BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25630_g3_i1 len=349 path=[4702:0-113 4815:114-116 4818:117-175
8547:176-178 7032:179-205 1269:206-288 @1352@!:289-348]

Length=349
                                                                      Score     E

gb|KGN54013.1|  hypothetical protein Csa_4G267480                       114   3e-27   
ref|XP_009411781.1|  PREDICTED: L-ascorbate oxidase homolog             114   5e-27   
ref|XP_004149637.1|  PREDICTED: L-ascorbate oxidase homolog             114   5e-27   
ref|XP_004164925.1|  PREDICTED: L-ascorbate oxidase homolog             114   5e-27   
gb|KGN63948.1|  hypothetical protein Csa_1G031720                       112   8e-27   
ref|XP_008438536.1|  PREDICTED: L-ascorbate oxidase homolog             112   1e-26   
ref|XP_004165665.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    112   1e-26   
ref|XP_004137383.1|  PREDICTED: L-ascorbate oxidase homolog             112   1e-26   
ref|XP_004164922.1|  PREDICTED: L-ascorbate oxidase homolog             112   2e-26   
ref|XP_004149634.1|  PREDICTED: L-ascorbate oxidase homolog             112   3e-26   
ref|XP_010044914.1|  PREDICTED: L-ascorbate oxidase homolog             112   3e-26   
gb|EPS72881.1|  pollen-specific protein                                 111   4e-26   
gb|KHN44494.1|  L-ascorbate oxidase like                                110   1e-25   
ref|XP_003538519.1|  PREDICTED: L-ascorbate oxidase homolog             110   1e-25   
gb|KGN54009.1|  hypothetical protein Csa_4G267440                       107   1e-25   
gb|KGN48499.1|  hypothetical protein Csa_6G490140                       108   2e-25   
ref|XP_004141928.1|  PREDICTED: L-ascorbate oxidase homolog             109   2e-25   
dbj|BAK05994.1|  predicted protein                                      109   2e-25   
gb|KGN54014.1|  hypothetical protein Csa_4G267980                       105   2e-25   
ref|XP_008440238.1|  PREDICTED: L-ascorbate oxidase homolog             109   2e-25   
ref|XP_007208285.1|  hypothetical protein PRUPE_ppa003733mg             108   3e-25   
ref|XP_008449954.1|  PREDICTED: L-ascorbate oxidase homolog             107   5e-25   
ref|XP_007163844.1|  hypothetical protein PHAVU_001G269100g             107   8e-25   
ref|XP_006850531.1|  hypothetical protein AMTR_s00159p00040990          107   1e-24   
ref|NP_001058771.1|  Os07g0119400                                       107   2e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002522339.1|  multicopper oxidase, putative                      106   2e-24   Ricinus communis
ref|XP_004511977.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    106   2e-24   
emb|CDX89588.1|  BnaC04g36070D                                          103   2e-24   
gb|EYU39394.1|  hypothetical protein MIMGU_mgv11b015886mg               106   3e-24   
ref|XP_004511976.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    106   3e-24   
ref|XP_003557661.2|  PREDICTED: L-ascorbate oxidase homolog             106   4e-24   
ref|XP_010263764.1|  PREDICTED: L-ascorbate oxidase homolog             105   6e-24   
emb|CDP07321.1|  unnamed protein product                                105   7e-24   
ref|XP_010070498.1|  PREDICTED: L-ascorbate oxidase homolog             105   7e-24   
ref|XP_004300548.1|  PREDICTED: L-ascorbate oxidase homolog             105   8e-24   
ref|XP_009347241.1|  PREDICTED: L-ascorbate oxidase homolog             104   1e-23   
ref|XP_009348086.1|  PREDICTED: L-ascorbate oxidase homolog             104   1e-23   
ref|XP_006411628.1|  hypothetical protein EUTSA_v10024832mg             104   1e-23   
ref|XP_004301852.1|  PREDICTED: L-ascorbate oxidase homolog             104   1e-23   
gb|ABK25092.1|  unknown                                                 104   1e-23   Picea sitchensis
gb|EMS52588.1|  L-ascorbate oxidase-like protein                        105   2e-23   
gb|KDP31875.1|  hypothetical protein JCGZ_12336                         104   2e-23   
ref|XP_010680450.1|  PREDICTED: L-ascorbate oxidase homolog             104   2e-23   
ref|XP_004250092.1|  PREDICTED: L-ascorbate oxidase homolog             104   2e-23   
ref|XP_006338228.1|  PREDICTED: L-ascorbate oxidase homolog             103   2e-23   
ref|XP_009140476.1|  PREDICTED: L-ascorbate oxidase homolog             103   2e-23   
ref|XP_009407426.1|  PREDICTED: L-ascorbate oxidase homolog             103   2e-23   
ref|XP_008241557.1|  PREDICTED: L-ascorbate oxidase homolog             103   3e-23   
ref|XP_009600428.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    103   3e-23   
ref|XP_007204826.1|  hypothetical protein PRUPE_ppa003926mg             103   3e-23   
ref|XP_009594576.1|  PREDICTED: L-ascorbate oxidase homolog             103   3e-23   
ref|XP_010088984.1|  L-ascorbate oxidase-like protein                   103   3e-23   
gb|ABR18324.1|  unknown                                                 103   3e-23   Picea sitchensis
ref|XP_009777142.1|  PREDICTED: L-ascorbate oxidase homolog             103   4e-23   
ref|XP_009600426.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    103   4e-23   
ref|XP_009366415.1|  PREDICTED: L-ascorbate oxidase homolog             102   5e-23   
ref|XP_009348089.1|  PREDICTED: L-ascorbate oxidase homolog             102   5e-23   
ref|XP_008445302.1|  PREDICTED: L-ascorbate oxidase homolog             102   5e-23   
ref|XP_004142986.1|  PREDICTED: L-ascorbate oxidase homolog             102   5e-23   
ref|XP_006445540.1|  hypothetical protein CICLE_v10018007mg             102   6e-23   
ref|NP_001151662.1|  L-ascorbate oxidase precursor                      102   7e-23   Zea mays [maize]
emb|CDY54804.1|  BnaA06g40970D                                          102   7e-23   
emb|CDP18567.1|  unnamed protein product                                102   7e-23   
emb|CAA65634.1|  PS60                                                   102   8e-23   Nicotiana tabacum [American tobacco]
ref|XP_009623446.1|  PREDICTED: L-ascorbate oxidase homolog             102   8e-23   
ref|XP_004955371.1|  PREDICTED: L-ascorbate oxidase homolog             102   9e-23   
ref|XP_009785141.1|  PREDICTED: L-ascorbate oxidase homolog             102   9e-23   
ref|XP_010255119.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    102   1e-22   
dbj|BAK04971.1|  predicted protein                                      102   1e-22   
ref|XP_008338225.1|  PREDICTED: L-ascorbate oxidase homolog             102   1e-22   
ref|XP_006353286.1|  PREDICTED: L-ascorbate oxidase homolog             102   1e-22   
gb|KHG04142.1|  L-ascorbate oxidase                                     102   1e-22   
ref|XP_010255117.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    102   1e-22   
gb|KFK44289.1|  hypothetical protein AALP_AA1G238900                  97.4    1e-22   
ref|XP_009347247.1|  PREDICTED: L-ascorbate oxidase homolog             102   1e-22   
ref|XP_006393891.1|  hypothetical protein EUTSA_v10003952mg             101   1e-22   
ref|XP_006393890.1|  hypothetical protein EUTSA_v10003952mg             101   1e-22   
ref|XP_002866726.1|  predicted protein                                  101   1e-22   
gb|KDP31876.1|  hypothetical protein JCGZ_12337                         101   1e-22   
ref|XP_004233429.1|  PREDICTED: L-ascorbate oxidase homolog             101   1e-22   
gb|KDO79340.1|  hypothetical protein CISIN_1g0092422mg                  100   1e-22   
ref|XP_004232058.1|  PREDICTED: L-ascorbate oxidase homolog             101   2e-22   
ref|XP_009376274.1|  PREDICTED: L-ascorbate oxidase homolog             101   2e-22   
ref|XP_010278638.1|  PREDICTED: L-ascorbate oxidase homolog             101   2e-22   
ref|XP_002459273.1|  hypothetical protein SORBIDRAFT_02g001610        99.4    2e-22   Sorghum bicolor [broomcorn]
ref|XP_002866796.1|  hypothetical protein ARALYDRAFT_490604             101   2e-22   
ref|XP_008241558.1|  PREDICTED: L-ascorbate oxidase homolog             101   2e-22   
emb|CDY12788.1|  BnaC07g16450D                                          101   2e-22   
ref|XP_007203632.1|  hypothetical protein PRUPE_ppa003976mg             101   2e-22   
emb|CDY31468.1|  BnaC05g15770D                                          101   2e-22   
ref|XP_008374029.1|  PREDICTED: L-ascorbate oxidase homolog             101   2e-22   
gb|AGE09595.1|  SKU5-like protein                                       100   2e-22   
ref|XP_002270831.1|  PREDICTED: L-ascorbate oxidase homolog             101   2e-22   Vitis vinifera
dbj|BAB08634.1|  pectinesterase like protein                            101   2e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61328.1|  pectinesterase-like protein                             101   2e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AFW82336.1|  hypothetical protein ZEAMMB73_082637                  95.1    2e-22   
ref|XP_010680456.1|  PREDICTED: L-ascorbate oxidase homolog             101   2e-22   
ref|NP_569041.1|  protein SKU5 similar 17                               101   2e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CBI18560.3|  unnamed protein product                                100   2e-22   
emb|CDY01453.1|  BnaA07g12260D                                          101   2e-22   
gb|ACN34077.1|  unknown                                                 101   2e-22   Zea mays [maize]
ref|XP_009412658.1|  PREDICTED: L-ascorbate oxidase homolog             100   2e-22   
ref|XP_009115829.1|  PREDICTED: L-ascorbate oxidase homolog             100   2e-22   
ref|XP_009103469.1|  PREDICTED: L-ascorbate oxidase homolog             100   2e-22   
ref|XP_006345828.1|  PREDICTED: L-ascorbate oxidase homolog             101   2e-22   
emb|CDY43557.1|  BnaC02g16540D                                          100   2e-22   
ref|XP_008792598.1|  PREDICTED: L-ascorbate oxidase homolog             100   3e-22   
ref|XP_009101945.1|  PREDICTED: L-ascorbate oxidase homolog             100   3e-22   
ref|XP_006283464.1|  hypothetical protein CARUB_v10004509mg             100   3e-22   
emb|CAB37498.1|  putative pectinesterase                                100   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011099705.1|  PREDICTED: L-ascorbate oxidase homolog             100   3e-22   
ref|XP_003537368.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    100   3e-22   
gb|KHN42054.1|  L-ascorbate oxidase like                                100   3e-22   
ref|XP_006838146.1|  hypothetical protein AMTR_s00106p00093220          100   3e-22   
ref|NP_195555.2|  protein SKU5 similar 9                                100   3e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CAB08077.1|  pectinesterase                                         100   3e-22   Solanum lycopersicum
ref|XP_006280268.1|  hypothetical protein CARUB_v10026189mg             100   3e-22   
ref|XP_006425823.1|  hypothetical protein CICLE_v10025326mg             100   3e-22   
gb|EYU38005.1|  hypothetical protein MIMGU_mgv1a004001mg                100   3e-22   
ref|XP_010464737.1|  PREDICTED: L-ascorbate oxidase homolog             100   4e-22   
ref|XP_006416260.1|  hypothetical protein EUTSA_v10007292mg             100   4e-22   
