BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25630_g4_i1 len=1423 path=[@1928@!:0-40 5303:41-70 2482:71-126
7802:127-137 5399:138-202 5464:203-242 5504:243-276 5538:277-299
5561:300-451 8159:452-459 5721:460-673 2015:674-680 2022:681-731
7973:732-763 6023:764-799 8305:800-803 6063:804-856 6116:857-896
6156:897-1007 2739:1008-1019 2751:1020-1183 25:1184-1422]

Length=1423
                                                                      Score     E

ref|XP_009766183.1|  PREDICTED: L-ascorbate oxidase homolog             665   0.0      
ref|XP_009591795.1|  PREDICTED: L-ascorbate oxidase homolog             665   0.0      
gb|AAQ90182.1|  ntp101                                                  662   0.0      Nicotiana tabacum [American tobacco]
ref|XP_006367595.1|  PREDICTED: L-ascorbate oxidase homolog             657   0.0      
dbj|BAO02510.1|  predicted pollen-specific protein ortholog             647   0.0      
ref|XP_009624631.1|  PREDICTED: L-ascorbate oxidase homolog             645   0.0      
sp|P29162.1|ASOL_TOBAC  RecName: Full=L-ascorbate oxidase homolog...    645   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009588330.1|  PREDICTED: L-ascorbate oxidase homolog             646   0.0      
gb|AAQ90185.1|  ntp805                                                  644   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009773470.1|  PREDICTED: L-ascorbate oxidase homolog             644   0.0      
ref|XP_006341879.1|  PREDICTED: L-ascorbate oxidase homolog             642   0.0      
ref|XP_009785667.1|  PREDICTED: L-ascorbate oxidase homolog             639   0.0      
ref|XP_004228635.1|  PREDICTED: L-ascorbate oxidase homolog             636   0.0      
ref|XP_004229062.1|  PREDICTED: L-ascorbate oxidase homolog             635   0.0      
ref|XP_006354116.1|  PREDICTED: L-ascorbate oxidase homolog             634   0.0      
gb|EYU32815.1|  hypothetical protein MIMGU_mgv1a003910mg                630   0.0      
gb|EYU32814.1|  hypothetical protein MIMGU_mgv1a003925mg                624   0.0      
gb|ABI52585.1|  pollen-specific protein                                 622   0.0      Camellia sinensis [black tea]
gb|AAL87103.1|AF479568_1  1-ascorbate oxidase                           618   0.0      Petunia x hybrida [garden petunia]
gb|EPS72881.1|  pollen-specific protein                                 612   0.0      
gb|EYU39285.1|  hypothetical protein MIMGU_mgv1a026945mg                608   0.0      
ref|XP_011089764.1|  PREDICTED: L-ascorbate oxidase homolog             605   0.0      
emb|CDP18567.1|  unnamed protein product                                602   0.0      
ref|XP_011089765.1|  PREDICTED: L-ascorbate oxidase homolog             600   0.0      
ref|XP_011089767.1|  PREDICTED: L-ascorbate oxidase homolog             599   0.0      
ref|XP_011089763.1|  PREDICTED: L-ascorbate oxidase homolog             598   0.0      
ref|XP_011089766.1|  PREDICTED: L-ascorbate oxidase homolog             598   0.0      
ref|XP_011089702.1|  PREDICTED: L-ascorbate oxidase homolog             597   0.0      
ref|XP_009339220.1|  PREDICTED: L-ascorbate oxidase homolog             589   0.0      
emb|CDP04133.1|  unnamed protein product                                587   0.0      
ref|XP_008449912.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    587   0.0      
ref|XP_007208287.1|  hypothetical protein PRUPE_ppa003715mg             587   0.0      
ref|XP_008449913.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    583   0.0      
ref|XP_010044910.1|  PREDICTED: L-ascorbate oxidase homolog             583   0.0      
ref|XP_010034522.1|  PREDICTED: L-ascorbate oxidase homolog             581   0.0      
ref|XP_009376274.1|  PREDICTED: L-ascorbate oxidase homolog             581   0.0      
ref|XP_010247847.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    581   0.0      
ref|XP_004164924.1|  PREDICTED: L-ascorbate oxidase homolog             581   0.0      
ref|XP_010247848.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    581   0.0      
ref|XP_010247849.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    580   0.0      
ref|XP_009773307.1|  PREDICTED: L-ascorbate oxidase homolog             580   0.0      
ref|XP_010271079.1|  PREDICTED: L-ascorbate oxidase homolog             579   0.0      
ref|XP_004164922.1|  PREDICTED: L-ascorbate oxidase homolog             577   0.0      
ref|XP_009626538.1|  PREDICTED: L-ascorbate oxidase homolog             577   0.0      
gb|KFK38673.1|  hypothetical protein AALP_AA3G145200                    575   0.0      
ref|XP_007014658.1|  SKU5 similar 13                                    575   0.0      
ref|XP_004149637.1|  PREDICTED: L-ascorbate oxidase homolog             575   0.0      
ref|XP_008219681.1|  PREDICTED: L-ascorbate oxidase homolog             574   0.0      
ref|XP_008374029.1|  PREDICTED: L-ascorbate oxidase homolog             574   0.0      
ref|XP_009135303.1|  PREDICTED: L-ascorbate oxidase homolog             574   0.0      
ref|XP_004149634.1|  PREDICTED: L-ascorbate oxidase homolog             574   0.0      
ref|XP_008438536.1|  PREDICTED: L-ascorbate oxidase homolog             573   0.0      
ref|XP_002303974.1|  multi-copper oxidase type 1 family protein         573   0.0      Populus trichocarpa [western balsam poplar]
emb|CDX82540.1|  BnaA03g32810D                                          573   0.0      
ref|XP_004137383.1|  PREDICTED: L-ascorbate oxidase homolog             573   0.0      
ref|XP_004164925.1|  PREDICTED: L-ascorbate oxidase homolog             573   0.0      
ref|XP_010044914.1|  PREDICTED: L-ascorbate oxidase homolog             572   0.0      
ref|XP_004165665.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    571   0.0      
emb|CDX75708.1|  BnaC03g37910D                                          571   0.0      
gb|KDP30647.1|  hypothetical protein JCGZ_16212                         571   0.0      
ref|XP_002882820.1|  hypothetical protein ARALYDRAFT_478721             570   0.0      
ref|XP_006303856.1|  hypothetical protein CARUB_v10012595mg             570   0.0      
ref|XP_009600426.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    570   0.0      
ref|NP_187948.1|  protein SKU5-like 13                                  568   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010465173.1|  PREDICTED: L-ascorbate oxidase homolog             568   0.0      
ref|XP_008374030.1|  PREDICTED: L-ascorbate oxidase homolog             568   0.0      
ref|XP_009803815.1|  PREDICTED: L-ascorbate oxidase homolog             567   0.0      
ref|XP_011025085.1|  PREDICTED: L-ascorbate oxidase homolog             567   0.0      
ref|XP_002894511.1|  hypothetical protein ARALYDRAFT_474617             567   0.0      
ref|XP_010487093.1|  PREDICTED: L-ascorbate oxidase homolog             566   0.0      
emb|CDY10549.1|  BnaC03g70650D                                          566   0.0      
ref|XP_009106861.1|  PREDICTED: L-ascorbate oxidase homolog             566   0.0      
ref|XP_006352142.1|  PREDICTED: L-ascorbate oxidase homolog             566   0.0      
ref|XP_006407227.1|  hypothetical protein EUTSA_v10020444mg             565   0.0      
emb|CDY43994.1|  BnaA05g25890D                                          565   0.0      
ref|XP_009146525.1|  PREDICTED: L-ascorbate oxidase homolog             565   0.0      
emb|CDY23597.1|  BnaC05g39970D                                          565   0.0      
ref|XP_010673839.1|  PREDICTED: L-ascorbate oxidase homolog             565   0.0      
emb|CDY24188.1|  BnaC01g37680D                                          565   0.0      
ref|XP_002523381.1|  multicopper oxidase, putative                      565   0.0      Ricinus communis
ref|XP_010500435.1|  PREDICTED: L-ascorbate oxidase homolog             564   0.0      
ref|XP_006392622.1|  hypothetical protein EUTSA_v10011369mg             564   0.0      
gb|AAD10639.1|  putative pollen specific protein                        564   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDY56013.1|  BnaA08g29220D                                          564   0.0      
ref|XP_002523382.1|  multicopper oxidase, putative                      564   0.0      Ricinus communis
ref|XP_004502172.1|  PREDICTED: L-ascorbate oxidase homolog             563   0.0      
ref|NP_564697.1|  SKU5 similar 14                                       563   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_003635547.1|  PREDICTED: L-ascorbate oxidase homolog             563   0.0      
gb|KHG27164.1|  L-ascorbate oxidase                                     560   0.0      
ref|XP_002299087.1|  multi-copper oxidase type 1 family protein         563   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009611384.1|  PREDICTED: L-ascorbate oxidase homolog             563   0.0      
emb|CAN69061.1|  hypothetical protein VITISV_032605                     563   0.0      Vitis vinifera
gb|KFK35575.1|  hypothetical protein AALP_AA4G008600                    562   0.0      
ref|XP_004305574.1|  PREDICTED: L-ascorbate oxidase homolog             562   0.0      
ref|XP_011048127.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    561   0.0      
ref|XP_010034521.1|  PREDICTED: L-ascorbate oxidase homolog             561   0.0      
ref|XP_011048128.1|  PREDICTED: L-ascorbate oxidase homolog             561   0.0      
ref|XP_009339221.1|  PREDICTED: L-ascorbate oxidase homolog             561   0.0      
ref|XP_006299973.1|  hypothetical protein CARUB_v10016186mg             561   0.0      
ref|XP_009376784.1|  PREDICTED: L-ascorbate oxidase homolog             566   0.0      
ref|XP_011048126.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    561   0.0      
ref|XP_004505353.1|  PREDICTED: L-ascorbate oxidase homolog             560   0.0      
ref|XP_010093150.1|  L-ascorbate oxidase-like protein                   559   0.0      
gb|EYU39505.1|  hypothetical protein MIMGU_mgv1a003980mg                559   0.0      
ref|XP_010480096.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    559   0.0      
ref|XP_010501174.1|  PREDICTED: L-ascorbate oxidase homolog             559   0.0      
ref|XP_004250092.1|  PREDICTED: L-ascorbate oxidase homolog             559   0.0      
gb|KFK35574.1|  hypothetical protein AALP_AA4G008500                    559   0.0      
ref|XP_003556690.2|  PREDICTED: L-ascorbate oxidase homolog             559   0.0      
dbj|BAL41449.1|  SKU5 similar 1                                         558   0.0      
ref|XP_002297609.2|  multi-copper oxidase type 1 family protein         558   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010462411.1|  PREDICTED: L-ascorbate oxidase homolog             556   0.0      
ref|XP_010093149.1|  L-ascorbate oxidase-like protein                   556   0.0      
gb|EPS68478.1|  hypothetical protein M569_06286                         554   0.0      
ref|XP_004234818.1|  PREDICTED: L-ascorbate oxidase homolog             555   0.0      
ref|XP_010534841.1|  PREDICTED: L-ascorbate oxidase homolog             554   0.0      
ref|XP_004149657.1|  PREDICTED: L-ascorbate oxidase homolog             554   0.0      
ref|XP_011077090.1|  PREDICTED: L-ascorbate oxidase homolog             554   0.0      
ref|XP_006306349.1|  hypothetical protein CARUB_v10012235mg             554   0.0      
ref|XP_007157830.1|  hypothetical protein PHAVU_002G101700g             553   0.0      
gb|AGW80453.1|  pollen-specific protein                                 552   0.0      
ref|XP_007014661.1|  SKU5 similar 12                                    552   0.0      
ref|XP_010552291.1|  PREDICTED: L-ascorbate oxidase homolog             552   0.0      
ref|NP_175953.1|  protein SKU5 similar 12                               552   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KHN44494.1|  L-ascorbate oxidase like                                551   0.0      
ref|XP_003538519.1|  PREDICTED: L-ascorbate oxidase homolog             551   0.0      
ref|XP_010500423.1|  PREDICTED: L-ascorbate oxidase homolog             551   0.0      
ref|XP_007163845.1|  hypothetical protein PHAVU_001G269200g             551   0.0      
ref|XP_010501175.1|  PREDICTED: L-ascorbate oxidase homolog             551   0.0      
ref|XP_010462412.1|  PREDICTED: L-ascorbate oxidase homolog             550   0.0      
ref|XP_002891844.1|  hypothetical protein ARALYDRAFT_892557             550   0.0      
ref|XP_006353286.1|  PREDICTED: L-ascorbate oxidase homolog             550   0.0      
ref|XP_010465172.1|  PREDICTED: L-ascorbate oxidase homolog             550   0.0      
emb|CDY23596.1|  BnaC05g39980D                                          549   0.0      
emb|CDX97352.1|  BnaA02g21430D                                          546   0.0      
emb|CAA47177.1|  Bplo                                                   548   0.0      Brassica napus [oilseed rape]
gb|KHN20513.1|  L-ascorbate oxidase like                                547   0.0      
ref|XP_006407228.1|  hypothetical protein EUTSA_v10020433mg             548   0.0      
ref|XP_006299300.1|  hypothetical protein CARUB_v10015454mg             548   0.0      
gb|EYU39761.1|  hypothetical protein MIMGU_mgv1a003754mg                548   0.0      
ref|NP_187947.1|  protein SKU5-like 11                                  548   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AFC88081.1|  skewed-like protein                                     547   0.0      
emb|CDX82541.1|  BnaA03g32800D                                          546   0.0      
ref|XP_010480098.1|  PREDICTED: L-ascorbate oxidase homolog             546   0.0      
sp|Q00624.1|ASOL_BRANA  RecName: Full=L-ascorbate oxidase homolog...    546   0.0      Brassica napus [oilseed rape]
gb|KFK38671.1|  hypothetical protein AALP_AA3G145000                    546   0.0      
ref|XP_009135302.1|  PREDICTED: L-ascorbate oxidase homolog             546   0.0      
ref|XP_009399915.1|  PREDICTED: L-ascorbate oxidase homolog             545   0.0      
emb|CDX75707.1|  BnaC03g37900D                                          545   0.0      
emb|CAA47178.1|  Bplo                                                   545   0.0      Brassica napus [oilseed rape]
ref|XP_006392621.1|  hypothetical protein EUTSA_v10011364mg             545   0.0      
ref|XP_009147500.1|  PREDICTED: L-ascorbate oxidase homolog             545   0.0      
ref|XP_003529456.1|  PREDICTED: L-ascorbate oxidase homolog             544   0.0      
ref|XP_009417950.1|  PREDICTED: L-ascorbate oxidase homolog             543   0.0      
ref|XP_002884964.1|  hypothetical protein ARALYDRAFT_478720             543   0.0      
ref|XP_007208285.1|  hypothetical protein PRUPE_ppa003733mg             543   0.0      
gb|KHG03555.1|  L-ascorbate oxidase                                     542   0.0      
ref|XP_009384956.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    541   0.0      
ref|XP_003601600.1|  L-ascorbate oxidase-like protein                   541   0.0      
ref|XP_003601595.1|  L-ascorbate oxidase-like protein                   541   0.0      
ref|XP_009384957.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    541   0.0      
ref|XP_008219577.1|  PREDICTED: L-ascorbate oxidase homolog             540   0.0      
ref|XP_006345828.1|  PREDICTED: L-ascorbate oxidase homolog             540   0.0      
gb|AES71848.2|  L-ascorbate oxidase-like protein                        538   0.0      
ref|XP_009124743.1|  PREDICTED: L-ascorbate oxidase homolog             540   0.0      
ref|XP_003601597.1|  L-ascorbate oxidase-like protein                   539   0.0      
ref|XP_008219320.1|  PREDICTED: L-ascorbate oxidase homolog             539   0.0      
ref|XP_003601599.1|  L-ascorbate oxidase-like protein                   538   0.0      
ref|XP_008219429.1|  PREDICTED: L-ascorbate oxidase homolog             538   0.0      
ref|XP_003601596.1|  L-ascorbate oxidase-like protein                   538   0.0      
ref|XP_003607814.1|  L-ascorbate oxidase-like protein                   538   0.0      
ref|XP_003601601.1|  L-ascorbate oxidase-like protein                   537   0.0      
gb|KHG05644.1|  L-ascorbate oxidase                                     536   0.0      
ref|XP_004505355.1|  PREDICTED: L-ascorbate oxidase homolog             536   0.0      
ref|XP_010938086.1|  PREDICTED: L-ascorbate oxidase homolog             536   0.0      
emb|CDY43353.1|  BnaA01g29840D                                          536   0.0      
ref|XP_009402422.1|  PREDICTED: L-ascorbate oxidase homolog             536   0.0      
emb|CDY24189.1|  BnaC01g37690D                                          536   0.0      
ref|XP_007163844.1|  hypothetical protein PHAVU_001G269100g             536   0.0      
ref|XP_009411781.1|  PREDICTED: L-ascorbate oxidase homolog             535   0.0      
ref|XP_009383852.1|  PREDICTED: L-ascorbate oxidase homolog             535   0.0      
ref|XP_003607816.1|  L-ascorbate oxidase-like protein                   534   0.0      
emb|CAA47176.1|  Bplo                                                   533   0.0      Brassica napus [oilseed rape]
ref|XP_009387378.1|  PREDICTED: L-ascorbate oxidase homolog             533   0.0      
ref|XP_010673838.1|  PREDICTED: L-ascorbate oxidase homolog             533   0.0      
ref|XP_008793387.1|  PREDICTED: L-ascorbate oxidase homolog             531   0.0      
ref|XP_009600428.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    530   0.0      
ref|XP_009420229.1|  PREDICTED: L-ascorbate oxidase homolog             531   0.0      
ref|XP_009416330.1|  PREDICTED: L-ascorbate oxidase homolog             529   2e-180   
ref|XP_010552290.1|  PREDICTED: L-ascorbate oxidase homolog             527   1e-179   
ref|XP_009392060.1|  PREDICTED: L-ascorbate oxidase homolog             530   2e-179   
ref|XP_009412658.1|  PREDICTED: L-ascorbate oxidase homolog             526   2e-179   
ref|XP_008449954.1|  PREDICTED: L-ascorbate oxidase homolog             522   3e-179   
ref|XP_004961713.1|  PREDICTED: L-ascorbate oxidase homolog             523   8e-178   
ref|XP_008788020.1|  PREDICTED: L-ascorbate oxidase homolog             522   9e-178   
ref|XP_004970369.1|  PREDICTED: L-ascorbate oxidase homolog             521   2e-177   
ref|XP_006445540.1|  hypothetical protein CICLE_v10018007mg             521   3e-177   
ref|XP_010921259.1|  PREDICTED: L-ascorbate oxidase homolog             520   5e-177   
ref|XP_010922850.1|  PREDICTED: L-ascorbate oxidase homolog             519   2e-176   
gb|KFK27206.1|  hypothetical protein AALP_AA8G349600                    518   3e-176   
ref|XP_003529457.1|  PREDICTED: L-ascorbate oxidase homolog             518   3e-176   
gb|AFK44839.1|  unknown                                                 511   3e-176   
ref|XP_006838146.1|  hypothetical protein AMTR_s00106p00093220          518   4e-176   
ref|XP_007157831.1|  hypothetical protein PHAVU_002G101800g             518   7e-176   
gb|EEC79422.1|  hypothetical protein OsI_20394                          514   9e-176   Oryza sativa Indica Group [Indian rice]
ref|XP_008804666.1|  PREDICTED: L-ascorbate oxidase homolog             515   6e-175   
ref|XP_008782736.1|  PREDICTED: L-ascorbate oxidase homolog             514   1e-174   
gb|ADK47981.1|  L-ascorbate oxidase-like protein                        514   2e-174   
ref|NP_001132891.1|  uncharacterized protein LOC100194388               509   2e-174   Zea mays [maize]
gb|EMT12555.1|  L-ascorbate oxidase-like protein                        509   2e-174   
dbj|BAK05994.1|  predicted protein                                      513   3e-174   
ref|XP_003567221.1|  PREDICTED: L-ascorbate oxidase homolog             513   3e-174   
gb|AAT01329.1|  putative L-ascorbate oxidase                            513   3e-174   Oryza sativa Japonica Group [Japonica rice]
emb|CDY50029.1|  BnaA06g00300D                                          512   5e-174   
ref|XP_003566121.2|  PREDICTED: L-ascorbate oxidase homolog             511   1e-173   
ref|NP_001044620.1|  Os01g0816700                                       511   2e-173   Oryza sativa Japonica Group [Japonica rice]
gb|EEE55579.1|  hypothetical protein OsJ_03867                          511   2e-173   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001151662.1|  L-ascorbate oxidase precursor                      511   3e-173   Zea mays [maize]
gb|ACN34077.1|  unknown                                                 511   4e-173   Zea mays [maize]
gb|ACF86554.2|  unknown                                                 509   9e-173   Zea mays [maize]
ref|NP_001151772.1|  pollen-specific protein NTP303 precursor           509   9e-173   Zea mays [maize]
ref|XP_010931432.1|  PREDICTED: L-ascorbate oxidase homolog             509   1e-172   
emb|CDY43352.1|  BnaA01g29830D                                          507   3e-172   
ref|XP_009120150.1|  PREDICTED: L-ascorbate oxidase homolog             508   3e-172   
ref|XP_008672229.1|  PREDICTED: uncharacterized protein LOC100194...    507   1e-171   
ref|XP_006644902.1|  PREDICTED: L-ascorbate oxidase homolog             506   2e-171   
emb|CDM84722.1|  unnamed protein product                                504   7e-171   
dbj|BAK07214.1|  predicted protein                                      504   1e-170   
ref|XP_002456532.1|  hypothetical protein SORBIDRAFT_03g037970          504   2e-170   Sorghum bicolor [broomcorn]
gb|EMT02825.1|  L-ascorbate oxidase-like protein                        504   2e-170   
ref|XP_002441281.1|  hypothetical protein SORBIDRAFT_09g023770          502   8e-170   Sorghum bicolor [broomcorn]
ref|NP_001151961.1|  pollen-specific protein NTP303 precursor           498   2e-168   Zea mays [maize]
gb|ACN26659.1|  unknown                                                 497   6e-168   Zea mays [maize]
ref|XP_006386039.1|  multi-copper oxidase type 1 family protein         491   6e-166   
gb|EMS66047.1|  L-ascorbate oxidase-like protein                        486   3e-163   
emb|CDY54363.1|  BnaC06g07290D                                          477   3e-160   
gb|ABV89619.1|  Sku5-like 11                                            459   5e-153   Brassica rapa
gb|AFK33666.1|  unknown                                                 435   7e-145   
ref|XP_006850531.1|  hypothetical protein AMTR_s00159p00040990          437   1e-144   
ref|XP_008466955.1|  PREDICTED: L-ascorbate oxidase homolog             423   7e-143   
ref|XP_007047154.1|  SKU5 similar 17 isoform 3                          419   1e-139   
gb|KGN54012.1|  hypothetical protein Csa_4G267470                       420   6e-139   
gb|KHG25743.1|  L-ascorbate oxidase                                     421   3e-138   
ref|XP_007047152.1|  SKU5 similar 17 isoform 1                          419   1e-137   
ref|XP_011088669.1|  PREDICTED: L-ascorbate oxidase homolog             419   2e-137   
ref|XP_007155969.1|  hypothetical protein PHAVU_003G247700g             417   6e-137   
ref|XP_009397777.1|  PREDICTED: L-ascorbate oxidase homolog             416   2e-136   
ref|XP_006364519.1|  PREDICTED: L-ascorbate oxidase homolog             416   2e-136   
gb|ABR18324.1|  unknown                                                 415   6e-136   Picea sitchensis
ref|XP_007047153.1|  SKU5 similar 17 isoform 2                          414   8e-136   
gb|KGN63948.1|  hypothetical protein Csa_1G031720                       412   1e-135   
ref|XP_011085509.1|  PREDICTED: L-ascorbate oxidase homolog             413   2e-135   
gb|KHG07318.1|  L-ascorbate oxidase                                     413   2e-135   
ref|XP_006449754.1|  hypothetical protein CICLE_v10014825mg             414   2e-135   
ref|XP_007041705.1|  SKU5 similar 5                                     413   3e-135   
gb|EPS74059.1|  hypothetical protein M569_00695                         413   4e-135   
gb|KGN54013.1|  hypothetical protein Csa_4G267480                       410   5e-135   
ref|XP_006467415.1|  PREDICTED: L-ascorbate oxidase homolog             412   6e-135   
gb|AGE09595.1|  SKU5-like protein                                       411   6e-135   
ref|XP_009758923.1|  PREDICTED: L-ascorbate oxidase homolog             412   6e-135   
ref|XP_002270831.1|  PREDICTED: L-ascorbate oxidase homolog             412   6e-135   Vitis vinifera
emb|CBI18560.3|  unnamed protein product                                412   6e-135   
ref|XP_007156841.1|  hypothetical protein PHAVU_002G021900g             411   1e-134   
ref|XP_008440238.1|  PREDICTED: L-ascorbate oxidase homolog             411   1e-134   
ref|XP_009408654.1|  PREDICTED: L-ascorbate oxidase homolog             411   2e-134   
gb|EYU38005.1|  hypothetical protein MIMGU_mgv1a004001mg                411   2e-134   
ref|XP_009630901.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    410   4e-134   
ref|XP_002282214.1|  PREDICTED: L-ascorbate oxidase homolog             410   6e-134   Vitis vinifera
gb|KHG21949.1|  L-ascorbate oxidase                                     410   6e-134   
ref|XP_004287955.1|  PREDICTED: L-ascorbate oxidase homolog             409   8e-134   
ref|XP_003550083.1|  PREDICTED: L-ascorbate oxidase homolog             409   8e-134   
ref|XP_008236098.1|  PREDICTED: L-ascorbate oxidase homolog             409   9e-134   
ref|XP_010266098.1|  PREDICTED: L-ascorbate oxidase homolog             409   1e-133   
ref|XP_004509176.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    409   1e-133   
gb|KCW68031.1|  hypothetical protein EUGRSUZ_F01712                     407   1e-133   
ref|XP_010028301.1|  PREDICTED: L-ascorbate oxidase homolog             409   1e-133   
emb|CDX81353.1|  BnaC09g07640D                                          409   2e-133   
ref|XP_004290036.1|  PREDICTED: L-ascorbate oxidase homolog             409   2e-133   
ref|XP_007215641.1|  hypothetical protein PRUPE_ppa003877mg             409   2e-133   
ref|XP_006425823.1|  hypothetical protein CICLE_v10025326mg             408   2e-133   
gb|ACF85744.1|  unknown                                                 404   2e-133   
ref|XP_004231076.1|  PREDICTED: L-ascorbate oxidase homolog             408   2e-133   
gb|KHG11003.1|  L-ascorbate oxidase                                     408   2e-133   
ref|XP_004141928.1|  PREDICTED: L-ascorbate oxidase homolog             408   3e-133   
ref|XP_010028797.1|  PREDICTED: L-ascorbate oxidase homolog             408   4e-133   
ref|XP_010923873.1|  PREDICTED: L-ascorbate oxidase homolog             407   4e-133   
emb|CAN72538.1|  hypothetical protein VITISV_028749                     409   4e-133   
ref|XP_010061137.1|  PREDICTED: L-ascorbate oxidase homolog             407   4e-133   
gb|KHG04142.1|  L-ascorbate oxidase                                     407   5e-133   
ref|XP_010547509.1|  PREDICTED: L-ascorbate oxidase homolog             407   5e-133   
ref|XP_009413373.1|  PREDICTED: L-ascorbate oxidase homolog             407   5e-133   
ref|XP_004509174.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    407   5e-133   
ref|XP_010070498.1|  PREDICTED: L-ascorbate oxidase homolog             407   5e-133   
ref|XP_002528421.1|  multicopper oxidase, putative                      407   6e-133   
ref|XP_011008684.1|  PREDICTED: L-ascorbate oxidase homolog             404   7e-133   
ref|XP_008362259.1|  PREDICTED: L-ascorbate oxidase homolog             407   7e-133   
emb|CDY18626.1|  BnaA09g07690D                                          407   9e-133   
ref|XP_007200295.1|  hypothetical protein PRUPE_ppa004000mg             406   1e-132   
gb|KEH20500.1|  multi-copper oxidase-like protein                       407   1e-132   
ref|XP_009112343.1|  PREDICTED: L-ascorbate oxidase homolog             407   1e-132   
gb|KCW55012.1|  hypothetical protein EUGRSUZ_I00988                     408   1e-132   
ref|XP_009347125.1|  PREDICTED: L-ascorbate oxidase homolog             406   1e-132   
gb|EYU36818.1|  hypothetical protein MIMGU_mgv1a004264mg                406   1e-132   
gb|AGT57427.1|  ascorbate oxidase                                       406   1e-132   
ref|XP_004487420.1|  PREDICTED: L-ascorbate oxidase homolog             406   1e-132   
ref|XP_010103300.1|  L-ascorbate oxidase-like protein                   406   2e-132   
ref|XP_003517277.1|  PREDICTED: L-ascorbate oxidase homolog             406   2e-132   
ref|XP_008789823.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    406   2e-132   
ref|XP_010244491.1|  PREDICTED: L-ascorbate oxidase homolog             406   2e-132   
ref|XP_009353293.1|  PREDICTED: L-ascorbate oxidase homolog             405   2e-132   
ref|XP_004300548.1|  PREDICTED: L-ascorbate oxidase homolog             405   3e-132   
ref|XP_008229964.1|  PREDICTED: L-ascorbate oxidase homolog             405   3e-132   
ref|XP_010676489.1|  PREDICTED: L-ascorbate oxidase homolog             405   4e-132   
ref|XP_009758924.1|  PREDICTED: L-ascorbate oxidase homolog             405   4e-132   
gb|KDP47151.1|  hypothetical protein JCGZ_00042                         405   5e-132   
ref|XP_004296148.1|  PREDICTED: L-ascorbate oxidase homolog             404   6e-132   
ref|XP_004987010.1|  PREDICTED: L-ascorbate oxidase homolog             405   7e-132   
ref|XP_004170388.1|  PREDICTED: L-ascorbate oxidase homolog             401   7e-132   
ref|XP_003596959.1|  L-ascorbate oxidase-like protein                   401   9e-132   
ref|XP_010266952.1|  PREDICTED: L-ascorbate oxidase homolog             404   1e-131   
ref|XP_011099220.1|  PREDICTED: L-ascorbate oxidase homolog             404   1e-131   
ref|XP_010263761.1|  PREDICTED: L-ascorbate oxidase homolog             404   1e-131   
gb|ABK95805.1|  unknown                                                 404   1e-131   
ref|XP_006383902.1|  multi-copper oxidase type 1 family protein         404   2e-131   
ref|XP_004166771.1|  PREDICTED: L-ascorbate oxidase homolog             403   2e-131   
ref|XP_011046956.1|  PREDICTED: L-ascorbate oxidase homolog             403   2e-131   
gb|EMT15848.1|  L-ascorbate oxidase-like protein                        403   2e-131   
ref|XP_009402576.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    399   2e-131   
dbj|BAK04971.1|  predicted protein                                      404   2e-131   
emb|CDY01453.1|  BnaA07g12260D                                          403   2e-131   
gb|ACL53812.1|  unknown                                                 403   3e-131   
gb|KHN36198.1|  L-ascorbate oxidase like                                403   3e-131   
ref|XP_006486657.1|  PREDICTED: L-ascorbate oxidase homolog             402   4e-131   
emb|CDP10787.1|  unnamed protein product                                402   5e-131   
ref|XP_009407426.1|  PREDICTED: L-ascorbate oxidase homolog             402   5e-131   
ref|XP_003563038.1|  PREDICTED: L-ascorbate oxidase homolog             402   5e-131   
ref|XP_008241557.1|  PREDICTED: L-ascorbate oxidase homolog             402   5e-131   
ref|XP_010444713.1|  PREDICTED: L-ascorbate oxidase homolog             402   6e-131   
gb|KEH29685.1|  multi-copper oxidase-like protein                       402   6e-131   
gb|KHN42054.1|  L-ascorbate oxidase like                                402   7e-131   
ref|XP_003537368.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    402   8e-131   
ref|XP_007204826.1|  hypothetical protein PRUPE_ppa003926mg             402   8e-131   
ref|XP_010099197.1|  L-ascorbate oxidase-like protein                   399   9e-131   
ref|XP_006469674.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    399   1e-130   
ref|XP_009402575.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    399   1e-130   
ref|XP_006657750.1|  PREDICTED: L-ascorbate oxidase homolog             402   1e-130   
ref|XP_011099705.1|  PREDICTED: L-ascorbate oxidase homolog             401   1e-130   
ref|XP_008806482.1|  PREDICTED: L-ascorbate oxidase homolog             401   1e-130   
gb|EAZ02087.1|  hypothetical protein OsI_24168                          401   1e-130   
gb|KDP31876.1|  hypothetical protein JCGZ_12337                         401   1e-130   
ref|XP_006422489.1|  hypothetical protein CICLE_v10028140mg             401   1e-130   
gb|ABK25092.1|  unknown                                                 401   1e-130   
ref|XP_007046383.1|  SKU5 similar 5 isoform 1                           401   1e-130   
gb|EYU44359.1|  hypothetical protein MIMGU_mgv1a004187mg                401   1e-130   
gb|EMT20871.1|  L-ascorbate oxidase-like protein                        399   2e-130   
ref|XP_006656379.1|  PREDICTED: L-ascorbate oxidase homolog             401   2e-130   
ref|XP_010929557.1|  PREDICTED: L-ascorbate oxidase homolog             401   2e-130   
ref|XP_003596958.1|  L-ascorbate oxidase-like protein                   400   2e-130   
ref|XP_009418785.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    400   2e-130   
gb|EAZ38022.1|  hypothetical protein OsJ_22366                          400   2e-130   
gb|KHG03845.1|  L-ascorbate oxidase                                     400   2e-130   
ref|XP_003611825.1|  L-ascorbate oxidase-like protein                   400   3e-130   
ref|XP_004144874.1|  PREDICTED: L-ascorbate oxidase homolog             400   3e-130   
gb|KDO54690.1|  hypothetical protein CISIN_1g009283mg                   398   3e-130   
ref|XP_010918208.1|  PREDICTED: L-ascorbate oxidase homolog             400   3e-130   
ref|XP_004144498.1|  PREDICTED: L-ascorbate oxidase homolog             400   4e-130   
ref|NP_001058365.1|  Os06g0678800                                       400   4e-130   
ref|XP_009381277.1|  PREDICTED: L-ascorbate oxidase homolog             400   4e-130   
ref|XP_010923874.1|  PREDICTED: L-ascorbate oxidase homolog             400   4e-130   
ref|XP_010464737.1|  PREDICTED: L-ascorbate oxidase homolog             400   4e-130   
ref|XP_006280268.1|  hypothetical protein CARUB_v10026189mg             400   5e-130   
dbj|BAC83966.1|  putative PS60                                          400   5e-130   
ref|XP_010046372.1|  PREDICTED: L-ascorbate oxidase homolog             399   6e-130   
ref|XP_002522337.1|  multicopper oxidase, putative                      399   7e-130   
ref|XP_011046313.1|  PREDICTED: L-ascorbate oxidase homolog             399   7e-130   
ref|XP_008447902.1|  PREDICTED: L-ascorbate oxidase homolog             399   7e-130   
ref|XP_010255119.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    399   8e-130   
gb|EEC82126.1|  hypothetical protein OsI_26158                          399   8e-130   
ref|XP_011039228.1|  PREDICTED: L-ascorbate oxidase homolog             399   8e-130   
gb|ACN28536.1|  unknown                                                 395   9e-130   
ref|XP_008455444.1|  PREDICTED: L-ascorbate oxidase homolog             399   9e-130   
emb|CDP04415.1|  unnamed protein product                                399   9e-130   
ref|XP_006393891.1|  hypothetical protein EUTSA_v10003952mg             399   1e-129   
ref|XP_009103469.1|  PREDICTED: L-ascorbate oxidase homolog             399   1e-129   
gb|ABK25324.1|  unknown                                                 398   1e-129   
ref|XP_006447580.1|  hypothetical protein CICLE_v10014842mg             398   1e-129   
ref|XP_002460757.1|  hypothetical protein SORBIDRAFT_02g034420          399   2e-129   
ref|XP_011013814.1|  PREDICTED: L-ascorbate oxidase homolog             398   2e-129   
ref|XP_010690287.1|  PREDICTED: L-ascorbate oxidase homolog             398   2e-129   
dbj|BAJ91397.1|  predicted protein                                      398   2e-129   
ref|XP_010558427.1|  PREDICTED: L-ascorbate oxidase homolog             398   2e-129   
gb|EEE67250.1|  hypothetical protein OsJ_24405                          398   2e-129   
ref|XP_009402574.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    398   3e-129   
ref|XP_008382461.1|  PREDICTED: L-ascorbate oxidase homolog             397   3e-129   
ref|XP_004957823.1|  PREDICTED: L-ascorbate oxidase homolog             398   3e-129   
ref|XP_006348131.1|  PREDICTED: L-ascorbate oxidase homolog             398   3e-129   
ref|XP_002310162.1|  multi-copper oxidase type 1 family protein         397   3e-129   
ref|XP_008798222.1|  PREDICTED: L-ascorbate oxidase homolog             397   3e-129   
ref|XP_010109886.1|  L-ascorbate oxidase-like protein                   397   3e-129   
ref|NP_001152000.1|  L-ascorbate oxidase precursor                      398   3e-129   
ref|XP_002866726.1|  predicted protein                                  397   4e-129   
gb|AGJ03718.1|  multicopper oxidase                                     397   4e-129   
ref|XP_009630902.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    397   6e-129   
gb|KDP20733.1|  hypothetical protein JCGZ_21204                         397   6e-129   
gb|KHN05478.1|  L-ascorbate oxidase like                                397   6e-129   
ref|XP_002320467.1|  hypothetical protein POPTR_0014s15260g             396   7e-129   
ref|XP_004506275.1|  PREDICTED: L-ascorbate oxidase homolog             396   8e-129   
ref|XP_004232701.1|  PREDICTED: L-ascorbate oxidase homolog             397   8e-129   
ref|XP_010263764.1|  PREDICTED: L-ascorbate oxidase homolog             396   1e-128   
ref|XP_009619786.1|  PREDICTED: L-ascorbate oxidase homolog             396   1e-128   
ref|XP_010484570.1|  PREDICTED: L-ascorbate oxidase homolog             396   1e-128   
ref|XP_003605947.1|  L-ascorbate oxidase-like protein                   396   1e-128   
ref|XP_006592035.1|  PREDICTED: L-ascorbate oxidase homolog             396   1e-128   
ref|XP_009794441.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    394   1e-128   
ref|XP_004509178.1|  PREDICTED: L-ascorbate oxidase homolog             396   1e-128   
ref|XP_009630899.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    396   1e-128   
ref|XP_006416260.1|  hypothetical protein EUTSA_v10007292mg             396   2e-128   
ref|XP_003527501.1|  PREDICTED: L-ascorbate oxidase homolog             395   2e-128   
ref|XP_008806480.1|  PREDICTED: L-ascorbate oxidase homolog             395   2e-128   
ref|XP_007026108.1|  SKU5 similar 4 isoform 1                           395   2e-128   
gb|EYU39394.1|  hypothetical protein MIMGU_mgv11b015886mg               395   2e-128   
ref|XP_003563398.1|  PREDICTED: L-ascorbate oxidase homolog             395   2e-128   
dbj|BAK00459.1|  predicted protein                                      395   3e-128   
ref|XP_009794442.1|  PREDICTED: L-ascorbate oxidase homolog             395   4e-128   
ref|XP_004233429.1|  PREDICTED: L-ascorbate oxidase homolog             395   4e-128   
ref|XP_008384084.1|  PREDICTED: L-ascorbate oxidase homolog             395   4e-128   
ref|XP_009623446.1|  PREDICTED: L-ascorbate oxidase homolog             394   5e-128   
ref|XP_002285913.1|  PREDICTED: L-ascorbate oxidase homolog             394   5e-128   
ref|XP_004232058.1|  PREDICTED: L-ascorbate oxidase homolog             394   5e-128   
ref|NP_001147597.1|  LOC100281206 precursor                             395   5e-128   
ref|XP_009782819.1|  PREDICTED: L-ascorbate oxidase homolog             394   6e-128   
emb|CDP07321.1|  unnamed protein product                                394   6e-128   
gb|AAL09733.1|  At1g76160/T23E18_10                                     394   7e-128   
ref|XP_003540295.1|  PREDICTED: L-ascorbate oxidase homolog             394   8e-128   
ref|XP_010905243.1|  PREDICTED: L-ascorbate oxidase homolog             393   8e-128   
ref|XP_006855939.1|  hypothetical protein AMTR_s00037p00216460          394   1e-127   
ref|XP_002524823.1|  multicopper oxidase, putative                      394   1e-127   
ref|XP_009400332.1|  PREDICTED: L-ascorbate oxidase homolog             394   1e-127   
ref|XP_007131584.1|  hypothetical protein PHAVU_011G025400g             394   1e-127   
ref|XP_009794440.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    394   1e-127   
emb|CAA65634.1|  PS60                                                   394   1e-127   
ref|XP_009348086.1|  PREDICTED: L-ascorbate oxidase homolog             394   1e-127   
ref|XP_008371076.1|  PREDICTED: L-ascorbate oxidase homolog             394   1e-127   
ref|XP_002269614.1|  PREDICTED: L-ascorbate oxidase homolog             393   1e-127   
gb|KHN21220.1|  L-ascorbate oxidase like                                393   1e-127   
ref|XP_003537754.1|  PREDICTED: L-ascorbate oxidase homolog             394   1e-127   
ref|XP_004171059.1|  PREDICTED: L-ascorbate oxidase homolog             390   1e-127   
ref|XP_003539859.1|  PREDICTED: L-ascorbate oxidase homolog             393   2e-127   
ref|XP_004506310.1|  PREDICTED: L-ascorbate oxidase homolog             393   2e-127   
ref|XP_009612547.1|  PREDICTED: L-ascorbate oxidase homolog             393   2e-127   
ref|XP_002889063.1|  hypothetical protein ARALYDRAFT_895494             393   2e-127   
ref|XP_010255117.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    393   2e-127   
ref|XP_002268020.2|  PREDICTED: L-ascorbate oxidase homolog             392   2e-127   
gb|KEH20499.1|  multi-copper oxidase-like protein                       392   3e-127   
ref|XP_011096053.1|  PREDICTED: L-ascorbate oxidase homolog             392   3e-127   
gb|EYU27771.1|  hypothetical protein MIMGU_mgv1a003982mg                393   3e-127   
ref|XP_006848556.1|  hypothetical protein AMTR_s00169p00049950          392   3e-127   
ref|XP_009629876.1|  PREDICTED: L-ascorbate oxidase homolog             392   3e-127   
emb|CDY68812.1|  BnaAnng28440D                                          389   3e-127   
gb|KFK28370.1|  hypothetical protein AALP_AA8G506600                    392   4e-127   
ref|XP_009777142.1|  PREDICTED: L-ascorbate oxidase homolog             392   4e-127   
ref|XP_006360232.1|  PREDICTED: L-ascorbate oxidase homolog             392   4e-127   
ref|XP_008241558.1|  PREDICTED: L-ascorbate oxidase homolog             392   4e-127   
ref|XP_009785141.1|  PREDICTED: L-ascorbate oxidase homolog             392   4e-127   
ref|NP_177743.1|  SKU5-like 5 protein                                   392   5e-127   
ref|XP_004243477.1|  PREDICTED: L-ascorbate oxidase homolog             392   5e-127   
gb|KHN44868.1|  L-ascorbate oxidase like                                390   5e-127   
gb|KHN33820.1|  L-ascorbate oxidase like                                392   5e-127   
ref|XP_003523207.1|  PREDICTED: L-ascorbate oxidase homolog             392   5e-127   
ref|XP_009597920.1|  PREDICTED: L-ascorbate oxidase homolog             392   6e-127   
ref|XP_006338228.1|  PREDICTED: L-ascorbate oxidase homolog             391   7e-127   
ref|NP_569041.1|  protein SKU5 similar 17                               392   7e-127   
ref|XP_006302110.1|  hypothetical protein CARUB_v10020107mg             391   8e-127   
dbj|BAB08634.1|  pectinesterase like protein                            391   8e-127   
ref|XP_011047251.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    391   8e-127   
ref|XP_004511977.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    391   9e-127   
ref|XP_010529443.1|  PREDICTED: L-ascorbate oxidase homolog             391   9e-127   
ref|XP_010088984.1|  L-ascorbate oxidase-like protein                   391   1e-126   
ref|XP_008791980.1|  PREDICTED: L-ascorbate oxidase homolog             391   1e-126   
ref|XP_009347241.1|  PREDICTED: L-ascorbate oxidase homolog             391   1e-126   
ref|XP_009366415.1|  PREDICTED: L-ascorbate oxidase homolog             391   1e-126   
ref|XP_010471765.1|  PREDICTED: L-ascorbate oxidase homolog             391   1e-126   
ref|XP_010416527.1|  PREDICTED: L-ascorbate oxidase homolog             391   1e-126   
gb|AAM61328.1|  pectinesterase-like protein                             391   1e-126   
gb|KDP22727.1|  hypothetical protein JCGZ_01829                         391   1e-126   
ref|XP_010686816.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    391   1e-126   
ref|XP_010428667.1|  PREDICTED: L-ascorbate oxidase homolog             390   2e-126   
ref|XP_006393890.1|  hypothetical protein EUTSA_v10003952mg             390   2e-126   
ref|XP_007026110.1|  SKU5 similar 4 isoform 3                           390   2e-126   
ref|XP_010686815.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    390   2e-126   
ref|XP_002518462.1|  multicopper oxidase, putative                      390   2e-126   
gb|EPS57861.1|  hypothetical protein M569_16956                         387   2e-126   
ref|XP_007203632.1|  hypothetical protein PRUPE_ppa003976mg             390   2e-126   
ref|XP_009803721.1|  PREDICTED: L-ascorbate oxidase homolog             390   3e-126   
gb|KHN12597.1|  L-ascorbate oxidase like                                387   3e-126   
emb|CAN83942.1|  hypothetical protein VITISV_013559                     390   3e-126   
ref|XP_007132533.1|  hypothetical protein PHAVU_011G102500g             390   3e-126   
emb|CBI18561.3|  unnamed protein product                                392   3e-126   
gb|KHF99506.1|  L-ascorbate oxidase                                     390   3e-126   
ref|XP_004142986.1|  PREDICTED: L-ascorbate oxidase homolog             390   3e-126   



>ref|XP_009766183.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=558

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/398 (80%), Positives = 354/398 (89%), Gaps = 2/398 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGK-IDPLFTMEAGKTYRY  177
             +NVF+ DWYNKGH+TLKKILD GRTI RPDG+ INGK  KVG K  + LFTMEAGKTYRY
Sbjct  162   YNVFLGDWYNKGHRTLKKILDGGRTIGRPDGIHINGKSSKVGDKATEALFTMEAGKTYRY  221

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             R+CNVGMRTSVN R QGHTM LVEMEGSHT+QN YDSLD+HVGQCLSVLVTAD+EPKDYY
Sbjct  222   RMCNVGMRTSVNVRIQGHTMKLVEMEGSHTVQNVYDSLDIHVGQCLSVLVTADQEPKDYY  281

Query  358   LVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTAS  537
             +VVSSRF KQE S+VAI+ YANG G  AS ELP PPP+NTEGIAWS+NQFRSFRWNLTAS
Sbjct  282   MVVSSRFLKQELSSVAILRYANGKG-PASSELPAPPPDNTEGIAWSMNQFRSFRWNLTAS  340

Query  538   AARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISE  717
             AARPNPQGSYHYG+INITRT+K+VNS+S V GKLR+ALNG+SH++TDTPLKL E+FG+ E
Sbjct  341   AARPNPQGSYHYGKINITRTMKIVNSRSQVAGKLRFALNGISHMDTDTPLKLVEFFGVPE  400

Query  718   KVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             K FKY++M D PP +  KVT++PNV NATFRNFVEI+FEN EKTIQTYHLDG+SFFAV I
Sbjct  401   KTFKYDLMADEPPSDLSKVTISPNVKNATFRNFVEIIFENEEKTIQTYHLDGYSFFAVGI  460

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G+WSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTT+DNAGMWNLRS+MWER YLGQQL
Sbjct  461   EPGKWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSEMWERFYLGQQL  520

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1191
             YFSVLSP RSLRDE+NLPD   LCG+VKGM MP PY+ 
Sbjct  521   YFSVLSPSRSLRDEYNLPDNHPLCGIVKGMPMPAPYTA  558



>ref|XP_009591795.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=558

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/398 (80%), Positives = 355/398 (89%), Gaps = 2/398 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKI-DPLFTMEAGKTYRY  177
             +NVF+ DWYNKGHKTLKKILD GRTI RPDG+ INGK  KVG K+ + LFTMEAGKTYRY
Sbjct  162   YNVFLGDWYNKGHKTLKKILDGGRTIGRPDGIHINGKSSKVGDKVAEALFTMEAGKTYRY  221

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             R+CNVGMRTSVN R QGHTM LVEMEGSHT+QN YDSLDLHVGQCLSVLVTAD+EPKDYY
Sbjct  222   RMCNVGMRTSVNVRIQGHTMKLVEMEGSHTVQNVYDSLDLHVGQCLSVLVTADQEPKDYY  281

Query  358   LVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTAS  537
             +VVSSRF KQ  S+VAI+ YANG G  AS ELP PPP+NTEGIAWS+NQFRSFRWNLTAS
Sbjct  282   MVVSSRFLKQALSSVAILRYANGKG-PASSELPTPPPDNTEGIAWSMNQFRSFRWNLTAS  340

Query  538   AARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISE  717
             AARPNPQGSYHYG+INITRT+K+VNS+S V GKLR+ALNG+SH++TDTPLKL E+FG+ E
Sbjct  341   AARPNPQGSYHYGKINITRTMKIVNSRSQVAGKLRFALNGISHMDTDTPLKLVEFFGVPE  400

Query  718   KVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             K FKY+++ D PP +  KVT++PNV NATFRNFVEI+FEN EKTIQTYHLDG+SFFAV+I
Sbjct  401   KTFKYDLIADEPPSDLSKVTISPNVKNATFRNFVEIIFENQEKTIQTYHLDGYSFFAVSI  460

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G+WSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTT+DNAGMWNLRS+MWER YLGQQL
Sbjct  461   EPGKWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSEMWERFYLGQQL  520

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1191
             YFSVLSP RSLRDE+NLPD   LCG+VKGM MP PY+ 
Sbjct  521   YFSVLSPSRSLRDEYNLPDNHPLCGIVKGMPMPAPYTA  558



>gb|AAQ90182.1| ntp101 [Nicotiana tabacum]
 gb|AAQ90184.1| ntp302 [Nicotiana tabacum]
Length=558

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/398 (79%), Positives = 354/398 (89%), Gaps = 2/398 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKI-DPLFTMEAGKTYRY  177
             +NVF+ DWYNKGHKTLKKILD GRTI RPDG+ INGK  KVG K+ + LFTMEAGKTYRY
Sbjct  162   YNVFLGDWYNKGHKTLKKILDGGRTIGRPDGIHINGKSSKVGDKVAEALFTMEAGKTYRY  221

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             R+CNVGMRTSVN R QGHTM LVEMEGSHT+QN YDSLDLHVGQCLSVLVTAD+EPKDYY
Sbjct  222   RMCNVGMRTSVNVRIQGHTMKLVEMEGSHTVQNVYDSLDLHVGQCLSVLVTADQEPKDYY  281

Query  358   LVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTAS  537
             +VVSSRF KQ  S+VAI+ YANG G  AS ELP PPP+NTEGIAWS+NQFRSFRWNLTAS
Sbjct  282   MVVSSRFLKQALSSVAILRYANGKG-PASSELPTPPPDNTEGIAWSMNQFRSFRWNLTAS  340

Query  538   AARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISE  717
             AARPNPQGSYHYG+INITRT+K+VNS+S V GKLR+ALNG+SH++TDTPLKL E+FG+ E
Sbjct  341   AARPNPQGSYHYGKINITRTMKIVNSRSQVAGKLRFALNGISHMDTDTPLKLVEFFGVPE  400

Query  718   KVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             K FKY+++ D PP +  KVT++ NV NATFRNFVEI+FEN EKTIQTYHLDG+SFFAV+I
Sbjct  401   KTFKYDLIADEPPSDLSKVTISSNVKNATFRNFVEIIFENQEKTIQTYHLDGYSFFAVSI  460

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G+WSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTT+DNAGMWNLRS+MWER YLGQQL
Sbjct  461   EPGKWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGMWNLRSEMWERFYLGQQL  520

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1191
             YFSVLSP RSLRDE+NLPD   LCG+VKGM MP PY+ 
Sbjct  521   YFSVLSPSRSLRDEYNLPDNHPLCGIVKGMPMPAPYTA  558



>ref|XP_006367595.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=567

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/402 (77%), Positives = 350/402 (87%), Gaps = 7/402 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             +NVF+ DWYNKGHK LKK LD GRTI RPDG+ INGK  K+G K +PLF+MEAGK YRYR
Sbjct  164   YNVFLGDWYNKGHKALKKTLDGGRTIGRPDGIHINGKSNKLGDKAEPLFSMEAGKIYRYR  223

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVGMRTSVN R QGH M LVEMEGSHT+QN YDSLD+HVGQCLSVLVTAD+EPKDYY+
Sbjct  224   MCNVGMRTSVNVRIQGHAMKLVEMEGSHTVQNMYDSLDIHVGQCLSVLVTADQEPKDYYM  283

Query  361   VVSSRFFKQEFSTVAIISYANGNGI---TASpelplpppeNTEGIAWSINQFRSFRWNLT  531
             VVSSRF KQ  S+VAI+ YANG G+   + S  LP PPP NT+GIAWS+NQFRSFRWNLT
Sbjct  284   VVSSRFLKQAISSVAILRYANGKGVGSTSISDHLPTPPPNNTQGIAWSMNQFRSFRWNLT  343

Query  532   ASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGI  711
             ASAARPNPQGSYHYGQINITRTIK+VNS+S V+GKLR+ALNG+SH+++DTPLKL EYFG+
Sbjct  344   ASAARPNPQGSYHYGQINITRTIKIVNSRSQVNGKLRFALNGISHMDSDTPLKLVEYFGV  403

Query  712   SEKVFKYNIMGDTPP----ENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHS  879
             +EK FKY++MGD PP     N + VT+APNV NATFRNFVEI+FEN EKTIQTYHLDG+S
Sbjct  404   AEKTFKYDVMGDEPPTPSSNNNKVVTIAPNVKNATFRNFVEIIFENEEKTIQTYHLDGYS  463

Query  880   FFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERA  1059
             FFAV IE G+W PEKRKNYNLVDAVSRHSIQVYPNSWAA+MTT+DNAG+WNLRSDMWER 
Sbjct  464   FFAVGIEPGKWKPEKRKNYNLVDAVSRHSIQVYPNSWAAIMTTLDNAGIWNLRSDMWERN  523

Query  1060  YLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             YLGQQLYFSVLSP RSLRDE+NLPD   LCG+VK M MPPPY
Sbjct  524   YLGQQLYFSVLSPSRSLRDEYNLPDNHPLCGIVKSMPMPPPY  565



>dbj|BAO02510.1| predicted pollen-specific protein ortholog [Nicotiana alata]
Length=555

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/395 (78%), Positives = 346/395 (88%), Gaps = 1/395 (0%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             +NVF+ DWYNKGHKTLKKILD GRTI RPDG++INGK  KVG   +PLFTMEAGKTYRYR
Sbjct  160   YNVFVGDWYNKGHKTLKKILDGGRTIGRPDGIIINGKSAKVGEAKEPLFTMEAGKTYRYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
              CN+GMR+SVN RFQGH M LVE+EGSHT+QN YDSLDLHVGQC SVLVTAD+EPKDYYL
Sbjct  220   FCNLGMRSSVNIRFQGHPMKLVELEGSHTVQNIYDSLDLHVGQCFSVLVTADQEPKDYYL  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             VVSSRF KQ  S+VAII YANG G  ASPELP PPPENTEGIAWS+NQFRSFRWNLTASA
Sbjct  280   VVSSRFLKQALSSVAIIRYANGKG-PASPELPTPPPENTEGIAWSMNQFRSFRWNLTASA  338

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTIK+ NSKS VDGKLRY LNG+SH + +TPLKL EYFG ++K
Sbjct  339   ARPNPQGSYHYGQINITRTIKIFNSKSQVDGKLRYGLNGISHTDGETPLKLVEYFGATDK  398

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
              FKY++M D  P +A K+T+  NV NAT+RNFVEI+FENHEKTI+TYHLDG+SFFAVA+E
Sbjct  399   AFKYDLMADEAPADATKLTITANVKNATYRNFVEIIFENHEKTIRTYHLDGYSFFAVAVE  458

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              GRWSPEKRKNYNLVD +SR++IQVYPNSWAA+M T DNAGMWNLRS+MWE+ YLG+QLY
Sbjct  459   PGRWSPEKRKNYNLVDGLSRNNIQVYPNSWAAIMLTFDNAGMWNLRSEMWEKTYLGEQLY  518

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             FSVLSP RSLRDE+N+PD   LCG+VKGM MP PY
Sbjct  519   FSVLSPSRSLRDEYNIPDNHPLCGIVKGMPMPAPY  553



>ref|XP_009624631.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=559

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/399 (79%), Positives = 353/399 (88%), Gaps = 5/399 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKI-DPLFTMEAGKTYRY  177
             +NVF+ DWYNKG+K+LKKILD GRTI RPDG+ INGK  KVG K+ +PLFTMEAGKTYRY
Sbjct  160   YNVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHINGKSVKVGDKVAEPLFTMEAGKTYRY  219

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             RVCN GMRTSVNFR QGH M LVEMEGSHT+QN Y+SLDLHVGQCLSVLVTAD+EPKDYY
Sbjct  220   RVCNAGMRTSVNFRIQGHPMKLVEMEGSHTVQNVYESLDLHVGQCLSVLVTADQEPKDYY  279

Query  358   LVVSSRFFKQ-EFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTA  534
             ++VSSRF KQ + S+VAII YANG G  AS +LP PPPENT+GIAWSINQFRSFRWNLTA
Sbjct  280   MIVSSRFLKQAQLSSVAIIRYANGKG-PASSDLPAPPPENTQGIAWSINQFRSFRWNLTA  338

Query  535   SAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINT-DTPLKLAEYFGI  711
             SAARPNPQGSYHYGQINITRT K+VNS+S VDGKLR+ALNG+SH N  +TP KLAEYFG+
Sbjct  339   SAARPNPQGSYHYGQINITRTFKIVNSRSEVDGKLRFALNGISHTNAAETPFKLAEYFGV  398

Query  712   SEKVFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFA  888
             +EK+FKY++M D P  ++  KVT+APN+ NATFRNFVEI+FEN EKTIQTYHLDG+SFFA
Sbjct  399   TEKMFKYDLMADEPQTDDLNKVTVAPNIKNATFRNFVEIIFENREKTIQTYHLDGYSFFA  458

Query  889   VAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLG  1068
             VAIE G+WS EKRKNYNLVDAVSRHSIQVYPNSWAAVMTT+DNAG+WNLRS+MWER YLG
Sbjct  459   VAIEPGKWSAEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGLWNLRSEMWERYYLG  518

Query  1069  QQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             QQLYFSVLSP RSLRDE+NLPD   LCG+VK M MP PY
Sbjct  519   QQLYFSVLSPARSLRDEYNLPDNHPLCGIVKSMPMPSPY  557



>sp|P29162.1|ASOL_TOBAC RecName: Full=L-ascorbate oxidase homolog; AltName: Full=Pollen-specific 
protein NTP303; Flags: Precursor [Nicotiana tabacum]
 emb|CAA43454.1| pollen specific protein [Nicotiana tabacum]
Length=554

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/395 (78%), Positives = 345/395 (87%), Gaps = 1/395 (0%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             +NVF+ DWYNKGHKTLKKILD GRTI RPDG++INGK  KVG   +PLFTMEAGKTYRYR
Sbjct  159   YNVFVGDWYNKGHKTLKKILDGGRTIGRPDGIIINGKSAKVGEAKEPLFTMEAGKTYRYR  218

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
              CN+GMR+SVN RFQGH M LVE+EGSHT+QN YDSLDLHVGQCLSVLVTAD+EPKDYYL
Sbjct  219   FCNLGMRSSVNIRFQGHPMKLVELEGSHTVQNIYDSLDLHVGQCLSVLVTADQEPKDYYL  278

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             VVSSRF KQ  S+VAII YANG G  ASPELP PPPENTEGIAWS+NQFRSFRWNLTASA
Sbjct  279   VVSSRFLKQALSSVAIIRYANGKG-PASPELPTPPPENTEGIAWSMNQFRSFRWNLTASA  337

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTIK+ NS S V GKLRY LNG+SH N +TPLKL EYFG + K
Sbjct  338   ARPNPQGSYHYGQINITRTIKIFNSMSQVGGKLRYGLNGISHTNGETPLKLVEYFGATNK  397

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
              FKY++M D  P +  K+T+A NV NAT+RNFVEI+FENHEKTI+TYHLDG+SFFAVA+E
Sbjct  398   AFKYDLMADEAPADPSKLTIATNVKNATYRNFVEIIFENHEKTIRTYHLDGYSFFAVAVE  457

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              GRWSPEKRKNYNLVD +SR++IQVYPNSWAA+M T DNAGMWNLRS+MWE+ YLG+QLY
Sbjct  458   PGRWSPEKRKNYNLVDGLSRNNIQVYPNSWAAIMLTFDNAGMWNLRSEMWEKTYLGEQLY  517

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             FSVLSP RSLRDE+N+PD   LCG+VKG+SMP PY
Sbjct  518   FSVLSPSRSLRDEYNIPDNHPLCGIVKGLSMPAPY  552



>ref|XP_009588330.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=589

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/395 (78%), Positives = 346/395 (88%), Gaps = 1/395 (0%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             +NVF+ DWYNKGHKTLKKILD GRTI RPDG++INGK  KVG   +PLFTMEAGKTYRYR
Sbjct  194   YNVFVGDWYNKGHKTLKKILDGGRTIGRPDGIIINGKSAKVGEAKEPLFTMEAGKTYRYR  253

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
              CN+GMR+SVN RFQGH M LVE+EGSHT+QN YDSLDLHVGQCLSVLVTAD+EPKDYYL
Sbjct  254   FCNLGMRSSVNIRFQGHPMKLVELEGSHTVQNIYDSLDLHVGQCLSVLVTADQEPKDYYL  313

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             VVSSRF KQ  S+VAII YANG G  ASPELP PPPENTEGIAWS+NQFRSFRWNLTASA
Sbjct  314   VVSSRFLKQALSSVAIIRYANGKG-PASPELPTPPPENTEGIAWSMNQFRSFRWNLTASA  372

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTIK+ NS S V GKLRY LNG+SH N +TPLKL EYFG ++K
Sbjct  373   ARPNPQGSYHYGQINITRTIKIFNSMSQVGGKLRYGLNGISHTNGETPLKLVEYFGATDK  432

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
              FKY++M D  P +  K+T+A NV NAT+RNFVEI+FENHEKTI+TYHLDG+SFFAVA+E
Sbjct  433   AFKYDLMADEAPADPSKLTIATNVKNATYRNFVEIIFENHEKTIRTYHLDGYSFFAVAVE  492

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              GRWSPEKRKNYNLVD +SR++IQVYPNSWAA+M T DNAGMWNLRS+MWE+ YLG+QLY
Sbjct  493   PGRWSPEKRKNYNLVDGLSRNNIQVYPNSWAAIMLTFDNAGMWNLRSEMWEKTYLGEQLY  552

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             FSVLSP RSLRDE+N+PD   LCG+VKG+SMP PY
Sbjct  553   FSVLSPSRSLRDEYNIPDNHPLCGIVKGLSMPAPY  587



>gb|AAQ90185.1| ntp805 [Nicotiana tabacum]
Length=559

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/399 (79%), Positives = 353/399 (88%), Gaps = 5/399 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKI-DPLFTMEAGKTYRY  177
             +NVF+ DWYNKG+K+LKKILD GRTI RPDG+ INGK  KVG K+ +PLFTMEAGKTYRY
Sbjct  160   YNVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHINGKSVKVGDKVAEPLFTMEAGKTYRY  219

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             RVCN GMRTSVNFR QGH M LVEMEGSHT+QN Y+SLDLHVGQCLSVLVTAD+EPKDYY
Sbjct  220   RVCNAGMRTSVNFRIQGHPMKLVEMEGSHTVQNVYESLDLHVGQCLSVLVTADQEPKDYY  279

Query  358   LVVSSRFFKQ-EFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTA  534
             ++VSSRF KQ + S+VAII YANG G  AS +LP PPPENT+GIAWSINQFRSFRWNLTA
Sbjct  280   MIVSSRFLKQAQLSSVAIIRYANGKG-PASSDLPAPPPENTQGIAWSINQFRSFRWNLTA  338

Query  535   SAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINT-DTPLKLAEYFGI  711
             SAARPNPQGSYHYGQINITRT K+VNS++ VDGKLR+ALNG+SH N  +TP KLAEYFG+
Sbjct  339   SAARPNPQGSYHYGQINITRTFKIVNSRTEVDGKLRFALNGISHTNAAETPFKLAEYFGV  398

Query  712   SEKVFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFA  888
             +EK+FKY++M D P  ++  KVT+APN+ NATFRNFVEI+FEN EKTIQTYHLDG+SFFA
Sbjct  399   TEKMFKYDLMADEPQTDDLNKVTVAPNIKNATFRNFVEIIFENREKTIQTYHLDGYSFFA  458

Query  889   VAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLG  1068
             VAIE G+WS EKRKNYNLVDAVSRHSIQVYPNSWAAVMTT+DNAG+WNLRS+MWER YLG
Sbjct  459   VAIEPGKWSAEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGLWNLRSEMWERYYLG  518

Query  1069  QQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             QQLYFSVLSP RSLRDE+NLPD   LCG+VK M MP PY
Sbjct  519   QQLYFSVLSPARSLRDEYNLPDNHPLCGIVKSMPMPSPY  557



>ref|XP_009773470.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=554

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/395 (78%), Positives = 347/395 (88%), Gaps = 1/395 (0%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             +NVF+ DWYNKGHKTLKKILD GRTI R DG++INGK  KVG   + LFTMEAGKTYRYR
Sbjct  159   YNVFVGDWYNKGHKTLKKILDGGRTIGRADGIIINGKSAKVGEAKESLFTMEAGKTYRYR  218

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
              CN+GMR+SVN RFQGH M LVE+EGSHT+QN YDSLDLHVGQCLSVLVTAD+EPKDYYL
Sbjct  219   FCNLGMRSSVNVRFQGHPMKLVELEGSHTVQNIYDSLDLHVGQCLSVLVTADQEPKDYYL  278

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             VVSSRF KQ  S+VAII YANG G  ASPELP PPPENTEGIAWS+NQFRSFRWNLTASA
Sbjct  279   VVSSRFLKQALSSVAIIRYANGKG-PASPELPTPPPENTEGIAWSMNQFRSFRWNLTASA  337

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTIK+ NSKS VDGKLRY LNG+SH +++TPLKL EYFG ++K
Sbjct  338   ARPNPQGSYHYGQINITRTIKIFNSKSQVDGKLRYGLNGISHTDSETPLKLVEYFGATDK  397

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
              FKY++M D  P ++ K+T+A NV NAT+RNFVEI+FENHEKTI+TYHLDG+SFFAVA+E
Sbjct  398   AFKYDLMADEAPADSTKLTIAANVKNATYRNFVEIIFENHEKTIRTYHLDGYSFFAVAVE  457

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              GRWSPEKRKNYNLVD +SR++IQVYPNSWAA+M T DNAGMWNLRS+MWE+ YLG+QLY
Sbjct  458   PGRWSPEKRKNYNLVDGLSRNNIQVYPNSWAAIMLTFDNAGMWNLRSEMWEKTYLGEQLY  517

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             FSVLSP RSLRDE+N+PD   LCG+VKGM MP PY
Sbjct  518   FSVLSPSRSLRDEYNIPDNHPLCGIVKGMPMPAPY  552



>ref|XP_006341879.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=554

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/395 (76%), Positives = 346/395 (88%), Gaps = 1/395 (0%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             +NVF+ DWYNKGHKTLKK+LD G T+ RPDG++INGK  KVG   +PLFTMEAGKTYRYR
Sbjct  159   YNVFVGDWYNKGHKTLKKVLDGGHTVGRPDGIIINGKSAKVGEAKEPLFTMEAGKTYRYR  218

