTIKL   +  VDGK R+  NGVSH++ +TP
Sbjct  330   CRSFRWNLTASAARPNPQGSYHYGQINITRTIKLAMGRGKVDGKERFGFNGVSHVDPETP  389

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             +KLAEYF  S+ VFKY+++GD PP N     +APNV++A FR F+E+VFEN EK+I T H
Sbjct  390   VKLAEYFNASDGVFKYNLIGDVPPSNTAPTKMAPNVISAEFRTFIEVVFENPEKSIDTIH  449

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             +DG++FFAV +  G+W+   R  YNL+D VSRH+IQVYP SW AVM T DNAGMW++RS+
Sbjct  450   IDGYAFFAVGMGPGKWTAASRSTYNLLDTVSRHTIQVYPRSWTAVMMTFDNAGMWSVRSN  509

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             +WER YLG+QLY SV+SPERSLRDE+N+P+    CG V G+ MPP Y
Sbjct  510   IWERQYLGEQLYVSVISPERSLRDEYNMPETSLRCGKVVGLPMPPSY  556



>ref|NP_001151662.1| L-ascorbate oxidase precursor [Zea mays]
 gb|ACG43714.1| L-ascorbate oxidase precursor [Zea mays]
Length=559

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/407 (62%), Positives = 307/407 (75%), Gaps = 6/407 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD+PAD+F V I DWY K H  L K LD+G  I RP G+VINGK+ K      P+
Sbjct  156   LIPVPFDTPADDFPVLIGDWYTKDHAVLAKNLDAGKGIGRPAGLVINGKNEKDASN-PPM  214

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             + +EAGKTYR+RVCNVG++ S N R + H M LVEMEGSHT+QN YDSLDLH+GQCLS L
Sbjct  215   YNVEAGKTYRFRVCNVGIKASFNVRIQDHIMKLVEMEGSHTMQNDYDSLDLHIGQCLSFL  274

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD++P DY LV S+RF K++ ST A+I Y    G +A P  P   PE   G AWSINQ
Sbjct  275   VTADQKPGDYLLVASTRFIKEKSSTTAVIRY---KGSSAPP--PAKLPEGPSGWAWSINQ  329

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
              RSFRWNLTASAARPNPQGSYHYGQINITRTIKL   +  VDGK R+  NGVSH++ +TP
Sbjct  330   CRSFRWNLTASAARPNPQGSYHYGQINITRTIKLAMGRGKVDGKERFGFNGVSHVDPETP  389

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             +KLAEYF  S+ VFKY+++GD PP N     +APNV++A FR F+E+VFEN EK+I T H
Sbjct  390   VKLAEYFNASDGVFKYNLIGDVPPSNTAPTKMAPNVISAEFRTFIEVVFENPEKSIDTIH  449

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             +DG++FFAV +  G+W+   R  YNL+D VSRH+IQVYP SW AVM T DNAGMW++RS+
Sbjct  450   IDGYAFFAVGMGPGKWTAASRSTYNLLDTVSRHTIQVYPRSWTAVMMTFDNAGMWSVRSN  509

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             +WER YLG+QLY SV+SPERSLRDE+N+P+    CG V G+ MPP Y
Sbjct  510   IWERQYLGEQLYVSVISPERSLRDEYNMPETSLRCGKVVGLPMPPSY  556



>gb|EEE55579.1| hypothetical protein OsJ_03867 [Oryza sativa Japonica Group]
Length=550

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/408 (62%), Positives = 311/408 (76%), Gaps = 7/408 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD PA ++ V + DWY K H  L K LD+G +I RP G+VINGK+ K      P+
Sbjct  146   LIPVPFDEPAGDYPVLVGDWYTKDHTVLAKNLDAGKSIGRPAGLVINGKNEKDASN-PPM  204

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             +TMEAGK YR+RVCNVG++TS+N R +GH++ LVEMEGSHT+QN YDSLD+HV QC+S L
Sbjct  205   YTMEAGKVYRFRVCNVGIKTSLNVRIQGHSLKLVEMEGSHTVQNSYDSLDVHVAQCVSFL  264

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD++P DY LV S+RF K+  +  AI+ Y NG+   ASP+LP  P     G AWSINQ
Sbjct  265   VTADQKPGDYLLVASTRFLKEYSAITAIVRY-NGSNTPASPKLPEGP----SGWAWSINQ  319

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHIN-TDT  718
             +RSFRWNLTASAARPNPQGSYHYGQINITRTIKL  SK  VDGK R+ALNGVSH++   T
Sbjct  320   WRSFRWNLTASAARPNPQGSYHYGQINITRTIKLCTSKGKVDGKERFALNGVSHVDDAQT  379

Query  719   PLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             PLKLAEYF  S  VF+Y+++GD PP       LAPNV++A FR F+E+VFEN EK+I ++
Sbjct  380   PLKLAEYFNASSGVFEYNLIGDVPPATTVPQKLAPNVISAEFRTFIEVVFENPEKSIDSF  439

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             H++G++FFA  +  G W+PE RK YNL+D VSRH+IQVYP SW AVM T DNAGMWN+RS
Sbjct  440   HINGYAFFAAGMGPGIWTPECRKTYNLLDTVSRHTIQVYPRSWTAVMLTFDNAGMWNIRS  499

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             +MWER YLG QLY SV+SP RSLRDE+N+P+    CG V G+ MPP Y
Sbjct  500   NMWERYYLGAQLYVSVVSPARSLRDEYNMPEIALRCGKVVGLPMPPSY  547



>ref|XP_008672229.1| PREDICTED: uncharacterized protein LOC100194388 isoform X1 [Zea 
mays]
 gb|ACN27218.1| unknown [Zea mays]
 tpg|DAA57111.1| TPA: hypothetical protein ZEAMMB73_564948 [Zea mays]
Length=557

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/407 (61%), Positives = 304/407 (75%), Gaps = 6/407 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD+PAD+F V + DWY K H  L K LD+G  I RP G+VINGK+ K      P+
Sbjct  154   LIPVPFDTPADDFPVLVGDWYTKDHTVLAKNLDAGKGIGRPAGLVINGKNEKDASN-PPM  212

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             + +EAGKTYR+RVCNVG++ S N R + H M LVEMEGSHT+QN YDSLDLH+GQCLS L
Sbjct  213   YNVEAGKTYRFRVCNVGIKASFNIRIQNHIMKLVEMEGSHTMQNDYDSLDLHIGQCLSFL  272

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD++P DY L VS+RF K+  S  A+I Y   N   A P  P   PE+  G AWSINQ
Sbjct  273   VTADQKPGDYLLAVSTRFIKEVNSITAVIRYKGSN---APP--PAKVPESPSGWAWSINQ  327

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
              RSFRWNLTASAARPNPQGSYHYGQINITRTIKL   +  VDGK R+  NGVSH++ +TP
Sbjct  328   CRSFRWNLTASAARPNPQGSYHYGQINITRTIKLAMGRGKVDGKERFGFNGVSHVDPETP  387

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             +KLAEYF  ++ VF+YDI+GD PP       +APNV+ A FR F+E+VFEN EK+I T H
Sbjct  388   VKLAEYFNTTDGVFQYDIIGDVPPSKSAPTKMAPNVIRAEFRTFIEVVFENPEKSIDTIH  447

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             +DG++FFAV +  G+W+P  R  YNL+D VSRH+IQVYP SW AVM T DNAGMW++RS+
Sbjct  448   IDGYAFFAVGMGPGKWTPASRSTYNLLDTVSRHTIQVYPRSWTAVMMTFDNAGMWSIRSN  507

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             +WER YLG+QLY SV+SPERSLRDE+N+P+    CG V G+ MPP Y
Sbjct  508   IWERQYLGEQLYVSVISPERSLRDEYNMPETSLRCGKVVGLPMPPSY  554



>ref|XP_010931432.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=551

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/411 (61%), Positives = 307/411 (75%), Gaps = 11/411 (3%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGK--VGDKID  175
             LIPVPF  PA+EF+V   DW+   HK L + LD+G  +  P GV+ING+ G+   G    
Sbjct  147   LIPVPFAPPAEEFDVLAGDWFTASHKLLARKLDAGRGLGLPAGVLINGRPGRPVTGHDDP  206

Query  176   PLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLS  355
             P+FT++AG  YR+R CNVG++TS+NFR + H++ LVEMEGSHTIQN+YDSLD+HVGQCLS
Sbjct  207   PMFTVQAGNVYRFRFCNVGLKTSLNFRIQKHSLKLVEMEGSHTIQNLYDSLDVHVGQCLS  266

Query  356   VLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSP--PENTEGIAW  529
             VLV AD+ P DYYLVVS+RF K+  +  A++ YA  N        PPSP  PE   G AW
Sbjct  267   VLVVADQGPGDYYLVVSTRFTKKIHTATAVLRYAGSN-------TPPSPVIPEGPSGWAW  319

Query  530   SINQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHIN  709
             S NQ+R+FRWNLTASAARPNPQGSYHYG+INITRTIKL+N  + VDGK R+ +NGVSH++
Sbjct  320   SFNQWRTFRWNLTASAARPNPQGSYHYGEINITRTIKLLNGHTVVDGKRRHFINGVSHVD  379

Query  710   TDTPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTI  889
              DTPLKLAEYF +S  VF Y++MGD PP     V LAPNV+ A FR F+EI+FEN E++I
Sbjct  380   PDTPLKLAEYFNLSNPVFNYNLMGDVPPALDIPVKLAPNVITAEFRTFIEIIFENTERSI  439

Query  890   QTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWN  1069
             Q+YHLDG++FF V +  G+WSPE R+ YNL+D VSRHSI V+P SW A+M T DNAGMWN
Sbjct  440   QSYHLDGYAFFPVGMGPGKWSPESRRLYNLLDTVSRHSIHVFPKSWTAIMLTFDNAGMWN  499

Query  1070  LRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             LRS  WE  YLGQQLY SV SP RSLRDE+N+PD    CG V G+ +PP Y
Sbjct  500   LRSMNWENKYLGQQLYVSVTSPARSLRDEYNMPDNTLRCGAVVGLPLPPSY  550



>dbj|BAK07214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=557

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/410 (60%), Positives = 309/410 (75%), Gaps = 10/410 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD PAD+F+  + DWY K H+ L K LD+G  I RP G++INGK+ K      P+
Sbjct  154   LIPVPFDPPADDFSALVGDWYTKDHEVLAKNLDTGKGIGRPAGLLINGKNEKDASN-PPM  212

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             + +E GKTYR+RVCNVG++T++N R +GH + LVEMEGSHT+QN YDSLD+H+GQCLS L
Sbjct  213   YNVETGKTYRFRVCNVGIKTTLNVRIQGHVVKLVEMEGSHTVQNEYDSLDVHIGQCLSFL  272

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSP--PENTEGIAWSI  535
              TA+++P DY+L+ S+RF K   +  A++ Y   N        PPSP  PE   G AWSI
Sbjct  273   TTANQKPGDYFLIASTRFIKGVNTITAVMRYKGSNS-------PPSPKLPEAPAGWAWSI  325

Query  536   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTD  715
             NQ+RSFRWNLTASAARPNPQGSYHYGQINITRTIKL  S+  VDGK RYALNGVSH + +
Sbjct  326   NQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLSTSRGKVDGKERYALNGVSHADAE  385

Query  716   TPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             TPLKLAEYF  ++ VF+Y+++ DTPP+ G  + LAPNV+ A  R ++E+VFEN E++I T
Sbjct  386   TPLKLAEYFNATKGVFEYNLITDTPPKEGTPIKLAPNVITAEHRTYIEVVFENPERSIDT  445

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HL+G++FFA  +  G W+ E RK YNL+D VSRH+IQVYP SW AVM T DNAGMWNLR
Sbjct  446   FHLNGYAFFAAGMGPGLWTAESRKTYNLLDTVSRHTIQVYPRSWTAVMLTFDNAGMWNLR  505