gb|EMT24760.1|  L-ascorbate oxidase-like protein                        100   4e-22   
ref|XP_007156841.1|  hypothetical protein PHAVU_002G021900g             100   4e-22   
ref|XP_006657750.1|  PREDICTED: L-ascorbate oxidase homolog             100   4e-22   
ref|XP_010539810.1|  PREDICTED: L-ascorbate oxidase homolog             100   4e-22   
ref|XP_008457817.1|  PREDICTED: L-ascorbate oxidase homolog             100   4e-22   
emb|CDY64276.1|  BnaCnng43630D                                          100   4e-22   
ref|XP_010263761.1|  PREDICTED: L-ascorbate oxidase homolog             100   5e-22   
ref|XP_010484570.1|  PREDICTED: L-ascorbate oxidase homolog             100   5e-22   
ref|XP_010444713.1|  PREDICTED: L-ascorbate oxidase homolog             100   5e-22   
ref|XP_010028301.1|  PREDICTED: L-ascorbate oxidase homolog             100   5e-22   
gb|KCW55012.1|  hypothetical protein EUGRSUZ_I00988                     100   6e-22   
gb|EYU39285.1|  hypothetical protein MIMGU_mgv1a026945mg                100   6e-22   
ref|XP_006342102.1|  PREDICTED: L-ascorbate oxidase homolog           99.8    6e-22   
ref|XP_006390228.1|  hypothetical protein EUTSA_v10018373mg           99.8    7e-22   
emb|CAN72539.1|  hypothetical protein VITISV_028750                   99.4    7e-22   Vitis vinifera
ref|XP_010436936.1|  PREDICTED: L-ascorbate oxidase homolog           99.8    7e-22   
emb|CAH67167.1|  H0211B05.4                                           99.8    7e-22   Oryza sativa [red rice]
ref|NP_001053555.1|  Os04g0561900                                     99.8    7e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006466655.1|  PREDICTED: L-ascorbate oxidase homolog           99.8    7e-22   
ref|XP_004238406.1|  PREDICTED: L-ascorbate oxidase homolog           99.8    7e-22   
ref|XP_010431777.1|  PREDICTED: L-ascorbate oxidase homolog           99.8    7e-22   
ref|XP_010558427.1|  PREDICTED: L-ascorbate oxidase homolog           99.8    7e-22   
gb|KDO79346.1|  hypothetical protein CISIN_1g009171mg                 99.8    7e-22   
ref|XP_007155969.1|  hypothetical protein PHAVU_003G247700g           99.8    8e-22   
ref|XP_009149524.1|  PREDICTED: L-ascorbate oxidase homolog           99.8    8e-22   
ref|XP_006425822.1|  hypothetical protein CICLE_v10027285mg           99.8    8e-22   
ref|XP_002268020.2|  PREDICTED: L-ascorbate oxidase homolog           99.4    9e-22   Vitis vinifera
emb|CDY18626.1|  BnaA09g07690D                                        99.4    1e-21   
ref|XP_009112343.1|  PREDICTED: L-ascorbate oxidase homolog           99.4    1e-21   
ref|XP_009339220.1|  PREDICTED: L-ascorbate oxidase homolog           99.4    1e-21   
ref|XP_009794442.1|  PREDICTED: L-ascorbate oxidase homolog           99.4    1e-21   
emb|CDX81353.1|  BnaC09g07640D                                        99.4    1e-21   
ref|XP_003550444.1|  PREDICTED: L-ascorbate oxidase homolog           99.4    1e-21   
gb|KGN62015.1|  hypothetical protein Csa_2G286480                     98.6    1e-21   
ref|XP_006416404.1|  hypothetical protein EUTSA_v10007361mg           99.0    1e-21   
emb|CBI18561.3|  unnamed protein product                              99.4    1e-21   
ref|XP_010498473.1|  PREDICTED: L-ascorbate oxidase homolog           99.0    1e-21   
ref|XP_010459724.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  99.0    1e-21   
ref|XP_004291312.1|  PREDICTED: L-ascorbate oxidase homolog           99.0    1e-21   
gb|EMS54595.1|  L-ascorbate oxidase-like protein                      99.0    1e-21   
ref|XP_010459725.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  99.0    1e-21   
ref|XP_009766183.1|  PREDICTED: L-ascorbate oxidase homolog           99.0    1e-21   
tpg|DAA62868.1|  TPA: hypothetical protein ZEAMMB73_701617            95.9    1e-21   
gb|EEC82126.1|  hypothetical protein OsI_26158                        99.0    2e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_010547509.1|  PREDICTED: L-ascorbate oxidase homolog           99.0    2e-21   
tpg|DAA62867.1|  TPA: hypothetical protein ZEAMMB73_701617            95.5    2e-21   
gb|ACL53812.1|  unknown                                               99.0    2e-21   Zea mays [maize]
dbj|BAC83966.1|  putative PS60                                        99.0    2e-21   Oryza sativa Japonica Group [Japonica rice]
gb|EEE67250.1|  hypothetical protein OsJ_24405                        98.6    2e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006657409.1|  PREDICTED: L-ascorbate oxidase homolog           98.6    2e-21   
ref|XP_009596487.1|  PREDICTED: L-ascorbate oxidase homolog           98.6    2e-21   
gb|EYU32815.1|  hypothetical protein MIMGU_mgv1a003910mg              98.6    2e-21   
ref|XP_004243477.1|  PREDICTED: L-ascorbate oxidase homolog           98.6    2e-21   
gb|KEH20500.1|  multi-copper oxidase-like protein                     98.6    2e-21   
ref|XP_010028303.1|  PREDICTED: L-ascorbate oxidase homolog           98.6    2e-21   
ref|XP_011039228.1|  PREDICTED: L-ascorbate oxidase homolog           98.6    2e-21   
ref|XP_011013814.1|  PREDICTED: L-ascorbate oxidase homolog           98.2    2e-21   
ref|XP_002310162.1|  multi-copper oxidase type 1 family protein       98.2    2e-21   Populus trichocarpa [western balsam poplar]
ref|XP_004148037.1|  PREDICTED: L-ascorbate oxidase homolog           98.6    2e-21   
ref|XP_002460757.1|  hypothetical protein SORBIDRAFT_02g034420        98.6    2e-21   Sorghum bicolor [broomcorn]
ref|XP_008452926.1|  PREDICTED: L-ascorbate oxidase homolog           98.2    2e-21   
ref|XP_007208287.1|  hypothetical protein PRUPE_ppa003715mg           98.2    2e-21   
ref|XP_008219681.1|  PREDICTED: L-ascorbate oxidase homolog           98.2    2e-21   
ref|NP_173604.1|  SKU5 similar 7 protein                              98.2    2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002522337.1|  multicopper oxidase, putative                    98.2    3e-21   Ricinus communis
gb|KFK28370.1|  hypothetical protein AALP_AA8G506600                  98.2    3e-21   
ref|NP_001152000.1|  L-ascorbate oxidase precursor                    98.2    3e-21   Zea mays [maize]
ref|XP_006367595.1|  PREDICTED: L-ascorbate oxidase homolog           98.2    3e-21   
ref|XP_004287955.1|  PREDICTED: L-ascorbate oxidase homolog           97.8    3e-21   
ref|XP_002510630.1|  multicopper oxidase, putative                    97.8    3e-21   Ricinus communis
ref|XP_006390229.1|  hypothetical protein EUTSA_v10018373mg           97.8    4e-21   
ref|XP_006360232.1|  PREDICTED: L-ascorbate oxidase homolog           97.8    4e-21   
ref|XP_004157080.1|  PREDICTED: L-ascorbate oxidase homolog           97.8    4e-21   
ref|XP_010428667.1|  PREDICTED: L-ascorbate oxidase homolog           97.8    4e-21   
ref|XP_004145593.1|  PREDICTED: L-ascorbate oxidase homolog           97.8    4e-21   
ref|XP_010673838.1|  PREDICTED: L-ascorbate oxidase homolog           97.8    4e-21   
gb|KGN55480.1|  hypothetical protein Csa_4G653410                     96.7    4e-21   
ref|XP_006848556.1|  hypothetical protein AMTR_s00169p00049950        97.4    4e-21   
ref|XP_007136137.1|  hypothetical protein PHAVU_009G021000g           97.4    4e-21   
emb|CDP19581.1|  unnamed protein product                              97.4    4e-21   
ref|XP_004957823.1|  PREDICTED: L-ascorbate oxidase homolog           97.4    4e-21   
gb|EYU32814.1|  hypothetical protein MIMGU_mgv1a003925mg              97.4    4e-21   
gb|EMT15848.1|  L-ascorbate oxidase-like protein                      97.4    5e-21   
gb|KEH40258.1|  multi-copper oxidase-like protein                     97.4    5e-21   
gb|KDP36848.1|  hypothetical protein JCGZ_08139                       97.4    5e-21   
ref|XP_008455444.1|  PREDICTED: L-ascorbate oxidase homolog           97.4    5e-21   
gb|AAQ90182.1|  ntp101                                                97.4    5e-21   Nicotiana tabacum [American tobacco]
ref|NP_173603.1|  SKU5 similar 8 protein                              97.4    5e-21   Arabidopsis thaliana [mouse-ear cress]
gb|ABK25324.1|  unknown                                               97.4    5e-21   Picea sitchensis
ref|XP_010908384.1|  PREDICTED: L-ascorbate oxidase homolog           97.4    5e-21   
ref|XP_003563038.1|  PREDICTED: L-ascorbate oxidase homolog           97.4    5e-21   
emb|CDP02461.1|  unnamed protein product                              97.4    5e-21   
ref|XP_010101299.1|  L-ascorbate oxidase-like protein                 97.1    6e-21   
ref|XP_002889063.1|  hypothetical protein ARALYDRAFT_895494           97.1    6e-21   
ref|XP_006302110.1|  hypothetical protein CARUB_v10020107mg           97.1    6e-21   
ref|XP_006596528.1|  PREDICTED: L-ascorbate oxidase homolog           97.1    6e-21   
ref|XP_009591795.1|  PREDICTED: L-ascorbate oxidase homolog           97.4    6e-21   
ref|XP_008377105.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...  97.1    6e-21   
gb|KFK34458.1|  hypothetical protein AALP_AA5G148000                  97.1    6e-21   
ref|XP_007160607.1|  hypothetical protein PHAVU_001G001500g           97.1    6e-21   
ref|XP_008663511.1|  PREDICTED: L-ascorbate oxidase homolog           97.1    6e-21   
emb|CDP02462.1|  unnamed protein product                              97.1    6e-21   
gb|EYU36818.1|  hypothetical protein MIMGU_mgv1a004264mg              97.1    6e-21   
ref|XP_009773470.1|  PREDICTED: L-ascorbate oxidase homolog           97.1    6e-21   
ref|XP_011048128.1|  PREDICTED: L-ascorbate oxidase homolog           97.1    6e-21   
ref|XP_002299087.1|  multi-copper oxidase type 1 family protein       97.1    7e-21   Populus trichocarpa [western balsam poplar]
ref|XP_003517277.1|  PREDICTED: L-ascorbate oxidase homolog           97.1    7e-21   
ref|XP_007213899.1|  hypothetical protein PRUPE_ppa003872mg           96.3    7e-21   
ref|XP_009420229.1|  PREDICTED: L-ascorbate oxidase homolog           97.1    7e-21   
ref|XP_009334388.1|  PREDICTED: L-ascorbate oxidase homolog           97.1    7e-21   
gb|KDP20733.1|  hypothetical protein JCGZ_21204                       97.1    7e-21   
gb|KHN36198.1|  L-ascorbate oxidase like                              97.1    7e-21   
gb|ABI52585.1|  pollen-specific protein                               97.1    7e-21   Camellia sinensis [black tea]
ref|XP_002518462.1|  multicopper oxidase, putative                    97.1    7e-21   Ricinus communis
ref|XP_003524640.1|  PREDICTED: L-ascorbate oxidase homolog           96.7    7e-21   
ref|XP_004506275.1|  PREDICTED: L-ascorbate oxidase homolog           96.7    8e-21   
ref|XP_008384084.1|  PREDICTED: L-ascorbate oxidase homolog           96.7    8e-21   
gb|EPS65321.1|  hypothetical protein M569_09457                       93.2    8e-21   
ref|XP_010555198.1|  PREDICTED: L-ascorbate oxidase homolog           96.7    8e-21   
ref|XP_010686816.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  96.7    8e-21   
ref|XP_009368021.1|  PREDICTED: L-ascorbate oxidase homolog           96.7    8e-21   
ref|XP_004506310.1|  PREDICTED: L-ascorbate oxidase homolog           96.7    8e-21   
ref|XP_008387887.1|  PREDICTED: L-ascorbate oxidase homolog           96.7    8e-21   