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
              CN+GMR+SVN RFQGH M LVE+EGSHT+QN YDSLDLHVGQCLSVLVTAD+EPKDYYL
Sbjct  219   FCNLGMRSSVNVRFQGHPMKLVELEGSHTVQNIYDSLDLHVGQCLSVLVTADQEPKDYYL  278

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             VVSSRF KQE S+VAII YANG G  ASPELP  PP+NTEGIAWS+NQFRSFRWNLTASA
Sbjct  279   VVSSRFLKQELSSVAIIRYANGKG-PASPELPASPPDNTEGIAWSMNQFRSFRWNLTASA  337

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTIK++NS   V+GKLRY LNG+SH +T+TPLKL EYFG ++K
Sbjct  338   ARPNPQGSYHYGQINITRTIKIINSMGQVNGKLRYGLNGISHSDTETPLKLVEYFGAADK  397

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
              FKY++M D  P +  K+T+APNV NAT+RNFVEI+FENHEK+I+TYHLDG+SFFAVA+E
Sbjct  398   TFKYDLMADEAPADPSKLTVAPNVKNATYRNFVEIIFENHEKSIRTYHLDGYSFFAVAVE  457

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G+WS EKRKNYNLVDA SR++IQVYPNSWAA+M T DNAGMWNLRS+MWE+ YLG+QLY
Sbjct  458   PGKWSAEKRKNYNLVDATSRNNIQVYPNSWAAIMLTFDNAGMWNLRSEMWEKTYLGEQLY  517

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             FSVLSP RSLRDE+NLPD   LCG+VKGM +P PY
Sbjct  518   FSVLSPGRSLRDEYNLPDNHPLCGVVKGMPLPTPY  552



>ref|XP_009785667.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
 gb|AAQ90183.1| ntp201 [Nicotiana tabacum]
Length=559

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/399 (78%), Positives = 350/399 (88%), Gaps = 5/399 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKI-DPLFTMEAGKTYRY  177
             +NVF+ DWYNKG+K+LKKILD GRTI RPDG+ INGK  KVG K+ +PLFTMEAGKTYRY
Sbjct  160   YNVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHINGKSLKVGDKVAEPLFTMEAGKTYRY  219

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             R+CN GMRTSVN R QGH M LVEMEGSHT+QN Y+SLDLHVGQCLSVLVTAD+EPKDYY
Sbjct  220   RMCNAGMRTSVNVRIQGHPMKLVEMEGSHTVQNVYESLDLHVGQCLSVLVTADQEPKDYY  279

Query  358   LVVSSRFFKQ-EFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTA  534
             ++VSSRF KQ + S+VAII YANG G  AS +LP PPPENT+GIAWSINQFRSFRWNLTA
Sbjct  280   MIVSSRFLKQAQLSSVAIIRYANGKG-PASSDLPAPPPENTQGIAWSINQFRSFRWNLTA  338

Query  535   SAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINT-DTPLKLAEYFGI  711
             SAARPNPQGSYHYGQINITRT K+VNS+S VDGKLR+ALNG+SH    +TP KLAEYFG 
Sbjct  339   SAARPNPQGSYHYGQINITRTFKIVNSRSEVDGKLRFALNGISHTAAGETPFKLAEYFGA  398

Query  712   SEKVFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFA  888
             ++K+FKY++M D P  E+  KVT+ PN+ NATFRNFVEI+FEN EKTIQTYHLDG+SFFA
Sbjct  399   TDKLFKYDLMADEPQTEDLNKVTVVPNIKNATFRNFVEIIFENREKTIQTYHLDGYSFFA  458

Query  889   VAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLG  1068
             VAIE GRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTT+DNAG+WNLRS+MWER YLG
Sbjct  459   VAIEPGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGLWNLRSEMWERFYLG  518

Query  1069  QQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             QQLYFSVLSP RSLRDE+NLPD   LCG+VK M +P PY
Sbjct  519   QQLYFSVLSPARSLRDEYNLPDNHPLCGIVKSMPLPSPY  557



>ref|XP_004228635.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=557

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/397 (77%), Positives = 350/397 (88%), Gaps = 3/397 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKI-DPLFTMEAGKTYRY  177
             ++VF+ DWYNKG+K+LKKILD GRTI RPDG+ INGK  KVG K+ +PL+ MEAGKTYRY
Sbjct  160   YSVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHINGKSEKVGEKVAEPLYKMEAGKTYRY  219

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             R CNVGMRTSVN R QGH M LVE+EGSHT+QN Y+SLDLHVGQCLSVLVTAD+EPKDYY
Sbjct  220   RFCNVGMRTSVNVRIQGHPMKLVEIEGSHTVQNVYESLDLHVGQCLSVLVTADQEPKDYY  279

Query  358   LVVSSRFFKQ-EFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTA  534
             ++VSSRF KQ E S+V+II Y NG G  AS +LP PPPENT+GIAWS+NQFRSFRWNLTA
Sbjct  280   MIVSSRFLKQAELSSVSIIRYVNGKG-PASSDLPAPPPENTQGIAWSMNQFRSFRWNLTA  338

Query  535   SAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGIS  714
             SAARPNPQGSYHYGQINITRT K+VNS++ VDGKLRYALNG+SH +++TP KLAEYFG +
Sbjct  339   SAARPNPQGSYHYGQINITRTFKIVNSRTEVDGKLRYALNGISHTDSETPFKLAEYFGAT  398

Query  715   EKVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             +KVFKY++M D P    +KVT+A N+ NATFRNFVEIVFENHEKTIQTYHLDG+SFFAVA
Sbjct  399   DKVFKYDLMPDQPSTPDDKVTIASNIKNATFRNFVEIVFENHEKTIQTYHLDGYSFFAVA  458

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             +E G+W+PEKRKNYNLVDA+SRHSIQVYPNSWAAVMTT+DNAG+W+LRS+MWER YLGQQ
Sbjct  459   VEPGKWTPEKRKNYNLVDAISRHSIQVYPNSWAAVMTTLDNAGLWSLRSEMWERFYLGQQ  518

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             LYFSVLSP RSLRDE+NLPD   LCG+VK M MP PY
Sbjct  519   LYFSVLSPARSLRDEYNLPDNHPLCGIVKTMPMPSPY  555



>ref|XP_004229062.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=554

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/395 (76%), Positives = 344/395 (87%), Gaps = 1/395 (0%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             +NVF+ DWYNKGHKTLKK+LD G T+ RPDG++INGK  KVG   +PLFTMEAGKTYRYR
Sbjct  159   YNVFVGDWYNKGHKTLKKVLDGGHTVGRPDGIIINGKSAKVGEAKEPLFTMEAGKTYRYR  218

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
              CN+GMR+SVN R QGH M LVE+EGSHT+QN YDSLD+HVGQCLSVLVTA++EPKDYYL
Sbjct  219   FCNLGMRSSVNVRLQGHPMKLVELEGSHTVQNIYDSLDIHVGQCLSVLVTANQEPKDYYL  278

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             VVSSRF KQE S+VAII YANG G  ASPELP  PP+NTEGIAWS+NQFRSFRWNLTASA
Sbjct  279   VVSSRFLKQELSSVAIIRYANGKG-PASPELPASPPDNTEGIAWSMNQFRSFRWNLTASA  337

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTIK+VNS   V+GKLRY LNG+SH +T+TPLKL EYFG ++K
Sbjct  338   ARPNPQGSYHYGQINITRTIKIVNSMGQVNGKLRYGLNGISHSDTETPLKLVEYFGAADK  397

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
              FKY++M D  P +  K+T+APNV N T+RNFVEI+FENHEK+I+TYHLDG+SFFAVA+E
Sbjct  398   SFKYDLMADEAPADPSKLTVAPNVKNTTYRNFVEIIFENHEKSIRTYHLDGYSFFAVAVE  457

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              GRWS EKRKNYNLVDA SR++IQVYPNSWAA+M T DNAGMWNLRS+MWE+ YLG+Q+Y
Sbjct  458   PGRWSAEKRKNYNLVDATSRNNIQVYPNSWAAIMLTFDNAGMWNLRSEMWEKTYLGEQMY  517

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             FSVLSP RSLRDE+NLPD   LCG+VKGM +P PY
Sbjct  518   FSVLSPSRSLRDEYNLPDNHPLCGVVKGMPLPAPY  552



>ref|XP_006354116.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=557

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/397 (76%), Positives = 350/397 (88%), Gaps = 3/397 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKI-DPLFTMEAGKTYRY  177
             ++VF+ DWYNKG+K+LKKILD GRTI RPDG+ INGK  KVG K  +PL+ MEAGKTYRY
Sbjct  160   YSVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHINGKSVKVGDKAAEPLYKMEAGKTYRY  219

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             R CNVGMRTSVN R QGH M LVE+EGSHT+QN Y+SLDLHVGQCLSVLVTAD+EPKDYY
Sbjct  220   RFCNVGMRTSVNVRIQGHPMKLVEIEGSHTVQNVYESLDLHVGQCLSVLVTADQEPKDYY  279

Query  358   LVVSSRFFKQ-EFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTA  534
             ++VSSRF KQ E S+V+II Y NG G  AS +LP PPPENT+GIAWS+NQFRSFRWNLTA
Sbjct  280   MIVSSRFLKQAELSSVSIIRYTNGKG-PASSDLPAPPPENTKGIAWSMNQFRSFRWNLTA  338

Query  535   SAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGIS  714
             SAARPNPQGSYHYGQINITRT K+VNS+S VDGKLRYALNG+SH +++TP KLAEYFG +
Sbjct  339   SAARPNPQGSYHYGQINITRTFKIVNSRSEVDGKLRYALNGISHTDSETPFKLAEYFGAT  398

Query  715   EKVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             +KVFKY++M D P  +++KVT+A N+ NATFRNFVEI+FENHEKTIQTYHLDG+SFFAV 
Sbjct  399   DKVFKYDLMDDEPSTSSDKVTVASNIKNATFRNFVEIIFENHEKTIQTYHLDGYSFFAVG  458

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             +E G+W+PEKRKNYNLVDA++RHSIQVYPNSWAAVMTT+DNAG+W+LRS+MWER YLGQQ
Sbjct  459   VEPGKWTPEKRKNYNLVDAINRHSIQVYPNSWAAVMTTLDNAGLWSLRSEMWERFYLGQQ  518

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             LYFSVLSP RSLRDE+NLPD   LCG+VK M MP PY
Sbjct  519   LYFSVLSPARSLRDEYNLPDNHPLCGIVKSMPMPSPY  555



>gb|EYU32815.1| hypothetical protein MIMGU_mgv1a003910mg [Erythranthe guttata]
Length=555

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/396 (76%), Positives = 338/396 (85%), Gaps = 2/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVG-GKIDPLFTMEAGKTYRY  177
             F V + DWYNKGHKTLK+ILDSGR+I +PDG+ INGK   VG     PL  ME GKTYRY
Sbjct  160   FAVLLGDWYNKGHKTLKRILDSGRSIGKPDGIQINGKSSSVGDAAAQPLAVMEPGKTYRY  219

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             RVCNVGM+ SVNFRFQGHTM LVE+EGSHT+QN YDSLDLHVGQCLSVLVTAD+ PKDYY
Sbjct  220   RVCNVGMKLSVNFRFQGHTMKLVELEGSHTVQNVYDSLDLHVGQCLSVLVTADQAPKDYY  279

Query  358   LVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTAS  537
             LVVSSRF K+  STVA+I Y NGNG  AS  +P PP EN  GIAWS+NQFRSFRWNLTAS
Sbjct  280   LVVSSRFSKKVMSTVAVIRYKNGNG-AASLSIPPPPAENRAGIAWSMNQFRSFRWNLTAS  338

Query  538   AARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISE  717
             AARPNPQGSYHYG+INITRTIK+ NS + VDGKLR+ +NG+SH+NT+TPLKLAEYFG+ +
Sbjct  339   AARPNPQGSYHYGKINITRTIKIANSHAVVDGKLRFGINGISHVNTETPLKLAEYFGLGD  398

Query  718   KVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             KVF YN+M D P E   K+ LAP+VVNATFRNFVEI+FEN EKTIQT+HLDG+SFFAVA+
Sbjct  399   KVFTYNLMKDEPTEGDNKLALAPSVVNATFRNFVEIIFENREKTIQTWHLDGYSFFAVAV  458

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRW+PEKRKNYNL+DAVSRH+IQVYPNSWAAVMTT+DNAGMWNLRSDM ER YLGQQ 
Sbjct  459   EPGRWAPEKRKNYNLLDAVSRHTIQVYPNSWAAVMTTLDNAGMWNLRSDMLERTYLGQQF  518

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             YFSVLSPE SLRDE+N+   QQLCG+V G+ MP PY
Sbjct  519   YFSVLSPENSLRDEYNIFPTQQLCGIVSGLPMPAPY  554



>gb|EYU32814.1| hypothetical protein MIMGU_mgv1a003925mg [Erythranthe guttata]
Length=555

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/396 (75%), Positives = 337/396 (85%), Gaps = 2/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGG-KIDPLFTMEAGKTYRY  177
             F V + DWYNKGHKTLKKILDSGR+I +PDG+ INGK  KVG     PL  ME GKTYRY
Sbjct  160   FAVLLGDWYNKGHKTLKKILDSGRSIGKPDGIQINGKSSKVGDVAAQPLAVMEPGKTYRY  219

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             RVCNVGM+ SVNFRFQGHTM LVE+EGSHT+QN YDSLDLHVGQCLSVLVTA++ PKDYY
Sbjct  220   RVCNVGMKLSVNFRFQGHTMKLVELEGSHTVQNVYDSLDLHVGQCLSVLVTANQAPKDYY  279

Query  358   LVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTAS  537
             LVVSSRF KQ  S+VA+I Y N NG  AS  +P PP EN  GIAWS+NQFRSFRWNLTAS
Sbjct  280   LVVSSRFSKQVMSSVAVIKYKNANG-AASTVIPPPPAENRVGIAWSMNQFRSFRWNLTAS  338

Query  538   AARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISE  717
             AARPNPQGSYHYG+INITRTIK+ N+ + VDGKLR+ +NG+SH+NT+TPLKLAEYFG+ +
Sbjct  339   AARPNPQGSYHYGKINITRTIKIANTHAVVDGKLRFGINGISHVNTETPLKLAEYFGLGD  398

Query  718   KVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             KVF YN+M D P E   K+ +AP+VVNATFRNFVEI+FEN EKTIQT+HLDG+SFFAVA+
Sbjct  399   KVFTYNLMKDEPTEGDNKLVVAPSVVNATFRNFVEIIFENREKTIQTWHLDGYSFFAVAV  458

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRWSPEKRK YNL+DAVSRH+IQVYPNSW+AVMTT+DNAGMWNLRSDM ER YLGQQ 
Sbjct  459   EPGRWSPEKRKTYNLLDAVSRHTIQVYPNSWSAVMTTLDNAGMWNLRSDMLERTYLGQQF  518

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             YFSVLSPE SLRDE+N+   QQLCG+V G+ MP PY
Sbjct  519   YFSVLSPENSLRDEYNIFPTQQLCGIVSGLPMPAPY  554



>gb|ABI52585.1| pollen-specific protein [Camellia sinensis]
Length=566

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/397 (73%), Positives = 338/397 (85%), Gaps = 4/397 (1%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             V   DWYNKGHK+++K LD+GR++ RPDG+ INGK GKVGG  +P+F MEAGK YRYRVC
Sbjct  166   VIAGDWYNKGHKSIQKQLDTGRSLGRPDGIQINGKSGKVGGSNEPMFNMEAGKIYRYRVC  225

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             NVGM+TS+NFR QGH++ LVEMEGSHT+QN YDSLD+H+GQC SVLV A++EP DYY+V 
Sbjct  226   NVGMKTSLNFRIQGHSLKLVEMEGSHTVQNVYDSLDVHIGQCFSVLVEANQEPNDYYMVF  285

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             SSRF KQ  ++VA+I YANG    +S     PP   T GIAWSINQFRSFRWNLTASAAR
Sbjct  286   SSRFTKQPLTSVAVIRYANGKNSPSSELPAPPPETAT-GIAWSINQFRSFRWNLTASAAR  344

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYG+INITRTIKLVNS++ VDGKLRYA+NGVSH+   TPLKL EY+GI +KVF
Sbjct  345   PNPQGSYHYGKINITRTIKLVNSRNNVDGKLRYAINGVSHVEPTTPLKLVEYYGIQDKVF  404

Query  727   KYNIMGDTP---PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             KY+I+ D P    E+ EK+ LAPNV+NATFRNFVEI+ ENHEKTIQT+HLDG+SFFAVAI
Sbjct  405   KYDIIKDEPEAASESNEKIVLAPNVLNATFRNFVEIILENHEKTIQTWHLDGYSFFAVAI  464

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRW+PEKRKNYNLVDAVSRH+IQVYP SWAA+MTT+DNAGMWN+RS+MWERAYLGQQ 
Sbjct  465   EPGRWTPEKRKNYNLVDAVSRHNIQVYPGSWAAIMTTLDNAGMWNMRSEMWERAYLGQQF  524

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             YFSVLSP RSLRDE+NLP+K  +CGLVK +  PPPYS
Sbjct  525   YFSVLSPARSLRDEYNLPEKTPVCGLVKDLPEPPPYS  561



>gb|AAL87103.1|AF479568_1 1-ascorbate oxidase [Petunia x hybrida]
Length=559

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/398 (77%), Positives = 342/398 (86%), Gaps = 5/398 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVG-GKIDPLFTMEAGKTYRY  177
             +NVF+ DWYNKG+K+LKKILD GRTI RPDG+ INGK GKVG    +PLFTMEAGKTYRY
Sbjct  162   YNVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHINGKSGKVGDNAAEPLFTMEAGKTYRY  221

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             R+CNVGMRTSVN R QGHTM LVEMEGSHT+QN Y+SLDLHVGQCLSVLVTAD+EPK YY
Sbjct  222   RMCNVGMRTSVNVRIQGHTMKLVEMEGSHTVQNVYESLDLHVGQCLSVLVTADQEPKGYY  281

Query  358   LVVSSRFFKQ-EFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTA  534
             +VVSSRF KQ E S+VAI+ YANG G  AS +LP PPP+NTEGIAWSINQFRSFRWNLTA
Sbjct  282   MVVSSRFLKQAELSSVAIVRYANGKG-PASSDLPAPPPDNTEGIAWSINQFRSFRWNLTA  340

Query  535   SAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGIS  714
             SAARPNPQGSYHYGQINITRTIK+ NS+S V GKLR+ALNG+SH   +TP KLAEYFG +
Sbjct  341   SAARPNPQGSYHYGQINITRTIKIANSRSQVGGKLRFALNGISHSPAETPFKLAEYFGAT  400

Query  715   EKVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             +KVFKY++M D PP + +KVT+  N+ NAT+RN+VEI+FEN EKTIQTYHLDG+SFFAVA
Sbjct  401   DKVFKYDLMADEPP-SGDKVTVDHNIKNATYRNYVEIIFENREKTIQTYHLDGYSFFAVA  459

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             IE G+WSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTT+DNAG+WNLRSDMWER YLGQQ
Sbjct  460   IEPGKWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTLDNAGLWNLRSDMWERYYLGQQ  519

Query  1075  LYFSVLSPERSLRDEHNLPDKQQL-CGLVKGMSMPPPY  1185
             LYFSVL P RSLRDE        L   L KGM MPPPY
Sbjct  520   LYFSVLLPTRSLRDELQPSLTTTLSVVLSKGMPMPPPY  557



>gb|EPS72881.1| pollen-specific protein [Genlisea aurea]
Length=585

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/398 (74%), Positives = 343/398 (86%), Gaps = 1/398 (0%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F V + DWYNKGHKTLK ILDSGR+I  PDGV INGK GKVGG   P+FT+E GKTYRYR
Sbjct  187   FAVLVGDWYNKGHKTLKSILDSGRSIGFPDGVHINGKFGKVGGGSPPMFTVEKGKTYRYR  246

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             VCNVGMR SVNFR QGH + LVEMEGSHT+QN YDSLDLHVGQC+SVL+TAD+ P DY+ 
Sbjct  247   VCNVGMRLSVNFRIQGHDLKLVEMEGSHTVQNVYDSLDLHVGQCMSVLITADQAPADYHF  306

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             VVSSRF K+  STVA+I Y+   G + S  +P PPPEN+ GIAWSINQFRSFRWNLTASA
Sbjct  307   VVSSRFTKKALSTVAVIRYSGSKGSSDSGAIPPPPPENSRGIAWSINQFRSFRWNLTASA  366

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIK+VN++  V+GKLR+ +NGVSH++ +TPLKLAEYFG+ +K
Sbjct  367   ARPNPQGSYHYGKINITRTIKVVNARYQVNGKLRFGINGVSHVDGETPLKLAEYFGVGDK  426

Query  721   VFKYNIMGDTPP-ENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY++M D P  ++ +K +LAPNVVNATFRNFVEIVFENHE+TIQT+HLDG++FFAVA+
Sbjct  427   VFKYDVMKDEPTGQDEQKASLAPNVVNATFRNFVEIVFENHERTIQTWHLDGYAFFAVAV  486

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRWSPEKRKNYNL DAVSRH+IQVYPNSWAAVMTT+DNAG+WNLRS+M ERAYLGQQ 
Sbjct  487   EPGRWSPEKRKNYNLEDAVSRHTIQVYPNSWAAVMTTLDNAGLWNLRSEMRERAYLGQQF  546

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1191
             YFSVLSP RSLRDE+N+   Q LCG+VKG+ +P PYSG
Sbjct  547   YFSVLSPARSLRDEYNILPDQPLCGIVKGLPLPMPYSG  584



>gb|EYU39285.1| hypothetical protein MIMGU_mgv1a026945mg [Erythranthe guttata]
Length=558

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/397 (75%), Positives = 342/397 (86%), Gaps = 2/397 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVG-GKIDPLFTMEAGKTYRY  177
             F V + DWYNKGHKTLKKILDSG TI  P+G+ ING+ GKVG   + PL  +E GKTYRY
Sbjct  163   FAVLLGDWYNKGHKTLKKILDSGATIGLPNGIHINGQSGKVGSAPLTPLAIVEPGKTYRY  222

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             RVCNVG+RTS+NFRFQ H M LVE+EGSHT+QN YDSLDLH GQC+SVLVTAD+ PKDYY
Sbjct  223   RVCNVGLRTSINFRFQSHIMKLVEVEGSHTVQNVYDSLDLHAGQCVSVLVTADQAPKDYY  282

Query  358   LVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTAS  537
             LV SSRF K+  S+VAII YANG G  ASPELP PPPENT GIAWS+NQFRS+RWNLTAS
Sbjct  283   LVASSRFSKKPLSSVAIIRYANGKGAPASPELPPPPPENTAGIAWSVNQFRSYRWNLTAS  342

Query  538   AARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISE  717
             AARPNPQGSYHYG+INITRTIK+ NS+  V+GKLR+ +NGVSHI ++TPLKLAEYFG+++
Sbjct  343   AARPNPQGSYHYGKINITRTIKIANSRYQVNGKLRFGINGVSHIESETPLKLAEYFGLAD  402

Query  718   KVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             K F Y+++ D  P N +KV LAP+VVNATFRNFVEI+FEN+E TIQT+HLDG+SFFAVAI
Sbjct  403   KAFNYDLVKDE-PSNDKKVVLAPSVVNATFRNFVEIIFENNENTIQTWHLDGYSFFAVAI  461

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             EAG+W+PEKRKNYNL+DAVSRH+I VYP SWAAVMTT+DNAGMWNLRSDM ERAYLGQQL
Sbjct  462   EAGKWNPEKRKNYNLLDAVSRHTIHVYPKSWAAVMTTLDNAGMWNLRSDMAERAYLGQQL  521

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             YFSVLSP RSLRDE+N+P  QQLCG+V+ +  P PYS
Sbjct  522   YFSVLSPARSLRDEYNIPLTQQLCGIVQNLPKPTPYS  558



>ref|XP_011089764.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=554

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/397 (74%), Positives = 344/397 (87%), Gaps = 3/397 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVG-GKIDPLFTMEAGKTYRY  177
             + V + DWYNKGHK+LK ILDSGR+I RPDG+ ING+  KVG     PLFT EAGKTYR+
Sbjct  160   YPVLLGDWYNKGHKSLKNILDSGRSIGRPDGIQINGQSSKVGDANAKPLFTFEAGKTYRF  219

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             RVCNVG+R SVNFR Q H+MT+VE+EGSHT+QN YDSLDLHVGQC+SVLVTAD+ PKDYY
Sbjct  220   RVCNVGLRLSVNFRIQAHSMTVVEVEGSHTVQNVYDSLDLHVGQCMSVLVTADQTPKDYY  279

Query  358   LVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTAS  537
              V SSRF +   STVA+I YANGNG  ASPELP PPP+NT GIAWSI+QFRSFRWNLTAS
Sbjct  280   FVASSRFAQHPLSTVAVIRYANGNG-PASPELPPPPPQNTMGIAWSISQFRSFRWNLTAS  338

Query  538   AARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISE  717
             AARPNPQGSY YG+INITRTIKLVN++S  +GKLR+ +NGVSH++T+TPLKLAEY+G+++
Sbjct  339   AARPNPQGSYKYGKINITRTIKLVNTRSSSNGKLRFGINGVSHVDTETPLKLAEYYGVAD  398

Query  718   KVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             KVF YN+M D P E   KV +APNVVN T+RNFVEI+FENHEKTIQT+HLDG+SFFAVAI
Sbjct  399   KVFTYNLMKDEPQE-GNKVEVAPNVVNGTYRNFVEIIFENHEKTIQTWHLDGYSFFAVAI  457

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRWSPEKRKNYNL+DA+SR++IQVYPN+WAAVMTT+DNAGMWNLRS+M ERAYLGQQ 
Sbjct  458   EPGRWSPEKRKNYNLLDALSRNTIQVYPNTWAAVMTTLDNAGMWNLRSEMRERAYLGQQF  517

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             YFSV+S  RSLRDE++LP+ Q+LCG+VK +  P PY+
Sbjct  518   YFSVVSEARSLRDEYSLPETQELCGIVKSLPKPAPYT  554



>emb|CDP18567.1| unnamed protein product [Coffea canephora]
Length=557

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/399 (72%), Positives = 337/399 (84%), Gaps = 3/399 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             +NV + DWY KGHK LK +LDSGR++ RPDG+ INGK  KVG  ++PLFTME GKTYRYR
Sbjct  160   YNVLVGDWYTKGHKALKNMLDSGRSLGRPDGIQINGKSAKVGDNVEPLFTMEPGKTYRYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             VCNVG++TS+NFR QGH + LVE+EGSHT+Q  +DSLD+HVGQCLSVLVTADKEPKDYY 
Sbjct  220   VCNVGLKTSINFRIQGHPLKLVEIEGSHTVQYDFDSLDVHVGQCLSVLVTADKEPKDYYF  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V SSRF +   S+V II Y NG G  ASPELP  PP  + GIAWS+NQFRSFRWNLTASA
Sbjct  280   VASSRFIQAPLSSVGIIRYTNGKG-PASPELPPSPPVGSAGIAWSMNQFRSFRWNLTASA  338

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTIKLVNS+S V GKLRYA+NGVSHI+T TPLK AEYFG+++K
Sbjct  339   ARPNPQGSYHYGQINITRTIKLVNSESRVGGKLRYAINGVSHIDTPTPLKHAEYFGVADK  398

Query  721   VFKYNIMGDTPPE-NAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             +F+YN++ D     N     +AP+VVNATFRNFVEI+FENHEKTIQTY+LDG+SFFAVA+
Sbjct  399   LFQYNLVKDDGSAVNTPAPIIAPSVVNATFRNFVEIIFENHEKTIQTYNLDGYSFFAVAV  458

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G WSPEKRKNYNL+DA+SRH++QVYP SWAA+MTT+DNAGMWNLRS+M  RAYLGQQL
Sbjct  459   EPGTWSPEKRKNYNLLDAISRHNVQVYPGSWAAIMTTLDNAGMWNLRSEMQHRAYLGQQL  518

Query  1078  YFSVLSPERSLRDEHNLPDKQQLC-GLVKGMSMPPPYSG  1191
             YFSVLSP RSLRDE+NLPD Q LC G+V+ + +P PY+ 
Sbjct  519   YFSVLSPARSLRDEYNLPDNQPLCGGIVEKLPLPAPYTA  557



>ref|XP_011089765.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=554

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/397 (73%), Positives = 340/397 (86%), Gaps = 3/397 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVG-GKIDPLFTMEAGKTYRY  177
             + V + DWYNKGHKTLK ILDSGR+I RPDG+ ING+  KVG     PLFT EAGKTY+ 
Sbjct  160   YPVLLGDWYNKGHKTLKSILDSGRSIGRPDGIQINGQSSKVGDANAKPLFTFEAGKTYKL  219

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             RVCNVG+R SVNFR QGHTM +VE+EGSHT+QN YDSLDLHVGQC+SVLVTAD+ PKDYY
Sbjct  220   RVCNVGLRLSVNFRVQGHTMKVVEVEGSHTVQNLYDSLDLHVGQCMSVLVTADQTPKDYY  279

Query  358   LVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTAS  537
              V SSRF +   STVA+I YANGNG  ASPELP PPPENT+GIAWSI+QFRSFRWNLT++
Sbjct  280   FVASSRFAQHPLSTVAVIRYANGNG-AASPELPPPPPENTKGIAWSISQFRSFRWNLTSN  338

Query  538   AARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISE  717
             AARPNPQGSY YG+INITRTIK+ NS+S  +GKLR+ +NGVSH++ +TPLKLAEY+G+++
Sbjct  339   AARPNPQGSYKYGKINITRTIKIANSRSSSNGKLRFGINGVSHVDAETPLKLAEYYGVAD  398

Query  718   KVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             KVF YN+M D P E   KV +APNVVN T+RNFVEI+FENHEKTIQT+HLDG SFFAVAI
Sbjct  399   KVFTYNLMKDEPQE-GNKVEVAPNVVNGTYRNFVEIIFENHEKTIQTWHLDGFSFFAVAI  457

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRWS EKRKNYNL+DAVSR++IQVYPNSWAAVMTT+DNAGMWNLRS+M ERAYLGQQL
Sbjct  458   EPGRWSAEKRKNYNLLDAVSRNTIQVYPNSWAAVMTTLDNAGMWNLRSEMRERAYLGQQL  517

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             Y SV+S  RSLRDE++LP+ Q+LCG+VK +  P PY+
Sbjct  518   YLSVVSEARSLRDEYSLPETQELCGIVKSLPKPAPYT  554



>ref|XP_011089767.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/397 (73%), Positives = 340/397 (86%), Gaps = 3/397 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVG-GKIDPLFTMEAGKTYRY  177
             + V + DWYNKGHKTLK ILDSGR+I RPDG+ ING+  KVG     PLFT EAG TY+ 
Sbjct  161   YPVLLGDWYNKGHKTLKSILDSGRSIGRPDGIQINGQSSKVGDANAKPLFTFEAGNTYKL  220

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             RVCNVG+R SVNFR QGHTM +VE+EGSHT+QN YDSLDLHVGQC+SVLVTAD+ PKDYY
Sbjct  221   RVCNVGLRLSVNFRVQGHTMKVVEVEGSHTVQNLYDSLDLHVGQCMSVLVTADQTPKDYY  280

Query  358   LVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTAS  537
              V SSRF +   STVA+I YANGNG  ASPELP PPPENT+GIAWSI+QFRSFRWNLT++
Sbjct  281   FVASSRFAQHPHSTVAVIRYANGNG-AASPELPPPPPENTKGIAWSISQFRSFRWNLTSN  339

Query  538   AARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISE  717
             AARPNPQGSY YG+INITRTIK+ NS+S  +GKLR+ +NGVSH++ +TPLKLAEY+G+++
Sbjct  340   AARPNPQGSYKYGKINITRTIKIANSRSSSNGKLRFGINGVSHVDAETPLKLAEYYGVAD  399

Query  718   KVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             KVF YN+M D P E  +KV +APNVVN T+RNFVEI+FENHEKTIQT+HLDG SFFAVAI
Sbjct  400   KVFTYNLMKDEPQE-GDKVEVAPNVVNGTYRNFVEIIFENHEKTIQTWHLDGFSFFAVAI  458

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRWSPEKRKNYNL+DAVSR++IQVYPNSWAAVMTT+DNAGMWNLRS+M ERAYLGQQ 
Sbjct  459   EPGRWSPEKRKNYNLLDAVSRNTIQVYPNSWAAVMTTLDNAGMWNLRSEMRERAYLGQQF  518

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             Y SV+S  RSLRDE++LP+ Q+LCG+VK +  P PY+
Sbjct  519   YLSVVSEARSLRDEYSLPETQELCGIVKSLPKPAPYT  555



>ref|XP_011089763.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/397 (73%), Positives = 340/397 (86%), Gaps = 3/397 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVG-GKIDPLFTMEAGKTYRY  177
             + V + DWYNKGHKTLK ILDSGR+I RPDG+ ING+  KVG     PLFT EAGKTY+ 
Sbjct  161   YPVLLGDWYNKGHKTLKSILDSGRSIGRPDGIQINGQSSKVGDANAKPLFTFEAGKTYKL  220

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             RVCNVG+R SVNFR QGHTM +VE+EGSHT+QN YDSLDLHVGQC+SVLVTAD+ PKDYY
Sbjct  221   RVCNVGLRLSVNFRVQGHTMKVVEVEGSHTVQNLYDSLDLHVGQCMSVLVTADQTPKDYY  280

Query  358   LVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTAS  537
              V SSRF +   STVA+I YANGNG  ASPELP PPP++T+GIAWSI+QFRSFRWNLT++
Sbjct  281   FVASSRFAQHPLSTVAVIRYANGNG-AASPELPPPPPDSTKGIAWSISQFRSFRWNLTSN  339

Query  538   AARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISE  717
             AARPNPQGSY YG+INITRTIK+ NS+S  +GKLR+ +NGVSH++ +TPLKLAEY+G+++
Sbjct  340   AARPNPQGSYKYGKINITRTIKIANSRSSSNGKLRFGINGVSHVDAETPLKLAEYYGVAD  399

Query  718   KVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             KVF YN+M D P E   KV +APNVVN T+RNFVEI+FENHEKTIQT+HLDG SFFAVAI
Sbjct  400   KVFTYNLMKDEPQE-GNKVEVAPNVVNGTYRNFVEIIFENHEKTIQTWHLDGFSFFAVAI  458

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRWS EKRKNYNL+DAVSR++IQVYPNSWAAVMTT+DNAGMWNLRS+M ERAYLGQQL
Sbjct  459   EPGRWSAEKRKNYNLLDAVSRNTIQVYPNSWAAVMTTLDNAGMWNLRSEMRERAYLGQQL  518

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             Y SV+S  RSLRDE++LP+ Q+LCG+VK +  P PY+
Sbjct  519   YLSVVSEARSLRDEYSLPETQELCGIVKSLPKPAPYT  555



>ref|XP_011089766.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/397 (73%), Positives = 340/397 (86%), Gaps = 3/397 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVG-GKIDPLFTMEAGKTYRY  177
             + V + DWYNKGHKTLK ILDSGR+I RPDG+ ING+  KVG     PLFT EAGKTY+ 
Sbjct  161   YPVLLGDWYNKGHKTLKSILDSGRSIGRPDGIQINGQSSKVGDANAKPLFTFEAGKTYKL  220

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             RVCNVG+R SVNFR QGHT+ +VE+EGSH +QN YDSLDLHVGQC+SVLVTAD+ PKDYY
Sbjct  221   RVCNVGLRLSVNFRVQGHTLKVVEVEGSHNVQNLYDSLDLHVGQCMSVLVTADQTPKDYY  280

Query  358   LVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTAS  537
              V SSRF +   STVA+I Y NGNG  ASPELP PPPENT+GIAWSI+QFRSFRWNLT++
Sbjct  281   FVASSRFAQHPLSTVAVIRYVNGNG-AASPELPPPPPENTKGIAWSISQFRSFRWNLTSN  339

Query  538   AARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISE  717
             AARPNPQGSY YG+INITRTIK+ NS+S  +GKLR+ +NGVSH++ +TPLKLAEY+G+++
Sbjct  340   AARPNPQGSYKYGKINITRTIKIANSRSSSNGKLRFGINGVSHVDAETPLKLAEYYGVAD  399

Query  718   KVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             KVF YN+M D P E  +KV +APNVVN T+RNFVEI+FENHEKTIQT+HLDG SFFAVAI
Sbjct  400   KVFTYNLMKDEPQE-GDKVEVAPNVVNGTYRNFVEIIFENHEKTIQTWHLDGFSFFAVAI  458

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRWSPEKRKNYNL+DA+SR++IQVYPNSWAAVMTT+DNAGMWNLRS+M ERAYLGQQL
Sbjct  459   EPGRWSPEKRKNYNLLDALSRNTIQVYPNSWAAVMTTLDNAGMWNLRSEMRERAYLGQQL  518

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             Y SV+S  RSLRDE++LP+ Q+LCG+VK +  P PY+
Sbjct  519   YLSVVSEARSLRDEYSLPETQELCGIVKSLPKPAPYT  555



>ref|XP_011089702.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/397 (73%), Positives = 342/397 (86%), Gaps = 3/397 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVG-GKIDPLFTMEAGKTYRY  177
             + V + DWYNKGHKTLK ILDSGR+I RPDG+ ING+  KVG     PLFT EAGKTY+ 
Sbjct  161   YPVLLGDWYNKGHKTLKSILDSGRSIGRPDGIQINGQSSKVGDANAKPLFTFEAGKTYKL  220

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             RVCNVG+R SVNFR QGHTM +VE+EGSHT+QN YDSLDLHVGQC+SVLVTAD+ PKDYY
Sbjct  221   RVCNVGLRLSVNFRVQGHTMKVVEVEGSHTVQNLYDSLDLHVGQCMSVLVTADQTPKDYY  280

Query  358   LVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTAS  537
              V SSRF +   STVA+I YANGNG  ASPELP PPP++T+GIAWSI+QFRSFRWNLT++
Sbjct  281   FVASSRFAQHPLSTVAVIRYANGNG-PASPELPPPPPDSTKGIAWSISQFRSFRWNLTSN  339

Query  538   AARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISE  717
             AARPNPQGSY YG+INITRTIK+ NS+S  +GKLR+ +NGVSH++ +TPLKLAEY+G+++
Sbjct  340   AARPNPQGSYKYGKINITRTIKIANSRSSSNGKLRFGINGVSHVDAETPLKLAEYYGVAD  399

Query  718   KVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             KVF YN+M D P E  +KV +APNVVN T+RNFVEI+FENHEKTIQT+HLDG SFFAVAI
Sbjct  400   KVFTYNLMKDEPQE-GDKVEVAPNVVNGTYRNFVEIIFENHEKTIQTWHLDGFSFFAVAI  458

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRWSPEKRKNYNL+DAVSR++IQVYPNSWAAVMTT+DNAGMWNLRS+M ERAYLGQQL
Sbjct  459   EPGRWSPEKRKNYNLLDAVSRNTIQVYPNSWAAVMTTLDNAGMWNLRSEMRERAYLGQQL  518

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             Y SV+S  RSLRDE++LP+ Q+LCG+VK +  P PY+
Sbjct  519   YLSVVSEARSLRDEYSLPETQELCGIVKSLPKPAPYT  555



>ref|XP_009339220.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=552

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/397 (70%), Positives = 324/397 (82%), Gaps = 6/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  LKKILDSGR++ RP GV+INGK+ K  GK +PLFTM+ GKTY+YR
Sbjct  160   YTVMIGDWYTKSHTALKKILDSGRSMGRPAGVLINGKNAKGDGKDEPLFTMKPGKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             VCNVG++ S+NFR QGH + LVEMEGSHT+QN Y+SLD+HVGQC S+LVTADKEPKDYY+
Sbjct  220   VCNVGLKNSLNFRIQGHPLKLVEMEGSHTVQNTYESLDVHVGQCFSLLVTADKEPKDYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   +   II Y NGNG  +      P      G AWS+NQFRSFRWNLTASA
Sbjct  280   VASTRFTKTVLTGKGIIRYENGNGPASPELPEAPV-----GWAWSLNQFRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIK+VNS S VDGKLRYA+NGVSH+ ++TPLKLAEYFG+++K
Sbjct  335   ARPNPQGSYHYGKINITRTIKIVNSASRVDGKLRYAVNGVSHVESETPLKLAEYFGVADK  394

Query  721   VFKYNIMGDTPPENAE-KVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D PP   E K+TLAPNVVN TFR+FVEI+FENHEK+IQ++HLDG+SFFAVAI
Sbjct  395   VFKYDTIEDEPPATVEDKITLAPNVVNQTFRDFVEIIFENHEKSIQSWHLDGYSFFAVAI  454

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRW+PEKRKNYNL+D VSRH+IQV+P SWAAVM T DNAGMWN+RS+  ER YLGQQ 
Sbjct  455   EPGRWTPEKRKNYNLLDGVSRHTIQVFPKSWAAVMLTFDNAGMWNVRSEQPERRYLGQQF  514

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             Y SVLSP RSLRDE+NLP+  QLCG+VK    PPPYS
Sbjct  515   YVSVLSPARSLRDEYNLPETAQLCGIVKDSPKPPPYS  551



>emb|CDP04133.1| unnamed protein product [Coffea canephora]
Length=557

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/400 (69%), Positives = 322/400 (81%), Gaps = 9/400 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + +   DWY+K H  L+K+LDSGRT+ RPDGV+INGK GK  GK +P+FTM  GKTYRYR
Sbjct  162   YTIMAGDWYSKSHVALRKLLDSGRTLGRPDGVLINGKSGKADGKDEPMFTMIPGKTYRYR  221

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             VCNVGM+ S+NFRFQGHTM LVEMEGSHT+Q  YDSLDLH+GQC SVLVTADKEPKDYY 
Sbjct  222   VCNVGMKNSLNFRFQGHTMKLVEMEGSHTMQYLYDSLDLHLGQCASVLVTADKEPKDYYF  281

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF KQ  S  A I Y  G G  +    P P      G AWS+NQFRSFRWNLTASA
Sbjct  282   VASTRFTKQILSATATIRYTTGKGPASPELPPAPV-----GWAWSLNQFRSFRWNLTASA  336

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTI++VNS    DGKLRYA+NGVSH++ +TPLKLAEYFG+++K
Sbjct  337   ARPNPQGSYHYGQINITRTIRIVNSAGEADGKLRYAINGVSHVDPETPLKLAEYFGVADK  396

Query  721   VFKYNIMGDTPPENA----EKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFA  888
             VFKYNI+ D P  +A      +TLAPNVVNATFRNF+EI+ ENHEKT+Q++HLDG+SFFA
Sbjct  397   VFKYNIIQDEPSADATAKNHAITLAPNVVNATFRNFIEIILENHEKTVQSWHLDGYSFFA  456

Query  889   VAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLG  1068
             VAIE G W+PE+RK YNL+DA+SR++IQVYP SWAA+M TMDNAGMWNLRS + ER YLG
Sbjct  457   VAIEPGTWTPERRKVYNLLDAISRNTIQVYPKSWAAIMLTMDNAGMWNLRSTLLERQYLG  516

Query  1069  QQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             QQLYFSVLSP  SLRDE+N+PD   LCG+VK M  P PYS
Sbjct  517   QQLYFSVLSPNYSLRDEYNVPDDALLCGIVKDMPKPKPYS  556



>ref|XP_008449912.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Cucumis melo]
Length=554

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/398 (70%), Positives = 327/398 (82%), Gaps = 7/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSG-RTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRY  177
             + V I DWY K H TLK+ILD+G R+IARP+GV+INGK  K  G  +PLFTM+ GKTY+Y
Sbjct  161   YTVLIGDWYTKSHTTLKQILDNGHRSIARPEGVLINGKTAKGDGTDEPLFTMKPGKTYKY  220

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             RVCNVG++TS+NFRFQGHTM LVEMEGSHT+QN Y SLD+HVGQC SVLVTA++EPKDYY
Sbjct  221   RVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQNDYQSLDVHVGQCFSVLVTANQEPKDYY  280

Query  358   LVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTAS  537
             +V S+RF K       II Y NG G  +      P      G AWS+NQFR+FRWNLTAS
Sbjct  281   MVASTRFIKNVIIGKGIIRYTNGKGPASPEIPKAPM-----GWAWSLNQFRTFRWNLTAS  335

Query  538   AARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISE  717
             AARPNPQGSYHYG INITRTIKL NS + VDGKLRYA+NGVSHI+ +TPLKLAEYFGI++
Sbjct  336   AARPNPQGSYHYGSINITRTIKLFNSATKVDGKLRYAINGVSHIDPETPLKLAEYFGIAD  395

Query  718   KVFKYNIMGDT-PPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             KVFKY+I+ D  P E A  VT+APNVVNATFRNF+EI+FENHEK++Q++HLDG+SFFAVA
Sbjct  396   KVFKYDIISDEGPTEGATAVTIAPNVVNATFRNFIEIIFENHEKSLQSWHLDGYSFFAVA  455

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             IE GRWSPEKR NYNL+DAVSRH+IQV+PNSWAA++ T DNAGMWNLRS++ E  YLGQQ
Sbjct  456   IEPGRWSPEKRSNYNLLDAVSRHTIQVFPNSWAAILLTFDNAGMWNLRSELTENRYLGQQ  515

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             LY SVLSP RSLRDE+N+PD   LCGLVKGM +P PY+
Sbjct  516   LYMSVLSPARSLRDEYNIPDHTLLCGLVKGMPLPKPYT  553



>ref|XP_007208287.1| hypothetical protein PRUPE_ppa003715mg [Prunus persica]
 gb|EMJ09486.1| hypothetical protein PRUPE_ppa003715mg [Prunus persica]
Length=554

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/398 (69%), Positives = 326/398 (82%), Gaps = 6/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY KGH  LKK LDSGR++ARPDGV+INGK  K  GK +PLFTM+ GKTY+YR
Sbjct  160   YTVLIGDWYAKGHTALKKHLDSGRSMARPDGVIINGKSAKGDGKDEPLFTMKPGKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ S+NFR QGH M LVEMEGSHT+QN Y+SLD+HVGQC SVLVTADK+PKDYY+
Sbjct  220   ICNVGLKNSLNFRIQGHPMKLVEMEGSHTVQNTYESLDVHVGQCFSVLVTADKDPKDYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+  +   I+ Y NGNG  +      P      G AWS+NQFRSFRWNLTASA
Sbjct  280   VASTRFTKKVLTGKGIMRYENGNGPASPELPEAPV-----GWAWSLNQFRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRT+K+VNS + VDGKLRYA+NGVSH++ +TPLKLAEY+G+++K
Sbjct  335   ARPNPQGSYHYGKINITRTLKIVNSATKVDGKLRYAINGVSHVDPETPLKLAEYYGVADK  394

Query  721   VFKYNIMGDTPPENAE-KVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D PP   E KVTLAPNVVN TFRNFVEI+FENHEK+IQ+++LDG+SFFAVAI
Sbjct  395   VFKYDTIQDDPPATVEDKVTLAPNVVNQTFRNFVEIIFENHEKSIQSWNLDGYSFFAVAI  454

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRW+PEKRKNYNL+D VSRH+IQV+P SWAA+M T DNAGMWN+RS+  ER YLGQQ 
Sbjct  455   EPGRWAPEKRKNYNLLDGVSRHTIQVFPKSWAAIMLTFDNAGMWNVRSEQSERRYLGQQF  514

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1191
             Y SVLSP RSLRDE+NLPD   +CG+VK +  PPPYS 
Sbjct  515   YVSVLSPARSLRDEYNLPDNTLVCGIVKDLPKPPPYSA  552



>ref|XP_008449913.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Cucumis melo]
Length=554

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/398 (70%), Positives = 325/398 (82%), Gaps = 7/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSG-RTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRY  177
             + V I DWY K H TLK+ILD+G R+IARP+GV+INGK  K  G  +PLFTM+ GKTY+Y
Sbjct  161   YTVLIGDWYTKSHTTLKQILDNGHRSIARPEGVLINGKTAKGDGTDEPLFTMKPGKTYKY  220

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             RVCNVG++TS+NFRFQGHTM LVEMEGSHT+QN Y SLD+HVGQC SVLVTA++EPKDYY
Sbjct  221   RVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQNDYQSLDVHVGQCFSVLVTANQEPKDYY  280

Query  358   LVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTAS  537
             +V S+RF K       II Y NG G  +      P      G AWS+NQFR+FRWNLTAS
Sbjct  281   MVASTRFIKNVIIGKGIIRYTNGKGPASPEIPKAPM-----GWAWSLNQFRTFRWNLTAS  335

Query  538   AARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISE  717
             AARPNPQGSYHYG INITRTIKL NS + VDGKLRYA+NGVSHI+ +TPLKLAEYFGI++
Sbjct  336   AARPNPQGSYHYGSINITRTIKLFNSATKVDGKLRYAINGVSHIDPETPLKLAEYFGIAD  395

Query  718   KVFKYNIMGDT-PPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             KVFKY+I+ D  P E A  VT+APNVVNATFRNF+EI+FENHEK++Q++HLDG+SFFAVA
Sbjct  396   KVFKYDIISDEGPTEGATAVTIAPNVVNATFRNFIEIIFENHEKSLQSWHLDGYSFFAVA  455

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             IE GRWSPEKR NYNL+DAVSRH+IQV+PNSWAA++ T DNAGMWNLRS++ E  YLG Q
Sbjct  456   IEPGRWSPEKRSNYNLLDAVSRHTIQVFPNSWAAILLTFDNAGMWNLRSELTENRYLGSQ  515

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             LY SVLSP RSLRDE+N+PD   LCGLVK M MP PY+
Sbjct  516   LYISVLSPARSLRDEYNIPDNTLLCGLVKDMPMPKPYT  553



>ref|XP_010044910.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW87033.1| hypothetical protein EUGRSUZ_B03580 [Eucalyptus grandis]
Length=551

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/397 (67%), Positives = 324/397 (82%), Gaps = 6/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY+K H TL K LDSGR + RPDGV+INGK  K  GK +PLFTM+ GKTY+YR
Sbjct  159   YTVLIGDWYSKSHTTLHKFLDSGRALGRPDGVLINGKSSKSKGKEEPLFTMKPGKTYKYR  218

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ S+NFR QGH M LVEMEGSHTIQN+YDSLD+HVGQC +VLVTADKEPKDYY+
Sbjct  219   ICNVGLKNSLNFRIQGHPMKLVEMEGSHTIQNSYDSLDVHVGQCFAVLVTADKEPKDYYM  278

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+R+ K   +T A+ISY NG G  +      P      G AW++NQFRSFRWNLTASA
Sbjct  279   VASTRYTKTVLTTTAVISYTNGKGPASPVLPEAPV-----GWAWTLNQFRSFRWNLTASA  333

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTIKLVNS S   GKLRYA+NG+SH N  TPLKLAEY+G+++K
Sbjct  334   ARPNPQGSYHYGQINITRTIKLVNSASREGGKLRYAINGISHANPATPLKLAEYYGVADK  393

Query  721   VFKYNIMGDTPPENA-EKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             +FKY+ M D  P  A +K+T+ PNV N T+R FVE++FENHEK+IQ++HLDG+SFFAVA+
Sbjct  394   IFKYDTMSDDAPATASDKITVEPNVANITYRTFVEVIFENHEKSIQSWHLDGYSFFAVAV  453

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRW+PEKRK+YNL+DAVSRH++QV+P SWAA+M T DNAGMWNLRS++ ER YLGQ+L
Sbjct  454   EPGRWTPEKRKSYNLLDAVSRHTVQVFPKSWAAIMLTFDNAGMWNLRSELAERRYLGQEL  513

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             Y SVLSPERSLRDE+N+PD   LCG+VK ++ PPPY+
Sbjct  514   YISVLSPERSLRDEYNIPDDALLCGIVKDLAKPPPYT  550



>ref|XP_010034522.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW52300.1| hypothetical protein EUGRSUZ_J01720 [Eucalyptus grandis]
Length=552

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/397 (68%), Positives = 321/397 (81%), Gaps = 6/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY+K HK LK  LDSGR++ARPDGVVINGK GK  G   P+FTM+ GKTY+YR
Sbjct  160   YTVLIGDWYSKTHKQLKTFLDSGRSLARPDGVVINGKSGKGPGGDKPVFTMKPGKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ S+NFR QGH M LVEMEGSH +QN Y+SLD+HVGQC SVLVTAD+EP+DYY+
Sbjct  220   ICNVGLKNSLNFRIQGHPMKLVEMEGSHVVQNVYESLDVHVGQCFSVLVTADQEPRDYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+  +   I+ Y NG G  ++           EG AWS+NQFRSFRWNLTASA
Sbjct  280   VASTRFTKEVITATRILRYTNGKGPASTVLPKA-----PEGWAWSLNQFRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTIKLVNS S   GKLRYA+NGVSH+N  TPLK AEYFG ++K
Sbjct  335   ARPNPQGSYHYGQINITRTIKLVNSASRAGGKLRYAINGVSHVNPTTPLKFAEYFGTADK  394

Query  721   VFKYNIMGDTPPENAEK-VTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+++ D+PPE   K VTL PNV N TFR FVEI+FENHEK+IQ++HLDG+SFFAVA+
Sbjct  395   VFKYDVIPDSPPEQEPKLVTLEPNVGNITFRTFVEIIFENHEKSIQSWHLDGYSFFAVAV  454

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRW+PEKRK+YNL+DAVSRH++QV+P SWAA+M T DNAGMWNLRS++ ER YLGQ++
Sbjct  455   EPGRWTPEKRKSYNLLDAVSRHTVQVFPKSWAAIMLTFDNAGMWNLRSELLERRYLGQEM  514

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             Y SVLSPERSLRDE+NLPD   LCG V G+ +P PY+
Sbjct  515   YISVLSPERSLRDEYNLPDNAPLCGSVVGLPLPAPYT  551



>ref|XP_009376274.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=552

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/398 (68%), Positives = 323/398 (81%), Gaps = 6/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  LKK+LDSGRT+ RPDG++INGK+ K  GK +PLFTM+ GKTY+YR
Sbjct  160   YTVMIGDWYTKSHTALKKLLDSGRTMGRPDGILINGKNAKGDGKDEPLFTMKPGKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             VCNVG++ S+NFR QGH + LVEMEGSHT+QN Y+SLD+HVGQC S+LVTADKE KDYY+
Sbjct  220   VCNVGLKNSLNFRIQGHPLKLVEMEGSHTVQNTYESLDVHVGQCFSLLVTADKERKDYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   +   II Y NGNG  +      P      G AWS+NQFRSFRWNLTASA
Sbjct  280   VASTRFTKTVLTGKGIIRYENGNGPASPELPEAPV-----GWAWSLNQFRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIK+VNS S V+GKLRYA+NGVSH+ ++TPLKLAEYFG+++K
Sbjct  335   ARPNPQGSYHYGKINITRTIKIVNSASRVNGKLRYAINGVSHVESETPLKLAEYFGVADK  394

Query  721   VFKYNIMGDTPPENAE-KVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D P    E KVTLAPNVVN TFR+FVEI+FENHEK+IQ++HLDG+SFFAVAI
Sbjct  395   VFKYDTIQDEPRATVEDKVTLAPNVVNQTFRDFVEIIFENHEKSIQSWHLDGYSFFAVAI  454

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRW+PEKRKNYNL+D VSRH+IQV+P SWAA+M T DNAGMWN+RS+  ER YLGQQ 
Sbjct  455   EPGRWTPEKRKNYNLLDGVSRHTIQVFPKSWAAIMLTFDNAGMWNVRSEQPERRYLGQQF  514

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1191
             Y SVLSP  SLRDE+NLP+  QLCG+VK +  PPPYS 
Sbjct  515   YVSVLSPAHSLRDEYNLPETTQLCGIVKDLPKPPPYSA  552



>ref|XP_010247847.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nelumbo nucifera]
Length=552

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/398 (67%), Positives = 329/398 (83%), Gaps = 7/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGG-KIDPLFTMEAGKTYRY  177
             + V I DWY+KGH +LKK+LD+GR++ +PDGV+INGK GKV G K +PLFTM+  K YRY
Sbjct  159   YTVLIGDWYSKGHSSLKKLLDTGRSLGKPDGVLINGKSGKVEGHKDEPLFTMKPHKXYRY  218

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             RVCNVG++ S+NFR QGH++ LVEMEGSHT+QN YDSLD+HVGQC SVLVTA++ PKDYY
Sbjct  219   RVCNVGLKXSLNFRIQGHSLKLVEMEGSHTVQNVYDSLDVHVGQCYSVLVTANQXPKDYY  278

Query  358   LVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTAS  537
             +V S+RF K   S   II Y NG G  +      P      G AWS+NQFRSFRWNLTAS
Sbjct  279   MVASTRFTKYMISATRIIRYTNGKGPASPVLPEAPV-----GWAWSLNQFRSFRWNLTAS  333

Query  538   AARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISE  717
             AARPNPQGSYHYG INITRTIKLVN+   VDGKLRYA+NG+SH++ DTPLKLAEYFG+++
Sbjct  334   AARPNPQGSYHYGAINITRTIKLVNTAGTVDGKLRYAINGMSHVDKDTPLKLAEYFGVAD  393

Query  718   KVFKYNIMGDTPP-ENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             KVFKY+ + D P  + +EK+ + PNV+NATFRNFVEI+ ENHEK+IQ++HLDG+SFFAV 
Sbjct  394   KVFKYDSIPDEPKGKGSEKIVMGPNVLNATFRNFVEIILENHEKSIQSWHLDGYSFFAVG  453

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             IE G+W+PE+RKNYNL+DAVSRH++QV+PNSWAA++ T DNAGMWNLRS++W+R YLGQQ
Sbjct  454   IEPGKWTPERRKNYNLLDAVSRHTVQVFPNSWAAILLTFDNAGMWNLRSEIWDRFYLGQQ  513

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             LY SVLSP RSLRDE+N+PD  +LCG+VKG+  PPPY+
Sbjct  514   LYVSVLSPARSLRDEYNIPDGTKLCGIVKGLPKPPPYT  551



>ref|XP_004164924.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/398 (69%), Positives = 325/398 (82%), Gaps = 7/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSG-RTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRY  177
             + V I DWY K H TLK+ILD+G R+IARP+GV+INGK  K  G  +PLFTM+  KTY+Y
Sbjct  160   YTVLIGDWYTKSHTTLKQILDNGHRSIARPEGVLINGKTAKGDGTDEPLFTMKPEKTYKY  219

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             RVCNVG++TS+NFRFQGHTM LVEMEGSHT+QN Y SLD+HVGQC SVLVTA++EPKDYY
Sbjct  220   RVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQNDYQSLDVHVGQCFSVLVTANQEPKDYY  279

Query  358   LVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTAS  537
             +V S+RF K       II Y NG G  +      P      G AWS+NQFR+FRWNLTAS
Sbjct  280   MVASTRFIKNVLIGKGIIRYTNGKGPASPEIPKAPM-----GWAWSLNQFRTFRWNLTAS  334

Query  538   AARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISE  717
             AARPNPQGSYHYG INITRTIKL NS + VDGKLRYA+NGVSH++ +TPLKLAEYF I+E
Sbjct  335   AARPNPQGSYHYGSINITRTIKLFNSATKVDGKLRYAINGVSHVDPETPLKLAEYFEIAE  394

Query  718   KVFKYNIMGDT-PPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             KVFKY+++ D  P E A  VT+APNVVNATFRNF+EI+FENHEK++Q++HLDG+SFFAVA
Sbjct  395   KVFKYDMISDEGPTEGATAVTIAPNVVNATFRNFIEIIFENHEKSLQSWHLDGYSFFAVA  454

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             IE GRWSPEKR NYNL+DAVSRH+IQV+PNSWAA++ T DNAGMWNLRS++ E  YLGQQ
Sbjct  455   IEPGRWSPEKRSNYNLLDAVSRHTIQVFPNSWAAILLTFDNAGMWNLRSELIENRYLGQQ  514

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             LY SVLSP RSLRDE+N+PD   LCGLVKGM +P PY+
Sbjct  515   LYISVLSPARSLRDEYNIPDHTLLCGLVKGMPLPKPYT  552



>ref|XP_010247848.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Nelumbo nucifera]
Length=551

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/398 (67%), Positives = 329/398 (83%), Gaps = 7/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGG-KIDPLFTMEAGKTYRY  177
             + V I DWY+KGH +LKK+LD+GR++ +PDGV+INGK GKV G K +PLFTM+  K YRY
Sbjct  158   YTVLIGDWYSKGHSSLKKLLDTGRSLGKPDGVLINGKSGKVEGHKDEPLFTMKPHKXYRY  217

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             RVCNVG++ S+NFR QGH++ LVEMEGSHT+QN YDSLD+HVGQC SVLVTA++ PKDYY
Sbjct  218   RVCNVGLKXSLNFRIQGHSLKLVEMEGSHTVQNVYDSLDVHVGQCYSVLVTANQXPKDYY  277

Query  358   LVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTAS  537
             +V S+RF K   S   II Y NG G  +      P      G AWS+NQFRSFRWNLTAS
Sbjct  278   MVASTRFTKYMISATRIIRYTNGKGPASPVLPEAPV-----GWAWSLNQFRSFRWNLTAS  332

Query  538   AARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISE  717
             AARPNPQGSYHYG INITRTIKLVN+   VDGKLRYA+NG+SH++ DTPLKLAEYFG+++
Sbjct  333   AARPNPQGSYHYGAINITRTIKLVNTAGTVDGKLRYAINGMSHVDKDTPLKLAEYFGVAD  392

Query  718   KVFKYNIMGDTPP-ENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             KVFKY+ + D P  + +EK+ + PNV+NATFRNFVEI+ ENHEK+IQ++HLDG+SFFAV 
Sbjct  393   KVFKYDSIPDEPKGKGSEKIVMGPNVLNATFRNFVEIILENHEKSIQSWHLDGYSFFAVG  452

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             IE G+W+PE+RKNYNL+DAVSRH++QV+PNSWAA++ T DNAGMWNLRS++W+R YLGQQ
Sbjct  453   IEPGKWTPERRKNYNLLDAVSRHTVQVFPNSWAAILLTFDNAGMWNLRSEIWDRFYLGQQ  512

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             LY SVLSP RSLRDE+N+PD  +LCG+VKG+  PPPY+
Sbjct  513   LYVSVLSPARSLRDEYNIPDGTKLCGIVKGLPKPPPYT  550



>ref|XP_010247849.1| PREDICTED: L-ascorbate oxidase homolog isoform X3 [Nelumbo nucifera]
Length=553

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/398 (67%), Positives = 329/398 (83%), Gaps = 7/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGG-KIDPLFTMEAGKTYRY  177
             + V I DWY+KGH +LKK+LD+GR++ +PDGV+INGK GKV G K +PLFTM+  K YRY
Sbjct  160   YTVLIGDWYSKGHSSLKKLLDTGRSLGKPDGVLINGKSGKVEGHKDEPLFTMKPHKXYRY  219

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             RVCNVG++ S+NFR QGH++ LVEMEGSHT+QN YDSLD+HVGQC SVLVTA++ PKDYY
Sbjct  220   RVCNVGLKXSLNFRIQGHSLKLVEMEGSHTVQNVYDSLDVHVGQCYSVLVTANQXPKDYY  279

Query  358   LVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTAS  537
             +V S+RF K   S   II Y NG G  +      P      G AWS+NQFRSFRWNLTAS
Sbjct  280   MVASTRFTKYMISATRIIRYTNGKGPASPVLPEAPV-----GWAWSLNQFRSFRWNLTAS  334

Query  538   AARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISE  717
             AARPNPQGSYHYG INITRTIKLVN+   VDGKLRYA+NG+SH++ DTPLKLAEYFG+++
Sbjct  335   AARPNPQGSYHYGAINITRTIKLVNTAGTVDGKLRYAINGMSHVDKDTPLKLAEYFGVAD  394

Query  718   KVFKYNIMGDTPP-ENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             KVFKY+ + D P  + +EK+ + PNV+NATFRNFVEI+ ENHEK+IQ++HLDG+SFFAV 
Sbjct  395   KVFKYDSIPDEPKGKGSEKIVMGPNVLNATFRNFVEIILENHEKSIQSWHLDGYSFFAVG  454

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             IE G+W+PE+RKNYNL+DAVSRH++QV+PNSWAA++ T DNAGMWNLRS++W+R YLGQQ
Sbjct  455   IEPGKWTPERRKNYNLLDAVSRHTVQVFPNSWAAILLTFDNAGMWNLRSEIWDRFYLGQQ  514

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             LY SVLSP RSLRDE+N+PD  +LCG+VKG+  PPPY+
Sbjct  515   LYVSVLSPARSLRDEYNIPDGTKLCGIVKGLPKPPPYT  552



>ref|XP_009773307.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=557

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/400 (68%), Positives = 329/400 (82%), Gaps = 8/400 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F V +SDWY K H  ++K+LDSGR + RP+GV+INGK GK   K +P+FTM  GKTYRYR
Sbjct  161   FFVLVSDWYTKSHSQMRKLLDSGRALGRPNGVIINGKSGKGDNKDEPMFTMTPGKTYRYR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
              CNVGM+ S+N R QGH M LVE+EGSHT+QN YDSLD+H+GQC+SVLVTADK+PKDY+L
Sbjct  221   FCNVGMKDSINVRIQGHVMKLVEIEGSHTVQNMYDSLDVHLGQCMSVLVTADKDPKDYFL  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+  +  A I YANG G  AS ELP  P     G AWS+NQFRSFRWNLTASA
Sbjct  281   VASTRFTKEPHTATATIRYANGKGAPASLELPKAPI----GWAWSLNQFRSFRWNLTASA  336

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQIN TRTIKLVN+   VDGKLRYA+NGVSH+N +TP+KLAEY+G++ K
Sbjct  337   ARPNPQGSYHYGQINFTRTIKLVNAAGSVDGKLRYAINGVSHVNPETPIKLAEYYGVANK  396

Query  721   VFKYNIMGD----TPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFA  888
             VFKY+++ D       +  EK+TLAPNVVN T+RNFVEI+FENHEK++Q++HL G+SFFA
Sbjct  397   VFKYDLIKDDYEAPTAKTEEKITLAPNVVNGTYRNFVEIIFENHEKSVQSFHLAGYSFFA  456

Query  889   VAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLG  1068
             VAIE G+W+PEKRKNYNL+DAVSR++IQVYPNSWAA+MTT+DNAG+WNLRS+  ER YLG
Sbjct  457   VAIEPGKWTPEKRKNYNLLDAVSRNTIQVYPNSWAAIMTTIDNAGLWNLRSNSLERQYLG  516

Query  1069  QQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             QQLYFSVLSP+R L+DE+N+PD   LCG++K M +P PYS
Sbjct  517   QQLYFSVLSPKRDLKDEYNMPDNDILCGIIKDMPLPKPYS  556



>ref|XP_010271079.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=552

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/398 (67%), Positives = 328/398 (82%), Gaps = 7/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKV-GGKIDPLFTMEAGKTYRY  177
             + V I DWY+KGH +LKK+LD+GR++ +PDGV+INGK GKV G K +PLFTM+  K YRY
Sbjct  159   YTVLIGDWYSKGHSSLKKLLDTGRSLGKPDGVLINGKSGKVEGDKDEPLFTMKPHKXYRY  218

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             RVCNVG++ S+NFR QGH++ LVEMEGSHT+QN YDSLD+HVGQC SVLVTA++ PKDYY
Sbjct  219   RVCNVGLKXSLNFRIQGHSLKLVEMEGSHTVQNVYDSLDVHVGQCYSVLVTANQTPKDYY  278

Query  358   LVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTAS  537
             +V S+RF K   S   II Y NG G  +      P      G AWS+NQFRSFRWNLTAS
Sbjct  279   MVASTRFTKYMISATRIIRYTNGKGPASPVLPEAPV-----GWAWSLNQFRSFRWNLTAS  333

Query  538   AARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISE  717
             AARPNPQGSYHYG INITRTIKLVN+   VDGKLRYA+NG+SH++ DTPLKLAEYFG+++
Sbjct  334   AARPNPQGSYHYGAINITRTIKLVNTAGTVDGKLRYAINGMSHVDKDTPLKLAEYFGVAD  393

Query  718   KVFKYNIMGDTPP-ENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             KVFKY+ + D P  + +EK+ + PNV+NATFRNFVEI+ ENHEK+IQ++HLDG+SFFAV 
Sbjct  394   KVFKYDSIPDEPKGKGSEKIVMGPNVLNATFRNFVEIILENHEKSIQSWHLDGYSFFAVG  453