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             S++WER YLG+QLY S  SP RSLRDE+N+PD    CG V GM +PPPY+
Sbjct  506   SNLWERYYLGEQLYVSCTSPARSLRDEYNMPDNALRCGKVVGMPLPPPYT  555



>gb|EEC79422.1| hypothetical protein OsI_20394 [Oryza sativa Indica Group]
Length=466

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/407 (61%), Positives = 310/407 (76%), Gaps = 6/407 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD PAD+  V I DWY K H  + K+LD+G +  RP GVVINGK GK      P+
Sbjct  63    LIPVPFDPPADDHMVLIGDWYTKDHAAMAKMLDAGKSFGRPHGVVINGKSGKAAAD-PPM  121

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FT+EAGKTYR RVCNVG++ S+NFR +GH M LVEMEGSHT+Q++YDSLD+HVG CLSVL
Sbjct  122   FTVEAGKTYRLRVCNVGIKASLNFRIQGHDMKLVEMEGSHTVQDMYDSLDVHVGHCLSVL  181

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             V AD++P DYY V S+RF  +  S  A+I YA      +S    P+ PE   G AWSINQ
Sbjct  182   VDADQKPGDYYAVASTRFIHEAKSVSAVIRYAG-----SSTPPSPAVPEPPAGWAWSINQ  236

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             +RSFRWNLTASAARPNPQGSYHYGQINITRTI+L+ S+ ++DGKL+Y  NGVSH++ +TP
Sbjct  237   WRSFRWNLTASAARPNPQGSYHYGQINITRTIRLMVSRGHIDGKLKYGFNGVSHVDAETP  296

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYF +++ VF+Y+ M D PP     + + PNV+ A FR F+EI+FEN EK++ + H
Sbjct  297   LKLAEYFNVTDGVFRYNQMTDVPPAVNGPLHVVPNVITAEFRTFIEIIFENPEKSMDSVH  356

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG++FFAV +  G+WS E+RK YNL+D VSRHS+QVYP SW A+M T DNAGMWN+RS+
Sbjct  357   LDGYAFFAVGMGPGKWSAEERKTYNLLDGVSRHSVQVYPRSWTAIMLTFDNAGMWNVRSN  416

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             +WER YLG+QLY SV+SP RSLRDE+N+P+    CG V G+ +PP Y
Sbjct  417   IWERHYLGEQLYISVVSPARSLRDEYNMPENALRCGKVVGLPLPPSY  463



>ref|XP_006445540.1| hypothetical protein CICLE_v10018007mg [Citrus clementina]
 ref|XP_006489004.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|ESR58780.1| hypothetical protein CICLE_v10018007mg [Citrus clementina]
 gb|KDO54549.1| hypothetical protein CISIN_1g046746mg [Citrus sinensis]
Length=561

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/416 (59%), Positives = 328/416 (79%), Gaps = 14/416 (3%)
 Frame = +2

Query  2     LIPVPFDS-PADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKV------  160
             ++PVP++    D+F + I DWY + H  L K LDSG  + +PDGV+INGK G++      
Sbjct  150   VVPVPYNRFVEDDFTLLIGDWYTRSHVELGKQLDSGKLLGKPDGVLINGKSGRLDYDSDG  209

Query  161   -GDKIDPLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLH  337
              GD  +PLFTM+AGK Y+YR+CNVG++TS+NFR +GHTM LVEMEGSH +QN Y+SLD+H
Sbjct  210   KGDN-EPLFTMKAGKVYKYRICNVGVKTSLNFRIQGHTMKLVEMEGSHVVQNEYESLDVH  268

Query  338   VGQCLSVLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTE  517
             VGQC +VLVTA+++PKDYYL+ S+RF +   +T AI+ Y++  G+ ASP+LP +P     
Sbjct  269   VGQCFTVLVTANQDPKDYYLIASTRFTRTVITTTAIVRYSDSKGL-ASPDLPKAP----V  323

Query  518   GIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGV  697
             G  WS+NQFRSFRWNLTASAARPNPQGS+HYG I I RTI+L N+   V+GK+R+A+NGV
Sbjct  324   GWDWSLNQFRSFRWNLTASAARPNPQGSFHYGGIPINRTIRLANTAHLVNGKVRFAVNGV  383

Query  698   SHINTDTPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENH  877
             S++N++TPLK AEY+GI E+VFKY+++ D P +  E VTL PNV++AT++ F+EIV EN 
Sbjct  384   SYVNSETPLKFAEYYGIPEEVFKYNVISDKPADEIENVTLQPNVMDATYKAFMEIVLENR  443

Query  878   EKTIQTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNA  1057
             + T+Q++ LDG++FFAV +E G W+P+KRK+YNL+DAVSR++IQV+PN WAA++ ++DNA
Sbjct  444   QNTMQSWILDGYAFFAVGMEPGTWNPDKRKSYNLIDAVSRYTIQVFPNCWAAILVSMDNA  503

Query  1058  GMWNLRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             GMWNLRS++WER YLGQQLY SV   +RSLRDE+N+PD   LCG+V  MS P PYS
Sbjct  504   GMWNLRSNIWERNYLGQQLYLSVRLHKRSLRDEYNMPDNALLCGIVANMSKPTPYS  559



>ref|XP_002456532.1| hypothetical protein SORBIDRAFT_03g037970 [Sorghum bicolor]
 gb|EES01652.1| hypothetical protein SORBIDRAFT_03g037970 [Sorghum bicolor]
Length=558

 Score =   529 bits (1363),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 246/407 (60%), Positives = 307/407 (75%), Gaps = 6/407 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD PAD+F V + DWY K H  L K LD+G  I RP G+VINGK+ K      P+
Sbjct  155   LIPVPFDRPADDFPVLVGDWYTKDHAVLAKNLDAGKGIGRPSGLVINGKNEKDAAN-PPM  213

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             + +EAGKTYR+R+CNVGM+ S+N   + H M LVEMEGSHT+QN YDSLD+HVGQCLSVL
Sbjct  214   YNVEAGKTYRFRICNVGMKASINIGIQNHIMKLVEMEGSHTMQNDYDSLDIHVGQCLSVL  273

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD++P DY LV S+RF K+  +T A+I Y    G +A P  P   PE+  G AWSINQ
Sbjct  274   VTADQKPGDYLLVASTRFIKEVSTTTAVIRY---KGASAPP--PAKLPESPSGWAWSINQ  328

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
              RSFRWNLTASAARPNPQGSYHYGQINITRTI+L   +  VDGK R+ +NGVSH++ +TP
Sbjct  329   ARSFRWNLTASAARPNPQGSYHYGQINITRTIRLGIGRGKVDGKERFGINGVSHVDPETP  388

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             +KLAEYF  ++ VF+YD++GD PP       +APNV+ A FR F+E+VFEN EK+I T+H
Sbjct  389   VKLAEYFNATDGVFQYDLIGDVPPAKSAPTKMAPNVLRAEFRTFIEVVFENPEKSIDTFH  448

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             +DG++FFAV +  G+W+P  R  YNL+D VSRH++QVYP SW AVM T DNAGMW++RS+
Sbjct  449   IDGYAFFAVGMGPGKWTPACRSTYNLLDTVSRHTVQVYPRSWTAVMMTFDNAGMWSIRSN  508

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             +WER YLG+QLY SV SPERSLRDE+N+P+    CG V G+ +PP Y
Sbjct  509   IWERNYLGEQLYISVTSPERSLRDEYNMPETSLRCGKVVGLPLPPSY  555



>ref|XP_009120150.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=554

 Score =   529 bits (1362),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 245/408 (60%), Positives = 315/408 (77%), Gaps = 7/408 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I DWY K H  LK  LDSG +I RP+GV+INGK GK     +P+
Sbjct  147   LIPVPYPDPEDDYTVLIGDWYTKTHVALKDNLDSGRSIGRPEGVLINGKAGKPDGTGEPI  206

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CNVG++ ++NFR + H + LVE+EGSHT+QN+YDSLDLHVGQC  VL
Sbjct  207   FTMKPGKTYKYRICNVGLKMALNFRIQNHKIKLVELEGSHTLQNLYDSLDLHVGQCFGVL  266

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+EPKDYY+V S+RF K   ++ A++ Y  G G  ASPELP  P     G AWS+NQ
Sbjct  267   VTADQEPKDYYMVASTRFLKTVLTSTALLRYEGGKG-AASPELPKPP----VGWAWSLNQ  321

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDG-KLRYALNGVSHINTDT  718
             FRSFRWNLTASAARPNPQGSYHYG+INITR+IKLVN+   ++G KLRYAL+GVSH+ T+T
Sbjct  322   FRSFRWNLTASAARPNPQGSYHYGKINITRSIKLVNTVGKIEGKKLRYALSGVSHVETET  381

Query  719   PLKLAEYFGISEKVFKYDIMGDTPPE-NGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             P+KLA+YFG+++KVFKYD + D P + +   + + PNV+N   R+FVEIVFEN E+T Q+
Sbjct  382   PIKLAQYFGVADKVFKYDTIKDEPTKVDTSNILVQPNVLNIEHRSFVEIVFENQERTTQS  441

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG+SFFAVA+E G+W+P KRKNYNL+DAV RH+IQVYP  W A++ T DN GMWN+R
Sbjct  442   WHLDGYSFFAVAVEPGKWTPAKRKNYNLLDAVYRHTIQVYPKCWGAILLTFDNCGMWNIR  501

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPP  1219
             S++ E+ YLGQQLY +V  PE S RDE++ P     CG+++G+  P P
Sbjct  502   SEILEKRYLGQQLYVNVGPPELSQRDEYSFPANGLRCGIIQGLPDPQP  549



>emb|CDY50029.1| BnaA06g00300D [Brassica napus]
Length=540

 Score =   528 bits (1359),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 249/410 (61%), Positives = 309/410 (75%), Gaps = 21/410 (5%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I+DWY + H  LK  LDSG TI RPDG++INGK GK      PL
Sbjct  150   LIPVPYADPEDDYTVLINDWYTESHTQLKNFLDSGRTIGRPDGILINGKAGKGDGSDQPL  209

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FT++ GKTYR R+CNVG++ S+NFR + H M LVEMEGSH +QN YDSLD+HVGQC  V+
Sbjct  210   FTLKQGKTYRIRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVI  269

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             +TA++EPKDYY+V S+RF K   +T  ++ Y  G G+ AS +LP +P     G AWS+NQ
Sbjct  270   LTANQEPKDYYIVASTRFLKNALTTTGLLRYEGGKGL-ASSQLPAAP----VGWAWSLNQ  324

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVN++  VD KLRYALNGVSHI+ +TP
Sbjct  325   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDSKLRYALNGVSHIDLETP  384

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEK-VTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEYFG+++KVFKYD + D P  +  K + + PN               NHE+++Q++
Sbjct  385   LKLAEYFGVTDKVFKYDSISDNPTSDQIKNIKIEPN---------------NHERSVQSW  429

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
             HLDG+SFFAVA+E G W+PEKRKNYNL+DAVSRH+IQVYP  WAA++ T DN GMWN+RS
Sbjct  430   HLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTIQVYPKCWAAILLTFDNCGMWNIRS  489

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1228
             +  ER YLGQQLY SVLSPE+SLRDE+N+P+    CGLVK      PY+G
Sbjct  490   ENSERRYLGQQLYASVLSPEKSLRDEYNMPESSLQCGLVKDKPKINPYAG  539



>dbj|BAK05994.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=560

 Score =   528 bits (1359),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 243/407 (60%), Positives = 310/407 (76%), Gaps = 6/407 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD PAD+  V I DW+ K H  +  +LD+G +  RP GV+INGK GK      P+
Sbjct  157   LIPVPFDPPADDLQVVIGDWFTKDHAVMASLLDAGRSFGRPAGVLINGKGGKEATN-PPM  215