ref|XP_008362259.1|  PREDICTED: L-ascorbate oxidase homolog           96.7    8e-21   
ref|XP_011034917.1|  PREDICTED: L-ascorbate oxidase homolog           96.7    9e-21   
ref|XP_004500896.1|  PREDICTED: L-ascorbate oxidase homolog           96.7    1e-20   
gb|KFK44156.1|  hypothetical protein AALP_AA1G222300                  96.7    1e-20   
ref|XP_010536445.1|  PREDICTED: L-ascorbate oxidase homolog           96.7    1e-20   
gb|KHN33820.1|  L-ascorbate oxidase like                              96.7    1e-20   
ref|XP_009397777.1|  PREDICTED: L-ascorbate oxidase homolog           96.7    1e-20   
ref|XP_002269614.1|  PREDICTED: L-ascorbate oxidase homolog           96.3    1e-20   Vitis vinifera
ref|XP_002300669.1|  multi-copper oxidase type 1 family protein       96.3    1e-20   Populus trichocarpa [western balsam poplar]
gb|KDP22727.1|  hypothetical protein JCGZ_01829                       96.3    1e-20   
ref|XP_009418784.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  96.7    1e-20   
ref|XP_010046372.1|  PREDICTED: L-ascorbate oxidase homolog           96.3    1e-20   
ref|XP_003523207.1|  PREDICTED: L-ascorbate oxidase homolog           96.3    1e-20   
ref|XP_008782736.1|  PREDICTED: L-ascorbate oxidase homolog           96.3    1e-20   
ref|XP_003605947.1|  L-ascorbate oxidase-like protein                 96.3    1e-20   
ref|XP_010480557.1|  PREDICTED: L-ascorbate oxidase homolog           96.3    1e-20   
ref|XP_009794440.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  96.3    1e-20   
ref|XP_009418785.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  96.3    1e-20   
ref|XP_007213900.1|  hypothetical protein PRUPE_ppa003872mg           96.3    1e-20   
ref|XP_010922850.1|  PREDICTED: L-ascorbate oxidase homolog           96.3    1e-20   
ref|XP_009597920.1|  PREDICTED: L-ascorbate oxidase homolog           96.3    1e-20   
ref|XP_002307765.1|  multi-copper oxidase type 1 family protein       96.3    1e-20   Populus trichocarpa [western balsam poplar]
ref|XP_008804666.1|  PREDICTED: L-ascorbate oxidase homolog           96.3    1e-20   
ref|XP_011041276.1|  PREDICTED: L-ascorbate oxidase homolog           96.3    1e-20   
ref|XP_007221787.1|  hypothetical protein PRUPE_ppa003860mg           96.3    1e-20   
gb|KDP30646.1|  hypothetical protein JCGZ_16211                       95.1    1e-20   
ref|XP_007017957.1|  SKU5 similar 5 isoform 3                         95.1    1e-20   
ref|XP_010471765.1|  PREDICTED: L-ascorbate oxidase homolog           95.9    1e-20   
ref|XP_010416527.1|  PREDICTED: L-ascorbate oxidase homolog           95.9    1e-20   
ref|XP_010244491.1|  PREDICTED: L-ascorbate oxidase homolog           95.9    1e-20   
ref|XP_002272880.1|  PREDICTED: L-ascorbate oxidase homolog           95.9    2e-20   Vitis vinifera
ref|XP_003527461.1|  PREDICTED: L-ascorbate oxidase homolog           95.9    2e-20   
ref|XP_008789824.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  94.7    2e-20   
ref|XP_007132533.1|  hypothetical protein PHAVU_011G102500g           95.9    2e-20   
ref|XP_003596958.1|  L-ascorbate oxidase-like protein                 95.9    2e-20   
ref|XP_010094026.1|  L-ascorbate oxidase-like protein                 89.4    2e-20   
ref|XP_008221175.1|  PREDICTED: L-ascorbate oxidase homolog           95.9    2e-20   
ref|XP_007017956.1|  SKU5 similar 5 isoform 2                         95.1    2e-20   
ref|XP_010247847.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  95.9    2e-20   
ref|XP_007046384.1|  SKU5 similar 5 isoform 2                         94.7    2e-20   
ref|XP_002301616.1|  hypothetical protein POPTR_0002s21400g           95.5    2e-20   
ref|XP_009359037.1|  PREDICTED: L-ascorbate oxidase homolog           95.5    2e-20   
ref|XP_010247849.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  95.5    2e-20   
emb|CDP10787.1|  unnamed protein product                              95.5    2e-20   
ref|XP_008371076.1|  PREDICTED: L-ascorbate oxidase homolog           95.5    2e-20   
ref|XP_010929557.1|  PREDICTED: L-ascorbate oxidase homolog           95.5    2e-20   
ref|XP_004507683.1|  PREDICTED: L-ascorbate oxidase homolog           95.5    2e-20   
ref|XP_004229062.1|  PREDICTED: L-ascorbate oxidase homolog           95.5    2e-20   
gb|KHN42952.1|  L-ascorbate oxidase like                              90.1    2e-20   
ref|XP_009400332.1|  PREDICTED: L-ascorbate oxidase homolog           95.5    2e-20   
ref|XP_011085509.1|  PREDICTED: L-ascorbate oxidase homolog           95.5    2e-20   
ref|XP_010247848.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  95.5    3e-20   
ref|XP_002310164.1|  multi-copper oxidase type 1 family protein       95.1    3e-20   
ref|XP_006341879.1|  PREDICTED: L-ascorbate oxidase homolog           95.5    3e-20   
ref|XP_010921259.1|  PREDICTED: L-ascorbate oxidase homolog           95.1    3e-20   
ref|XP_010093150.1|  L-ascorbate oxidase-like protein                 95.1    3e-20   
ref|XP_007017955.1|  SKU5 similar 5 isoform 1                         95.1    3e-20   
emb|CDP04415.1|  unnamed protein product                              95.1    3e-20   
ref|NP_177743.1|  SKU5-like 5 protein                                 95.1    3e-20   
ref|XP_006342554.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  95.9    3e-20   
ref|XP_003635547.1|  PREDICTED: L-ascorbate oxidase homolog           95.1    3e-20   
ref|XP_003610452.1|  L-ascorbate oxidase-like protein                 95.1    3e-20   
ref|XP_009611384.1|  PREDICTED: L-ascorbate oxidase homolog           95.1    3e-20   
emb|CDX73238.1|  BnaC06g36860D                                        95.1    3e-20   
ref|XP_002524823.1|  multicopper oxidase, putative                    95.1    3e-20   
emb|CAN83942.1|  hypothetical protein VITISV_013559                   95.1    3e-20   
gb|AAL09733.1|  At1g76160/T23E18_10                                   95.1    3e-20   
ref|XP_010530339.1|  PREDICTED: L-ascorbate oxidase homolog           95.1    4e-20   
ref|XP_002285913.1|  PREDICTED: L-ascorbate oxidase homolog           95.1    4e-20   
gb|AAM97070.1|  pectinesterase, putative                              95.1    4e-20   
ref|XP_003556690.2|  PREDICTED: L-ascorbate oxidase homolog           95.1    4e-20   
gb|KCW70295.1|  hypothetical protein EUGRSUZ_F03538                   94.4    4e-20   
ref|XP_007041705.1|  SKU5 similar 5                                   94.7    4e-20   
ref|XP_008789823.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  94.7    4e-20   
gb|KEH29685.1|  multi-copper oxidase-like protein                     94.7    4e-20   
ref|XP_010667351.1|  PREDICTED: L-ascorbate oxidase homolog           94.7    4e-20   
sp|P29162.1|ASOL_TOBAC  RecName: Full=L-ascorbate oxidase homolog...  94.7    4e-20   
ref|XP_009106271.1|  PREDICTED: L-ascorbate oxidase homolog           94.7    4e-20   
ref|XP_009408654.1|  PREDICTED: L-ascorbate oxidase homolog           94.7    4e-20   
ref|XP_010676489.1|  PREDICTED: L-ascorbate oxidase homolog           94.7    4e-20   
ref|XP_003540295.1|  PREDICTED: L-ascorbate oxidase homolog           94.7    4e-20   
ref|XP_009588330.1|  PREDICTED: L-ascorbate oxidase homolog           94.7    4e-20   
emb|CDX87633.1|  BnaA07g32400D                                        94.7    5e-20   
gb|KHN21220.1|  L-ascorbate oxidase like                              94.7    5e-20   
ref|XP_010266098.1|  PREDICTED: L-ascorbate oxidase homolog           94.7    5e-20   
ref|XP_006396008.1|  hypothetical protein EUTSA_v10005208mg           88.2    5e-20   
ref|XP_003550083.1|  PREDICTED: L-ascorbate oxidase homolog           94.7    5e-20   
ref|XP_003539859.1|  PREDICTED: L-ascorbate oxidase homolog           94.7    5e-20   
ref|XP_004253133.1|  PREDICTED: L-ascorbate oxidase homolog           94.7    5e-20   
ref|XP_007046383.1|  SKU5 similar 5 isoform 1                         94.7    5e-20   
ref|XP_006855939.1|  hypothetical protein AMTR_s00037p00216460        94.4    5e-20   
ref|XP_009803815.1|  PREDICTED: L-ascorbate oxidase homolog           94.7    5e-20   
gb|KGN64509.1|  hypothetical protein Csa_1G062350                     93.2    5e-20   
ref|XP_010063104.1|  PREDICTED: L-ascorbate oxidase homolog           94.4    6e-20   
dbj|BAK07214.1|  predicted protein                                    94.4    6e-20   
ref|XP_011096053.1|  PREDICTED: L-ascorbate oxidase homolog           94.4    6e-20   
ref|XP_004228635.1|  PREDICTED: L-ascorbate oxidase homolog           94.4    6e-20   
ref|XP_003527501.1|  PREDICTED: L-ascorbate oxidase homolog           94.4    6e-20   
ref|XP_008229964.1|  PREDICTED: L-ascorbate oxidase homolog           94.4    6e-20   
ref|XP_006435292.1|  hypothetical protein CICLE_v10000783mg           93.6    6e-20   
ref|XP_011046313.1|  PREDICTED: L-ascorbate oxidase homolog           94.4    6e-20   
ref|XP_002441281.1|  hypothetical protein SORBIDRAFT_09g023770        94.4    6e-20   
ref|XP_002306213.1|  hypothetical protein POPTR_0004s18730g           94.4    6e-20   
ref|XP_007215641.1|  hypothetical protein PRUPE_ppa003877mg           94.4    7e-20   
ref|XP_010923874.1|  PREDICTED: L-ascorbate oxidase homolog           94.0    7e-20   
ref|XP_006342555.1|  PREDICTED: L-ascorbate oxidase homolog           94.0    7e-20   
ref|XP_004487420.1|  PREDICTED: L-ascorbate oxidase homolog           94.0    7e-20   
ref|XP_010923873.1|  PREDICTED: L-ascorbate oxidase homolog           94.0    7e-20   
ref|XP_004232701.1|  PREDICTED: L-ascorbate oxidase homolog           94.0    7e-20   
ref|XP_004253203.1|  PREDICTED: L-ascorbate oxidase homolog           94.0    8e-20   
ref|XP_008224692.1|  PREDICTED: L-ascorbate oxidase homolog           94.0    8e-20   
ref|XP_009629876.1|  PREDICTED: L-ascorbate oxidase homolog           94.0    8e-20   
gb|EYU27771.1|  hypothetical protein MIMGU_mgv1a003982mg              94.0    8e-20   
ref|XP_009128157.1|  PREDICTED: L-ascorbate oxidase homolog           94.0    8e-20   
gb|KHG11003.1|  L-ascorbate oxidase                                   94.0    8e-20   
gb|KEH36280.1|  multi-copper oxidase-like protein                     94.0    8e-20   
gb|ACJ85585.1|  unknown                                               94.0    8e-20   
gb|AFK35121.1|  unknown                                               94.0    9e-20   
ref|XP_007014661.1|  SKU5 similar 12                                  94.0    9e-20   
emb|CDY68834.1|  BnaCnng60730D                                        94.0    9e-20   
ref|XP_002448327.1|  hypothetical protein SORBIDRAFT_06g025300        94.0    9e-20   
ref|XP_007153964.1|  hypothetical protein PHAVU_003G080100g           94.0    9e-20   
gb|EMS66047.1|  L-ascorbate oxidase-like protein                      94.0    9e-20   
emb|CDY55201.1|  BnaCnng28410D                                        94.0    9e-20   
ref|XP_006435293.1|  hypothetical protein CICLE_v10000783mg           94.0    9e-20   
ref|XP_004145114.1|  PREDICTED: L-ascorbate oxidase homolog           94.0    9e-20   
gb|KHN20513.1|  L-ascorbate oxidase like                              93.6    9e-20   