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             IE G+W+PE+RKNYNL+DAVSRH++QV+P SWAA++ T DNAGMWNLRS++W+R YLGQQ
Sbjct  454   IEPGKWTPERRKNYNLLDAVSRHTVQVFPKSWAAILLTFDNAGMWNLRSEIWDRFYLGQQ  513

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             LY SVLSP RSLRDE+N+PD  +LCG+VKG+  PPPY+
Sbjct  514   LYVSVLSPARSLRDEYNIPDGTKLCGIVKGLPKPPPYT  551



>ref|XP_004164922.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/397 (69%), Positives = 320/397 (81%), Gaps = 6/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H TLK+ LDSGR+IARPDGV+INGK  K  G  +PLFTM+ GKTY+YR
Sbjct  161   YTVLIGDWYTKSHTTLKQFLDSGRSIARPDGVLINGKTSKDDGIDEPLFTMKPGKTYKYR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             VCNVG++TS+NFRFQGHTM LVEMEGSHT+QN Y SLD+HVGQC SVLVTAD+EPKDYY+
Sbjct  221   VCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQNDYKSLDVHVGQCFSVLVTADQEPKDYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K       I+ Y NG G  +      P      G AWS+NQFR+FRWNLTASA
Sbjct  281   VASTRFIKSALVGKGIVRYTNGKGPASPEIPNAPM-----GWAWSLNQFRTFRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG INITRTIKLVNS + VDGKLRYA+NGVSH++ +TPLKLAEYF I++K
Sbjct  336   ARPNPQGSYHYGSINITRTIKLVNSATKVDGKLRYAINGVSHVDPETPLKLAEYFEITDK  395

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D    E    VT+APNVVN TFRNF+EI+FENHEK++Q++HLDG+SFFAVAI
Sbjct  396   VFKYDTISDEGLAEGVTTVTVAPNVVNTTFRNFIEIIFENHEKSLQSWHLDGYSFFAVAI  455

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRWSPEKR NYNL+DAVSRH+IQV+P SWAA++ T DNAGMWNLRS++ E  YLGQQL
Sbjct  456   EPGRWSPEKRSNYNLLDAVSRHTIQVFPKSWAAILLTFDNAGMWNLRSELTENRYLGQQL  515

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             Y SV SP RSLRDE+N+PDK  LCGLVK + +P PY+
Sbjct  516   YMSVQSPARSLRDEYNIPDKTLLCGLVKDLPLPKPYT  552



>ref|XP_009626538.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=557

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/400 (68%), Positives = 328/400 (82%), Gaps = 8/400 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F V +SDWY K H  L+K+LDSGR+  RP+GV+INGK GK   K +P+FTM  GKTYRYR
Sbjct  161   FFVLVSDWYTKSHSQLRKLLDSGRSAGRPNGVIINGKSGKGDNKDEPMFTMTPGKTYRYR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
              CNVGM+ S+N R QGH M LVE+EGSHT+QN YDSLD+H+GQC+SVLVTADK+PKDY+L
Sbjct  221   FCNVGMKDSINVRIQGHIMKLVEIEGSHTVQNMYDSLDVHLGQCMSVLVTADKDPKDYFL  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+  +  A I Y NG G  AS ELP  P     G AWS+NQFRSFRWNLTASA
Sbjct  281   VASTRFTKEPHTATATIRYGNGKGAPASLELPKAPI----GWAWSLNQFRSFRWNLTASA  336

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTIKLVN+   VDGKLRYA+NGVSH+N +TP+KLAEY+ +++K
Sbjct  337   ARPNPQGSYHYGQINITRTIKLVNTAGSVDGKLRYAINGVSHVNPETPIKLAEYYSVADK  396

Query  721   VFKYNIMGD----TPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFA  888
             VFKY+I+ D       +  EK+TLAPNVVN T+RNFVEI+FENHEK++Q++HL G+SFFA
Sbjct  397   VFKYDIIKDDYEAPTAKTEEKITLAPNVVNGTYRNFVEIIFENHEKSVQSFHLAGYSFFA  456

Query  889   VAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLG  1068
             VAIE G+W+ EKRKNYNL+DAVSR++IQVYPNSWAA+MTT+DNAG+WNLRS+  ER YLG
Sbjct  457   VAIEPGKWTAEKRKNYNLLDAVSRNTIQVYPNSWAAIMTTIDNAGLWNLRSNSLERQYLG  516

Query  1069  QQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             QQLYFSVLSP+R L+DE+N+PD   LCG++K M +P PYS
Sbjct  517   QQLYFSVLSPKRDLKDEYNMPDNDILCGIIKDMPLPKPYS  556



>gb|KFK38673.1| hypothetical protein AALP_AA3G145200 [Arabis alpina]
Length=551

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/394 (66%), Positives = 326/394 (83%), Gaps = 5/394 (1%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             + I+DWY K H  LK  LDSGRT+  PDGV+INGK GKVGGK +PLFT++ GKTY++R+C
Sbjct  162   ILINDWYTKSHTALKNFLDSGRTLGLPDGVLINGKSGKVGGKNEPLFTLKPGKTYKFRIC  221

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             NVG ++++NFR QGH M LVEMEGSH +QN YDSLD+HVGQC +VLVTAD+  K+YY+V 
Sbjct  222   NVGFKSTLNFRVQGHKMKLVEMEGSHVLQNDYDSLDIHVGQCFAVLVTADQTAKNYYMVA  281

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+RF K+E ST+ ++SYA G+ + AS  +P  P     G AWS+NQFRSFRWNLTASAAR
Sbjct  282   STRFLKKEVSTIGVMSYA-GSKVEASAVIPKAPV----GWAWSLNQFRSFRWNLTASAAR  336

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYG+INITRTIKL N+K+ VDGK+R+  NGVSH++T+TPLKLAEYFG++EK+F
Sbjct  337   PNPQGSYHYGKINITRTIKLANTKNMVDGKIRFGFNGVSHVDTETPLKLAEYFGMAEKIF  396

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
             KYN++ D P      +T+ PNV+N TFR FVEI+FENHEK++ ++HLDGHSFFAVA E G
Sbjct  397   KYNVIKDEPAAKITTLTVEPNVLNVTFRTFVEIIFENHEKSMASFHLDGHSFFAVASEPG  456

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
             RW+PEKRKNYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+ WER YLGQQLY S
Sbjct  457   RWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSENWERRYLGQQLYVS  516

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             VLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  517   VLSPEKSLRDEYNIPLNTNLCGIVKGLPLPTPYT  550



>ref|XP_007014658.1| SKU5 similar 13 [Theobroma cacao]
 gb|EOY32277.1| SKU5 similar 13 [Theobroma cacao]
Length=553

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/396 (67%), Positives = 318/396 (80%), Gaps = 4/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  LKK LDSGR++ RPDGV+INGK  K  GK  PLFTM+ GKTY+YR
Sbjct  161   YTVLIGDWYTKSHTMLKKFLDSGRSLGRPDGVLINGKVAKGNGKDKPLFTMKPGKTYKYR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ S+NFR QGH M LVEMEGSHT+QN Y+SLD+HVGQC +VLVTAD+ PKDY++
Sbjct  221   ICNVGLKNSLNFRIQGHRMKLVEMEGSHTVQNVYESLDVHVGQCFAVLVTADQGPKDYFM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   +   II Y NG G  ASP+LP  P     G AWS+NQFR+FRWNLTASA
Sbjct  281   VASTRFTKNVLTATGIIRYTNGKGAAASPKLPPAPV----GWAWSLNQFRTFRWNLTASA  336

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG INITRTIKLVN+ S   GKLRY +NGVSHIN  TPLKLAEY+ ++ K
Sbjct  337   ARPNPQGSYHYGAINITRTIKLVNTASRAGGKLRYGINGVSHINPPTPLKLAEYYNVANK  396

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKY+++GD PP     VT+ PNV+N TFRNFVEI+ ENHEK+IQ+YHLDG+SFFAVAIE
Sbjct  397   VFKYDVIGDEPPAKITGVTVQPNVLNMTFRNFVEIILENHEKSIQSYHLDGYSFFAVAIE  456

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              GRW+PEKR+NYNL+DAVSRH+IQV+P SWAA++ T DNAGMWN+RS++WER YLGQQLY
Sbjct  457   PGRWTPEKRRNYNLLDAVSRHTIQVFPKSWAAILLTFDNAGMWNIRSEIWERTYLGQQLY  516

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SV SP RSLRDE+N+PD   LCG+V  +  PPPY+
Sbjct  517   ASVASPVRSLRDEYNIPDNAPLCGVVTNLPKPPPYT  552



>ref|XP_004149637.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/397 (68%), Positives = 322/397 (81%), Gaps = 6/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  LK++LDSGR+IARPDGV+INGK  K  G  +PLFTM+ GKTY+YR
Sbjct  161   YTVLIGDWYTKSHTALKQLLDSGRSIARPDGVLINGKSAKGDGTDEPLFTMKPGKTYKYR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             VCNVG+++S+NFRFQGHTM LVEMEGSHT+QN Y+SLD+HVGQC SVLVTA++EPKDYY+
Sbjct  221   VCNVGLKSSLNFRFQGHTMKLVEMEGSHTVQNDYESLDVHVGQCFSVLVTANQEPKDYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K       I+ Y +G G  +      P      G AWS+NQFR+FRWNLTASA
Sbjct  281   VASTRFIKNVLVGKGIVRYIDGKGPASPEIPEAPM-----GWAWSLNQFRTFRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG INITRTIKLVNS S VDGKLRYA+NGVSH++ +TPLKLAEYF +++K
Sbjct  336   ARPNPQGSYHYGSINITRTIKLVNSISKVDGKLRYAINGVSHVDPETPLKLAEYFEVADK  395

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D    E A  VT+APNVVNATFRNF+EI+FENHEK++Q++HLDG+SFFAVAI
Sbjct  396   VFKYDTISDEGLAEGATTVTVAPNVVNATFRNFIEIIFENHEKSLQSWHLDGYSFFAVAI  455

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRWSPEKR NYNL+DAVSRH+IQV+P SWAA++ T DNAGMWNLRS++ E  YLG QL
Sbjct  456   EPGRWSPEKRANYNLLDAVSRHTIQVFPKSWAAILLTFDNAGMWNLRSELLENRYLGSQL  515

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             Y SVLSP RSLRDE+N+PD   LCGLVK M +P PY+
Sbjct  516   YVSVLSPARSLRDEYNIPDNTLLCGLVKDMPLPKPYT  552



>ref|XP_008219681.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=554

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/398 (67%), Positives = 321/398 (81%), Gaps = 6/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  LKK LDSGR++ RPDGV+INGK  K  GK +PLFTM+ GKTY+YR
Sbjct  160   YTVLIGDWYAKSHTALKKHLDSGRSMGRPDGVIINGKSAKGDGKDEPLFTMKPGKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ S+NFR QGH M LVEMEGSHT+QN Y+SLD+H+GQC SVLVTADK+P DYY+
Sbjct  220   ICNVGLKNSLNFRIQGHPMKLVEMEGSHTMQNTYESLDVHLGQCFSVLVTADKDPMDYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+  +   I+ Y NGNG  +      P      G AWS+NQFRSFRWNLTASA
Sbjct  280   VASTRFTKKVLTGKGIMRYENGNGPASPELPEAPV-----GWAWSLNQFRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRT+K+VNS + VDGKLRYA+NGVSH++ +TPLKLAEY+G+++K
Sbjct  335   ARPNPQGSYHYGKINITRTMKIVNSATKVDGKLRYAINGVSHVDPETPLKLAEYYGVADK  394

Query  721   VFKYNIMGDTPPENAE-KVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D PP   E KVTLAPNVVN TFRNFVEI+FENHEK+IQ+++LDG+SFF VAI
Sbjct  395   VFKYDTIQDEPPATVEDKVTLAPNVVNQTFRNFVEIIFENHEKSIQSWNLDGYSFFTVAI  454

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRW+PEKR NYNL+D VSRH+IQV+P SWAA+M T DNAGMWN+RS+  ER YLGQQ 
Sbjct  455   EPGRWTPEKRNNYNLLDGVSRHTIQVFPKSWAAIMLTFDNAGMWNVRSEQSERRYLGQQF  514

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1191
             Y SVLSP RSLRDE+NLPD   +CG+VK +  PPPYS 
Sbjct  515   YVSVLSPARSLRDEYNLPDNTLVCGVVKDLPKPPPYSA  552



>ref|XP_008374029.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=552

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/396 (68%), Positives = 320/396 (81%), Gaps = 6/396 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  LKK+LDSGRT+ RPD ++INGK+ K  GK +PLFTM+ GKTY+YR
Sbjct  160   YTVMIGDWYTKSHTALKKLLDSGRTMGRPDXILINGKNAKGDGKDEPLFTMKPGKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             VCNVG + S+NFR QGH + LVEMEGSHT+QN Y+SLD+H+GQC S+LVTADKE KDYY+
Sbjct  220   VCNVGFKNSLNFRIQGHPLKLVEMEGSHTVQNTYESLDVHLGQCFSLLVTADKERKDYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   +   II Y N NG  +      P      G AWS+NQFRSFRWNLTASA
Sbjct  280   VASTRFTKTVLTGKGIIRYENXNGPASPELPEAPV-----GWAWSLNQFRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIK+VNS S V+GKLRYA+NGVS++ ++TPLKLA+YFG+++K
Sbjct  335   ARPNPQGSYHYGKINITRTIKIVNSASXVNGKLRYAINGVSYVESETPLKLAQYFGVADK  394

Query  721   VFKYNIMGDTPPENAE-KVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D PP   E KVTLAPNVVN TFR FVEI+FENHEK+IQ++HLDG+SFFAVAI
Sbjct  395   VFKYDTIQDEPPATVEDKVTLAPNVVNQTFRXFVEIIFENHEKSIQSWHLDGYSFFAVAI  454

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRW+PEKRKNYNL+D VSRH+IQV+P SWAA+M T DNAGMWN+RS+  ER YLGQQ 
Sbjct  455   EPGRWTPEKRKNYNLLDGVSRHTIQVFPKSWAAIMLTFDNAGMWNVRSEQPERRYLGQQF  514

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             Y SVLSP RSLRDE+NLP+  QLCG+VK +  PPPY
Sbjct  515   YVSVLSPARSLRDEYNLPETTQLCGIVKDLPKPPPY  550



>ref|XP_009135303.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=551

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/396 (67%), Positives = 326/396 (82%), Gaps = 5/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I+DWY K H  LK  LDSGRT+  PDGV+INGK GKVGG+  PLFTM+ GKTY+YR
Sbjct  160   YTVLINDWYTKSHTALKNFLDSGRTLGSPDGVLINGKSGKVGGQDKPLFTMKPGKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG ++++NFR QGH M LVEMEGSH +QN YDSLD+HVGQC +VLVTAD+  K+YY+
Sbjct  220   ICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQAAKNYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+E STV ++SY  G+ +  S ELP  P     G AWS+NQ+RSFRWNLTASA
Sbjct  280   VASTRFLKKEVSTVGVMSY-EGSTVQPSSELPKAPV----GWAWSLNQYRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKL N+KS V+GK+R+  NGVSH++T+TPLKLAEYF +SEK
Sbjct  335   ARPNPQGSYHYGKINITRTIKLANTKSVVNGKVRFGFNGVSHVDTETPLKLAEYFEMSEK  394

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKYN++ D P      +T+ PNV+N TFR FVEIVFENHEK++Q++HLDG+SFFAVA E
Sbjct  395   VFKYNVIKDEPAAKVTTLTVEPNVLNITFRTFVEIVFENHEKSMQSFHLDGYSFFAVASE  454

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              GRW+PEKRKNYNL+DAVSRH++QVYPNSW+A++ T DNAGMWN+RS+ WER YLGQQLY
Sbjct  455   PGRWTPEKRKNYNLLDAVSRHTVQVYPNSWSAILLTFDNAGMWNIRSENWERRYLGQQLY  514

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SVLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  515   VSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPTPYT  550



>ref|XP_004149634.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/397 (68%), Positives = 320/397 (81%), Gaps = 6/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H TLK+ LDSGR+IARPDGV+INGK  K  G  +PLFTM+ GKTY+YR
Sbjct  161   YTVLIGDWYTKSHTTLKQFLDSGRSIARPDGVLINGKTSKDDGIDEPLFTMKPGKTYKYR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             VCNVG+++S+NFRFQGHTM LVEMEGSHT+QN Y SLD+HVGQC SVLVTA++EPKDYY+
Sbjct  221   VCNVGLKSSLNFRFQGHTMKLVEMEGSHTVQNDYKSLDVHVGQCFSVLVTANQEPKDYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K       I+ Y NG G  +      P      G AWS+NQFR+FRWNLTASA
Sbjct  281   VASTRFIKSALVGKGIVRYTNGKGPASPEIPNAPM-----GWAWSLNQFRTFRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG INITRTIKLVNS + VDGKLRYA+NGVSH++ +TPLKLAEYF I++K
Sbjct  336   ARPNPQGSYHYGSINITRTIKLVNSATKVDGKLRYAINGVSHVDPETPLKLAEYFEITDK  395

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D    E    VT+APNVVN TFRNF+EI+FENHEK++Q++HLDG+SFFAVAI
Sbjct  396   VFKYDTISDEGLAEGVTTVTVAPNVVNTTFRNFIEIIFENHEKSLQSWHLDGYSFFAVAI  455

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRWSPEKR NYNL+DAVSRH+IQV+P SWAA++ T DNAGMWNLRS++ E  YLGQQL
Sbjct  456   EPGRWSPEKRSNYNLLDAVSRHTIQVFPKSWAAILLTFDNAGMWNLRSELTENRYLGQQL  515

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             Y SV SP RSLRDE+N+PDK  LCGLVK + +P PY+
Sbjct  516   YMSVQSPARSLRDEYNIPDKTLLCGLVKDLPLPKPYT  552



>ref|XP_008438536.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=553

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/397 (68%), Positives = 319/397 (80%), Gaps = 6/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H TLKK LDSGR+IARPDGV+INGK  K  G  +PLFTM  GKTY+YR
Sbjct  161   YTVLIGDWYTKSHSTLKKFLDSGRSIARPDGVLINGKIAKGDGTDEPLFTMNPGKTYKYR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ S+NFR QGHTM LVEMEGSHT+QN Y SLD+HVGQC SVLVTAD++P+DYY+
Sbjct  221   ICNVGLKISLNFRIQGHTMKLVEMEGSHTVQNVYQSLDVHVGQCFSVLVTADQDPRDYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V SSRF K       I+ Y NG    +             G AWS+NQFR+FRWNLTA+A
Sbjct  281   VASSRFTKNILVGKGIVRYTNGKAPASPEIPEA-----PRGWAWSLNQFRTFRWNLTANA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG INITRTIK+VNS + +DGKLRYA+NGVSHI+ +TPLKLAEYF +++K
Sbjct  336   ARPNPQGSYHYGSINITRTIKIVNSATNIDGKLRYAINGVSHIDPETPLKLAEYFEVADK  395

Query  721   VFKYNIMGDT-PPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D    + A  VT+APNVVNATFRNFVEI+FENHEK++Q++HLDG+SFFAVAI
Sbjct  396   VFKYDTISDEGSAKTANTVTIAPNVVNATFRNFVEIIFENHEKSLQSWHLDGYSFFAVAI  455

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRWSPEKRKNYNL+DAVSRH+IQV+P SW A++ T+DNAGMWNLRS++ E  YLGQQL
Sbjct  456   EPGRWSPEKRKNYNLLDAVSRHTIQVFPKSWGAILLTLDNAGMWNLRSELTENRYLGQQL  515

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             YFSV SP RSLRDE+N+PD   LCGLVK MS+P PY+
Sbjct  516   YFSVQSPARSLRDEYNIPDNALLCGLVKDMSLPQPYT  552



>ref|XP_002303974.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE78953.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=553

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/398 (66%), Positives = 323/398 (81%), Gaps = 7/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V ++DWY+K H  L+K+LDSGRT+ARPDGV++NGK+ K  GK +PLFTM+ GKTY+YR
Sbjct  160   YTVILNDWYSKSHTALQKLLDSGRTLARPDGVLVNGKNAKGDGKDEPLFTMKPGKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CN G++ ++NFR QGHTM LVEMEGSH +QN Y+SLD+HVGQC SVLVTA+++PKDYY+
Sbjct  220   ICNAGLKNTLNFRIQGHTMKLVEMEGSHVVQNVYESLDVHVGQCFSVLVTANQDPKDYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF KQ  +   II Y NG G  +      P      G AWS+NQFRSFRWNLTASA
Sbjct  280   VASTRFNKQVLTGKGIIRYTNGKGPASPELPEAPV-----GWAWSLNQFRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG INITRTIKL+NS S   GKLRYALNGVSH+N +TPLKLAEY+G+++K
Sbjct  335   ARPNPQGSYHYGSINITRTIKLINSASQEGGKLRYALNGVSHVNPETPLKLAEYYGVADK  394

Query  721   VFKYNIMGDTPPENAE--KVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             VFKY+ + D+P  N    K+   PNV+N TFRNFVEI+FENHEK++Q+YHLDG+SFFAVA
Sbjct  395   VFKYDTILDSPQANVANAKIVTQPNVLNLTFRNFVEIIFENHEKSMQSYHLDGYSFFAVA  454

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             +E G W+PEKRK+YNL+DAVSR ++QVYP SWAA++ T DNAG+WN+RS+MWERAYLGQQ
Sbjct  455   VEPGTWTPEKRKHYNLLDAVSRTTVQVYPKSWAAILLTFDNAGLWNIRSEMWERAYLGQQ  514

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             LY SVLSP RSLRDE+NLPD   LCG+VK M  P PYS
Sbjct  515   LYASVLSPARSLRDEYNLPDNSLLCGIVKDMPKPAPYS  552



>emb|CDX82540.1| BnaA03g32810D [Brassica napus]
Length=551

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/396 (67%), Positives = 326/396 (82%), Gaps = 5/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I+DWY K H  LK  LDSGRT+  PDGV+INGK GKVGG+  PLFTM+ GKTY+YR
Sbjct  160   YTVLINDWYTKSHTALKNFLDSGRTLGSPDGVLINGKSGKVGGQDKPLFTMKPGKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG ++++NFR QGH M LVEMEGSH +QN YDSLD+HVGQC +VLVTAD+  K+YY+
Sbjct  220   ICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQAAKNYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+E STV ++SY  G+ +  S ELP  P     G AWS+NQ+RSFRWNLTASA
Sbjct  280   VASTRFLKKEVSTVGVMSY-EGSTVQPSSELPKAPV----GWAWSLNQYRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKL N+KS V+GK+R+  NGVSH++T+TPLKLAEYF +SEK
Sbjct  335   ARPNPQGSYHYGKINITRTIKLANTKSVVNGKVRFGFNGVSHVDTETPLKLAEYFEMSEK  394

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKYN++ D P   A  +T+ PNV+N TFR FVEIVFENHEK++Q++HLDG+SFFAVA E
Sbjct  395   VFKYNVIKDEPAAKATTLTVEPNVLNITFRTFVEIVFENHEKSMQSFHLDGYSFFAVASE  454

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              GRW+PEKRKNYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+ WER YLGQQLY
Sbjct  455   PGRWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSENWERRYLGQQLY  514

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SVLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  515   VSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPTPYT  550



>ref|XP_004137383.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/397 (68%), Positives = 320/397 (81%), Gaps = 6/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H TLKK LDSGR+IARPDGV+ING+  K  G  +PLFTM+  KTY+YR
Sbjct  161   YTVLIGDWYTKSHSTLKKFLDSGRSIARPDGVLINGRIAKGDGTDEPLFTMKPEKTYKYR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++TS+NFR QGHTM LVEMEGSHT+QN Y SLD+HVGQC SVLVTADK+PKDYY+
Sbjct  221   ICNVGLKTSLNFRIQGHTMKLVEMEGSHTVQNVYQSLDVHVGQCFSVLVTADKDPKDYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K       II Y NG    +             G AWS+NQFR+FRWNLTASA
Sbjct  281   VASTRFTKNILVGKGIIRYTNGKAPASPEIPEA-----PRGWAWSLNQFRTFRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG INITRTIK+VNS + VDGKLRYA+NGVSH++ +TPLKLAEYF +++K
Sbjct  336   ARPNPQGSYHYGSINITRTIKIVNSATNVDGKLRYAINGVSHVDPETPLKLAEYFEVADK  395

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D    + A  VT+APNV+NATFRNFVEIVFEN EK++Q++HLDG+SFFAVA+
Sbjct  396   VFKYDTISDEGLSKTANIVTVAPNVLNATFRNFVEIVFENQEKSLQSWHLDGYSFFAVAV  455

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRWSPEKRKNYNL+DAVSRH+IQV+P SWAA++ T+DNAGMWNLRS++ E  YLGQQ+
Sbjct  456   EPGRWSPEKRKNYNLLDAVSRHTIQVFPKSWAAILLTLDNAGMWNLRSELTENRYLGQQM  515

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             YFSV SP RSLRDE+N+PD   LCGLVK M +PPPY+
Sbjct  516   YFSVQSPARSLRDEYNIPDNTLLCGLVKDMPLPPPYT  552



>ref|XP_004164925.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/397 (68%), Positives = 320/397 (81%), Gaps = 6/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  LK+ LDSGR+IARPDGV+INGK  K  G  +PLFTM+ GKTY+YR
Sbjct  161   YTVLIGDWYTKSHTALKQFLDSGRSIARPDGVLINGKTAKGDGTDEPLFTMKPGKTYKYR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             VCNVG+++S+NFRFQGHTM LVEMEGSHT+QN Y SLD+HVGQC SVLVTA++EPKDYY+
Sbjct  221   VCNVGLKSSLNFRFQGHTMKLVEMEGSHTVQNDYQSLDVHVGQCFSVLVTANQEPKDYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K       I+ Y +G G  +      P      G AWS+NQFR+FRWNLTASA
Sbjct  281   VASTRFIKNVLVGKGIVRYIDGKGPASPEIPEAPM-----GWAWSLNQFRTFRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG INITRTIKLVNS S VDGKLRYA+NGVSH++ +TPLKLAEYF +++K
Sbjct  336   ARPNPQGSYHYGSINITRTIKLVNSISKVDGKLRYAINGVSHVDPETPLKLAEYFEVADK  395

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D    E A  VT+APNVVNATFRNF+EI+FENHEK++Q++HLDG+SFFAVAI
Sbjct  396   VFKYDTISDEGLAEGATTVTVAPNVVNATFRNFIEIIFENHEKSLQSWHLDGYSFFAVAI  455

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRWSPEKR NYNL+DAVSRH+IQV+P SWAA++ T DNAGMWNLRS++ E  YLG QL
Sbjct  456   EPGRWSPEKRANYNLLDAVSRHTIQVFPKSWAAILLTFDNAGMWNLRSELLENRYLGSQL  515

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             Y SVLSP RSLRDE+N+PD   LCGLVK M +P PY+
Sbjct  516   YVSVLSPARSLRDEYNIPDNTLLCGLVKDMPLPKPYT  552



>ref|XP_010044914.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW87034.1| hypothetical protein EUGRSUZ_B03581 [Eucalyptus grandis]
Length=552

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/398 (67%), Positives = 321/398 (81%), Gaps = 6/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGK-IDPLFTMEAGKTYRY  177
             + V I DWY+K H  L++ LD+GR +ARPDGV+ING+ GK  GK + PLFTM+ GKTY+Y
Sbjct  158   YTVLIGDWYSKSHTVLRQKLDAGRPLARPDGVLINGQTGKGKGKDVKPLFTMKPGKTYKY  217

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             R+CNVG++ S+NFR QGH M LVEMEGSHT+QN YDSLD+HVGQC SVL+TADK+P+DYY
Sbjct  218   RICNVGLKNSLNFRIQGHQMKLVEMEGSHTVQNTYDSLDVHVGQCFSVLITADKDPRDYY  277

Query  358   LVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTAS  537
             +V S+RF K   +   II Y NGNG  AS  LP       EG AWS+NQFRSFRWNLTAS
Sbjct  278   MVASTRFTKSVLTATGIIRYTNGNGAPASSILPKA----PEGWAWSLNQFRSFRWNLTAS  333

Query  538   AARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISE  717
             AARPNPQGSYHYGQINITRTIKLV+S S   GKLRY +NGVSH+N  TPLKLAEY+G+++
Sbjct  334   AARPNPQGSYHYGQINITRTIKLVSSASSAGGKLRYGINGVSHVNPPTPLKLAEYYGVAD  393

Query  718   KVFKYNIMGDTPP-ENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             KVFKY+ + D P  E A  VT APNV+N TFR FVEI+ ENHEK++Q++HLDG+SFF VA
Sbjct  394   KVFKYDTIPDEPLLEKATPVTPAPNVMNITFRTFVEIILENHEKSVQSWHLDGYSFFGVA  453

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             IE GRW+PEKRK+YNL+DAVSRH+IQV+P SWAA+M T DNAGMWNLRS++ ER YLGQ+
Sbjct  454   IEPGRWTPEKRKSYNLLDAVSRHTIQVFPKSWAAIMLTFDNAGMWNLRSELAERRYLGQE  513

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             LY SVLSPERSLRDE+N+PD  +LCG V  +  P PYS
Sbjct  514   LYISVLSPERSLRDEYNMPDDAELCGAVTSLPKPTPYS  551



>ref|XP_004165665.1| PREDICTED: LOW QUALITY PROTEIN: L-ascorbate oxidase homolog [Cucumis 
sativus]
Length=553

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/397 (67%), Positives = 319/397 (80%), Gaps = 6/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H TLKK LDSGR+IARPDGV+ING+  K  G  +PLFTM+  KTY+YR
Sbjct  161   YTVLIGDWYTKSHSTLKKFLDSGRSIARPDGVLINGRIAKGDGTDEPLFTMKPEKTYKYR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++TS+NFR QGHTM LVEMEGSHT+QN Y SLD+HVGQC SVLVTADK+PKDYY+
Sbjct  221   ICNVGLKTSLNFRIQGHTMKLVEMEGSHTVQNVYQSLDVHVGQCFSVLVTADKDPKDYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K       II Y NG    +             G AWS+NQFR+FRWNLTASA
Sbjct  281   VASTRFTKNILVGKGIIRYTNGKAPASPEIPEA-----PRGWAWSLNQFRTFRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG INITRTIK+VNS + VDGKLRYA+NGVSH++ +TPLKLAEYF +++K
Sbjct  336   ARPNPQGSYHYGSINITRTIKIVNSATNVDGKLRYAINGVSHVDPETPLKLAEYFEVADK  395

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D    + A  VT+APNV+NATFRNFVEIVFEN EK++Q++HLDG+SFFAVA+
Sbjct  396   VFKYDTISDEGLSKTANIVTVAPNVLNATFRNFVEIVFENQEKSLQSWHLDGYSFFAVAV  455

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRWSPEKRKNYNL+DAVSRH+IQ +P SWAA++ T+DNAGMWNLRS++ E  YLGQQ+
Sbjct  456   EPGRWSPEKRKNYNLLDAVSRHTIQXFPKSWAAILLTLDNAGMWNLRSELTENRYLGQQM  515

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             YFSV SP RSLRDE+N+PD   LCGLVK M +PPPY+
Sbjct  516   YFSVQSPARSLRDEYNIPDNTLLCGLVKDMPLPPPYT  552



>emb|CDX75708.1| BnaC03g37910D [Brassica napus]
Length=551

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/396 (66%), Positives = 321/396 (81%), Gaps = 5/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I+DWY K H  LK  LDSGRT+  PDGV+INGK GKVGG+  PLFTM+ GKTY+YR
Sbjct  160   YTVLINDWYTKSHTALKNFLDSGRTLGSPDGVLINGKSGKVGGQDKPLFTMKPGKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG ++++NFR QGH M LVEMEGSH +QN YDSLD+HVGQC +VLVTAD+  K+YY+
Sbjct  220   ICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQAAKNYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+E STV ++SY   N   +S     P      G AWS+NQ+RSFRWNLTASA
Sbjct  280   VASTRFLKKEVSTVGVMSYEGSNVQPSSELPKAPV-----GWAWSLNQYRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKL N+KS V+GK+R+  NGVSH++T+TPLKLAEYF +SEK
Sbjct  335   ARPNPQGSYHYGKINITRTIKLANTKSVVNGKVRFGFNGVSHVDTETPLKLAEYFEMSEK  394

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKYN++ D P      +T+ PNV+N TFR FVEIVFENHEK++Q++HLDG+SFFAVA E
Sbjct  395   VFKYNVIEDEPAAKVTTLTVEPNVLNITFRTFVEIVFENHEKSMQSFHLDGYSFFAVASE  454

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G+W+PEKRKNYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+ WER YLGQQLY
Sbjct  455   PGKWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSENWERRYLGQQLY  514

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SVLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  515   VSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPTPYT  550



>gb|KDP30647.1| hypothetical protein JCGZ_16212 [Jatropha curcas]
Length=551

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/395 (66%), Positives = 312/395 (79%), Gaps = 5/395 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I+DWY K HK L+  LD GR + RPDGV+INGK+ K  GK +PLF M+  K Y+YR
Sbjct  160   YTVIINDWYTKDHKALRSFLDEGRVLGRPDGVLINGKNAKGDGKDEPLFEMKPEKVYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CN G++ S+NFR QGHTM LVEMEGSHT+QN Y+SLD+HVGQC SVLVTADKEPKDYY+
Sbjct  220   ICNAGLKASLNFRIQGHTMMLVEMEGSHTVQNVYESLDVHVGQCFSVLVTADKEPKDYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   +   II Y NG G  +      P      G AWS+NQFRSFRWNLTASA
Sbjct  280   VASTRFLKTVLTAKGIIRYTNGKGPASPELPEAPV-----GWAWSLNQFRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGS+HYG INITRTIK ++  +   GKLRYA+NGVSH N +TPLKLAEYFGI++K
Sbjct  335   ARPNPQGSFHYGSINITRTIKFISQATKAGGKLRYAVNGVSHTNPETPLKLAEYFGIADK  394

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKY+ + D PP   E+ TLAPNV+N TFR+FVEI+FEN EKTIQ++HLDG+SFFAVA+E
Sbjct  395   VFKYDTIKDDPPAKVEEATLAPNVMNMTFRDFVEIIFENPEKTIQSWHLDGYSFFAVAVE  454

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G W+PEKR NYNL+DAVSRH++QVYP SWAA++ T DNAGMWN+RS++WE+ YLGQQLY
Sbjct  455   PGTWTPEKRNNYNLLDAVSRHTVQVYPKSWAAILLTFDNAGMWNIRSEIWEKTYLGQQLY  514

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
              SVLSP RSLRDE+N+PD   LCGLVK +  PPPY
Sbjct  515   ASVLSPARSLRDEYNIPDNALLCGLVKDLPKPPPY  549



>ref|XP_002882820.1| hypothetical protein ARALYDRAFT_478721 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59079.1| hypothetical protein ARALYDRAFT_478721 [Arabidopsis lyrata subsp. 
lyrata]
Length=551

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/394 (66%), Positives = 325/394 (82%), Gaps = 5/394 (1%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             + I+DWY K H  LK  LDSGRT+  PDGV+INGK GK+GG   PLFTM+ GKTY+YR+C
Sbjct  162   ILINDWYTKSHTALKNFLDSGRTLGSPDGVLINGKSGKIGGNNAPLFTMKPGKTYKYRIC  221

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             NVG ++++NFR QGH M LVEMEGSH +QN YDSLD+HVGQC +VLVTAD+  K+YY+V 
Sbjct  222   NVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQVAKNYYMVA  281

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+RF K+E STV ++SY  G+ + AS E+P  P     G AWS+NQFRSFRWNLTASAAR
Sbjct  282   STRFLKKEVSTVGVMSY-EGSNVQASNEIPKAPV----GWAWSLNQFRSFRWNLTASAAR  336

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYG+INITRTIKL N+K+ V+GK+R+  NGVSH++T+TPLKLAEYFG+SEKVF
Sbjct  337   PNPQGSYHYGKINITRTIKLANTKNLVNGKVRFGFNGVSHVDTETPLKLAEYFGMSEKVF  396

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
             KYN++ D P      +T+ PNV+N TFR FVE++FENHEK++Q++HLDG+SFFAVA E G
Sbjct  397   KYNVIKDEPAAKITTLTVEPNVLNITFRTFVEVIFENHEKSMQSFHLDGYSFFAVASEPG  456

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
             RW+PEKRKNYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+ WER YLGQQLY S
Sbjct  457   RWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSENWERRYLGQQLYVS  516

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             VLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  517   VLSPEKSLRDEYNIPLNTNLCGIVKGLPLPTPYT  550



>ref|XP_006303856.1| hypothetical protein CARUB_v10012595mg [Capsella rubella]
 gb|EOA36754.1| hypothetical protein CARUB_v10012595mg [Capsella rubella]
Length=549

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/396 (66%), Positives = 326/396 (82%), Gaps = 5/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V + DWY  GH  LKK+LDSGRT+  P+GV+INGK GKVGGK +PLFTM+ GKTY+YR
Sbjct  159   YTVLLGDWYTTGHTALKKLLDSGRTLGLPNGVLINGKSGKVGGKNEPLFTMKPGKTYKYR  218

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG ++++NFR Q H M LVEMEGSH +QN YDSLD+HVGQC SVLVTAD+  KDYY+
Sbjct  219   LCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVTADQAAKDYYM  278

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+E STV +I Y  G+ + AS ELP  P     G AWS+NQFRSFRWNLTASA
Sbjct  279   VASTRFLKKELSTVGVIRY-EGSNVQASTELPKTPV----GWAWSLNQFRSFRWNLTASA  333

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITR+IKLVNSKS VDGK+R+  NGVSH++T+TPLKLAEYF ++EK
Sbjct  334   ARPNPQGSYHYGKINITRSIKLVNSKSVVDGKVRFGFNGVSHVDTETPLKLAEYFQMAEK  393

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKYN++ D P      +T+ PNV+N TFR FVEI+FENHEK++Q++HLDG+SFFAVA E
Sbjct  394   VFKYNVIKDEPEAKITALTVQPNVLNITFRTFVEIIFENHEKSMQSFHLDGYSFFAVASE  453

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
             AG+W+PEKR NYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+R++ WER YLG+QLY
Sbjct  454   AGKWTPEKRSNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRAENWERRYLGEQLY  513

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SVLSPE+SLRDE+N+P    LCG+VKG+ +P  Y+
Sbjct  514   VSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPAVYT  549



>ref|XP_009600426.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nicotiana 
tomentosiformis]
Length=549

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/398 (66%), Positives = 326/398 (82%), Gaps = 9/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F+VF+SDWY K HKTL+ ILD GR+I RP+G++INGK+GK  GK +P+F+M +GKTYRYR
Sbjct  158   FSVFVSDWYTKSHKTLRSILDEGRSIGRPEGIIINGKNGKGDGKDEPMFSMVSGKTYRYR  217

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
              CNVGM+ S+N RFQGHTM LVEMEGSHT+QN Y+SLD+H+GQCLSVLVTAD+EPKDY+L
Sbjct  218   FCNVGMKDSINVRFQGHTMKLVEMEGSHTVQNMYESLDIHLGQCLSVLVTADQEPKDYFL  277

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V SSRF K+     A I Y N              P+  EG  WS+NQFRSFRWNLTASA
Sbjct  278   VASSRFTKEPHIATATIRYTNDPA-------SPELPKAPEGWEWSLNQFRSFRWNLTASA  330

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTI+LV++   VDGK RYA+NGVSH++  TP+KLAE +G+++K
Sbjct  331   ARPNPQGSYHYGQINITRTIRLVSTAGDVDGKRRYAINGVSHVDPTTPIKLAELYGVADK  390

Query  721   VFKYNIMGD--TPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             VFKY+++ D    P   EK+TLAPNVVNAT+RNFVEI+ ENHEK++Q++HL G++FFAVA
Sbjct  391   VFKYDLIKDEYIAPSGNEKITLAPNVVNATYRNFVEIILENHEKSVQSWHLAGYNFFAVA  450

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             IEAGRW PE+R+NYNL+DAVSR++IQVYPNSWAA+MTT+DNAG+WNLRS+  ER YLG Q
Sbjct  451   IEAGRWKPERRQNYNLLDAVSRNTIQVYPNSWAAIMTTLDNAGLWNLRSNSLERQYLGHQ  510

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             LYFSVLSP  SL+DE+N+PD   LCG++K + +P PYS
Sbjct  511   LYFSVLSPSCSLKDEYNMPDNDILCGIIKDLPLPKPYS  548



>ref|NP_187948.1| protein SKU5-like 13 [Arabidopsis thaliana]
 dbj|BAB01745.1| BNH protein; pectinesterase-like protein; pollen-secific protein-like 
[Arabidopsis thaliana]
 gb|AAL08265.1| AT3g13400/MRP15_3 [Arabidopsis thaliana]
 gb|AAL60046.1| putative pollen specific protein [Arabidopsis thaliana]
 gb|AAM20113.1| putative pollen-specific protein [Arabidopsis thaliana]
 gb|AEE75342.1| protein SKU5-like 13 [Arabidopsis thaliana]
Length=551

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/394 (66%), Positives = 324/394 (82%), Gaps = 5/394 (1%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             + I+DWY K H  LK  LDSGRT+  PDGV+INGK GK+GG   PLFTM+ GKTY+YR+C
Sbjct  162   ILINDWYAKSHTALKNFLDSGRTLGSPDGVLINGKSGKLGGNNAPLFTMKPGKTYKYRIC  221

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             NVG ++++NFR QGH M LVEMEGSH +QN YDSLD+HVGQC +VLVTAD+  K+YY+V 
Sbjct  222   NVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQVAKNYYMVA  281

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+RF K+E STV ++SY  G+ + AS ++P  P     G AWS+NQFRSFRWNLTASAAR
Sbjct  282   STRFLKKEVSTVGVMSY-EGSNVQASSDIPKAPV----GWAWSLNQFRSFRWNLTASAAR  336

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYG+INITRTIKL N+K+ V+GK+R+  NGVSH++T+TPLKLAEYFG+SEKVF
Sbjct  337   PNPQGSYHYGKINITRTIKLANTKNLVNGKVRFGFNGVSHVDTETPLKLAEYFGMSEKVF  396

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
             KYN++ D P      +T+ PNV+N TFR FVE+VFENHEK++Q++HLDG+SFFAVA E G
Sbjct  397   KYNVIKDEPAAKITTLTVEPNVLNITFRTFVEVVFENHEKSMQSFHLDGYSFFAVASEPG  456

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
             RW+PEKR NYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+ WER YLGQQLY S
Sbjct  457   RWTPEKRNNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSENWERRYLGQQLYVS  516

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             VLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  517   VLSPEKSLRDEYNIPLNTNLCGIVKGLPLPTPYT  550



>ref|XP_010465173.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=551

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/394 (66%), Positives = 324/394 (82%), Gaps = 5/394 (1%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             + I+DW+ K H  LK  LDSGRT+  PDGV+INGK GKVG K + LFTM+ GKTY+YR+C
Sbjct  162   ILINDWFTKSHTALKNFLDSGRTLGSPDGVLINGKFGKVGEKNEALFTMKPGKTYKYRIC  221

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             NVG ++S+NFR QGH M LVEMEGSH +QN YDSLD+HVGQC +VLVTAD+  K+YY+V 
Sbjct  222   NVGFKSSLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQVAKNYYMVA  281

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+RF K+E STV ++SY  G+ + AS ELP  P     G AWS+NQFRSFRWNLTASAAR
Sbjct  282   STRFLKKEVSTVGVLSY-EGSNVEASAELPKAPV----GWAWSLNQFRSFRWNLTASAAR  336

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYG+INITRTIKL NSK+ V+GK+R+  NGVSH++T+TPLKLAEYFG++EKVF
Sbjct  337   PNPQGSYHYGKINITRTIKLANSKNVVNGKVRFGFNGVSHVDTETPLKLAEYFGMAEKVF  396

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
             KYN++ D P      +T+ PNV+N TFR FVEI+FENHEK++Q++HLDGHSFFAVA E G
Sbjct  397   KYNVIKDEPAAKITALTVEPNVLNITFRTFVEIIFENHEKSMQSFHLDGHSFFAVASEPG  456

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
             RW+PEKR NYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+ WER YLG+QLY S
Sbjct  457   RWTPEKRSNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNVRSENWERRYLGEQLYIS  516

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             VLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  517   VLSPEKSLRDEYNIPLNTNLCGIVKGLPLPTPYT  550



>ref|XP_008374030.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=551

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/396 (66%), Positives = 320/396 (81%), Gaps = 5/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  L+K LDSGR++ARPDGV+INGK  K  GK +PLFTM+AGKTY+YR
Sbjct  160   YTVIIGDWYTKSHSQLRKFLDSGRSMARPDGVLINGKSAKGDGKDEPLFTMKAGKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ S+NFR QGH M LVEMEGSHT+QN YDSLD+H+GQC S+LVTADKEPKDYY+
Sbjct  220   ICNVGLKNSLNFRIQGHQMKLVEMEGSHTVQNTYDSLDVHIGQCFSMLVTADKEPKDYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   +   II Y NG G  +      P      G AWS+NQFRSFRWNLTASA
Sbjct  280   VASTRFTKSVLTGKGIIRYENGXGPVSPEVPKAPV-----GWAWSLNQFRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKL+NS S  DGKLRYA+NG+SH++ +TPLKLA+Y+GI EK
Sbjct  335   ARPNPQGSYHYGKINITRTIKLINSASKADGKLRYAINGISHVDPETPLKLADYYGIREK  394

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFK++ M   P   AEK+T+ PNV+N T ++FVEI+FEN EK++QT+HL+G++FFAVA+E
Sbjct  395   VFKFDTMKVDPQSPAEKITMEPNVLNITIKDFVEIIFENPEKSLQTWHLNGYAFFAVAVE  454

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G+W+PEKRKNYNL+DA+SRH+IQV+P SWAA++ T DNAGMWNLRS+  ER YLGQQLY
Sbjct  455   PGKWTPEKRKNYNLLDAMSRHTIQVFPKSWAAILLTFDNAGMWNLRSEQPERRYLGQQLY  514

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
               V + +RSLR+E+N+PD   +CGLVKGM MPPPYS
Sbjct  515   VGVENIKRSLRNEYNMPDNALVCGLVKGMPMPPPYS  550



>ref|XP_009803815.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=557

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/400 (66%), Positives = 322/400 (81%), Gaps = 10/400 (3%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F V ++DWY K H  LK +LD+GR + RP GV+INGK GK  GK +P++T+  GKTYR+R
Sbjct  160   FMVLVADWYTKSHTELKNLLDNGRALGRPQGVIINGKSGKGDGKDEPMYTLTPGKTYRFR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
              CNVGM+ S+N RFQGHTM LVE+EGSHT+QN Y+SLD+H+GQC+SVL+TAD++PKDY+L
Sbjct  220   FCNVGMKDSINVRFQGHTMKLVEIEGSHTVQNVYESLDVHLGQCMSVLITADQDPKDYFL  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+     A I YANG G  +            EG AWS+NQFRSFRWNLTASA
Sbjct  280   VASTRFTKEPHVATATIRYANGKGPASPELPKA-----PEGWAWSLNQFRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTIKLV S   VDGKLRYA+NGVSH++  TP+KLAEY+G+ +K
Sbjct  335   ARPNPQGSYHYGQINITRTIKLVTSAGNVDGKLRYAINGVSHVDPATPIKLAEYYGVGDK  394

Query  721   VFKYNIMGD-----TPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFF  885
             VFKY+++ D     +  E  +K+TLAPNVVNAT+RNFVEI+FENH K++Q++HL G+SFF
Sbjct  395   VFKYDLIKDDYEPASGKEAQDKITLAPNVVNATYRNFVEIIFENHGKSVQSWHLSGYSFF  454

Query  886   AVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYL  1065
             AV IE GRW+PEKR+NYNL+DAVSR++IQVYPNSWAAVMTT+DNAG+WNLRS+  ER YL
Sbjct  455   AVGIEPGRWTPEKRRNYNLLDAVSRNTIQVYPNSWAAVMTTLDNAGLWNLRSNSLERNYL  514

Query  1066  GQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             G QLYFSVLSP RS++DE+N+PD + LCGLVK M  P PY
Sbjct  515   GHQLYFSVLSPNRSIKDEYNMPDNELLCGLVKDMPRPTPY  554



>ref|XP_011025085.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=553

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/398 (66%), Positives = 320/398 (80%), Gaps = 7/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V ++DWY+K H  L+K+LDSGRT+ARPDGV++NGK+ K  GK +PLF M+  KTY+YR
Sbjct  160   YTVILNDWYSKSHTALQKLLDSGRTLARPDGVLVNGKNAKGDGKDEPLFKMKPEKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CN G++ ++NFR QGHTM LVEMEGSH +QN Y+SLD+HVGQC SVLVTA+++PKDYY+
Sbjct  220   ICNAGIKNTLNFRIQGHTMKLVEMEGSHVVQNVYESLDVHVGQCFSVLVTANQDPKDYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF KQ  +   II Y NG G  +      P      G AWS+NQFRSFRWNLTASA
Sbjct  280   VASTRFNKQVLTAKGIIRYTNGKGPASPELPEAPV-----GWAWSLNQFRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG INITRTIKLVNS S   GKLRYALNGVSH+N +TPLKLAEY+G+++K
Sbjct  335   ARPNPQGSYHYGSINITRTIKLVNSASRAGGKLRYALNGVSHVNPETPLKLAEYYGVADK  394

Query  721   VFKYNIMGDTPPENAE--KVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             VFKY+ + D+P  N    K+   PNV+N TFRNFVEI+FENHEK++Q+YHLDG+SFFAVA
Sbjct  395   VFKYDTILDSPQANVANAKIVTQPNVLNLTFRNFVEIIFENHEKSMQSYHLDGYSFFAVA  454

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             +E G W+PEKRK+YNL+DAVSR ++QV+P SWAA++ T DNAG+WN+RS+MWER YLGQQ
Sbjct  455   VEPGTWTPEKRKHYNLLDAVSRTTVQVFPKSWAAILLTFDNAGLWNIRSEMWERVYLGQQ  514

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             LY SVLSP RSLRDE+NLPD   LCG+VK M  P PYS
Sbjct  515   LYASVLSPARSLRDEYNLPDNSLLCGIVKDMPKPAPYS  552



>ref|XP_002894511.1| hypothetical protein ARALYDRAFT_474617 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70770.1| hypothetical protein ARALYDRAFT_474617 [Arabidopsis lyrata subsp. 
lyrata]
Length=549

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/396 (67%), Positives = 323/396 (82%), Gaps = 5/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V + DWY  GH  LK  LDSGRT+  P+GV+INGK GKVGGK +PLFTM+ GKTY+YR
Sbjct  159   YTVLLGDWYTAGHTALKNFLDSGRTLGLPNGVLINGKSGKVGGKNEPLFTMKPGKTYKYR  218

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG ++++NFR Q H M LVEMEGSH +QN YDSLD+HVGQC SVLVTAD+  KDYY+
Sbjct  219   LCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVTADQAAKDYYM  278

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+E STV +I Y  G+ + AS ELP  P     G AWS+NQFRSFRWNLTASA
Sbjct  279   VASTRFLKKELSTVGVIRY-EGSNVQASAELPKAPI----GWAWSLNQFRSFRWNLTASA  333

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITR+IKLVNSKS VDGK+R+  NGVSH++T+TPLKLAEYF +SEK
Sbjct  334   ARPNPQGSYHYGKINITRSIKLVNSKSVVDGKVRFGFNGVSHVDTETPLKLAEYFQMSEK  393

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKYN++ D P      +T+ PNV+N TFR FVEI+FENHEK++Q++HLDG+SFFAVA E
Sbjct  394   VFKYNVIKDEPAAKITALTVQPNVLNITFRTFVEIIFENHEKSMQSFHLDGYSFFAVASE  453

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              GRW+PEKRKNYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+  ER YLG+QLY
Sbjct  454   PGRWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSENLERRYLGEQLY  513

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SVLSPE+SLRDE+N+P    LCG+VKG+ +P  YS
Sbjct  514   VSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPAHYS  549



>ref|XP_010487093.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=551

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/394 (66%), Positives = 324/394 (82%), Gaps = 5/394 (1%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             + I+DW+ K H  LK  LDSGRT+  PDGV+INGK GKVG K + LFTM+ GKTY++R+C
Sbjct  162   ILINDWFTKSHTALKNFLDSGRTLGSPDGVLINGKSGKVGEKNEALFTMKPGKTYKFRIC  221

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             NVG ++++NFR QGH M LVEMEGSH +QN YDSLD+HVGQC +VLVTAD+  K+YY+V 
Sbjct  222   NVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQVAKNYYMVA  281

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+RF K+E STV ++SY  G+ + AS ELP  P     G AWS+NQFRSFRWNLTASAAR
Sbjct  282   STRFLKKEVSTVGVLSY-EGSNVEASAELPKAPV----GWAWSLNQFRSFRWNLTASAAR  336

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYG+INITRTIKL NSK+ V+GK+R+  NGVSH++T+TPLKLAEYFG++EKVF
Sbjct  337   PNPQGSYHYGKINITRTIKLANSKNVVNGKVRFGFNGVSHVDTETPLKLAEYFGMAEKVF  396

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
             KYN++ D P      +T+ PNV+N TFR FVEI+FENHEK++Q++HLDGHSFFAVA E G
Sbjct  397   KYNVIKDEPAAKITALTVEPNVLNITFRTFVEIIFENHEKSMQSFHLDGHSFFAVASEPG  456

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
             RW+PEKR NYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+ WER YLG+QLY S
Sbjct  457   RWTPEKRSNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSENWERRYLGEQLYVS  516

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             VLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  517   VLSPEKSLRDEYNIPLNTNLCGIVKGLPLPAPYT  550



>emb|CDY10549.1| BnaC03g70650D [Brassica napus]
Length=549

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/396 (66%), Positives = 326/396 (82%), Gaps = 5/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I+DWY  GH  LK  LDSGRT+  P+GV+INGK GKVGGK +PLFTM+ GKTY+YR
Sbjct  159   YTVLINDWYTSGHTALKNFLDSGRTLGLPNGVLINGKSGKVGGKNEPLFTMKPGKTYKYR  218

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG ++++NFR Q H M LVEMEGSH +QN YDSLD+HVGQC SVLVTA++E KDYY+
Sbjct  219   LCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVTANQEAKDYYM  278

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+E STV +I YA G+ + AS ELP  P     G AWS+NQFRSFRWNLTASA
Sbjct  279   VASTRFLKKELSTVGVIRYA-GSNVQASTELPKTPV----GWAWSLNQFRSFRWNLTASA  333

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITR+IKLVN+K+ VDGK+RY  NGVSH++T+TPLKLAEYF ++EK
Sbjct  334   ARPNPQGSYHYGKINITRSIKLVNTKNVVDGKVRYGFNGVSHVDTETPLKLAEYFQMAEK  393

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKY+++ D P      +T+ PNV+N TFR FVEI+FENHEK+++++HLDG+SFFAVA E
Sbjct  394   VFKYDVIKDEPAAQITALTVQPNVLNITFRTFVEIIFENHEKSMESFHLDGYSFFAVASE  453

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              GRW+PEKRKNYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+  ER YLGQQLY
Sbjct  454   PGRWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSENLERRYLGQQLY  513

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SVLSPE+SLRDE+N+P    LCG+VKG+ +P  Y+
Sbjct  514   VSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPASYT  549



>ref|XP_009106861.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=549

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/396 (66%), Positives = 327/396 (83%), Gaps = 5/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I+DWY  GH  LK  LDSGRT+  P+GV+INGK GKVGGK +PLFTM+ GKTY+YR
Sbjct  159   YTVLINDWYTSGHTALKNFLDSGRTLGLPNGVLINGKSGKVGGKNEPLFTMKPGKTYKYR  218

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG ++++NFR Q H M LVEMEGSH +QN YDSLD+HVGQC SVLVTA++E KDYY+
Sbjct  219   LCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVTANQEAKDYYM  278

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+E STV +I YA G+ + AS ELP  P     G AWS+NQFRSFRWNLT++A
Sbjct  279   VASTRFLKKELSTVGVIRYA-GSNVQASAELPKTPV----GWAWSLNQFRSFRWNLTSNA  333

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITR+IKLVN+KS+VDGK+RY  NGVSH++T+TPLKLAEYF ++EK
Sbjct  334   ARPNPQGSYHYGKINITRSIKLVNTKSFVDGKVRYGFNGVSHVDTETPLKLAEYFQMAEK  393

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKY+++ D P      +T+ PNV+N TFR FVEI+FENHEK+++++HLDG+SFFAVA E
Sbjct  394   VFKYDVIKDEPAAQITALTVQPNVLNITFRTFVEIIFENHEKSMESFHLDGYSFFAVASE  453

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              GRW+PEKRKNYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+  ER YLGQQLY
Sbjct  454   PGRWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSENLERRYLGQQLY  513

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SVLSPE+SLRDE+N+P    LCG+VKG+ +P  Y+
Sbjct  514   VSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPARYT  549



>ref|XP_006352142.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=556

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/400 (67%), Positives = 324/400 (81%), Gaps = 9/400 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F V +SDWY K H  L+K LDSGR++ RPDG++INGK GK  GK +PLF+M  GKTYRYR
Sbjct  161   FFVLVSDWYTKSHTQLRKFLDSGRSMGRPDGIIINGKGGKGDGKDEPLFSMTPGKTYRYR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
              CN GM+ S+N R QGHTM LVEMEGSH +QN YDSLD+H+GQC+SVLVTADK+PKDY L
Sbjct  221   FCNAGMKDSINVRIQGHTMKLVEMEGSHVVQNMYDSLDIHLGQCVSVLVTADKDPKDYLL  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+  +  +II Y NGNG  +      P      G AWS+NQFRSFRWNLTASA
Sbjct  281   VASTRFTKEPHTATSIIRYTNGNGPASPELPKAPI-----GWAWSLNQFRSFRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTIKLVN+   VDGKLRYA+NGVSH+N  TP+KL EY+G+ +K
Sbjct  336   ARPNPQGSYHYGQINITRTIKLVNTAGTVDGKLRYAINGVSHVNPTTPIKLVEYYGVEDK  395

Query  721   VFKYNIMGDT--PP--ENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFA  888
             +FKY++M D   PP  +  EK+TLAPNVV  T+RNFVEI+FENHEK++Q++HL G+SFFA
Sbjct  396   IFKYDLMKDEYEPPAGKAEEKITLAPNVVKVTYRNFVEIIFENHEKSVQSFHLAGYSFFA  455

Query  889   VAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLG  1068
             VAIE G+W+PEKRKNYNL+DAVSR++IQVYPNSWAA+MTT+DNAG+WNLRS+  ER YLG
Sbjct  456   VAIEPGKWTPEKRKNYNLLDAVSRNTIQVYPNSWAAIMTTLDNAGLWNLRSNSVERQYLG  515

Query  1069  QQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             QQLYFS LSP+R L+DE+N+PD   LCG++K M +P PYS
Sbjct  516   QQLYFSALSPKRDLKDEYNMPDNDVLCGIIKDMPLPKPYS  555



>ref|XP_006407227.1| hypothetical protein EUTSA_v10020444mg [Eutrema salsugineum]
 gb|ESQ48680.1| hypothetical protein EUTSA_v10020444mg [Eutrema salsugineum]
Length=551

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/396 (66%), Positives = 325/396 (82%), Gaps = 5/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I+DWY K H  LK  LDSGRT+  PDGV+INGK GKVGG  +PLFTM+ GKTY+YR
Sbjct  160   YTVLINDWYTKSHTALKNFLDSGRTLGSPDGVLINGKSGKVGGNNEPLFTMKPGKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG ++++NFR QGH M LVEMEGSH IQN YDSLD+HVGQC +VLVTAD+  K+YY+
Sbjct  220   ICNVGFKSTLNFRIQGHKMKLVEMEGSHVIQNDYDSLDVHVGQCFAVLVTADQVAKNYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+E STV ++SY  G+ + AS ELP  P     G AWS+NQFRSFRWNLTASA
Sbjct  280   VASTRFLKKEVSTVGVMSY-EGSNVQASNELPKAPV----GWAWSLNQFRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKL N+K+ V+GK+R+ LNGVSH++ +TPLKLAEYFG++EK
Sbjct  335   ARPNPQGSYHYGKINITRTIKLANTKNLVNGKVRFGLNGVSHVDPETPLKLAEYFGLAEK  394

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKYN++ D P      + + PNV+N TFR FVEIVFENHEK++Q+++LDG+SFF VA E
Sbjct  395   VFKYNVIKDEPAAKITTLVVEPNVLNITFRTFVEIVFENHEKSMQSFNLDGYSFFNVASE  454

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              GRW+PEKRKNYNL+DAVSRH++QV+P SW+A++ T DNAGMWN+RS+ WER YLGQQ+Y
Sbjct  455   PGRWTPEKRKNYNLLDAVSRHTVQVFPKSWSAILLTFDNAGMWNIRSENWERRYLGQQMY  514

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SVLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  515   VSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPTPYT  550



>emb|CDY43994.1| BnaA05g25890D [Brassica napus]
Length=552

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/396 (66%), Positives = 324/396 (82%), Gaps = 5/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I+DWY K H  LK  LDSGRT+  PDGV+INGK GKVGG   PLFTM+ GKTY+YR
Sbjct  161   YTVLINDWYTKSHTALKTFLDSGRTLGSPDGVLINGKSGKVGGPNVPLFTMKPGKTYKYR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG ++++NFR QGH M LVEMEGSH +QN YDSLD+HVGQC +VLVTAD+  K+YY+
Sbjct  221   ICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQNAKNYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+E STV ++SY  G+ + AS ELP  P     G AWS+NQFRSFRWNLTASA
Sbjct  281   VASTRFLKKEVSTVGVMSY-EGSNVQASSELPKAPV----GWAWSLNQFRSFRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKL N+K+ V+GK+R+ LNGVSH++T+TPLKLAEYF +SEK
Sbjct  336   ARPNPQGSYHYGKINITRTIKLANTKNLVNGKVRFGLNGVSHVDTETPLKLAEYFEMSEK  395

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKYN++ D P      +T+ PNV+N TFR FVEIVFENHEK++Q++HLDG+SFF+VA E
Sbjct  396   VFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVEIVFENHEKSMQSFHLDGYSFFSVASE  455

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G W+PEKR NYNL+DAVSRH++QV+P SW+A++ T DNAGMWN+RS+ WER YLGQQ+Y
Sbjct  456   PGTWTPEKRNNYNLLDAVSRHTVQVFPKSWSAILLTFDNAGMWNIRSENWERRYLGQQMY  515

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SVLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  516   VSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPTPYT  551



>ref|XP_009146525.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=552

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/396 (66%), Positives = 324/396 (82%), Gaps = 5/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I+DWY K H  LK  LDSGRT+  PDGV+INGK GKVGG   PLFTM+ GKTY+YR
Sbjct  161   YTVLINDWYTKSHTALKTFLDSGRTLGSPDGVLINGKSGKVGGPNVPLFTMKPGKTYKYR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG ++++NFR QGH M LVEMEGSH +QN YDSLD+HVGQC +VLVTAD+  K+YY+
Sbjct  221   ICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQNAKNYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+E STV ++SY  G+ + AS ELP  P     G AWS+NQFRSFRWNLTASA
Sbjct  281   VASTRFLKKEVSTVGVMSY-EGSNVQASSELPKAPV----GWAWSLNQFRSFRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKL N+K+ V+GK+R+ LNGVSH++T+TPLKLAEYF +SEK
Sbjct  336   ARPNPQGSYHYGKINITRTIKLANTKNLVNGKVRFGLNGVSHVDTETPLKLAEYFEMSEK  395

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKYN++ D P      +T+ PNV+N TFR FVEIVFENHEK++Q++HLDG+SFF+VA E
Sbjct  396   VFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVEIVFENHEKSMQSFHLDGYSFFSVASE  455

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G W+PEKR NYNL+DAVSRH++QV+P SW+A++ T DNAGMWN+RS+ WER YLGQQ+Y
Sbjct  456   PGTWTPEKRNNYNLLDAVSRHTVQVFPKSWSAILLTFDNAGMWNIRSENWERRYLGQQMY  515

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SVLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  516   VSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPTPYT  551



>emb|CDY23597.1| BnaC05g39970D [Brassica napus]
Length=552

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/396 (66%), Positives = 324/396 (82%), Gaps = 5/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I+DWY K H  LK  LDSGRT+  PDGV+INGK GKVGG   PLFTM+ GKTY+YR
Sbjct  161   YTVLINDWYTKSHTALKTFLDSGRTLGSPDGVLINGKSGKVGGPNVPLFTMKPGKTYKYR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG ++++NFR QGH M LVEMEGSH +QN YDSLD+HVGQC +VLVTAD+  K+YY+
Sbjct  221   ICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQTAKNYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+E STV ++SY  G+ + AS ELP  P     G AWS+NQFRSFRWNLTASA
Sbjct  281   VASTRFLKKEVSTVGVMSY-EGSNVQASSELPKAPV----GWAWSLNQFRSFRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKL N+K+ V+GK+R+ LNGVSH++T+TPLKLAEYF +SEK
Sbjct  336   ARPNPQGSYHYGKINITRTIKLANTKNLVNGKVRFGLNGVSHVDTETPLKLAEYFEMSEK  395

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKYN++ D P      +T+ PNV+N TFR FVEIVFENHEK++Q++HLDG+SFF+VA E
Sbjct  396   VFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVEIVFENHEKSMQSFHLDGYSFFSVASE  455

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G W+PEKR NYNL+DAVSRH++QV+P SW+A++ T DNAGMWN+RS+ WER YLGQQ+Y
Sbjct  456   PGTWTPEKRNNYNLLDAVSRHTVQVFPKSWSAILLTFDNAGMWNIRSENWERRYLGQQMY  515

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SVLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  516   VSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPTPYT  551



>ref|XP_010673839.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=558

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/400 (65%), Positives = 318/400 (80%), Gaps = 9/400 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGG-KIDPLFTMEAGKTYRY  177
             + + + DWY + H  L+K L++G+++ARPD V++NGK GKVG  K +PLFTM+ GKTYRY
Sbjct  163   YTIMVGDWYKESHAVLRKHLENGKSLARPDAVLMNGKQGKVGDPKEEPLFTMKPGKTYRY  222

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             R+CNVGM+ S+NFR QGHTM LVE+EGSHT+QN YDSLD+H+GQC SVLVTADKEPKDYY
Sbjct  223   RICNVGMKNSINFRMQGHTMKLVEVEGSHTVQNMYDSLDIHLGQCYSVLVTADKEPKDYY  282

Query  358   LVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTAS  537
             +V S+RF K       I+ Y  G G  ++     P      G AWS+NQFRS RWNLTAS
Sbjct  283   MVASTRFTKYHLQATGIVRYEGGKGAPSTVLPEAPV-----GWAWSLNQFRSLRWNLTAS  337

Query  538   AARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISE  717
             AARPNPQGSYHYGQINITRTIKL N+   VDGKLRYA+NG SH + DTPLKL EY+ +++
Sbjct  338   AARPNPQGSYHYGQINITRTIKLANTAGTVDGKLRYAINGHSHTDVDTPLKLLEYYQVAQ  397

Query  718   KVFKYNIMGDTPPENAE---KVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFA  888
             K FKY+++ D PP N E   K T  PNV+N TFRNF+EI+FENHEK+IQ++HLDG+SFF 
Sbjct  398   KAFKYDVIKDEPPANVETLDKFTTGPNVLNGTFRNFIEIIFENHEKSIQSWHLDGYSFFP  457

Query  889   VAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLG  1068
             VAIE G+W+PEKRKNYNL+DAVSR++IQVYP SWAA+M T DNAGMW+LR++  ER++LG
Sbjct  458   VAIEVGQWTPEKRKNYNLLDAVSRYTIQVYPKSWAAIMLTTDNAGMWHLRNEAPERSFLG  517

Query  1069  QQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             QQ+Y SVLSPERSLRDE+NLPD   +CGLVK M  PPPYS
Sbjct  518   QQMYISVLSPERSLRDEYNLPDNSLICGLVKDMPKPPPYS  557



>emb|CDY24188.1| BnaC01g37680D [Brassica napus]
Length=550

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/394 (66%), Positives = 322/394 (82%), Gaps = 5/394 (1%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             + I+DWY K H  LK  LDSGRT+  PDGV+INGK GKVGG+  PLFTM+ GKTY+YR+C
Sbjct  161   ILINDWYTKSHTALKNFLDSGRTLGSPDGVLINGKSGKVGGQDKPLFTMKPGKTYKYRIC  220

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             NVG ++++NFR QGH M LVEMEGSH +QN YDSLD+HVGQC +VLVTAD+  K+YY+V 
Sbjct  221   NVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQNAKNYYMVA  280