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FT EA KTYR R+CNVG+++S+NFR +GH M LVE++GSHT+Q+ YDSLD+HVGQCLSVL
Sbjct  216   FTWEAAKTYRLRICNVGIKSSLNFRIQGHDMKLVEIDGSHTLQDSYDSLDVHVGQCLSVL  275

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             V AD++P DY +V S+RF     S  A++ YA  N   A         E   G AWS+NQ
Sbjct  276   VDADQKPADYLMVASTRFMADASSVSAVVRYAGSNTPPAPNVP-----EPPAGWAWSLNQ  330

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             +RSFRWNLTASAARPNPQGSYHYGQINITRTIKL+ ++ ++DGKL+Y  NGVSH++ DTP
Sbjct  331   WRSFRWNLTASAARPNPQGSYHYGQINITRTIKLLVTRGHIDGKLKYGFNGVSHVDADTP  390

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYF IS++VFKY+ M DTPP     + +APNV+ A FR F+E+VFEN EK++ + H
Sbjct  391   LKLAEYFNISDQVFKYNQMADTPPAVNGPMHVAPNVITAEFRTFIEVVFENPEKSMDSVH  450

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             +DG++FFAV +  G+W+P++RK YNL+DAVSRH+IQVYP SW+AVM T DNAGMWN+RS+
Sbjct  451   IDGYAFFAVGMGPGKWTPDQRKTYNLLDAVSRHTIQVYPRSWSAVMLTFDNAGMWNVRSN  510

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             +WER YLG+QLY SV+SP RSLRDE+N+P+    CG V G+ +PP Y
Sbjct  511   LWERHYLGEQLYMSVVSPARSLRDEYNMPENALRCGKVVGLPLPPSY  557



>gb|AAT01329.1| putative L-ascorbate oxidase [Oryza sativa Japonica Group]
 gb|AAT01403.1| putative L-ascorbate oxidase [Oryza sativa Japonica Group]
Length=556

 Score =   527 bits (1358),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 247/407 (61%), Positives = 310/407 (76%), Gaps = 6/407 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD PAD+  V I DWY K H  + K+LD+G +  RP GVVINGK GK      P+
Sbjct  153   LIPVPFDPPADDHMVLIGDWYTKDHAAMAKMLDAGKSFGRPHGVVINGKSGKAAAD-PPM  211

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FT+EAGKTYR RVCNVG++ S+NFR +GH M LVEMEGSHT+Q++YDSLD+HVG CLSVL
Sbjct  212   FTVEAGKTYRLRVCNVGIKASLNFRIQGHDMKLVEMEGSHTVQDMYDSLDVHVGHCLSVL  271

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             V AD++P DYY V S+RF  +  S  A+I YA      +S    P+ PE   G AWSINQ
Sbjct  272   VDADQKPGDYYAVASTRFIHEAKSVSAVIRYAG-----SSTPPSPAVPEPPAGWAWSINQ  326

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             +RSFRWNLTASAARPNPQGSYHYGQINITRTI+L+ S+ ++DGKL+Y  NGVSH++ +TP
Sbjct  327   WRSFRWNLTASAARPNPQGSYHYGQINITRTIRLMVSRGHIDGKLKYGFNGVSHVDAETP  386

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYF +++ VF+Y+ M D PP     + + PNV+ A FR F+EI+FEN EK++ + H
Sbjct  387   LKLAEYFNVTDGVFRYNQMTDVPPAVNGPLHVVPNVITAEFRTFIEIIFENPEKSMDSVH  446

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG++FFAV +  G+WS E+RK YNL+D VSRHS+QVYP SW A+M T DNAGMWN+RS+
Sbjct  447   LDGYAFFAVGMGPGKWSAEERKTYNLLDGVSRHSVQVYPRSWTAIMLTFDNAGMWNVRSN  506

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             +WER YLG+QLY SV+SP RSLRDE+N+P+    CG V G+ +PP Y
Sbjct  507   IWERHYLGEQLYISVVSPARSLRDEYNMPENALRCGKVVGLPLPPSY  553



>gb|ACF86554.2| unknown [Zea mays]
 gb|AFW82337.1| pollen-specific protein NTP303 [Zea mays]
Length=559

 Score =   527 bits (1357),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 245/410 (60%), Positives = 304/410 (74%), Gaps = 6/410 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFN--VFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID  175
             LIPVPFD P  E +  V I DWY K H+ L + LD+G ++ RP GV+INGK GK  +   
Sbjct  151   LIPVPFDQPPPESDHAVLIGDWYTKDHEVLARQLDAGKSVGRPAGVLINGKGGKDLEAAA  210

Query  176   PLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLS  355
             P+ T EAGKTYR RVCN G++ S+NFR +GH M LVE+EGSHT+Q+VYDSLD+HVG CLS
Sbjct  211   PMLTFEAGKTYRLRVCNTGIKASLNFRIQGHDMKLVELEGSHTLQDVYDSLDVHVGHCLS  270

Query  356   VLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSI  535
             VLV AD+ P DYY+V S+RF     S  A+I YA  +G   +P +   P     G AWSI
Sbjct  271   VLVDADQAPGDYYMVASTRFIHDAKSASAVIRYAGSSGAPPAPNMTEPP----AGWAWSI  326

Query  536   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTD  715
             NQ RSFRWNLTASAARPNPQGSYHYGQINITRTIK++ S+ ++DGKLRY  NG+SH +T+
Sbjct  327   NQARSFRWNLTASAARPNPQGSYHYGQINITRTIKVMVSRGHIDGKLRYGFNGISHRDTE  386

Query  716   TPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             TPLKLAEYF +++ VF Y+ MGD PP     + + PNV+ A FR F+EIVFEN EK+I +
Sbjct  387   TPLKLAEYFNVTDGVFSYNQMGDVPPAVNGPLHVIPNVITAEFRTFIEIVFENPEKSIDS  446

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
              HLDG++FF V +  G WSPE RK YNL+D VSRH+IQVYP SW A+M T DNAGMW++R
Sbjct  447   LHLDGYAFFGVGMGPGTWSPEMRKTYNLLDTVSRHTIQVYPRSWTAIMLTFDNAGMWSVR  506

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             S++WER YLG+Q Y SV+SP RSLRDE+N+PD    CG V G+ +PP Y+
Sbjct  507   SNVWERYYLGEQFYISVISPARSLRDEYNMPDNALRCGKVVGLPLPPSYA  556



>ref|NP_001151772.1| pollen-specific protein NTP303 precursor [Zea mays]
 gb|ACG44269.1| pollen-specific protein NTP303 precursor [Zea mays]
Length=559

 Score =   527 bits (1357),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 245/410 (60%), Positives = 304/410 (74%), Gaps = 6/410 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFN--VFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID  175
             LIPVPFD P  E +  V I DWY K H+ L + LD+G ++ RP GV+INGK GK  +   
Sbjct  151   LIPVPFDQPPPESDHAVLIGDWYTKDHEVLARQLDAGKSVGRPAGVLINGKGGKDLEAAA  210

Query  176   PLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLS  355
             P+ T EAGKTYR RVCN G++ S+NFR +GH M LVE+EGSHT+Q+VYDSLD+HVG CLS
Sbjct  211   PMLTFEAGKTYRLRVCNTGIKASLNFRIQGHYMKLVELEGSHTLQDVYDSLDVHVGHCLS  270

Query  356   VLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSI  535
             VLV AD+ P DYY+V S+RF     S  A+I YA  +G   +P +   P     G AWSI
Sbjct  271   VLVDADQAPGDYYMVASTRFIHDAKSASAVIRYAGSSGAPPAPNMTEPP----AGWAWSI  326

Query  536   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTD  715
             NQ RSFRWNLTASAARPNPQGSYHYGQINITRTIK++ S+ ++DGKLRY  NG+SH +T+
Sbjct  327   NQARSFRWNLTASAARPNPQGSYHYGQINITRTIKVMVSRGHIDGKLRYGFNGISHRDTE  386

Query  716   TPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             TPLKLAEYF +++ VF Y+ MGD PP     + + PNV+ A FR F+EIVFEN EK+I +
Sbjct  387   TPLKLAEYFNVTDGVFSYNQMGDVPPAVNGPLHVIPNVITAEFRTFIEIVFENPEKSIDS  446

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
              HLDG++FF V +  G WSPE RK YNL+D VSRH+IQVYP SW A+M T DNAGMW++R
Sbjct  447   LHLDGYAFFGVGMGPGTWSPEMRKTYNLLDTVSRHTIQVYPRSWTAIMLTFDNAGMWSVR  506

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             S++WER YLG+Q Y SV+SP RSLRDE+N+PD    CG V G+ +PP Y+
Sbjct  507   SNVWERYYLGEQFYISVISPARSLRDEYNMPDNALRCGKVVGLPLPPSYA  556



>emb|CDM84722.1| unnamed protein product [Triticum aestivum]
Length=556

 Score =   526 bits (1356),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 245/408 (60%), Positives = 311/408 (76%), Gaps = 6/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD PAD+F V + DWY K H  L K LD+G  I RP G++INGK+ K      P+
Sbjct  153   LIPVPFDPPADDFGVLVGDWYTKDHTVLAKNLDTGKGIGRPAGLLINGKNEKDASN-PPM  211

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             F +EAGKTYR+RVCNVG++T++N R +GH + LVEMEGSHT+QN YDS+D+H+GQCLS L
Sbjct  212   FNVEAGKTYRFRVCNVGIKTTLNVRIQGHVLKLVEMEGSHTVQNEYDSMDVHIGQCLSFL  271

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
              TA+++P DY+ + S+RF K   +  A++ Y   N   A+ +LP +P    +G AWSINQ
Sbjct  272   STANQKPGDYFFIASTRFIKGVSTITAVMRYKGSNTPPAA-KLPDAP----DGWAWSINQ  326

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             +RSFRWNLTASAARPNPQGSYHYGQINITRTIKL +S+  VDGK RYALNGVSH + +TP
Sbjct  327   WRSFRWNLTASAARPNPQGSYHYGQINITRTIKLSSSRGKVDGKERYALNGVSHTDPETP  386

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYF  ++ VF+Y+++ DTPP+ G  + +AP+V+ A  R ++EIVFEN EK+I T+H
Sbjct  387   LKLAEYFNATKGVFEYNLVTDTPPKEGTPIKVAPSVITAEHRTYIEIVFENPEKSIDTFH  446

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             L+G++FFA  +  G W+ E RK YNL+D VSRH+IQVYP SW AVM T DNAGMWNLRS+
Sbjct  447   LNGYAFFAAGMGPGLWTVESRKTYNLLDTVSRHTIQVYPRSWTAVMLTFDNAGMWNLRSN  506

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             +WER YLG+QLY S  SP RSLRDE+N+PD    CG V GM +PPPY+
Sbjct  507   LWERYYLGEQLYVSCTSPARSLRDEYNMPDNSLRCGKVVGMPLPPPYT  554



>ref|XP_003566121.2| PREDICTED: L-ascorbate oxidase homolog [Brachypodium distachyon]
Length=540

 Score =   525 bits (1351),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 243/407 (60%), Positives = 305/407 (75%), Gaps = 6/407 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD PAD+  V I DWY K H  + ++LD G +  RP GV+ING+ GK      PL
Sbjct  137   LIPVPFDPPADDLQVLIGDWYTKDHAVMARLLDEGRSFGRPAGVLINGRGGKEAAD-PPL  195

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FT EAGKTYR R+CNVG+++++NFR +GH M LVEM+GSHT+Q++YDSLD+HVG CLSVL
Sbjct  196   FTFEAGKTYRLRICNVGIKSTLNFRIQGHDMKLVEMDGSHTVQDMYDSLDVHVGHCLSVL  255