ref|XP_008806480.1|  PREDICTED: L-ascorbate oxidase homolog           94.0    9e-20   
ref|XP_006402152.1|  hypothetical protein EUTSA_v10013200mg           93.6    1e-19   
ref|XP_002269725.2|  PREDICTED: monocopper oxidase-like protein SKU5  94.0    1e-19   
ref|XP_009782819.1|  PREDICTED: L-ascorbate oxidase homolog           93.6    1e-19   
ref|XP_011089764.1|  PREDICTED: L-ascorbate oxidase homolog           94.0    1e-19   
ref|XP_003529638.1|  PREDICTED: L-ascorbate oxidase homolog           93.6    1e-19   
ref|XP_008440923.1|  PREDICTED: L-ascorbate oxidase homolog           93.6    1e-19   
ref|XP_010529443.1|  PREDICTED: L-ascorbate oxidase homolog           93.6    1e-19   
ref|XP_009353293.1|  PREDICTED: L-ascorbate oxidase homolog           93.6    1e-19   
ref|XP_003537754.1|  PREDICTED: L-ascorbate oxidase homolog           93.6    1e-19   
ref|XP_008219577.1|  PREDICTED: L-ascorbate oxidase homolog           93.6    1e-19   
ref|XP_009624631.1|  PREDICTED: L-ascorbate oxidase homolog           93.6    1e-19   
gb|AAQ90185.1|  ntp805                                                93.6    1e-19   
ref|XP_002893186.1|  hypothetical protein ARALYDRAFT_313077           93.6    1e-19   
gb|KHN03487.1|  L-ascorbate oxidase like                              93.6    1e-19   
ref|XP_008219429.1|  PREDICTED: L-ascorbate oxidase homolog           93.6    1e-19   
ref|XP_006282576.1|  hypothetical protein CARUB_v10004445mg           93.6    1e-19   
ref|XP_003549771.1|  PREDICTED: L-ascorbate oxidase homolog           93.6    1e-19   
ref|XP_008219320.1|  PREDICTED: L-ascorbate oxidase homolog           93.6    1e-19   
ref|XP_010227225.1|  PREDICTED: L-ascorbate oxidase homolog           93.6    1e-19   
emb|CAN72538.1|  hypothetical protein VITISV_028749                   93.6    1e-19   
gb|KGN43515.1|  hypothetical protein Csa_7G043570                     92.8    1e-19   
gb|KFK28784.1|  hypothetical protein AALP_AA7G047600                  93.2    1e-19   
ref|XP_006348131.1|  PREDICTED: L-ascorbate oxidase homolog           93.6    1e-19   
gb|KHF99853.1|  L-ascorbate oxidase                                   93.2    1e-19   
ref|XP_009135529.1|  PREDICTED: L-ascorbate oxidase homolog           93.2    1e-19   
ref|XP_009347125.1|  PREDICTED: L-ascorbate oxidase homolog           93.2    1e-19   
ref|XP_006413696.1|  hypothetical protein EUTSA_v10024862mg           93.2    1e-19   
emb|CDX79120.1|  BnaA01g11870D                                        93.2    1e-19   
ref|XP_004499321.1|  PREDICTED: L-ascorbate oxidase homolog           93.2    1e-19   
ref|XP_004509178.1|  PREDICTED: L-ascorbate oxidase homolog           93.2    1e-19   
ref|XP_004166771.1|  PREDICTED: L-ascorbate oxidase homolog           93.2    2e-19   
emb|CDX82897.1|  BnaC01g13470D                                        93.2    2e-19   
ref|XP_003601595.1|  L-ascorbate oxidase-like protein                 93.2    2e-19   
ref|XP_003601599.1|  L-ascorbate oxidase-like protein                 93.2    2e-19   
ref|XP_004144498.1|  PREDICTED: L-ascorbate oxidase homolog           93.2    2e-19   
ref|XP_003601601.1|  L-ascorbate oxidase-like protein                 93.2    2e-19   
ref|XP_008806482.1|  PREDICTED: L-ascorbate oxidase homolog           93.2    2e-19   
ref|NP_193932.1|  protein SKU5 similar 4                              93.2    2e-19   
gb|KCW55614.1|  hypothetical protein EUGRSUZ_I01478                   92.4    2e-19   
ref|XP_010266952.1|  PREDICTED: L-ascorbate oxidase homolog           93.2    2e-19   
ref|XP_003550084.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  93.2    2e-19   
gb|EPS74059.1|  hypothetical protein M569_00695                       93.2    2e-19   
gb|ACF86554.2|  unknown                                               93.2    2e-19   
gb|EMS67789.1|  L-ascorbate oxidase-like protein                      93.2    2e-19   
ref|XP_006366591.1|  PREDICTED: L-ascorbate oxidase homolog           93.2    2e-19   
ref|XP_003601600.1|  L-ascorbate oxidase-like protein                 93.2    2e-19   
emb|CDM84722.1|  unnamed protein product                              93.2    2e-19   
ref|NP_001151772.1|  pollen-specific protein NTP303 precursor         93.2    2e-19   
ref|XP_002869849.1|  hypothetical protein ARALYDRAFT_914433           92.8    2e-19   
ref|XP_003601596.1|  L-ascorbate oxidase-like protein                 92.8    2e-19   
ref|XP_010667350.1|  PREDICTED: L-ascorbate oxidase homolog           92.8    2e-19   
gb|EYU44359.1|  hypothetical protein MIMGU_mgv1a004187mg              92.8    2e-19   
ref|XP_010539014.1|  PREDICTED: L-ascorbate oxidase homolog           92.8    2e-19   
ref|XP_010434093.1|  PREDICTED: L-ascorbate oxidase homolog           92.8    2e-19   
gb|EMT02825.1|  L-ascorbate oxidase-like protein                      92.8    2e-19   
ref|XP_011039229.1|  PREDICTED: L-ascorbate oxidase homolog           92.8    2e-19   
gb|KEH20499.1|  multi-copper oxidase-like protein                     92.8    2e-19   
ref|XP_011013815.1|  PREDICTED: L-ascorbate oxidase homolog           92.8    2e-19   
gb|KFK30447.1|  hypothetical protein AALP_AA7G262200                  92.8    2e-19   
ref|XP_011088669.1|  PREDICTED: L-ascorbate oxidase homolog           92.8    2e-19   
ref|XP_010448953.1|  PREDICTED: L-ascorbate oxidase homolog           92.8    2e-19   
ref|XP_010439384.1|  PREDICTED: L-ascorbate oxidase homolog           92.8    2e-19   
gb|EYU39761.1|  hypothetical protein MIMGU_mgv1a003754mg              92.8    2e-19   
ref|XP_010061137.1|  PREDICTED: L-ascorbate oxidase homolog           92.8    2e-19   
ref|XP_006364519.1|  PREDICTED: L-ascorbate oxidase homolog           92.8    2e-19   
gb|ABK95805.1|  unknown                                               92.8    2e-19   
gb|KHF99506.1|  L-ascorbate oxidase                                   92.8    2e-19   
ref|XP_009413373.1|  PREDICTED: L-ascorbate oxidase homolog           92.8    2e-19   
gb|AFK33407.1|  unknown                                               91.3    2e-19   
ref|XP_011077090.1|  PREDICTED: L-ascorbate oxidase homolog           92.8    3e-19   
ref|XP_002320467.1|  hypothetical protein POPTR_0014s15260g           92.4    3e-19   
ref|XP_011046956.1|  PREDICTED: L-ascorbate oxidase homolog           92.4    3e-19   
dbj|BAO02510.1|  predicted pollen-specific protein ortholog           92.4    3e-19   
ref|XP_003607814.1|  L-ascorbate oxidase-like protein                 92.4    3e-19   
gb|KFK34651.1|  hypothetical protein AALP_AA5G173600                  92.4    3e-19   
emb|CDY35790.1|  BnaA08g04510D                                        92.4    3e-19   
emb|CDY67479.1|  BnaCnng55180D                                        92.4    3e-19   
ref|XP_002523381.1|  multicopper oxidase, putative                    92.4    3e-19   
ref|XP_007163845.1|  hypothetical protein PHAVU_001G269200g           92.4    3e-19   
ref|XP_002523382.1|  multicopper oxidase, putative                    92.4    3e-19   
ref|XP_006383902.1|  multi-copper oxidase type 1 family protein       92.4    3e-19   
ref|XP_009107631.1|  PREDICTED: L-ascorbate oxidase homolog           92.4    3e-19   
ref|NP_564479.1|  SKU5 similar 6                                      92.4    3e-19   
gb|AAL24296.1|  Unknown protein                                       92.4    3e-19   
gb|AAF99833.1|AC008046_5  Putative pectinesterase                     92.4    3e-19   
ref|XP_009402574.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  92.4    3e-19   
ref|XP_010089487.1|  L-ascorbate oxidase-like protein                 90.1    3e-19   
gb|AAL87103.1|AF479568_1  1-ascorbate oxidase                         92.4    3e-19   
gb|AGJ03718.1|  multicopper oxidase                                   92.4    3e-19   
gb|EYU44358.1|  hypothetical protein MIMGU_mgv1a004238mg              92.4    3e-19   
dbj|BAK00459.1|  predicted protein                                    92.4    3e-19   
ref|XP_006447580.1|  hypothetical protein CICLE_v10014842mg           92.4    3e-19   
gb|KHN09263.1|  L-ascorbate oxidase like                              86.3    3e-19   
ref|XP_009803721.1|  PREDICTED: L-ascorbate oxidase homolog           92.4    3e-19   
ref|XP_010052867.1|  PREDICTED: L-ascorbate oxidase homolog           92.0    3e-19   
gb|ACN26659.1|  unknown                                               92.4    3e-19   
ref|NP_001151961.1|  pollen-specific protein NTP303 precursor         92.4    3e-19   
ref|XP_011089767.1|  PREDICTED: L-ascorbate oxidase homolog           92.4    4e-19   
ref|XP_010686815.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  92.0    4e-19   
emb|CDP04133.1|  unnamed protein product                              92.4    4e-19   
gb|KHN33019.1|  L-ascorbate oxidase like                              91.7    4e-19   
dbj|BAJ91397.1|  predicted protein                                    92.0    4e-19   
ref|XP_009612547.1|  PREDICTED: L-ascorbate oxidase homolog           92.0    4e-19   
ref|XP_010028797.1|  PREDICTED: L-ascorbate oxidase homolog           92.0    4e-19   
ref|XP_011089766.1|  PREDICTED: L-ascorbate oxidase homolog           92.0    4e-19   
ref|XP_006307199.1|  hypothetical protein CARUB_v10008790mg           92.0    4e-19   
ref|XP_002894511.1|  hypothetical protein ARALYDRAFT_474617           92.0    4e-19   
ref|XP_010444936.1|  PREDICTED: L-ascorbate oxidase homolog           87.0    4e-19   
ref|XP_004502172.1|  PREDICTED: L-ascorbate oxidase homolog           92.0    4e-19   
ref|XP_008365718.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...  90.1    4e-19   
ref|XP_006467415.1|  PREDICTED: L-ascorbate oxidase homolog           92.0    5e-19   
ref|XP_009773307.1|  PREDICTED: L-ascorbate oxidase homolog           92.0    5e-19   
ref|XP_011047251.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  92.0    5e-19   
ref|XP_003567221.1|  PREDICTED: L-ascorbate oxidase homolog           92.0    5e-19   
ref|XP_009630902.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  91.7    5e-19   
ref|XP_009765874.1|  PREDICTED: L-ascorbate oxidase homolog           91.7    5e-19   
gb|EAZ38022.1|  hypothetical protein OsJ_22366                        91.7    5e-19   
ref|XP_006449754.1|  hypothetical protein CICLE_v10014825mg           91.7    5e-19   
ref|XP_010271079.1|  PREDICTED: L-ascorbate oxidase homolog           91.7    5e-19   
ref|NP_001058365.1|  Os06g0678800                                     91.7    5e-19   
gb|EAZ02087.1|  hypothetical protein OsI_24168                        91.7    5e-19   
gb|AGT57427.1|  ascorbate oxidase                                     91.7    5e-19   
ref|XP_010323833.1|  PREDICTED: L-ascorbate oxidase homolog           91.7    5e-19   
gb|AFK33666.1|  unknown                                               91.3    6e-19   
gb|EYU39505.1|  hypothetical protein MIMGU_mgv1a003980mg              91.7    6e-19   
ref|XP_010461374.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  91.7    6e-19   
ref|XP_003529456.1|  PREDICTED: L-ascorbate oxidase homolog           91.7    6e-19   
ref|XP_002528421.1|  multicopper oxidase, putative                    91.7    6e-19   