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+RF K+E STV ++SY  G+ +  S  LP  P     G AWS+NQFRSFRWNLTASAAR
Sbjct  281   STRFLKKEVSTVGVMSY-EGSNVQPSNVLPKAPV----GWAWSLNQFRSFRWNLTASAAR  335

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYG+INITRTIKL N+K+ VDGK+R+ LNGVSH++T+TPLKLAEYF +SEKVF
Sbjct  336   PNPQGSYHYGKINITRTIKLANTKNLVDGKVRFGLNGVSHVDTETPLKLAEYFEMSEKVF  395

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
             KYN++ D P      +T+ PNV+N TFR FVEIVFENHEK++Q++HLDG+SFF+VA E G
Sbjct  396   KYNVIKDEPAAKITTLTVEPNVLNITFRTFVEIVFENHEKSMQSFHLDGYSFFSVASEPG  455

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
              W+PEKR NYNL+DAVSRH++QV+P SW+A++ T DNAGMWN+RS+ WER YLGQQ+Y S
Sbjct  456   TWTPEKRNNYNLLDAVSRHTVQVFPKSWSAILLTFDNAGMWNIRSENWERRYLGQQMYVS  515

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             VLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  516   VLSPEKSLRDEYNIPLNTNLCGIVKGLPLPTPYT  549



>ref|XP_002523381.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF38960.1| multicopper oxidase, putative [Ricinus communis]
Length=551

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/396 (66%), Positives = 315/396 (80%), Gaps = 5/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V ++DWY K HK+L+  LDSGR++ RPDGV+INGK+ K  GK +PLFTM+  KTY+YR
Sbjct  160   YTVVLNDWYTKSHKSLRTFLDSGRSLGRPDGVLINGKNAKGDGKDEPLFTMKPDKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             VCN G++TS+NFR QGH M LVEMEGSH +QN Y+SLD+HVGQCLSVLV A++ PKDYY+
Sbjct  220   VCNAGIKTSLNFRIQGHEMKLVEMEGSHVVQNVYESLDVHVGQCLSVLVRANQAPKDYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   +   II Y NG G  +      P      G AWS+NQFRSFRWNLTASA
Sbjct  280   VASTRFMKTVQTAKGIIRYTNGKGPASPELPEAPV-----GWAWSLNQFRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG INITRTIKLVNS S   GKLRYA+NGVSH +T+TPLKLAEY+GI++K
Sbjct  335   ARPNPQGSYHYGSINITRTIKLVNSPSRAGGKLRYAINGVSHTDTETPLKLAEYYGIADK  394

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKY+ + D PP    +V   PNV+N TFRNFVEI+FEN EK+IQ++HLDG+SFFAVA+E
Sbjct  395   VFKYDTIKDDPPPKITEVVTQPNVLNMTFRNFVEIIFENPEKSIQSWHLDGYSFFAVAVE  454

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G W+PEKRKNYNL+DAVSR ++QV+P SWAA+  T DNAGMWN+RS++WER YLGQQLY
Sbjct  455   PGTWTPEKRKNYNLLDAVSRTTVQVFPKSWAAIFLTFDNAGMWNIRSEVWERTYLGQQLY  514

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SV+SP RSLRDE+N+PD   LCGLVK +  PPPYS
Sbjct  515   ASVISPARSLRDEYNIPDNALLCGLVKDLPKPPPYS  550



>ref|XP_010500435.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=551

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/394 (66%), Positives = 324/394 (82%), Gaps = 5/394 (1%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             + I+DW+ K H  LK  LDSGRT+  PDGV+INGK GKVG K + LFTM+ GKTY++R+C
Sbjct  162   ILINDWFTKSHTALKNFLDSGRTLGSPDGVLINGKSGKVGEKNEALFTMKPGKTYKFRIC  221

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             NVG ++++NFR QGH M LVEMEGSH +QN YDSLD+HVGQC +VLVTAD+  K+YY+V 
Sbjct  222   NVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQVAKNYYMVA  281

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+RF K+E STV ++SY  G+ + AS ELP  P     G AWS+NQFRSFRWNLTASAAR
Sbjct  282   STRFLKKEVSTVGVLSY-EGSNVEASAELPKAPV----GWAWSLNQFRSFRWNLTASAAR  336

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYG+INITRTIKL NSK+ V+GK+R+  NGVSH++T+TPLKLAEYFG++EKVF
Sbjct  337   PNPQGSYHYGKINITRTIKLANSKNVVNGKVRFGFNGVSHVDTETPLKLAEYFGMAEKVF  396

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
             KYN++ D P      +T+ PNV+N TFR FVEI+FENHEK++Q++HLDG+SFFAVA E G
Sbjct  397   KYNVIKDEPAAKITALTVEPNVLNITFRTFVEIIFENHEKSMQSFHLDGYSFFAVASEPG  456

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
             RW+PEKR NYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+ WER YLG+QLY S
Sbjct  457   RWTPEKRSNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSENWERRYLGEQLYVS  516

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             VLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  517   VLSPEKSLRDEYNIPLNTNLCGIVKGLPLPAPYT  550



>ref|XP_006392622.1| hypothetical protein EUTSA_v10011369mg [Eutrema salsugineum]
 gb|ESQ29908.1| hypothetical protein EUTSA_v10011369mg [Eutrema salsugineum]
Length=549

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/396 (66%), Positives = 323/396 (82%), Gaps = 5/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V + DWY  GH  LK  LDSGRT+  P+GV+INGK GKVGG  +PLFTM+ GKTY+YR
Sbjct  159   YTVLLGDWYTSGHTALKNFLDSGRTLGLPNGVLINGKSGKVGGNNEPLFTMKPGKTYKYR  218

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG ++++NFR Q H M LVEMEGSH +QN YDSLD+HVGQC SVLVTAD+  KDYY+
Sbjct  219   LCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVTADQAAKDYYM  278

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+E STV +I YA G+ + AS ELP  P     G AWS+NQFRSFRWNLTASA
Sbjct  279   VASTRFLKKELSTVGVIRYA-GSNVQASAELPKAPV----GWAWSLNQFRSFRWNLTASA  333

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITR+IKLV+SK+ V+GK+R+  N VSH++T+TPLKLAEYF ++EK
Sbjct  334   ARPNPQGSYHYGKINITRSIKLVSSKNMVNGKVRFGFNSVSHVDTETPLKLAEYFQMAEK  393

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKYN++ D P      +T+ PNV+N TFR FVEI+FENHEK++Q++HLDG+SFFAVA E
Sbjct  394   VFKYNVIKDEPAAKITALTVEPNVLNITFRTFVEIIFENHEKSMQSFHLDGYSFFAVASE  453

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              GRW+PEKRKNYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+ WER YLGQQLY
Sbjct  454   PGRWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSENWERRYLGQQLY  513

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SVLSPE+SLRDE+N+P    LCG+VKG+ MP  Y+
Sbjct  514   ASVLSPEKSLRDEYNIPLNTNLCGIVKGLPMPAIYT  549



>gb|AAD10639.1| putative pollen specific protein [Arabidopsis thaliana]
Length=558

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/396 (66%), Positives = 323/396 (82%), Gaps = 5/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V + DWY  GH  LK  LDSGRT+  P+GV+INGK GKVGGK +PLFTM+ GKTY+YR
Sbjct  168   YTVLLGDWYTAGHTALKNFLDSGRTLGLPNGVLINGKSGKVGGKNEPLFTMKPGKTYKYR  227

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG ++++NFR Q H M LVEMEGSH IQN YDSLD+HVGQC SVLVTA++  KDYY+
Sbjct  228   LCNVGFKSTLNFRIQNHKMKLVEMEGSHVIQNDYDSLDVHVGQCFSVLVTANQAAKDYYM  287

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+E STV +I Y  G+ + AS ELP  P     G AWS+NQFRSFRWNLT++A
Sbjct  288   VASTRFLKKELSTVGVIRY-EGSNVQASTELPKAPV----GWAWSLNQFRSFRWNLTSNA  342

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITR+IKLVNSKS VDGK+R+  NGVSH++T+TPLKLAEYF +SEK
Sbjct  343   ARPNPQGSYHYGKINITRSIKLVNSKSVVDGKVRFGFNGVSHVDTETPLKLAEYFQMSEK  402

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKYN++ D P      +T+ PNV+N TFR FVEI+FENHEKT+Q++HLDG+SFFAVA E
Sbjct  403   VFKYNVIKDEPAAKITALTVQPNVLNITFRTFVEIIFENHEKTMQSFHLDGYSFFAVASE  462

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              GRW+PEKR+NYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+  ER YLG+QLY
Sbjct  463   PGRWTPEKRENYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSENLERKYLGEQLY  522

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SVLSPE+SLRDE+N+P    LCG+VKG+ +P  YS
Sbjct  523   VSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPAHYS  558



>emb|CDY56013.1| BnaA08g29220D [Brassica napus]
Length=549

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/396 (66%), Positives = 326/396 (82%), Gaps = 5/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I+DWY  GH  LK  LDSGRT+  P+GV+INGK GKVGGK +PLFTM+ GKTY+YR
Sbjct  159   YTVLINDWYTSGHTALKNFLDSGRTLGLPNGVLINGKSGKVGGKNEPLFTMKPGKTYKYR  218

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG ++++NFR Q H M LVEMEGSH +QN YDSLD+HVGQC SVLVTA++E KDYY+
Sbjct  219   LCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVTANQEAKDYYM  278

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+E STV +I YA G+ + AS ELP  P     G AWS+NQFRSFRWNLT++A
Sbjct  279   VASTRFLKKELSTVGVIRYA-GSNVQASAELPKTPV----GWAWSLNQFRSFRWNLTSNA  333

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITR+IKLVN+K+ VDGK+RY  NGVSH++T+TPLKLAEYF ++EK
Sbjct  334   ARPNPQGSYHYGKINITRSIKLVNTKNVVDGKVRYGFNGVSHVDTETPLKLAEYFQMAEK  393

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKY+++ D P      +T+ PNV+N TFR FVEI+FENHEK+++++HLDG+SFFAVA E
Sbjct  394   VFKYDVIKDEPAAQITALTVQPNVLNITFRTFVEIIFENHEKSMESFHLDGYSFFAVASE  453

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              GRW+PEKRKNYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+  ER YLGQQLY
Sbjct  454   PGRWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSENLERRYLGQQLY  513

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SVLSPE+SLRDE+N+P    LCG+VKG+ +P  Y+
Sbjct  514   VSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPASYT  549



>ref|XP_002523382.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF38961.1| multicopper oxidase, putative [Ricinus communis]
Length=551

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/396 (65%), Positives = 310/396 (78%), Gaps = 5/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V ++DWY K H +L+K LDSG +I RP+GV+INGK  K  GK  PLFTM+ GKTY+YR
Sbjct  160   YTVIVNDWYTKSHTSLRKSLDSGVSIGRPEGVLINGKTAKGNGKDKPLFTMKPGKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CN G++TS+NFR QGHTM LVEMEGSH +QN Y+SLD+HVGQC SVLVTA++ PKDYY+
Sbjct  220   ICNAGLKTSINFRIQGHTMKLVEMEGSHVVQNIYESLDVHVGQCFSVLVTANQAPKDYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K       I+ Y NG G  +      P      G AWS+NQFRSFRWNLTASA
Sbjct  280   VASTRFLKTVLVGKGIVRYTNGKGQASPVLPKAPV-----GWAWSLNQFRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG INITRTIKLVNS S   GKLRYA+N VSH+  +TPLKLAEYFG++ K
Sbjct  335   ARPNPQGSYHYGSINITRTIKLVNSASTTGGKLRYAINSVSHVEPETPLKLAEYFGVANK  394

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKY+   D PP    K+   PNV+N TFRNFVEI+FEN EK+IQ++HLDG+SFF VA+E
Sbjct  395   VFKYDTFQDNPPAKIGKIVSQPNVLNMTFRNFVEIIFENPEKSIQSWHLDGYSFFVVAVE  454

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G W+PEKRKNYNL+DAVSR ++QV+P SWAA++ T DNAGMWN+RS+MWER YLGQQLY
Sbjct  455   PGTWTPEKRKNYNLLDAVSRTTVQVFPKSWAAILLTFDNAGMWNIRSEMWERTYLGQQLY  514

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SVLSP RSLRDE+N+PD   LCGLVKG+  PPPY+
Sbjct  515   ASVLSPARSLRDEYNIPDNALLCGLVKGLPKPPPYT  550



>ref|XP_004502172.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=545

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/392 (67%), Positives = 319/392 (81%), Gaps = 9/392 (2%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             V I DWYNKGHKTLK +LDSGR+I RPDGV++NGK        +PL+TM+ GKTY+YR+C
Sbjct  160   VIIGDWYNKGHKTLKMMLDSGRSIGRPDGVIMNGK----ATNEEPLYTMKPGKTYKYRIC  215

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             NVG++ ++NFRFQGH M LVE EGSH +Q+ YDSLD+HVGQC +VLVTADK+PKDYY+V 
Sbjct  216   NVGLKDALNFRFQGHAMKLVETEGSHVVQSFYDSLDVHVGQCYTVLVTADKDPKDYYMVA  275

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+RF K   +   II Y NG G  ++   P P      G AWS+NQFRSFRWNLTASAAR
Sbjct  276   STRFTKYTHTATGIIRYTNGAGPASNVLPPAPV-----GWAWSLNQFRSFRWNLTASAAR  330

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYGQINITRTIKLVNS + VDGKLRYA+NGVSH++ +TPLKLAEY+G+++KVF
Sbjct  331   PNPQGSYHYGQINITRTIKLVNSVAKVDGKLRYAINGVSHVDGETPLKLAEYYGVADKVF  390

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
             KYNI+GD PP +   +T+APNV+NATFR F+E++ EN  K+IQ+Y+LDG+SFFAVA E G
Sbjct  391   KYNIIGDEPPADLTAITIAPNVINATFRTFIEVILENSGKSIQSYNLDGYSFFAVACEPG  450

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
             +WSPEKRKNYNL+DA+SRH+IQV+P SWAA+M T DNAGMWNLRS+  E  YLGQQLY S
Sbjct  451   KWSPEKRKNYNLLDAISRHTIQVFPKSWAAIMLTFDNAGMWNLRSEQAENRYLGQQLYIS  510

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMPPP  1182
             VLSPE SLRDE+NLP+ Q +CG+VK +  P P
Sbjct  511   VLSPELSLRDEYNLPETQIVCGIVKSLPKPAP  542



>ref|NP_564697.1| SKU5 similar 14 [Arabidopsis thaliana]
 emb|CAB59910.1| BNH protein [Arabidopsis thaliana]
 dbj|BAC43197.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64845.1| At1g55560 [Arabidopsis thaliana]
 gb|AEE33266.1| SKU5 similar 14 [Arabidopsis thaliana]
Length=549

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/396 (66%), Positives = 323/396 (82%), Gaps = 5/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V + DWY  GH  LK  LDSGRT+  P+GV+INGK GKVGGK +PLFTM+ GKTY+YR
Sbjct  159   YTVLLGDWYTAGHTALKNFLDSGRTLGLPNGVLINGKSGKVGGKNEPLFTMKPGKTYKYR  218

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG ++++NFR Q H M LVEMEGSH IQN YDSLD+HVGQC SVLVTA++  KDYY+
Sbjct  219   LCNVGFKSTLNFRIQNHKMKLVEMEGSHVIQNDYDSLDVHVGQCFSVLVTANQAAKDYYM  278

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+E STV +I Y  G+ + AS ELP  P     G AWS+NQFRSFRWNLT++A
Sbjct  279   VASTRFLKKELSTVGVIRY-EGSNVQASTELPKAPV----GWAWSLNQFRSFRWNLTSNA  333

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITR+IKLVNSKS VDGK+R+  NGVSH++T+TPLKLAEYF +SEK
Sbjct  334   ARPNPQGSYHYGKINITRSIKLVNSKSVVDGKVRFGFNGVSHVDTETPLKLAEYFQMSEK  393

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKYN++ D P      +T+ PNV+N TFR FVEI+FENHEKT+Q++HLDG+SFFAVA E
Sbjct  394   VFKYNVIKDEPAAKITALTVQPNVLNITFRTFVEIIFENHEKTMQSFHLDGYSFFAVASE  453

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              GRW+PEKR+NYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+  ER YLG+QLY
Sbjct  454   PGRWTPEKRENYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSENLERKYLGEQLY  513

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SVLSPE+SLRDE+N+P    LCG+VKG+ +P  YS
Sbjct  514   VSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPAHYS  549



>ref|XP_003635547.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 ref|XP_003635599.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI18839.3| unnamed protein product [Vitis vinifera]
 emb|CBI41110.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/397 (66%), Positives = 317/397 (80%), Gaps = 9/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  LKK LDSG +I RPDGV INGK      K +PLFTM+ G TYRYR
Sbjct  161   YTVLIGDWYKKSHTVLKKKLDSGHSIGRPDGVQINGKSED---KDEPLFTMKPGLTYRYR  217

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG+++S+NFR QGHTM LVE+EGSHT+QN YDSLD+H+GQC SVLVTA+++PKDYY+
Sbjct  218   ICNVGIKSSLNFRIQGHTMKLVELEGSHTVQNVYDSLDVHLGQCYSVLVTANQDPKDYYM  277

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF KQ ++   II Y NG G  +             G  WS+NQFRSFRWNLTASA
Sbjct  278   VASTRFLKQVYTAKRIIRYTNGKGPASPELPEP-----PSGWIWSLNQFRSFRWNLTASA  332

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG INITRTIK+VNS S VDGKLRYA+NGVSH +  TP KLAEYFG+ +K
Sbjct  333   ARPNPQGSYHYGFINITRTIKIVNSASTVDGKLRYAINGVSHTDPTTPPKLAEYFGVVDK  392

Query  721   VFKYNIM-GDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKYN M  D PPE+AEK+ + PNV+N TFR FVEI+FENHEK+IQ++HL+G+SFFAVA+
Sbjct  393   VFKYNTMVDDPPPESAEKIVITPNVLNITFRTFVEIIFENHEKSIQSWHLNGYSFFAVAM  452

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRW+P+KRKNYNL+DAVSR++IQVYP SW A++ T DNAG+WNLRS+ WER YLGQQL
Sbjct  453   EPGRWNPDKRKNYNLLDAVSRNTIQVYPGSWTAILLTFDNAGLWNLRSETWERNYLGQQL  512

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             Y SVLSP RSLRDE+N+PD  +LCG+VKG+  P PY+
Sbjct  513   YVSVLSPARSLRDEYNIPDVAELCGIVKGLPKPQPYT  549



>gb|KHG27164.1| L-ascorbate oxidase [Gossypium arboreum]
Length=475

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/396 (65%), Positives = 319/396 (81%), Gaps = 5/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + + + D++NKGH +LKKILDSGR + R DGV +NGK  K  GK +PLFTMEAGKTY+YR
Sbjct  84    YTLLVGDFFNKGHTSLKKILDSGRNLGRCDGVHLNGKVAKGDGKDEPLFTMEAGKTYKYR  143

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CN G +TS+N RFQGHTM LVEMEGSHT+QN YDSLD+HVGQC SVLVTA++EP+DYY+
Sbjct  144   ICNTGTKTSLNVRFQGHTMKLVEMEGSHTMQNDYDSLDVHVGQCFSVLVTANQEPRDYYV  203

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+E +   II Y NG G  +S   P P      G AWS+NQFR+FRWNLT++A
Sbjct  204   VASTRFTKREVTATGIIRYKNGKGAASSELPPPPV-----GWAWSLNQFRTFRWNLTSNA  258

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSY YG INITRTIKL N+   VDGKLRYALNGVS++   TPLKLAEY+G+++K
Sbjct  259   ARPNPQGSYKYGSINITRTIKLANTAQIVDGKLRYALNGVSYVEPTTPLKLAEYYGVADK  318

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKY+ + D PP +  KVTLAP V+N T RNFVEI+FENHE  IQ+YHL G+SFFAV ++
Sbjct  319   VFKYDTIPDEPPSDNTKVTLAPIVLNMTHRNFVEIIFENHETAIQSYHLSGYSFFAVGMD  378

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G+WSPEKR NYNL+DAVSRH+IQV+PNSW+A++ T DN GMWNLRS++W+R YLGQQLY
Sbjct  379   IGKWSPEKRMNYNLLDAVSRHTIQVFPNSWSAILLTFDNCGMWNLRSEIWDRHYLGQQLY  438

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SV+SP RSL+DE+NLP+    CG+V+GM  PPP+S
Sbjct  439   ASVISPNRSLKDEYNLPEGVLTCGIVQGMPRPPPFS  474



>ref|XP_002299087.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE83892.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=551

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/396 (66%), Positives = 314/396 (79%), Gaps = 5/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V ++DWY   H TL+K LD GR++ARP GV+INGK+ K  GK +PLFTM+ GKTY+YR
Sbjct  160   YTVILNDWYTSSHATLRKYLDDGRSLARPTGVLINGKNAKGDGKDEPLFTMKPGKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CN G++ ++NFR QGHTM LVEMEGSH +QN Y++LD+HVGQC SVLVTA++ PKDYY+
Sbjct  220   ICNAGIKNTLNFRIQGHTMKLVEMEGSHVVQNVYEALDVHVGQCFSVLVTANQAPKDYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V ++RF KQ  +   II Y NG G  +      P      G AWS+NQFRSFRWNLTASA
Sbjct  280   VTTTRFNKQILTAKGIIRYTNGKGPASPELPEAPV-----GWAWSLNQFRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG INITRTIKLVNS S   GKLRYALNGVSH++ +TPLK+AEY+GI++K
Sbjct  335   ARPNPQGSYHYGSINITRTIKLVNSASREGGKLRYALNGVSHVDPETPLKIAEYYGIADK  394

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKYN + D P     KV   PNV+N TFRNFVEI+FENHEK++Q+YHLDG+SFFAVAIE
Sbjct  395   VFKYNTIKDMPSAKIGKVVTQPNVLNQTFRNFVEIIFENHEKSMQSYHLDGYSFFAVAIE  454

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G W+PEKRKNYNL+DAVSR +IQV+P SWAA+  T DNAGMWN+RS+MWE+ YLGQQLY
Sbjct  455   PGTWTPEKRKNYNLLDAVSRTTIQVFPKSWAAIFLTFDNAGMWNIRSEMWEKTYLGQQLY  514

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SVLSPE SLRDE+N+PD   LCG VKG+  P PY+
Sbjct  515   VSVLSPELSLRDEYNIPDNALLCGKVKGLPKPKPYT  550



>ref|XP_009611384.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=557

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/400 (65%), Positives = 319/400 (80%), Gaps = 10/400 (3%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F V ++DWY K H  LK +LD+GR + RP GV+INGK GK  GK +P++T+  GKTYR+R
Sbjct  160   FMVLVADWYTKSHTELKNLLDNGRALGRPQGVIINGKSGKGDGKDEPMYTLTPGKTYRFR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
              CNVGM+ S+N RFQGHTM LVE+EGSHT+QN Y+SLD+H+GQC+SVL+TAD++PKDY+L
Sbjct  220   FCNVGMKDSINVRFQGHTMKLVEIEGSHTVQNVYESLDVHLGQCMSVLITADQDPKDYFL  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+     A I YANG G  +            EG AWS+NQFRSFRWNLTASA
Sbjct  280   VASTRFTKEPHVATATIRYANGKGPASPQLPKA-----PEGWAWSLNQFRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTIKLV S   VDGKLRYA+NGVSH++  TP+KLAEY+G+ +K
Sbjct  335   ARPNPQGSYHYGQINITRTIKLVTSAGNVDGKLRYAINGVSHVDPATPIKLAEYYGVGDK  394

Query  721   VFKYNIMGD-----TPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFF  885
             VFKY+++ D     +  E  +K+TLAPNVVNAT+RNFVEI+FENH K++Q++HL GHSFF
Sbjct  395   VFKYDLIKDDYEPASGKEAQDKITLAPNVVNATYRNFVEIIFENHGKSVQSWHLSGHSFF  454

Query  886   AVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYL  1065
             AV IE GRW+PEKR+NYNL+DAVSR++IQVYPNSWAA+MTT+DNAG+WNLRS+  ER YL
Sbjct  455   AVGIEPGRWTPEKRRNYNLLDAVSRNTIQVYPNSWAAIMTTLDNAGLWNLRSNSLERNYL  514

Query  1066  GQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             G QLYFSVLSP  S++DE+N+PD   +CG VK M  P PY
Sbjct  515   GHQLYFSVLSPNHSVKDEYNMPDNDLVCGFVKDMPRPTPY  554



>emb|CAN69061.1| hypothetical protein VITISV_032605 [Vitis vinifera]
Length=562

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/397 (66%), Positives = 317/397 (80%), Gaps = 9/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  LKK LDSG +I RPDGV INGK      K +PLFTM+ G TYRYR
Sbjct  173   YTVLIGDWYKKSHTVLKKKLDSGHSIGRPDGVQINGKSED---KDEPLFTMKPGLTYRYR  229

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG+++S+NFR QGHTM LVE+EGSHT+QN YDSLD+H+GQC SVLVTA+++PKDYY+
Sbjct  230   ICNVGIKSSLNFRIQGHTMKLVELEGSHTVQNVYDSLDVHLGQCYSVLVTANQDPKDYYM  289

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF KQ ++   II Y NG G  +             G  WS+NQFRSFRWNLTASA
Sbjct  290   VASTRFLKQVYTAKRIIRYTNGKGPASPELPEP-----PSGWIWSLNQFRSFRWNLTASA  344

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG INITRTIK+VNS S VDGKLRYA+NGVSH +  TP KLAEYFG+ +K
Sbjct  345   ARPNPQGSYHYGFINITRTIKIVNSASTVDGKLRYAINGVSHTDPTTPPKLAEYFGVVDK  404

Query  721   VFKYNIM-GDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKYN M  D PPE+AEK+ + PNV+N TFR FVEI+FENHEK+IQ++HL+G+SFFAVA+
Sbjct  405   VFKYNTMVDDPPPESAEKIVITPNVLNITFRTFVEIIFENHEKSIQSWHLNGYSFFAVAM  464

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRW+P+KRKNYNL+DAVSR++IQVYP SW A++ T DNAG+WNLRS+ WER YLGQQL
Sbjct  465   EPGRWNPDKRKNYNLLDAVSRNTIQVYPGSWTAILLTFDNAGLWNLRSETWERNYLGQQL  524

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             Y SVLSP RSLRDE+N+PD  +LCG+VKG+  P PY+
Sbjct  525   YVSVLSPARSLRDEYNIPDVAELCGIVKGLPKPQPYT  561



>gb|KFK35575.1| hypothetical protein AALP_AA4G008600 [Arabis alpina]
Length=549

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/396 (66%), Positives = 322/396 (81%), Gaps = 5/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V + DWY  GH  LK +LDSGRT+  P+GV+INGK GKVGG  +PLFTM  GKTY+YR
Sbjct  159   YTVILGDWYTSGHTALKNLLDSGRTLGLPNGVLINGKSGKVGGNNEPLFTMNPGKTYKYR  218

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG ++++NFR Q H M LVEMEGSH +QN YDSLD+HVGQC +VLVTA++  KDYY+
Sbjct  219   LCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTANQAAKDYYM  278

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+E STV +I YA G+ + AS ELP  P     G AWS+NQFRSFRWNLTASA
Sbjct  279   VASTRFLKKELSTVGVIRYA-GSNVQASSELPKTPI----GWAWSLNQFRSFRWNLTASA  333

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITR+IKLVNSKS V+GK R+  NGVSH++TDTPLKLAEYF +SEK
Sbjct  334   ARPNPQGSYHYGRINITRSIKLVNSKSSVNGKTRFGFNGVSHVDTDTPLKLAEYFQMSEK  393

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKYN++ D P      +T+ PNV+N TFR FVEI+FENHEK++Q++HLDG+SFFAVA E
Sbjct  394   VFKYNVIKDEPASKITTLTVQPNVLNITFRTFVEIIFENHEKSMQSFHLDGYSFFAVASE  453

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              GRW+PEKRKNYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+  ER YLG+QLY
Sbjct  454   PGRWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSENSERKYLGEQLY  513

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SVLSPE+SLRDE+N+P    LCG+VKG+ +P  Y+
Sbjct  514   VSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPASYT  549



>ref|XP_004305574.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=553

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/396 (66%), Positives = 317/396 (80%), Gaps = 6/396 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H +L+K LD GR++ RP+GV+INGK+ +  G  +PLFTM+ GKTY++R
Sbjct  161   YTVLIGDWYTKSHNSLRKQLDMGRSLGRPEGVLINGKNARGDGTDEPLFTMKPGKTYKFR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             VCNVG++ S+NFR QGHTM LVEMEGSH +QN Y+SLD+H+GQC S LVTADKEPKDY++
Sbjct  221   VCNVGLKNSLNFRIQGHTMKLVEMEGSHVVQNTYESLDVHLGQCFSALVTADKEPKDYWM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V  +RF K   + + +I Y NGNG               EG+AWS+NQ RSFRWNLTASA
Sbjct  281   VADTRFTKTMLTGLGLIRYTNGNGPANPELPLP-----PEGLAWSLNQARSFRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG INITRTIKLVNS S VDGKLRYA+NGVSHI+T+TPLK AEYFG+++K
Sbjct  336   ARPNPQGSYHYGAINITRTIKLVNSASKVDGKLRYAVNGVSHIDTETPLKYAEYFGVADK  395

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+I+ D P PE   K+TLAPNVVN T+R+FVEI+FENH K+IQ++HLDG++FF VAI
Sbjct  396   VFKYDIIKDDPSPEAEAKITLAPNVVNQTYRDFVEIIFENHGKSIQSWHLDGYAFFPVAI  455

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRW+PEKR+NYNL+DA+SRH++QVYP SWAA+M T DNAGMWNLRS   ERAYLGQQL
Sbjct  456   EFGRWAPEKRRNYNLLDAISRHTVQVYPGSWAAIMLTFDNAGMWNLRSAQAERAYLGQQL  515

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             Y SV +  RSLRDE+ L D   LCG+VKG+  PPPY
Sbjct  516   YLSVENVARSLRDEYMLLDTTPLCGVVKGLPKPPPY  551



>ref|XP_011048127.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Populus euphratica]
Length=537

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/398 (65%), Positives = 320/398 (80%), Gaps = 7/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V ++DWY K H  L+K+LDSGR++ARPDGV+INGK+    GK +PLFTM+  KTY+YR
Sbjct  144   YTVVLNDWYTKSHTALQKLLDSGRSLARPDGVLINGKNAMGDGKDEPLFTMKPEKTYKYR  203

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CN G++ ++NFR QGHTM LVEMEGSH +QN Y+SLD+HVGQC SVLVTA++ PKDYY+
Sbjct  204   ICNAGLKNTLNFRIQGHTMKLVEMEGSHVVQNVYESLDVHVGQCFSVLVTANQAPKDYYM  263

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             + S+RF KQ  + + II Y NG G  +      P      G AWS+NQFRSFRWNLTASA
Sbjct  264   MASTRFNKQVLTYMGIIRYTNGKGPASPEFPEAPV-----GWAWSLNQFRSFRWNLTASA  318

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG INITRTIKLVNS S   GKLRYALNGVSH++ +TPLK+AEY+G+++K
Sbjct  319   ARPNPQGSYHYGSINITRTIKLVNSASREGGKLRYALNGVSHVDPETPLKIAEYYGVADK  378

Query  721   VFKYNIMGDTPPENAE--KVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             +FKY+ M D+P  N    K+   PNV+N TFRNFVEI+FENHEK++Q+YHLDG+SFFAVA
Sbjct  379   LFKYDTMQDSPQANIAHAKIVSQPNVLNLTFRNFVEIIFENHEKSMQSYHLDGYSFFAVA  438

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             +E G W+PEKRK+YNL+DAVSR ++QV+P SWAA++ T DNAGMWN+RS+MWERAYLGQQ
Sbjct  439   VEPGTWTPEKRKHYNLLDAVSRTTVQVFPKSWAAILLTFDNAGMWNIRSEMWERAYLGQQ  498

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             LY SVLSP RSLRDE+N+PD   LCGLVK +  P PYS
Sbjct  499   LYASVLSPARSLRDEYNIPDNTLLCGLVKDLPKPEPYS  536



>ref|XP_010034521.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW52299.1| hypothetical protein EUGRSUZ_J01719 [Eucalyptus grandis]
Length=551

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/397 (66%), Positives = 311/397 (78%), Gaps = 6/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  LK  LDSGR + RPDGV+INGK  K  GK +PLFTM+ GKTY+YR
Sbjct  159   YTVMIGDWYTKSHTQLKSFLDSGRALGRPDGVLINGKSNKSRGKDEPLFTMKPGKTYKYR  218

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ S+NFR Q H M LVEMEGSHT+QN Y+SLD+HVGQC  VLVTADK+PKDY +
Sbjct  219   ICNVGLKNSLNFRIQDHPMKLVEMEGSHTVQNNYESLDVHVGQCFGVLVTADKKPKDYLM  278

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   +T A++SY NG G  +      P      G AWS+NQFRSFRWNLTASA
Sbjct  279   VASTRFTKTVLTTTAVVSYTNGKGQASPEIPKAPV-----GWAWSLNQFRSFRWNLTASA  333

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG INITRTIKLVNS S V+ KLRYA+NGVSH    TPLKLAEY+ + +K
Sbjct  334   ARPNPQGSYHYGHINITRTIKLVNSASKVNDKLRYAINGVSHEEPKTPLKLAEYYNVVDK  393

Query  721   VFKYNIMGDTPPEN-AEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKYN + D PP    +KVT+ PNV N TFR FVEI+ ENHE +IQ++HLDG+SFFAVAI
Sbjct  394   VFKYNAIQDDPPATVGDKVTVEPNVANITFRTFVEIILENHENSIQSWHLDGYSFFAVAI  453

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRW+P+KRKNYNL+DAVSRH++ V+P SWAA+M T DNAG+WNLRS++ ER YLGQQ+
Sbjct  454   EPGRWTPDKRKNYNLLDAVSRHTVPVFPKSWAAIMLTFDNAGIWNLRSELLERRYLGQQM  513

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             Y SVLSPERSLRDE+N+PD   LCG+VK M  PPPYS
Sbjct  514   YLSVLSPERSLRDEYNIPDNALLCGIVKDMPKPPPYS  550



>ref|XP_011048128.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=551

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/396 (66%), Positives = 314/396 (79%), Gaps = 5/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V ++DWY   H TL+K LD GR++ARP GV+INGK+ K  GK +PLF M+  KTY+YR
Sbjct  160   YTVILNDWYTSSHATLRKYLDDGRSLARPTGVLINGKNAKGDGKDEPLFKMKPEKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CN G++ ++NFR QGHTM LVEMEGSH +QN Y+SLD+HVGQC SVLVTA++ PKDYY+
Sbjct  220   ICNAGIKNTLNFRIQGHTMKLVEMEGSHVVQNVYESLDVHVGQCFSVLVTANQAPKDYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF KQ  +   II Y NG G  +      P      G AWS+NQFRSFRWNLTASA
Sbjct  280   VASTRFNKQVLTAKGIIRYTNGKGPASPEFPEAPV-----GWAWSLNQFRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG INITRTIKLVNS S   GKLRY+LNGVSH++ +TPLK+AEY+GI++K
Sbjct  335   ARPNPQGSYHYGSINITRTIKLVNSASREGGKLRYSLNGVSHVDPETPLKIAEYYGIADK  394

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKYN + D P     KV   PNV+N TFRNFVEI+FENHEK++Q+YHLDG+SFFAVAIE
Sbjct  395   VFKYNTIKDMPSAKIGKVVTQPNVLNQTFRNFVEIIFENHEKSMQSYHLDGYSFFAVAIE  454

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G W+PEKRKNYNL+DAVSR +IQV+P SWAA++ T DNAGMWN+RS+MWE+AYLGQQLY
Sbjct  455   PGTWTPEKRKNYNLLDAVSRTTIQVFPKSWAAILLTFDNAGMWNIRSEMWEKAYLGQQLY  514

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SVLSPE SLRDE+N+PD   LCG VKG+  P PY+
Sbjct  515   VSVLSPELSLRDEYNIPDNALLCGKVKGLPKPKPYT  550



>ref|XP_009339221.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=552

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/397 (65%), Positives = 318/397 (80%), Gaps = 6/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY+K H  LKK LDSGR +ARPDGV+INGK  K  GK +PLFTM+AGKTY+YR
Sbjct  160   YTVMIGDWYSKSHSQLKKFLDSGRAMARPDGVLINGKSAKGDGKDEPLFTMKAGKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ S+NFR QGH M LVE EGSHT+QN YDSLD+H+GQC +VLVTADKEPKDYY+
Sbjct  220   ICNVGLKNSLNFRIQGHQMKLVETEGSHTVQNTYDSLDVHIGQCFAVLVTADKEPKDYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   +   II Y NG G  +      P      G AWS+NQFRSFRWNLTASA
Sbjct  280   VASTRFSKSVLTGKGIIRYENGKGPASPEVPKAPV-----GWAWSLNQFRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKL+NS S  DGKLRYA+NG+SH++ +TPLKLA+Y+GI EK
Sbjct  335   ARPNPQGSYHYGKINITRTIKLINSASKADGKLRYAINGISHVDPETPLKLADYYGIREK  394

Query  721   VFKYNIMGDTPPEN-AEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFK++ M   P    AEK+T+ PNV+N T ++FVEI+FEN EK++QT+HL+G++FFAVA+
Sbjct  395   VFKFDTMKVDPQSTPAEKITMEPNVLNITIKDFVEIIFENPEKSLQTWHLNGYAFFAVAV  454

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G+W+PEKRKNYNL+DAVSRH+IQV+P SWAA++ T DNAGMWNLRS+  ER YLGQQL
Sbjct  455   EPGKWTPEKRKNYNLLDAVSRHTIQVFPKSWAAILLTFDNAGMWNLRSEQPERRYLGQQL  514

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             Y  V + +RSLR+E+N+PD   +CGLVKGM  PPPYS
Sbjct  515   YVGVENIKRSLRNEYNMPDNALVCGLVKGMPKPPPYS  551



>ref|XP_006299973.1| hypothetical protein CARUB_v10016186mg [Capsella rubella]
 gb|EOA32871.1| hypothetical protein CARUB_v10016186mg [Capsella rubella]
Length=551

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/394 (64%), Positives = 317/394 (80%), Gaps = 5/394 (1%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             + I+DW+ K H  LK  LDSGRT+  PDGV+INGK GKVG K +PLFTM  GKTY++R+C
Sbjct  162   ILINDWFTKSHTALKNFLDSGRTLGSPDGVLINGKSGKVGHKNEPLFTMNPGKTYKFRIC  221

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             NVG ++++NFR QGH M LVEMEGSH +QN YDSLD+HVGQC +VLVTAD+  K+YY+V 
Sbjct  222   NVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQVAKNYYMVA  281

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+RF K+E STV ++SY   N   ++     P      G AWS+NQFRSFRWNLTASAAR
Sbjct  282   STRFLKKEVSTVGVLSYEGSNVEPSTELPKAPV-----GWAWSLNQFRSFRWNLTASAAR  336

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYG+INITRTIKL N+K+ V+GK+R+  NGVSH++T+TPLKL EYFG ++KVF
Sbjct  337   PNPQGSYHYGKINITRTIKLANTKNVVNGKVRFGFNGVSHVDTETPLKLVEYFGFADKVF  396

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
             KYN++ D P      +T+ PNV+N TFR FVEIVFENHEK++Q++HLDGHSFFAVA E G
Sbjct  397   KYNVIKDEPAAKITTLTVEPNVLNITFRTFVEIVFENHEKSMQSFHLDGHSFFAVASEPG  456

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
             RW+PEKR NYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+ WER YLG+Q+Y S
Sbjct  457   RWTPEKRNNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSENWERRYLGEQMYVS  516

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             VLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  517   VLSPEKSLRDEYNIPLNTNLCGIVKGLPLPAPYT  550



>ref|XP_009376784.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=706

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/398 (65%), Positives = 320/398 (80%), Gaps = 5/398 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  L+K LDSGR++ARPDGV+INGK  K  GK +PLFTM+AGKTY+YR
Sbjct  160   YTVIIGDWYTKSHSQLRKFLDSGRSMARPDGVLINGKSAKGDGKDEPLFTMKAGKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ S+NFR QGH M LVEMEGSHT+QN YDSLD+H+GQC S+LVTADKEPKDYY+
Sbjct  220   ICNVGLKNSLNFRIQGHQMKLVEMEGSHTVQNTYDSLDVHIGQCFSMLVTADKEPKDYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   +   II Y NG G  +      P      G AWS+NQFRSFRWNLTASA
Sbjct  280   VASTRFTKSVLTGKGIIRYENGKGPVSPEVPKAPV-----GWAWSLNQFRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKL+NS S  DGKLRYA+NG+SH++ +TPLKLA+Y+GI EK
Sbjct  335   ARPNPQGSYHYGKINITRTIKLINSASKADGKLRYAINGISHVDPETPLKLADYYGIREK  394

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFK++ M   P   AEK+T+ PNV+N T ++FVEI+FEN EK++QT+HL+G++FFAVA+E
Sbjct  395   VFKFDTMKVDPQSPAEKITMEPNVLNITIKDFVEIIFENPEKSLQTWHLNGYAFFAVAVE  454

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G+W+PEKRKNYNL+DA+SRH+IQV+P SWAA++ T DNAGMWNLRS+  ER YLGQQLY
Sbjct  455   PGKWTPEKRKNYNLLDAMSRHTIQVFPKSWAAILLTFDNAGMWNLRSEQPERRYLGQQLY  514

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSGF  1194
               V + +RSLR+E+N+PD   +CGLVKGM  PPPYS F
Sbjct  515   VGVENIKRSLRNEYNMPDNALVCGLVKGMPKPPPYSTF  552



>ref|XP_011048126.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Populus euphratica]
Length=553

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/398 (65%), Positives = 319/398 (80%), Gaps = 7/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V ++DWY K H  L+K+LDSGR++ARPDGV+INGK+    GK +PLFTM+  KTY+YR
Sbjct  160   YTVVLNDWYTKSHTALQKLLDSGRSLARPDGVLINGKNAMGDGKDEPLFTMKPEKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CN G++ ++NFR QGHTM LVEMEGSH +QN Y+SLD+HVGQC SVLVTA++ PKDYY+
Sbjct  220   ICNAGLKNTLNFRIQGHTMKLVEMEGSHVVQNVYESLDVHVGQCFSVLVTANQAPKDYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             + S+RF KQ  +   II Y NG G  +      P      G AWS+NQFRSFRWNLTASA
Sbjct  280   MASTRFNKQVLTAKGIIRYTNGKGPASPEFPEAPV-----GWAWSLNQFRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG INITRTIKLVNS S   GKLRYALNGVSH++ +TPLK+AEY+G+++K
Sbjct  335   ARPNPQGSYHYGSINITRTIKLVNSASREGGKLRYALNGVSHVDPETPLKIAEYYGVADK  394

Query  721   VFKYNIMGDTPPENAE--KVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             +FKY+ M D+P  N    K+   PNV+N TFRNFVEI+FENHEK++Q+YHLDG+SFFAVA
Sbjct  395   LFKYDTMQDSPQANIAHAKIVSQPNVLNLTFRNFVEIIFENHEKSMQSYHLDGYSFFAVA  454

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             +E G W+PEKRK+YNL+DAVSR ++QV+P SWAA++ T DNAGMWN+RS+MWERAYLGQQ
Sbjct  455   VEPGTWTPEKRKHYNLLDAVSRTTVQVFPKSWAAILLTFDNAGMWNIRSEMWERAYLGQQ  514

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             LY SVLSP RSLRDE+N+PD   LCGLVK +  P PYS
Sbjct  515   LYASVLSPARSLRDEYNIPDNTLLCGLVKDLPKPEPYS  552



>ref|XP_004505353.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=545

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/390 (67%), Positives = 316/390 (81%), Gaps = 9/390 (2%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             V I DW+ K H TLKK LDSGR++ RPDGV I GK   V    +PL+TME+GKTY+YR+C
Sbjct  160   VLIGDWFGKSHTTLKKFLDSGRSMGRPDGVHIMGKSNSV----EPLYTMESGKTYKYRIC  215

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             NVG++ ++NFR QGH+M LVEMEGSHT+QN YDSLD+HVGQC SVLVTADKEPKDYYLV 
Sbjct  216   NVGLKDTLNFRIQGHSMKLVEMEGSHTVQNMYDSLDVHVGQCYSVLVTADKEPKDYYLVA  275

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+RF K   +T A+I Y+NG G  +    P P      G AWS+NQ RSFRWNLTASAAR
Sbjct  276   STRFTKNVLTTTAVIRYSNGVGPASPIIPPAPV-----GWAWSLNQLRSFRWNLTASAAR  330

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYGQINITRTIKLVN+ S V+GKLRYA+NGVSH++++TPLKLAEY+G+++KVF
Sbjct  331   PNPQGSYHYGQINITRTIKLVNTASRVNGKLRYAINGVSHVDSETPLKLAEYYGVADKVF  390

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
             KY+I+ D PP     +TLAPNV+NATFR F+EI+ EN  KTIQ+Y+LDG+SFFAVA+E G
Sbjct  391   KYDIISDDPPTVITDITLAPNVINATFRTFIEIILENPTKTIQSYNLDGYSFFAVAVEPG  450

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
             +W+PEKRKNYNL+D VSRH+IQV+P SWAA+M T DNAGMWNLRS+  E  YLGQQLY S
Sbjct  451   KWTPEKRKNYNLLDGVSRHTIQVFPKSWAAIMLTFDNAGMWNLRSENTENKYLGQQLYIS  510

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMP  1176
             VLSPE S RDE+NLPD Q +CG+VK +  P
Sbjct  511   VLSPEFSNRDEYNLPDTQLVCGIVKDLPRP  540



>ref|XP_010093150.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB53609.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=535

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/397 (66%), Positives = 317/397 (80%), Gaps = 5/397 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + + I DWY + H TL+K LD GR++ RPDGV+INGK  K  G  +PLFTM+ GK Y+YR
Sbjct  142   YTILIGDWYTESHSTLRKFLDIGRSLGRPDGVLINGKSAKSDGSDEPLFTMKPGKIYKYR  201

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ S+NFR QGH + LVEMEGSHT+QN Y+SLD+HVGQC +VLVTADK PKDY +
Sbjct  202   ICNVGLKNSLNFRIQGHPLKLVEMEGSHTVQNTYESLDVHVGQCFAVLVTADKAPKDYLV  261

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   +   II Y N      SP++   P     G AWS+NQFRSFRWNLT+SA
Sbjct  262   VASTRFTKNVLTGKGIIRYTNAKPAPPSPDVVEAPV----GWAWSLNQFRSFRWNLTSSA  317

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVNS   V GKLRYA+NGVSH++  TPLKLAEY+ +++K
Sbjct  318   ARPNPQGSYHYGKINITRTIKLVNSAVRVQGKLRYAINGVSHVDPYTPLKLAEYYQVADK  377

Query  721   VFKYNIMGDTPPENA-EKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+I+ D PP NA +K+T+A NVVN TFRNFVEI+FENHEK++QT+HLDG+SFFAVAI
Sbjct  378   VFKYDIISDEPPANAGDKITVATNVVNQTFRNFVEIIFENHEKSLQTWHLDGYSFFAVAI  437

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRWSP+KR  YNL+DAVSRH+IQV+P SWAA+M T DNAGMWNLRS++ ER YLGQQL
Sbjct  438   EPGRWSPDKRSRYNLLDAVSRHTIQVFPKSWAAIMLTFDNAGMWNLRSELTERRYLGQQL  497

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             Y SV SP RSLRDE+N+PD   LCG+VK +  PPPYS
Sbjct  498   YISVQSPARSLRDEYNMPDNALLCGVVKDLPWPPPYS  534



>gb|EYU39505.1| hypothetical protein MIMGU_mgv1a003980mg [Erythranthe guttata]
Length=551

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/395 (67%), Positives = 310/395 (78%), Gaps = 6/395 (2%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             V   DWY K H  LK+ +D+G+TI R DGV+INGK GK  G   P+FTM  GKTYRYR C
Sbjct  161   VLTGDWYRKSHTELKRHMDNGKTIGRTDGVIINGKQGKGDGSDPPMFTMIPGKTYRYRFC  220

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             NVGM+ S+N R QGHTM LVE+EGSHT+QN YDSLD+H+GQC SVLVTAD++PKDYYLV 
Sbjct  221   NVGMKNSLNVRIQGHTMKLVEIEGSHTVQNVYDSLDVHMGQCYSVLVTADQKPKDYYLVS  280

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+RF K    T A I Y   N   +      P      G AWS+NQFRSFRWNLTASAAR
Sbjct  281   STRFTKTVLMTTATIRYTGSNEPASPVLPEAPT-----GWAWSLNQFRSFRWNLTASAAR  335

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYG+INITRTIK VN+   VD KLRYA+NG+SH+NTDTPLKLAEY+GI ++VF
Sbjct  336   PNPQGSYHYGKINITRTIKFVNTAGTVDRKLRYAINGLSHMNTDTPLKLAEYYGIQDQVF  395

Query  727   KYNIMGDTPPEN-AEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEA  903
             KY+I+ D PP +   KVT+APNV+   FRNFVEI+FENHEK++Q++HL G+SFFAVAIE 
Sbjct  396   KYDIITDDPPADVGTKVTIAPNVITGIFRNFVEIIFENHEKSVQSWHLSGYSFFAVAIEP  455

Query  904   GRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYF  1083
             G WSPEKRKNYNLVDAVSRH+IQVYP  WAA+MTT+DNAGMWN+RS + ER YLGQQLY 
Sbjct  456   GTWSPEKRKNYNLVDAVSRHTIQVYPKGWAAIMTTLDNAGMWNMRSLLLERNYLGQQLYV  515

Query  1084  SVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             SVLSP RSLRDE+N+P+ Q LCG VK +  P PYS
Sbjct  516   SVLSPARSLRDEYNMPETQLLCGKVKNLPFPAPYS  550



>ref|XP_010480096.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Camelina sativa]
 ref|XP_010480097.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Camelina sativa]
Length=549

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/396 (65%), Positives = 322/396 (81%), Gaps = 5/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V + DWY  GH  LK +LDSGRT+  P+GV+INGK GKVGG  +PLFTM+ GKTY+YR
Sbjct  159   YTVLLGDWYTTGHTALKSLLDSGRTLGLPNGVLINGKSGKVGGNNEPLFTMKPGKTYKYR  218

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG ++++NFR Q H M LVEMEGSH +QN YDSLD+HVGQC SVLVTA++  KDYY+
Sbjct  219   LCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVTANQAAKDYYM  278

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+E STV +I Y  G+ + AS ELP  P     G AWS+NQFRSFRWNLTASA
Sbjct  279   VASTRFLKKELSTVGVIRY-EGSNVQASAELPKAPV----GWAWSLNQFRSFRWNLTASA  333

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITR+IKLVN+KS VDGKLR+  NGVSH++T+TPLKLAEYF +++K
Sbjct  334   ARPNPQGSYHYGKINITRSIKLVNTKSMVDGKLRFGFNGVSHVDTETPLKLAEYFQMADK  393

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKYN++ D P      +T+ PNV+N TFR FVEI+FENHEK++Q++HLDG+SFFAVA E
Sbjct  394   VFKYNVIKDEPAAKITALTVEPNVLNITFRTFVEIIFENHEKSMQSFHLDGYSFFAVASE  453

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G+W+PE RKNYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+R++ WER YLG+QLY
Sbjct  454   PGKWTPESRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRAENWERRYLGEQLY  513

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SV SPE+SLRDE+N+P    LCG+VKG+ +P  Y+
Sbjct  514   VSVQSPEKSLRDEYNIPLNTNLCGIVKGLPLPTVYT  549



>ref|XP_010501174.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=549

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/396 (65%), Positives = 321/396 (81%), Gaps = 5/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V + DWY  GH  LK +LDSGRT+  P+GV+INGK GKVGG  +PLFTM+ GKTY+YR
Sbjct  159   YTVLLGDWYTTGHTALKNLLDSGRTLGLPNGVLINGKSGKVGGNNEPLFTMKPGKTYKYR  218

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG ++++NFR Q H M LVEMEGSH +QN YDSLD+HVGQC SVLVTA++  KDYY+
Sbjct  219   LCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVTANQAAKDYYM  278

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+E  TV +I Y  G+ + AS +LP  P     G AWS+NQFRSFRWNLTASA
Sbjct  279   VASTRFLKKELGTVGVIRY-EGSNVQASTKLPKAPV----GWAWSLNQFRSFRWNLTASA  333

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITR+IKLVN+KS VDGKLR+  NGVSH++T+TPLKLAEYF ++EK
Sbjct  334   ARPNPQGSYHYGKINITRSIKLVNTKSMVDGKLRFGFNGVSHVDTETPLKLAEYFQMAEK  393

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKYN++ D P      +T+ PNV+N TFR FVEI+FENHEK++Q++HLDG+SFFAVA E
Sbjct  394   VFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVEIIFENHEKSMQSFHLDGYSFFAVASE  453

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G+W+PE RKNYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+R++ WER YLG+QLY
Sbjct  454   PGKWTPESRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRAENWERRYLGEQLY  513

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SV SPE+SLRDE+N+P    LCG+VKG+ +P  Y+
Sbjct  514   VSVQSPEKSLRDEYNIPLNTNLCGIVKGLPLPTVYT  549



>ref|XP_004250092.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=555

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/395 (66%), Positives = 314/395 (79%), Gaps = 7/395 (2%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             V   DWY K H  LK++LDSGR + RP GV+INGK GK  GK +P+FT+ AGKTYR+R C
Sbjct  163   VLAGDWYTKSHVELKRMLDSGRALGRPTGVLINGKSGKGDGKDEPMFTVIAGKTYRFRFC  222

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             NVGM+ S+N R QGHTM LVE+EGSHT+QN Y+S+D+H+GQC SVLVTA++EPKDYYLVV
Sbjct  223   NVGMKDSINVRMQGHTMKLVEIEGSHTVQNVYESIDIHLGQCFSVLVTANQEPKDYYLVV  282

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+RF K      A I YANG G  +            EG AWS+NQFRSFRWNLTASAAR
Sbjct  283   STRFTKDSHVATATIRYANGKGPASPELPKA-----PEGWAWSLNQFRSFRWNLTASAAR  337

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYGQINITRTIKLV S   VDGKLRYALNGVSH++T TP+KLAEY+G  +KVF
Sbjct  338   PNPQGSYHYGQINITRTIKLVTSAGQVDGKLRYALNGVSHVDTATPIKLAEYYGAGDKVF  397

Query  727   KYNIMGDT--PPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             KYN++ D   P    +K+T+APNVVNAT+RN+VEIV ENH KT+Q++HL GHSFFAV IE
Sbjct  398   KYNLIKDEYEPNPGQDKITVAPNVVNATYRNYVEIVIENHGKTVQSWHLSGHSFFAVGIE  457

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              GRW+PE+RKNYNL+DAVSR++IQVYP S+A +MTT+DNAG+WNLRS+  ER YLG QLY
Sbjct  458   PGRWAPERRKNYNLLDAVSRNTIQVYPKSFAVIMTTLDNAGLWNLRSNSLERNYLGHQLY  517

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             FSVLSP +S++DE+N+PD   LCG+VK M  P PY
Sbjct  518   FSVLSPNKSIKDEYNMPDNDLLCGIVKDMPKPTPY  552



>gb|KFK35574.1| hypothetical protein AALP_AA4G008500 [Arabis alpina]
Length=555

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/398 (65%), Positives = 315/398 (79%), Gaps = 6/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I+DWY K H  LKK LDSGRTI RPDG++INGK GK  G   PLFT++ GKTYR R
Sbjct  162   YTVLINDWYTKSHTQLKKFLDSGRTIGRPDGILINGKAGKGDGSDQPLFTLKQGKTYRVR  221

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG+++S+NFR Q H M LVEMEGSH +QN YDSLD+HVGQC  V+VTAD+EPKDYY+
Sbjct  222   ICNVGLKSSLNFRIQNHKMRLVEMEGSHVLQNDYDSLDVHVGQCYGVIVTADQEPKDYYM  281

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
               S+RF K   ST  ++ Y  G G  +S     P      G AWS+NQFRSFRWNLTASA
Sbjct  282   AASTRFLKNALSTTGLLRYEGGKGPASSQLPAAPV-----GWAWSLNQFRSFRWNLTASA  336

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYALNGVSH +++TPLKLAEYFG+++K
Sbjct  337   ARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGVSHTDSETPLKLAEYFGVADK  396

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+I+ D P PE  +K+ + PNV+N T R F+E++FENHEK++Q++HLDG+SFFAVA+
Sbjct  397   VFKYDIISDNPTPEQIKKIKMEPNVLNITHRTFIEVIFENHEKSVQSWHLDGYSFFAVAV  456

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS+  ER YLGQQL
Sbjct  457   EPGVWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSENSERRYLGQQL  516

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1191
             Y SVLSPE+SLRDE+N+P+    CGLVKG     PY+G
Sbjct  517   YASVLSPEKSLRDEYNMPETSLQCGLVKGKPKVNPYAG  554



>ref|XP_003556690.2| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=557

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/394 (66%), Positives = 319/394 (81%), Gaps = 9/394 (2%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             V I DW+ K H  LK+ LDSGR+I RP GV INGK+G     ++PL+TME GKTY+YR+C
Sbjct  172   VLIGDWFGKSHTALKQKLDSGRSIGRPVGVHINGKNGG----LEPLYTMEPGKTYKYRIC  227

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             NVG++ S+NFR QGH + LVE EGSH +QN YDSLD+HVGQC +VLVTAD+EPKDY++V 
Sbjct  228   NVGLKDSLNFRIQGHPLKLVETEGSHVVQNNYDSLDVHVGQCYTVLVTADQEPKDYFMVA  287

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+RF K+  +   +I Y+NG G  +    P       +G AWSINQFRSFRWNLTASAAR
Sbjct  288   STRFTKKVLTATRVIRYSNGVGPASGGLPPA-----PQGWAWSINQFRSFRWNLTASAAR  342

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYGQINITRTIKLVN+ S  +GKLRY LNGVSH++T TPLKLAEY+G+++KVF
Sbjct  343   PNPQGSYHYGQINITRTIKLVNTVSRANGKLRYGLNGVSHVDTQTPLKLAEYYGVADKVF  402

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
             KYN++ D+P      +T+APNV+NATFR+F+E++FEN  K IQ+Y+LDG+SFFA+A+E G
Sbjct  403   KYNLISDSPDTAFPDLTVAPNVINATFRDFIEVIFENPGKVIQSYNLDGYSFFALAVEPG  462

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
             +W+PEKRKNYNL+DA+SRH+IQV+PNSWAA+M T DNAGMWNLRS+M E  YLGQQLY S
Sbjct  463   KWTPEKRKNYNLLDAISRHTIQVFPNSWAAIMLTFDNAGMWNLRSEMAENRYLGQQLYVS  522

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             VLSP RSLRDE+NLP+ Q LCG+VK M  PPPYS
Sbjct  523   VLSPNRSLRDEYNLPETQLLCGIVKDMPKPPPYS  556



>dbj|BAL41449.1| SKU5 similar 1 [Linum grandiflorum]
Length=552

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/397 (64%), Positives = 318/397 (80%), Gaps = 6/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I+DW++K H  L+ +LDSGRT+ARP+GV++NGK+ K  GK +PLFTM+AGKTY+YR
Sbjct  160   YTVIINDWFSKTHSALRTMLDSGRTLARPEGVLLNGKNAKGDGKDEPLFTMKAGKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CN G++TS+NFR QGHTM LVEMEGSH +QN YDSLD+HVG C++VLVTAD++PKDYY+
Sbjct  220   ICNAGLKTSLNFRIQGHTMKLVEMEGSHVVQNMYDSLDVHVGGCMAVLVTADQDPKDYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             + S+RF K   +   II Y  G G   +     P      G AWS+NQFRSFRWNLTASA
Sbjct  280   IASTRFTKTVTTGKGIIRYEGGKGPADTEIPAAPV-----GWAWSLNQFRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRT++L N+    +GKLRYA NG+SH++  TPLKLAEY+G+++K
Sbjct  335   ARPNPQGSYHYGQINITRTLRLANTAGRSNGKLRYAFNGISHVDPPTPLKLAEYYGVADK  394

Query  721   VFKYNIMGDTPPENAE-KVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ M DTPP + +  + + PNV+N TFRNFVEI+FENHEK+IQ+YHLDG++FFAV I
Sbjct  395   VFKYDTMKDTPPSSDKVDIVMQPNVMNFTFRNFVEIIFENHEKSIQSYHLDGYAFFAVGI  454

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G WSPEKRKNYNL+DAVSR +IQVYP SWAA++ T DNAGMWN+RS+MWER YLGQQ 
Sbjct  455   EPGIWSPEKRKNYNLLDAVSRTTIQVYPKSWAAILLTFDNAGMWNVRSEMWERTYLGQQF  514

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             Y S LSP RSLRDE++LP+   LCG+VK M  P PY+
Sbjct  515   YVSTLSPGRSLRDEYSLPEGTLLCGIVKDMPKPAPYT  551



>ref|XP_002297609.2| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE82414.2| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=553

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/398 (65%), Positives = 318/398 (80%), Gaps = 7/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V ++DWY K H  L+K+LDSGR++ARPDGV+INGK+    GK +PLFTM+  KTY+YR
Sbjct  160   YTVVLNDWYTKSHTALQKLLDSGRSLARPDGVLINGKNAMGDGKDEPLFTMKPEKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CN G++ ++NFR Q HTM LVEMEGSH +QN Y+SLD+HVGQC SVLVTA++ PKDYY+
Sbjct  220   ICNAGLKNTLNFRIQDHTMKLVEMEGSHVVQNVYESLDVHVGQCFSVLVTANQAPKDYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF KQ  +   II Y NG G  +      P      G AWS+NQFRSFRWNLTASA
Sbjct  280   VASTRFNKQVLTAKGIIRYTNGKGPASPELPEAPV-----GWAWSLNQFRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG INITRTIKLVNS S   GKLRYALNGVSH++ +TPLK+AEY+G+++K
Sbjct  335   ARPNPQGSYHYGSINITRTIKLVNSASREGGKLRYALNGVSHVDPETPLKIAEYYGVADK  394

Query  721   VFKYNIMGDTPPENAE--KVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             +FKY+ M D+P  +    K+   PNV+N TFRNFVEI+FENHEK++Q+YHLDG+SFFAVA
Sbjct  395   LFKYDTMQDSPQADIAHAKIVSQPNVLNLTFRNFVEIIFENHEKSMQSYHLDGYSFFAVA  454

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             +E G W+PEKRK+YNL+DAVSR ++QV+P SWAA++ T DNAGMWN+RS+MWERAYLGQQ
Sbjct  455   VEPGTWTPEKRKHYNLLDAVSRTTVQVFPKSWAAILLTFDNAGMWNIRSEMWERAYLGQQ  514

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             LY SVLSP RSLRDE+N+PD   LCGLVK +  P PYS
Sbjct  515   LYASVLSPARSLRDEYNIPDNTLLCGLVKDLPKPEPYS  552



>ref|XP_010462411.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=549

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/396 (65%), Positives = 321/396 (81%), Gaps = 5/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V + DWY  GH  LK +LDSGRT+  P+GV+INGK GKVGG  +PLFTM+  KTY+YR
Sbjct  159   YTVLLGDWYTTGHTALKNLLDSGRTLGLPNGVLINGKSGKVGGNNEPLFTMKPRKTYKYR  218

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG ++++NFR Q H M LVEMEGSH +QN YDSLD+HVGQC SVLVTA++  KDYY+
Sbjct  219   LCNVGFKSTLNFRIQNHMMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVTANQAAKDYYM  278

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+E STV +I Y  G+ + AS ELP  P     G AWS+NQFRSFRWNLTASA
Sbjct  279   VASTRFLKKELSTVGVIRY-EGSNVQASTELPKAPV----GWAWSLNQFRSFRWNLTASA  333

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITR+IKLVN+KS VDGKLR+ LNGVSH++ +TPLKLAEYF ++EK
Sbjct  334   ARPNPQGSYHYGKINITRSIKLVNTKSMVDGKLRFGLNGVSHVDPETPLKLAEYFQMAEK  393

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKYN++ D P      +T+ PNV+N TFR FVEI+FENHEK++Q++HLDG+SFFAVA E
Sbjct  394   VFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVEIIFENHEKSMQSFHLDGYSFFAVASE  453

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G+W+PE RKNYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+R++ WER YLG+QLY
Sbjct  454   PGKWTPESRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRAENWERRYLGEQLY  513

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SV SPE+SLRDE+N+P    LCG+VKG+ +P  Y+
Sbjct  514   VSVQSPEKSLRDEYNIPLNTNLCGIVKGLPLPTVYT  549



>ref|XP_010093149.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB53608.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=550

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/397 (67%), Positives = 318/397 (80%), Gaps = 7/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K HKTLK  LDSGR++ RPDGV+INGK G       PLFTM+ GKTY+YR
Sbjct  159   YTVLIGDWYVKSHKTLKNFLDSGRSLGRPDGVLINGKSGN---DKKPLFTMKPGKTYKYR  215

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ S+NFR Q H M LVEMEGSHT+QN Y+SLD+HVGQC SVLVTADK PK+YY+
Sbjct  216   ICNVGLKDSLNFRIQDHPMKLVEMEGSHTVQNTYESLDVHVGQCFSVLVTADKAPKEYYM  275

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   +  AII Y NG   +AS +     P    G AWS+NQFRSFRWNLTASA
Sbjct  276   VASTRFTKTVLTGKAIIRYTNGRKGSASLKNIPEAPV---GWAWSLNQFRSFRWNLTASA  332

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+I ITRTIK+VNS S V GKLRY +NGVSH+N  TPLKLAEY+G+++K
Sbjct  333   ARPNPQGSYHYGKIPITRTIKIVNSASRVKGKLRYGINGVSHVNPVTPLKLAEYYGVADK  392

Query  721   VFKYNIMGDTPPEN-AEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+++ D PP+  + +VTLAPNVVN TFRNFVEI+FENHEK++Q++HL G+SFFAV+I
Sbjct  393   VFKYDLIKDEPPKKLSGEVTLAPNVVNQTFRNFVEIIFENHEKSLQSWHLAGYSFFAVSI  452

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRW PEKRKNYNL+DAVSRH+IQVYP S+AAV+ T DNAGMWNLRS++ E  YLGQQL
Sbjct  453   EPGRWRPEKRKNYNLLDAVSRHTIQVYPKSYAAVLLTFDNAGMWNLRSELTENRYLGQQL  512

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             Y SVLSP RSLRDE+N+PD   LCG+VK +  P PY+
Sbjct  513   YISVLSPARSLRDEYNMPDNALLCGIVKDLPKPHPYT  549



>gb|EPS68478.1| hypothetical protein M569_06286, partial [Genlisea aurea]
Length=533

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/397 (67%), Positives = 324/397 (82%), Gaps = 10/397 (3%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             +NV + DWY KG  +LKK+LD+GRT+ RPDGV+INGKH       +P+F+ EAGKT+R+R
Sbjct  145   YNVLVGDWYKKGQGSLKKLLDTGRTLGRPDGVIINGKHDSN----EPMFSFEAGKTHRFR  200

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             VCNVG++ S+NFR Q HT+TLVE+EGSHT+QN YDSLDLH+GQC SVLVTAD+ PKDYY 
Sbjct  201   VCNVGLKNSINFRIQAHTLTLVEIEGSHTVQNVYDSLDLHLGQCASVLVTADQTPKDYYF  260

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   +T AII Y NG+   ASPELP  P     G AWS+NQFRSFRWNLTASA
Sbjct  261   VASTRFTKTVLTTKAIIRY-NGSSTPASPELPEAPV----GWAWSVNQFRSFRWNLTASA  315

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIK VN+   VDGKLRY++NGVSH +  TPLKLAEYFG+ +K
Sbjct  316   ARPNPQGSYHYGKINITRTIKFVNAPGTVDGKLRYSVNGVSHTDPATPLKLAEYFGVGDK  375

Query  721   VFKYNIMGDTPPENA-EKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             +FKY+I+ D P  +A  K+T+AP V+NATFRNFVEI+FEN EK++Q++HL G+SFFAVAI
Sbjct  376   LFKYDIIKDDPSVDANSKITIAPIVLNATFRNFVEIIFENQEKSVQSWHLSGYSFFAVAI  435

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             + G+W+P +R  YNLVDAVSRH+I VYP SWAA+MTT+DNAGMWNLRS M ER YLGQQL
Sbjct  436   QPGKWTPARRAVYNLVDAVSRHTIHVYPKSWAAIMTTLDNAGMWNLRSMMLERQYLGQQL  495