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             V AD++P DYY+V S+RF   + S  A+I YA  N   A         E   G AWS+NQ
Sbjct  256   VDADQKPGDYYVVASTRFISDKSSVSAVIRYAGSNTPPAPNVP-----EPPAGWAWSLNQ  310

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             +RSFRWNLTASAARPNPQGSYHYGQINITRTIKL+ ++ +++GKL+Y  NGVSH++ DTP
Sbjct  311   WRSFRWNLTASAARPNPQGSYHYGQINITRTIKLLVTRGHLEGKLKYGFNGVSHVDADTP  370

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKL EYF +++ VFKY+ M D PP     + + PNV+ A FR F+E+VFEN EK++ + H
Sbjct  371   LKLLEYFNVTDPVFKYNQMADVPPAVMGPLQVVPNVITAEFRTFIEVVFENPEKSMDSVH  430

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             +DG++FFAV +  G+WSPE RK YNL+DAVSRHSIQVYP SW+AVM T DNAGMWN+RS+
Sbjct  431   IDGYAFFAVGMGPGKWSPELRKTYNLLDAVSRHSIQVYPRSWSAVMLTFDNAGMWNVRSN  490

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
             +WER Y G+Q Y SV SP RSLRDE+N+PD    CG V G+ MPP Y
Sbjct  491   VWERYYTGEQFYISVTSPARSLRDEYNMPDTSLRCGRVVGLPMPPSY  537



>gb|EMT02825.1| L-ascorbate oxidase-like protein [Aegilops tauschii]
Length=556

 Score =   525 bits (1352),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 245/408 (60%), Positives = 309/408 (76%), Gaps = 6/408 (1%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD PAD+F V + DWY K H  L K LD+G  I RP G++INGK+ K      P+
Sbjct  153   LIPVPFDPPADDFGVLVGDWYTKDHTVLAKNLDTGKGIGRPAGLLINGKNEKDASN-PPM  211

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             F +E GKTYR+RVCNVG++T++N R +GH + LVEMEGSHT+QN YDS+D+H+GQCLS L
Sbjct  212   FNVEEGKTYRFRVCNVGIKTTLNVRIQGHVLKLVEMEGSHTVQNEYDSMDVHIGQCLSFL  271

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
              TA+++P DY+ + S+RF K   +  A++ Y   N   A+ +LP +P    +G AWSINQ
Sbjct  272   STANQKPGDYFFIASTRFIKGVSTITAVMRYKGSNTPPAA-KLPDAP----DGWAWSINQ  326

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             +RSFRWNLTASAARPNPQGSYHYGQINITRTIKL  S+  VDGK RYALNGVSH + +TP
Sbjct  327   WRSFRWNLTASAARPNPQGSYHYGQINITRTIKLSPSRGKVDGKERYALNGVSHTDPETP  386

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYF  ++ VF+Y+++ DTPP+ G  + +AP+V+ A  R ++EIVFEN EK+I T+H
Sbjct  387   LKLAEYFNATKGVFEYNLVTDTPPKEGTPIKVAPSVITAEHRTYIEIVFENPEKSIDTFH  446

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG++FFA  +  G W+ E RK YNL+D VSRH+IQVYP SW AVM T DNAGMWNLRS+
Sbjct  447   LDGYAFFAAGMGPGLWTVESRKTYNLLDTVSRHTIQVYPRSWTAVMLTFDNAGMWNLRSN  506

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             +WER YLG+QLY S  SP RSLRDE+N+PD    CG V GM +PPPY+
Sbjct  507   LWERYYLGEQLYVSCTSPARSLRDEYNMPDNSLRCGKVVGMPLPPPYT  554



>gb|AFK44839.1| unknown [Medicago truncatula]
Length=375

 Score =   515 bits (1326),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 241/375 (64%), Positives = 296/375 (79%), Gaps = 5/375 (1%)
 Frame = +2

Query  95    LDSGHTIARPDGVVINGKHGKVGDKIDPLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTM  274
             LDSG +I RP GV+INGK+ K     +PL+TM+ GKTY+YR+CN G++ ++NFRF+GH M
Sbjct  3     LDSGRSIGRPAGVIINGKNAKGDGSDEPLYTMKPGKTYKYRICNTGLKDTLNFRFQGHGM  62

Query  275   TLVEMEGSHTIQNVYDSLDLHVGQCLSVLVTADKEPKDYYLVVSSRFFKQEFSTVAIISY  454
              LVE EGSH +QNVYDSLD+HVGQC +VLVTADKEPKDYY+V S+R  K       II Y
Sbjct  63    KLVETEGSHVVQNVYDSLDVHVGQCYTVLVTADKEPKDYYMVASTRMTKYNLLGKGIIRY  122

Query  455   ANGNGITASPELPPSPPENTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRT  634
              NG G  ASP LPP+P     G AWS+NQFRSFRWNLTASAARPNPQGSYHYGQI+ITRT
Sbjct  123   TNGKG-PASPMLPPAP----VGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQISITRT  177

Query  635   IKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVFKYDIMGDTPPENGEKVT  814
             IK VNS S V+GKLRYA+NGVSH++ +TP+KLAEY+G+++KVFKY+I+ D PP +   +T
Sbjct  178   IKFVNSVSNVNGKLRYAINGVSHVDPETPVKLAEYYGVADKVFKYNIISDEPPIDLRAIT  237

Query  815   LAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVS  994
             +APNV+  TFR F+EI+FEN  K +Q+Y+L G+SFF VA E G W+PEKRK YNL+DA+S
Sbjct  238   IAPNVMQTTFRTFIEIIFENPGKVLQSYNLGGYSFFVVAGEPGTWTPEKRKGYNLLDAIS  297

Query  995   RHSIQVYPNSWAAVMTTLDNAGMWNLRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDK  1174
             RH+IQV+P SWAA+M T DNAGMW L S+  E  YLGQQLY SV S E+S RDE+NLP+ 
Sbjct  298   RHTIQVFPKSWAAIMLTFDNAGMWQLGSEHAEHRYLGQQLYLSVESEEKSTRDEYNLPET  357

Query  1175  QQLCGLVKGMSMPPP  1219
             Q +CG+VK M  PPP
Sbjct  358   QLVCGIVKDMPRPPP  372



>ref|XP_004961713.1| PREDICTED: L-ascorbate oxidase homolog [Setaria italica]
Length=556

 Score =   515 bits (1326),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 237/394 (60%), Positives = 301/394 (76%), Gaps = 6/394 (2%)
 Frame = +2

Query  44    VFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPLFTMEAGKTYRYRVC  223
             V I DWY K H+ + ++LD+G ++ RP+GV+INGK G       P+FT EAGKTYR+RVC
Sbjct  166   VLIGDWYTKDHEVMARMLDAGRSVGRPEGVLINGKGGP-DAAAAPMFTFEAGKTYRFRVC  224

Query  224   NVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVLVTADKEPKDYYLVV  403
             N G++ S+NFR +GH M LVEMEGSHT+Q++YDSLD+HVG CLSVLV AD++P DYY+V 
Sbjct  225   NTGIKASLNFRIQGHDMKLVEMEGSHTVQDMYDSLDVHVGHCLSVLVDADQKPGDYYMVA  284

Query  404   SSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQFRSFRWNLTASAAR  583
             S+RF     S +A+I YA  N   +         E   G AWSINQ+RSFRWNLTASAAR
Sbjct  285   STRFIHDARSVMAVIRYAGSNTPPSPNVP-----EPPAGWAWSINQWRSFRWNLTASAAR  339

Query  584   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  763
             PNPQGSYHYGQINITRTIKL+ S+ ++DGKL+Y  NGVSH +T+TPLKLAEYF +++ VF
Sbjct  340   PNPQGSYHYGQINITRTIKLMVSRGHIDGKLKYGFNGVSHRDTETPLKLAEYFNVTDGVF  399

Query  764   KYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  943
              Y+ MGD PP     +++ PNV+ A FR F+EI+FEN EK++ + HLDG++FF V +  G
Sbjct  400   SYNQMGDVPPAVNGPLSVIPNVITAEFRTFIEIIFENPEKSMDSLHLDGYAFFGVGMGPG  459

Query  944   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSDMWERAYLGQQLYFS  1123
             +WSPE RK YNL+DAVSRH+IQVYP SW+A+M T DNAGMWN+RS++WER YLG+QLY S
Sbjct  460   KWSPELRKTYNLLDAVSRHTIQVYPRSWSAIMLTFDNAGMWNIRSNIWERHYLGEQLYMS  519

Query  1124  VLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             V+SP RSLRDE+N+PD    CG V G+ MPP Y+
Sbjct  520   VVSPARSLRDEYNMPDNALRCGKVVGLPMPPSYA  553



>ref|XP_006386039.1| multi-copper oxidase type 1 family protein, partial [Populus 
trichocarpa]
 gb|ERP63836.1| multi-copper oxidase type 1 family protein, partial [Populus 
trichocarpa]
Length=534

 Score =   513 bits (1321),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 250/411 (61%), Positives = 303/411 (74%), Gaps = 32/411 (8%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V ++DWY   H TL+K LDSG ++ARP+GV+INGK+ K     +PL
Sbjct  127   LIPVPYVDPEDDYTVILNDWYTSSHSTLRKYLDSGRSLARPNGVLINGKNAKGDGNDEPL  186

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FTM+ GKTY+YR+CN G++ ++NFR +GHTM LVEMEGSH +QNVY+ LD+HVGQC SVL
Sbjct  187   FTMKPGKTYKYRICNAGLKNTLNFRIQGHTMKLVEMEGSHVVQNVYEPLDVHVGQCFSVL  246

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
                                 +  ++  II Y NG G  ASPELP +P     G AWS+NQ
Sbjct  247   --------------------EVLTSKGIIRYTNGKG-PASPELPEAP----VGWAWSLNQ  281

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSF WNLTASAARPNPQGSYHYG INITRTIKLVNS S   GKL YA+NGVSH+N +TP
Sbjct  282   FRSFHWNLTASAARPNPQGSYHYGSINITRTIKLVNSASRAGGKLCYAINGVSHVNPETP  341

Query  722   LKLAEYFGISEKVFKYDIMGDTPPEN--GEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             LKLAEY+GI+ KVFKYD + D P  N    KV   PNV+N TFRNFVEIVFENHEK++Q+
Sbjct  342   LKLAEYYGIAHKVFKYDTIPDMPLANIASAKVVTHPNVINQTFRNFVEIVFENHEKSMQS  401

Query  896   YHLDGHSFFAV-----AIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAG  1060
             YHLDG+SFFA+      IE   W+PEKRK+YNL+DAVSR +IQV+P SWAA++ T DNAG
Sbjct  402   YHLDGYSFFALYTNIHNIEPDTWTPEKRKSYNLLDAVSRTTIQVFPKSWAAILLTFDNAG  461

Query  1061  MWNLRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMP  1213
             MWN+RS+MWER YLGQQLY SVL P  SL+DE+N+PD   LCG VK +  P
Sbjct  462   MWNIRSEMWERTYLGQQLYVSVLCPGCSLKDEYNVPDNALLCGQVKDLPKP  512



>gb|EMT12555.1| L-ascorbate oxidase-like protein [Aegilops tauschii]
Length=440

 Score =   508 bits (1309),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 233/395 (59%), Positives = 300/395 (76%), Gaps = 10/395 (3%)
 Frame = +2

Query  44    VFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPLFTMEAGKTYRYRVC  223
             V I DW+ K H  +  +LD+G    RP GV+ING+ GK      P+FT EA KTY+ R+C
Sbjct  51    VLIGDWFTKDHAVMASLLDAGRNFGRPAGVLINGRGGKEAAN-PPMFTWEAAKTYQLRIC  109