>gb|KGN54013.1| hypothetical protein Csa_4G267480 [Cucumis sativus]
Length=476

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTW VTYGTISP+GVPQQ ILINGQFPGP IN TSNNN+++NVFN LDEP LL 
Sbjct  24   EDPYFFFTWNVTYGTISPLGVPQQGILINGQFPGPNINSTSNNNLVINVFNNLDEPFLLH  83

Query  337  WSGI  348
            WSGI
Sbjct  84   WSGI  87



>ref|XP_009411781.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=548

 Score =   114 bits (284),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYLFFTW VTYGT+SP+GVPQQVILING+FPGP IN TSNNN+++NVFN LDEP L +
Sbjct  24   EDPYLFFTWNVTYGTVSPLGVPQQVILINGEFPGPNINSTSNNNLVINVFNNLDEPFLFS  83

Query  337  WSGI  348
            W+GI
Sbjct  84   WNGI  87



>ref|XP_004149637.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   114 bits (284),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTW VTYGTISP+GVPQQ ILINGQFPGP IN TSNNN+++NVFN LDEP LL 
Sbjct  24   EDPYFFFTWNVTYGTISPLGVPQQGILINGQFPGPNINSTSNNNLVINVFNNLDEPFLLH  83

Query  337  WSGI  348
            WSGI
Sbjct  84   WSGI  87



>ref|XP_004164925.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   114 bits (284),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTW VTYGTISP+GVPQQ ILINGQFPGP IN TSNNN+++NVFN LDEP LL 
Sbjct  24   EDPYFFFTWNVTYGTISPLGVPQQGILINGQFPGPNINSTSNNNLVINVFNNLDEPFLLH  83

Query  337  WSGI  348
            WSGI
Sbjct  84   WSGI  87



>gb|KGN63948.1| hypothetical protein Csa_1G031720 [Cucumis sativus]
Length=480

 Score =   112 bits (280),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTW VTYGTISP+GVPQQ ILINGQFPGP IN T+NNN+++NVFN LDEP LL 
Sbjct  24   EDPYFFFTWNVTYGTISPLGVPQQGILINGQFPGPNINSTTNNNLVINVFNNLDEPFLLH  83

Query  337  WSGI  348
            WSGI
Sbjct  84   WSGI  87



>ref|XP_008438536.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=553

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTW VTYGTISP+GVPQQ ILINGQFPGP IN T+NNN+++NVFN LDEP LL 
Sbjct  24   EDPYFFFTWNVTYGTISPLGVPQQGILINGQFPGPNINSTTNNNLVINVFNNLDEPFLLH  83

Query  337  WSGI  348
            WSGI
Sbjct  84   WSGI  87



>ref|XP_004165665.1| PREDICTED: LOW QUALITY PROTEIN: L-ascorbate oxidase homolog [Cucumis 
sativus]
Length=553

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTW VTYGTISP+GVPQQ ILINGQFPGP IN T+NNN+++NVFN LDEP LL 
Sbjct  24   EDPYFFFTWNVTYGTISPLGVPQQGILINGQFPGPNINSTTNNNLVINVFNNLDEPFLLH  83

Query  337  WSGI  348
            WSGI
Sbjct  84   WSGI  87



>ref|XP_004137383.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTW VTYGTISP+GVPQQ ILINGQFPGP IN T+NNN+++NVFN LDEP LL 
Sbjct  24   EDPYFFFTWNVTYGTISPLGVPQQGILINGQFPGPNINSTTNNNLVINVFNNLDEPFLLH  83

Query  337  WSGI  348
            WSGI
Sbjct  84   WSGI  87



>ref|XP_004164922.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTW VTYGTISP+GVPQQ ILINGQFPGP +N T+NNN+++NVFN LDEP LL 
Sbjct  24   EDPYFFFTWNVTYGTISPLGVPQQGILINGQFPGPNVNSTTNNNLVINVFNNLDEPFLLH  83

Query  337  WSGI  348
            WSGI
Sbjct  84   WSGI  87



>ref|XP_004149634.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTW VTYGTISP+GVPQQ ILINGQFPGP +N T+NNN+++NVFN LDEP LL 
Sbjct  24   EDPYFFFTWNVTYGTISPLGVPQQGILINGQFPGPNVNSTTNNNLVINVFNNLDEPFLLH  83