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             YFSVLSP +SLRDE+N+P+ Q  CG+V+G+  P PY+
Sbjct  496   YFSVLSPAKSLRDEYNIPETQLQCGIVEGLPKPMPYT  532



>ref|XP_004234818.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=556

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/400 (66%), Positives = 320/400 (80%), Gaps = 9/400 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F V +SDWY K H  L+K LDSGR++ RPDGV+INGK G   GK +P+F+M  GKTYRYR
Sbjct  161   FFVLVSDWYTKSHTQLRKFLDSGRSMGRPDGVIINGKGGNGDGKDEPMFSMTPGKTYRYR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
              CN G + S+N R QGHTM LVE+EGSH +QN YDSLD+H+GQC+SVLVTADK+PKDY L
Sbjct  221   FCNAGNKDSINVRIQGHTMKLVEIEGSHVVQNMYDSLDIHLGQCVSVLVTADKDPKDYLL  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+  +  +II Y NG G  +      P      G AWS+NQFRSFRWNLTASA
Sbjct  281   VASTRFTKEPHTATSIIRYTNGKGPASPELPKAPI-----GWAWSLNQFRSFRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTIKLVN+   VDGKLRYA NG+SH+N  TP+KLAEY+G+ +K
Sbjct  336   ARPNPQGSYHYGQINITRTIKLVNTAGTVDGKLRYAFNGISHVNPTTPIKLAEYYGVEDK  395

Query  721   VFKYNIMGDT--PP--ENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFA  888
             VFKY++M D   PP  +  EK+TLAPNVV   +RN+VEI+FENHEK++Q++HL G+SFFA
Sbjct  396   VFKYDLMKDEYEPPAGKAEEKITLAPNVVKVIYRNYVEIIFENHEKSVQSFHLAGYSFFA  455

Query  889   VAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLG  1068
             VAIE G+W+PEKRKNYNL+DAVSR++IQVYPNSWAA+MTT+DNAG+WNLRS+  ER YLG
Sbjct  456   VAIEPGKWTPEKRKNYNLLDAVSRNTIQVYPNSWAAIMTTLDNAGLWNLRSNSLERQYLG  515

Query  1069  QQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             QQLYFS LSP+R L+DE+N+PD   LCG++K M +P PYS
Sbjct  516   QQLYFSALSPKRDLKDEYNMPDNDVLCGIIKDMPLPKPYS  555



>ref|XP_010534841.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=549

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/396 (65%), Positives = 311/396 (79%), Gaps = 5/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V ISDWY K H +LK +LDSGR +  PDGV+INGK  K+ GK  PLFTM+ GKTY+YR
Sbjct  159   YTVLISDWYTKSHTSLKNLLDSGRALGSPDGVLINGKSAKMDGKDQPLFTMKLGKTYKYR  218

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG ++++NFR Q H M LVEMEGSH +QN YDSLD+HVGQC +VLVTAD+   DYY+
Sbjct  219   ICNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQTATDYYM  278

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V SSRF K++ S   +I Y  G G  +      P      G AWS+NQFRSFRWNLTASA
Sbjct  279   VASSRFLKKQLSGTGLIRYEGGQGQASPVLPKAPV-----GWAWSLNQFRSFRWNLTASA  333

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVNS+  VD KLR+  NGVSHI+T+TPLKLAEYF ++EK
Sbjct  334   ARPNPQGSYHYGKINITRTIKLVNSQKVVDRKLRFGFNGVSHIDTETPLKLAEYFQMAEK  393

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKYN++ D P      +T+ PNV+N TFR FVE++FENHEK++Q+YHLDG+SFFAVA E
Sbjct  394   VFKYNVIKDEPAGKITGLTVEPNVLNITFRTFVEVIFENHEKSMQSYHLDGYSFFAVATE  453

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              GRWSP KR+NYNL+DAVSRH++QVYPNSW+A++ T DNAGMWN+RS+ WER YLGQQLY
Sbjct  454   PGRWSPAKRENYNLLDAVSRHTVQVYPNSWSAILLTFDNAGMWNIRSENWERRYLGQQLY  513

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SVLSPE+SLRDE+N+P    LCG+VK +  P  YS
Sbjct  514   VSVLSPEKSLRDEYNIPLNAGLCGIVKDLPKPSIYS  549



>ref|XP_004149657.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=546

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/398 (67%), Positives = 316/398 (79%), Gaps = 14/398 (4%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSG-RTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRY  177
             + V I DWY K H TLK+ILD+G R+IARP+GV+INGK  K  G  +PLFTM+  KTY+Y
Sbjct  160   YTVLIGDWYTKSHTTLKQILDNGHRSIARPEGVLINGKTAKGDGTDEPLFTMKPEKTYKY  219

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             RVCNVG++TS+NFRFQGHTM LVEMEGSHT+QN Y SLD+HVGQC SVLVTA++EPKDYY
Sbjct  220   RVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQNDYQSLDVHVGQCFSVLVTANQEPKDYY  279

Query  358   LVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTAS  537
             +V S+RF K       II Y NG G  +      P      G AWS+NQFR+F       
Sbjct  280   MVASTRFIKNVLIGKGIIRYTNGKGPASPEIPKAPM-----GWAWSLNQFRTF-------  327

Query  538   AARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISE  717
             +  PNPQGSYHYG INITRTIKL NS + VDGKLRYA+NGVSH++ +TPLKLAEYF I+E
Sbjct  328   SLEPNPQGSYHYGSINITRTIKLFNSATKVDGKLRYAINGVSHVDPETPLKLAEYFEIAE  387

Query  718   KVFKYNIMGDT-PPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             KVFKY+++ D  P E A  VT+APNVVNATFRNF+EI+FENHEK++Q++HLDG+SFFAVA
Sbjct  388   KVFKYDMISDEGPTEGATAVTIAPNVVNATFRNFIEIIFENHEKSLQSWHLDGYSFFAVA  447

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             IE GRWSPEKR NYNL+DAVSRH+IQV+PNSWAA++ T DNAGMWNLRS++ E  YLGQQ
Sbjct  448   IEPGRWSPEKRSNYNLLDAVSRHTIQVFPNSWAAILLTFDNAGMWNLRSELIENRYLGQQ  507

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             LY SVLSP RSLRDE+N+PD   LCGLVKGM +P PY+
Sbjct  508   LYISVLSPARSLRDEYNIPDHTLLCGLVKGMPLPKPYT  545



>ref|XP_011077090.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=558

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/390 (69%), Positives = 318/390 (82%), Gaps = 6/390 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             FNV + DWY+KGH TLKK LDSGR++ RPDGVVINGK G       P + +  GKTYRYR
Sbjct  161   FNVLVGDWYSKGHVTLKKFLDSGRSLGRPDGVVINGKSGNEA----PKWNLIPGKTYRYR  216

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVGM+ SVN R QGHTM LVE+EGSHT+QN YDSLD+H+GQC SVLVTAD+ PKDY  
Sbjct  217   ICNVGMKNSVNVRIQGHTMKLVEIEGSHTVQNVYDSLDIHLGQCNSVLVTADQTPKDYAF  276

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             VVS+RF K   +T   I Y  G+ I AS ELP  P    EGIAWSINQFRS RWNLTASA
Sbjct  277   VVSTRFTKTVLTTTGTIHY-EGSNIPASTELPAAPGNAPEGIAWSINQFRSLRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIK+VNS S  + KLRYA+NGVSH + +TPLKLAEYFG+S+K
Sbjct  336   ARPNPQGSYHYGKINITRTIKIVNSASRGEDKLRYAVNGVSHTDPETPLKLAEYFGVSDK  395

Query  721   VFKYNIMGDTPPENAEK-VTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+++ D P  +AE  +T+APNVVN TFRNF+EI+FENHEK+IQ++HLDG+SFFAVAI
Sbjct  396   VFKYDLIKDEPSADAEDHITIAPNVVNGTFRNFIEIIFENHEKSIQSWHLDGYSFFAVAI  455

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E GRW+P KR NYNL+DA+SRH+IQVYPNSWAA+MTT+DN GMWNLRS   ER YLGQQL
Sbjct  456   EPGRWAPAKRANYNLIDAISRHTIQVYPNSWAAIMTTLDNCGMWNLRSVSLERNYLGQQL  515

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGM  1167
             YFSV+SPE SLRDE+ LP+ Q LCG+VK +
Sbjct  516   YFSVVSPEHSLRDEYLLPEGQLLCGIVKDL  545



>ref|XP_006306349.1| hypothetical protein CARUB_v10012235mg [Capsella rubella]
 gb|EOA39247.1| hypothetical protein CARUB_v10012235mg [Capsella rubella]
Length=555

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/398 (64%), Positives = 314/398 (79%), Gaps = 6/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I+DWY K H  LKK LDSGRT+ RPDG++INGK GK  G   PLFT++ GKTYR R
Sbjct  162   YTVLINDWYTKSHTQLKKFLDSGRTLGRPDGILINGKSGKTDGSDKPLFTLKPGKTYRVR  221

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++TS+NFR Q H M LVEMEGSH +QN YDSLD+HVGQC  V+VTA++E KDYY+
Sbjct  222   ICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVIVTANQEAKDYYM  281

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+  +T  ++ Y  G G  +S     P      G AWS+NQFRSFRWNLTASA
Sbjct  282   VASTRFLKKPLTTTGLLRYEGGKGPASSQLPAAPV-----GWAWSLNQFRSFRWNLTASA  336

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYA++GVSH + +TPLKLAEYFG+++K
Sbjct  337   ARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYAMSGVSHTDPETPLKLAEYFGVADK  396

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKYNI+ D P PE  + + + PNV+N T R F+E+VFENHEK++Q++HLDG+SFFAVA+
Sbjct  397   VFKYNIITDNPNPEQIKTIKIEPNVLNITHRTFIEVVFENHEKSVQSWHLDGYSFFAVAV  456

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS+  ER YLGQQL
Sbjct  457   EPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSENSERRYLGQQL  516

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1191
             Y SVLSPE+SLRDE+N+P+    CGLVKG     PY+G
Sbjct  517   YASVLSPEKSLRDEYNMPETSLQCGLVKGKPKVNPYAG  554



>ref|XP_007157830.1| hypothetical protein PHAVU_002G101700g [Phaseolus vulgaris]
 gb|ESW29824.1| hypothetical protein PHAVU_002G101700g [Phaseolus vulgaris]
Length=547

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/396 (65%), Positives = 312/396 (79%), Gaps = 9/396 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F V I DW+ K H+TLK+ LDSGR+I RP GV INGK+G     ++P +TME GKTY+YR
Sbjct  160   FWVLIGDWFGKSHQTLKQFLDSGRSIGRPSGVHINGKNGG----LEPAYTMEPGKTYKYR  215

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ S+NFR QGH++ LVEMEGSH +QN YDSLD+HVGQC SVLVTAD+EPKDYY+
Sbjct  216   ICNVGLKDSLNFRIQGHSLKLVEMEGSHVVQNQYDSLDVHVGQCFSVLVTADQEPKDYYM  275

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+      II Y+NG G  +    P       EG AWS+NQFRSFRWNLTASA
Sbjct  276   VASTRFAKKTLGATRIIRYSNGVGPASPELPPA-----PEGWAWSLNQFRSFRWNLTASA  330

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTIKLVN+ S   GKLRY LNGVSH++ +TPLKLAEY+G+S++
Sbjct  331   ARPNPQGSYHYGQINITRTIKLVNTLSRTGGKLRYGLNGVSHVDPETPLKLAEYYGVSDQ  390

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKYNI+ D P      +  APNV+NATFR+F+EI+FEN  K  Q+Y+LDG+SFFAV +E
Sbjct  391   VFKYNIISDDPASPIGDLACAPNVINATFRDFIEIIFENPTKVPQSYNLDGYSFFAVGME  450

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G+WSPEKRKNYN +D VSRH+IQV+P SW+A+M T DNAGMWNLRS++ E  YLGQQLY
Sbjct  451   PGKWSPEKRKNYNNLDGVSRHTIQVFPKSWSAIMLTFDNAGMWNLRSELGENRYLGQQLY  510

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SVLSP RSLRDE+N+PD Q LCG+V  +  PPPYS
Sbjct  511   VSVLSPNRSLRDEYNMPDTQVLCGIVTDLPEPPPYS  546



>gb|AGW80453.1| pollen-specific protein [Gossypium hirsutum]
Length=551

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/396 (65%), Positives = 318/396 (80%), Gaps = 5/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + + + D++NKGH +LKKILDSGR + R DGV +NGK  K   K +PLFTMEAGKTY+YR
Sbjct  160   YTLLVGDFFNKGHTSLKKILDSGRNLGRCDGVHLNGKVAKGDRKDEPLFTMEAGKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CN G++TS+N RFQGHTM LVEMEGSHT+QN YDSLD+HVGQC SVLVTA++EP+DYY+
Sbjct  220   ICNTGIKTSLNVRFQGHTMKLVEMEGSHTMQNDYDSLDVHVGQCFSVLVTANQEPRDYYV  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF ++E +   II Y NG G  +S   P P      G AWS+NQFR+FRWNLT++A
Sbjct  280   VASTRFTRREVTATGIIRYKNGKGAASSELPPPPV-----GWAWSLNQFRTFRWNLTSNA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSY YG INITRTIKL N+   VDGKLRYALNGVS++   TPLKLAEY+G+++K
Sbjct  335   ARPNPQGSYKYGSINITRTIKLANTAQKVDGKLRYALNGVSYVEPTTPLKLAEYYGVADK  394

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKY+ + D P  +  KVTLAP V+N T RNFVEI+FENHE  IQ+YHL G+SFFAV ++
Sbjct  395   VFKYDTIPDEPQSDNTKVTLAPIVLNMTHRNFVEIIFENHESAIQSYHLSGYSFFAVGMD  454

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G+WSPEKR NYNL+DAVSRH+IQV+PNSW+A++ T DN GMWNLRS++W+R YLGQQLY
Sbjct  455   VGKWSPEKRMNYNLLDAVSRHTIQVFPNSWSAILLTFDNCGMWNLRSEIWDRHYLGQQLY  514

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SV+SP RSL+DE+NLP+    CG+V+GM  PPP+S
Sbjct  515   ASVISPNRSLKDEYNLPEGVLTCGIVQGMPRPPPFS  550



>ref|XP_007014661.1| SKU5 similar 12 [Theobroma cacao]
 gb|EOY32280.1| SKU5 similar 12 [Theobroma cacao]
Length=552

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/397 (64%), Positives = 315/397 (79%), Gaps = 6/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + +   DW++KGH TLKK+LDSGR + R DGV INGK  K  GK +PLFTME GKTY+YR
Sbjct  160   YTILAGDWFSKGHTTLKKMLDSGRNLGRCDGVHINGKVAKGDGKDEPLFTMEPGKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++TS+N RFQGH M LVEMEGSHT+QN Y+SLD+HVGQC  VLVTAD+EP+DYY+
Sbjct  220   ICNVGIKTSLNVRFQGHNMKLVEMEGSHTVQNTYESLDVHVGQCFGVLVTADQEPRDYYV  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+  +   II Y NG G  +    P P      G AWS+NQFR+FRWNLTASA
Sbjct  280   VASTRFTKRVITATGIIRYTNGKGPASPELPPAPI-----GWAWSLNQFRTFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG I+ITRTIKL N+   V GKLRYA+NG+SH++  TPLKLAEY+ +++K
Sbjct  335   ARPNPQGSYHYGAIDITRTIKLANTAGKVGGKLRYAINGISHVDPPTPLKLAEYYNVADK  394

Query  721   VFKYNIMGDTPPEN-AEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
              FKY+I+ D PP   +E++T+ P VVN T+R FVEI+FEN E  IQ++HL G+SFFAVA+
Sbjct  395   SFKYDILRDDPPAKISEEITVQPIVVNLTYRTFVEIIFENRETAIQSWHLSGYSFFAVAV  454

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRKNYNL+DAVSRH+IQV+PNSWAA++ T DN GMWN+RS++W+R YLGQQL
Sbjct  455   ETGTWTPEKRKNYNLLDAVSRHTIQVFPNSWAAILLTFDNCGMWNIRSEIWDRHYLGQQL  514

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             Y SVLSPE SLRDE+N+PD   LCG+V+ M  PPPYS
Sbjct  515   YASVLSPEHSLRDEYNIPDNALLCGVVESMPKPPPYS  551



>ref|XP_010552291.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=549

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/396 (63%), Positives = 318/396 (80%), Gaps = 5/396 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I+DWY K H ++K +LDSGR +  PDGV+INGK  K+ GK  PLFTM+ GKTY++R
Sbjct  159   YTVLINDWYTKSHTSIKNLLDSGRALGSPDGVLINGKSAKMDGKDQPLFTMKPGKTYKFR  218

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG ++++NFR Q H M LVEMEGSH +QN YDSLD+HVGQC +VLVTAD+  KDYY+
Sbjct  219   ICNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQAAKDYYM  278

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+E ++  ++ Y  G+   ++     P      G AWS+NQFRSFRWNLTASA
Sbjct  279   VASTRFLKKEMTSTGVLRYVGGSAQASTVLPKAPV-----GWAWSLNQFRSFRWNLTASA  333

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVNS+  V+GKL++ LNGVSHI+T+TPLKLAEYF ++EK
Sbjct  334   ARPNPQGSYHYGKINITRTIKLVNSQQVVNGKLKFGLNGVSHIDTETPLKLAEYFQMAEK  393

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKYN++ D P    +++T+ PNV+N TFR FVE++FEN EK++Q+YHLDG+SFFAVA E
Sbjct  394   VFKYNVIKDEPGAMIKQLTVEPNVLNITFRTFVEVIFENREKSMQSYHLDGYSFFAVATE  453

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              GRW+P KR+NYNL+DAVSRH++QVYP SW+A++ T DNAGMWN+RS+ WER YLGQQ+Y
Sbjct  454   PGRWTPAKRENYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSENWERRYLGQQMY  513

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SVLSPE+SLRDE+N+P    LCG+VKG+S P  YS
Sbjct  514   VSVLSPEKSLRDEYNIPLNAGLCGIVKGLSKPIIYS  549



>ref|NP_175953.1| protein SKU5 similar 12 [Arabidopsis thaliana]
 gb|AAK32912.1|AF367325_1 At1g55570/T5A14_1 [Arabidopsis thaliana]
 gb|AAD10638.1| putative pollen specific protein [Arabidopsis thaliana]
 gb|AAM91432.1| At1g55570/T5A14_1 [Arabidopsis thaliana]
 gb|AEE33267.1| protein SKU5 similar 12 [Arabidopsis thaliana]
Length=555

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/398 (63%), Positives = 313/398 (79%), Gaps = 6/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + + I+DWY K H  LKK LDSGRTI RPDG++INGK GK  G   PLFT++ GKTYR R
Sbjct  162   YTILINDWYTKSHTQLKKFLDSGRTIGRPDGILINGKSGKTDGSDKPLFTLKPGKTYRVR  221

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ S+NFR Q H M LVEMEGSH +QN YDSLD+HVGQC  V+VTAD+EPKDYY+
Sbjct  222   ICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVIVTADQEPKDYYM  281

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             + S+RF K+  +T  ++ Y  G G  +S     P      G AWS+NQ+RSFRWNLTASA
Sbjct  282   IASTRFLKKPLTTTGLLRYEGGKGPASSQLPAAPV-----GWAWSLNQYRSFRWNLTASA  336

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYAL+GVSH + +TPLKLAEYFG+++K
Sbjct  337   ARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALSGVSHTDPETPLKLAEYFGVADK  396

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D P P+  + + + PNV+N T R F+E+VFENHE+++Q++HLDG+SFFAVA+
Sbjct  397   VFKYDTISDNPNPDQIKNIKIEPNVLNITHRTFIEVVFENHERSVQSWHLDGYSFFAVAV  456

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS+  ER YLGQQL
Sbjct  457   EPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSENAERRYLGQQL  516

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1191
             Y SVLSPE+SLRDE+N+P+    CGLVKG     PY+G
Sbjct  517   YASVLSPEKSLRDEYNMPETSLQCGLVKGKPKVNPYAG  554



>gb|KHN44494.1| L-ascorbate oxidase like [Glycine soja]
Length=551

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/397 (66%), Positives = 310/397 (78%), Gaps = 6/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  L+K+LDSGR++ RP+GV+INGK  K  GK +PLFTM+  KTY+YR
Sbjct  160   YTVLIGDWYTKSHTILRKLLDSGRSLGRPEGVLINGKTAKGDGKDEPLFTMKPAKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ S+N+R QGH+M LVEMEGSH +QN YDSLD+HVG+C SVLVTADKEPKDYY+
Sbjct  220   ICNVGLKNSLNYRIQGHSMKLVEMEGSHVVQNMYDSLDVHVGECFSVLVTADKEPKDYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K       II Y NG G  +    P P      G AWS+NQF +FRWNLTASA
Sbjct  280   VASTRFTKTVLIGKGIIRYTNGKGPASPDIPPAPV-----GWAWSLNQFHTFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSY YGQINITRTIKLVNS S  +GKLRYALNGVSH++ +TPLKLAEYFGIS+K
Sbjct  335   ARPNPQGSYKYGQINITRTIKLVNSVSKSNGKLRYALNGVSHVDPETPLKLAEYFGISDK  394

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D P P     VT+ PNV+N T RNF+EI+FEN EKTIQ+YHLDG+SFF + I
Sbjct  395   VFKYDTIPDNPSPNIGNAVTVQPNVLNITHRNFIEIIFENPEKTIQSYHLDGYSFFVLGI  454

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRK+YNL+DAVSRH++ V+P  WAA+M T DNAGMWNLRSD+ E  YLGQQL
Sbjct  455   EPGTWTPEKRKSYNLLDAVSRHTVHVFPKCWAAIMLTFDNAGMWNLRSDIAESRYLGQQL  514

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             Y SVLSPE SLRDE+N+PD   LCGLVK +  P PYS
Sbjct  515   YISVLSPEHSLRDEYNMPDSNLLCGLVKNLPKPAPYS  551



>ref|XP_003538519.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=552

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/397 (66%), Positives = 310/397 (78%), Gaps = 6/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  L+K+LDSGR++ RP+GV+INGK  K  GK +PLFTM+  KTY+YR
Sbjct  161   YTVLIGDWYTKSHTILRKLLDSGRSLGRPEGVLINGKTAKGDGKDEPLFTMKPAKTYKYR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ S+N+R QGH+M LVEMEGSH +QN YDSLD+HVG+C SVLVTADKEPKDYY+
Sbjct  221   ICNVGLKNSLNYRIQGHSMKLVEMEGSHVVQNMYDSLDVHVGECFSVLVTADKEPKDYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K       II Y NG G  +    P P      G AWS+NQF +FRWNLTASA
Sbjct  281   VASTRFTKTVLIGKGIIRYTNGKGPASPDIPPAPV-----GWAWSLNQFHTFRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSY YGQINITRTIKLVNS S  +GKLRYALNGVSH++ +TPLKLAEYFGIS+K
Sbjct  336   ARPNPQGSYKYGQINITRTIKLVNSVSKSNGKLRYALNGVSHVDPETPLKLAEYFGISDK  395

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D P P     VT+ PNV+N T RNF+EI+FEN EKTIQ+YHLDG+SFF + I
Sbjct  396   VFKYDTIPDNPSPNIGNAVTVQPNVLNITHRNFIEIIFENPEKTIQSYHLDGYSFFVLGI  455

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRK+YNL+DAVSRH++ V+P  WAA+M T DNAGMWNLRSD+ E  YLGQQL
Sbjct  456   EPGTWTPEKRKSYNLLDAVSRHTVHVFPKCWAAIMLTFDNAGMWNLRSDIAESRYLGQQL  515

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             Y SVLSPE SLRDE+N+PD   LCGLVK +  P PYS
Sbjct  516   YISVLSPEHSLRDEYNMPDSNLLCGLVKNLPKPAPYS  552



>ref|XP_010500423.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=554

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/398 (64%), Positives = 310/398 (78%), Gaps = 6/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  LKK LD GRT+ RPDG++INGK GK  G   PLFT++ GKTYR R
Sbjct  161   YTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILINGKSGKGDGSDAPLFTLKPGKTYRVR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVGM+TS+NFR Q H + LVEMEGSH +QN YDSLD+HVGQC   ++TAD+E KDYY+
Sbjct  221   ICNVGMKTSLNFRIQNHKLKLVEMEGSHVLQNDYDSLDVHVGQCYGTILTADQEAKDYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V SSRF K   +T  ++ Y  G G  +S     P      G AWS+NQFRSFRWNLTASA
Sbjct  281   VASSRFLKSVITTTGLLRYEGGKGPASSQLPAGPV-----GWAWSLNQFRSFRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYALNGVSH + +TPLKLAEYFGI++K
Sbjct  336   ARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGVSHTDPETPLKLAEYFGIADK  395

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D P PE  + + + PNV+N T R F+E+VFENHEK++Q++HLDG+SFFAVA+
Sbjct  396   VFKYDTITDNPTPEQIKTIKIEPNVLNITHRTFIEVVFENHEKSVQSWHLDGYSFFAVAV  455

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS+  ER YLGQQL
Sbjct  456   EPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSENTERRYLGQQL  515

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1191
             Y SVLSPE+SLRDE+N+P+    CGLVKG   P PY+G
Sbjct  516   YASVLSPEKSLRDEYNMPETSLQCGLVKGTPKPNPYAG  553



>ref|XP_007163845.1| hypothetical protein PHAVU_001G269200g [Phaseolus vulgaris]
 gb|ESW35839.1| hypothetical protein PHAVU_001G269200g [Phaseolus vulgaris]
Length=549

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/394 (65%), Positives = 315/394 (80%), Gaps = 6/394 (2%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             V + DWY K H +L+K+LDSGR+I RP+GV+INGK  K  G   PL+TM  GKTY+YR+C
Sbjct  161   VIMGDWYTKSHTSLQKLLDSGRSIGRPNGVLINGKTAKGDGSDQPLYTMIPGKTYKYRLC  220

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             NVG++ ++NFR QGH++ LVE EGSH +QN YDSLD+HVGQC +VLVTADK+PKDYY+V 
Sbjct  221   NVGLKDALNFRIQGHSLKLVETEGSHVVQNVYDSLDVHVGQCFTVLVTADKDPKDYYMVA  280

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+RF K + S  AII Y N     ++       P +  G AWS+NQFRSFRWNLTASAAR
Sbjct  281   STRFTKYDLSAKAIIHYTN-----SAAPASPELPPSPVGWAWSLNQFRSFRWNLTASAAR  335

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYGQINITRTIK  NS S   G LRYA+NGVSH++ +TPLKLAEY+G+++KVF
Sbjct  336   PNPQGSYHYGQINITRTIKFANSVSRGQG-LRYAINGVSHVDPETPLKLAEYYGVADKVF  394

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
             KYN + D PP +   +T APNV+NATFR+F+EI+FEN  KT+Q+Y+LDG+SFFAVA+E G
Sbjct  395   KYNTISDEPPVDLSSITKAPNVINATFRDFIEIIFENDGKTVQSYNLDGYSFFAVAMEPG  454

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
             +WSP KRKNYNL+DAVSRH++QV+P SW+A+M T DNAGMWNLRS+  E  YLGQQLY S
Sbjct  455   KWSPVKRKNYNLLDAVSRHTVQVFPKSWSAIMLTFDNAGMWNLRSEHAENRYLGQQLYIS  514

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             VLSP+RSLRDE+NLPD Q LCG+VK +  PPPYS
Sbjct  515   VLSPQRSLRDEYNLPDTQLLCGIVKDLPKPPPYS  548



>ref|XP_010501175.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=555

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/398 (63%), Positives = 313/398 (79%), Gaps = 6/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I+DWY K H  LKK LDSGRT+ RPDG++INGK GK  G   PLFT++ GKTYR R
Sbjct  162   YTVLINDWYTKSHTQLKKFLDSGRTLGRPDGILINGKSGKTDGSDKPLFTLKPGKTYRVR  221

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ S+NFR Q H M LVEMEGSH +QN YDSLD+HVGQC  V+VTA++EPKDYY+
Sbjct  222   ICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDYDSLDIHVGQCFGVIVTANQEPKDYYM  281

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+  +T  ++ Y  G G  +S     P      G AWS+NQFRSFRWNLTASA
Sbjct  282   VASTRFLKKPLTTTGLLLYEGGKGPASSQLPAAPV-----GWAWSLNQFRSFRWNLTASA  336

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYAL+GVSH + +TPLKLAEYFG+++K
Sbjct  337   ARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALSGVSHTDPETPLKLAEYFGVTDK  396

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D P P+  + + + PNV+N T R F+E+VFENHEK++Q++HLDG+SFFAVA+
Sbjct  397   VFKYDSISDNPNPDQIKTIKIEPNVLNITHRTFIEVVFENHEKSVQSWHLDGYSFFAVAV  456

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRKNYNL+DAVSRH++QV+P  WAA++ T DN GMWN+RS+  ER YLGQQL
Sbjct  457   EPGTWTPEKRKNYNLLDAVSRHTVQVFPKCWAAILLTFDNCGMWNIRSENSERRYLGQQL  516

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1191
             Y SVLSPE+SLRDE+NLP+    CGLVKG     PY+G
Sbjct  517   YVSVLSPEKSLRDEYNLPESSLQCGLVKGKPKINPYAG  554



>ref|XP_010462412.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=555

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/398 (63%), Positives = 313/398 (79%), Gaps = 6/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I+DWY K H  LKK LDSGRT+ RPDG++INGK GK  G   PLFT++ GKTYR R
Sbjct  162   YTVLINDWYTKSHTQLKKFLDSGRTLGRPDGILINGKSGKTDGSDKPLFTLKPGKTYRVR  221

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ S+NFR Q H M LVEMEGSH +QN YDSLD+HVGQC  V+VTA++EPKDYY+
Sbjct  222   ICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDYDSLDIHVGQCFGVIVTANQEPKDYYM  281

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+  +T  ++ Y  G G  +S     P      G AWS+NQFRSFRWNLTASA
Sbjct  282   VASTRFLKKPLTTTGLLRYEGGKGPASSQLPAAPV-----GWAWSLNQFRSFRWNLTASA  336

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYAL+GVSH + +TPLKLAEYFG+++K
Sbjct  337   ARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALSGVSHTDPETPLKLAEYFGVTDK  396

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D P P+  + + + PNV+N T R F+E+VFENHEK++Q++HLDG+SFFAVA+
Sbjct  397   VFKYDSISDNPNPDQIKTIKIEPNVLNITHRTFIEVVFENHEKSVQSWHLDGYSFFAVAV  456

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRKNYNL+DAVSRH++QV+P  WAA++ T DN GMWN+RS+  ER YLGQQL
Sbjct  457   EPGTWTPEKRKNYNLLDAVSRHTVQVFPKCWAAILLTFDNCGMWNIRSENSERRYLGQQL  516

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1191
             Y SVLSPE+SLRDE+N+P+    CGLVKG     PY+G
Sbjct  517   YASVLSPEKSLRDEYNMPESSLQCGLVKGKPKINPYAG  554



>ref|XP_002891844.1| hypothetical protein ARALYDRAFT_892557 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68103.1| hypothetical protein ARALYDRAFT_892557 [Arabidopsis lyrata subsp. 
lyrata]
Length=555

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/398 (63%), Positives = 312/398 (78%), Gaps = 6/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I+DWY K H  LKK LDSGRTI RPDG++INGK GK  G   PLFT++ GKTYR R
Sbjct  162   YTVLINDWYTKSHTQLKKFLDSGRTIGRPDGILINGKSGKTDGSDKPLFTLKPGKTYRVR  221

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ S+NFR Q H M LVEMEGSH +QN YDSLD+HVGQC  V+VTAD+E KDYY+
Sbjct  222   ICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVIVTADQELKDYYM  281

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+  +T  ++ Y  G G  +S     P      G AWS+NQFRSFRWNLTASA
Sbjct  282   VASTRFLKKPLTTTGLLRYEGGKGPASSQLPAAPV-----GWAWSLNQFRSFRWNLTASA  336

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYAL+GVSH + +TPLKLAEYFG+++K
Sbjct  337   ARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALSGVSHTDPETPLKLAEYFGVADK  396

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D P P+  + + + PNV+N T R F+E+VFENHE+++Q++HLDG+SFFAVA+
Sbjct  397   VFKYDTISDNPNPDQIKNIKIEPNVLNITHRTFIEVVFENHERSVQSWHLDGYSFFAVAV  456

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS+  ER YLGQQL
Sbjct  457   EPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSENSERRYLGQQL  516

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1191
             Y SVLSPE+SLRDE+N+P+    CGLVKG     PY+G
Sbjct  517   YASVLSPEKSLRDEYNMPETSLQCGLVKGKPKVNPYAG  554



>ref|XP_006353286.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=558

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/398 (65%), Positives = 313/398 (79%), Gaps = 10/398 (3%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             V + DWY K H  LK++LDSGR + RP GVVINGK GK  GK +P+FT+  GKTYR+R+C
Sbjct  163   VLVGDWYTKSHTELKRLLDSGRALGRPQGVVINGKSGKGDGKDEPMFTVTPGKTYRFRIC  222

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             NVG++ S+N R QGHT+ LVE+EGSHT+QN Y+SLD+H+GQC SVLVTA++EPKDY+LV 
Sbjct  223   NVGLKDSINVRMQGHTLKLVEIEGSHTVQNVYESLDIHLGQCFSVLVTANQEPKDYFLVA  282

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+RF K        I YANG G  +            EG AWS+NQFRSFRWNLTASAAR
Sbjct  283   STRFTKDSHVATTTIRYANGKGPASPELPKA-----PEGWAWSLNQFRSFRWNLTASAAR  337

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYGQINITRTIKLV S   VDGKLRYALNGVSH++  TP+KLAEY+G  +KVF
Sbjct  338   PNPQGSYHYGQINITRTIKLVTSAGQVDGKLRYALNGVSHVDPTTPIKLAEYYGAGDKVF  397

Query  727   KYNIMGD---TPPENA--EKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAV  891
             KY+++ D     P  A  +K+T+APNVVNAT+RNFVEIV ENH K++Q++HL GHSFFAV
Sbjct  398   KYDLIKDEYEPSPGQAGQDKITVAPNVVNATYRNFVEIVIENHGKSVQSWHLSGHSFFAV  457

Query  892   AIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQ  1071
              IE GRW+PEKR+NYNL+DAVSR++IQVYP S+A +MTT+DNAG+WNLRS+  ER YLG 
Sbjct  458   GIEPGRWTPEKRRNYNLLDAVSRNTIQVYPKSFAVIMTTLDNAGLWNLRSNSLERNYLGH  517

Query  1072  QLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             QLYFSVLSP +S++DE+N+PD   LCG+VK M  P PY
Sbjct  518   QLYFSVLSPNKSIKDEYNMPDNDLLCGIVKDMPKPTPY  555



>ref|XP_010465172.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
 ref|XP_010487091.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Camelina sativa]
 ref|XP_010487092.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Camelina sativa]
Length=554

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/398 (64%), Positives = 310/398 (78%), Gaps = 6/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  LKK LD GRT+ RPDG++INGK GK  G   PLFT++ GKTYR R
Sbjct  161   YTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILINGKSGKGDGSDAPLFTLKPGKTYRVR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++TS+NFR Q H + LVEMEGSH +QN YDSLD+HVGQC   ++TAD+E KDYY+
Sbjct  221   ICNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDYDSLDVHVGQCYGTILTADQEAKDYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V SSRF K   +T  ++ Y  G G  +S     P      G AWS+NQFRSFRWNLTASA
Sbjct  281   VASSRFLKSVITTTGLLRYEGGKGPASSQLPAGPV-----GWAWSLNQFRSFRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYALNGVSH + +TPLKLAEYFGI++K
Sbjct  336   ARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGVSHTDPETPLKLAEYFGIADK  395

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D P PE  + + + PNV+N T R F+E+VFENHEK++Q++HLDG+SFFAVA+
Sbjct  396   VFKYDTITDNPTPEQIKTIKIEPNVLNITHRTFIEVVFENHEKSVQSWHLDGYSFFAVAV  455

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS+  ER YLGQQL
Sbjct  456   EPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSENTERRYLGQQL  515

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1191
             Y SVLSPE+SLRDE+N+P+    CGLVKG   P PY+G
Sbjct  516   YASVLSPEKSLRDEYNMPETSLQCGLVKGTPKPNPYAG  553



>emb|CDY23596.1| BnaC05g39980D [Brassica napus]
Length=555

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/399 (64%), Positives = 311/399 (78%), Gaps = 7/399 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  LKK LD GRTI RPDG+VINGK GK  G   PLFT++ GKTYR R
Sbjct  161   YTVLIGDWYTKSHTQLKKFLDGGRTIGRPDGIVINGKSGKGDGSDAPLFTLKPGKTYRVR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++TS+NFR Q H M LVEMEGSH +QN YDSLD+HVGQC   +VTA++EPKDYY+
Sbjct  221   ICNVGLKTSINFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGTIVTANQEPKDYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V SSRF K   +T  ++ Y  G G  +S     P      G AWS+NQFRSFRWNLTASA
Sbjct  281   VASSRFLKTVITTTGLLRYEGGKGPASSQLPAGPV-----GWAWSLNQFRSFRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  VDGKLR+ALNGVSH + +TPLKLAEYFGIS+K
Sbjct  336   ARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRFALNGVSHTDPETPLKLAEYFGISDK  395

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D P PE  + + + PNV+N T RNF+E+VFENHEK++Q++HLDG+SFF+VA+
Sbjct  396   VFKYDTITDDPTPEQIKNIKIEPNVLNITHRNFIEVVFENHEKSVQSWHLDGYSFFSVAV  455

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS+  ER YLGQQL
Sbjct  456   EPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNVRSENTERRYLGQQL  515

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPP-PYSG  1191
             Y SVLSPE+SLRDE+N+P+    CGLVK    P  PY+G
Sbjct  516   YASVLSPEKSLRDEYNMPETSLQCGLVKNTPKPVNPYAG  554



>emb|CDX97352.1| BnaA02g21430D [Brassica napus]
Length=488

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/398 (63%), Positives = 312/398 (78%), Gaps = 6/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I+DWY K H  LKK LDSGRTI RPDG++INGK GK  G   PLFT++ GKTYR R
Sbjct  95    YTVLINDWYTKSHTQLKKFLDSGRTIGRPDGILINGKAGKGDGSDQPLFTLKQGKTYRVR  154

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++TS+NFR Q H M LVEMEGSH +QN YDSLD+HVGQC  V+VTA++EPKDYY+
Sbjct  155   ICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVIVTANQEPKDYYM  214

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+  +T  ++ Y  G G+ +      P      G AWS+NQFRSFRWNLTASA
Sbjct  215   VASTRFLKKALATTGLLRYEGGKGLASPQLPAAPV-----GWAWSLNQFRSFRWNLTASA  269

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  +DGKLRYAL+GVSH + +TPLKLAEYFG+++K
Sbjct  270   ARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLRYALSGVSHTDPETPLKLAEYFGVADK  329

Query  721   VFKYNIMGDTPPENAEK-VTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+I+ D P  +  K + + PNV+N T R F+E+VFENHEK++Q++HLDG+SFFAVA+
Sbjct  330   VFKYDIISDNPTSDQIKNIKIEPNVLNITHRTFIEVVFENHEKSVQSWHLDGYSFFAVAV  389

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS+  ER YLGQQL
Sbjct  390   EPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSENSERRYLGQQL  449

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1191
             Y SVLSPE+SLR E+N+P+    CGLVK      PY+G
Sbjct  450   YASVLSPEKSLRGEYNMPESSLQCGLVKDKPKINPYAG  487



>emb|CAA47177.1| Bplo [Brassica napus]
Length=555

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/399 (64%), Positives = 311/399 (78%), Gaps = 7/399 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DW+ K H  LKK LD GRTI RPDG+VINGK GK  G   PLFT++ GKTYR R
Sbjct  161   YTVLIGDWFTKSHTQLKKFLDGGRTIGRPDGIVINGKSGKGDGSDAPLFTLKPGKTYRVR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++TS+NFR Q H M LVEMEGSH +QN YDSLD+HVGQC   +VTA++EPKDYY+
Sbjct  221   ICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCYGTIVTANQEPKDYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+  +T  ++ Y  G G  +S     P      G AWS+NQFRSFRWNLTASA
Sbjct  281   VASTRFLKKVITTTGLLRYEGGKGPASSQLPAGPV-----GWAWSLNQFRSFRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  +DGKLRYALNGVSH   +TPLKLAEYFGI++K
Sbjct  336   ARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLRYALNGVSHTEPETPLKLAEYFGITDK  395

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+I+ D P PE  + + + PNV+N T R FVE+VFENHEK++Q++HLDG+SFFAVA+
Sbjct  396   VFKYDIITDNPTPEQIKNIKIEPNVLNITHRTFVEVVFENHEKSVQSWHLDGYSFFAVAV  455

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRKNYNL+DAVSRH+IQVYP  WAA++ T DN GMWN+RS+  ER YLGQQL
Sbjct  456   EPGTWTPEKRKNYNLLDAVSRHTIQVYPKCWAAILLTFDNCGMWNIRSENSERRYLGQQL  515

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPP-PYSG  1191
             Y SVLSPE+SLRDE+N+P+    CGLVK    P  PY+G
Sbjct  516   YASVLSPEKSLRDEYNMPETSLQCGLVKNTPKPVNPYAG  554



>gb|KHN20513.1| L-ascorbate oxidase like [Glycine soja]
Length=516

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/388 (65%), Positives = 316/388 (81%), Gaps = 9/388 (2%)
 Frame = +1

Query  25    YNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVCNVGMRT  204
             +++ H  LK+ LDSGR+I RP GV INGK+G     ++PL+TME GKTY+YR+CNVG++ 
Sbjct  137   FSRLHTALKQKLDSGRSIGRPVGVHINGKNGG----LEPLYTMEPGKTYKYRICNVGLKD  192

Query  205   SVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVVSSRFFK  384
             S+NFR QGH + LVE EGSH +QN YDSLD+HVGQC +VLVTAD+EPKDY++V S+RF K
Sbjct  193   SLNFRIQGHPLKLVETEGSHVVQNNYDSLDVHVGQCYTVLVTADQEPKDYFMVASTRFTK  252

Query  385   QEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAARPNPQGS  564
             +  +   +I Y+NG G  +    P       +G AWS+NQFRSFRWNLTASAARPNPQGS
Sbjct  253   KVLTATRVIRYSNGVGPASGGLPPA-----PQGWAWSLNQFRSFRWNLTASAARPNPQGS  307

Query  565   YHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVFKYNIMG  744
             YHYGQINITRTIKLVN+ S  +GKLRY LNGVSH++T TPLKLAEY+G+++KVFKYN++ 
Sbjct  308   YHYGQINITRTIKLVNTVSRANGKLRYGLNGVSHVDTQTPLKLAEYYGVADKVFKYNLIS  367

Query  745   DTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAGRWSPEK  924
             D+P      +T+APNV+NATFR+F+E++FEN  K IQ+Y+LDG+SFFA+A+E G+W+PEK
Sbjct  368   DSPDTAFPDLTVAPNVINATFRDFIEVIFENPGKVIQSYNLDGYSFFALAVEPGKWTPEK  427

Query  925   RKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFSVLSPER  1104
             RKNYNL+DA+SRH+IQV+PNSWAA+M T DNAGMWNLRS+M E  YLGQQLY SVLSP R
Sbjct  428   RKNYNLLDAISRHTIQVFPNSWAAIMLTFDNAGMWNLRSEMAENRYLGQQLYVSVLSPNR  487

Query  1105  SLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             SLRDE+NLP+ Q LCG+VK M  PPPYS
Sbjct  488   SLRDEYNLPETQLLCGIVKDMPKPPPYS  515



>ref|XP_006407228.1| hypothetical protein EUTSA_v10020433mg [Eutrema salsugineum]
 gb|ESQ48681.1| hypothetical protein EUTSA_v10020433mg [Eutrema salsugineum]
Length=554

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/398 (64%), Positives = 309/398 (78%), Gaps = 6/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  LKK LD GRT+ RPDG++INGK GK  G   PLFT++ GKTYR R
Sbjct  161   YTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILINGKAGKGDGSDAPLFTLKPGKTYRVR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++TS+NFR Q H M LVEMEGSH +QN YDSLD+HVGQC   +VTA++EPKDYY+
Sbjct  221   ICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCYGTIVTANQEPKDYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V SSRF K   +T  ++ Y  G G  +S            G AWS+NQFRSFRWNLTASA
Sbjct  281   VASSRFLKSVITTTGLLRYEGGKGPASSQLPA-----GPVGWAWSLNQFRSFRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INI+RTI L N++  VDGKLRYALNGVSHI+ +TPLKLAEYFGI++K
Sbjct  336   ARPNPQGSYHYGKINISRTIVLKNTQGKVDGKLRYALNGVSHIDPETPLKLAEYFGIADK  395

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D P PE  + + + PNV+N T R F+E+VFENHEK++Q++HLDG+SFFAVA+
Sbjct  396   VFKYDSITDNPTPEQIKTIKIEPNVLNITHRTFIEVVFENHEKSVQSWHLDGYSFFAVAV  455

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS+  ER YLGQQL
Sbjct  456   EPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSENTERRYLGQQL  515

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1191
             Y SVLSPE+SLRDE+N+P+    CGLVKG   P PY+G
Sbjct  516   YASVLSPEKSLRDEYNMPETSLQCGLVKGTPKPNPYAG  553



>ref|XP_006299300.1| hypothetical protein CARUB_v10015454mg [Capsella rubella]
 gb|EOA32198.1| hypothetical protein CARUB_v10015454mg [Capsella rubella]
Length=554

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/398 (64%), Positives = 310/398 (78%), Gaps = 6/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  LKK LD GRT+ RPDG++INGK GK  G   PLF ++ GKTYR R
Sbjct  161   YTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILINGKSGKGDGSDAPLFNLKPGKTYRVR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++TS+NFR Q H + LVEMEGSH +QN YDSLD+HVGQC   ++TA++E KDYY+
Sbjct  221   ICNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDYDSLDVHVGQCYGTILTANQEAKDYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V SSRF K   +T  ++ Y  G G  +S     P      G AWS+NQFRSFRWNLTASA
Sbjct  281   VASSRFLKSVITTTGLLRYEGGKGPASSQLPAGPV-----GWAWSLNQFRSFRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYALNGVSH + +TPLKLAEYFGI++K
Sbjct  336   ARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGVSHTDPETPLKLAEYFGIADK  395

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D P PE  + + + PNV+N T RNF+E+VFENHEK++Q++HLDG+SFFAVA+
Sbjct  396   VFKYDTITDNPTPEQTKNIKIEPNVLNITHRNFIEVVFENHEKSVQSWHLDGYSFFAVAV  455

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS+  ER YLGQQL
Sbjct  456   EPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSENTERRYLGQQL  515

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1191
             Y SVLSPE+SLRDE+N+P+    CGLVKG   P PY+G
Sbjct  516   YASVLSPEKSLRDEYNMPETSLQCGLVKGKPKPNPYAG  553



>gb|EYU39761.1| hypothetical protein MIMGU_mgv1a003754mg [Erythranthe guttata]
Length=566

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/403 (65%), Positives = 325/403 (81%), Gaps = 13/403 (3%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHG-----KVGGKIDPLFTMEAGKTY  171
             VF+ DWY KGH +L+K+LD GR++ RPDGV+INGK       K GG+  P+FTM A KTY
Sbjct  167   VFVGDWYKKGHASLRKLLDGGRSLGRPDGVIINGKGSFGTGNKTGGEDSPMFTMIAKKTY  226

Query  172   RYRVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPK-  348
             RYR CNVGM+ SVN R QGHTM +VE+EGSHT+QN YDSLD+H+GQC SVLVTAD++P+ 
Sbjct  227   RYRFCNVGMKDSVNVRIQGHTMKIVEIEGSHTVQNVYDSLDVHLGQCYSVLVTADQKPES  286

Query  349   DYYLVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNL  528
             DYYLV S+RF K+  ++ AII Y  G  +  SPELP  P     G+ WSINQFRSFRWNL
Sbjct  287   DYYLVASTRFSKKALTSTAIIRYVGGGQVPPSPELPPAPV----GLPWSINQFRSFRWNL  342

Query  529   TASAARPNPQGSYHYGQINITRTIKLV-NSKSYVDGKLRYALNGVSHINTDTPLKLAEYF  705
             TASAARPNPQGSYHYG+I+ITRTIK V    S V GK RY++NGVSH++ +TPLKLAEY+
Sbjct  343   TASAARPNPQGSYHYGKIDITRTIKFVLKPFSKVGGKRRYSINGVSHVDPETPLKLAEYY  402

Query  706   GISEKVFKYNIMGDTPPEN--AEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHS  879
             G+++KVFKY+++ D P ++  A +V +APNV+N TFRNFVEI+ ENH+K++QT+H+ G+S
Sbjct  403   GVADKVFKYDMIKDQPSDSDLAAEVIVAPNVINGTFRNFVEIILENHDKSVQTFHVSGYS  462

Query  880   FFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERA  1059
             FFAVA+E GRW+ EKRKNYNL+DA+S+H++QVYPNSW A+MTT+DNAGMWN+RS   ER 
Sbjct  463   FFAVAVEPGRWTEEKRKNYNLIDAISKHTVQVYPNSWTAIMTTLDNAGMWNMRSMSLERQ  522

Query  1060  YLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             YLG+Q+Y SVLSP RSLRDE+NLPD Q LCG+VK M  PPPYS
Sbjct  523   YLGEQIYVSVLSPNRSLRDEYNLPDTQLLCGIVKDMPKPPPYS  565



>ref|NP_187947.1| protein SKU5-like 11 [Arabidopsis thaliana]
 dbj|BAB01744.1| l-ascorbate oxidase; pectinesterase-like protein; pollen-specific 
protein-like [Arabidopsis thaliana]
 gb|AAO42003.1| putative pectinesterase (pectin methylesterase) family protein 
[Arabidopsis thaliana]
 gb|AAO50591.1| putative pectinesterase (pectin methylesterase) family protein 
[Arabidopsis thaliana]
 gb|AEE75341.1| protein SKU5-like 11 [Arabidopsis thaliana]
Length=554

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/398 (64%), Positives = 311/398 (78%), Gaps = 6/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  LKK LDSGRT+ RPDG++INGK GK  G   PLFT++ GKTYR R
Sbjct  161   YTVLIGDWYTKSHTQLKKFLDSGRTLGRPDGILINGKSGKGDGSDAPLFTLKPGKTYRVR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++TS+NFR Q H + LVEMEGSH +QN YDSLD+HVGQC   ++TA++E KDYY+
Sbjct  221   ICNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDYDSLDVHVGQCYGTILTANQEAKDYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V SSRF K   +T  ++ Y  G G  +S   P        G AWS+NQFRSFRWNLTASA
Sbjct  281   VASSRFLKSVITTTGLLRYEGGKGPASSQLPP-----GPVGWAWSLNQFRSFRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYALNGVSH + +TPLKLAEYFG+++K
Sbjct  336   ARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGVSHTDPETPLKLAEYFGVADK  395

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D P PE  + + + PNV+N T R F+E+VFENHEK++Q++HLDG+SFFAVA+
Sbjct  396   VFKYDSITDNPTPEQIKSIKIVPNVLNITHRTFIEVVFENHEKSVQSWHLDGYSFFAVAV  455

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS+  ER YLGQQL
Sbjct  456   EPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNVRSENSERRYLGQQL  515

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1191
             Y SVLSPE+SLRDE+N+P+    CGLVKG   P PY+G
Sbjct  516   YASVLSPEKSLRDEYNMPETSLQCGLVKGTPKPNPYAG  553



>gb|AFC88081.1| skewed-like protein [Brassica rapa subsp. oleifera]
Length=555

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/399 (64%), Positives = 309/399 (77%), Gaps = 7/399 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  LKK LD GRTI RPDG+VINGK GK  G   PLFT++ GKTYR R
Sbjct  161   YTVLIGDWYTKSHTQLKKFLDGGRTIGRPDGIVINGKSGKGDGSDAPLFTLKPGKTYRVR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++TS+NFR Q H M LVEMEGSH +QN YDSLD+HVGQC   +VTA++EPKDYY+
Sbjct  221   ICNVGLKTSINFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGTIVTANQEPKDYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V SSRF K   +T  ++ Y  G G  +S     P      G AWS+NQFRSFRWNLTASA
Sbjct  281   VASSRFLKTVITTTGLLRYEGGKGPASSQLPAGPV-----GWAWSLNQFRSFRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  VDGKLR+ALNGVSH   +TPLKLAEYFGIS+K
Sbjct  336   ARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRFALNGVSHTEPETPLKLAEYFGISDK  395

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D P PE  + + + PNV+N T R FVE+VFENHEK++Q++HLDG+SFF+VA+
Sbjct  396   VFKYDTITDDPTPEQIKNIKIEPNVLNITHRTFVEVVFENHEKSVQSWHLDGYSFFSVAV  455

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS+  ER YLGQQL
Sbjct  456   EPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNVRSENTERRYLGQQL  515

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPP-PYSG  1191
             Y SVLSPE+SLRDE+N+P+    CGLVK    P  PY+G
Sbjct  516   YASVLSPEKSLRDEYNMPETSLQCGLVKNTPKPVNPYAG  554



>emb|CDX82541.1| BnaA03g32800D [Brassica napus]
Length=555

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/399 (64%), Positives = 310/399 (78%), Gaps = 7/399 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DW+ K H  LKK LD GRTI RPDG+VINGK GK  G   PLFT++ GKTYR R
Sbjct  161   YTVLIGDWFTKSHTQLKKFLDGGRTIGRPDGIVINGKSGKGDGSDAPLFTLKPGKTYRVR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++TS+NFR Q H M LVEMEGSH +QN YDSLD+HVGQC   +V A++EPKDYY+
Sbjct  221   ICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCYGTIVAANQEPKDYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+  +T  ++ Y  G G  +S     P      G AWS+NQFRSFRWNLTASA
Sbjct  281   VASTRFLKKVITTTGLLRYEGGKGPASSQLPAGPV-----GWAWSLNQFRSFRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  +DGKLRYALNGVSH   +TPLKLAEYFGI++K
Sbjct  336   ARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLRYALNGVSHTEPETPLKLAEYFGITDK  395

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+I+ D P PE  + + + PNV+N T R FVE+VFENHEK++Q++HLDG+SFFAVA+
Sbjct  396   VFKYDIITDNPTPEQIKNIKIEPNVLNITHRTFVEVVFENHEKSVQSWHLDGYSFFAVAV  455

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRKNYNL+DAVSRH+IQVYP  WAA++ T DN GMWN+RS+  ER YLGQQL
Sbjct  456   EPGTWTPEKRKNYNLLDAVSRHTIQVYPKCWAAILLTFDNCGMWNIRSENSERRYLGQQL  515

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPP-PYSG  1191
             Y SVLSPE+SLRDE+N+P+    CGLVK    P  PY+G
Sbjct  516   YASVLSPEKSLRDEYNMPETSLQCGLVKNTPKPVNPYAG  554



>ref|XP_010480098.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=555

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/398 (63%), Positives = 312/398 (78%), Gaps = 6/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I+DWY K H  LKK LDSGRT+ RPDG++INGK GK  G   PLFT++ GKTYR R
Sbjct  162   YTVLINDWYTKSHTQLKKFLDSGRTLGRPDGILINGKSGKTDGSDKPLFTLKPGKTYRVR  221

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ S+NFR Q H M LVEMEGSH +QN YDSLD+HVGQC  V+VTA++EPKDYY+
Sbjct  222   ICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDYDSLDIHVGQCFGVIVTANQEPKDYYM  281

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+  +T  ++ Y  G G  +S     P      G AWS+NQFRSFRWNLTASA
Sbjct  282   VASTRFLKKPLTTTGLLRYEGGKGPASSQLPAAPV-----GWAWSLNQFRSFRWNLTASA  336

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYAL+GVSH + +TPLKLAEYFG+++K
Sbjct  337   ARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALSGVSHTDPETPLKLAEYFGVTDK  396

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D P  +  + + + PNV+N T R F+E+VFENHEK++Q++HLDG+SFFAVA+
Sbjct  397   VFKYDSISDNPNADQIKTIKIEPNVLNITHRTFIEVVFENHEKSVQSWHLDGYSFFAVAV  456

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRKNYNL+DAVSRH++QV+P  WAA++ T DN GMWN+RS+  ER YLGQQL
Sbjct  457   EPGTWTPEKRKNYNLLDAVSRHTVQVFPKCWAAILLTFDNCGMWNIRSENSERRYLGQQL  516

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1191
             Y SVLSPE+SLRDE+N+P+    CGLVKG     PY+G
Sbjct  517   YASVLSPEKSLRDEYNMPESSLQCGLVKGKPKINPYAG  554



>sp|Q00624.1|ASOL_BRANA RecName: Full=L-ascorbate oxidase homolog; Flags: Precursor [Brassica 
napus]
 emb|CAA45554.1| Bp10 [Brassica napus]
 emb|CDY43995.1| BnaA05g25900D [Brassica napus]
Length=555

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/399 (64%), Positives = 309/399 (77%), Gaps = 7/399 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  LKK LD GRTI RPDG+VINGK GK  G   PLFT++ GKTYR R
Sbjct  161   YTVLIGDWYTKSHTQLKKFLDGGRTIGRPDGIVINGKSGKGDGSDAPLFTLKPGKTYRVR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++TS+NFR Q H M LVEMEGSH +QN YDSLD+HVGQC   +VTA++EPKDYY+
Sbjct  221   ICNVGVKTSINFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGTIVTANQEPKDYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V SSRF K   +T  ++ Y  G G  +S     P      G AWS+NQFRSFRWNLTASA
Sbjct  281   VASSRFLKTVITTTGLLRYEGGKGPASSQLPAGPV-----GWAWSLNQFRSFRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  VDGKLR+ALNGVSH   +TPLKLAEYFGIS+K
Sbjct  336   ARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRFALNGVSHTEPETPLKLAEYFGISDK  395

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D P PE  + + + PNV+N T R FVE+VFENHEK++Q++HLDG+SFF+VA+
Sbjct  396   VFKYDTITDDPTPEQIKNIKIEPNVLNITHRTFVEVVFENHEKSVQSWHLDGYSFFSVAV  455

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS+  ER YLGQQL
Sbjct  456   EPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNVRSENTERRYLGQQL  515

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPP-PYSG  1191
             Y SVLSPE+SLRDE+N+P+    CGLVK    P  PY+G
Sbjct  516   YASVLSPEKSLRDEYNMPETSLQCGLVKNTPKPVNPYAG  554



>gb|KFK38671.1| hypothetical protein AALP_AA3G145000 [Arabis alpina]
Length=554

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/398 (63%), Positives = 310/398 (78%), Gaps = 6/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  LKK LD GRT+ RPDG++INGK GK  G   PLFT++ GKTYR R
Sbjct  161   YTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILINGKSGKGDGSDAPLFTLKPGKTYRLR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++TS+NFR Q H + LVEMEGSH +QN YDSLD+HVGQC   +++AD++ KDYY+
Sbjct  221   ICNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDYDSLDVHVGQCYGTILSADQQAKDYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V SSRF K   +T  ++ Y  G G  +S   P        G AWS+NQFRS+RWNLTASA
Sbjct  281   VASSRFLKSVITTTGLLRYEGGKGPASSQLPP-----GPVGWAWSLNQFRSYRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYALNG+SH + +TPLKLAEYFGI +K
Sbjct  336   ARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGISHTDPETPLKLAEYFGIGDK  395

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D P PE  + + + PNV+N T R FVE+VFENHEK++Q++HLDG+SFFAVA+
Sbjct  396   VFKYDSITDNPTPEQIKSIKILPNVLNITHRTFVEVVFENHEKSVQSWHLDGYSFFAVAV  455

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS+  ER YLGQQ+
Sbjct  456   EPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSENSERRYLGQQM  515

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1191
             Y SVLSPE+SLRDE+N+P+    CGLVKGM  P PY+G
Sbjct  516   YASVLSPEKSLRDEYNMPETSLQCGLVKGMPKPNPYAG  553



>ref|XP_009135302.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=555

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/399 (64%), Positives = 310/399 (78%), Gaps = 7/399 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DW+ K H  LKK LD GRTI RPDG+VINGK GK  G   PLFT++ GKTYR R
Sbjct  161   YTVLIGDWFTKSHTQLKKFLDGGRTIGRPDGIVINGKSGKGDGSDAPLFTLKPGKTYRVR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++TS+NFR Q H M LVEMEGSH +QN YDSLD+HVGQC   +V A++EPKDYY+
Sbjct  221   ICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCYGTIVAANQEPKDYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+  +T  ++ Y  G G  +S     P      G AWS+NQFRSFRWNLTASA
Sbjct  281   VASTRFLKKVITTTGLLRYEGGKGPASSQLPAGPV-----GWAWSLNQFRSFRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  +DGKLRYALNGVSH   +TPLKLAEYFGI++K
Sbjct  336   ARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLRYALNGVSHTEPETPLKLAEYFGITDK  395

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+I+ D P PE  + + + PNV+N T R FVE+VFENHEK++Q++HLDG+SFFAVA+
Sbjct  396   VFKYDIITDNPTPEQIKNIKIEPNVLNITHRTFVEVVFENHEKSVQSWHLDGYSFFAVAV  455

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRKNYNL+DAVSRH+IQVYP  WAA++ T DN GMWN+RS+  ER YLGQQL
Sbjct  456   EPGTWTPEKRKNYNLLDAVSRHTIQVYPKCWAAILLTFDNCGMWNIRSENSERRYLGQQL  515

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPP-PYSG  1191
             Y S+LSPE+SLRDE+N+P+    CGLVK    P  PY+G
Sbjct  516   YASILSPEKSLRDEYNMPETSLQCGLVKNTPKPVNPYAG  554



>ref|XP_009399915.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=550

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/397 (64%), Positives = 307/397 (77%), Gaps = 7/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKID--PLFTMEAGKTYR  174
             + V I DWY K HK L+KILD+GR + RP G++ING  GK G   D  PLFTMEA KTYR
Sbjct  158   YTVLIGDWYTKSHKILEKILDAGRAVGRPAGLLINGHSGKNGAGKDEPPLFTMEAKKTYR  217

Query  175   YRVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDY  354
             YR+CN+GM+ ++NFR Q H+MTLVEM+GSHT+QN YDSLD+HVGQCLSVLVTA++ P+DY
Sbjct  218   YRICNIGMKVTLNFRIQSHSMTLVEMDGSHTVQNNYDSLDIHVGQCLSVLVTANQSPRDY  277

Query  355   YLVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTA  534
             Y+V SSRF K   +   I+ YA      +        PE   G AWS NQ+RSFRWNLTA
Sbjct  278   YMVASSRFTKYMLTVTGIVRYAG-----SQTPPSQDLPEAPAGWAWSFNQWRSFRWNLTA  332

Query  535   SAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGIS  714
             SAARPNPQGSYHYG INITRTI+LVN+   VDGK RYALNGVSH +TDTPLKLAEY+GI+
Sbjct  333   SAARPNPQGSYHYGSINITRTIRLVNTIGNVDGKRRYALNGVSHQDTDTPLKLAEYYGIA  392

Query  715   EKVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             +KVFKY+I+ D PP +  ++ LAPNVVN TFR FVEI+FEN E+++Q YHLDG+SFF V 
Sbjct  393   DKVFKYDIISDEPPADGAQIKLAPNVVNTTFRTFVEIIFENPERSMQAYHLDGYSFFPVG  452

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             +  G+W+P  RK YNL+DAVSRH+IQVY  SW+AVM T DNAGMWNLRS++WER YLGQQ
Sbjct  453   MGHGKWTPASRKTYNLLDAVSRHTIQVYQRSWSAVMLTFDNAGMWNLRSELWERRYLGQQ  512

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             LYF+V SP RSLRDE+N+PD   LCG V  +  PP Y
Sbjct  513   LYFTVQSPARSLRDEYNMPDNALLCGDVANLPKPPSY  549



>emb|CDX75707.1| BnaC03g37900D [Brassica napus]
Length=555

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/399 (64%), Positives = 311/399 (78%), Gaps = 7/399 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DW+ K H  +KK LD GRTI RPDG+VINGK GK  G   PLFT++ GKTYR R
Sbjct  161   YTVLIGDWFTKSHTQVKKFLDGGRTIGRPDGIVINGKSGKGDGSDAPLFTLKPGKTYRVR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++TS+NFR Q H M LVEMEGSH +QN YDSLD+HVGQC   +V+A++EPKDYY+
Sbjct  221   ICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCYGTIVSANQEPKDYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V SSRF K+  +T  ++ Y  G G  +S     P      G AWS+NQFRSFRWNLTASA
Sbjct  281   VASSRFLKKVITTTGLLRYEGGKGPASSQLPAGPV-----GWAWSLNQFRSFRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  +DGKLRYALNGVSH   +TPLKLAEYFGI++K
Sbjct  336   ARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLRYALNGVSHTEPETPLKLAEYFGITDK  395

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+I+ D P PE  + + + PNV+N T R FVE+VFENHEK++Q++HLDG+SFFAVA+
Sbjct  396   VFKYDIITDDPTPEQIKNIKIEPNVLNITHRTFVEVVFENHEKSVQSWHLDGYSFFAVAV  455

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS+  ER YLGQQL
Sbjct  456   EPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSENSERRYLGQQL  515

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPP-PYSG  1191
             Y S+LSPE+SLRDE+N+P+    CGLVK    P  PY+G
Sbjct  516   YASILSPEKSLRDEYNMPETSLQCGLVKNTPKPVNPYAG  554



>emb|CAA47178.1| Bplo [Brassica napus]
Length=555

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/399 (64%), Positives = 311/399 (78%), Gaps = 7/399 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DW+ K H  +KK LD GRTI RPDG+VINGK GK  G   PLFT++ GKTYR R
Sbjct  161   YTVLIGDWFTKSHTQVKKFLDGGRTIGRPDGIVINGKAGKGDGSDAPLFTLKPGKTYRVR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++TS+NFR Q H M LVEMEGSH +QN YDSLD+HVGQC   +V+A++EPKDYY+
Sbjct  221   ICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCYGTIVSANQEPKDYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V SSRF K+  +T  ++ Y  G G  +S     P      G AWS+NQFRSFRWNLTASA
Sbjct  281   VASSRFLKKVITTTGLLRYEGGKGPASSQLPAGPV-----GWAWSLNQFRSFRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  +DGKLRYALNGVSH   +TPLKLAEYFGI++K
Sbjct  336   ARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLRYALNGVSHTEPETPLKLAEYFGITDK  395

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+I+ D P PE  + + + PNV+N T R FVE+VFENHEK++Q++HLDG+SFFAVA+
Sbjct  396   VFKYDIITDDPTPEQIKNIKIEPNVLNITHRTFVEVVFENHEKSVQSWHLDGYSFFAVAV  455

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS+  ER YLGQQL
Sbjct  456   EPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSENSERRYLGQQL  515

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPP-PYSG  1191
             Y S+LSPE+SLRDE+N+P+    CGLVK    P  PY+G
Sbjct  516   YASILSPEKSLRDEYNMPETSLQCGLVKNTPKPVNPYAG  554



>ref|XP_006392621.1| hypothetical protein EUTSA_v10011364mg [Eutrema salsugineum]
 gb|ESQ29907.1| hypothetical protein EUTSA_v10011364mg [Eutrema salsugineum]
Length=553

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/398 (63%), Positives = 310/398 (78%), Gaps = 6/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + + I+DWY K H  LKK LDSGRTI RPDG++INGK GK  G   PLFT++ GKTYR R
Sbjct  160   YTILINDWYTKSHTQLKKFLDSGRTIGRPDGILINGKAGKGDGSDQPLFTLKQGKTYRVR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ S+NFR Q H M LVEMEGSH +QN YDSLD+HVGQC  VLVTA++EPKDYY+
Sbjct  220   ICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVLVTANQEPKDYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   +T  ++ Y  G G  +S     P      G AWS+NQFRSFRWNLTASA
Sbjct  280   VASTRFLKNALTTTGLLRYEGGKGPASSQLPAAPV-----GWAWSLNQFRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  +DGKLRYAL+GVSH + +TPLKLAEYFG+ +K
Sbjct  335   ARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLRYALSGVSHTDPETPLKLAEYFGVVDK  394

Query  721   VFKYNIMGDTPPENAEK-VTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D P  +  K + + PNV+N T RNF+EIVFENHE+++Q++HLDG+SFFAVA+
Sbjct  395   VFKYDSISDNPTSDQIKNIKIEPNVLNITHRNFIEIVFENHERSVQSWHLDGYSFFAVAV  454

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS+  ER YLGQQL
Sbjct  455   EPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSENSERRYLGQQL  514