Query  224   NVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVLVTADKEPKDYYLVV  403
             NVG++TS+NFR +GH M LVEM+GSHT+Q +Y+SLD+HVGQC++VLV AD++P DY +V 
Sbjct  110   NVGIKTSLNFRIQGHDMKLVEMDGSHTVQGMYESLDVHVGQCMAVLVDADQKPADYLMVA  169

Query  404   SSRFFKQEFSTVAIISYANGNGITASPELPPSP--PENTEGIAWSINQFRSFRWNLTASA  577
             S+RF     S  A+I YA  N        PP+   PE   G AWSINQ+RSFRWNLTASA
Sbjct  170   STRFMAGPSSVSAVIRYAGSN-------TPPAANVPEPPAGWAWSINQWRSFRWNLTASA  222

Query  578   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  757
             ARPNPQGSYHYGQINITRTIKL+ ++ +V+GKL+Y  NGVSH++ DTPLKLAEYF +S++
Sbjct  223   ARPNPQGSYHYGQINITRTIKLMVTRGHVEGKLKYGFNGVSHVDGDTPLKLAEYFNVSDQ  282

Query  758   VFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  937
             VFKY+ MGD PP     + + PNV+ A FR F+E+VFEN EK++++ H+DG++FFAV + 
Sbjct  283   VFKYNQMGDEPPAVNGPMHVVPNVITAEFRTFIEVVFENPEKSMESMHIDGYAFFAVGMG  342

Query  938   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSDMWERAYLGQQLY  1117
              G+W+  +RK YNL+DAVSRH+IQVYP SW+AVM T DNAGMWN+RS++WER YLG+QLY
Sbjct  343   PGKWTAAERKTYNLLDAVSRHTIQVYPRSWSAVMLTFDNAGMWNVRSNLWERHYLGEQLY  402

Query  1118  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1222
              SV+SP RSLRDE+N+P+    CG V G+SMPP Y
Sbjct  403   MSVVSPARSLRDEYNMPENALRCGKVVGLSMPPSY  437



>ref|NP_001151961.1| pollen-specific protein NTP303 precursor [Zea mays]
 gb|ACG45153.1| pollen-specific protein NTP303 precursor [Zea mays]
Length=559

 Score =   511 bits (1316),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 242/412 (59%), Positives = 303/412 (74%), Gaps = 12/412 (3%)
 Frame = +2

Query  2     LIPVPFDSPADEFN--VFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID  175
             LIPVPFD P  E +  V I DWY K H+ L + +D+G  + RP GV+INGK GK   +  
Sbjct  153   LIPVPFDQPPPENDHVVLIGDWYTKDHEVLARQIDAGKGVGRPAGVLINGKGGK-DLEAA  211

Query  176   PLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLS  355
             P FT EAGKTYR RVCN G++ S+NFR +GH M LVE+EGSHT+QN YDSLD+HVG CLS
Sbjct  212   PAFTFEAGKTYRLRVCNTGIKASLNFRIQGHYMKLVELEGSHTLQNTYDSLDVHVGHCLS  271

Query  356   VLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSP--PENTEGIAW  529
             VLV AD++P DYY+V S+RF     S  A+I YA  +       +PP+P   E   G AW
Sbjct  272   VLVDADQKPGDYYMVASTRFIHDAKSASAVIRYAGSS-------VPPAPNMTEPPAGWAW  324

Query  530   SINQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHIN  709
             SINQ RSFRWNLTASAARPNPQGSYHYGQINITRTIK++ S+ ++DGKLRY  NG+SH +
Sbjct  325   SINQARSFRWNLTASAARPNPQGSYHYGQINITRTIKVMVSRGHIDGKLRYGFNGISHRD  384

Query  710   TDTPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTI  889
              +TP+KLAEYF +++ VF Y+ MGD PP     + + PNV+ A FR F+EIVFEN EK+I
Sbjct  385   PETPVKLAEYFNVTDGVFSYNQMGDVPPAVNGPLHVIPNVITAEFRTFIEIVFENPEKSI  444

Query  890   QTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWN  1069
              + H+DG++FF V +  G+WSPE RK YNL+D VSRH+IQVYP SW A+M T DNAGMW+
Sbjct  445   DSLHVDGYAFFGVGMGPGKWSPEVRKTYNLLDTVSRHTIQVYPRSWTAIMLTFDNAGMWS  504

Query  1070  LRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             + S++WER YLG+Q Y SV+SP RSLRDE+N+PD    CG V G+ +PP Y+
Sbjct  505   VHSNIWERYYLGEQFYISVVSPARSLRDEYNMPDNALRCGKVVGLPLPPSYA  556



>gb|ACN26659.1| unknown [Zea mays]
 gb|AFW78430.1| pollen-specific protein NTP303 [Zea mays]
Length=559

 Score =   510 bits (1314),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 243/412 (59%), Positives = 301/412 (73%), Gaps = 12/412 (3%)
 Frame = +2

Query  2     LIPVPFDSPADEFN--VFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID  175
             LIPVPFD P  E +  V I DWY K H+ L + +D+G  + RP GV+INGK GK   +  
Sbjct  153   LIPVPFDQPPPENDHVVLIGDWYTKDHEVLARQIDAGKGVGRPAGVLINGKGGK-DLEAA  211

Query  176   PLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLS  355
             P FT EAGKTYR RVCN G++ S+NFR +GH M LVE+EGSHT+QN YDSLD+HVG CLS
Sbjct  212   PAFTFEAGKTYRLRVCNTGIKASLNFRIQGHYMKLVELEGSHTLQNTYDSLDVHVGHCLS  271

Query  356   VLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSP--PENTEGIAW  529
             VLV AD++P DYY+V S+RF     S  A+I YA  +        PPSP   E   G AW
Sbjct  272   VLVDADQKPGDYYMVASTRFIHDAKSASAVIRYAGSSA-------PPSPNMTEPPAGWAW  324

Query  530   SINQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHIN  709
             SINQ RSFRWNLTASAARPNPQGSYHYGQINITRTIK++ S+ ++DGKLRY  NG+SH +
Sbjct  325   SINQARSFRWNLTASAARPNPQGSYHYGQINITRTIKVMVSRGHIDGKLRYGFNGISHRD  384

Query  710   TDTPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTI  889
              +TP+KLAEYF  ++ VF Y+ MGD PP     + + PNV+ A FR F+EIVFEN EK+I
Sbjct  385   PETPVKLAEYFNATDGVFSYNQMGDVPPAVNGPLHVIPNVITAEFRTFIEIVFENPEKSI  444

Query  890   QTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWN  1069
              + H+DG++FF V +  G+WSPE RK YNL+D VSRH+IQVYP SW A+M T DNAGMW+
Sbjct  445   DSLHVDGYAFFGVGMGPGKWSPEVRKTYNLLDTVSRHTIQVYPRSWTAIMLTFDNAGMWS  504

Query  1070  LRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             + S++WER YLG+Q Y SV+SP RSLRDE+N+PD    CG V G+ +PP Y+
Sbjct  505   VHSNIWERYYLGEQFYISVVSPARSLRDEYNMPDNALRCGKVVGLPLPPSYA  556



>ref|XP_002441281.1| hypothetical protein SORBIDRAFT_09g023770 [Sorghum bicolor]
 gb|EES19711.1| hypothetical protein SORBIDRAFT_09g023770 [Sorghum bicolor]
Length=559

 Score =   509 bits (1312),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 245/410 (60%), Positives = 306/410 (75%), Gaps = 8/410 (2%)
 Frame = +2

Query  2     LIPVPFDSPADEFN--VFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID  175
             LIPVPFD P  E +  V I DWY K H+ L + LD+G ++ RP GVVINGK GK  +   
Sbjct  153   LIPVPFDQPPPENDHVVLIGDWYTKDHEVLARQLDAGKSVGRPAGVVINGKGGKDLESA-  211

Query  176   PLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLS  355
             PLFT +AGKTYR RVCN G++ S+NFR +GH MTLVE+EGSHT+Q+VYDSLD+HVG CLS
Sbjct  212   PLFTFDAGKTYRLRVCNTGIKASLNFRIQGHHMTLVELEGSHTLQDVYDSLDVHVGHCLS  271

Query  356   VLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSI  535
             VLVTAD++P DYY+V S+RF     S  A++ YA      +S   P   PE   G AWSI
Sbjct  272   VLVTADQKPGDYYMVASTRFIHDAKSARAVVRYAG-----SSAPPPAEMPEPPAGWAWSI  326

Query  536   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTD  715
             NQ RS RWNLT+SAARPNPQGSYHYGQINITRTI+++ S+ ++DGKLRY  NGVSH + +
Sbjct  327   NQARSIRWNLTSSAARPNPQGSYHYGQINITRTIRVMVSRGHIDGKLRYGFNGVSHRDPE  386

Query  716   TPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             TP+KLAEYF +++ VF Y+ MGD PP     + + PNV+ A FR F+EIVFEN EK++ +
Sbjct  387   TPVKLAEYFNVTDGVFSYNQMGDVPPAVNGPLHVVPNVITAEFRTFIEIVFENPEKSLDS  446

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
              HLDG++FF V +  G+WSPE R  YNL+DAVSRH+IQVYP SW A+M T DNAGMW++R
Sbjct  447   IHLDGYAFFGVGMGPGQWSPEARVTYNLLDAVSRHTIQVYPRSWTAIMLTFDNAGMWSVR  506

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             S++WER YLG+Q Y SV+SPE SLRDE+N+PD    CG V G+ +PP YS
Sbjct  507   SNIWERYYLGEQFYISVISPEHSLRDEYNMPDNDLRCGKVVGLPLPPSYS  556



>emb|CDY43352.1| BnaA01g29830D [Brassica napus]
Length=509

 Score =   507 bits (1306),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 230/350 (66%), Positives = 291/350 (83%), Gaps = 5/350 (1%)
 Frame = +2

Query  176   PLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLS  355
             PLFTM+ GKTY+YR+CNVG ++++NFR +GH M LVEMEGSH +QN YDSLD+HVGQC +
Sbjct  164   PLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFA  223

Query  356   VLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSI  535
             VLVTAD+E K YY+V S+RF K+E STV ++SY  G+ +  S  LP +P     G AWS+
Sbjct  224   VLVTADQEAKSYYMVASTRFLKKEVSTVGVMSY-EGSNVQPSNVLPKAP----VGWAWSL  278

Query  536   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTD  715
             NQFRSFRWNLTASAARPNPQGSYHYG+INITRTIKL N+K+ VDGK+R+ LNGVSH++T+
Sbjct  279   NQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVDGKVRFGLNGVSHVDTE  338

Query  716   TPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             TPLKLAEYF +SEKVFKY+++ D P      +T+ PNV+N TFR FVEIVFENHE+++Q+
Sbjct  339   TPLKLAEYFEMSEKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVEIVFENHERSMQS  398

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG+SFF+VA E G W+PEKR NYNL+DAVSRH++QV+P SW+A++ T DNAGMWN+R
Sbjct  399   FHLDGYSFFSVASEPGTWTPEKRNNYNLLDAVSRHTVQVFPKSWSAILLTFDNAGMWNIR  458

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             S+ WER YLGQQ+Y SVLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  459   SENWERRYLGQQMYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPTPYT  508



>gb|EMS66047.1| L-ascorbate oxidase-like protein [Triticum urartu]
Length=570

 Score =   508 bits (1307),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 240/408 (59%), Positives = 302/408 (74%), Gaps = 17/408 (4%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD PAD+F   + DWY K H  L K LD+G  I RP G++INGK+ K      P+
Sbjct  178   LIPVPFDPPADDFGALVGDWYTKDHTVLAKNLDTGKGIGRPAGLLINGKNEKDASN-PPM  236