Query  337  WSGI  348
            WSGI
Sbjct  84   WSGI  87



>ref|XP_010044914.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW87034.1| hypothetical protein EUGRSUZ_B03581 [Eucalyptus grandis]
Length=552

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYLFFTW VTYGTISP+GVPQ+ ILINGQFPGP IN T+NNN+++NVFN +DEPLL T
Sbjct  21   EDPYLFFTWNVTYGTISPLGVPQEGILINGQFPGPNINSTTNNNLVINVFNNIDEPLLFT  80

Query  337  WSGI  348
            W+GI
Sbjct  81   WNGI  84



>gb|EPS72881.1| pollen-specific protein [Genlisea aurea]
Length=585

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYLF+ WKVTYG +SP+GV  + ILING+FPGPKINCTSNNN+ VNVFNELDEPLL T
Sbjct  23   EDPYLFYDWKVTYGDVSPLGVATKGILINGEFPGPKINCTSNNNIYVNVFNELDEPLLFT  82

Query  337  WSGI  348
            W+GI
Sbjct  83   WNGI  86



>gb|KHN44494.1| L-ascorbate oxidase like [Glycine soja]
Length=551

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYL+FTW VTYGTISP+G+PQQ I INGQFPGP IN TSNNN+++NVFN LDEP L T
Sbjct  24   EDPYLYFTWNVTYGTISPLGIPQQGIFINGQFPGPNINSTSNNNLVINVFNNLDEPFLFT  83

Query  337  WSGI  348
            W+GI
Sbjct  84   WNGI  87



>ref|XP_003538519.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=552

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYL+FTW VTYGTISP+G+PQQ I INGQFPGP IN TSNNN+++NVFN LDEP L T
Sbjct  24   EDPYLYFTWNVTYGTISPLGIPQQGIFINGQFPGPNINSTSNNNLVINVFNNLDEPFLFT  83

Query  337  WSGI  348
            W+GI
Sbjct  84   WNGI  87



>gb|KGN54009.1| hypothetical protein Csa_4G267440 [Cucumis sativus]
Length=265

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTW VTYGTISP+GVPQQ ILINGQFPGP +N T+NNN+++NVFN LDEP LL 
Sbjct  24   EDPYFFFTWNVTYGTISPLGVPQQGILINGQFPGPNVNSTTNNNLVINVFNNLDEPFLLH  83

Query  337  W  339
            W
Sbjct  84   W  84



>gb|KGN48499.1| hypothetical protein Csa_6G490140 [Cucumis sativus]
Length=458

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E+PY F+TW VTYGTISP+GVPQQVILINGQFPGPK+   +N+N+I+N+FN+LDEPLLLT
Sbjct  25   ENPYRFYTWTVTYGTISPLGVPQQVILINGQFPGPKLEVVTNDNIILNLFNKLDEPLLLT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>ref|XP_004141928.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
 ref|XP_004157172.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=537

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E+PY F+TW VTYGTISP+GVPQQVILINGQFPGPK+   +N+N+I+N+FN+LDEPLLLT
Sbjct  25   ENPYRFYTWTVTYGTISPLGVPQQVILINGQFPGPKLEVVTNDNIILNLFNKLDEPLLLT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>dbj|BAK05994.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=560

 Score =   109 bits (273),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 46/64 (72%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY+FF W VTYGT + +G PQ+VILING+FPGP+INC+SNNN++VNVFN+LD+PLL T
Sbjct  32   EDPYVFFEWHVTYGTKNIVGTPQKVILINGEFPGPRINCSSNNNIMVNVFNQLDQPLLFT  91

Query  337  WSGI  348
            W+GI
Sbjct  92   WNGI  95



>gb|KGN54014.1| hypothetical protein Csa_4G267980 [Cucumis sativus]
Length=204

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTW VTYGTISP+GVPQQ ILINGQFPGP IN TSNNN+++NVFN LDEP LL 
Sbjct  24   EDPYFFFTWNVTYGTISPLGVPQQGILINGQFPGPNINSTSNNNLVINVFNNLDEPFLLH  83

Query  337  WSG  345
             + 
Sbjct  84   CAA  86



>ref|XP_008440238.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=538

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E+PY F+TW VTYGTISP+GVPQQVILINGQFPGPK+   +N+N+I+N+FN+LDEPLLLT
Sbjct  25   ENPYRFYTWTVTYGTISPLGVPQQVILINGQFPGPKLEVVTNDNIILNLFNKLDEPLLLT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>ref|XP_007208285.1| hypothetical protein PRUPE_ppa003733mg [Prunus persica]
 gb|EMJ09484.1| hypothetical protein PRUPE_ppa003733mg [Prunus persica]
Length=552

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +1

Query  160  DPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLTW  339
            +PYLFFTW VTYGT+SP+GVPQQVILINGQFPGP IN T+N+N+++NVFN LDEP L+TW
Sbjct  24   NPYLFFTWNVTYGTLSPLGVPQQVILINGQFPGPNINSTTNDNIVLNVFNNLDEPFLVTW  83

Query  340  SGI  348
            +GI
Sbjct  84   NGI  86



>ref|XP_008449954.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=446

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTW VTYGTISP+GVPQQ ILINGQFPGP IN T+NNN+++NVFN LDEP LL 
Sbjct  24   EDPYFFFTWNVTYGTISPLGVPQQGILINGQFPGPNINSTTNNNLVINVFNNLDEPFLLH  83

Query  337  W  339
            W
Sbjct  84   W  84



>ref|XP_007163844.1| hypothetical protein PHAVU_001G269100g [Phaseolus vulgaris]
 gb|ESW35838.1| hypothetical protein PHAVU_001G269100g [Phaseolus vulgaris]
Length=549

 Score =   107 bits (268),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY+FFTW VTYG ISP+GVPQQ ILING+FPGP IN TSNNN++ N+FN LDEPLL T
Sbjct  21   EDPYIFFTWNVTYGIISPLGVPQQGILINGKFPGPNINSTSNNNLVFNIFNNLDEPLLFT  80

Query  337  WSGI  348
            W+G+
Sbjct  81   WNGV  84



>ref|XP_006850531.1| hypothetical protein AMTR_s00159p00040990 [Amborella trichopoda]
 gb|ERN12112.1| hypothetical protein AMTR_s00159p00040990 [Amborella trichopoda]
Length=543

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E+PY +FTWKVTYGT+SP+GVPQ+VI+IN QFPGP IN T+N+N++VNVFN+LDEP L++
Sbjct  22   ENPYRYFTWKVTYGTVSPLGVPQEVIMINDQFPGPNINSTTNDNIVVNVFNQLDEPFLIS  81

Query  337  WSGI  348
            W+G+
Sbjct  82   WNGV  85



>ref|NP_001058771.1| Os07g0119400 [Oryza sativa Japonica Group]
 dbj|BAC79733.1| putative pollen-specific protein NTP303 precursor [Oryza sativa 
Japonica Group]
 dbj|BAF20685.1| Os07g0119400 [Oryza sativa Japonica Group]
 gb|EAZ02590.1| hypothetical protein OsI_24700 [Oryza sativa Indica Group]
 gb|EAZ38518.1| hypothetical protein OsJ_22905 [Oryza sativa Japonica Group]
Length=545

 Score =   107 bits (266),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 47/65 (72%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMG-VPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLL  333
            +DPY FFTW VTYG+I+P+G  PQQ ILINGQFPGP+I+C +N+N+IVNVFN LDEP LL
Sbjct  26   DDPYRFFTWNVTYGSINPLGSTPQQGILINGQFPGPRIDCVTNDNIIVNVFNNLDEPFLL  85

Query  334  TWSGI  348
            TW+GI
Sbjct  86   TWNGI  90



>ref|XP_002522339.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF40023.1| multicopper oxidase, putative [Ricinus communis]
Length=540

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTW VTYGTISP+GVPQ+ ILINGQFPGP I+C +N+N+IVNV N+LD P LLT
Sbjct  25   EDPYRFFTWTVTYGTISPLGVPQRGILINGQFPGPAIDCVTNDNIIVNVINKLDVPFLLT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>ref|XP_004511977.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Cicer arietinum]
Length=538

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY F+TW VTYGT+SP+GVPQQVILINGQFPGP+++  +N+NVI+N+ N+LDEP LLT
Sbjct  25   EDPYKFYTWTVTYGTLSPLGVPQQVILINGQFPGPRLDLVTNDNVILNLVNKLDEPFLLT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>emb|CDX89588.1| BnaC04g36070D [Brassica napus]
Length=275

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTW VTYGT SP+GVPQQVILINGQFPGP I   +N+N++VN+ N++DEPLL+T
Sbjct  50   EDPYRFFTWTVTYGTRSPLGVPQQVILINGQFPGPPIEGVTNDNILVNLINKIDEPLLIT  109

Query  337  WSGI  348
            W+GI
Sbjct  110  WNGI  113



>gb|EYU39394.1| hypothetical protein MIMGU_mgv11b015886mg [Erythranthe guttata]
Length=539

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTW VTYGT SP+G+ QQVILINGQFPGP ++C +N+NVI+NV N+LD+P LLT
Sbjct  25   EDPYRFFTWTVTYGTASPLGLSQQVILINGQFPGPSLDCVTNDNVIINVVNKLDQPFLLT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>ref|XP_004511976.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Cicer arietinum]
Length=559

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY F+TW VTYGT+SP+GVPQQVILINGQFPGP+++  +N+NVI+N+ N+LDEP LLT
Sbjct  25   EDPYKFYTWTVTYGTLSPLGVPQQVILINGQFPGPRLDLVTNDNVILNLVNKLDEPFLLT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>ref|XP_003557661.2| PREDICTED: L-ascorbate oxidase homolog [Brachypodium distachyon]
Length=553

 Score =   106 bits (264),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY +FTW VTYG ISP+G  QQ ILINGQFPGP I C +N+N+IVNVFN LDEP L+T
Sbjct  32   EDPYRYFTWNVTYGPISPLGTTQQGILINGQFPGPTIECVTNDNLIVNVFNYLDEPFLIT  91

Query  337  WSGI  348
            WSGI
Sbjct  92   WSGI  95



>ref|XP_010263764.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
 ref|XP_010263765.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=539

 Score =   105 bits (262),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY +FTW V YGTISP+GVPQQ ILINGQFPGP+I+C +N+N++VNV N+LD+P L+T
Sbjct  28   EDPYKYFTWTVIYGTISPLGVPQQGILINGQFPGPRIDCVTNDNIVVNVINKLDQPFLIT  87

Query  337  WSGI  348
            W+G+
Sbjct  88   WNGV  91



>emb|CDP07321.1| unnamed protein product [Coffea canephora]
Length=543

 Score =   105 bits (262),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYLFF W VTYGTI P+GVPQQ ILINGQFPGP I+  +NNN+++NVFN L EP LL+
Sbjct  25   EDPYLFFNWNVTYGTIYPLGVPQQGILINGQFPGPDIHSVTNNNLVINVFNSLTEPFLLS  84