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1191
             Y SVLSPE+SLRDE+N+P+    CGLVK      PY+G
Sbjct  515   YASVLSPEKSLRDEYNMPESSLQCGLVKDKPKINPYAG  552



>ref|XP_009147500.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=555

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/398 (63%), Positives = 311/398 (78%), Gaps = 6/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I+DWY K H  LK  LDSGRTI RPDG++INGK GK  G   PLFT++ GKTYR R
Sbjct  162   YTVLINDWYTKSHTQLKNFLDSGRTIGRPDGILINGKAGKGDGSDQPLFTLKQGKTYRIR  221

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ S+NFR Q   M LVEMEGSH +QN YDSLD+HVGQC  V++TA++EPKDYY+
Sbjct  222   ICNVGLKASLNFRIQNLKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVILTANQEPKDYYI  281

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   +T  ++ Y  G G+ +S     P      G AWS+NQFRSFRWNLTASA
Sbjct  282   VASTRFLKNALTTTGLLRYEGGKGLASSQLPAAPV-----GWAWSLNQFRSFRWNLTASA  336

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  VD KLRYALNGVSHI+T+TPLKLAEYFG+++K
Sbjct  337   ARPNPQGSYHYGKINITRTIKLVNTQGKVDSKLRYALNGVSHIDTETPLKLAEYFGVTDK  396

Query  721   VFKYNIMGDTPPENAEK-VTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D P  +  K + + PNV+N T RNF+E+VFENHE+++Q++HLDG+SFFAVA+
Sbjct  397   VFKYDSISDNPTSDQIKNIKIEPNVLNITHRNFIEVVFENHERSVQSWHLDGYSFFAVAV  456

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRKNYNL+DAVSRH+IQVYP  WAA++ T DN GMWN+RS+  ER YLGQQL
Sbjct  457   EPGTWTPEKRKNYNLLDAVSRHTIQVYPKCWAAILLTFDNCGMWNIRSENSERRYLGQQL  516

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1191
             Y SVLSPE+SLRDE+N+P+    CGLVK      PY+G
Sbjct  517   YASVLSPEKSLRDEYNMPESSLQCGLVKDKPKINPYAG  554



>ref|XP_003529456.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=550

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/396 (64%), Positives = 314/396 (79%), Gaps = 10/396 (3%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             V I DW+ K H  LK+ LDSGR+I RP GV INGK+G     ++ L+TME GKTY+YR+C
Sbjct  162   VLIGDWFGKSHTALKQTLDSGRSIGRPSGVHINGKNGG----LEALYTMEPGKTYKYRIC  217

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             NVG++ ++NFR QGH M LVE EGSH +QN YDSLD+HVGQC +VLVTAD+EP+DY++V 
Sbjct  218   NVGLKEALNFRIQGHPMKLVETEGSHVVQNTYDSLDVHVGQCFTVLVTADQEPRDYFMVA  277

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+RF K+  +   +I Y+NG G  +    P P     +G AWS+NQFRSFRWNLTASAAR
Sbjct  278   STRFTKKVITATRVIRYSNGVGPASPLLPPAPH----QGWAWSLNQFRSFRWNLTASAAR  333

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYGQINITRTIKLV ++S + GKLRYALNGVSH++ +TPLKLAEY+G+++KVF
Sbjct  334   PNPQGSYHYGQINITRTIKLVGTRSKIGGKLRYALNGVSHVDPETPLKLAEYYGVADKVF  393

Query  727   KYNIMGDTPPEN--AEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             KYN++ D P     +    +APNV+NATFRNF+E++ EN  K  Q+Y+LDG+SFFAVA+E
Sbjct  394   KYNLISDAPDAAIASRDPIIAPNVINATFRNFIEVILENPTKVTQSYNLDGYSFFAVAVE  453

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G+WSPEKRK YNL+DAVSRH+IQV+P SWAA+M T DNAGMWNLRS+M E  YLGQQLY
Sbjct  454   PGQWSPEKRKCYNLLDAVSRHTIQVFPKSWAAIMLTFDNAGMWNLRSEMAENRYLGQQLY  513

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SVLSP RSLRDE+NLP+ Q +CG+VK M  PPPYS
Sbjct  514   VSVLSPNRSLRDEYNLPETQLVCGIVKDMPKPPPYS  549



>ref|XP_009417950.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=560

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/397 (64%), Positives = 306/397 (77%), Gaps = 7/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGK--VGGKIDPLFTMEAGKTYR  174
             + V I DWY K HK L K+LDSGRTI RP GV+ING+ GK   G    PLFTMEAGKTYR
Sbjct  168   YTVLIGDWYTKSHKILAKLLDSGRTIGRPAGVLINGRSGKDSTGKDDPPLFTMEAGKTYR  227

Query  175   YRVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDY  354
             YR+CNVGM+ ++NFR Q H+M LVEM+GSHT+QN Y+SLD+HVGQCLS LV A + PKDY
Sbjct  228   YRICNVGMKVTLNFRIQSHSMKLVEMDGSHTMQNVYESLDIHVGQCLSALVEATQAPKDY  287

Query  355   YLVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTA  534
             Y+V SSRF K   +   +I YA  N   +      P      G AWS NQ+RSFRWNLTA
Sbjct  288   YMVASSRFTKYTLTASGLIRYAGSNTPPSQDLPAAPV-----GWAWSFNQWRSFRWNLTA  342

Query  535   SAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGIS  714
             SAARPNPQGSYHYG I+ITRTIKLVNS  +V+GK RYALN VSH +T TPLKLAEYFGI+
Sbjct  343   SAARPNPQGSYHYGSIDITRTIKLVNSVGHVNGKRRYALNAVSHQDTATPLKLAEYFGIA  402

Query  715   EKVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             +KVFKYNI+GD PP +   + +APNV+NATFRNF+EI+FEN E+++Q YHLDG+SFF V 
Sbjct  403   DKVFKYNIIGDDPPASTAPIKIAPNVMNATFRNFIEIIFENPERSMQAYHLDGYSFFPVG  462

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             +  G+W+P+ RK YNL+D VSRH+IQVY  SW+A+M T DNAGMWNLRS++WER YLGQQ
Sbjct  463   MGHGKWTPQSRKTYNLLDTVSRHTIQVYQRSWSAIMLTFDNAGMWNLRSELWERRYLGQQ  522

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             LY SVLSP RSLRDE+N+P+K  +CG V  +  PP Y
Sbjct  523   LYISVLSPARSLRDEYNMPEKALICGDVVNLPRPPSY  559



>ref|XP_002884964.1| hypothetical protein ARALYDRAFT_478720 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61223.1| hypothetical protein ARALYDRAFT_478720 [Arabidopsis lyrata subsp. 
lyrata]
Length=554

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/398 (63%), Positives = 310/398 (78%), Gaps = 6/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  LKK LD GRT+ RPDG++INGK GK  G   PLFT++ GKTYR R
Sbjct  161   YTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILINGKAGKGDGSDAPLFTLKPGKTYRVR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             VCNVG++TS+NFR Q H + LVEMEGSH +QN YDSLD+HVGQC   +++A++E KDYY+
Sbjct  221   VCNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDYDSLDVHVGQCYGTILSANQEAKDYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V SSRF K   +T  ++ Y  G G  +S   P        G AWS+NQFRSFRWNLTASA
Sbjct  281   VASSRFLKSVITTTGLLRYEGGKGPASSQLPP-----GPVGWAWSLNQFRSFRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  V+GKLRYALNGVSH + +TPLKLAEYFG+++K
Sbjct  336   ARPNPQGSYHYGKINITRTIKLVNTQGKVNGKLRYALNGVSHTDPETPLKLAEYFGVADK  395

Query  721   VFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D P PE  + + + PNV+N T R F+E+VFENHEK++Q++HLDG+SFFAVA+
Sbjct  396   VFKYDSITDNPTPEQIKSIKIEPNVLNITHRTFIEVVFENHEKSVQSWHLDGYSFFAVAV  455

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS+  ER YLGQQL
Sbjct  456   EPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSENSERRYLGQQL  515

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1191
             Y SVLSPE+SLRDE+N+P+    CGLVKG   P PY+G
Sbjct  516   YASVLSPEKSLRDEYNMPETSLQCGLVKGTPKPNPYAG  553



>ref|XP_007208285.1| hypothetical protein PRUPE_ppa003733mg [Prunus persica]
 gb|EMJ09484.1| hypothetical protein PRUPE_ppa003733mg [Prunus persica]
Length=552

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/397 (63%), Positives = 313/397 (79%), Gaps = 6/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  LKK+LDSGR++ARPDGV+INGK  K  GK +PLF M+ GKTY+YR
Sbjct  160   YTVLIGDWYTKSHTQLKKLLDSGRSMARPDGVLINGKSSKGDGKDEPLFVMKPGKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ S+NFR QGH+M LVE+EGSHT+QN YDS+D+H+GQC SVLVTADK+PKDYY+
Sbjct  220   ICNVGLKNSLNFRIQGHSMKLVELEGSHTVQNTYDSMDVHLGQCFSVLVTADKDPKDYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   +   II Y NG G  +      P      G AWS+NQFRSFRWNLTASA
Sbjct  280   VASTRFTKSVLTGKGIIRYENGKGPASPELPKAPV-----GWAWSLNQFRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INI+RTIKLVNS S VDGKLRYA+NG+SH++++TPLKLA+Y+ + +K
Sbjct  335   ARPNPQGSYHYGKINISRTIKLVNSASKVDGKLRYAINGISHVDSETPLKLADYYKVWDK  394

Query  721   VFKYNIMGDTPPEN-AEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFK + M DTPP   A+K+T+  NVVN T ++FVEI+FEN EK++QT+HLDG+SFF+VA 
Sbjct  395   VFKPDTMKDTPPATAADKITMVTNVVNITIKDFVEIIFENPEKSLQTWHLDGYSFFSVAS  454

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+P KR NYNL+DAVSR+S+QV+P SWAA+M T DNAGMWN+RSD  ER YLGQQ 
Sbjct  455   EPGTWTPAKRSNYNLLDAVSRYSVQVFPKSWAAIMLTFDNAGMWNIRSDQPERRYLGQQF  514

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             Y  V +  RSLR+E+N+PD   +CG+VK M  P PYS
Sbjct  515   YVDVENIARSLRNEYNMPDNALVCGIVKDMPKPAPYS  551



>gb|KHG03555.1| L-ascorbate oxidase [Gossypium arboreum]
 gb|KHG09844.1| L-ascorbate oxidase [Gossypium arboreum]
Length=551

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/394 (63%), Positives = 310/394 (79%), Gaps = 5/394 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + +   D++NKGH TLKKIL+SGR + R DGV INGK  K  G  +PLFTMEAGKTY+YR
Sbjct  160   YTIIAGDFFNKGHTTLKKILESGRNLGRCDGVHINGKVAKGDGSDEPLFTMEAGKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CN G++TS+N RFQGH M LVEMEGSHT+QN Y+SLD+HVGQC SVLVTAD+EP DY++
Sbjct  220   ICNAGLKTSLNVRFQGHNMKLVEMEGSHTVQNDYESLDVHVGQCFSVLVTADQEPMDYFV  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF KQE +   +I Y NG G  +    P P      G AWS+NQFR+FRWNLTASA
Sbjct  280   VASTRFTKQEVTATGVIRYTNGKGAPSPKLPPPPV-----GWAWSLNQFRTFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSY YG +NITRTIKL N+   VDGKLRYA+NG S++   TPLKLAEY+G+++K
Sbjct  335   ARPNPQGSYKYGSVNITRTIKLANTAQKVDGKLRYAINGASYVEPTTPLKLAEYYGVADK  394

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKY+ + D PP    K+T+ P V+N T RNF+EI+FEN E  IQ+YHL G++FFAVA+E
Sbjct  395   VFKYDTIPDDPPAEITKITMEPVVLNLTHRNFMEIIFENRETAIQSYHLCGYAFFAVAVE  454

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G+WSPEKRKNYNL+DAVSRH+IQV+P SWAA++ + DN GMWN+RS++W+R YLGQQLY
Sbjct  455   TGQWSPEKRKNYNLLDAVSRHTIQVFPKSWAAILLSFDNCGMWNIRSEIWDRRYLGQQLY  514

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPP  1182
              SVLSP +SLRDE+N+P+   +CG+V+ M  PPP
Sbjct  515   VSVLSPNKSLRDEYNMPEGALVCGVVENMPRPPP  548



>ref|XP_009384956.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=550

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/397 (63%), Positives = 311/397 (78%), Gaps = 7/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGK-VGGKID-PLFTMEAGKTYR  174
             + V I DWY K HK L ++LD+GR+I  P GV+ING  GK   GK D PLFTMEAGKTYR
Sbjct  158   YTVLIGDWYTKSHKVLAQLLDAGRSIGNPAGVIINGSPGKDAAGKDDAPLFTMEAGKTYR  217

Query  175   YRVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDY  354
             YR+CNVG++ S+NFR Q H M LVEM+GSHT+QN Y SLD+HVGQC SVLVTA++EPKDY
Sbjct  218   YRICNVGLKVSLNFRIQSHLMKLVEMDGSHTVQNDYKSLDIHVGQCFSVLVTANQEPKDY  277

Query  355   YLVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTA  534
             Y+V S+RF K   +   II YA      +S       P    G AWS NQ+RSFRWNLTA
Sbjct  278   YMVASTRFTKYMRTATGIIRYAG-----SSVPPSPELPAGPVGWAWSFNQWRSFRWNLTA  332

Query  535   SAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGIS  714
             SAARPNPQGSYHYG INITRTIKL +S   V+GK R+ALNG SH+ + TPLKLAEY+G++
Sbjct  333   SAARPNPQGSYHYGSINITRTIKLASSVGLVNGKRRFALNGASHVESPTPLKLAEYYGVA  392

Query  715   EKVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             +KVFKY+ +GD PPE++  +T+APNV+NATFR+++EI+ EN E++IQ+YHLDG+SFFAV 
Sbjct  393   DKVFKYDTIGDEPPESSATITVAPNVLNATFRDYIEIILENPERSIQSYHLDGYSFFAVG  452

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             +  G+W+P  R++YNL+DAVSRH+IQVYP SW+A+M T DNAGMW+LRS++WER YLGQQ
Sbjct  453   MGHGKWTPASRRSYNLLDAVSRHTIQVYPRSWSAIMLTFDNAGMWSLRSELWERHYLGQQ  512

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             LY SV+SP RSLRDE+N+PD   LCG+V  +  PPPY
Sbjct  513   LYISVVSPARSLRDEYNIPDNTLLCGVVASLPKPPPY  549



>ref|XP_003601600.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71851.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/392 (64%), Positives = 307/392 (78%), Gaps = 5/392 (1%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             V I DWY K HKTLK  LDSGR+I RP GV+INGK+ K  G  +PL+TM+ GKTY+YR+C
Sbjct  160   VLIGDWYGKSHKTLKMELDSGRSIGRPAGVIINGKNAKGDGSDEPLYTMKPGKTYKYRIC  219

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             N G++ ++NFRFQGH M LVE EGSH +QN YDSLD+HVGQC +VLVTADKEP+DYY++ 
Sbjct  220   NTGLKDTLNFRFQGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVLVTADKEPRDYYMIA  279

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+R  K       II Y NG G  +    P P      G AWS+NQFRSFRWNLTASAAR
Sbjct  280   STRMTKYNLLGKGIIRYTNGKGPASPVLPPAPV-----GWAWSLNQFRSFRWNLTASAAR  334

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYGQINITRTIK VNS S V+GKLRYA+NGVSH++ +TP+KLAEY+G+++KVF
Sbjct  335   PNPQGSYHYGQINITRTIKFVNSVSNVNGKLRYAINGVSHVDPETPVKLAEYYGVADKVF  394

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
             KYNI+ D PP + + +T+APNV+  TFR F+EI+FEN EK +Q+Y+L G+SFFAVA E G
Sbjct  395   KYNIISDEPPTDLKAITIAPNVMQTTFRTFIEIIFENPEKVLQSYNLGGYSFFAVAGEPG  454

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
              W+PEKRK YNL+DA+SRH+IQV+P SWAA+M T DNAGMW LRS+  E  YLGQQLY S
Sbjct  455   TWTPEKRKGYNLLDAISRHTIQVFPKSWAAIMLTFDNAGMWQLRSEHAEHRYLGQQLYLS  514

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMPPP  1182
             V S E+S RDE+NLP+ Q +CG+VK M  PPP
Sbjct  515   VESEEKSTRDEYNLPETQLVCGIVKDMPRPPP  546



>ref|XP_003601595.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71846.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/392 (64%), Positives = 307/392 (78%), Gaps = 5/392 (1%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             V I DWY K HKTLK  LDSGR+I RP GV+INGK+ K  G+ +PL+TM+ GKTY+YR+C
Sbjct  160   VLIGDWYGKSHKTLKMELDSGRSIGRPAGVIINGKNAKGDGRDEPLYTMKPGKTYKYRIC  219

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             N G++ ++NFRFQGH M LVE EGSH +QN YDSLD+HVGQC +VLVTADKEP+DYY++ 
Sbjct  220   NTGLKDTLNFRFQGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVLVTADKEPRDYYMIA  279

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+R  K       I+ Y NG G  +    P P      G AWS+NQFRSFRWNLTASAAR
Sbjct  280   STRMTKYNLLGKGIVRYTNGKGPASPVLPPAPV-----GWAWSLNQFRSFRWNLTASAAR  334

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYGQINITRTIK VNS S V+GKLRYA+NGVSH++ +TP+KLAEY+G+++KVF
Sbjct  335   PNPQGSYHYGQINITRTIKFVNSVSNVNGKLRYAINGVSHVDPETPVKLAEYYGVADKVF  394

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
             KYNI+ D PP +   +T+APNV+  TFR F+EI+FEN EK +Q+Y+L G+SFFAVA E G
Sbjct  395   KYNIISDEPPTDLRAITIAPNVMQTTFRTFIEIIFENPEKVLQSYNLGGYSFFAVAGEPG  454

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
              W+PEKRK YNL+DA+SRH+IQV+P SWAA+M T DNAGMW LRS+  E  YLGQQLY S
Sbjct  455   TWTPEKRKGYNLLDAISRHTIQVFPKSWAAIMLTFDNAGMWQLRSEHAEHRYLGQQLYLS  514

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMPPP  1182
             V S E+S RDE+NLP+ Q +CG+VK M  PPP
Sbjct  515   VESEEKSTRDEYNLPETQLVCGIVKDMPRPPP  546



>ref|XP_009384957.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=556

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/397 (63%), Positives = 311/397 (78%), Gaps = 7/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGK-VGGKID-PLFTMEAGKTYR  174
             + V I DWY K HK L ++LD+GR+I  P GV+ING  GK   GK D PLFTMEAGKTYR
Sbjct  164   YTVLIGDWYTKSHKVLAQLLDAGRSIGNPAGVIINGSPGKDAAGKDDAPLFTMEAGKTYR  223

Query  175   YRVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDY  354
             YR+CNVG++ S+NFR Q H M LVEM+GSHT+QN Y SLD+HVGQC SVLVTA++EPKDY
Sbjct  224   YRICNVGLKVSLNFRIQSHLMKLVEMDGSHTVQNDYKSLDIHVGQCFSVLVTANQEPKDY  283

Query  355   YLVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTA  534
             Y+V S+RF K   +   II YA      +S       P    G AWS NQ+RSFRWNLTA
Sbjct  284   YMVASTRFTKYMRTATGIIRYAG-----SSVPPSPELPAGPVGWAWSFNQWRSFRWNLTA  338

Query  535   SAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGIS  714
             SAARPNPQGSYHYG INITRTIKL +S   V+GK R+ALNG SH+ + TPLKLAEY+G++
Sbjct  339   SAARPNPQGSYHYGSINITRTIKLASSVGLVNGKRRFALNGASHVESPTPLKLAEYYGVA  398

Query  715   EKVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             +KVFKY+ +GD PPE++  +T+APNV+NATFR+++EI+ EN E++IQ+YHLDG+SFFAV 
Sbjct  399   DKVFKYDTIGDEPPESSATITVAPNVLNATFRDYIEIILENPERSIQSYHLDGYSFFAVG  458

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             +  G+W+P  R++YNL+DAVSRH+IQVYP SW+A+M T DNAGMW+LRS++WER YLGQQ
Sbjct  459   MGHGKWTPASRRSYNLLDAVSRHTIQVYPRSWSAIMLTFDNAGMWSLRSELWERHYLGQQ  518

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             LY SV+SP RSLRDE+N+PD   LCG+V  +  PPPY
Sbjct  519   LYISVVSPARSLRDEYNIPDNTLLCGVVASLPKPPPY  555



>ref|XP_008219577.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=552

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/397 (63%), Positives = 313/397 (79%), Gaps = 6/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DW+ K H  LKK+LD GR++ARPDGV+INGK  K  GK +PLF M+ GKTY+YR
Sbjct  160   YTVLIGDWFTKSHTQLKKLLDGGRSMARPDGVLINGKSSKGDGKDEPLFVMKPGKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ ++NFR QGH+M LVE+EGSHT+QN YDS+D+H+GQC SVLVTADK+PKDYY+
Sbjct  220   ICNVGLKNTLNFRIQGHSMKLVELEGSHTVQNTYDSMDVHLGQCFSVLVTADKDPKDYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   +   II Y NG G  +      P      G AWS+NQFRSFRWNLTASA
Sbjct  280   VASTRFTKSVLTGKGIIRYENGKGPASPELPKAPV-----GWAWSLNQFRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVNS S VDGKLRYA+NG+SH++ +TPLKLA+Y+ + +K
Sbjct  335   ARPNPQGSYHYGKINITRTIKLVNSASKVDGKLRYAINGISHVDPETPLKLADYYKVYDK  394

Query  721   VFKYNIMGDTPPEN-AEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFK++ M DTPP   A+K+T+ PNVVN T R+FVEI+FEN EK+ QT+HLDG+SFF+VA 
Sbjct  395   VFKFDTMKDTPPATAADKITMEPNVVNITIRDFVEIIFENPEKSPQTWHLDGYSFFSVAS  454

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKR NYNL+DAVSR+++QV+P SWAA+M T D+AGMWN+RS+  ER YLGQQ 
Sbjct  455   EPGTWTPEKRSNYNLLDAVSRYTVQVFPKSWAAIMLTFDSAGMWNVRSEQPERRYLGQQF  514

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             Y  V +  RSLR+E+N+PD   +CG+VK M  P P+S
Sbjct  515   YVGVENIARSLRNEYNMPDNALVCGIVKDMPKPAPFS  551



>ref|XP_006345828.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=552

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/398 (62%), Positives = 312/398 (78%), Gaps = 6/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F V +SDWY   HK+LK +LD+GR++ RPDG+VINGK GK  GK +P+FTM  GKTYR+R
Sbjct  158   FTVLVSDWYTNSHKSLKGLLDTGRSLGRPDGIVINGKSGKGDGKDEPMFTMVKGKTYRFR  217

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
              CNVGM+ ++N R QGHTM LVEMEGSHT+QN Y+ LD+H+GQCLSVL+TAD+ PKDY++
Sbjct  218   FCNVGMKDTINVRIQGHTMKLVEMEGSHTVQNLYELLDIHLGQCLSVLITADQNPKDYFI  277

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V +SRF K+     A I YANG G  +  E         EG  WS+NQF SFRWNLTAS+
Sbjct  278   VATSRFTKESRVATATIRYANGKGPASPLEKKEA----PEGWEWSLNQFNSFRWNLTASS  333

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTI+LV++   V+GK RYA+NGVSH + +TP+KLA+Y+G+++K
Sbjct  334   ARPNPQGSYHYGQINITRTIRLVSTAGVVNGKHRYAINGVSHTDPETPIKLAQYYGVADK  393

Query  721   VFKYNIMGD--TPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             VFKY +  D   PP   E +T+APNVVN T+RNFVEI+ ENHEK++Q++HLDG +FFAVA
Sbjct  394   VFKYGLCKDEYIPPSGNEVITIAPNVVNVTYRNFVEIILENHEKSVQSWHLDGFNFFAVA  453

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             I  GRW PE R+NYNL+DAVSR +IQVYPNSWAA++TT+DNAG+WNLRS+  E+ YLG Q
Sbjct  454   IAPGRWKPEMRQNYNLLDAVSRSTIQVYPNSWAAIITTLDNAGLWNLRSNALEKQYLGHQ  513

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             LYFSV +P  SL+DE+N+PD    CG++K +  P PYS
Sbjct  514   LYFSVNAPNTSLKDEYNMPDNDISCGIIKDLPHPKPYS  551



>gb|AES71848.2| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=513

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/392 (64%), Positives = 306/392 (78%), Gaps = 5/392 (1%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             V I DWY K HKTLK  LDSGR+I RP GV+INGK+ K  G  +PL+TM+ GKTY+YR+C
Sbjct  124   VLICDWYGKSHKTLKMELDSGRSIGRPAGVIINGKNAKGDGSDEPLYTMKPGKTYKYRIC  183

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             N G++ ++NFRFQGH M LVE EGSH +QN YDSLD+HVGQC +VLVTADKEP+DYY++ 
Sbjct  184   NTGLKDTLNFRFQGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVLVTADKEPRDYYMIA  243

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+R  K       II Y NG G  +    P P      G AWS+NQFRSFRWNLTASAAR
Sbjct  244   STRMTKYNLLGKGIIRYTNGKGPASPVLPPAPV-----GWAWSLNQFRSFRWNLTASAAR  298

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYGQINITRTIK VNS S V+GKL YA+NGVSH++ +TP+KLAEY+GI++KVF
Sbjct  299   PNPQGSYHYGQINITRTIKFVNSVSNVNGKLCYAINGVSHVDPETPVKLAEYYGIADKVF  358

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
             KYNI+ D PP + + +T+APNV+  TFR F+EI+FEN EK +Q+Y+L G+SFFAVA E G
Sbjct  359   KYNIISDEPPTDLKAITIAPNVMQTTFRTFIEIIFENPEKVLQSYNLGGYSFFAVAGEPG  418

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
              W+PEKRK YNL+DA+SRH+IQV+P SWAA+M T DNAGMW LRS+  E  YLGQQLY S
Sbjct  419   TWTPEKRKGYNLLDAISRHTIQVFPKSWAAIMLTFDNAGMWQLRSEHAEHRYLGQQLYLS  478

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMPPP  1182
             V S E+S RDE+NLP+ Q +CG+VK M  PPP
Sbjct  479   VESEEKSTRDEYNLPETQLVCGIVKDMPRPPP  510



>ref|XP_009124743.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=554

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/398 (62%), Positives = 310/398 (78%), Gaps = 6/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  LKK LD GRT+ RP+GV+INGK GK  G   PLFT++ GK+YR R
Sbjct  161   YTVLIGDWYTKSHTQLKKFLDGGRTLGRPNGVLINGKAGKGDGSDAPLFTLKPGKSYRVR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++TS+NFR Q H M LVEMEGSH +QN +DSLD+HVGQC   +VTA++EPKDYY+
Sbjct  221   ICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDFDSLDVHVGQCFGTIVTANQEPKDYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V SSRF K   +T  ++ Y  G G  +S     P      G AWS+NQFRSFRWNLT++A
Sbjct  281   VASSRFLKSVITTTGLLRYEGGKGPASSQLPAGPV-----GWAWSLNQFRSFRWNLTSNA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYALNG+SH + +TPLKLAEYFGI++K
Sbjct  336   ARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGISHTDLETPLKLAEYFGIADK  395

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKYN + +  PE  + + + P+V+N T RNF+E+VFENHEK++Q++HL+G+SFFAVA+E
Sbjct  396   VFKYNSVDNPTPEQTKSIKIEPHVLNITHRNFIEVVFENHEKSVQSWHLNGYSFFAVAVE  455

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS+  ER YLGQQLY
Sbjct  456   PGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSENTERRYLGQQLY  515

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPP-PYSG  1191
              SVLSPE+SLRDE+N+P+    CGLVK    P  PY+G
Sbjct  516   VSVLSPEKSLRDEYNMPETSLQCGLVKNTPKPANPYAG  553



>ref|XP_003601597.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=554

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/392 (64%), Positives = 306/392 (78%), Gaps = 5/392 (1%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             V I DWY K HKTLK  LDSGR+I RP GV+INGK+ K  G  +PL+TM+ GKTY+YR+C
Sbjct  165   VLICDWYGKSHKTLKMELDSGRSIGRPAGVIINGKNAKGDGSDEPLYTMKPGKTYKYRIC  224

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             N G++ ++NFRFQGH M LVE EGSH +QN YDSLD+HVGQC +VLVTADKEP+DYY++ 
Sbjct  225   NTGLKDTLNFRFQGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVLVTADKEPRDYYMIA  284

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+R  K       II Y NG G  +    P P      G AWS+NQFRSFRWNLTASAAR
Sbjct  285   STRMTKYNLLGKGIIRYTNGKGPASPVLPPAPV-----GWAWSLNQFRSFRWNLTASAAR  339

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYGQINITRTIK VNS S V+GKL YA+NGVSH++ +TP+KLAEY+GI++KVF
Sbjct  340   PNPQGSYHYGQINITRTIKFVNSVSNVNGKLCYAINGVSHVDPETPVKLAEYYGIADKVF  399

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
             KYNI+ D PP + + +T+APNV+  TFR F+EI+FEN EK +Q+Y+L G+SFFAVA E G
Sbjct  400   KYNIISDEPPTDLKAITIAPNVMQTTFRTFIEIIFENPEKVLQSYNLGGYSFFAVAGEPG  459

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
              W+PEKRK YNL+DA+SRH+IQV+P SWAA+M T DNAGMW LRS+  E  YLGQQLY S
Sbjct  460   TWTPEKRKGYNLLDAISRHTIQVFPKSWAAIMLTFDNAGMWQLRSEHAEHRYLGQQLYLS  519

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMPPP  1182
             V S E+S RDE+NLP+ Q +CG+VK M  PPP
Sbjct  520   VESEEKSTRDEYNLPETQLVCGIVKDMPRPPP  551



>ref|XP_008219320.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=552

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/397 (62%), Positives = 312/397 (79%), Gaps = 6/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DW+ K H  LKK+LD GR++ARPDGV+INGK  K  GK +PLF M+ GKTY+YR
Sbjct  160   YTVLIGDWFTKSHTQLKKLLDGGRSMARPDGVLINGKSSKGDGKDEPLFVMKPGKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ ++NFR QGH+M LVE+EGSHT+QN YDS+D+H+GQC SVLVTADK+PKDYY+
Sbjct  220   ICNVGLKNTLNFRIQGHSMKLVELEGSHTVQNTYDSMDVHLGQCFSVLVTADKDPKDYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF     +   II Y NG G  +      P      G AWS+NQFRSFRWNLTASA
Sbjct  280   VASTRFTNSVLTGKGIIRYENGKGPASPELPKAPV-----GWAWSLNQFRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVNS S VDGKLRYA+NG+SH++ +TPLKLA+Y+ + +K
Sbjct  335   ARPNPQGSYHYGKINITRTIKLVNSASKVDGKLRYAINGISHVDPETPLKLADYYKVYDK  394

Query  721   VFKYNIMGDTPPEN-AEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFK++ M DTPP   A+K+T+ PNVVN T R+FVEI+FEN EK++QT+HLDG+SFF+V  
Sbjct  395   VFKFDTMKDTPPATAADKITMEPNVVNITIRDFVEIIFENPEKSLQTWHLDGYSFFSVGS  454

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKR NYNL+DAVSR+++QV+P SWAA+M T D+AGMWN+RS+  ER YLGQQ 
Sbjct  455   EPGTWTPEKRSNYNLLDAVSRYTVQVFPKSWAAIMLTFDSAGMWNVRSEQPERRYLGQQF  514

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             Y  V +  RSLR+E+N+PD   +CG+VK M  P P+S
Sbjct  515   YVGVENIARSLRNEYNMPDNALVCGIVKDMPKPAPFS  551



>ref|XP_003601599.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71850.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/392 (64%), Positives = 304/392 (78%), Gaps = 5/392 (1%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             V I DWY K HKTLK  LDSGR+I RP GV+INGK+ K  G  +PL+TM+ GKTY+YR+C
Sbjct  160   VLIGDWYGKSHKTLKMELDSGRSIGRPAGVIINGKNAKGDGSDEPLYTMKPGKTYKYRIC  219

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             N G++ ++NFRFQGH M LVE EGSH +QN YDSLD+HVGQC +VLVTADKEP+DYY++ 
Sbjct  220   NTGLKDTLNFRFQGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVLVTADKEPRDYYMIA  279

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+R  K       I+ Y NG G  +      P      G AWS+NQFRSFRWNLTASAAR
Sbjct  280   STRMTKYNLVGKGIVRYTNGKGPASPLLPSAPV-----GWAWSLNQFRSFRWNLTASAAR  334

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYGQINITRTIK VNS S V+GKLRYA+NGVSH++ +TP+KLAEY+G+++KVF
Sbjct  335   PNPQGSYHYGQINITRTIKFVNSVSNVNGKLRYAINGVSHVDPETPVKLAEYYGVADKVF  394

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
             KYNI+ D PP +   +T+APNV+  TFR F+EI+FEN  K +Q+Y+L G+SFFAVA E G
Sbjct  395   KYNIISDEPPTDLRAITIAPNVMQTTFRTFIEIIFENPGKVLQSYNLGGYSFFAVAGEPG  454

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
              W+PEKRK YNL+DA+SRH+IQV+P SWAA+M T DNAGMW LRS+  E  YLGQQLY S
Sbjct  455   TWTPEKRKGYNLLDAISRHTIQVFPKSWAAIMLTFDNAGMWQLRSEHAEHRYLGQQLYLS  514

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMPPP  1182
             V S E+S RDE+NLP+ Q +CG+VK M  PPP
Sbjct  515   VESEEKSTRDEYNLPETQLVCGIVKDMPRPPP  546



>ref|XP_008219429.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=552

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/397 (62%), Positives = 312/397 (79%), Gaps = 6/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DW+ K H  LKK+LD GR++ARPDGV+INGK  K  GK +PLF M+ GKTY+YR
Sbjct  160   YTVLIGDWFTKSHTQLKKLLDGGRSMARPDGVLINGKSSKGDGKDEPLFVMKPGKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ ++NFR QGH+M LVE+EGSHT+QN YDS+D+H+GQC SVLVTADK+PKDYY+
Sbjct  220   ICNVGLKNTLNFRIQGHSMKLVELEGSHTVQNTYDSMDVHLGQCFSVLVTADKDPKDYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF     +   II Y NG G  +      P      G AWS+NQFRSFRWNLTASA
Sbjct  280   VASTRFTNSVLTGKGIIRYENGKGPASPELPKAPV-----GWAWSLNQFRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVNS S VDGKLRYA+NG+SH++ +TPLKLA+Y+ + +K
Sbjct  335   ARPNPQGSYHYGKINITRTIKLVNSASKVDGKLRYAINGISHVDPETPLKLADYYKVYDK  394

Query  721   VFKYNIMGDTPPEN-AEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFK++ M DTPP   A+K+T+ PNVVN T R+FVEI+FEN E ++QT+HLDG+SFF+VA 
Sbjct  395   VFKFDTMKDTPPATAADKITMEPNVVNITIRDFVEIIFENPENSLQTWHLDGYSFFSVAS  454

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKR NYNL+DAVSR+++QV+P SWAA+M T D+AGMWN+RS+  ER YLGQQ 
Sbjct  455   EPGTWTPEKRSNYNLLDAVSRYTVQVFPKSWAAIMLTFDSAGMWNVRSEQPERRYLGQQF  514

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             Y  V +  RSLR+E+N+PD   +CG+VK M  P P+S
Sbjct  515   YVGVENIARSLRNEYNMPDNALVCGIVKDMPKPAPFS  551



>ref|XP_003601596.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71847.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/392 (64%), Positives = 306/392 (78%), Gaps = 5/392 (1%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             V I DWY K HKTLK  LDSGR+I RP GV+INGK+ K  G  +PL+TM+ GKTY+YR+C
Sbjct  160   VLIGDWYGKSHKTLKMELDSGRSIGRPAGVIINGKNAKGDGSDEPLYTMKPGKTYKYRIC  219

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             N G++ ++NFRFQGH M LVE EGSH +QN YDSLD+HVGQC +VLVTADKEP+DYY++ 
Sbjct  220   NTGLKDTLNFRFQGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVLVTADKEPRDYYMIA  279

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+R  K       I+ Y NG G  +    P P      G AWS+NQFRSFRWNLTASAAR
Sbjct  280   STRMTKYNLLGKGIVRYTNGKGPASPVLPPAPV-----GWAWSLNQFRSFRWNLTASAAR  334

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYGQINITRTIK VNS S V+GKL YA+NGVSH++ +TP+KLAEY+G+++KVF
Sbjct  335   PNPQGSYHYGQINITRTIKFVNSVSNVNGKLCYAINGVSHVDPETPVKLAEYYGVADKVF  394

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
             KYNI+ D PP + + +T+APNV+  TFR F+EI+FEN EK +Q+Y+L G+SFFAVA E G
Sbjct  395   KYNIISDEPPTDLKAITIAPNVMQTTFRTFIEIIFENPEKVLQSYNLGGYSFFAVAGEPG  454

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
              W+PEKRK YNL+DA+SRH+IQV+P SWAA+M T DNAGMW LRS+  E  YLGQQLY S
Sbjct  455   TWTPEKRKGYNLLDAISRHTIQVFPKSWAAIMLTFDNAGMWQLRSEHAEHRYLGQQLYLS  514

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMPPP  1182
             V S E+S RDE+NLP+ Q +CG+VK M  PPP
Sbjct  515   VESEEKSTRDEYNLPETQLVCGIVKDMPRPPP  546



>ref|XP_003607814.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES90011.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=550

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/395 (63%), Positives = 305/395 (77%), Gaps = 5/395 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DW+ K H TL K+LDSGR + RP  V++NG++ K  G   PLFTM+ GKTY+YR
Sbjct  160   YTVLIGDWFTKSHSTLSKLLDSGRALGRPQAVLVNGQNAKGDGSDKPLFTMKPGKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ S+NF  Q H M LVE EGSHT+QN+YDSLD+HVGQC  VLVTADKEPKDYY+
Sbjct  220   ICNVGLKNSLNFGIQNHPMKLVEFEGSHTVQNSYDSLDVHVGQCFGVLVTADKEPKDYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   +   I+ YANG G  +      P      G AWS+NQFRSFRWNLTASA
Sbjct  280   VASTRFTKTVITGKGIMRYANGKGPASPELPEAPV-----GWAWSLNQFRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRT+KL+N+ S   GKLRYALNGVSH++T+TPLKLAEY+ ++EK
Sbjct  335   ARPNPQGSYHYGQINITRTVKLINTVSREGGKLRYALNGVSHVDTETPLKLAEYYNVAEK  394

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKY+ + D P      VTLAPNV+    R F+EIVFENHEK++Q+Y+LDG+SFFAVAIE
Sbjct  395   VFKYDTIPDMPENLGTSVTLAPNVLKFKHRTFIEIVFENHEKSVQSYNLDGYSFFAVAIE  454

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G W+PEKRK YNL+DAVSRH+IQV+P SWAA+M + DN G+WNLRS++ E  YLGQQLY
Sbjct  455   PGLWTPEKRKTYNLLDAVSRHTIQVFPKSWAAIMLSFDNVGVWNLRSEIAENRYLGQQLY  514

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
              SV +PERSLRDE+NLP+   LCG+VK +  PP Y
Sbjct  515   ISVPTPERSLRDEYNLPENSLLCGIVKDLPKPPSY  549



>ref|XP_003601601.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71852.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=550

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/392 (64%), Positives = 304/392 (78%), Gaps = 5/392 (1%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             V I DWY K HKTLK  LDSGR+I RP GV+INGK+ K  G  +PL+TM+ GKTY+YR+C
Sbjct  161   VLIGDWYGKSHKTLKMELDSGRSIGRPAGVIINGKNAKGDGSDEPLYTMKPGKTYKYRIC  220

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             N G++ ++NFRFQGH M LVE EGSH +QN YDSLD+HVGQC +VLVTADKEPKDYY+V 
Sbjct  221   NTGLKDTLNFRFQGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVLVTADKEPKDYYMVA  280

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+R  K       II Y NG G  +    P P      G AWS+NQFRSFRWNLTASAAR
Sbjct  281   STRMTKYNLLGKGIIRYTNGKGPASPMLPPAPV-----GWAWSLNQFRSFRWNLTASAAR  335

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYGQINITRTIK VNS S V+GKLRYA+NGVSH++ +TP+KLAEY+G+++KVF
Sbjct  336   PNPQGSYHYGQINITRTIKFVNSVSNVNGKLRYAINGVSHVDPETPVKLAEYYGVADKVF  395

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
             KYNI+ D PP +   +T+APNV+  TFR F+EI+FEN  K +Q+Y+L G+SFF VA E G
Sbjct  396   KYNIISDEPPIDLRAITIAPNVMQTTFRTFIEIIFENPGKVLQSYNLGGYSFFVVAGEPG  455

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
              W+PEKRK YNL+DA+SRH+IQV+P SWAA+M T DNAGMW LRS+  E  YLGQQLY S
Sbjct  456   TWTPEKRKGYNLLDAISRHTIQVFPKSWAAIMLTFDNAGMWQLRSEHAEHRYLGQQLYLS  515

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMPPP  1182
             V S E+S RDE+NLP+ Q +CG+VK M  PPP
Sbjct  516   VESEEKSTRDEYNLPETQLVCGIVKDMPRPPP  547



>gb|KHG05644.1| L-ascorbate oxidase [Gossypium arboreum]
Length=535

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/394 (63%), Positives = 310/394 (79%), Gaps = 5/394 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + +   D++NKG+ +LKK+L SGR + R DGV INGK  K  G  +PLFTMEAGKTY+YR
Sbjct  144   YTLIAGDFFNKGYTSLKKVLLSGRNLGRCDGVHINGKVAKGDGNDEPLFTMEAGKTYKYR  203

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CN G++TS+N RFQGHTM LVEMEGSHT+QN Y+SLD+HVGQC SVLVTA++EPKDY++
Sbjct  204   ICNAGIKTSLNVRFQGHTMKLVEMEGSHTVQNDYESLDVHVGQCFSVLVTANQEPKDYFV  263

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+E     +I Y NG G  +    P P        AWS+NQFR+FRWNLTASA
Sbjct  264   VASTRFTKREVIATGVIRYNNGKGAPSPKLPPPPVSW-----AWSLNQFRTFRWNLTASA  318

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSY YG INITRTIKL N+   VDGKLRYALNGVS++   TPLKLAEY+ +++K
Sbjct  319   ARPNPQGSYKYGSINITRTIKLANTAHKVDGKLRYALNGVSYVEPTTPLKLAEYYNVADK  378

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKY+ + D PP    KVT+ P V+N T RNF+EI+FEN E  IQ+YHLDG+SFFAVAIE
Sbjct  379   VFKYDNIPDDPPAEITKVTMEPIVLNMTHRNFIEIIFENRETAIQSYHLDGYSFFAVAIE  438

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G+WSPEKRKNYNL+DAVSRH+IQV+P SWAA++ T DN GMWN+RS++W+R YLGQQLY
Sbjct  439   TGKWSPEKRKNYNLLDAVSRHTIQVFPKSWAAILLTFDNCGMWNIRSEVWDRHYLGQQLY  498

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPP  1182
              SV+SP +SL+DE+N+PD   +CG+V+ M  PPP
Sbjct  499   ASVVSPNKSLKDEYNMPDGALVCGVVESMPRPPP  532



>ref|XP_004505355.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=550

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/395 (63%), Positives = 305/395 (77%), Gaps = 5/395 (1%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  L K+LDSGR++ RP  V++NG+  K  G   PLFTM+ GKTY+YR
Sbjct  160   YTVLIGDWYTKSHTALAKLLDSGRSLGRPQAVLVNGQVAKGDGSDKPLFTMKPGKTYKYR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ S+NFR QGH M LVE EGSHT+QN+YDSLD+H+GQC  VLVTADK+PKDYY+
Sbjct  220   ICNVGLKNSLNFRIQGHPMKLVEFEGSHTVQNSYDSLDVHLGQCFGVLVTADKDPKDYYM  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   +   II Y NG G  +      P      G AWS+NQFRSF WNLTASA
Sbjct  280   VASTRFTKSIVTGKGIIRYTNGKGPASPELPEAPV-----GWAWSLNQFRSFHWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRT+KL+NS S  + KLRYALNG+SH++ +TPLKLAEYFGI+EK
Sbjct  335   ARPNPQGSYHYGQINITRTVKLINSVSRDNSKLRYALNGISHVDPETPLKLAEYFGIAEK  394

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKY+ + D P      VTL PNV+N   R F+EI+FENHEK++Q+++L+G+SFF VAIE
Sbjct  395   VFKYDSIPDMPQSVPSSVTLQPNVLNFKHRTFIEIIFENHEKSVQSFNLNGYSFFKVAIE  454

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G W+PEKRK YNL+DAVSRH++QV+P SWAA+M T DN G+WNLRS++ E  YLGQQLY
Sbjct  455   PGTWTPEKRKCYNLLDAVSRHTVQVFPKSWAAIMLTFDNVGVWNLRSELAENRYLGQQLY  514

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
              SV++PERSLRDE+N+P+   LCGLVKG+  PP Y
Sbjct  515   ISVITPERSLRDEYNIPENSLLCGLVKGLPKPPSY  549



>ref|XP_010938086.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=550

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/398 (63%), Positives = 302/398 (76%), Gaps = 7/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKID--PLFTMEAGKTYR  174
             FNV   DWY K HK L ++LDSGR + RP GV+INGKHGK     D  P+FTMEAGKTYR
Sbjct  158   FNVLAGDWYTKSHKVLARLLDSGRGVGRPAGVLINGKHGKDASGKDEPPMFTMEAGKTYR  217

Query  175   YRVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDY  354
             YRVCNVG++TS++FR Q H + LVEMEGSHTIQN YDSLD+H+GQC SV VTAD++P DY
Sbjct  218   YRVCNVGIKTSLSFRIQKHALRLVEMEGSHTIQNVYDSLDIHIGQCFSVFVTADQQPGDY  277

Query  355   YLVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTA  534
             Y+V+S+RF K      AII YA  N   +    P        G AWS NQ+RSFRWNLTA
Sbjct  278   YMVISTRFTKYNCGGTAIIRYAGSNTPPSPDLPP-----APSGWAWSFNQWRSFRWNLTA  332

Query  535   SAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGIS  714
             SAARPNPQGSYHYG INITRTI+L  S   V+GK RYALNGVSH N  TPLKL+EY+GI+
Sbjct  333   SAARPNPQGSYHYGSINITRTIRLRGSTGLVNGKRRYALNGVSHENPATPLKLSEYYGIA  392

Query  715   EKVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             EK FKYNI+GD PP +   + ++PNVVN TFR F+EI+ EN E++I  YHLDG+SFF V 
Sbjct  393   EKEFKYNIIGDEPPADKSTIVISPNVVNCTFRTFIEIILENPERSIHAYHLDGYSFFPVG  452

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             +  G W+PE+R+ YNL+DAVSRH++QVYP SW+AVM T DNAGMWNLR+ +W++ YLGQQ
Sbjct  453   MGHGEWTPERRRTYNLLDAVSRHTVQVYPKSWSAVMLTFDNAGMWNLRTLIWDKQYLGQQ  512

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             LY SV+SP RSLRDE+N+P+   LCG V  +  PPPY+
Sbjct  513   LYISVVSPARSLRDEYNIPENTLLCGNVVNLPKPPPYT  550



>emb|CDY43353.1| BnaA01g29840D [Brassica napus]
Length=554

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/398 (62%), Positives = 309/398 (78%), Gaps = 6/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  LKK LD GRT+ RP+GV+INGK GK  G   PLFT++ GK+YR R
Sbjct  161   YTVLIGDWYTKSHTQLKKFLDGGRTLGRPNGVLINGKAGKGDGSDAPLFTLKPGKSYRVR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++TS+NFR Q H M LVEMEGSH +QN +DSLD+HVGQC   +VTA++E KDYY+
Sbjct  221   ICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDFDSLDVHVGQCFGTIVTANQEAKDYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V SSRF K   +T  ++ Y  G G  +S     P      G AWS+NQFRSFRWNLT++A
Sbjct  281   VASSRFLKSVITTTGLLRYEGGKGPASSQLPAGPV-----GWAWSLNQFRSFRWNLTSNA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYALNG+SH + +TPLKLAEYFGI++K
Sbjct  336   ARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGISHTDLETPLKLAEYFGIADK  395

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKYN + +  PE  + + + P+V+N T RNF+E+VFENHEK++Q++HL+G+SFFAVA+E
Sbjct  396   VFKYNSVDNPTPEQTKSIKIEPHVLNITHRNFIEVVFENHEKSVQSWHLNGYSFFAVAVE  455

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS+  ER YLGQQLY
Sbjct  456   PGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSENTERRYLGQQLY  515

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPP-PYSG  1191
              SVLSPE+SLRDE+N+P+    CGLVK    P  PY+G
Sbjct  516   VSVLSPEKSLRDEYNMPETSLQCGLVKNTPKPANPYAG  553



>ref|XP_009402422.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=550

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/397 (63%), Positives = 307/397 (77%), Gaps = 7/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGK-VGGKID-PLFTMEAGKTYR  174
             + V I DWY K HK L  ILD+GR+I  P G+++NG  GK   GK D PLF MEAGKTYR
Sbjct  158   YTVLIGDWYTKSHKALAGILDAGRSIGNPTGILMNGSPGKNAAGKDDAPLFAMEAGKTYR  217

Query  175   YRVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDY  354
             YR+CNVG++ S+NFR Q H M LVEM+GSHT+QN Y+SLD+HVGQCLSVLVTA++EPKDY
Sbjct  218   YRICNVGLKVSLNFRIQNHLMKLVEMDGSHTVQNDYESLDVHVGQCLSVLVTANQEPKDY  277

Query  355   YLVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTA  534
             Y+V S+RF K   +   I+ YA  N   +S            G AWS NQ+RSFRWNLTA
Sbjct  278   YMVASTRFTKYMLTATGIVRYAGSNVPPSSELPA-----GPVGWAWSFNQWRSFRWNLTA  332

Query  535   SAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGIS  714
             SAARPNPQGSYHYG INITRTIKL +S   V+GK R+ALNGVSH+ T+TPLKLAEY+GI+
Sbjct  333   SAARPNPQGSYHYGSINITRTIKLASSVGLVNGKRRFALNGVSHVETETPLKLAEYYGIA  392

Query  715   EKVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             +KVFKY+ + D PP  +  +T APNV+NATFR+++EI+ EN E++IQ++HLDG+SFFAV 
Sbjct  393   DKVFKYDSISDEPPAASATITAAPNVLNATFRDYIEIILENPERSIQSFHLDGYSFFAVG  452

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             +  G+W+P  RK YNL+DAVSRH+IQVYP SW+A+M T DNAGMW+LRS++WER YLGQQ
Sbjct  453   MGHGKWTPASRKTYNLLDAVSRHTIQVYPRSWSAIMLTFDNAGMWSLRSELWERHYLGQQ  512

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             LY SVLSP RSLRDE+++PD   LCG V  +  PPPY
Sbjct  513   LYISVLSPARSLRDEYSIPDNTLLCGDVTTLPKPPPY  549



>emb|CDY24189.1| BnaC01g37690D [Brassica napus]
Length=554

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/398 (62%), Positives = 309/398 (78%), Gaps = 6/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  LKK LD GRT+ RP+GV+INGK GK  G   PLFT++ GK++R R
Sbjct  161   YTVLIGDWYTKSHTQLKKFLDGGRTLGRPNGVLINGKAGKGDGSDAPLFTLKPGKSHRVR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++TS+NFR Q H M LVEMEGSH +QN +DSLD+HVGQC   +VTA++EPKDYY+
Sbjct  221   ICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDFDSLDVHVGQCFGTIVTANQEPKDYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V SSRF K   +T  ++ Y  G G  +S     P      G AWS+NQFRSFRWNLT+SA
Sbjct  281   VASSRFLKSVITTTGLLRYEGGKGPASSQLPAGPV-----GWAWSLNQFRSFRWNLTSSA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYALNG+SH + +TPLKLAEYFGI++K
Sbjct  336   ARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGISHTDLETPLKLAEYFGIADK  395

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKYN + +   E  + + + P+V+N T RNF+E+VFENHEK++Q++HL+G+SFFAVA+E
Sbjct  396   VFKYNSVDNPTAEQTKSIKIEPHVLNITHRNFIEVVFENHEKSVQSWHLNGYSFFAVAVE  455

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS+  ER YLGQQLY
Sbjct  456   PGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSENTERRYLGQQLY  515

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPP-PYSG  1191
              SVLSPE+SLRDE+N+P+    CGLVK    P  PY+G
Sbjct  516   VSVLSPEKSLRDEYNMPETSLQCGLVKNTPKPANPYAG  553



>ref|XP_007163844.1| hypothetical protein PHAVU_001G269100g [Phaseolus vulgaris]
 gb|ESW35838.1| hypothetical protein PHAVU_001G269100g [Phaseolus vulgaris]
Length=549

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/397 (63%), Positives = 306/397 (77%), Gaps = 6/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V ISDWY K H TLKK LDSGR+I RP+GV+INGK  K  G   P+FTM+ GKTY+YR
Sbjct  158   YTVLISDWYTKSHTTLKKFLDSGRSIGRPEGVLINGKTAKGDGSDKPMFTMKPGKTYKYR  217

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVGM+ S+N RFQGH M LVEMEGSH +QN YDSLD+HVG C SVL+TADK+PKDYY+
Sbjct  218   ICNVGMKNSLNLRFQGHLMKLVEMEGSHVVQNNYDSLDVHVGGCFSVLITADKDPKDYYI  277

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   +  AI+ Y NG G  +      P      G AWS+NQF++FRWNL+ASA
Sbjct  278   VASTRFSKTVLTGKAIMRYTNGKGAPSPDIPESPL-----GWAWSLNQFKTFRWNLSASA  332

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSY Y +I+ITRTIKLVNS S  +GKLRYALNGVSH++ +TPLKLAEYFG+S+K
Sbjct  333   ARPNPQGSYKYSKIDITRTIKLVNSVSRENGKLRYALNGVSHVDPETPLKLAEYFGVSDK  392

Query  721   VFKYNIMGDTPPEN-AEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKYN + D PP +    V + PNV+N T R F+EI+FEN EK+IQ+YHLDG++FF V I
Sbjct  393   VFKYNTIQDEPPADLGASVKIQPNVLNVTHRKFIEIIFENPEKSIQSYHLDGYAFFVVGI  452

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+P+KRK+YN  DAVSRH++QV+P  WAA++ + DN GMWNLRS   E  YLGQQL
Sbjct  453   EPGTWTPDKRKSYNPFDAVSRHTVQVFPKCWAAILLSTDNVGMWNLRSLTAENMYLGQQL  512

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             Y S++SPE SLRDE+N+PD   LCG+VKG+  PPPY+
Sbjct  513   YISIMSPEGSLRDEYNMPDDNLLCGVVKGLPKPPPYT  549



>ref|XP_009411781.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=548

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/396 (62%), Positives = 299/396 (76%), Gaps = 8/396 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K HKTL +ILD+GR+I  P GV+INGK GK     +PLF MEAGK YRYR
Sbjct  161   YTVMIGDWYTKDHKTLARILDTGRSIGLPAGVLINGKAGK---DDEPLFVMEAGKVYRYR  217

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             VCN+G +TS+NFR QGH+M LVEM+GSHT+QN Y+SLD+HVGQC SVLVTA++ P DYY+
Sbjct  218   VCNIGTKTSLNFRIQGHSMLLVEMDGSHTMQNTYESLDIHVGQCFSVLVTANQAPGDYYM  277

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF ++E +   +I Y+  + + +             G AWS+NQ+RSFRWNLTASA
Sbjct  278   VASTRFLRKELTATGVIRYSGSHTLPSPVLPKA-----PSGWAWSLNQWRSFRWNLTASA  332

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG I+ITRTIKL +S++ + GK RY LNGVSH+  DTPLKLAEYFGI  K
Sbjct  333   ARPNPQGSYHYGSIDITRTIKLASSRAIIAGKNRYTLNGVSHVEADTPLKLAEYFGIGGK  392

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
              FKYN+  D PP       LA NV+   FR FVEI+FEN EK +Q+YHL+G+SFF V + 
Sbjct  393   SFKYNLTSDEPPSGGAPAILATNVITIEFRTFVEIIFENPEKNVQSYHLNGYSFFLVGMG  452

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G+W+PE RK YNL+DAVSRH++QVYP SWAA+M T DNAGMWNLRS++WER YLGQQLY
Sbjct  453   PGKWTPESRKTYNLLDAVSRHAVQVYPKSWAAIMLTFDNAGMWNLRSELWERRYLGQQLY  512

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              SV SP RSLRDE+NLPD   LCG V+G+  P PY+
Sbjct  513   ISVQSPARSLRDEYNLPDTALLCGAVEGLPKPAPYT  548



>ref|XP_009383852.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=552

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/398 (62%), Positives = 300/398 (75%), Gaps = 7/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVG-GKID-PLFTMEAGKTYR  174
             + V + DWY K HK L K LD GR+I  P GV+INGK GK G GK D PLF MEAGK YR
Sbjct  160   YTVLVGDWYAKDHKALAKTLDMGRSIGLPSGVLINGKSGKHGSGKDDKPLFVMEAGKVYR  219

Query  175   YRVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDY  354
             YR+CN G++ S+NFR QGHTM LVEM+GSHT+QN YDSLD+HVGQC SVLVTAD+ PKDY
Sbjct  220   YRICNTGIKASINFRIQGHTMELVEMDGSHTMQNMYDSLDIHVGQCFSVLVTADRAPKDY  279

Query  355   YLVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTA  534
             YLV S+RF ++E +  A++ YA  N   ++            G  WS+NQ+RSFRWNLTA
Sbjct  280   YLVASTRFLRKEITATAVVRYAGSNTPPSAVLPK-----GPTGWGWSLNQWRSFRWNLTA  334

Query  535   SAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGIS  714
             SAARPNPQGSYHYG INITRTIKL +S+    GK+R+ LNG+SH++TDTPLK  EYFG+ 
Sbjct  335   SAARPNPQGSYHYGSINITRTIKLSSSRVVDGGKIRFTLNGLSHVDTDTPLKHGEYFGVG  394

Query  715   EKVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             +K FKYN++GD PP +    TLAPNV+   FR +VEI+ EN E+ +Q+YHLDG+SFF V 
Sbjct  395   DKFFKYNLIGDVPPASKAPFTLAPNVITIEFRTYVEIILENPERNLQSYHLDGYSFFPVG  454

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             +  G+W+P  RK YNL+DAVSRH+IQVYP SW+A+M T DNAGMWNLRS++WER Y GQQ
Sbjct  455   MGPGKWTPASRKGYNLLDAVSRHTIQVYPRSWSAIMLTFDNAGMWNLRSELWERRYQGQQ  514

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             LY SV SP RSLRDE++LPD   LCG V  +  PPPY+
Sbjct  515   LYISVQSPARSLRDEYSLPDTVLLCGAVASLPKPPPYT  552



>ref|XP_003607816.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES90013.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=545

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/390 (65%), Positives = 302/390 (77%), Gaps = 9/390 (2%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             V + DWY K H  L+K LDSGR++ RPDGV I GK        +PL+ ME GKTY+YR+C
Sbjct  160   VLMGDWYGKSHTQLQKFLDSGRSMGRPDGVHIMGKSNSA----EPLYKMEPGKTYKYRLC  215

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             NVG++ S+NFR Q H M LVEMEGSHT+QN YDSLD+HVGQC SVLVTADKEPK Y +V 
Sbjct  216   NVGLKDSLNFRIQDHPMKLVEMEGSHTVQNVYDSLDVHVGQCFSVLVTADKEPKQYKMVA  275

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+RF K   +T A+ISY NGNG  +    P P      G AWS+NQ RSFRWNLTASAAR
Sbjct  276   STRFTKTVLTTTAVISYTNGNGPASPVLPPAPV-----GWAWSLNQVRSFRWNLTASAAR  330

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYGQINITRTIKLVN+   +DGKLRY LNGVSH + +TPLKLAEY+G++ KVF
Sbjct  331   PNPQGSYHYGQINITRTIKLVNNPFNIDGKLRYTLNGVSHEDDETPLKLAEYYGVANKVF  390

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
             +Y++  D PP     + +  NV+N TFR FVEI+FEN  K IQ+Y+LDG+SFFAVA+E G
Sbjct  391   QYDLTSDNPPAVIGNLRVEANVLNVTFRTFVEIIFENPTKVIQSYNLDGYSFFAVAVEPG  450

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
             +W+PEKRKNYNL+DAVSRH++QV+P SWAA+M T DNAGMWNLRS+M E  YLGQQ+Y S
Sbjct  451   KWTPEKRKNYNLLDAVSRHTVQVFPKSWAAIMLTFDNAGMWNLRSEMAENRYLGQQMYMS  510

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMP  1176
             VLSPE+S RDE+NLPD  Q+CG+VK M  P
Sbjct  511   VLSPEKSNRDEYNLPDTHQVCGIVKDMPRP  540



>emb|CAA47176.1| Bplo [Brassica napus]
Length=554

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/398 (62%), Positives = 308/398 (77%), Gaps = 6/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  LKK LD GRT+ RP+GV+INGK GK  G   PLFT++ GK+YR R
Sbjct  161   YTVLIGDWYTKSHTQLKKFLDGGRTLGRPNGVLINGKAGKGDGSDAPLFTLKPGKSYRVR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++TS+NFR Q H M LVEMEGSH +QN +DSLD+HVGQC   +VTA++EPKDYY+
Sbjct  221   ICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDFDSLDVHVGQCFGTIVTANQEPKDYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V SSRF K   +T  ++ Y  G G  +S     P      G AWS+NQFRSFRWNLT++A
Sbjct  281   VASSRFLKSVITTTGLLRYEGGKGPASSQLPAGPV-----GWAWSLNQFRSFRWNLTSNA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  VDGKLRYALNG+SH + +TPLKLAEYFGI++K
Sbjct  336   ARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGISHTDLETPLKLAEYFGIADK  395

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKYN + +   E  + + + P+V+N T RNF+E+VFENHEK++Q++HL+G+SFFAVA+E
Sbjct  396   VFKYNSVDNPTAEQTKSIKIEPHVLNITHRNFIEVVFENHEKSVQSWHLNGYSFFAVAVE  455

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+ S+  ER YLGQQLY
Sbjct  456   PGSWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIASENTERRYLGQQLY  515

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPP-PYSG  1191
              SVLSPE+SLRDE+N+P+    CGLVK    P  PY+G
Sbjct  516   VSVLSPEKSLRDEYNMPETSLQCGLVKNTPKPANPYAG  553



>ref|XP_009387378.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=550

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/398 (63%), Positives = 300/398 (75%), Gaps = 7/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGK--VGGKIDPLFTMEAGKTYR  174
             + V I DWY K HK L  ILD+GR+I  PDGV+INGK GK   G    PLF ME+GK YR
Sbjct  158   YTVLIGDWYAKDHKALAGILDAGRSIGLPDGVIINGKTGKDRTGKDGKPLFVMESGKVYR  217

Query  175   YRVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDY  354
             YR+CN G+R S+NFR QGH+M LVE++GSHT+QN YDSLD+HVGQC SVLVTA++ P DY
Sbjct  218   YRICNTGIRASLNFRIQGHSMELVEIDGSHTMQNLYDSLDVHVGQCYSVLVTANQAPGDY  277

Query  355   YLVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTA  534
             YLV S+RF K+E +   I+ YA G+ +  S  LP        G AWS NQ+RSFRWNLTA
Sbjct  278   YLVASTRFMKKELTATGIVRYA-GSKVPPSAVLPKA----PTGWAWSFNQWRSFRWNLTA  332

Query  535   SAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGIS  714
             SAARPNPQGS+HYG INITRTIK  NS++ V GK R+ALNGVSH++ DTPLK  EYFG++
Sbjct  333   SAARPNPQGSFHYGSINITRTIKFANSRAVVGGKSRFALNGVSHVDVDTPLKHLEYFGVA  392

Query  715   EKVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             +K FKYN+ GD P E +  V LAPNV+   FR FVE++FEN EK  Q YHLDG+SFFAV 
Sbjct  393   DKFFKYNLTGDEPREGSGPVNLAPNVITVEFRTFVEVIFENPEKGPQFYHLDGYSFFAVG  452

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             +  G+W PE RK YNL+DAVSRH+IQVYP SW A+M T DNAGMWNLRS++WER YLGQQ
Sbjct  453   MGPGKWKPESRKRYNLLDAVSRHAIQVYPKSWTAIMLTFDNAGMWNLRSELWERRYLGQQ  512

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             LY SV SP RSLRDE++LPD   LCG V  +  PPPY+
Sbjct  513   LYISVQSPARSLRDEYSLPDTVLLCGAVASLPKPPPYT  550



>ref|XP_010673838.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=557

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/400 (61%), Positives = 310/400 (78%), Gaps = 9/400 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVG-GKIDPLFTMEAGKTYRY  177
             + V I DWY + H  L+K+LDSG+++ RPDGV++NGK GKVG  K +PLFTM+ GKTY+Y
Sbjct  162   YTVLIGDWYKQSHTALRKVLDSGKSLGRPDGVLMNGKQGKVGDAKEEPLFTMKPGKTYKY  221

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             R+CNVG++ ++NFR QGH + LVE+EGSH++QN+YDSLD+H+GQC +VLVTAD++PKDYY
Sbjct  222   RICNVGLKNTLNFRIQGHKIKLVEVEGSHSVQNSYDSLDVHLGQCYAVLVTADQDPKDYY  281

Query  358   LVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTAS  537
             +V S RF K        I Y NG G  ++            G AWS+NQFRSFRWNLTAS
Sbjct  282   MVASVRFTKYHLQATGKIRYENGKGPASNILPEA-----PTGWAWSLNQFRSFRWNLTAS  336

Query  538   AARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISE  717
             AARPNPQGSYHYGQINITRT+KL  + + VDGKLRYA+NGVSH + +TP+KLAEY+    
Sbjct  337   AARPNPQGSYHYGQINITRTVKLATTANTVDGKLRYAVNGVSHTDPETPMKLAEYYEAPA  396

Query  718   KVFKYNIMGDTPPENAEK---VTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFA  888
             KVFKY+ +GD PP N EK   +T+AP V+N   R+F+E++FENHEK++Q++ L G++FF 
Sbjct  397   KVFKYDPIGDEPPANIEKLDKITIAPIVLNFKHRDFIEVIFENHEKSVQSFRLAGYAFFP  456

Query  889   VAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLG  1068
             VAIE G WSP KRKNYNL+DAVS+++IQVYP SWAA++ T DN GMWN+R++  ERAYLG
Sbjct  457   VAIEVGTWSPAKRKNYNLMDAVSKYNIQVYPKSWAAILLTFDNVGMWNVRNECMERAYLG  516

Query  1069  QQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             QQLY SV +PER LRDE+NLPD   LCG+VK M  P PY+
Sbjct  517   QQLYISVPTPERVLRDEYNLPDNALLCGMVKNMPKPKPYT  556



>ref|XP_008793387.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=550

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/398 (63%), Positives = 298/398 (75%), Gaps = 7/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKID--PLFTMEAGKTYR  174
             FNV   DWY K HK L ++LD GR I RP GV+INGKHGK     D  P+FTMEAGKTYR
Sbjct  158   FNVLAGDWYTKSHKVLARLLDRGRGIGRPAGVLINGKHGKDASGKDEPPMFTMEAGKTYR  217

Query  175   YRVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDY  354
             YRVCNVG++TS+N R Q H + LVEMEGSHTIQN YDSLDLH GQC SV VTAD++P DY
Sbjct  218   YRVCNVGIKTSLNLRIQKHKLRLVEMEGSHTIQNVYDSLDLHTGQCFSVFVTADQQPGDY  277

Query  355   YLVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTA  534
             Y+V+S+RF K      AII YA  N            P +  G AWS NQ+RSFRWNLTA
Sbjct  278   YMVISTRFTKYNCGGTAIIRYAGSN-----MPPSPDLPPSPSGWAWSFNQWRSFRWNLTA  332

Query  535   SAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGIS  714
             SAARPNPQGSYHYG INITRTI+L  S   V+GK RYALNGVSH N  TPLKL+EY+ I+
Sbjct  333   SAARPNPQGSYHYGSINITRTIRLRGSTGLVNGKRRYALNGVSHENPATPLKLSEYYSIT  392

Query  715   EKVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             +K FKYNI+GD PP +   + +APNV+  TFR F+EI+ EN E++I +YHLDG+SFF   
Sbjct  393   DKEFKYNIIGDEPPADKSPIVIAPNVIKCTFRTFIEIILENPERSIHSYHLDGYSFFPAG  452