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             + +EAGKTYR+RVCNVG++T++N R +GH + LVEMEGSHT+QN YDS+D+H+GQCLS L
Sbjct  237   YNVEAGKTYRFRVCNVGIKTTLNVRIQGHVLKLVEMEGSHTVQNEYDSMDVHIGQCLSFL  296

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
              TA+++P DY+ + S+RF K   +  A+I Y   N   A+ +LP +P    +G AWSINQ
Sbjct  297   TTANQKPGDYFFIASTRFIKGVSTITAVIRYKGSNTPPAA-KLPDAP----DGWAWSINQ  351

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             +RSFRWNLTASAARPNPQGSYHYGQINITRTIKL  S+  VDGK RYALNGVSH + +TP
Sbjct  352   WRSFRWNLTASAARPNPQGSYHYGQINITRTIKLSPSRGKVDGKERYALNGVSHTDPETP  411

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLAEYF  ++ VF+Y+++ DTPP+ G  + +AP+V+    R ++EIVFEN EK+I T+H
Sbjct  412   LKLAEYFNATKGVFEYNLVTDTPPKEGTPIKVAPSVITTEHRTYIEIVFENPEKSIDTFH  471

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG++FFA             K YNL+D VSRH+IQVYP SW AVM T DNAGMWNLRS+
Sbjct  472   LDGYAFFAAG-----------KTYNLLDTVSRHTIQVYPRSWTAVMLTFDNAGMWNLRSN  520

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1225
             +WER YLG+QLY S  SP RSLRDE+N+PD    CG V GM +PPPY+
Sbjct  521   LWERYYLGEQLYVSCTSPARSLRDEYNMPDNALRCGKVVGMPLPPPYT  568



>emb|CDY54363.1| BnaC06g07290D [Brassica napus]
Length=545

 Score =   491 bits (1265),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 239/410 (58%), Positives = 294/410 (72%), Gaps = 18/410 (4%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVP+  P D++ V I+DWY K H  LK  LDSG TI RPDG++INGK GK      PL
Sbjct  152   LIPVPYADPEDDYTVLINDWYTKTHTQLKNFLDSGRTIGRPDGILINGKAGKGDGSDQPL  211

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FT++ GKTYR R+CNVG++ S+NFR + H M LVEMEGSH +QN YDSLD+HVGQC  V 
Sbjct  212   FTLKQGKTYRIRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVT  271

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             +TA++EPKDYY+V S+RF K   +T  ++ Y  G G+ AS +LP +P     G AWS+NQ
Sbjct  272   LTANQEPKDYYMVASTRFLKNALTTTGLLRYEGGKGL-ASSQLPAAP----VGWAWSLNQ  326

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVN++  VD KLRYALNGVSHI+ +TP
Sbjct  327   FRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDSKLRYALNGVSHIDPETP  386

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEK-VTLAPNVVNATFRNFVEIVFENHEKTIQTY  898
             LKLAEYFG+++KVFKYD + D P  +  K + + PNV+N        I     E  +  +
Sbjct  387   LKLAEYFGVTDKVFKYDSISDNPTSDQIKNIKIEPNVLN--------ITQPREECPVLAF  438

Query  899   HLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRS  1078
                      +    G W+PEKRKNYNL+DAVSRH+IQVYP  WAA++ T DN GMWN+RS
Sbjct  439   GW----LLLLRYSPGTWTPEKRKNYNLLDAVSRHTIQVYPKCWAAILLTFDNCGMWNIRS  494

Query  1079  DMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1228
             +  ER YLGQQLY SVLSPE+SLRDE+N+P+    CGLVK      PY+G
Sbjct  495   ENSERRYLGQQLYASVLSPEKSLRDEYNMPESSLQCGLVKDKPKINPYAG  544



>gb|ABV89619.1| Sku5-like 11 [Brassica rapa]
Length=553

 Score =   473 bits (1218),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 244/416 (59%), Positives = 296/416 (71%), Gaps = 19/416 (5%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKID-P  178
             LIPVP+  P D++ V I DWY K H  LKK LD G TI RPDG+VINGK GK GD  D P
Sbjct  149   LIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTIGRPDGIVINGKSGK-GDGSDAP  207

Query  179   LFTMEAGKTYRYRVCNVGMRTSVN----FRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQ  346
             LFT++       R+  +G  T V+    FR + H M LVE +   T              
Sbjct  208   LFTLKPE-----RLTGLGSVTWVSDIYHFRIQNHKMKLVEWK-DRTFFKRLRLSRRSRWP  261

Query  347   CLSVLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIA  526
              L  +VTA++EPKDYY+V SSRF K   +T  ++ Y  G G  AS +LP  P     G A
Sbjct  262   VLWHIVTANQEPKDYYMVASSRFLKTVITTTGLLRYEGGKG-PASSQLPAGP----VGWA  316

Query  527   WSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHI  706
             WS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRTIKLVN++  VDGKLR+ALNGVSH 
Sbjct  317   WSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRFALNGVSHT  376

Query  707   NTDTPLKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEK  883
               +TPLKLAEYFGIS+KVFKYD + D P PE  + + + PNV+N T R FVE+VFENHEK
Sbjct  377   EPETPLKLAEYFGISDKVFKYDTITDDPTPEQIKNIKIEPNVLNITHRTFVEVVFENHEK  436

Query  884   TIQTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGM  1063
             ++Q++HLDG+SFF+VA+E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GM
Sbjct  437   SVQSWHLDGYSFFSVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGM  496

Query  1064  WNLRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMP-PPYSG  1228
             WN+RS+  ER YLGQQLY SVLSPE+SLRDE+N+P+    CGLVK    P  PY+G
Sbjct  497   WNVRSENTERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKNTPKPVNPYAG  552



>gb|AFK33666.1| unknown [Lotus japonicus]
Length=467

 Score =   457 bits (1175),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 215/322 (67%), Positives = 259/322 (80%), Gaps = 5/322 (2%)
 Frame = +2

Query  2    LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
            LIPVP+  P DE+ V I DWY K HKTLK +LDSG +I RP+GV+INGK  K      PL
Sbjct  146  LIPVPYPDPEDEYWVIIGDWYAKSHKTLKSLLDSGRSIGRPNGVLINGKTAKGDGSDQPL  205

Query  182  FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
            +TM+ GKTY+YR+CNVG++ S+NFR +GH M LVE EGSH +QN YDSLD+HVGQC +VL
Sbjct  206  YTMKPGKTYKYRICNVGLKDSLNFRIQGHPMKLVETEGSHVVQNTYDSLDVHVGQCYTVL  265

Query  362  VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
            VTADK+PKDYYLV S+RF K   +   II Y NG G  ASPELPP+P     G AWS+NQ
Sbjct  266  VTADKDPKDYYLVASTRFTKYSLTGKGIIRYTNGVG-PASPELPPAP----VGWAWSLNQ  320

Query  542  FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
            FRSFRWNLTASAARPNP+GSYHYGQINITRTIKLVN+ S   GKLRYA+NGVSH++ +TP
Sbjct  321  FRSFRWNLTASAARPNPRGSYHYGQINITRTIKLVNTVSKAQGKLRYAINGVSHVDGETP  380

Query  722  LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
            LKLAEYFG+++KVFKY+I+ D PP +   +TLAPNVVNATFR F+EI+FEN  KT+Q+Y+
Sbjct  381  LKLAEYFGVADKVFKYNIISDEPPADLNTITLAPNVVNATFRTFIEIIFENPGKTVQSYN  440

Query  902  LDGHSFFAVAIEAGRWSPEKRK  967
            LDG+SFF VA+E G+W+PEKRK
Sbjct  441  LDGYSFFLVAVEPGKWTPEKRK  462



>ref|XP_006850531.1| hypothetical protein AMTR_s00159p00040990 [Amborella trichopoda]
 gb|ERN12112.1| hypothetical protein AMTR_s00159p00040990 [Amborella trichopoda]
Length=543

 Score =   456 bits (1174),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 220/404 (54%), Positives = 293/404 (73%), Gaps = 13/404 (3%)
 Frame = +2

Query  5     IPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPLF  184
             IPVPFD PA+++ + I DWY K HK L+K LD   ++ +P GV+ING+ GK  + +    
Sbjct  148   IPVPFDPPAEDYTLLIGDWYTKSHKELRKRLDDSKSLGKPCGVLINGRTGKNAETL----  203

Query  185   TMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVLV  364
             T+E GKTYR R+ NVG++TS+NFR +GH + LVE+EGSHT+QNVY+SLD+HVGQ  SVLV
Sbjct  204   TVEPGKTYRIRISNVGIKTSLNFRIEGHALLLVEIEGSHTVQNVYESLDVHVGQSYSVLV  263

Query  365   TADKEPKDYYLVVSSRFFKQEFSTVAIISYANGN-GITASPELPPSPPENTEGIAWSINQ  541
             TA++  KDY +V S+RF K   +  A++ Y+    G++ +    P+      G+A+S+NQ
Sbjct  264   TANQAVKDYQIVASTRFTKYILTGTAVLHYSGATEGVSDAALSGPT------GVAFSLNQ  317

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
             FRSFRWNLTASAARPNPQGSYHYG I I RTIKL +S   ++GKLRYA+NGVS+    TP
Sbjct  318   FRSFRWNLTASAARPNPQGSYHYGSIPIVRTIKLASSIGKIEGKLRYAINGVSYKQASTP  377

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLA+Y+ + ++V+    M D+PPE  E++    NVV+   R+F+EIVFEN EKT+QT+H
Sbjct  378   LKLADYYEMGKEVWCDKCMPDSPPE--EEMKEETNVVDGVHRDFIEIVFENREKTVQTWH  435

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             L+G+SFFAV +  G W+PE R  YNL DA+SR +IQVYP SW+A++ T DNAGMW+LRS+
Sbjct  436   LNGYSFFAVGMSRGTWTPESRNVYNLFDAISRSNIQVYPKSWSAILLTTDNAGMWSLRSE  495

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMP  1213
             +WER YLGQQLY  + SP  SLRDE+++P     CGLV     P
Sbjct  496   IWERQYLGQQLYLRIPSPVHSLRDEYDIPLNTPHCGLVANKGEP  539



>gb|KGN54012.1| hypothetical protein Csa_4G267470 [Cucumis sativus]
Length=480

 Score =   442 bits (1137),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 214/314 (68%), Positives = 255/314 (81%), Gaps = 7/314 (2%)
 Frame = +2

Query  2    LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGH-TIARPDGVVINGKHGKVGDKIDP  178
            LIPVP+  P D++ V I DWY K H TLK+ILD+GH +IARP+GV+INGK  K     +P
Sbjct  148  LIPVPYADPEDDYTVLIGDWYTKSHTTLKQILDNGHRSIARPEGVLINGKTAKGDGTDEP  207

Query  179  LFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSV  358
            LFTM+  KTY+YRVCNVG++TS+NFRF+GHTM LVEMEGSHT+QN Y SLD+HVGQC SV
Sbjct  208  LFTMKPEKTYKYRVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQNDYQSLDVHVGQCFSV  267

Query  359  LVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSIN  538
            LVTA++EPKDYY+V S+RF K       II Y NG G  ASPE+P +P     G AWS+N
Sbjct  268  LVTANQEPKDYYMVASTRFIKNVLIGKGIIRYTNGKG-PASPEIPKAP----MGWAWSLN  322

Query  539  QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDT  718
            QFR+FRWNLTASAARPNPQGSYHYG INITRTIKL NS + VDGKLRYA+NGVSH++ +T
Sbjct  323  QFRTFRWNLTASAARPNPQGSYHYGSINITRTIKLFNSATKVDGKLRYAINGVSHVDPET  382

Query  719  PLKLAEYFGISEKVFKYDIMGDT-PPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
            PLKLAEYF I+EKVFKYD++ D  P E    VT+APNVVNATFRNF+EI+FENHEK++Q+
Sbjct  383  PLKLAEYFEIAEKVFKYDMISDEGPTEGATAVTIAPNVVNATFRNFIEIIFENHEKSLQS  442