Query  337  WSGI  348
            WSGI
Sbjct  85   WSGI  88



>ref|XP_010070498.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW59310.1| hypothetical protein EUGRSUZ_H01991 [Eucalyptus grandis]
Length=538

 Score =   105 bits (261),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY F+TW VTYGTISP+GVPQQVILINGQFPGP+++  +N+N+++N+ N+LDEP LLT
Sbjct  25   DDPYRFYTWTVTYGTISPLGVPQQVILINGQFPGPRLDVVTNDNLVLNLINKLDEPFLLT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>ref|XP_004300548.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=539

 Score =   105 bits (261),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY F+TW VTYGT+SP+GVPQQVILINGQFPGP+++  +N+N+I+N+ N+LD+P LLT
Sbjct  26   EDPYKFYTWTVTYGTLSPLGVPQQVILINGQFPGPRLDVVTNDNIILNLINKLDQPFLLT  85

Query  337  WSGI  348
            W+GI
Sbjct  86   WNGI  89



>ref|XP_009347241.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=541

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY F+TW VTYGT+SP+GVPQQVILINGQFPGP+++  +N+N+I+N+ N+LD+P LLT
Sbjct  28   EDPYKFYTWTVTYGTLSPLGVPQQVILINGQFPGPRLDVVTNDNIILNLINKLDQPFLLT  87

Query  337  WSGI  348
            W+GI
Sbjct  88   WNGI  91



>ref|XP_009348086.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=541

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY F+TW VTYGT+SP+GVPQQVILINGQFPGP+++  +N+N+I+N+ N+LD+P LLT
Sbjct  28   EDPYKFYTWTVTYGTLSPLGVPQQVILINGQFPGPRLDVVTNDNIILNLINKLDQPFLLT  87

Query  337  WSGI  348
            W+GI
Sbjct  88   WNGI  91



>ref|XP_006411628.1| hypothetical protein EUTSA_v10024832mg [Eutrema salsugineum]
 gb|ESQ53081.1| hypothetical protein EUTSA_v10024832mg [Eutrema salsugineum]
Length=551

 Score =   104 bits (260),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W+VTYG I P+G+PQ+ ILINGQFPGP+I   +NNN+I+NV N+LDEP LL+
Sbjct  24   EDPYRFFDWRVTYGNIYPLGIPQRGILINGQFPGPEIYSVTNNNLIINVHNDLDEPFLLS  83

Query  337  WSGI  348
            W+G+
Sbjct  84   WNGV  87



>ref|XP_004301852.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=537

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY +FTW VTYGTISP+GVPQQ ILINGQFPGP I   +N+N++V+V N+LDEP L+T
Sbjct  26   EDPYRYFTWTVTYGTISPLGVPQQAILINGQFPGPTIEAVTNDNIVVDVINKLDEPFLIT  85

Query  337  WSGI  348
            W+GI
Sbjct  86   WNGI  89



>gb|ABK25092.1| unknown [Picea sitchensis]
 gb|ACN40425.1| unknown [Picea sitchensis]
Length=539

 Score =   104 bits (259),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/64 (72%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            ED Y +FTW VTYGTI PMGVPQQ ILINGQFPGP++N  +N+NVI+NVFN L+EP LL+
Sbjct  24   EDAYKYFTWTVTYGTIYPMGVPQQGILINGQFPGPQLNVVTNDNVIINVFNYLNEPFLLS  83

Query  337  WSGI  348
            W+GI
Sbjct  84   WNGI  87



>gb|EMS52588.1| L-ascorbate oxidase-like protein [Triticum urartu]
Length=890

 Score =   105 bits (262),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTW V+YG I P+GV QQ ILINGQFPGP+I   +N+N++VNVFN+L+EP LL+
Sbjct  27   EDPYRFFTWNVSYGDIYPLGVKQQGILINGQFPGPQIEAVTNDNLVVNVFNKLNEPFLLS  86

Query  337  WSGI  348
            WSGI
Sbjct  87   WSGI  90



>gb|KDP31875.1| hypothetical protein JCGZ_12336 [Jatropha curcas]
Length=536

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY +FTW VTYGTISP+GVPQ+ ILINGQFPGP I+  +N+N+IVNV N+LDEP L+T
Sbjct  21   EDPYRYFTWTVTYGTISPLGVPQRGILINGQFPGPTIDAVTNDNIIVNVINKLDEPFLIT  80

Query  337  WSGI  348
            W+GI
Sbjct  81   WNGI  84



>ref|XP_010680450.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010680451.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=538

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY FFTW VTYG I+P+GV QQVILINGQFPGPK++C +N+N+++NV N+L+EP LLT
Sbjct  25   DDPYRFFTWTVTYGNIAPLGVSQQVILINGQFPGPKLDCVTNDNIVLNVINKLNEPFLLT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>ref|XP_004250092.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=555

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYLF  WKVTYGT+SP+GVPQ+VILINGQFPGP+IN TSNNNV+VNVFN+LDEPLLLT
Sbjct  24   EDPYLFHEWKVTYGTLSPLGVPQKVILINGQFPGPRINGTSNNNVVVNVFNQLDEPLLLT  83

Query  337  WSGI  348
            WSGI
Sbjct  84   WSGI  87



>ref|XP_006338228.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=538

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            ED Y +FTW  TYGT+SP+GVPQQVILINGQFPGP+++  +N+NVI+N+ N+LDEPLLLT
Sbjct  25   EDTYKYFTWTATYGTLSPLGVPQQVILINGQFPGPRLDLVTNDNVILNLINKLDEPLLLT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>ref|XP_009140476.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
 emb|CDY38959.1| BnaA04g13800D [Brassica napus]
Length=539

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTW VTYGT SP+GVPQQVILINGQFPGP I   +N+N++VN+ N++DEPLL+T
Sbjct  26   EDPYRFFTWTVTYGTRSPLGVPQQVILINGQFPGPPIEGVTNDNILVNLINKIDEPLLIT  85

Query  337  WSGI  348
            W+GI
Sbjct  86   WNGI  89



>ref|XP_009407426.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=533

 Score =   103 bits (257),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY FFTW VTYG I P+GV QQ ILINGQFPGP+++C +N+N++++V N+LDEPLLLT
Sbjct  21   DDPYRFFTWTVTYGPIYPLGVQQQGILINGQFPGPRLDCVTNDNIVIDVINKLDEPLLLT  80

Query  337  WSGI  348
            W+GI
Sbjct  81   WNGI  84



>ref|XP_008241557.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=539

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY F+TW VTYGT SP+GVPQQVILINGQFPGP+++  +N+N+I+N+ N+LD+P LLT
Sbjct  26   EDPYKFYTWTVTYGTRSPLGVPQQVILINGQFPGPRLDVVTNDNIILNLINKLDQPFLLT  85

Query  337  WSGI  348
            W+GI
Sbjct  86   WNGI  89



>ref|XP_009600428.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Nicotiana 
tomentosiformis]
Length=520

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYLFF W VTYGTISP+GVPQQVILINGQFPGPKINCTSNNN++VNVFN+LDEP LLT
Sbjct  21   EDPYLFFDWNVTYGTISPLGVPQQVILINGQFPGPKINCTSNNNIVVNVFNQLDEPFLLT  80

Query  337  WSGI  348
            W+GI
Sbjct  81   WNGI  84



>ref|XP_007204826.1| hypothetical protein PRUPE_ppa003926mg [Prunus persica]
 gb|EMJ06025.1| hypothetical protein PRUPE_ppa003926mg [Prunus persica]
Length=539

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY F+TW VTYGT SP+GVPQQVILINGQFPGP+++  +N+N+I+N+ N+LD+P LLT
Sbjct  26   EDPYKFYTWTVTYGTRSPLGVPQQVILINGQFPGPRLDVVTNDNIILNLINKLDQPFLLT  85

Query  337  WSGI  348
            W+GI
Sbjct  86   WNGI  89



>ref|XP_009594576.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=538

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            ED Y +FTW  TYGT SP+GVPQQ+ILINGQFPGPK++  +N NVI+N+ N+LDEPLLLT
Sbjct  25   EDAYRYFTWTATYGTASPLGVPQQIILINGQFPGPKLDLVTNENVILNLINKLDEPLLLT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>ref|XP_010088984.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB37211.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=537

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY ++TW VTYGTISP+GV Q+ ILINGQFPGP I C +N+N+IVNV N+LDEP L+T
Sbjct  25   EDPYRYYTWTVTYGTISPLGVQQKGILINGQFPGPTIECVTNDNIIVNVINKLDEPFLIT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>gb|ABR18324.1| unknown [Picea sitchensis]
Length=542

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTW VT+GTI P+G+PQQ ILINGQFPGP+I+  +N+N+IVNVFN LD+P L++
Sbjct  24   EDPYKFFTWNVTWGTIWPLGIPQQGILINGQFPGPRIDSVTNDNIIVNVFNSLDQPFLIS  83

Query  337  WSGI  348
            WSGI
Sbjct  84   WSGI  87



>ref|XP_009777142.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=538

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            ED Y +FTW  TYGT SP+GVPQQ+ILINGQFPGPK++  +N NVI+N+ N+LDEPLLLT
Sbjct  25   EDAYRYFTWTATYGTASPLGVPQQIILINGQFPGPKLDLITNENVILNLINKLDEPLLLT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>ref|XP_009600426.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nicotiana 
tomentosiformis]
Length=549

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYLFF W VTYGTISP+GVPQQVILINGQFPGPKINCTSNNN++VNVFN+LDEP LLT
Sbjct  21   EDPYLFFDWNVTYGTISPLGVPQQVILINGQFPGPKINCTSNNNIVVNVFNQLDEPFLLT  80

Query  337  WSGI  348
            W+GI
Sbjct  81   WNGI  84



>ref|XP_009366415.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=541

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY F+TW VTYGT+SP+GVPQQVILINGQFPGP ++  +N+N+I+N+ N+LD+P LLT
Sbjct  28   EDPYKFYTWTVTYGTLSPLGVPQQVILINGQFPGPTLDVVTNDNIILNLINKLDQPFLLT  87

Query  337  WSGI  348
            W+GI
Sbjct  88   WNGI  91



>ref|XP_009348089.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=539

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYL++TW VTYG ISP+GVPQ+ ILINGQFPGP I   +N+NVIVNV N+LDEP L+T
Sbjct  26   EDPYLYYTWTVTYGIISPLGVPQKGILINGQFPGPNIEAVTNDNVIVNVINKLDEPFLIT  85