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             +  G WSPEKR+ YNL+DAVSRH++QVYP SW+A+M T DNAGMWNLR+ +W++ YLGQQ
Sbjct  453   MGHGEWSPEKRRTYNLLDAVSRHTVQVYPKSWSAIMLTFDNAGMWNLRTMIWDKQYLGQQ  512

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             LY SV+SPERSLRDE+N+P+   LCG V  +  PPPY+
Sbjct  513   LYISVISPERSLRDEYNIPENSLLCGNVVNLPKPPPYA  550



>ref|XP_009600428.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Nicotiana 
tomentosiformis]
Length=520

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/398 (62%), Positives = 308/398 (77%), Gaps = 38/398 (10%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F+VF+SDWY K HKTL+ ILD GR+I RP+G++INGK+GK  GK +P+F+M +GKTYRYR
Sbjct  158   FSVFVSDWYTKSHKTLRSILDEGRSIGRPEGIIINGKNGKGDGKDEPMFSMVSGKTYRYR  217

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
              CNVGM+ S+N RFQGHTM LVEMEGSHT+QN Y+SLD+H+GQCLSVLVTAD+EPKDY+L
Sbjct  218   FCNVGMKDSINVRFQGHTMKLVEMEGSHTVQNMYESLDIHLGQCLSVLVTADQEPKDYFL  277

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V SSRF K+     A I Y N                                    ASA
Sbjct  278   VASSRFTKEPHIATATIRYTN------------------------------------ASA  301

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTI+LV++   VDGK RYA+NGVSH++  TP+KLAE +G+++K
Sbjct  302   ARPNPQGSYHYGQINITRTIRLVSTAGDVDGKRRYAINGVSHVDPTTPIKLAELYGVADK  361

Query  721   VFKYNIMGD--TPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             VFKY+++ D    P   EK+TLAPNVVNAT+RNFVEI+ ENHEK++Q++HL G++FFAVA
Sbjct  362   VFKYDLIKDEYIAPSGNEKITLAPNVVNATYRNFVEIILENHEKSVQSWHLAGYNFFAVA  421

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             IEAGRW PE+R+NYNL+DAVSR++IQVYPNSWAA+MTT+DNAG+WNLRS+  ER YLG Q
Sbjct  422   IEAGRWKPERRQNYNLLDAVSRNTIQVYPNSWAAIMTTLDNAGLWNLRSNSLERQYLGHQ  481

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             LYFSVLSP  SL+DE+N+PD   LCG++K + +P PYS
Sbjct  482   LYFSVLSPSCSLKDEYNMPDNDILCGIIKDLPLPKPYS  519



>ref|XP_009420229.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=551

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/397 (63%), Positives = 313/397 (79%), Gaps = 7/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGK-VGGKIDP-LFTMEAGKTYR  174
             + V I DWY K HK L  ILD+GR+I  P GV++NG  GK   GK DP LFTMEAGKTYR
Sbjct  159   YTVLIGDWYTKSHKVLAGILDAGRSIGNPAGVLMNGLSGKDATGKDDPPLFTMEAGKTYR  218

Query  175   YRVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDY  354
             YR+CNVG++ S+NFR QGH M LVEM+GSHT+QN Y+SLD+HVGQCLSVLVTA++EPKDY
Sbjct  219   YRICNVGLKLSLNFRIQGHLMKLVEMDGSHTVQNDYESLDVHVGQCLSVLVTANQEPKDY  278

Query  355   YLVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTA  534
             Y+V S+RF K   +   ++ YA G+ +  SPELP        G AWS+NQ+RS RWNLTA
Sbjct  279   YMVASTRFTKYMRTATGVVRYA-GSKVPPSPELPA----GPVGWAWSLNQWRSLRWNLTA  333

Query  535   SAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGIS  714
             SAARPNPQGSYHYG INITRTIKL +S   V+GK R+ LNGVSH+++ TPLKLAEY+GIS
Sbjct  334   SAARPNPQGSYHYGSINITRTIKLASSVGLVNGKRRFGLNGVSHVDSPTPLKLAEYYGIS  393

Query  715   EKVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             +KVFKY+ +GD PP +   +T+APNV+NAT+R+++EI+ EN E++IQ YHLDG+SFFA  
Sbjct  394   DKVFKYDSIGDEPPASGASITVAPNVLNATYRDYIEIILENPERSIQCYHLDGYSFFAAG  453

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             +  G+W+P  R+ YNL+DAVSRH+IQVYP SW+A+M T DNAGMW+LRS++WER YLGQQ
Sbjct  454   MGHGKWTPASRRTYNLLDAVSRHTIQVYPRSWSAIMLTFDNAGMWSLRSELWERHYLGQQ  513

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             LY SV+SP RSLRDE+N+PD   LCG V G+  PP Y
Sbjct  514   LYISVVSPARSLRDEYNMPDNTLLCGDVVGLPKPPSY  550



>ref|XP_009416330.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=552

 Score =   529 bits (1363),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 256/397 (64%), Positives = 308/397 (78%), Gaps = 7/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGK-VGGKID-PLFTMEAGKTYR  174
             + V I DWY K HK L  ILD+G  I  P GV+ING+ GK   GK D PLFTMEAGKTYR
Sbjct  160   YTVLIGDWYAKSHKALAAILDAGHGIGNPAGVLINGRTGKDASGKDDTPLFTMEAGKTYR  219

Query  175   YRVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDY  354
             YR+CNVGM+ S+NFR Q H M LVEM+GSHT+QN Y+SLD+HVGQCLSVLVTA++EPKDY
Sbjct  220   YRICNVGMKVSLNFRMQNHRMKLVEMDGSHTVQNDYESLDVHVGQCLSVLVTANQEPKDY  279

Query  355   YLVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTA  534
             Y+V S+RF K   +   +I YA G+ +  SPELP  P     G AWS NQ+RSFRWNLTA
Sbjct  280   YMVASTRFTKYMRTATGVIRYA-GSSVPPSPELPAAPV----GWAWSFNQWRSFRWNLTA  334

Query  535   SAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGIS  714
             SAARPNPQGSYHYG INITRTIKL +S   V+GK R+ALNGVSH+ + TPLKLAEY+GI+
Sbjct  335   SAARPNPQGSYHYGGINITRTIKLASSVGLVNGKRRFALNGVSHVESPTPLKLAEYYGIA  394

Query  715   EKVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             +KVFKY+ + D PP  +  +T  PNV+NAT+R ++EI+ EN E++IQ YHLDG+SFF V 
Sbjct  395   DKVFKYDSINDEPPAASAPITATPNVLNATYRTYIEIILENPERSIQCYHLDGYSFFPVG  454

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             +  G+W+PE RK YNL+DAVSRH+IQVYP SW+A+M T DNAGMWNLRS+MWER YLGQQ
Sbjct  455   MGHGKWTPESRKTYNLLDAVSRHTIQVYPRSWSAIMLTFDNAGMWNLRSEMWERHYLGQQ  514

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             +Y SV SPERSLRDE+N+PD   LCG V  +  PP Y
Sbjct  515   IYISVTSPERSLRDEYNIPDNTLLCGDVADLPKPPSY  551



>ref|XP_010552290.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=553

 Score =   527 bits (1358),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 246/398 (62%), Positives = 308/398 (77%), Gaps = 7/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKID-PLFTMEAGKTYRY  177
             + V I DWY K H  LKK LDSGR++ RPDG++INGK GK     D PLFTM+ GKTYR 
Sbjct  161   YTVLIGDWYAKSHTALKKFLDSGRSLGRPDGILINGKSGKGSSGSDAPLFTMKPGKTYRV  220

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             R+CNVG++TS+NFR Q H M LVEMEGSH +QN YDSLD+HVGQC   +VTAD++PKDY 
Sbjct  221   RICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCYGTIVTADQDPKDYL  280

Query  358   LVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTAS  537
             +V SSRF K   ST  ++ Y  G G  +S     P      G AWS+NQFRSFRWNLTAS
Sbjct  281   MVASSRFLKSVISTTGVLRYDGGKGPASSEIPAAPV-----GWAWSLNQFRSFRWNLTAS  335

Query  538   AARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISE  717
             AARPNPQGSYHYG+INITRTIK VN++   DGKLRYAL+GVSH + +TP+KLAEYFG+++
Sbjct  336   AARPNPQGSYHYGKINITRTIKFVNTQGKADGKLRYALSGVSHTDPETPVKLAEYFGMAD  395

Query  718   KVFKYNIMGDTPPENAEK-VTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             KVFKYNI+ D+P  +  K + + PN++N T R FVE++FENHE+++Q++H+DG++FFAVA
Sbjct  396   KVFKYNIISDSPTSDQTKTIKIEPNILNVTHRTFVEVIFENHERSVQSWHIDGYAFFAVA  455

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             +E G W+PEKR+NYNL+DAVSRH++QV+P  WAAV+ + DN GMWN+RS+  ER YLGQQ
Sbjct  456   VEPGTWTPEKRENYNLLDAVSRHTVQVFPKCWAAVLLSFDNCGMWNVRSENMERRYLGQQ  515

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             LY SVLSPE SLRDE+N+P     CGLVKG+  P PY+
Sbjct  516   LYLSVLSPESSLRDEYNMPQNSLQCGLVKGLPKPQPYA  553



>ref|XP_009392060.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=639

 Score =   530 bits (1364),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 248/397 (62%), Positives = 297/397 (75%), Gaps = 7/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGK--VGGKIDPLFTMEAGKTYR  174
             + V + DWY K HK L ++LD+GRTI RP G++ING+ GK   G    PLFTM++GKTYR
Sbjct  247   YTVLVGDWYTKSHKNLARLLDAGRTIGRPSGILINGRPGKDSTGKDDPPLFTMKSGKTYR  306

Query  175   YRVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDY  354
             YRVCNVGM+ S+NFR Q H M LVEM+GSHT+QN YDSLD+HVGQCLSVLVTA +E +DY
Sbjct  307   YRVCNVGMKVSLNFRIQSHAMKLVEMDGSHTVQNVYDSLDVHVGQCLSVLVTAHQEHRDY  366

Query  355   YLVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTA  534
             Y+V SSRF K   S   +I YA  N   +             G AWS NQ+RSFR NLTA
Sbjct  367   YMVASSRFTKYALSATGVIRYAGSNTPPSPDLPAA-----PSGWAWSFNQWRSFRLNLTA  421

Query  535   SAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGIS  714
             SAARPNPQGSYHYG INITRTIKLVNS   VDGK RYALN VSH +  TPLKLAEY+GI+
Sbjct  422   SAARPNPQGSYHYGSINITRTIKLVNSVGLVDGKRRYALNAVSHSDAATPLKLAEYYGIA  481

Query  715   EKVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             +KVFKY+ + D P  +   + + PNVVNAT+R F+EIVFEN ++++Q YHLDG+SFFA  
Sbjct  482   DKVFKYDTIADEPAASDAPIKIVPNVVNATYRTFIEIVFENPDRSMQAYHLDGYSFFAAG  541

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             +  G+W+PE RK YNL DAVSRH+IQVY  SW+A++ T DNAGMWNLRS++WER YLGQQ
Sbjct  542   MGHGKWTPESRKRYNLADAVSRHTIQVYQRSWSAILLTFDNAGMWNLRSELWERRYLGQQ  601

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             LY SV+SPERSLRDE N+PD   LCG V  +  PP Y
Sbjct  602   LYISVVSPERSLRDESNMPDNALLCGAVAKLPRPPSY  638



>ref|XP_009412658.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=545

 Score =   526 bits (1354),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 252/395 (64%), Positives = 308/395 (78%), Gaps = 8/395 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V ISDWY K HK L  +LD+GR+I  P GV+ING  GK      PLFTMEAGKTYRYR
Sbjct  158   YTVLISDWYTKSHKALAGLLDAGRSIGNPAGVLINGLTGKDNA---PLFTMEAGKTYRYR  214

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ S+NFR Q H M LVEM+GSHT+QN Y+SLD+HVGQCLSVLVTA++E KDYY+
Sbjct  215   ICNVGLKVSLNFRIQSHLMKLVEMDGSHTVQNDYESLDVHVGQCLSVLVTANQEAKDYYM  274

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   S   II YA G+ +  SPELP  P     G AWS NQ+RS RWNLTASA
Sbjct  275   VASTRFTKYSLSATGIIRYA-GSVVPPSPELPKAPV----GWAWSFNQWRSLRWNLTASA  329

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG INITRTI+L +S   V+GK R+ALNGVSH++  TPLKLAEY+GI++K
Sbjct  330   ARPNPQGSYHYGGINITRTIRLASSVGLVNGKRRFALNGVSHVDPPTPLKLAEYYGIADK  389

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKY+ + D PPE    +T+APNV+NAT+R+++EI+ EN E++IQ YHLDG+SFFAV + 
Sbjct  390   VFKYDSISDDPPETNAPITVAPNVLNATYRDYIEIILENPERSIQCYHLDGYSFFAVGMG  449

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G+W+P  R+ YNL+DAVSRH+IQVYP SW+A+M T DNAGMW+LRS+MWER YLGQQLY
Sbjct  450   HGKWTPASRRTYNLLDAVSRHTIQVYPRSWSAIMLTFDNAGMWSLRSEMWERHYLGQQLY  509

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
              SV+SP RSLRDE+N+PD   LCG V  +  PP Y
Sbjct  510   VSVVSPARSLRDEYNMPDNALLCGDVASLPKPPSY  544



>ref|XP_008449954.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=446

 Score =   522 bits (1344),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 243/352 (69%), Positives = 289/352 (82%), Gaps = 6/352 (2%)
 Frame = +1

Query  136   DPLFTMEAGKTYRYRVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCL  315
             +PLFTM+ GKTY+YRVCNVG++TS+NFRFQGHTM LVEMEGSHT+QN Y SLD+HVGQC 
Sbjct  99    NPLFTMKPGKTYKYRVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQNDYKSLDVHVGQCF  158

Query  316   SVLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWS  495
             SVLVTAD+EPKDYY+V S+RF K       I+ Y NG G  +      P      G AWS
Sbjct  159   SVLVTADQEPKDYYMVASTRFIKSALVGKGIVRYTNGKGPASPELPNAPM-----GWAWS  213

Query  496   INQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINT  675
             +NQFR+FRWNLTASAARPNPQGSYHYG INITRTIKLVNS S VDGKLRYA+NGVSH++ 
Sbjct  214   LNQFRTFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASKVDGKLRYAINGVSHVDP  273

Query  676   DTPLKLAEYFGISEKVFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTI  852
             +TPLKLAEYFG+++KVFKY+ + D    E A  VT+APNVVN TFRNF+EI+FENHEK++
Sbjct  274   ETPLKLAEYFGVTDKVFKYDTISDEGLAEGATTVTVAPNVVNTTFRNFIEIIFENHEKSL  333

Query  853   QTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWN  1032
             Q++HLDG+SFFAVAIE GRW+PEKR +YNL+DAVSRH+IQV+P SWAA++ T DNAGMWN
Sbjct  334   QSWHLDGYSFFAVAIEPGRWTPEKRSDYNLLDAVSRHTIQVFPKSWAAILLTFDNAGMWN  393

Query  1033  LRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             LRS++ E  YLGQQLY SV SP RSLRDE+N+PD   LCGLVK + +P PY+
Sbjct  394   LRSELAENRYLGQQLYMSVQSPARSLRDEYNIPDNTLLCGLVKDLPLPKPYT  445



>ref|XP_004961713.1| PREDICTED: L-ascorbate oxidase homolog [Setaria italica]
Length=556

 Score =   523 bits (1346),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 241/394 (61%), Positives = 301/394 (76%), Gaps = 6/394 (2%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             V I DWY K H+ + ++LD+GR++ RP+GV+INGK G       P+FT EAGKTYR+RVC
Sbjct  166   VLIGDWYTKDHEVMARMLDAGRSVGRPEGVLINGKGGPDAAAA-PMFTFEAGKTYRFRVC  224

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             N G++ S+NFR QGH M LVEMEGSHT+Q+ YDSLD+HVG CLSVLV AD++P DYY+V 
Sbjct  225   NTGIKASLNFRIQGHDMKLVEMEGSHTVQDMYDSLDVHVGHCLSVLVDADQKPGDYYMVA  284

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+RF     S +A+I YA  N            PE   G AWSINQ+RSFRWNLTASAAR
Sbjct  285   STRFIHDARSVMAVIRYAGSN-----TPPSPNVPEPPAGWAWSINQWRSFRWNLTASAAR  339

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYGQINITRTIKL+ S+ ++DGKL+Y  NGVSH +T+TPLKLAEYF +++ VF
Sbjct  340   PNPQGSYHYGQINITRTIKLMVSRGHIDGKLKYGFNGVSHRDTETPLKLAEYFNVTDGVF  399

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
              YN MGD PP     +++ PNV+ A FR F+EI+FEN EK++ + HLDG++FF V +  G
Sbjct  400   SYNQMGDVPPAVNGPLSVIPNVITAEFRTFIEIIFENPEKSMDSLHLDGYAFFGVGMGPG  459

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
             +WSPE RK YNL+DAVSRH+IQVYP SW+A+M T DNAGMWN+RS++WER YLG+QLY S
Sbjct  460   KWSPELRKTYNLLDAVSRHTIQVYPRSWSAIMLTFDNAGMWNIRSNIWERHYLGEQLYMS  519

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             V+SP RSLRDE+N+PD    CG V G+ MPP Y+
Sbjct  520   VVSPARSLRDEYNMPDNALRCGKVVGLPMPPSYA  553



>ref|XP_008788020.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=551

 Score =   522 bits (1345),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 242/398 (61%), Positives = 294/398 (74%), Gaps = 7/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKID--PLFTMEAGKTYR  174
             FNV   DW+ K HK L + LD+GR +  P GV+ING+ GK     D  P+FTM+AG  YR
Sbjct  159   FNVLAGDWFTKSHKVLARQLDAGRGLGLPAGVLINGRLGKDAAGRDEPPMFTMQAGNVYR  218

Query  175   YRVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDY  354
             +R CNVG++TS+NFR Q H++ LVEMEGSHT+QN YDSLD+HVGQCLSVLVTAD+ P DY
Sbjct  219   FRFCNVGLKTSLNFRLQKHSLKLVEMEGSHTVQNLYDSLDVHVGQCLSVLVTADQAPGDY  278

Query  355   YLVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTA  534
             YLV S+RF K+  +  A++ YA  N   +             G AWS NQ+R+FRWNLTA
Sbjct  279   YLVASTRFTKEILAATAVLRYAGSNAPPSPVIPD-----GPSGWAWSFNQWRTFRWNLTA  333

Query  535   SAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGIS  714
             SAARPNPQGSYHYGQINITRTIKLVN  S VDGK R+ +NG+SH++ DTPLKLAEYF +S
Sbjct  334   SAARPNPQGSYHYGQINITRTIKLVNGHSVVDGKRRHFINGISHVDPDTPLKLAEYFNLS  393

Query  715   EKVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             +  F+YN+MGD PP     VTLAPNV+ A FR F+EI+FEN E++IQ+YHLDG++FF   
Sbjct  394   KPAFEYNLMGDVPPAPDAPVTLAPNVITAEFRTFIEIIFENTERSIQSYHLDGYAFFPAG  453

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             +  G+WSPE RK YN +D VSRHSIQV+P SW A+M T DNAGMWNLRS  WE  YLGQQ
Sbjct  454   MGPGKWSPESRKRYNHLDTVSRHSIQVFPRSWTAIMLTFDNAGMWNLRSMNWENKYLGQQ  513

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             LY SV SP RSLRDE+N+P     CG V G+ +PP Y+
Sbjct  514   LYVSVTSPARSLRDEYNMPANALRCGAVVGLPLPPSYT  551



>ref|XP_004970369.1| PREDICTED: L-ascorbate oxidase homolog [Setaria italica]
Length=557

 Score =   521 bits (1343),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 245/395 (62%), Positives = 293/395 (74%), Gaps = 6/395 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F V +SDWY K H  L K LDSG+ I RP G+VINGK+ K      P++ MEAGKTYR+R
Sbjct  166   FPVLVSDWYTKDHTVLAKNLDSGKGIGRPAGLVINGKNEKDASN-PPMYNMEAGKTYRFR  224

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             VCN+G++ S N R Q H + LVEMEGSHT+QN YDSLDLH+GQCLS LVTAD+ P DY L
Sbjct  225   VCNLGIKASFNVRIQKHILKLVEMEGSHTVQNTYDSLDLHIGQCLSFLVTADQAPGDYLL  284

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+  +  A+I Y   N    S            G AWSINQ+RSFRWNLTASA
Sbjct  285   VASTRFIKEVSTITAVIRYKGSNTPPPSQLPEA-----PSGWAWSINQWRSFRWNLTASA  339

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTIKL  SK  VDGK RYALNGVSH++T+TPLKLAEYF  ++ 
Sbjct  340   ARPNPQGSYHYGQINITRTIKLATSKGKVDGKERYALNGVSHVDTETPLKLAEYFNATDG  399

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VF+YNIMGD PP     + +APNV++A FR F+E+VFEN EK+I T+H++G++FFA  + 
Sbjct  400   VFQYNIMGDVPPAAGTPIKMAPNVISAEFRTFIEVVFENPEKSIDTFHINGYAFFAAGMG  459

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G WSP  RK YNL+D VSRH+IQVYP SW AVM T DNAGMWN+RS++WER YLG+QLY
Sbjct  460   PGTWSPASRKTYNLLDTVSRHTIQVYPRSWTAVMLTFDNAGMWNIRSNLWERHYLGEQLY  519

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
              SV SP RSLRDE+N+P+    CG V G+ MPP Y
Sbjct  520   VSVTSPARSLRDEYNMPETSLRCGKVVGLPMPPSY  554



>ref|XP_006445540.1| hypothetical protein CICLE_v10018007mg [Citrus clementina]
 ref|XP_006489004.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|ESR58780.1| hypothetical protein CICLE_v10018007mg [Citrus clementina]
 gb|KDO54549.1| hypothetical protein CISIN_1g046746mg [Citrus sinensis]
Length=561

 Score =   521 bits (1342),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 237/402 (59%), Positives = 313/402 (78%), Gaps = 11/402 (3%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVG------GKIDPLFTMEAG  162
             F + I DWY + H  L K LDSG+ + +PDGV+INGK G++       G  +PLFTM+AG
Sbjct  163   FTLLIGDWYTRSHVELGKQLDSGKLLGKPDGVLINGKSGRLDYDSDGKGDNEPLFTMKAG  222

Query  163   KTYRYRVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKE  342
             K Y+YR+CNVG++TS+NFR QGHTM LVEMEGSH +QN Y+SLD+HVGQC +VLVTA+++
Sbjct  223   KVYKYRICNVGVKTSLNFRIQGHTMKLVEMEGSHVVQNEYESLDVHVGQCFTVLVTANQD  282

Query  343   PKDYYLVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRW  522
             PKDYYL+ S+RF +   +T AI+ Y++  G+ +      P      G  WS+NQFRSFRW
Sbjct  283   PKDYYLIASTRFTRTVITTTAIVRYSDSKGLASPDLPKAPV-----GWDWSLNQFRSFRW  337

Query  523   NLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEY  702
             NLTASAARPNPQGS+HYG I I RTI+L N+   V+GK+R+A+NGVS++N++TPLK AEY
Sbjct  338   NLTASAARPNPQGSFHYGGIPINRTIRLANTAHLVNGKVRFAVNGVSYVNSETPLKFAEY  397

Query  703   FGISEKVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSF  882
             +GI E+VFKYN++ D P +  E VTL PNV++AT++ F+EIV EN + T+Q++ LDG++F
Sbjct  398   YGIPEEVFKYNVISDKPADEIENVTLQPNVMDATYKAFMEIVLENRQNTMQSWILDGYAF  457

Query  883   FAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAY  1062
             FAV +E G W+P+KRK+YNL+DAVSR++IQV+PN WAA++ +MDNAGMWNLRS++WER Y
Sbjct  458   FAVGMEPGTWNPDKRKSYNLIDAVSRYTIQVFPNCWAAILVSMDNAGMWNLRSNIWERNY  517

Query  1063  LGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             LGQQLY SV   +RSLRDE+N+PD   LCG+V  MS P PYS
Sbjct  518   LGQQLYLSVRLHKRSLRDEYNMPDNALLCGIVANMSKPTPYS  559



>ref|XP_010921259.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=550

 Score =   520 bits (1339),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 241/398 (61%), Positives = 296/398 (74%), Gaps = 7/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKID--PLFTMEAGKTYR  174
             FN+   +WY K HK L + LDSGR I RP GV+INGKHGK     D  P+FT+EAGKTYR
Sbjct  158   FNILAGEWYTKSHKVLARFLDSGRGIGRPAGVLINGKHGKDASGKDEPPMFTVEAGKTYR  217

Query  175   YRVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDY  354
             +RVCN+G++ S+NFR Q H + LVEMEGSH +QN YDSLDLH+GQC SV VTAD++P DY
Sbjct  218   FRVCNIGIKNSLNFRIQKHALRLVEMEGSHVVQNMYDSLDLHIGQCFSVFVTADQQPGDY  277

Query  355   YLVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTA  534
             Y++ S+RF K +    AII YA  N   +    P        G AWS NQ+RSFRWNLTA
Sbjct  278   YILASTRFTKYKCDGSAIIRYAGSNTPPSKDLPP-----GPSGWAWSFNQWRSFRWNLTA  332

Query  535   SAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGIS  714
             SAARPNPQGSYHYGQINITRTI+L      V+GK RYA+NGVSH N  TP KL+EYFGI+
Sbjct  333   SAARPNPQGSYHYGQINITRTIRLRGGTGLVNGKRRYAINGVSHDNPVTPFKLSEYFGIA  392

Query  715   EKVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             +K FKYNI+GD PP     +T+APNVVN TFR F+EI+ EN E++I  YH+DG++FF V 
Sbjct  393   DKEFKYNIIGDEPPTGKSPITIAPNVVNCTFRTFIEIILENPERSIHAYHIDGYAFFPVG  452

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             +  G W PEKR+ YNL+DA SRH++QVYP SW+A+M T DNAGMWNLR+ +W++ YLGQQ
Sbjct  453   MGHGEWDPEKRRTYNLLDASSRHTVQVYPKSWSAIMLTFDNAGMWNLRTLVWDKQYLGQQ  512

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             LYFSV+SP RSLRDE+N+P+   LCG V  +  P PY+
Sbjct  513   LYFSVVSPARSLRDEYNIPENALLCGNVVKLPQPAPYT  550



>ref|XP_010922850.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=551

 Score =   519 bits (1337),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 239/397 (60%), Positives = 294/397 (74%), Gaps = 7/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKID--PLFTMEAGKTYR  174
             FNV   DW+ +GHK L + LD+GR +  P GV+ING+ G+     D  P+FTM+AG  YR
Sbjct  159   FNVLAGDWFTRGHKVLARKLDAGRRLGLPAGVLINGRSGRNAAGHDDLPMFTMQAGNVYR  218

Query  175   YRVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDY  354
             +R CNVG++ S+NFR Q H++ LVEMEGSHT+QN YDSLD+HVGQC+SVLVTAD+ P DY
Sbjct  219   FRFCNVGLKASLNFRIQKHSLKLVEMEGSHTVQNLYDSLDVHVGQCMSVLVTADQAPGDY  278

Query  355   YLVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTA  534
             YLV S+RF K+  +  A++ YA  N   +             G AWS NQ+R+FRWNLTA
Sbjct  279   YLVASTRFTKKVHTATAVLRYAGSNSPPSRVIPR-----GPSGWAWSFNQWRTFRWNLTA  333

Query  535   SAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGIS  714
             SAARPNPQGSYHYGQINITRTI+LVN  + VDGKLRY +NG+SH+ +DTPLKLAEYF  S
Sbjct  334   SAARPNPQGSYHYGQINITRTIRLVNGHNVVDGKLRYFINGISHVESDTPLKLAEYFNAS  393

Query  715   EKVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
               VFKYN+MGD PP     +TL PNV+ A FR F+EI+FEN E++IQ+YHLDG++FF V 
Sbjct  394   SPVFKYNLMGDVPPAPDAPLTLVPNVITAEFRTFIEIIFENTERSIQSYHLDGYAFFPVG  453

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             +  G+WSPE RK YNL+D VSRHSI+V+P SW A++ T DNAGMWNLRS  WE  YLGQQ
Sbjct  454   MGPGKWSPESRKRYNLLDTVSRHSIEVFPRSWTAILLTFDNAGMWNLRSMNWENKYLGQQ  513

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             LY SV SP RSLRDE+N+P     CG V G+ +PP Y
Sbjct  514   LYVSVTSPARSLRDEYNMPLNALRCGQVIGLPLPPSY  550



>gb|KFK27206.1| hypothetical protein AALP_AA8G349600 [Arabis alpina]
Length=559

 Score =   518 bits (1335),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 244/396 (62%), Positives = 303/396 (77%), Gaps = 7/396 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H TLK  LDSGR+I RP GV+INGK GK  G  +P+FTM+ GKTYRYR
Sbjct  164   YTVLIGDWYTKTHVTLKNNLDSGRSIGRPAGVLINGKSGKPDGTGEPIFTMKPGKTYRYR  223

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVGM+ ++NFR Q H + LVE+EGSHT+QN YDSLDLHVGQC  VLVTAD+EPKDYY+
Sbjct  224   ICNVGMKMALNFRIQNHKIKLVELEGSHTLQNLYDSLDLHVGQCFGVLVTADQEPKDYYM  283

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   ++ AI+ Y  G G  +        P++  G AWS+NQFRSFRWNLT++A
Sbjct  284   VASTRFLKSVLTSTAILRYEGGKGAASP-----QLPKSPVGWAWSLNQFRSFRWNLTSNA  338

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDG-KLRYALNGVSHINTDTPLKLAEYFGISE  717
             ARPNPQGSYHYG+INITR+IKLVN+    DG KLRYAL+GVSH+ TDTP+KLA+YFG+++
Sbjct  339   ARPNPQGSYHYGKINITRSIKLVNTIGKDDGKKLRYALSGVSHVETDTPVKLAQYFGVAD  398

Query  718   KVFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             KVFKY+ + D P      K+ + PNV+N   R FVEIVFENHEKT Q++HLDG+SFFAVA
Sbjct  399   KVFKYDTIKDEPTAAETSKILVQPNVLNIEHRAFVEIVFENHEKTTQSWHLDGYSFFAVA  458

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             +E G W+PEKRKNYNL+DAVSRH+IQVYP  W A++ T DN GMWN+RS++ E+ YLGQQ
Sbjct  459   VEPGNWTPEKRKNYNLLDAVSRHTIQVYPKCWGAILLTFDNCGMWNIRSEILEKRYLGQQ  518

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPP  1182
             LY +V  PE S+RDE++ P     CG+VK +  P P
Sbjct  519   LYVNVGPPELSMRDEYSFPANGLRCGIVKDLPHPHP  554



>ref|XP_003529457.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=552

 Score =   518 bits (1335),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 236/396 (60%), Positives = 303/396 (77%), Gaps = 6/396 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V   DW+ K H TL+K+LD GR++ RP  V++NG++ K  G   PLFTM  GKTY+YR
Sbjct  161   YTVLAGDWFTKSHSTLRKLLDGGRSLGRPQAVLLNGQNAKGDGTDKPLFTMIPGKTYKYR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ ++NFR Q H M LVEMEGSHT+QN Y+SLD+H+GQC  VLVTA++EPKDYY+
Sbjct  221   ICNVGLKNTINFRIQNHPMKLVEMEGSHTVQNTYNSLDVHLGQCFGVLVTANQEPKDYYM  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   +   I+ Y  G    +      P      G AWS+NQFRSFRWNLTASA
Sbjct  281   VASTRFTKSILTGKGIMRYTTGKAPPSPEIPEAPV-----GWAWSLNQFRSFRWNLTASA  335

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQ+NITRT+K +NS S   GKLRYA+NGVSH++ +TP+KLAEYFG+ EK
Sbjct  336   ARPNPQGSYHYGQVNITRTVKFINSVSRDSGKLRYAINGVSHVDGETPIKLAEYFGVPEK  395

Query  721   VFKYNIMGDTPPENAEK-VTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+I+ D P ++  K V L PNV+    R F+EI+FEN EK++Q+YHL+G++FFAVAI
Sbjct  396   VFKYDIISDNPSQDVGKNVVLQPNVIRFKHRTFIEIIFENPEKSVQSYHLNGYAFFAVAI  455

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRKNYNL+DAVSRH++ V+P SWAA++ + DN G+WNLRS++ E  YLGQQL
Sbjct  456   EPGTWTPEKRKNYNLLDAVSRHTMPVFPKSWAAILLSFDNVGVWNLRSELAENRYLGQQL  515

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             Y SVL+PERSLRDE+N+P+   LCG+VKG+  P PY
Sbjct  516   YISVLTPERSLRDEYNIPEYALLCGVVKGLPKPEPY  551



>gb|AFK44839.1| unknown [Medicago truncatula]
Length=375

 Score =   511 bits (1317),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 239/375 (64%), Positives = 292/375 (78%), Gaps = 5/375 (1%)
 Frame = +1

Query  58    LDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVCNVGMRTSVNFRFQGHTM  237
             LDSGR+I RP GV+INGK+ K  G  +PL+TM+ GKTY+YR+CN G++ ++NFRFQGH M
Sbjct  3     LDSGRSIGRPAGVIINGKNAKGDGSDEPLYTMKPGKTYKYRICNTGLKDTLNFRFQGHGM  62

Query  238   TLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVVSSRFFKQEFSTVAIISY  417
              LVE EGSH +QN YDSLD+HVGQC +VLVTADKEPKDYY+V S+R  K       II Y
Sbjct  63    KLVETEGSHVVQNVYDSLDVHVGQCYTVLVTADKEPKDYYMVASTRMTKYNLLGKGIIRY  122

Query  418   ANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRT  597
              NG G  +    P P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYGQI+ITRT
Sbjct  123   TNGKGPASPMLPPAPV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQISITRT  177

Query  598   IKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVFKYNIMGDTPPENAEKVT  777
             IK VNS S V+GKLRYA+NGVSH++ +TP+KLAEY+G+++KVFKYNI+ D PP +   +T
Sbjct  178   IKFVNSVSNVNGKLRYAINGVSHVDPETPVKLAEYYGVADKVFKYNIISDEPPIDLRAIT  237

Query  778   LAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVS  957
             +APNV+  TFR F+EI+FEN  K +Q+Y+L G+SFF VA E G W+PEKRK YNL+DA+S
Sbjct  238   IAPNVMQTTFRTFIEIIFENPGKVLQSYNLGGYSFFVVAGEPGTWTPEKRKGYNLLDAIS  297

Query  958   RHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFSVLSPERSLRDEHNLPDK  1137
             RH+IQV+P SWAA+M T DNAGMW L S+  E  YLGQQLY SV S E+S RDE+NLP+ 
Sbjct  298   RHTIQVFPKSWAAIMLTFDNAGMWQLGSEHAEHRYLGQQLYLSVESEEKSTRDEYNLPET  357

Query  1138  QQLCGLVKGMSMPPP  1182
             Q +CG+VK M  PPP
Sbjct  358   QLVCGIVKDMPRPPP  372



>ref|XP_006838146.1| hypothetical protein AMTR_s00106p00093220 [Amborella trichopoda]
 gb|ERN00715.1| hypothetical protein AMTR_s00106p00093220 [Amborella trichopoda]
Length=546

 Score =   518 bits (1333),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 245/397 (62%), Positives = 306/397 (77%), Gaps = 8/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY   H TL++ LDSGR+I +PDGV+ING + K      PLF ME GKTYRYR
Sbjct  157   YTVLIGDWYASDHNTLRRRLDSGRSIGQPDGVLINGMN-KPNKANKPLFNMEPGKTYRYR  215

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++TS+NFR QGHT+ LVE+EGSHT+QN Y+SLD+HVGQC SVLVTA+K P+DYY+
Sbjct  216   ICNVGLKTSLNFRIQGHTLKLVEIEGSHTVQNIYESLDVHVGQCYSVLVTANKVPRDYYI  275

Query  361   VVSSRFF-KQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTAS  537
             V S+RF  K   +  A+I Y       +    PL  P    G+AWS+NQFRSFRWNLTAS
Sbjct  276   VASTRFTNKYTHTATALIHYTG-----SKKPAPLMLPPAPTGVAWSLNQFRSFRWNLTAS  330

Query  538   AARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISE  717
             AARPNPQGS+HYGQINITRTIKL NS  +V  KLRYA+NGVS++   TPLKLAEY+G++ 
Sbjct  331   AARPNPQGSFHYGQINITRTIKLSNSVGFVKSKLRYAMNGVSYVRPSTPLKLAEYYGVAA  390

Query  718   KVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             +VF    + D PP  + ++ LAP VV   FR+F+EIVFEN EK+IQ++HLDG+SFFAV +
Sbjct  391   RVFDTKAIADMPPA-SPQIKLAPAVVKGNFRDFIEIVFENREKSIQSWHLDGYSFFAVGM  449

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
               G+W+P  RK YNL+DAVS+H+IQVYPNSW AV+ T+DNAGMW+LRS++WER YLGQQL
Sbjct  450   SGGQWTPASRKVYNLLDAVSKHTIQVYPNSWTAVLLTIDNAGMWSLRSELWERQYLGQQL  509

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             Y SV+SP RSLRDE+N+PD  +LCG+VK M  P PY+
Sbjct  510   YLSVVSPARSLRDEYNMPDNARLCGIVKRMPKPAPYT  546



>ref|XP_007157831.1| hypothetical protein PHAVU_002G101800g [Phaseolus vulgaris]
 gb|ESW29825.1| hypothetical protein PHAVU_002G101800g [Phaseolus vulgaris]
Length=553

 Score =   518 bits (1333),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 242/396 (61%), Positives = 298/396 (75%), Gaps = 6/396 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V   DWY K H TL K+LDSGR + RP  +++NG++ K  G   PLFTM  GKTY+YR
Sbjct  162   YTVLAGDWYTKSHSTLAKLLDSGRALGRPQALLVNGQNAKGDGTDKPLFTMLPGKTYKYR  221

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ S+NFR Q H M LVEMEGSHT+QN YDSLD+H+GQC  VLVTAD+E KDYY+
Sbjct  222   LCNVGLKNSINFRIQNHQMKLVEMEGSHTVQNVYDSLDVHLGQCFGVLVTADQEAKDYYI  281

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   +   II YANG G  +      P      G AWS+NQFRSFRWNLTASA
Sbjct  282   VASTRFTKTVLTGKGIIRYANGKGPASPEIPEAPV-----GWAWSLNQFRSFRWNLTASA  336

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRT+K VNS S  +GKLRYA+NGVSH++ DTPLKL++Y+GI  K
Sbjct  337   ARPNPQGSYHYGQINITRTLKFVNSVSRDNGKLRYAINGVSHVDGDTPLKLSDYYGIGSK  396

Query  721   VFKYNIMGDTPPEN-AEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
              FK + + D P  +    VTLAPNV+   +R F+EI+FENHEK++Q+Y+L+G+SFFAVAI
Sbjct  397   FFKNDTIPDQPAADLGSAVTLAPNVMKFEYRTFIEIIFENHEKSVQSYNLNGYSFFAVAI  456

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRK YNL+D VSRH++QV+P SWAA+M T DN GMWNLRS++ E  YLGQQL
Sbjct  457   EPGTWTPEKRKGYNLLDGVSRHTVQVFPKSWAAIMLTFDNVGMWNLRSEIAENRYLGQQL  516

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             Y SV +PE SLRDE+N+P+   LCG V G+  P PY
Sbjct  517   YISVPTPEGSLRDEYNIPENAVLCGAVVGLPKPAPY  552



>gb|EEC79422.1| hypothetical protein OsI_20394 [Oryza sativa Indica Group]
Length=466

 Score =   514 bits (1323),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 238/393 (61%), Positives = 297/393 (76%), Gaps = 6/393 (2%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             V I DWY K H  + K+LD+G++  RP GVVINGK GK      P+FT+EAGKTYR RVC
Sbjct  77    VLIGDWYTKDHAAMAKMLDAGKSFGRPHGVVINGKSGKAAAD-PPMFTVEAGKTYRLRVC  135

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             NVG++ S+NFR QGH M LVEMEGSHT+Q+ YDSLD+HVG CLSVLV AD++P DYY V 
Sbjct  136   NVGIKASLNFRIQGHDMKLVEMEGSHTVQDMYDSLDVHVGHCLSVLVDADQKPGDYYAVA  195

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+RF  +  S  A+I YA      +S       PE   G AWSINQ+RSFRWNLTASAAR
Sbjct  196   STRFIHEAKSVSAVIRYAG-----SSTPPSPAVPEPPAGWAWSINQWRSFRWNLTASAAR  250

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYGQINITRTI+L+ S+ ++DGKL+Y  NGVSH++ +TPLKLAEYF +++ VF
Sbjct  251   PNPQGSYHYGQINITRTIRLMVSRGHIDGKLKYGFNGVSHVDAETPLKLAEYFNVTDGVF  310

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
             +YN M D PP     + + PNV+ A FR F+EI+FEN EK++ + HLDG++FFAV +  G
Sbjct  311   RYNQMTDVPPAVNGPLHVVPNVITAEFRTFIEIIFENPEKSMDSVHLDGYAFFAVGMGPG  370

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
             +WS E+RK YNL+D VSRHS+QVYP SW A+M T DNAGMWN+RS++WER YLG+QLY S
Sbjct  371   KWSAEERKTYNLLDGVSRHSVQVYPRSWTAIMLTFDNAGMWNVRSNIWERHYLGEQLYIS  430

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             V+SP RSLRDE+N+P+    CG V G+ +PP Y
Sbjct  431   VVSPARSLRDEYNMPENALRCGKVVGLPLPPSY  463



>ref|XP_008804666.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=551

 Score =   515 bits (1326),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 240/398 (60%), Positives = 291/398 (73%), Gaps = 7/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGK--VGGKIDPLFTMEAGKTYR  174
             FNV   DW+ K HK L   LD+GR++  P GV+ING+ GK   G    P+FTM+AG  YR
Sbjct  159   FNVLAGDWFTKSHKVLAGQLDAGRSVGHPAGVLINGRRGKDAAGHDEPPMFTMQAGDVYR  218

Query  175   YRVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDY  354
             +R CNVG++TS+NFR Q H + LVEMEGSHT+QN Y SLD+HVGQCLSVLVTAD+ P DY
Sbjct  219   FRFCNVGLKTSLNFRIQKHPLKLVEMEGSHTVQNLYTSLDVHVGQCLSVLVTADQAPGDY  278

Query  355   YLVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTA  534
             YLV S+RF K+  +  A++ YA  N   +             G AWS NQ+R+FRWNLTA
Sbjct  279   YLVASTRFTKKVLTATAVLRYAGSNTPPSPVIPE-----GPTGWAWSFNQWRTFRWNLTA  333

Query  535   SAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGIS  714
             SAARPNPQGSYHYGQINITR+I+LVN  S VDGK R  +NGVSH++ DTPLKLAEYF +S
Sbjct  334   SAARPNPQGSYHYGQINITRSIRLVNGHSIVDGKRRNFINGVSHVDPDTPLKLAEYFNLS  393

Query  715   EKVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
               VFKY++MGD PP     VTLAPNV+   FR F+EI+FEN EK+IQ+YHLDG++FF   
Sbjct  394   NPVFKYSLMGDAPPAPDTPVTLAPNVIAVEFRTFIEIIFENTEKSIQSYHLDGYAFFPAG  453

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             +  G+WSPE RK YNL+D VSRHS+ V+P SW A++ T DNAGMWNLRS  WE  YLGQQ
Sbjct  454   MGPGKWSPESRKRYNLLDTVSRHSVHVFPKSWTAILLTFDNAGMWNLRSMNWENKYLGQQ  513

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             LY SV SPERSLRDE+N+P     CG V G+ +PP Y+
Sbjct  514   LYVSVTSPERSLRDEYNMPLNALRCGAVVGLPLPPSYT  551



>ref|XP_008782736.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=550

 Score =   514 bits (1324),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 238/398 (60%), Positives = 294/398 (74%), Gaps = 7/398 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKID--PLFTMEAGKTYR  174
             FN+   DWY K HK L   LDSGR+I RP GV+INGKHGK     D  P+FTMEAGKTYR
Sbjct  158   FNILAGDWYTKSHKVLAGRLDSGRSIGRPAGVLINGKHGKDASGKDEPPMFTMEAGKTYR  217

Query  175   YRVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDY  354
             +RVCN+G++ S+NFR Q H++ LVEMEGSH +QN YDSLDLH+GQC SV VTAD++P DY
Sbjct  218   FRVCNIGIKDSLNFRIQKHSLRLVEMEGSHVVQNTYDSLDLHIGQCFSVFVTADQQPGDY  277

Query  355   YLVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTA  534
             Y+++S+RF K      AI+ YA  N   +    P        G AWS NQ+RSFRWNLTA
Sbjct  278   YILMSTRFTKYSCGGSAIVRYAGSNAPPSKDLPPA-----PSGWAWSFNQWRSFRWNLTA  332

Query  535   SAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGIS  714
             SAARPNPQGSYHYGQINITRTIKL      V+GK RYA+NGVSH N  TPLKL+EY+GI+
Sbjct  333   SAARPNPQGSYHYGQINITRTIKLRGGTGLVNGKRRYAINGVSHENPVTPLKLSEYYGIA  392

Query  715   EKVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             +K FKY+I+GD PP     +T+APNV+N TFR F+E++ EN E++I  YHLDG++FF   
Sbjct  393   DKEFKYSIIGDEPPNGKSLITIAPNVINCTFRTFIEVILENPERSIHAYHLDGYAFFPAG  452

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             +  G W+PEKR  YNL+DA SRH++QVYP SW+A+M T DNAGMWNLR+ +W++ YLGQQ
Sbjct  453   MGHGEWTPEKRVTYNLLDAASRHTVQVYPKSWSAIMLTFDNAGMWNLRTLVWDKQYLGQQ  512

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             LY SV SP RSLRDE+N+P+    CG V  +  P PY+
Sbjct  513   LYISVASPARSLRDEYNMPENALHCGNVVNLPKPAPYT  550



>gb|ADK47981.1| L-ascorbate oxidase-like protein [Cynodon dactylon]
Length=550

 Score =   514 bits (1323),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 238/395 (60%), Positives = 297/395 (75%), Gaps = 6/395 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F V + DWY K H  L K LD+G+ I RP G++INGK+ K      P++  EAGKTYR+R
Sbjct  159   FPVLVGDWYTKDHTVLAKHLDAGKGIGRPAGLIINGKNDKDAASA-PMYNFEAGKTYRFR  217

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             VCNVG++ S+N R  GH + LVEMEGSHT+QN YDSLD+HVGQCLS LVTAD++P DY+L
Sbjct  218   VCNVGIKASLNVRVPGHNLKLVEMEGSHTVQNMYDSLDVHVGQCLSFLVTADQKPADYFL  277

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             VVS+RF K+  +  A+I Y       +S       PE   G AWSINQ+RSFRWNLTASA
Sbjct  278   VVSTRFIKEVSTITALIRYKG-----SSTPPSPKLPEGPSGWAWSINQWRSFRWNLTASA  332

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTIKL  S+  VDGK RYALNGVSH++ +TPLKLAEYF  ++ 
Sbjct  333   ARPNPQGSYHYGQINITRTIKLSTSRGKVDGKERYALNGVSHVDAETPLKLAEYFNATDG  392

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VF+YN++ D PP+    + LAPNV++A FR F+E+VFEN EK+I ++H+DG++FF   + 
Sbjct  393   VFQYNLISDVPPKAGTPIKLAPNVLSAEFRTFIEVVFENPEKSIDSFHIDGYAFFTAGMG  452

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G WSP+ RK YNL+D VSRH+IQVYP SW AVM T DNAGMWN+RS++WER YLG+Q+Y
Sbjct  453   PGTWSPQSRKTYNLLDTVSRHTIQVYPRSWTAVMLTFDNAGMWNVRSNLWERQYLGEQMY  512

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
              SV+SP RSLRDE+N+P+    CG V G+ MPP Y
Sbjct  513   ISVISPARSLRDEYNMPETSLRCGKVVGLPMPPSY  547



>ref|NP_001132891.1| uncharacterized protein LOC100194388 [Zea mays]
 gb|ACF81925.1| unknown [Zea mays]
Length=421

 Score =   509 bits (1310),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 235/395 (59%), Positives = 290/395 (73%), Gaps = 6/395 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F V + DWY K H  L K LD+G+ I RP G+VINGK+ K      P++ +EAGKTYR+R
Sbjct  30    FPVLVGDWYTKDHTVLAKNLDAGKGIGRPAGLVINGKNEKDASN-PPMYNVEAGKTYRFR  88

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             VCNVG++ S N R Q H M LVEMEGSHT+QN YDSLDLH+GQCLS LVTAD++P DY L
Sbjct  89    VCNVGIKASFNIRIQNHIMKLVEMEGSHTMQNDYDSLDLHIGQCLSFLVTADQKPGDYLL  148

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
              VS+RF K+  S  A+I Y   N    +         +  G AWSINQ RSFRWNLTASA
Sbjct  149   AVSTRFIKEVNSITAVIRYKGSNAPPPAKVPE-----SPSGWAWSINQCRSFRWNLTASA  203

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTIKL   +  VDGK R+  NGVSH++ +TP+KLAEYF  ++ 
Sbjct  204   ARPNPQGSYHYGQINITRTIKLAMGRGKVDGKERFGFNGVSHVDPETPVKLAEYFNTTDG  263

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VF+Y+I+GD PP  +    +APNV+ A FR F+E+VFEN EK+I T H+DG++FFAV + 
Sbjct  264   VFQYDIIGDVPPSKSAPTKMAPNVIRAEFRTFIEVVFENPEKSIDTIHIDGYAFFAVGMG  323

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G+W+P  R  YNL+D VSRH+IQVYP SW AVM T DNAGMW++RS++WER YLG+QLY
Sbjct  324   PGKWTPASRSTYNLLDTVSRHTIQVYPRSWTAVMMTFDNAGMWSIRSNIWERQYLGEQLY  383

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
              SV+SPERSLRDE+N+P+    CG V G+ MPP Y
Sbjct  384   VSVISPERSLRDEYNMPETSLRCGKVVGLPMPPSY  418



>gb|EMT12555.1| L-ascorbate oxidase-like protein [Aegilops tauschii]
Length=440

 Score =   509 bits (1312),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 233/393 (59%), Positives = 297/393 (76%), Gaps = 6/393 (2%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             V I DW+ K H  +  +LD+GR   RP GV+ING+ GK      P+FT EA KTY+ R+C
Sbjct  51    VLIGDWFTKDHAVMASLLDAGRNFGRPAGVLINGRGGKEAAN-PPMFTWEAAKTYQLRIC  109

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             NVG++TS+NFR QGH M LVEM+GSHT+Q  Y+SLD+HVGQC++VLV AD++P DY +V 
Sbjct  110   NVGIKTSLNFRIQGHDMKLVEMDGSHTVQGMYESLDVHVGQCMAVLVDADQKPADYLMVA  169

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+RF     S  A+I YA  N   A+            G AWSINQ+RSFRWNLTASAAR
Sbjct  170   STRFMAGPSSVSAVIRYAGSNTPPAANVPEP-----PAGWAWSINQWRSFRWNLTASAAR  224

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYGQINITRTIKL+ ++ +V+GKL+Y  NGVSH++ DTPLKLAEYF +S++VF
Sbjct  225   PNPQGSYHYGQINITRTIKLMVTRGHVEGKLKYGFNGVSHVDGDTPLKLAEYFNVSDQVF  284

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
             KYN MGD PP     + + PNV+ A FR F+E+VFEN EK++++ H+DG++FFAV +  G
Sbjct  285   KYNQMGDEPPAVNGPMHVVPNVITAEFRTFIEVVFENPEKSMESMHIDGYAFFAVGMGPG  344

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
             +W+  +RK YNL+DAVSRH+IQVYP SW+AVM T DNAGMWN+RS++WER YLG+QLY S
Sbjct  345   KWTAAERKTYNLLDAVSRHTIQVYPRSWSAVMLTFDNAGMWNVRSNLWERHYLGEQLYMS  404

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             V+SP RSLRDE+N+P+    CG V G+SMPP Y
Sbjct  405   VVSPARSLRDEYNMPENALRCGKVVGLSMPPSY  437



>dbj|BAK05994.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=560

 Score =   513 bits (1322),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 235/395 (59%), Positives = 300/395 (76%), Gaps = 6/395 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
               V I DW+ K H  +  +LD+GR+  RP GV+INGK GK      P+FT EA KTYR R
Sbjct  169   LQVVIGDWFTKDHAVMASLLDAGRSFGRPAGVLINGKGGKEATN-PPMFTWEAAKTYRLR  227

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG+++S+NFR QGH M LVE++GSHT+Q++YDSLD+HVGQCLSVLV AD++P DY +
Sbjct  228   ICNVGIKSSLNFRIQGHDMKLVEIDGSHTLQDSYDSLDVHVGQCLSVLVDADQKPADYLM  287

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF     S  A++ YA  N   A             G AWS+NQ+RSFRWNLTASA
Sbjct  288   VASTRFMADASSVSAVVRYAGSNTPPAPNVPEP-----PAGWAWSLNQWRSFRWNLTASA  342

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTIKL+ ++ ++DGKL+Y  NGVSH++ DTPLKLAEYF IS++
Sbjct  343   ARPNPQGSYHYGQINITRTIKLLVTRGHIDGKLKYGFNGVSHVDADTPLKLAEYFNISDQ  402

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKYN M DTPP     + +APNV+ A FR F+E+VFEN EK++ + H+DG++FFAV + 
Sbjct  403   VFKYNQMADTPPAVNGPMHVAPNVITAEFRTFIEVVFENPEKSMDSVHIDGYAFFAVGMG  462

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G+W+P++RK YNL+DAVSRH+IQVYP SW+AVM T DNAGMWN+RS++WER YLG+QLY
Sbjct  463   PGKWTPDQRKTYNLLDAVSRHTIQVYPRSWSAVMLTFDNAGMWNVRSNLWERHYLGEQLY  522

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
              SV+SP RSLRDE+N+P+    CG V G+ +PP Y
Sbjct  523   MSVVSPARSLRDEYNMPENALRCGKVVGLPLPPSY  557



>ref|XP_003567221.1| PREDICTED: L-ascorbate oxidase homolog [Brachypodium distachyon]
Length=557

 Score =   513 bits (1322),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 240/395 (61%), Positives = 306/395 (77%), Gaps = 6/395 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F+V + DWY K    L+K +D+G++I RP G++INGK+ K      P++ +EAGKTYR+R
Sbjct  166   FSVLVGDWYTKDFAVLEKHIDTGKSIGRPAGLLINGKNEKDASN-PPMYNVEAGKTYRFR  224

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             VCNVG+++S+N R QGH + LVEMEGSHT+QN YDSLD+HVGQCLS LVTA+++P DY L
Sbjct  225   VCNVGIKSSLNVRVQGHMIKLVEMEGSHTVQNEYDSLDVHVGQCLSFLVTANQKPGDYLL  284

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+  +  AII Y  G+ + ASP+LP        G AWSINQ+RSFRWNLTASA
Sbjct  285   VASTRFIKEVSTITAIIRY-KGSSVPASPKLPEA----PNGWAWSINQWRSFRWNLTASA  339

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTIKL  S++ VDGK RYALNGVSH++ DTP KLAEYF  +  
Sbjct  340   ARPNPQGSYHYGQINITRTIKLSTSRAKVDGKERYALNGVSHVDPDTPPKLAEYFNATTG  399

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VF+YN++GDTPP+    + +APN++ A FR F+E+VFEN EK+I ++HL+G++FFA  + 
Sbjct  400   VFEYNLIGDTPPKEGTPIKVAPNILTAEFRTFIEVVFENPEKSIDSFHLNGYAFFAAGMG  459

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G W+P+ RK YNL+D VSRH+IQVYP SW A+M T DNAGMWNLR+++WER Y+G+QLY
Sbjct  460   PGLWTPDCRKTYNLLDTVSRHTIQVYPRSWTAIMLTFDNAGMWNLRTNIWERYYMGEQLY  519

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
              SV SP RSLRDE+N+PD    CG V GM +PPPY
Sbjct  520   MSVTSPARSLRDEYNMPDNGLRCGKVVGMPLPPPY  554



>gb|AAT01329.1| putative L-ascorbate oxidase [Oryza sativa Japonica Group]
 gb|AAT01403.1| putative L-ascorbate oxidase [Oryza sativa Japonica Group]
Length=556

 Score =   513 bits (1321),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 238/393 (61%), Positives = 297/393 (76%), Gaps = 6/393 (2%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             V I DWY K H  + K+LD+G++  RP GVVINGK GK      P+FT+EAGKTYR RVC
Sbjct  167   VLIGDWYTKDHAAMAKMLDAGKSFGRPHGVVINGKSGKAAAD-PPMFTVEAGKTYRLRVC  225

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             NVG++ S+NFR QGH M LVEMEGSHT+Q+ YDSLD+HVG CLSVLV AD++P DYY V 
Sbjct  226   NVGIKASLNFRIQGHDMKLVEMEGSHTVQDMYDSLDVHVGHCLSVLVDADQKPGDYYAVA  285

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+RF  +  S  A+I YA      +S       PE   G AWSINQ+RSFRWNLTASAAR
Sbjct  286   STRFIHEAKSVSAVIRYAG-----SSTPPSPAVPEPPAGWAWSINQWRSFRWNLTASAAR  340

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYGQINITRTI+L+ S+ ++DGKL+Y  NGVSH++ +TPLKLAEYF +++ VF
Sbjct  341   PNPQGSYHYGQINITRTIRLMVSRGHIDGKLKYGFNGVSHVDAETPLKLAEYFNVTDGVF  400

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
             +YN M D PP     + + PNV+ A FR F+EI+FEN EK++ + HLDG++FFAV +  G
Sbjct  401   RYNQMTDVPPAVNGPLHVVPNVITAEFRTFIEIIFENPEKSMDSVHLDGYAFFAVGMGPG  460

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
             +WS E+RK YNL+D VSRHS+QVYP SW A+M T DNAGMWN+RS++WER YLG+QLY S
Sbjct  461   KWSAEERKTYNLLDGVSRHSVQVYPRSWTAIMLTFDNAGMWNVRSNIWERHYLGEQLYIS  520

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             V+SP RSLRDE+N+P+    CG V G+ +PP Y
Sbjct  521   VVSPARSLRDEYNMPENALRCGKVVGLPLPPSY  553



>emb|CDY50029.1| BnaA06g00300D [Brassica napus]
Length=540

 Score =   512 bits (1319),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 241/398 (61%), Positives = 298/398 (75%), Gaps = 21/398 (5%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I+DWY + H  LK  LDSGRTI RPDG++INGK GK  G   PLFT++ GKTYR R
Sbjct  162   YTVLINDWYTESHTQLKNFLDSGRTIGRPDGILINGKAGKGDGSDQPLFTLKQGKTYRIR  221

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ S+NFR Q H M LVEMEGSH +QN YDSLD+HVGQC  V++TA++EPKDYY+
Sbjct  222   ICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVILTANQEPKDYYI  281

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   +T  ++ Y  G G+ +S     P      G AWS+NQFRSFRWNLTASA
Sbjct  282   VASTRFLKNALTTTGLLRYEGGKGLASSQLPAAPV-----GWAWSLNQFRSFRWNLTASA  336

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  VD KLRYALNGVSHI+ +TPLKLAEYFG+++K
Sbjct  337   ARPNPQGSYHYGKINITRTIKLVNTQGKVDSKLRYALNGVSHIDLETPLKLAEYFGVTDK  396

Query  721   VFKYNIMGDTPPENAEK-VTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D P  +  K + + PN               NHE+++Q++HLDG+SFFAVA+
Sbjct  397   VFKYDSISDNPTSDQIKNIKIEPN---------------NHERSVQSWHLDGYSFFAVAV  441

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             E G W+PEKRKNYNL+DAVSRH+IQVYP  WAA++ T DN GMWN+RS+  ER YLGQQL
Sbjct  442   EPGTWTPEKRKNYNLLDAVSRHTIQVYPKCWAAILLTFDNCGMWNIRSENSERRYLGQQL  501

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1191
             Y SVLSPE+SLRDE+N+P+    CGLVK      PY+G
Sbjct  502   YASVLSPEKSLRDEYNMPESSLQCGLVKDKPKINPYAG  539



>ref|XP_003566121.2| PREDICTED: L-ascorbate oxidase homolog [Brachypodium distachyon]
Length=540

 Score =   511 bits (1316),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 235/395 (59%), Positives = 293/395 (74%), Gaps = 6/395 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
               V I DWY K H  + ++LD GR+  RP GV+ING+ GK      PLFT EAGKTYR R
Sbjct  149   LQVLIGDWYTKDHAVMARLLDEGRSFGRPAGVLINGRGGKEAAD-PPLFTFEAGKTYRLR  207

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG+++++NFR QGH M LVEM+GSHT+Q+ YDSLD+HVG CLSVLV AD++P DYY+
Sbjct  208   ICNVGIKSTLNFRIQGHDMKLVEMDGSHTVQDMYDSLDVHVGHCLSVLVDADQKPGDYYV  267

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF   + S  A+I YA  N   A             G AWS+NQ+RSFRWNLTASA
Sbjct  268   VASTRFISDKSSVSAVIRYAGSNTPPAPNVPE-----PPAGWAWSLNQWRSFRWNLTASA  322

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTIKL+ ++ +++GKL+Y  NGVSH++ DTPLKL EYF +++ 
Sbjct  323   ARPNPQGSYHYGQINITRTIKLLVTRGHLEGKLKYGFNGVSHVDADTPLKLLEYFNVTDP  382

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKYN M D PP     + + PNV+ A FR F+E+VFEN EK++ + H+DG++FFAV + 
Sbjct  383   VFKYNQMADVPPAVMGPLQVVPNVITAEFRTFIEVVFENPEKSMDSVHIDGYAFFAVGMG  442

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G+WSPE RK YNL+DAVSRHSIQVYP SW+AVM T DNAGMWN+RS++WER Y G+Q Y
Sbjct  443   PGKWSPELRKTYNLLDAVSRHSIQVYPRSWSAVMLTFDNAGMWNVRSNVWERYYTGEQFY  502

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
              SV SP RSLRDE+N+PD    CG V G+ MPP Y
Sbjct  503   ISVTSPARSLRDEYNMPDTSLRCGRVVGLPMPPSY  537



>ref|NP_001044620.1| Os01g0816700 [Oryza sativa Japonica Group]
 dbj|BAB64824.1| putative L-ascorbate oxidase [Oryza sativa Japonica Group]
 dbj|BAF06534.1| Os01g0816700 [Oryza sativa Japonica Group]
Length=553

 Score =   511 bits (1316),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 246/396 (62%), Positives = 302/396 (76%), Gaps = 7/396 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V + DWY K H  L K LD+G++I RP G+VINGK+ K      P++TMEAGK YR+R
Sbjct  161   YPVLVGDWYTKDHTVLAKNLDAGKSIGRPAGLVINGKNEKDASN-PPMYTMEAGKVYRFR  219

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             VCNVG++TS+N R QGH++ LVEMEGSHT+QN+YDSLD+HV QC+S LVTAD++P DY L
Sbjct  220   VCNVGIKTSLNVRIQGHSLKLVEMEGSHTVQNSYDSLDVHVAQCVSFLVTADQKPGDYLL  279

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+  +  AI+ Y NG+   ASP+LP        G AWSINQ+RSFRWNLTASA
Sbjct  280   VASTRFLKEYSAITAIVRY-NGSNTPASPKLPE----GPSGWAWSINQWRSFRWNLTASA  334

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHIN-TDTPLKLAEYFGISE  717
             ARPNPQGSYHYGQINITRTIKL  SK  VDGK R+ALNGVSH++   TPLKLAEYF  S 
Sbjct  335   ARPNPQGSYHYGQINITRTIKLCTSKGKVDGKERFALNGVSHVDDAQTPLKLAEYFNASS  394

Query  718   KVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
              VF+YN++GD PP       LAPNV++A FR F+E+VFEN EK+I ++H++G++FFA  +
Sbjct  395   GVFEYNLIGDVPPATTVPQKLAPNVISAEFRTFIEVVFENPEKSIDSFHINGYAFFAAGM  454

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
               G W+PE RK YNL+D VSRH+IQVYP SW AVM T DNAGMWN+RS+MWER YLG QL
Sbjct  455   GPGIWTPECRKTYNLLDTVSRHTIQVYPRSWTAVMLTFDNAGMWNIRSNMWERYYLGAQL  514

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             Y SV+SP RSLRDE+N+P+    CG V G+ MPP Y
Sbjct  515   YVSVVSPARSLRDEYNMPEIALRCGKVVGLPMPPSY  550



>gb|EEE55579.1| hypothetical protein OsJ_03867 [Oryza sativa Japonica Group]
Length=550

 Score =   511 bits (1315),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 246/396 (62%), Positives = 302/396 (76%), Gaps = 7/396 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V + DWY K H  L K LD+G++I RP G+VINGK+ K      P++TMEAGK YR+R
Sbjct  158   YPVLVGDWYTKDHTVLAKNLDAGKSIGRPAGLVINGKNEKDASN-PPMYTMEAGKVYRFR  216

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             VCNVG++TS+N R QGH++ LVEMEGSHT+QN+YDSLD+HV QC+S LVTAD++P DY L
Sbjct  217   VCNVGIKTSLNVRIQGHSLKLVEMEGSHTVQNSYDSLDVHVAQCVSFLVTADQKPGDYLL  276

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+  +  AI+ Y NG+   ASP+LP        G AWSINQ+RSFRWNLTASA
Sbjct  277   VASTRFLKEYSAITAIVRY-NGSNTPASPKLPE----GPSGWAWSINQWRSFRWNLTASA  331

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHIN-TDTPLKLAEYFGISE  717
             ARPNPQGSYHYGQINITRTIKL  SK  VDGK R+ALNGVSH++   TPLKLAEYF  S 
Sbjct  332   ARPNPQGSYHYGQINITRTIKLCTSKGKVDGKERFALNGVSHVDDAQTPLKLAEYFNASS  391

Query  718   KVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
              VF+YN++GD PP       LAPNV++A FR F+E+VFEN EK+I ++H++G++FFA  +
Sbjct  392   GVFEYNLIGDVPPATTVPQKLAPNVISAEFRTFIEVVFENPEKSIDSFHINGYAFFAAGM  451

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
               G W+PE RK YNL+D VSRH+IQVYP SW AVM T DNAGMWN+RS+MWER YLG QL
Sbjct  452   GPGIWTPECRKTYNLLDTVSRHTIQVYPRSWTAVMLTFDNAGMWNIRSNMWERYYLGAQL  511

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             Y SV+SP RSLRDE+N+P+    CG V G+ MPP Y
Sbjct  512   YVSVVSPARSLRDEYNMPEIALRCGKVVGLPMPPSY  547



>ref|NP_001151662.1| L-ascorbate oxidase precursor [Zea mays]
 gb|ACG43714.1| L-ascorbate oxidase precursor [Zea mays]
Length=559

 Score =   511 bits (1315),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 242/395 (61%), Positives = 294/395 (74%), Gaps = 6/395 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F V I DWY K H  L K LD+G+ I RP G+VINGK+ K      P++ +EAGKTYR+R
Sbjct  168   FPVLIGDWYTKDHAVLAKNLDAGKGIGRPAGLVINGKNEKDASN-PPMYNVEAGKTYRFR  226

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             VCNVG++ S N R Q H M LVEMEGSHT+QN YDSLDLH+GQCLS LVTAD++P DY L
Sbjct  227   VCNVGIKASFNVRIQDHIMKLVEMEGSHTMQNDYDSLDLHIGQCLSFLVTADQKPGDYLL  286

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K++ ST A+I Y       +S   P   PE   G AWSINQ RSFRWNLTASA
Sbjct  287   VASTRFIKEKSSTTAVIRYKG-----SSAPPPAKLPEGPSGWAWSINQCRSFRWNLTASA  341

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTIKL   +  VDGK R+  NGVSH++ +TP+KLAEYF  S+ 
Sbjct  342   ARPNPQGSYHYGQINITRTIKLAMGRGKVDGKERFGFNGVSHVDPETPVKLAEYFNASDG  401

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKYN++GD PP N     +APNV++A FR F+E+VFEN EK+I T H+DG++FFAV + 
Sbjct  402   VFKYNLIGDVPPSNTAPTKMAPNVISAEFRTFIEVVFENPEKSIDTIHIDGYAFFAVGMG  461