Query  896  YHLDGHSFFAVAIE  937
            +HLDG+SFFAVA E
Sbjct  443  WHLDGYSFFAVADE  456



>ref|XP_007047154.1| SKU5 similar 17 isoform 3 [Theobroma cacao]
 gb|EOX91311.1| SKU5 similar 17 isoform 3 [Theobroma cacao]
Length=406

 Score =   439 bits (1128),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 204/400 (51%), Positives = 282/400 (71%), Gaps = 14/400 (4%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             +IP+P+ +P  +F + I DWY   HKTL++ LDSG ++  PDGV+ING+           
Sbjct  18    VIPIPYANPDGDFTLLIGDWYKTSHKTLQQTLDSGKSLPFPDGVLINGQ-------TQTT  70

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             F+ E GKTY +R+ NVG+ TS+NFR +GHTM LVE+EGSH IQN+YDSLD+HVGQ ++VL
Sbjct  71    FSGEQGKTYMFRISNVGLSTSLNFRIQGHTMKLVEVEGSHVIQNLYDSLDVHVGQSVTVL  130

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VT ++ PKDYY+V S+RF K   +  A++ Y N     + P LP +P        WS+ Q
Sbjct  131   VTLNQPPKDYYIVASTRFTKTVLTATAVLHYTNSQTPVSGP-LPAAPAYQYH---WSMQQ  186

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
              R++RWNLT++AARPNPQGS+HYG+I  T+TI L NS S ++GKLRY +NGVS +N DTP
Sbjct  187   ARTYRWNLTSNAARPNPQGSFHYGKITTTKTIVLANSGSLINGKLRYTVNGVSFVNPDTP  246

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLA+YF I   VF    + D P  +G   T+A +VV  +  +F+E+VF+N+E T+Q++H
Sbjct  247   LKLADYFNI-PGVFSMSSIQDLP--SGGAATVATSVVPTSLHDFIEVVFQNNENTMQSWH  303

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+ F+ V   +G+W+P+KR+ YNL+DA++RH+ QVYPNSW A++ +LDN GMWN+RS 
Sbjct  304   LDGYDFWVVGFGSGQWAPKKRRTYNLIDALTRHTTQVYPNSWTAILVSLDNQGMWNMRSA  363

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKG  1201
             MWER YLGQQ Y  V +P RS  +E+++P    LCG   G
Sbjct  364   MWERQYLGQQFYLRVWTPVRSFANEYDIPSNVLLCGKAVG  403



>ref|XP_008466955.1| PREDICTED: L-ascorbate oxidase homolog, partial [Cucumis melo]
Length=281

 Score =   431 bits (1109),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 203/286 (71%), Positives = 242/286 (85%), Gaps = 6/286 (2%)
 Frame = +2

Query  173   DPLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCL  352
             +PLFTM+ GKTY+YRVCNVG+++S+NFRF+GHTM LVEMEGSHT+QN Y SLD+HVGQC 
Sbjct  1     EPLFTMKPGKTYKYRVCNVGLKSSLNFRFQGHTMKLVEMEGSHTVQNDYQSLDVHVGQCF  60

Query  353   SVLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWS  532
             SVLVTA++E KDYY+V S+RF K       I+ Y +G G  ASPE+P +P     G AWS
Sbjct  61    SVLVTANQESKDYYMVASTRFIKNVLVGKGIVRYTDGKG-PASPEIPEAP----VGWAWS  115

Query  533   INQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINT  712
             +NQFR+FRWNLTASAARPNPQGSYHYG INITRTIKLVNS S VDGKLRYA+NGVSH++ 
Sbjct  116   LNQFRTFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASKVDGKLRYAINGVSHVDP  175

Query  713   DTPLKLAEYFGISEKVFKYDIMGDTP-PENGEKVTLAPNVVNATFRNFVEIVFENHEKTI  889
             +TPLKLAEYFGI++KVFKYD + D    E    VT+APNVVNATFR+F+EI+FENHEK++
Sbjct  176   ETPLKLAEYFGIADKVFKYDTISDEGLAEGATTVTVAPNVVNATFRDFIEIIFENHEKSL  235

Query  890   QTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSW  1027
             Q++HLDG+SFFAVAIE GRWSPEKR NYNL+DAVSRH+IQV+P SW
Sbjct  236   QSWHLDGYSFFAVAIEPGRWSPEKRANYNLLDAVSRHTIQVFPKSW  281



>ref|XP_007041705.1| SKU5 similar 5 [Theobroma cacao]
 gb|EOX97536.1| SKU5 similar 5 [Theobroma cacao]
Length=547

 Score =   440 bits (1131),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 215/404 (53%), Positives = 282/404 (70%), Gaps = 12/404 (3%)
 Frame = +2

Query  5     IPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPLF  184
             IPVPF  PA +F V I DWY   H+ LK  LD GH +  PDG++ING HG  G     +F
Sbjct  155   IPVPFPDPAGDFTVLIGDWYKTDHRQLKARLDGGHKLPFPDGILING-HGPNG----AIF  209

Query  185   TMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVLV  364
             T+E GKTYR+R+ NVG++ ++NFR +GH+M LVE+EG+HT+Q +Y+SLD+HVGQ  SVLV
Sbjct  210   TVEQGKTYRFRISNVGLQNTLNFRIQGHSMKLVEVEGTHTVQTIYESLDVHVGQSYSVLV  269

Query  365   TADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQF  544
             T D+  KD+Y+V S+RF  +  +T A + Y+N N   + P +P  P   T+ I WS+NQ 
Sbjct  270   TMDQTAKDFYIVASTRFTDKILTTTASLHYSNSNKAVSGP-IPGGP---TDQIDWSLNQA  325

Query  545   RSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPL  724
             RS R NLTAS  RPNPQGSYHYG INITRTIKLV+S + V+GK RYA+N VS +  DTPL
Sbjct  326   RSIRTNLTASGPRPNPQGSYHYGLINITRTIKLVSSAAQVNGKQRYAVNSVSFVPADTPL  385

Query  725   KLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHL  904
             KLA+YF I + VF+   + D+P   G+K+ L  +V+ A FR FVEIVFENHE  +Q++H+
Sbjct  386   KLADYFKI-DGVFRVGSISDSPA--GKKMYLDTSVMGADFRAFVEIVFENHESIVQSWHI  442

Query  905   DGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSDM  1084
             +G++F+ V ++ G W+P+ RK YNL DAVSR + QVYP SW A+   LDN GMWN+R++ 
Sbjct  443   NGYAFWVVGMDGGLWTPDSRKQYNLRDAVSRSTTQVYPRSWTAIYIALDNVGMWNVRTEF  502

Query  1085  WERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPP  1216
             W R YLGQQ Y  V SP  S+RDE+ +P    LCG   G S  P
Sbjct  503   WARQYLGQQFYLRVYSPVESVRDEYPIPKNALLCGRAAGKSTRP  546



>ref|XP_007047152.1| SKU5 similar 17 isoform 1 [Theobroma cacao]
 gb|EOX91309.1| SKU5 similar 17 isoform 1 [Theobroma cacao]
Length=538

 Score =   437 bits (1125),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 204/400 (51%), Positives = 282/400 (71%), Gaps = 14/400 (4%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             +IP+P+ +P  +F + I DWY   HKTL++ LDSG ++  PDGV+ING+           
Sbjct  150   VIPIPYANPDGDFTLLIGDWYKTSHKTLQQTLDSGKSLPFPDGVLINGQ-------TQTT  202

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             F+ E GKTY +R+ NVG+ TS+NFR +GHTM LVE+EGSH IQN+YDSLD+HVGQ ++VL
Sbjct  203   FSGEQGKTYMFRISNVGLSTSLNFRIQGHTMKLVEVEGSHVIQNLYDSLDVHVGQSVTVL  262

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VT ++ PKDYY+V S+RF K   +  A++ Y N     + P LP +P        WS+ Q
Sbjct  263   VTLNQPPKDYYIVASTRFTKTVLTATAVLHYTNSQTPVSGP-LPAAPAYQYH---WSMQQ  318

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
              R++RWNLT++AARPNPQGS+HYG+I  T+TI L NS S ++GKLRY +NGVS +N DTP
Sbjct  319   ARTYRWNLTSNAARPNPQGSFHYGKITTTKTIVLANSGSLINGKLRYTVNGVSFVNPDTP  378

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLA+YF I   VF    + D P  +G   T+A +VV  +  +F+E+VF+N+E T+Q++H
Sbjct  379   LKLADYFNI-PGVFSMSSIQDLP--SGGAATVATSVVPTSLHDFIEVVFQNNENTMQSWH  435

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+ F+ V   +G+W+P+KR+ YNL+DA++RH+ QVYPNSW A++ +LDN GMWN+RS 
Sbjct  436   LDGYDFWVVGFGSGQWAPKKRRTYNLIDALTRHTTQVYPNSWTAILVSLDNQGMWNMRSA  495

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKG  1201
             MWER YLGQQ Y  V +P RS  +E+++P    LCG   G
Sbjct  496   MWERQYLGQQFYLRVWTPVRSFANEYDIPSNVLLCGKAVG  535



>ref|XP_010028797.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW55613.1| hypothetical protein EUGRSUZ_I01478 [Eucalyptus grandis]
Length=545

 Score =   437 bits (1125),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 212/405 (52%), Positives = 278/405 (69%), Gaps = 12/405 (3%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD+PAD++ V I DWY   H  LK ILD GH +  PDG++ING+ G  G      
Sbjct  152   LIPVPFDNPADDYTVLIGDWYKANHTKLKAILDGGHRLPFPDGILINGR-GSNGAS----  206

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             F +E GKTYR R+ NVG++ ++NFR +GH M LVE+EG+HT+Q  Y SLD+HVGQ  SVL
Sbjct  207   FKVEQGKTYRLRISNVGLQNTLNFRIQGHKMKLVEVEGTHTVQTTYTSLDVHVGQSYSVL  266

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VTAD+ P+DYY+ VS+RF  +  ++ A++ YAN    +A P   P P   T  I WSINQ
Sbjct  267   VTADQTPQDYYIAVSTRFTSKVLTSTAVLHYAN----SARPVSGPVPGGPTSEIDWSINQ  322

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
              RS R NLTAS  RPNPQGSYHYG INITRTIKLV+S   ++GK RYA+N VS++  DTP
Sbjct  323   ARSIRTNLTASGPRPNPQGSYHYGLINITRTIKLVSSAGLINGKQRYAVNSVSYVPADTP  382

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLA+YF IS  VF+   + D+P     K+ L  +V+ A +R F+E+VFEN E  +Q++H
Sbjct  383   LKLADYFNIS-GVFRVGSISDSPI--ARKMHLDTSVMGADYRAFIEVVFENRESIVQSWH  439

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             L+G++F+ V ++ G W+PE+R  YNL DA+SR + QVYP SW A+   LDN GMWN+R++
Sbjct  440   LNGYAFWVVGMDGGLWTPERRNEYNLRDAISRCTTQVYPKSWTAIYIALDNVGMWNMRTE  499

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPP  1216
              W R YLGQQ Y  V +P  S+RDE+ +P    LCG  +G    P
Sbjct  500   HWARQYLGQQFYLRVHTPSTSIRDEYPIPKNALLCGRAQGKITRP  544



>gb|EYU36818.1| hypothetical protein MIMGU_mgv1a004264mg [Erythranthe guttata]
Length=536

 Score =   437 bits (1123),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 214/405 (53%), Positives = 271/405 (67%), Gaps = 12/405 (3%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             LIPVPFD+P D+F+V I DWY   H  LK ILD G+ +  PDG++ING+   V       
Sbjct  143   LIPVPFDNPTDDFSVLIGDWYTSNHTDLKAILDKGNKLPFPDGILINGRGPNVTS-----  197