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G+W+   R  YNL+D VSRH+IQVYP SW AVM T DNAGMW++RS++WER YLG+QLY
Sbjct  462   PGKWTAASRSTYNLLDTVSRHTIQVYPRSWTAVMMTFDNAGMWSVRSNIWERQYLGEQLY  521

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
              SV+SPERSLRDE+N+P+    CG V G+ MPP Y
Sbjct  522   VSVISPERSLRDEYNMPETSLRCGKVVGLPMPPSY  556



>gb|ACN34077.1| unknown [Zea mays]
 gb|AFW84771.1| L-ascorbate oxidase [Zea mays]
Length=559

 Score =   511 bits (1315),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 242/395 (61%), Positives = 294/395 (74%), Gaps = 6/395 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F V I DWY K H  L K LD+G+ I RP G+VINGK+ K      P++ +EAGKTYR+R
Sbjct  168   FPVLIGDWYTKDHAVLAKNLDAGKGIGRPAGLVINGKNEKDASN-PPMYNVEAGKTYRFR  226

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             VCNVG++ S N R Q H M LVEMEGSHT+QN YDSLDLH+GQCLS LVTAD++P DY L
Sbjct  227   VCNVGIKASFNVRIQDHIMKLVEMEGSHTMQNDYDSLDLHIGQCLSFLVTADQKPGDYLL  286

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K++ ST A+I Y       +S   P   PE   G AWSINQ RSFRWNLTASA
Sbjct  287   VASTRFIKEKSSTTAVIRYKG-----SSAPPPAKLPEGPSGWAWSINQCRSFRWNLTASA  341

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTIKL   +  VDGK R+  NGVSH++ +TP+KLAEYF  S+ 
Sbjct  342   ARPNPQGSYHYGQINITRTIKLAMGRGKVDGKERFGFNGVSHVDPETPVKLAEYFNASDG  401

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFKYN++GD PP N     +APNV++A FR F+E+VFEN EK+I T H+DG++FFAV + 
Sbjct  402   VFKYNLIGDVPPSNTAPTKMAPNVISAEFRTFIEVVFENPEKSIDTIHIDGYAFFAVGMG  461

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G+W+   R  YNL+D VSRH+IQVYP SW AVM T DNAGMW++RS++WER YLG+QLY
Sbjct  462   PGKWTAASRSTYNLLDTVSRHTIQVYPRSWTAVMMTFDNAGMWSVRSNIWERQYLGEQLY  521

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
              SV+SPERSLRDE+N+P+    CG V G+ MPP Y
Sbjct  522   VSVISPERSLRDEYNMPETSLRCGKVVGLPMPPSY  556



>gb|ACF86554.2| unknown [Zea mays]
 gb|AFW82337.1| pollen-specific protein NTP303 [Zea mays]
Length=559

 Score =   509 bits (1312),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 237/394 (60%), Positives = 293/394 (74%), Gaps = 4/394 (1%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             V I DWY K H+ L + LD+G+++ RP GV+INGK GK      P+ T EAGKTYR RVC
Sbjct  167   VLIGDWYTKDHEVLARQLDAGKSVGRPAGVLINGKGGKDLEAAAPMLTFEAGKTYRLRVC  226

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             N G++ S+NFR QGH M LVE+EGSHT+Q+ YDSLD+HVG CLSVLV AD+ P DYY+V 
Sbjct  227   NTGIKASLNFRIQGHDMKLVELEGSHTLQDVYDSLDVHVGHCLSVLVDADQAPGDYYMVA  286

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+RF     S  A+I YA  +G   +P +  P      G AWSINQ RSFRWNLTASAAR
Sbjct  287   STRFIHDAKSASAVIRYAGSSGAPPAPNMTEP----PAGWAWSINQARSFRWNLTASAAR  342

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYGQINITRTIK++ S+ ++DGKLRY  NG+SH +T+TPLKLAEYF +++ VF
Sbjct  343   PNPQGSYHYGQINITRTIKVMVSRGHIDGKLRYGFNGISHRDTETPLKLAEYFNVTDGVF  402

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
              YN MGD PP     + + PNV+ A FR F+EIVFEN EK+I + HLDG++FF V +  G
Sbjct  403   SYNQMGDVPPAVNGPLHVIPNVITAEFRTFIEIVFENPEKSIDSLHLDGYAFFGVGMGPG  462

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
              WSPE RK YNL+D VSRH+IQVYP SW A+M T DNAGMW++RS++WER YLG+Q Y S
Sbjct  463   TWSPEMRKTYNLLDTVSRHTIQVYPRSWTAIMLTFDNAGMWSVRSNVWERYYLGEQFYIS  522

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             V+SP RSLRDE+N+PD    CG V G+ +PP Y+
Sbjct  523   VISPARSLRDEYNMPDNALRCGKVVGLPLPPSYA  556



>ref|NP_001151772.1| pollen-specific protein NTP303 precursor [Zea mays]
 gb|ACG44269.1| pollen-specific protein NTP303 precursor [Zea mays]
Length=559

 Score =   509 bits (1312),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 237/394 (60%), Positives = 293/394 (74%), Gaps = 4/394 (1%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             V I DWY K H+ L + LD+G+++ RP GV+INGK GK      P+ T EAGKTYR RVC
Sbjct  167   VLIGDWYTKDHEVLARQLDAGKSVGRPAGVLINGKGGKDLEAAAPMLTFEAGKTYRLRVC  226

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             N G++ S+NFR QGH M LVE+EGSHT+Q+ YDSLD+HVG CLSVLV AD+ P DYY+V 
Sbjct  227   NTGIKASLNFRIQGHYMKLVELEGSHTLQDVYDSLDVHVGHCLSVLVDADQAPGDYYMVA  286

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+RF     S  A+I YA  +G   +P +  P      G AWSINQ RSFRWNLTASAAR
Sbjct  287   STRFIHDAKSASAVIRYAGSSGAPPAPNMTEP----PAGWAWSINQARSFRWNLTASAAR  342

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYGQINITRTIK++ S+ ++DGKLRY  NG+SH +T+TPLKLAEYF +++ VF
Sbjct  343   PNPQGSYHYGQINITRTIKVMVSRGHIDGKLRYGFNGISHRDTETPLKLAEYFNVTDGVF  402

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
              YN MGD PP     + + PNV+ A FR F+EIVFEN EK+I + HLDG++FF V +  G
Sbjct  403   SYNQMGDVPPAVNGPLHVIPNVITAEFRTFIEIVFENPEKSIDSLHLDGYAFFGVGMGPG  462

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
              WSPE RK YNL+D VSRH+IQVYP SW A+M T DNAGMW++RS++WER YLG+Q Y S
Sbjct  463   TWSPEMRKTYNLLDTVSRHTIQVYPRSWTAIMLTFDNAGMWSVRSNVWERYYLGEQFYIS  522

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             V+SP RSLRDE+N+PD    CG V G+ +PP Y+
Sbjct  523   VISPARSLRDEYNMPDNALRCGKVVGLPLPPSYA  556



>ref|XP_010931432.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=551

 Score =   509 bits (1310),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 240/397 (60%), Positives = 294/397 (74%), Gaps = 7/397 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGK-VGGKIDP-LFTMEAGKTYR  174
             F+V   DW+   HK L + LD+GR +  P GV+ING+ G+ V G  DP +FT++AG  YR
Sbjct  159   FDVLAGDWFTASHKLLARKLDAGRGLGLPAGVLINGRPGRPVTGHDDPPMFTVQAGNVYR  218

Query  175   YRVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDY  354
             +R CNVG++TS+NFR Q H++ LVEMEGSHTIQN YDSLD+HVGQCLSVLV AD+ P DY
Sbjct  219   FRFCNVGLKTSLNFRIQKHSLKLVEMEGSHTIQNLYDSLDVHVGQCLSVLVVADQGPGDY  278

Query  355   YLVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTA  534
             YLVVS+RF K+  +  A++ YA  N   +             G AWS NQ+R+FRWNLTA
Sbjct  279   YLVVSTRFTKKIHTATAVLRYAGSNTPPSPVIPE-----GPSGWAWSFNQWRTFRWNLTA  333

Query  535   SAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGIS  714
             SAARPNPQGSYHYG+INITRTIKL+N  + VDGK R+ +NGVSH++ DTPLKLAEYF +S
Sbjct  334   SAARPNPQGSYHYGEINITRTIKLLNGHTVVDGKRRHFINGVSHVDPDTPLKLAEYFNLS  393

Query  715   EKVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
               VF YN+MGD PP     V LAPNV+ A FR F+EI+FEN E++IQ+YHLDG++FF V 
Sbjct  394   NPVFNYNLMGDVPPALDIPVKLAPNVITAEFRTFIEIIFENTERSIQSYHLDGYAFFPVG  453

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             +  G+WSPE R+ YNL+D VSRHSI V+P SW A+M T DNAGMWNLRS  WE  YLGQQ
Sbjct  454   MGPGKWSPESRRLYNLLDTVSRHSIHVFPKSWTAIMLTFDNAGMWNLRSMNWENKYLGQQ  513

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
             LY SV SP RSLRDE+N+PD    CG V G+ +PP Y
Sbjct  514   LYVSVTSPARSLRDEYNMPDNTLRCGAVVGLPLPPSY  550



>emb|CDY43352.1| BnaA01g29830D [Brassica napus]
Length=509

 Score =   507 bits (1305),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 232/350 (66%), Positives = 290/350 (83%), Gaps = 5/350 (1%)
 Frame = +1

Query  139   PLFTMEAGKTYRYRVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLS  318
             PLFTM+ GKTY+YR+CNVG ++++NFR QGH M LVEMEGSH +QN YDSLD+HVGQC +
Sbjct  164   PLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFA  223

Query  319   VLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSI  498
             VLVTAD+E K YY+V S+RF K+E STV ++SY  G+ +  S  LP  P     G AWS+
Sbjct  224   VLVTADQEAKSYYMVASTRFLKKEVSTVGVMSY-EGSNVQPSNVLPKAPV----GWAWSL  278

Query  499   NQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTD  678
             NQFRSFRWNLTASAARPNPQGSYHYG+INITRTIKL N+K+ VDGK+R+ LNGVSH++T+
Sbjct  279   NQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVDGKVRFGLNGVSHVDTE  338

Query  679   TPLKLAEYFGISEKVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQT  858
             TPLKLAEYF +SEKVFKYN++ D P      +T+ PNV+N TFR FVEIVFENHE+++Q+
Sbjct  339   TPLKLAEYFEMSEKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVEIVFENHERSMQS  398

Query  859   YHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLR  1038
             +HLDG+SFF+VA E G W+PEKR NYNL+DAVSRH++QV+P SW+A++ T DNAGMWN+R
Sbjct  399   FHLDGYSFFSVASEPGTWTPEKRNNYNLLDAVSRHTVQVFPKSWSAILLTFDNAGMWNIR  458

Query  1039  SDMWERAYLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             S+ WER YLGQQ+Y SVLSPE+SLRDE+N+P    LCG+VKG+ +P PY+
Sbjct  459   SENWERRYLGQQMYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPTPYT  508



>ref|XP_009120150.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=554

 Score =   508 bits (1309),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 234/396 (59%), Positives = 302/396 (76%), Gaps = 7/396 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  LK  LDSGR+I RP+GV+INGK GK  G  +P+FTM+ GKTY+YR
Sbjct  159   YTVLIGDWYTKTHVALKDNLDSGRSIGRPEGVLINGKAGKPDGTGEPIFTMKPGKTYKYR  218

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ ++NFR Q H + LVE+EGSHT+QN YDSLDLHVGQC  VLVTAD+EPKDYY+
Sbjct  219   ICNVGLKMALNFRIQNHKIKLVELEGSHTLQNLYDSLDLHVGQCFGVLVTADQEPKDYYM  278

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   ++ A++ Y  G G  +      P      G AWS+NQFRSFRWNLTASA
Sbjct  279   VASTRFLKTVLTSTALLRYEGGKGAASPELPKPPV-----GWAWSLNQFRSFRWNLTASA  333

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDG-KLRYALNGVSHINTDTPLKLAEYFGISE  717
             ARPNPQGSYHYG+INITR+IKLVN+   ++G KLRYAL+GVSH+ T+TP+KLA+YFG+++
Sbjct  334   ARPNPQGSYHYGKINITRSIKLVNTVGKIEGKKLRYALSGVSHVETETPIKLAQYFGVAD  393

Query  718   KVFKYNIMGDTPPE-NAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             KVFKY+ + D P + +   + + PNV+N   R+FVEIVFEN E+T Q++HLDG+SFFAVA
Sbjct  394   KVFKYDTIKDEPTKVDTSNILVQPNVLNIEHRSFVEIVFENQERTTQSWHLDGYSFFAVA  453

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             +E G+W+P KRKNYNL+DAV RH+IQVYP  W A++ T DN GMWN+RS++ E+ YLGQQ
Sbjct  454   VEPGKWTPAKRKNYNLLDAVYRHTIQVYPKCWGAILLTFDNCGMWNIRSEILEKRYLGQQ  513

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPP  1182
             LY +V  PE S RDE++ P     CG+++G+  P P
Sbjct  514   LYVNVGPPELSQRDEYSFPANGLRCGIIQGLPDPQP  549



>ref|XP_008672229.1| PREDICTED: uncharacterized protein LOC100194388 isoform X1 [Zea 
mays]
 gb|ACN27218.1| unknown [Zea mays]
 tpg|DAA57111.1| TPA: hypothetical protein ZEAMMB73_564948 [Zea mays]
Length=557

 Score =   507 bits (1305),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 235/395 (59%), Positives = 290/395 (73%), Gaps = 6/395 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F V + DWY K H  L K LD+G+ I RP G+VINGK+ K      P++ +EAGKTYR+R
Sbjct  166   FPVLVGDWYTKDHTVLAKNLDAGKGIGRPAGLVINGKNEKDASN-PPMYNVEAGKTYRFR  224

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             VCNVG++ S N R Q H M LVEMEGSHT+QN YDSLDLH+GQCLS LVTAD++P DY L
Sbjct  225   VCNVGIKASFNIRIQNHIMKLVEMEGSHTMQNDYDSLDLHIGQCLSFLVTADQKPGDYLL  284

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
              VS+RF K+  S  A+I Y   N    +         +  G AWSINQ RSFRWNLTASA
Sbjct  285   AVSTRFIKEVNSITAVIRYKGSNAPPPAKVPE-----SPSGWAWSINQCRSFRWNLTASA  339

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTIKL   +  VDGK R+  NGVSH++ +TP+KLAEYF  ++ 
Sbjct  340   ARPNPQGSYHYGQINITRTIKLAMGRGKVDGKERFGFNGVSHVDPETPVKLAEYFNTTDG  399

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VF+Y+I+GD PP  +    +APNV+ A FR F+E+VFEN EK+I T H+DG++FFAV + 
Sbjct  400   VFQYDIIGDVPPSKSAPTKMAPNVIRAEFRTFIEVVFENPEKSIDTIHIDGYAFFAVGMG  459

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G+W+P  R  YNL+D VSRH+IQVYP SW AVM T DNAGMW++RS++WER YLG+QLY
Sbjct  460   PGKWTPASRSTYNLLDTVSRHTIQVYPRSWTAVMMTFDNAGMWSIRSNIWERQYLGEQLY  519

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
              SV+SPERSLRDE+N+P+    CG V G+ MPP Y
Sbjct  520   VSVISPERSLRDEYNMPETSLRCGKVVGLPMPPSY  554



>ref|XP_006644902.1| PREDICTED: L-ascorbate oxidase homolog [Oryza brachyantha]
Length=555

 Score =   506 bits (1303),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 240/395 (61%), Positives = 298/395 (75%), Gaps = 6/395 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V + DWY K H  L K L++G++I RP G+VINGK+ K      P++TMEAGK YRYR
Sbjct  164   YPVLVGDWYTKDHTVLAKNLEAGKSIGRPAGLVINGKNEKDASN-PPMYTMEAGKVYRYR  222

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             VCNVG++TS+N R Q H + LVEMEGSHT+QN YDSLD+HV QC+S LV AD++P DY L
Sbjct  223   VCNVGIKTSLNVRIQSHIIKLVEMEGSHTVQNTYDSLDVHVAQCVSFLVAADQKPGDYLL  282

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+  S  AII Y NG+   ASP+LP        G AWSINQ+RSFRWNLTASA
Sbjct  283   VASTRFMKETSSITAIIRY-NGSNTPASPKLPE----GPSGWAWSINQWRSFRWNLTASA  337

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTI+L   ++ V GK R+A+NGVSH++ +TPLKLAEYF  +  
Sbjct  338   ARPNPQGSYHYGQINITRTIRLSAGRAKVGGKERFAINGVSHVDAETPLKLAEYFNATAG  397

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VF+YN++GD PP     V LAPNV+   FR F+E+VFEN EK+I ++H++G++FFA  + 
Sbjct  398   VFEYNLIGDVPPAAGAAVKLAPNVIQTEFRTFIEVVFENPEKSIDSFHINGYAFFAAGMG  457

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G W+P+ RK YNL+D VSRH+IQVYP SW AVM T DNAGMWN+RS+MWER YLG+QLY
Sbjct  458   PGTWTPDCRKTYNLLDTVSRHTIQVYPRSWTAVMLTFDNAGMWNIRSNMWERFYLGEQLY  517

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
              SV+SP RSLRDE+N+P+    CG V GM MPP Y
Sbjct  518   VSVISPARSLRDEYNMPENGLRCGKVVGMPMPPSY  552



>emb|CDM84722.1| unnamed protein product [Triticum aestivum]
Length=556

 Score =   504 bits (1299),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 233/396 (59%), Positives = 295/396 (74%), Gaps = 6/396 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F V + DWY K H  L K LD+G+ I RP G++INGK+ K      P+F +EAGKTYR+R
Sbjct  165   FGVLVGDWYTKDHTVLAKNLDTGKGIGRPAGLLINGKNEKDASN-PPMFNVEAGKTYRFR  223

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             VCNVG++T++N R QGH + LVEMEGSHT+QN YDS+D+H+GQCLS L TA+++P DY+ 
Sbjct  224   VCNVGIKTTLNVRIQGHVLKLVEMEGSHTVQNEYDSMDVHIGQCLSFLSTANQKPGDYFF  283

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             + S+RF K   +  A++ Y   N   A+           +G AWSINQ+RSFRWNLTASA
Sbjct  284   IASTRFIKGVSTITAVMRYKGSNTPPAAKLPDA-----PDGWAWSINQWRSFRWNLTASA  338

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTIKL +S+  VDGK RYALNGVSH + +TPLKLAEYF  ++ 
Sbjct  339   ARPNPQGSYHYGQINITRTIKLSSSRGKVDGKERYALNGVSHTDPETPLKLAEYFNATKG  398

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VF+YN++ DTPP+    + +AP+V+ A  R ++EIVFEN EK+I T+HL+G++FFA  + 
Sbjct  399   VFEYNLVTDTPPKEGTPIKVAPSVITAEHRTYIEIVFENPEKSIDTFHLNGYAFFAAGMG  458

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G W+ E RK YNL+D VSRH+IQVYP SW AVM T DNAGMWNLRS++WER YLG+QLY
Sbjct  459   PGLWTVESRKTYNLLDTVSRHTIQVYPRSWTAVMLTFDNAGMWNLRSNLWERYYLGEQLY  518

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              S  SP RSLRDE+N+PD    CG V GM +PPPY+
Sbjct  519   VSCTSPARSLRDEYNMPDNSLRCGKVVGMPLPPPYT  554



>dbj|BAK07214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=557

 Score =   504 bits (1298),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 231/396 (58%), Positives = 293/396 (74%), Gaps = 6/396 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F+  + DWY K H+ L K LD+G+ I RP G++INGK+ K      P++ +E GKTYR+R
Sbjct  166   FSALVGDWYTKDHEVLAKNLDTGKGIGRPAGLLINGKNEKDASN-PPMYNVETGKTYRFR  224

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             VCNVG++T++N R QGH + LVEMEGSHT+QN YDSLD+H+GQCLS L TA+++P DY+L
Sbjct  225   VCNVGIKTTLNVRIQGHVVKLVEMEGSHTVQNEYDSLDVHIGQCLSFLTTANQKPGDYFL  284

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             + S+RF K   +  A++ Y   N   +             G AWSINQ+RSFRWNLTASA
Sbjct  285   IASTRFIKGVNTITAVMRYKGSNSPPSPKLPEA-----PAGWAWSINQWRSFRWNLTASA  339

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTIKL  S+  VDGK RYALNGVSH + +TPLKLAEYF  ++ 
Sbjct  340   ARPNPQGSYHYGQINITRTIKLSTSRGKVDGKERYALNGVSHADAETPLKLAEYFNATKG  399

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VF+YN++ DTPP+    + LAPNV+ A  R ++E+VFEN E++I T+HL+G++FFA  + 
Sbjct  400   VFEYNLITDTPPKEGTPIKLAPNVITAEHRTYIEVVFENPERSIDTFHLNGYAFFAAGMG  459

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G W+ E RK YNL+D VSRH+IQVYP SW AVM T DNAGMWNLRS++WER YLG+QLY
Sbjct  460   PGLWTAESRKTYNLLDTVSRHTIQVYPRSWTAVMLTFDNAGMWNLRSNLWERYYLGEQLY  519

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              S  SP RSLRDE+N+PD    CG V GM +PPPY+
Sbjct  520   VSCTSPARSLRDEYNMPDNALRCGKVVGMPLPPPYT  555



>ref|XP_002456532.1| hypothetical protein SORBIDRAFT_03g037970 [Sorghum bicolor]
 gb|EES01652.1| hypothetical protein SORBIDRAFT_03g037970 [Sorghum bicolor]
Length=558

 Score =   504 bits (1297),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 235/395 (59%), Positives = 296/395 (75%), Gaps = 6/395 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F V + DWY K H  L K LD+G+ I RP G+VINGK+ K      P++ +EAGKTYR+R
Sbjct  167   FPVLVGDWYTKDHAVLAKNLDAGKGIGRPSGLVINGKNEKDAAN-PPMYNVEAGKTYRFR  225

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVGM+ S+N   Q H M LVEMEGSHT+QN YDSLD+HVGQCLSVLVTAD++P DY L
Sbjct  226   ICNVGMKASINIGIQNHIMKLVEMEGSHTMQNDYDSLDIHVGQCLSVLVTADQKPGDYLL  285

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K+  +T A+I Y       AS   P   PE+  G AWSINQ RSFRWNLTASA
Sbjct  286   VASTRFIKEVSTTTAVIRYKG-----ASAPPPAKLPESPSGWAWSINQARSFRWNLTASA  340

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTI+L   +  VDGK R+ +NGVSH++ +TP+KLAEYF  ++ 
Sbjct  341   ARPNPQGSYHYGQINITRTIRLGIGRGKVDGKERFGINGVSHVDPETPVKLAEYFNATDG  400

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VF+Y+++GD PP  +    +APNV+ A FR F+E+VFEN EK+I T+H+DG++FFAV + 
Sbjct  401   VFQYDLIGDVPPAKSAPTKMAPNVLRAEFRTFIEVVFENPEKSIDTFHIDGYAFFAVGMG  460

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G+W+P  R  YNL+D VSRH++QVYP SW AVM T DNAGMW++RS++WER YLG+QLY
Sbjct  461   PGKWTPACRSTYNLLDTVSRHTVQVYPRSWTAVMMTFDNAGMWSIRSNIWERNYLGEQLY  520

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPY  1185
              SV SPERSLRDE+N+P+    CG V G+ +PP Y
Sbjct  521   ISVTSPERSLRDEYNMPETSLRCGKVVGLPLPPSY  555



>gb|EMT02825.1| L-ascorbate oxidase-like protein [Aegilops tauschii]
Length=556

 Score =   504 bits (1297),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 233/396 (59%), Positives = 293/396 (74%), Gaps = 6/396 (2%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F V + DWY K H  L K LD+G+ I RP G++INGK+ K      P+F +E GKTYR+R
Sbjct  165   FGVLVGDWYTKDHTVLAKNLDTGKGIGRPAGLLINGKNEKDASN-PPMFNVEEGKTYRFR  223

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             VCNVG++T++N R QGH + LVEMEGSHT+QN YDS+D+H+GQCLS L TA+++P DY+ 
Sbjct  224   VCNVGIKTTLNVRIQGHVLKLVEMEGSHTVQNEYDSMDVHIGQCLSFLSTANQKPGDYFF  283

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             + S+RF K   +  A++ Y   N   A+           +G AWSINQ+RSFRWNLTASA
Sbjct  284   IASTRFIKGVSTITAVMRYKGSNTPPAAKLPDA-----PDGWAWSINQWRSFRWNLTASA  338

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTIKL  S+  VDGK RYALNGVSH + +TPLKLAEYF  ++ 
Sbjct  339   ARPNPQGSYHYGQINITRTIKLSPSRGKVDGKERYALNGVSHTDPETPLKLAEYFNATKG  398

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VF+YN++ DTPP+    + +AP+V+ A  R ++EIVFEN EK+I T+HLDG++FFA  + 
Sbjct  399   VFEYNLVTDTPPKEGTPIKVAPSVITAEHRTYIEIVFENPEKSIDTFHLDGYAFFAAGMG  458

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G W+ E RK YNL+D VSRH+IQVYP SW AVM T DNAGMWNLRS++WER YLG+QLY
Sbjct  459   PGLWTVESRKTYNLLDTVSRHTIQVYPRSWTAVMLTFDNAGMWNLRSNLWERYYLGEQLY  518

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              S  SP RSLRDE+N+PD    CG V GM +PPPY+
Sbjct  519   VSCTSPARSLRDEYNMPDNSLRCGKVVGMPLPPPYT  554



>ref|XP_002441281.1| hypothetical protein SORBIDRAFT_09g023770 [Sorghum bicolor]
 gb|EES19711.1| hypothetical protein SORBIDRAFT_09g023770 [Sorghum bicolor]
Length=559

 Score =   502 bits (1293),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 237/394 (60%), Positives = 296/394 (75%), Gaps = 6/394 (2%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             V I DWY K H+ L + LD+G+++ RP GVVINGK GK   +  PLFT +AGKTYR RVC
Sbjct  169   VLIGDWYTKDHEVLARQLDAGKSVGRPAGVVINGKGGK-DLESAPLFTFDAGKTYRLRVC  227

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             N G++ S+NFR QGH MTLVE+EGSHT+Q+ YDSLD+HVG CLSVLVTAD++P DYY+V 
Sbjct  228   NTGIKASLNFRIQGHHMTLVELEGSHTLQDVYDSLDVHVGHCLSVLVTADQKPGDYYMVA  287

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+RF     S  A++ YA      +S   P   PE   G AWSINQ RS RWNLT+SAAR
Sbjct  288   STRFIHDAKSARAVVRYAG-----SSAPPPAEMPEPPAGWAWSINQARSIRWNLTSSAAR  342

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYGQINITRTI+++ S+ ++DGKLRY  NGVSH + +TP+KLAEYF +++ VF
Sbjct  343   PNPQGSYHYGQINITRTIRVMVSRGHIDGKLRYGFNGVSHRDPETPVKLAEYFNVTDGVF  402

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
              YN MGD PP     + + PNV+ A FR F+EIVFEN EK++ + HLDG++FF V +  G
Sbjct  403   SYNQMGDVPPAVNGPLHVVPNVITAEFRTFIEIVFENPEKSLDSIHLDGYAFFGVGMGPG  462

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
             +WSPE R  YNL+DAVSRH+IQVYP SW A+M T DNAGMW++RS++WER YLG+Q Y S
Sbjct  463   QWSPEARVTYNLLDAVSRHTIQVYPRSWTAIMLTFDNAGMWSVRSNIWERYYLGEQFYIS  522

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             V+SPE SLRDE+N+PD    CG V G+ +PP YS
Sbjct  523   VISPEHSLRDEYNMPDNDLRCGKVVGLPLPPSYS  556



>ref|NP_001151961.1| pollen-specific protein NTP303 precursor [Zea mays]
 gb|ACG45153.1| pollen-specific protein NTP303 precursor [Zea mays]
Length=559

 Score =   498 bits (1283),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 233/394 (59%), Positives = 290/394 (74%), Gaps = 6/394 (2%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             V I DWY K H+ L + +D+G+ + RP GV+INGK GK   +  P FT EAGKTYR RVC
Sbjct  169   VLIGDWYTKDHEVLARQIDAGKGVGRPAGVLINGKGGK-DLEAAPAFTFEAGKTYRLRVC  227

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             N G++ S+NFR QGH M LVE+EGSHT+QN YDSLD+HVG CLSVLV AD++P DYY+V 
Sbjct  228   NTGIKASLNFRIQGHYMKLVELEGSHTLQNTYDSLDVHVGHCLSVLVDADQKPGDYYMVA  287

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+RF     S  A+I YA      +S        E   G AWSINQ RSFRWNLTASAAR
Sbjct  288   STRFIHDAKSASAVIRYAG-----SSVPPAPNMTEPPAGWAWSINQARSFRWNLTASAAR  342

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYGQINITRTIK++ S+ ++DGKLRY  NG+SH + +TP+KLAEYF +++ VF
Sbjct  343   PNPQGSYHYGQINITRTIKVMVSRGHIDGKLRYGFNGISHRDPETPVKLAEYFNVTDGVF  402

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
              YN MGD PP     + + PNV+ A FR F+EIVFEN EK+I + H+DG++FF V +  G
Sbjct  403   SYNQMGDVPPAVNGPLHVIPNVITAEFRTFIEIVFENPEKSIDSLHVDGYAFFGVGMGPG  462

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
             +WSPE RK YNL+D VSRH+IQVYP SW A+M T DNAGMW++ S++WER YLG+Q Y S
Sbjct  463   KWSPEVRKTYNLLDTVSRHTIQVYPRSWTAIMLTFDNAGMWSVHSNIWERYYLGEQFYIS  522

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             V+SP RSLRDE+N+PD    CG V G+ +PP Y+
Sbjct  523   VVSPARSLRDEYNMPDNALRCGKVVGLPLPPSYA  556



>gb|ACN26659.1| unknown [Zea mays]
 gb|AFW78430.1| pollen-specific protein NTP303 [Zea mays]
Length=559

 Score =   497 bits (1280),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 233/394 (59%), Positives = 289/394 (73%), Gaps = 6/394 (2%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             V I DWY K H+ L + +D+G+ + RP GV+INGK GK   +  P FT EAGKTYR RVC
Sbjct  169   VLIGDWYTKDHEVLARQIDAGKGVGRPAGVLINGKGGK-DLEAAPAFTFEAGKTYRLRVC  227

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             N G++ S+NFR QGH M LVE+EGSHT+QN YDSLD+HVG CLSVLV AD++P DYY+V 
Sbjct  228   NTGIKASLNFRIQGHYMKLVELEGSHTLQNTYDSLDVHVGHCLSVLVDADQKPGDYYMVA  287

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+RF     S  A+I YA      +S        E   G AWSINQ RSFRWNLTASAAR
Sbjct  288   STRFIHDAKSASAVIRYAG-----SSAPPSPNMTEPPAGWAWSINQARSFRWNLTASAAR  342

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYGQINITRTIK++ S+ ++DGKLRY  NG+SH + +TP+KLAEYF  ++ VF
Sbjct  343   PNPQGSYHYGQINITRTIKVMVSRGHIDGKLRYGFNGISHRDPETPVKLAEYFNATDGVF  402

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
              YN MGD PP     + + PNV+ A FR F+EIVFEN EK+I + H+DG++FF V +  G
Sbjct  403   SYNQMGDVPPAVNGPLHVIPNVITAEFRTFIEIVFENPEKSIDSLHVDGYAFFGVGMGPG  462

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
             +WSPE RK YNL+D VSRH+IQVYP SW A+M T DNAGMW++ S++WER YLG+Q Y S
Sbjct  463   KWSPEVRKTYNLLDTVSRHTIQVYPRSWTAIMLTFDNAGMWSVHSNIWERYYLGEQFYIS  522

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
             V+SP RSLRDE+N+PD    CG V G+ +PP Y+
Sbjct  523   VVSPARSLRDEYNMPDNALRCGKVVGLPLPPSYA  556



>ref|XP_006386039.1| multi-copper oxidase type 1 family protein, partial [Populus 
trichocarpa]
 gb|ERP63836.1| multi-copper oxidase type 1 family protein, partial [Populus 
trichocarpa]
Length=534

 Score =   491 bits (1265),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 238/399 (60%), Positives = 290/399 (73%), Gaps = 32/399 (8%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V ++DWY   H TL+K LDSGR++ARP+GV+INGK+ K  G  +PLFTM+ GKTY+YR
Sbjct  139   YTVILNDWYTSSHSTLRKYLDSGRSLARPNGVLINGKNAKGDGNDEPLFTMKPGKTYKYR  198

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CN G++ ++NFR QGHTM LVEMEGSH +QN Y+ LD+HVGQC SVL            
Sbjct  199   ICNAGLKNTLNFRIQGHTMKLVEMEGSHVVQNVYEPLDVHVGQCFSVL------------  246

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
                     +  ++  II Y NG G  +      P      G AWS+NQFRSF WNLTASA
Sbjct  247   --------EVLTSKGIIRYTNGKGPASPELPEAPV-----GWAWSLNQFRSFHWNLTASA  293

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG INITRTIKLVNS S   GKL YA+NGVSH+N +TPLKLAEY+GI+ K
Sbjct  294   ARPNPQGSYHYGSINITRTIKLVNSASRAGGKLCYAINGVSHVNPETPLKLAEYYGIAHK  353

Query  721   VFKYNIMGDTPPEN--AEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAV-  891
             VFKY+ + D P  N  + KV   PNV+N TFRNFVEIVFENHEK++Q+YHLDG+SFFA+ 
Sbjct  354   VFKYDTIPDMPLANIASAKVVTHPNVINQTFRNFVEIVFENHEKSMQSYHLDGYSFFALY  413

Query  892   ----AIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERA  1059
                  IE   W+PEKRK+YNL+DAVSR +IQV+P SWAA++ T DNAGMWN+RS+MWER 
Sbjct  414   TNIHNIEPDTWTPEKRKSYNLLDAVSRTTIQVFPKSWAAILLTFDNAGMWNIRSEMWERT  473

Query  1060  YLGQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMP  1176
             YLGQQLY SVL P  SL+DE+N+PD   LCG VK +  P
Sbjct  474   YLGQQLYVSVLCPGCSLKDEYNVPDNALLCGQVKDLPKP  512



>gb|EMS66047.1| L-ascorbate oxidase-like protein [Triticum urartu]
Length=570

 Score =   486 bits (1251),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 228/396 (58%), Positives = 286/396 (72%), Gaps = 17/396 (4%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F   + DWY K H  L K LD+G+ I RP G++INGK+ K      P++ +EAGKTYR+R
Sbjct  190   FGALVGDWYTKDHTVLAKNLDTGKGIGRPAGLLINGKNEKDASN-PPMYNVEAGKTYRFR  248

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             VCNVG++T++N R QGH + LVEMEGSHT+QN YDS+D+H+GQCLS L TA+++P DY+ 
Sbjct  249   VCNVGIKTTLNVRIQGHVLKLVEMEGSHTVQNEYDSMDVHIGQCLSFLTTANQKPGDYFF  308

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             + S+RF K   +  A+I Y   N   A+           +G AWSINQ+RSFRWNLTASA
Sbjct  309   IASTRFIKGVSTITAVIRYKGSNTPPAAKLPDA-----PDGWAWSINQWRSFRWNLTASA  363

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYGQINITRTIKL  S+  VDGK RYALNGVSH + +TPLKLAEYF  ++ 
Sbjct  364   ARPNPQGSYHYGQINITRTIKLSPSRGKVDGKERYALNGVSHTDPETPLKLAEYFNATKG  423

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VF+YN++ DTPP+    + +AP+V+    R ++EIVFEN EK+I T+HLDG++FFA    
Sbjct  424   VFEYNLVTDTPPKEGTPIKVAPSVITTEHRTYIEIVFENPEKSIDTFHLDGYAFFAAG--  481

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
                      K YNL+D VSRH+IQVYP SW AVM T DNAGMWNLRS++WER YLG+QLY
Sbjct  482   ---------KTYNLLDTVSRHTIQVYPRSWTAVMLTFDNAGMWNLRSNLWERYYLGEQLY  532

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYS  1188
              S  SP RSLRDE+N+PD    CG V GM +PPPY+
Sbjct  533   VSCTSPARSLRDEYNMPDNALRCGKVVGMPLPPPYT  568



>emb|CDY54363.1| BnaC06g07290D [Brassica napus]
Length=545

 Score =   477 bits (1228),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 231/398 (58%), Positives = 283/398 (71%), Gaps = 18/398 (5%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I+DWY K H  LK  LDSGRTI RPDG++INGK GK  G   PLFT++ GKTYR R
Sbjct  164   YTVLINDWYTKTHTQLKNFLDSGRTIGRPDGILINGKAGKGDGSDQPLFTLKQGKTYRIR  223

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG++ S+NFR Q H M LVEMEGSH +QN YDSLD+HVGQC  V +TA++EPKDYY+
Sbjct  224   ICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVTLTANQEPKDYYM  283

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   +T  ++ Y  G G+ +S     P      G AWS+NQFRSFRWNLTASA
Sbjct  284   VASTRFLKNALTTTGLLRYEGGKGLASSQLPAAPV-----GWAWSLNQFRSFRWNLTASA  338

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG+INITRTIKLVN++  VD KLRYALNGVSHI+ +TPLKLAEYFG+++K
Sbjct  339   ARPNPQGSYHYGKINITRTIKLVNTQGKVDSKLRYALNGVSHIDPETPLKLAEYFGVTDK  398

Query  721   VFKYNIMGDTPPENAEK-VTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
             VFKY+ + D P  +  K + + PNV+N        I     E  +  +         +  
Sbjct  399   VFKYDSISDNPTSDQIKNIKIEPNVLN--------ITQPREECPVLAFGW----LLLLRY  446

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
               G W+PEKRKNYNL+DAVSRH+IQVYP  WAA++ T DN GMWN+RS+  ER YLGQQL
Sbjct  447   SPGTWTPEKRKNYNLLDAVSRHTIQVYPKCWAAILLTFDNCGMWNIRSENSERRYLGQQL  506

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPPPYSG  1191
             Y SVLSPE+SLRDE+N+P+    CGLVK      PY+G
Sbjct  507   YASVLSPEKSLRDEYNMPESSLQCGLVKDKPKINPYAG  544



>gb|ABV89619.1| Sku5-like 11 [Brassica rapa]
Length=553

 Score =   459 bits (1181),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 233/403 (58%), Positives = 283/403 (70%), Gaps = 17/403 (4%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + V I DWY K H  LKK LD GRTI RPDG+VINGK GK  G   PLFT++       R
Sbjct  161   YTVLIGDWYTKSHTQLKKFLDGGRTIGRPDGIVINGKSGKGDGSDAPLFTLKPE-----R  215

Query  181   VCNVGMRTSVN----FRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPK  348
             +  +G  T V+    FR Q H M LVE +   T               L  +VTA++EPK
Sbjct  216   LTGLGSVTWVSDIYHFRIQNHKMKLVEWK-DRTFFKRLRLSRRSRWPVLWHIVTANQEPK  274

Query  349   DYYLVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNL  528
             DYY+V SSRF K   +T  ++ Y  G G  +S     P      G AWS+NQFRSFRWNL
Sbjct  275   DYYMVASSRFLKTVITTTGLLRYEGGKGPASSQLPAGPV-----GWAWSLNQFRSFRWNL  329

Query  529   TASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFG  708
             TASAARPNPQGSYHYG+INITRTIKLVN++  VDGKLR+ALNGVSH   +TPLKLAEYFG
Sbjct  330   TASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRFALNGVSHTEPETPLKLAEYFG  389

Query  709   ISEKVFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFF  885
             IS+KVFKY+ + D P PE  + + + PNV+N T R FVE+VFENHEK++Q++HLDG+SFF
Sbjct  390   ISDKVFKYDTITDDPTPEQIKNIKIEPNVLNITHRTFVEVVFENHEKSVQSWHLDGYSFF  449

Query  886   AVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYL  1065
             +VA+E G W+PEKRKNYNL+DAVSRH++QVYP  WAA++ T DN GMWN+RS+  ER YL
Sbjct  450   SVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNVRSENTERRYL  509

Query  1066  GQQLYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPP-PYSG  1191
             GQQLY SVLSPE+SLRDE+N+P+    CGLVK    P  PY+G
Sbjct  510   GQQLYASVLSPEKSLRDEYNMPETSLQCGLVKNTPKPVNPYAG  552



>gb|AFK33666.1| unknown [Lotus japonicus]
Length=467

 Score =   435 bits (1119),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 205/308 (67%), Positives = 245/308 (80%), Gaps = 5/308 (2%)
 Frame = +1

Query  7    VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
            V I DWY K HKTLK +LDSGR+I RP+GV+INGK  K  G   PL+TM+ GKTY+YR+C
Sbjct  160  VIIGDWYAKSHKTLKSLLDSGRSIGRPNGVLINGKTAKGDGSDQPLYTMKPGKTYKYRIC  219

Query  187  NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
            NVG++ S+NFR QGH M LVE EGSH +QN YDSLD+HVGQC +VLVTADK+PKDYYLV 
Sbjct  220  NVGLKDSLNFRIQGHPMKLVETEGSHVVQNTYDSLDVHVGQCYTVLVTADKDPKDYYLVA  279

Query  367  SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
            S+RF K   +   II Y NG G  +    P P      G AWS+NQFRSFRWNLTASAAR
Sbjct  280  STRFTKYSLTGKGIIRYTNGVGPASPELPPAPV-----GWAWSLNQFRSFRWNLTASAAR  334

Query  547  PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
            PNP+GSYHYGQINITRTIKLVN+ S   GKLRYA+NGVSH++ +TPLKLAEYFG+++KVF
Sbjct  335  PNPRGSYHYGQINITRTIKLVNTVSKAQGKLRYAINGVSHVDGETPLKLAEYFGVADKVF  394

Query  727  KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
            KYNI+ D PP +   +TLAPNVVNATFR F+EI+FEN  KT+Q+Y+LDG+SFF VA+E G
Sbjct  395  KYNIISDEPPADLNTITLAPNVVNATFRTFIEIIFENPGKTVQSYNLDGYSFFLVAVEPG  454

Query  907  RWSPEKRK  930
            +W+PEKRK
Sbjct  455  KWTPEKRK  462



>ref|XP_006850531.1| hypothetical protein AMTR_s00159p00040990 [Amborella trichopoda]
 gb|ERN12112.1| hypothetical protein AMTR_s00159p00040990 [Amborella trichopoda]
Length=543

 Score =   437 bits (1124),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 210/392 (54%), Positives = 279/392 (71%), Gaps = 11/392 (3%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             + + I DWY K HK L+K LD  +++ +P GV+ING+ GK    +    T+E GKTYR R
Sbjct  159   YTLLIGDWYTKSHKELRKRLDDSKSLGKPCGVLINGRTGKNAETL----TVEPGKTYRIR  214

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             + NVG++TS+NFR +GH + LVE+EGSHT+QN Y+SLD+HVGQ  SVLVTA++  KDY +
Sbjct  215   ISNVGIKTSLNFRIEGHALLLVEIEGSHTVQNVYESLDVHVGQSYSVLVTANQAVKDYQI  274

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   +  A++ Y+      A+  +         G+A+S+NQFRSFRWNLTASA
Sbjct  275   VASTRFTKYILTGTAVLHYSG-----ATEGVSDAALSGPTGVAFSLNQFRSFRWNLTASA  329

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGSYHYG I I RTIKL +S   ++GKLRYA+NGVS+    TPLKLA+Y+ + ++
Sbjct  330   ARPNPQGSYHYGSIPIVRTIKLASSIGKIEGKLRYAINGVSYKQASTPLKLADYYEMGKE  389

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             V+    M D+PPE  E++    NVV+   R+F+EIVFEN EKT+QT+HL+G+SFFAV + 
Sbjct  390   VWCDKCMPDSPPE--EEMKEETNVVDGVHRDFIEIVFENREKTVQTWHLNGYSFFAVGMS  447

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G W+PE R  YNL DA+SR +IQVYP SW+A++ T DNAGMW+LRS++WER YLGQQLY
Sbjct  448   RGTWTPESRNVYNLFDAISRSNIQVYPKSWSAILLTTDNAGMWSLRSEIWERQYLGQQLY  507

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKGMSMP  1176
               + SP  SLRDE+++P     CGLV     P
Sbjct  508   LRIPSPVHSLRDEYDIPLNTPHCGLVANKGEP  539



>ref|XP_008466955.1| PREDICTED: L-ascorbate oxidase homolog, partial [Cucumis melo]
Length=281

 Score =   423 bits (1087),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 199/286 (70%), Positives = 237/286 (83%), Gaps = 6/286 (2%)
 Frame = +1

Query  136  DPLFTMEAGKTYRYRVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCL  315
            +PLFTM+ GKTY+YRVCNVG+++S+NFRFQGHTM LVEMEGSHT+QN Y SLD+HVGQC 
Sbjct  1    EPLFTMKPGKTYKYRVCNVGLKSSLNFRFQGHTMKLVEMEGSHTVQNDYQSLDVHVGQCF  60

Query  316  SVLVTADKEPKDYYLVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWS  495
            SVLVTA++E KDYY+V S+RF K       I+ Y +G G  +      P      G AWS
Sbjct  61   SVLVTANQESKDYYMVASTRFIKNVLVGKGIVRYTDGKGPASPEIPEAPV-----GWAWS  115

Query  496  INQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINT  675
            +NQFR+FRWNLTASAARPNPQGSYHYG INITRTIKLVNS S VDGKLRYA+NGVSH++ 
Sbjct  116  LNQFRTFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASKVDGKLRYAINGVSHVDP  175

Query  676  DTPLKLAEYFGISEKVFKYNIMGDTP-PENAEKVTLAPNVVNATFRNFVEIVFENHEKTI  852
            +TPLKLAEYFGI++KVFKY+ + D    E A  VT+APNVVNATFR+F+EI+FENHEK++
Sbjct  176  ETPLKLAEYFGIADKVFKYDTISDEGLAEGATTVTVAPNVVNATFRDFIEIIFENHEKSL  235

Query  853  QTYHLDGHSFFAVAIEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSW  990
            Q++HLDG+SFFAVAIE GRWSPEKR NYNL+DAVSRH+IQV+P SW
Sbjct  236  QSWHLDGYSFFAVAIEPGRWSPEKRANYNLLDAVSRHTIQVFPKSW  281



>ref|XP_007047154.1| SKU5 similar 17 isoform 3 [Theobroma cacao]
 gb|EOX91311.1| SKU5 similar 17 isoform 3 [Theobroma cacao]
Length=406

 Score =   419 bits (1078),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 198/388 (51%), Positives = 271/388 (70%), Gaps = 14/388 (4%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F + I DWY   HKTL++ LDSG+++  PDGV+ING+           F+ E GKTY +R
Sbjct  30    FTLLIGDWYKTSHKTLQQTLDSGKSLPFPDGVLINGQ-------TQTTFSGEQGKTYMFR  82

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             + NVG+ TS+NFR QGHTM LVE+EGSH IQN YDSLD+HVGQ ++VLVT ++ PKDYY+
Sbjct  83    ISNVGLSTSLNFRIQGHTMKLVEVEGSHVIQNLYDSLDVHVGQSVTVLVTLNQPPKDYYI  142

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   +  A++ Y N     + P    P  +      WS+ Q R++RWNLT++A
Sbjct  143   VASTRFTKTVLTATAVLHYTNSQTPVSGPLPAAPAYQ----YHWSMQQARTYRWNLTSNA  198

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGS+HYG+I  T+TI L NS S ++GKLRY +NGVS +N DTPLKLA+YF I   
Sbjct  199   ARPNPQGSFHYGKITTTKTIVLANSGSLINGKLRYTVNGVSFVNPDTPLKLADYFNI-PG  257

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VF  + + D P   A   T+A +VV  +  +F+E+VF+N+E T+Q++HLDG+ F+ V   
Sbjct  258   VFSMSSIQDLPSGGA--ATVATSVVPTSLHDFIEVVFQNNENTMQSWHLDGYDFWVVGFG  315

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
             +G+W+P+KR+ YNL+DA++RH+ QVYPNSW A++ ++DN GMWN+RS MWER YLGQQ Y
Sbjct  316   SGQWAPKKRRTYNLIDALTRHTTQVYPNSWTAILVSLDNQGMWNMRSAMWERQYLGQQFY  375

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKG  1164
               V +P RS  +E+++P    LCG   G
Sbjct  376   LRVWTPVRSFANEYDIPSNVLLCGKAVG  403



>gb|KGN54012.1| hypothetical protein Csa_4G267470 [Cucumis sativus]
Length=480

 Score =   420 bits (1080),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 204/302 (68%), Positives = 242/302 (80%), Gaps = 7/302 (2%)
 Frame = +1

Query  1    FNVFISDWYNKGHKTLKKILDSG-RTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRY  177
            + V I DWY K H TLK+ILD+G R+IARP+GV+INGK  K  G  +PLFTM+  KTY+Y
Sbjct  160  YTVLIGDWYTKSHTTLKQILDNGHRSIARPEGVLINGKTAKGDGTDEPLFTMKPEKTYKY  219

Query  178  RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
            RVCNVG++TS+NFRFQGHTM LVEMEGSHT+QN Y SLD+HVGQC SVLVTA++EPKDYY
Sbjct  220  RVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQNDYQSLDVHVGQCFSVLVTANQEPKDYY  279

Query  358  LVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTAS  537
            +V S+RF K       II Y NG G  +      P      G AWS+NQFR+FRWNLTAS
Sbjct  280  MVASTRFIKNVLIGKGIIRYTNGKGPASPEIPKAPM-----GWAWSLNQFRTFRWNLTAS  334

Query  538  AARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISE  717
            AARPNPQGSYHYG INITRTIKL NS + VDGKLRYA+NGVSH++ +TPLKLAEYF I+E
Sbjct  335  AARPNPQGSYHYGSINITRTIKLFNSATKVDGKLRYAINGVSHVDPETPLKLAEYFEIAE  394

Query  718  KVFKYNIMGDT-PPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
            KVFKY+++ D  P E A  VT+APNVVNATFRNF+EI+FENHEK++Q++HLDG+SFFAVA
Sbjct  395  KVFKYDMISDEGPTEGATAVTIAPNVVNATFRNFIEIIFENHEKSLQSWHLDGYSFFAVA  454

Query  895  IE  900
             E
Sbjct  455  DE  456



>gb|KHG25743.1| L-ascorbate oxidase [Gossypium arboreum]
Length=538

 Score =   421 bits (1081),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 198/388 (51%), Positives = 271/388 (70%), Gaps = 14/388 (4%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F + + DW+   HKTL++ LDSG+++  PDGV+ING+           FT + GKTY +R
Sbjct  162   FTLLVGDWFKANHKTLQQSLDSGKSMPFPDGVLINGQ-------TQATFTGDQGKTYMFR  214

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
               NVG+ TS+NFR QGH M LVE+EGSH IQN YDSLD+HVGQ +++LVT D+ PK+YY+
Sbjct  215   FSNVGLSTSLNFRIQGHKMKLVEVEGSHVIQNLYDSLDVHVGQSITILVTLDQPPKNYYI  274

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   +  A + YAN N   + P    P      G  WS+ Q R++RWNLT++A
Sbjct  275   VASTRFTKTVLTATAALHYANSNAPVSGPVPAAP----ANGFDWSMEQARTYRWNLTSNA  330

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGS+HYG I  T+TI L NS   ++GKLRYA+NGVS+IN DTPLKLA+YF I   
Sbjct  331   ARPNPQGSFHYGTITPTKTIVLANSAPLINGKLRYAVNGVSYINPDTPLKLADYFNI-PG  389

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VF  N + + P  +    TLA +V+  +  +F+E+VF+N+E T+Q +HLDG+ F+ V   
Sbjct  390   VFSTNSLSELP--SGRAATLATSVMATSLHDFIEVVFQNNENTMQAWHLDGYDFWVVGFG  447

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
             +G+W+P+KRK+YNLVDA++RH+ QVYPNSW A++ ++DN GMWN+RS +W+R YLGQQ Y
Sbjct  448   SGQWTPDKRKSYNLVDALTRHTTQVYPNSWTAILVSLDNQGMWNVRSTLWDRQYLGQQFY  507

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKG  1164
               V +P RSL +E+++P    LCG   G
Sbjct  508   LRVWNPVRSLANEYDIPSNVLLCGQAVG  535



>ref|XP_007047152.1| SKU5 similar 17 isoform 1 [Theobroma cacao]
 gb|EOX91309.1| SKU5 similar 17 isoform 1 [Theobroma cacao]
Length=538

 Score =   419 bits (1077),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 198/388 (51%), Positives = 271/388 (70%), Gaps = 14/388 (4%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F + I DWY   HKTL++ LDSG+++  PDGV+ING+           F+ E GKTY +R
Sbjct  162   FTLLIGDWYKTSHKTLQQTLDSGKSLPFPDGVLINGQ-------TQTTFSGEQGKTYMFR  214

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             + NVG+ TS+NFR QGHTM LVE+EGSH IQN YDSLD+HVGQ ++VLVT ++ PKDYY+
Sbjct  215   ISNVGLSTSLNFRIQGHTMKLVEVEGSHVIQNLYDSLDVHVGQSVTVLVTLNQPPKDYYI  274

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   +  A++ Y N     + P    P  +      WS+ Q R++RWNLT++A
Sbjct  275   VASTRFTKTVLTATAVLHYTNSQTPVSGPLPAAPAYQ----YHWSMQQARTYRWNLTSNA  330

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGS+HYG+I  T+TI L NS S ++GKLRY +NGVS +N DTPLKLA+YF I   
Sbjct  331   ARPNPQGSFHYGKITTTKTIVLANSGSLINGKLRYTVNGVSFVNPDTPLKLADYFNI-PG  389

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VF  + + D P   A   T+A +VV  +  +F+E+VF+N+E T+Q++HLDG+ F+ V   
Sbjct  390   VFSMSSIQDLPSGGA--ATVATSVVPTSLHDFIEVVFQNNENTMQSWHLDGYDFWVVGFG  447

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
             +G+W+P+KR+ YNL+DA++RH+ QVYPNSW A++ ++DN GMWN+RS MWER YLGQQ Y
Sbjct  448   SGQWAPKKRRTYNLIDALTRHTTQVYPNSWTAILVSLDNQGMWNMRSAMWERQYLGQQFY  507

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKG  1164
               V +P RS  +E+++P    LCG   G
Sbjct  508   LRVWTPVRSFANEYDIPSNVLLCGKAVG  535



>ref|XP_011088669.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=538

 Score =   419 bits (1076),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 208/388 (54%), Positives = 261/388 (67%), Gaps = 11/388 (3%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F + I DWY   H  LK ILD G+ +A PDG++ING+     G     FT+E GKTYR R
Sbjct  159   FTLLIGDWYKTNHNVLKSILDQGKMLAFPDGILINGR-----GNNSAWFTVEPGKTYRLR  213

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             + NVG+R S+NFR QGH M LVE+EG+HT+Q    SLD+HVGQ  SVLVTAD+  +DYY+
Sbjct  214   ISNVGLRDSLNFRIQGHEMKLVEVEGTHTVQTTVSSLDVHVGQSCSVLVTADQPAQDYYI  273

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
              VS+RF  Q  +T A++ Y+N    +  P    PPP  T  I WS+NQ RS R NLTAS 
Sbjct  274   AVSTRFTDQVLTTTAVLHYSN----SRKPVSGPPPPGPTTDIQWSLNQARSIRTNLTASG  329

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
              RPNPQGSYHYGQIN++RTI+L N    V+GK RYA+NGVS ++ DTPLKLA+Y+ IS  
Sbjct  330   PRPNPQGSYHYGQINVSRTIRLANLPGIVNGKQRYAVNGVSFVHADTPLKLADYYNIS-G  388

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VF+   + D PP     + L  +V+ A +R FVEIVFEN E   Q++HLDG+SFF V ++
Sbjct  389   VFRVGSISDYPPR-GRGIRLDTSVMGADYRAFVEIVFENRENITQSWHLDGYSFFVVGMD  447

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              G W+P  RK YNLVDA+SR + QVYP SW A+   +DN GMWNLRS+ W R YLGQQ Y
Sbjct  448   GGSWTPSSRKQYNLVDAISRSTTQVYPKSWTAIYVALDNVGMWNLRSEYWARQYLGQQFY  507

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKG  1164
               V +P RS RDE+ +P    LCG   G
Sbjct  508   LRVYTPVRSFRDEYAIPQNALLCGRADG  535



>ref|XP_007155969.1| hypothetical protein PHAVU_003G247700g [Phaseolus vulgaris]
 gb|ESW27963.1| hypothetical protein PHAVU_003G247700g [Phaseolus vulgaris]
Length=543

 Score =   417 bits (1073),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 199/389 (51%), Positives = 272/389 (70%), Gaps = 15/389 (4%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGK-HGKVGGKIDPLFTMEAGKTYRY  177
             F + I DWY   HK+L++ LDSG ++A PDG++ING+ H  V G        + GKTY +
Sbjct  164   FTLLIGDWYKTNHKSLRESLDSGNSLAFPDGLLINGQAHTTVNG--------DQGKTYMF  215

Query  178   RVCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYY  357
             R+ NVGM TS+NFR QGHT+ LVE+EGSHT+QN YD+LD+HVGQ  +VLVT ++ PKDYY
Sbjct  216   RISNVGMSTSINFRIQGHTLKLVEIEGSHTLQNVYDTLDVHVGQSATVLVTLNQPPKDYY  275

Query  358   LVVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTAS  537
             +V S+RF ++ F+  A++ Y+N N    SP     P        WS+ Q R++RWNLTA+
Sbjct  276   IVASTRFSRKMFTATAVLHYSNSN----SPASGPLPSPPIHQYHWSVKQARTYRWNLTAN  331

Query  538   AARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISE  717
             AARPNPQGSYHYG+I  T+TI L NS S ++GKLRY +N VS++N DTPLKLA+YF I  
Sbjct  332   AARPNPQGSYHYGEITPTKTIVLSNSASLINGKLRYTVNKVSYVNPDTPLKLADYFNI-P  390

Query  718   KVFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAI  897
              ++  + +   P +N    ++A +VV     +F+E+VF+N+E T Q++HLDG+ F+ V  
Sbjct  391   GIYSVDSLQSLPSDNTPS-SVATSVVPTDLHDFIEVVFQNNENTTQSWHLDGYDFWVVGY  449

Query  898   EAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
               G W+P KR+ YNLVDA++RH+ QVYPN+W  ++ ++DN GMWNLRS MWER YLGQQL
Sbjct  450   GFGEWTPAKRRTYNLVDALTRHTAQVYPNAWTGILVSLDNQGMWNLRSAMWERQYLGQQL  509

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKG  1164
             Y  V + ERSL +E+++PD   LCG   G
Sbjct  510   YLRVWTSERSLANEYDIPDNVLLCGKAVG  538



>ref|XP_009397777.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=541

 Score =   416 bits (1069),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 206/395 (52%), Positives = 266/395 (67%), Gaps = 16/395 (4%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F + I DWY   H TLK +LDSGR +A PDGV+ING+     G     FT++ G+TYR+R
Sbjct  160   FTLLIGDWYKANHSTLKYVLDSGRDLAFPDGVLINGR-----GSYGNTFTVDQGRTYRFR  214

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             +CNVG+ TS+N R QGHTM LVE+EGSHT+QN Y SLD+H+ QC SVLVTAD+   DY++
Sbjct  215   ICNVGLATSLNIRIQGHTMKLVEVEGSHTLQNIYSSLDVHLAQCYSVLVTADQPALDYFI  274

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             VVS+RF     +T AI+ Y+N  G T       P    T  I WS+NQ RS RWNLTAS 
Sbjct  275   VVSTRFTSSVLTTTAILHYSNSAGRTVGAPPGGP----TIQIDWSLNQARSIRWNLTASG  330

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
              RPNPQGSYHYG +N TRTI+L NS   ++GK RYA+N VS I  DTPLK+A+++ I   
Sbjct  331   PRPNPQGSYHYGLVNTTRTIRLANSAPVINGKQRYAVNSVSFIPADTPLKVADFYKIPGV  390

Query  721   VFKYNIMGDTPPENAE--KVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVA  894
             VF  +I     P+N       L  +V+ A FR++VEIVFEN+E T+Q++H+DG+SF+ V 
Sbjct  391   VFLGSI-----PDNPTFGGGYLQTSVMAANFRDYVEIVFENYENTMQSWHIDGYSFWTVG  445

Query  895   IEAGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQ  1074
             ++ G+WS   RKNYNL DAV+R ++QV+P SW+A+   +DN GMWN+RS+ W R YLGQQ
Sbjct  446   MDGGQWSAASRKNYNLRDAVARCTVQVFPKSWSAIYMPLDNVGMWNIRSEHWARQYLGQQ  505

Query  1075  LYFSVLSPERSLRDEHNLPDKQQLCGLVKGMSMPP  1179
              Y  V SP  S RDE+ +P    LCG   G    P
Sbjct  506   FYLRVYSPANSWRDENPIPRNALLCGRASGRRTRP  540



>ref|XP_006364519.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=541

 Score =   416 bits (1069),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 210/388 (54%), Positives = 259/388 (67%), Gaps = 12/388 (3%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F + I DWY   HK L+ ILD G+ +  PDG+ ING  G+ G K    FT+E GKTYR R
Sbjct  166   FTILIGDWYKTDHKVLQTILDRGKRLTFPDGIQINGL-GRDGAK----FTVEPGKTYRLR  220

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             + NVG++ S+NFR QGH MTLVE+EG+HTIQ    SLD+HVGQ  SVLVTAD+  +DYY+
Sbjct  221   ISNVGLQNSLNFRIQGHKMTLVEVEGTHTIQTTLSSLDVHVGQSYSVLVTADQPAQDYYI  280

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
              VSSRF  Q  ++ AI+ Y+N     +    P P    T  I+WS+NQ RS R NLTAS 
Sbjct  281   AVSSRFTTQILNSTAILHYSNSRKTVSGLPPPGP----TTDISWSLNQARSIRTNLTASG  336

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
              RPNPQGSYHYGQIN+TRTI+L N    VD K RYA+NGVS I  DTPLKLA+Y+ I + 
Sbjct  337   PRPNPQGSYHYGQINVTRTIRLANHAGLVDKKQRYAVNGVSFIPADTPLKLADYYNI-DG  395

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VFK   + D P     K+ L   V+ A +R FVEIVFEN E  +Q++HLDG+SFF V ++
Sbjct  396   VFKVGSIQDKP--AGRKIHLDTAVMGADYRAFVEIVFENRENIVQSWHLDGYSFFVVGMD  453

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLY  1080
              GRWSP  +  YNL+DAVSR + QVYP SW A+   +DN GMWNLRS  W R YLGQQ Y
Sbjct  454   VGRWSPASKNQYNLIDAVSRCTTQVYPRSWTAIYVPLDNVGMWNLRSQFWARQYLGQQFY  513

Query  1081  FSVLSPERSLRDEHNLPDKQQLCGLVKG  1164
               V +P +S RDE+ +P     CG  KG
Sbjct  514   LRVYTPVKSFRDEYPIPKNALHCGRAKG  541



>gb|ABR18324.1| unknown [Picea sitchensis]
Length=542

 Score =   415 bits (1066),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 205/391 (52%), Positives = 266/391 (68%), Gaps = 12/391 (3%)
 Frame = +1

Query  7     VFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYRVC  186
             + I DWY   H  L++ LD GR++ +PD VVING+    G  I    T++ GKTYR R+ 
Sbjct  163   LLIGDWYKANHTILRRTLDMGRSLGKPDAVVINGRGPASGATI----TVDQGKTYRLRIS  218

Query  187   NVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYLVV  366
             NVG+ +S+NFR QGH + LVE+EGSHT+QN YDSLD+HVGQ  SVLVT D+  +DYY+V 
Sbjct  219   NVGLSSSLNFRIQGHKLKLVEVEGSHTVQNVYDSLDIHVGQTYSVLVTTDQPSQDYYMVA  278

Query  367   SSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASAAR  546
             S+RF     + +A   Y+N    +        P   TE I WS+NQ RS RWNLTASAAR
Sbjct  279   STRFTSPVLTGLATFHYSN----SQKKVSGPIPGAPTE-IVWSLNQARSVRWNLTASAAR  333

Query  547   PNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEKVF  726
             PNPQGSYHYG I ITRTIKL NS  +++GK RYA+NGVS++ + TPL+LA+Y+ IS  VF
Sbjct  334   PNPQGSYHYGNITITRTIKLANSAPFINGKQRYAVNGVSYLPSATPLQLADYYNIS-GVF  392

Query  727   KYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIEAG  906
                 + D+P   +  +  A   ++  +R F+E+VF+N+E TIQ++HLDG+SFF V ++ G
Sbjct  393   TAGGIPDSPRGGSGYLQTA--ALSVEYRAFIEVVFQNYESTIQSWHLDGYSFFVVGMDGG  450

Query  907   RWSPEKRKNYNLVDAVSRHSIQVYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQLYFS  1086
              W+P  RK YNL DAVSR + QVYPNSW AV+ T DNAG+WNLRS  WER +LGQQ Y  
Sbjct  451   DWTPANRKGYNLFDAVSRCTTQVYPNSWTAVLLTFDNAGLWNLRSQTWERQFLGQQTYVR  510

Query  1087  VLSPERSLRDEHNLPDKQQLCGLVKGMSMPP  1179
             V SP +SLRDE+++P    LCG   G    P
Sbjct  511   VKSPVKSLRDEYDIPHNALLCGKAVGRPRLP  541



>ref|XP_007047153.1| SKU5 similar 17 isoform 2 [Theobroma cacao]
 gb|EOX91310.1| SKU5 similar 17 isoform 2 [Theobroma cacao]
Length=539

 Score =   414 bits (1065),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 198/389 (51%), Positives = 271/389 (70%), Gaps = 15/389 (4%)
 Frame = +1

Query  1     FNVFISDWYNKGHKTLKKILDSGRTIARPDGVVINGKHGKVGGKIDPLFTMEAGKTYRYR  180
             F + I DWY   HKTL++ LDSG+++  PDGV+ING+           F+ E GKTY +R
Sbjct  162   FTLLIGDWYKTSHKTLQQTLDSGKSLPFPDGVLINGQ-------TQTTFSGEQGKTYMFR  214

Query  181   VCNVGMRTSVNFRFQGHTMTLVEMEGSHTIQNAYDSLDLHVGQCLSVLVTADKEPKDYYL  360
             + NVG+ TS+NFR QGHTM LVE+EGSH IQN YDSLD+HVGQ ++VLVT ++ PKDYY+
Sbjct  215   ISNVGLSTSLNFRIQGHTMKLVEVEGSHVIQNLYDSLDVHVGQSVTVLVTLNQPPKDYYI  274

Query  361   VVSSRFFKQEFSTVAIISYANGNGITASpelplpppeNTEGIAWSINQFRSFRWNLTASA  540
             V S+RF K   +  A++ Y N     + P    P  +      WS+ Q R++RWNLT++A
Sbjct  275   VASTRFTKTVLTATAVLHYTNSQTPVSGPLPAAPAYQ----YHWSMQQARTYRWNLTSNA  330

Query  541   ARPNPQGSYHYGQINITRTIKLVNSKSYVDGKLRYALNGVSHINTDTPLKLAEYFGISEK  720
             ARPNPQGS+HYG+I  T+TI L NS S ++GKLRY +NGVS +N DTPLKLA+YF I   
Sbjct  331   ARPNPQGSFHYGKITTTKTIVLANSGSLINGKLRYTVNGVSFVNPDTPLKLADYFNI-PG  389

Query  721   VFKYNIMGDTPPENAEKVTLAPNVVNATFRNFVEIVFENHEKTIQTYHLDGHSFFAVAIE  900
             VF  + + D P   A   T+A +VV  +  +F+E+VF+N+E T+Q++HLDG+ F+ V   
Sbjct  390   VFSMSSIQDLPSGGA--ATVATSVVPTSLHDFIEVVFQNNENTMQSWHLDGYDFWVVGFG  447

Query  901   AGRWSPEKRKNYNLVDAVSRHSIQ-VYPNSWAAVMTTMDNAGMWNLRSDMWERAYLGQQL  1077
             +G+W+P+KR+ YNL+DA++RH+ Q VYPNSW A++ ++DN GMWN+RS MWER YLGQQ 
Sbjct  448   SGQWAPKKRRTYNLIDALTRHTTQVVYPNSWTAILVSLDNQGMWNMRSAMWERQYLGQQF  507

Query  1078  YFSVLSPERSLRDEHNLPDKQQLCGLVKG  1164
             Y  V +P RS  +E+++P    LCG   G
Sbjct  508   YLRVWTPVRSFANEYDIPSNVLLCGKAVG  536



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3816303783714