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FT++ GKTYR+R+CNVG++ S+NFR +GH M +VE+EG+HT+Q  Y SLD+HVGQC+SVL
Sbjct  198   FTIQQGKTYRFRICNVGLQNSLNFRIQGHKMKVVEVEGTHTVQVSYSSLDIHVGQCMSVL  257

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             +TAD++P+DYY+VVSSRF     ST   + YA  N     P L P P   T  + WS+NQ
Sbjct  258   LTADQQPQDYYIVVSSRFTTPVLSTTGFLRYAGSN----RPALGPLPGGPTIEVDWSLNQ  313

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
              RS R NLTAS  RPNPQGSYHYG IN TRT +L +S   V  K RYALN VS I  DTP
Sbjct  314   ARSIRTNLTASGPRPNPQGSYHYGMINTTRTYRLSSSAGQVANKQRYALNSVSFIPADTP  373

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LK+A+YF I + VF+   + D+P   G  + L  +V+ A +R FVEIVFEN E  +Q+YH
Sbjct  374   LKVADYFKI-DGVFRVGSISDSP--TGGGIYLDTSVLGADYRAFVEIVFENTEDIVQSYH  430

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             L G+SFF V ++ G+W+ + R  YNL DAVSR ++QVYP SW A+   LDN GMWNLRS+
Sbjct  431   LSGYSFFVVGMDGGKWTSDSRAQYNLRDAVSRCTVQVYPMSWTAIYVALDNVGMWNLRSE  490

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPP  1216
              W R YLGQQ Y  V +   SLRDE+ +P    LCG   G    P
Sbjct  491   FWARQYLGQQTYLRVYTTSTSLRDEYPIPKNALLCGRASGRRTRP  535



>gb|KHG25743.1| L-ascorbate oxidase [Gossypium arboreum]
Length=538

 Score =   437 bits (1123),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 204/400 (51%), Positives = 284/400 (71%), Gaps = 14/400 (4%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPL  181
             +IP+P+ +P  +F + + DW+   HKTL++ LDSG ++  PDGV+ING+           
Sbjct  150   VIPIPYANPDGDFTLLVGDWFKANHKTLQQSLDSGKSMPFPDGVLINGQ-------TQAT  202

Query  182   FTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVL  361
             FT + GKTY +R  NVG+ TS+NFR +GH M LVE+EGSH IQN+YDSLD+HVGQ +++L
Sbjct  203   FTGDQGKTYMFRFSNVGLSTSLNFRIQGHKMKLVEVEGSHVIQNLYDSLDVHVGQSITIL  262

Query  362   VTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQ  541
             VT D+ PK+YY+V S+RF K   +  A + YAN N   + P   P+ P N  G  WS+ Q
Sbjct  263   VTLDQPPKNYYIVASTRFTKTVLTATAALHYANSNAPVSGPV--PAAPAN--GFDWSMEQ  318

Query  542   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTP  721
              R++RWNLT++AARPNPQGS+HYG I  T+TI L NS   ++GKLRYA+NGVS+IN DTP
Sbjct  319   ARTYRWNLTSNAARPNPQGSFHYGTITPTKTIVLANSAPLINGKLRYAVNGVSYINPDTP  378

Query  722   LKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYH  901
             LKLA+YF I   VF  + + + P  +G   TLA +V+  +  +F+E+VF+N+E T+Q +H
Sbjct  379   LKLADYFNI-PGVFSTNSLSELP--SGRAATLATSVMATSLHDFIEVVFQNNENTMQAWH  435

Query  902   LDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSD  1081
             LDG+ F+ V   +G+W+P+KRK+YNLVDA++RH+ QVYPNSW A++ +LDN GMWN+RS 
Sbjct  436   LDGYDFWVVGFGSGQWTPDKRKSYNLVDALTRHTTQVYPNSWTAILVSLDNQGMWNVRST  495

Query  1082  MWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKG  1201
             +W+R YLGQQ Y  V +P RSL +E+++P    LCG   G
Sbjct  496   LWDRQYLGQQFYLRVWNPVRSLANEYDIPSNVLLCGQAVG  535



>ref|XP_006364519.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=541

 Score =   436 bits (1122),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 220/399 (55%), Positives = 269/399 (67%), Gaps = 12/399 (3%)
 Frame = +2

Query  5     IPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPLF  184
             IPVPF  PA +F + I DWY   HK L+ ILD G  +  PDG+ ING  G+ G K    F
Sbjct  155   IPVPFPEPAGDFTILIGDWYKTDHKVLQTILDRGKRLTFPDGIQINGL-GRDGAK----F  209

Query  185   TMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVLV  364
             T+E GKTYR R+ NVG++ S+NFR +GH MTLVE+EG+HTIQ    SLD+HVGQ  SVLV
Sbjct  210   TVEPGKTYRLRISNVGLQNSLNFRIQGHKMTLVEVEGTHTIQTTLSSLDVHVGQSYSVLV  269

Query  365   TADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQF  544
             TAD+  +DYY+ VSSRF  Q  ++ AI+ Y+N     +   LPP  P  T  I+WS+NQ 
Sbjct  270   TADQPAQDYYIAVSSRFTTQILNSTAILHYSNSRKTVSG--LPPPGP--TTDISWSLNQA  325

Query  545   RSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPL  724
             RS R NLTAS  RPNPQGSYHYGQIN+TRTI+L N    VD K RYA+NGVS I  DTPL
Sbjct  326   RSIRTNLTASGPRPNPQGSYHYGQINVTRTIRLANHAGLVDKKQRYAVNGVSFIPADTPL  385

Query  725   KLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHL  904
             KLA+Y+ I + VFK   + D P   G K+ L   V+ A +R FVEIVFEN E  +Q++HL
Sbjct  386   KLADYYNI-DGVFKVGSIQDKPA--GRKIHLDTAVMGADYRAFVEIVFENRENIVQSWHL  442

Query  905   DGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSDM  1084
             DG+SFF V ++ GRWSP  +  YNL+DAVSR + QVYP SW A+   LDN GMWNLRS  
Sbjct  443   DGYSFFVVGMDVGRWSPASKNQYNLIDAVSRCTTQVYPRSWTAIYVPLDNVGMWNLRSQF  502

Query  1085  WERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKG  1201
             W R YLGQQ Y  V +P +S RDE+ +P     CG  KG
Sbjct  503   WARQYLGQQFYLRVYTPVKSFRDEYPIPKNALHCGRAKG  541



>ref|XP_007155969.1| hypothetical protein PHAVU_003G247700g [Phaseolus vulgaris]
 gb|ESW27963.1| hypothetical protein PHAVU_003G247700g [Phaseolus vulgaris]
Length=543

 Score =   436 bits (1122),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 209/404 (52%), Positives = 287/404 (71%), Gaps = 17/404 (4%)
 Frame = +2

Query  2     LIPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGK-HGKV-GDKID  175
             +IPVP+  P  +F + I DWY   HK+L++ LDSG+++A PDG++ING+ H  V GD+  
Sbjct  152   VIPVPYPYPDGDFTLLIGDWYKTNHKSLRESLDSGNSLAFPDGLLINGQAHTTVNGDQ--  209

Query  176   PLFTMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLS  355
                    GKTY +R+ NVGM TS+NFR +GHT+ LVE+EGSHT+QNVYD+LD+HVGQ  +
Sbjct  210   -------GKTYMFRISNVGMSTSINFRIQGHTLKLVEIEGSHTLQNVYDTLDVHVGQSAT  262

Query  356   VLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSI  535
             VLVT ++ PKDYY+V S+RF ++ F+  A++ Y+N N   + P   PSPP       WS+
Sbjct  263   VLVTLNQPPKDYYIVASTRFSRKMFTATAVLHYSNSNSPASGPL--PSPP--IHQYHWSV  318

Query  536   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTD  715
              Q R++RWNLTA+AARPNPQGSYHYG+I  T+TI L NS S ++GKLRY +N VS++N D
Sbjct  319   KQARTYRWNLTANAARPNPQGSYHYGEITPTKTIVLSNSASLINGKLRYTVNKVSYVNPD  378

Query  716   TPLKLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  895
             TPLKLA+YF I   ++  D +   P +N    ++A +VV     +F+E+VF+N+E T Q+
Sbjct  379   TPLKLADYFNI-PGIYSVDSLQSLPSDNTPS-SVATSVVPTDLHDFIEVVFQNNENTTQS  436

Query  896   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLR  1075
             +HLDG+ F+ V    G W+P KR+ YNLVDA++RH+ QVYPN+W  ++ +LDN GMWNLR
Sbjct  437   WHLDGYDFWVVGYGFGEWTPAKRRTYNLVDALTRHTAQVYPNAWTGILVSLDNQGMWNLR  496

Query  1076  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMS  1207
             S MWER YLGQQLY  V + ERSL +E+++PD   LCG   G +
Sbjct  497   SAMWERQYLGQQLYLRVWTSERSLANEYDIPDNVLLCGKAVGQN  540



>ref|XP_004287955.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=542

 Score =   436 bits (1121),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 216/404 (53%), Positives = 274/404 (68%), Gaps = 12/404 (3%)
 Frame = +2

Query  5     IPVPFDSPADEFNVFISDWYNKGHKTLKKILDSGHTIARPDGVVINGKHGKVGDKIDPLF  184
             IPVPFD PA +F +   DW+ + H  LK ILD G+ +  PDG++ING+ G  G+     F
Sbjct  150   IPVPFDPPAGDFTILAGDWFKQNHTDLKAILDGGNNLPFPDGLIINGR-GSNGNT----F  204

Query  185   TMEAGKTYRYRVCNVGMRTSVNFRFKGHTMTLVEMEGSHTIQNVYDSLDLHVGQCLSVLV  364
             T++ GKTYR+R+ NVG+ TS+NFR +GH M LVE+EG HT+QN Y SLD+H+GQ LSVLV
Sbjct  205   TVDQGKTYRFRISNVGIATSINFRIQGHKMLLVEVEGIHTLQNTYSSLDIHLGQSLSVLV  264

Query  365   TADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASPELPPSPPENTEGIAWSINQF  544
             TAD+ P+DYY+VVS+RF  Q  S  +I+ Y+N  G  + P  PP  P  T  + WS+ Q 
Sbjct  265   TADQPPQDYYIVVSTRFTSQVLSATSILHYSNSGGSVSGP--PPGGP--TTEVDWSLEQA  320

Query  545   RSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPL  724
             RSFR NLTAS  RPNPQGSYHYG IN TRTI+L NS   ++GK RYA+N VS +  DTPL
Sbjct  321   RSFRRNLTASGPRPNPQGSYHYGLINTTRTIRLTNSAPIINGKQRYAINSVSFLQPDTPL  380

Query  725   KLAEYFGISEKVFKYDIMGDTPPENGEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHL  904
             K+A+YF IS  VF    + D P   G    L  +V++A FR FVE VFEN E T+Q++HL
Sbjct  381   KVADYFKIS-GVFSVGSISDNPTGGGGY--LQTSVMHADFRAFVEFVFENPENTLQSWHL  437

Query  905   DGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSDM  1084
             DG+SFF V ++ G+W+P  R  YNL+D VSR ++QVYPNSW A+   LDN GMWN+RS+ 
Sbjct  438   DGYSFFVVGMDGGQWTPASRLRYNLMDTVSRCTVQVYPNSWTAIYVPLDNVGMWNVRSEN  497

Query  1085  WERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPP  1216
             W R YLGQQ Y  V SP  S RDE+ +P    LCG   G    P
Sbjct  498   WARQYLGQQFYLRVYSPVNSWRDEYPIPKNALLCGRASGRRTRP  541



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3816303783714