Query  337  WSGI  348
            W+GI
Sbjct  86   WNGI  89



>ref|XP_008445302.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=538

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W VTYGTI P+G+PQQ ILINGQFPGP I+  +N+N+I+NVFN LDEP LL+
Sbjct  19   EDPYRFFDWNVTYGTIYPLGLPQQGILINGQFPGPDIHSVTNDNIIINVFNSLDEPFLLS  78

Query  337  WSGI  348
            W+GI
Sbjct  79   WNGI  82



>ref|XP_004142986.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
 gb|KGN62282.1| Multicopper oxidase [Cucumis sativus]
Length=539

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W VTYGTI P+G+PQQ ILINGQFPGP I+  +N+N+I+NVFN LDEP LL+
Sbjct  20   EDPYRFFDWNVTYGTIYPLGLPQQGILINGQFPGPDIHSVTNDNIIINVFNSLDEPFLLS  79

Query  337  WSGI  348
            W+GI
Sbjct  80   WNGI  83



>ref|XP_006445540.1| hypothetical protein CICLE_v10018007mg [Citrus clementina]
 ref|XP_006489004.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|ESR58780.1| hypothetical protein CICLE_v10018007mg [Citrus clementina]
 gb|KDO54549.1| hypothetical protein CISIN_1g046746mg [Citrus sinensis]
Length=561

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  163  PYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLTWS  342
            P  FFTW VTYGTISP+G+PQQ ILINGQFPGP IN T+N+N+++NVFN+LDEP LLTW 
Sbjct  27   PTFFFTWNVTYGTISPLGIPQQGILINGQFPGPNINSTTNDNLVINVFNKLDEPFLLTWP  86

Query  343  GI  348
            GI
Sbjct  87   GI  88



>ref|NP_001151662.1| L-ascorbate oxidase precursor [Zea mays]
 gb|ACG43714.1| L-ascorbate oxidase precursor [Zea mays]
Length=559

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF WKVTYGT + MG  QQVILIN  FPGP INC+SNNN++VNVFN LD+PLL T
Sbjct  31   EDPYHFFEWKVTYGTRTIMGTAQQVILINDMFPGPTINCSSNNNILVNVFNMLDQPLLFT  90

Query  337  WSGI  348
            W GI
Sbjct  91   WHGI  94



>emb|CDY54804.1| BnaA06g40970D [Brassica napus]
Length=639

 Score =   102 bits (255),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W+VTYG I P+G+PQ+ ILINGQFPGP+I   +N+N+I+NV N+LDEP LL+
Sbjct  114  EDPYRFFDWRVTYGNIYPLGIPQRGILINGQFPGPEIYSVTNDNLIINVHNDLDEPFLLS  173

Query  337  WSGI  348
            W+G+
Sbjct  174  WNGV  177



>emb|CDP18567.1| unnamed protein product [Coffea canephora]
Length=557

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYLFF WKVTYGTI+P+GVPQQ ILINGQFPGP+INCTSNNN++VNVFN+LDEPLLLT
Sbjct  23   EDPYLFFDWKVTYGTIAPLGVPQQGILINGQFPGPRINCTSNNNIVVNVFNQLDEPLLLT  82

Query  337  WSGI  348
            W+G+
Sbjct  83   WAGV  86



>emb|CAA65634.1| PS60 [Nicotiana tabacum]
Length=540

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W VTYGTI P+GVPQQ ILINGQFPGP I   +N+N+I+NVFN LDEP LL+
Sbjct  23   EDPYRFFEWNVTYGTIYPLGVPQQGILINGQFPGPDIYSVTNDNLIINVFNSLDEPFLLS  82

Query  337  WSGI  348
            W+GI
Sbjct  83   WNGI  86



>ref|XP_009623446.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=540

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W VTYGTI P+GVPQQ ILINGQFPGP I   +N+N+I+NVFN LDEP LL+
Sbjct  23   EDPYRFFEWNVTYGTIYPLGVPQQGILINGQFPGPDIYSVTNDNLIINVFNSLDEPFLLS  82

Query  337  WSGI  348
            W+GI
Sbjct  83   WNGI  86



>ref|XP_004955371.1| PREDICTED: L-ascorbate oxidase homolog [Setaria italica]
Length=537

 Score =   102 bits (253),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY ++TW VTYG I+P+G  QQ ILINGQFPGP+I+C +N+N+IVNV N LDEP LLT
Sbjct  21   DDPYRYYTWTVTYGPINPLGTTQQGILINGQFPGPRIDCVTNDNLIVNVVNNLDEPFLLT  80

Query  337  WSGI  348
            W+GI
Sbjct  81   WNGI  84



>ref|XP_009785141.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=540

 Score =   102 bits (253),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W VTYGTI P+GVPQQ ILINGQFPGP I   +N+N+I+NVFN LDEP LL+
Sbjct  23   EDPYRFFEWNVTYGTIYPLGVPQQGILINGQFPGPDIYSVTNDNLIINVFNSLDEPFLLS  82

Query  337  WSGI  348
            W+GI
Sbjct  83   WNGI  86



>ref|XP_010255119.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Nelumbo nucifera]
Length=540

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY ++TW VTYG ISP+GVPQQVILINGQFPGP+++  +N+N+++N+ N+LD+P LLT
Sbjct  27   EDPYKYYTWTVTYGKISPLGVPQQVILINGQFPGPRLDVVTNDNIVLNLINKLDQPFLLT  86

Query  337  WSGI  348
            W+GI
Sbjct  87   WNGI  90



>dbj|BAK04971.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score =   102 bits (253),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTW V+YG I P+GV QQ ILINGQFPGP+I+  +N+N++VNVFN+L+EP LL+
Sbjct  33   EDPYRFFTWNVSYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLVVNVFNKLNEPFLLS  92

Query  337  WSGI  348
            WSG+
Sbjct  93   WSGV  96



>ref|XP_008338225.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=541

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY F+TW VTYGT+SP+GV QQVILINGQFPGP+++  +N+N+I+N+ N+LD+P LLT
Sbjct  28   EDPYKFYTWTVTYGTLSPLGVSQQVILINGQFPGPRLDVVTNDNIILNLINKLDQPFLLT  87

Query  337  WSGI  348
            W+GI
Sbjct  88   WNGI  91



>ref|XP_006353286.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=558

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYLF  WKVTYGT+SP+GVPQ++ILINGQFPGP+IN TSNNNV+VNVFN+LDEPLL T
Sbjct  24   EDPYLFHEWKVTYGTLSPLGVPQKIILINGQFPGPRINGTSNNNVVVNVFNQLDEPLLFT  83

Query  337  WSGI  348
            WSGI
Sbjct  84   WSGI  87



>gb|KHG04142.1| L-ascorbate oxidase [Gossypium arboreum]
Length=550

 Score =   102 bits (253),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY F+TW VTYG I P+GV QQVILINGQFPGP+I   +N N+I+NVFN LD+P L++
Sbjct  30   EDPYRFYTWNVTYGDIYPLGVKQQVILINGQFPGPQIETVTNENLIINVFNSLDQPFLIS  89

Query  337  WSGI  348
            W+G+
Sbjct  90   WNGV  93



>ref|XP_010255117.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nelumbo nucifera]
 ref|XP_010255118.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nelumbo nucifera]
Length=545

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY ++TW VTYG ISP+GVPQQVILINGQFPGP+++  +N+N+++N+ N+LD+P LLT
Sbjct  27   EDPYKYYTWTVTYGKISPLGVPQQVILINGQFPGPRLDVVTNDNIVLNLINKLDQPFLLT  86

Query  337  WSGI  348
            W+GI
Sbjct  87   WNGI  90



>gb|KFK44289.1| hypothetical protein AALP_AA1G238900 [Arabis alpina]
Length=176

 Score = 97.4 bits (241),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W VTYG ISP+GV QQ ILING+FPGP I   +N+N+I+NVFN LDEP L++
Sbjct  23   EDPYKFFEWHVTYGNISPLGVQQQGILINGKFPGPDIYSVTNDNLIINVFNHLDEPFLIS  82

Query  337  WSGI  348
            WSGI
Sbjct  83   WSGI  86



>ref|XP_009347247.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=539

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYL++TW VTYGTISP+GVPQ+ ILINGQFPGP I   +N+ VIVNV N+LDEP L+T
Sbjct  26   EDPYLYYTWTVTYGTISPLGVPQKGILINGQFPGPNIEAVTNDIVIVNVINKLDEPFLIT  85

Query  337  WSGI  348
            W+GI
Sbjct  86   WNGI  89



>ref|XP_006393891.1| hypothetical protein EUTSA_v10003952mg [Eutrema salsugineum]
 gb|ESQ31177.1| hypothetical protein EUTSA_v10003952mg [Eutrema salsugineum]
Length=544

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E PY F+TW VTYG ISP+GVPQQVILINGQFPGPK++  +N+N+I+N+ N+LD+P LLT
Sbjct  31   ESPYKFYTWTVTYGIISPLGVPQQVILINGQFPGPKLDVVTNDNIILNLINKLDQPFLLT  90

Query  337  WSGI  348
            W+GI
Sbjct  91   WNGI  94



>ref|XP_006393890.1| hypothetical protein EUTSA_v10003952mg [Eutrema salsugineum]
 gb|ESQ31176.1| hypothetical protein EUTSA_v10003952mg [Eutrema salsugineum]
Length=542

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E PY F+TW VTYG ISP+GVPQQVILINGQFPGPK++  +N+N+I+N+ N+LD+P LLT
Sbjct  31   ESPYKFYTWTVTYGIISPLGVPQQVILINGQFPGPKLDVVTNDNIILNLINKLDQPFLLT  90

Query  337  WSGI  348
            W+GI
Sbjct  91   WNGI  94



>ref|XP_002866726.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42985.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=543

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E PY F+TW VTYG ISP+GVPQQVILINGQFPGPK++  +N+N+I+N+ N+LD+P LLT
Sbjct  30   ESPYKFYTWTVTYGIISPLGVPQQVILINGQFPGPKLDVVTNDNIILNLINKLDQPFLLT  89

Query  337  WSGI  348
            W+GI
Sbjct  90   WNGI  93



>gb|KDP31876.1| hypothetical protein JCGZ_12337 [Jatropha curcas]
Length=538

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY ++TW VTYGTISP+G PQQVILINGQFPGP+++  +N+N+I+N+ N+LD+P LLT
Sbjct  25   DDPYRYYTWTVTYGTISPLGKPQQVILINGQFPGPRLDVVTNDNIILNLINKLDQPFLLT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>ref|XP_004233429.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=539

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY +FTW  TYG  SP+G PQQVILINGQFPGP+++  +N+N+++N+ N+LDEPLLLT
Sbjct  25   EDPYKYFTWTATYGMASPLGTPQQVILINGQFPGPRLDLVTNDNIVLNLINKLDEPLLLT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>gb|KDO79340.1| hypothetical protein CISIN_1g0092422mg, partial [Citrus sinensis]
Length=472

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY F+TW VT GT+SP+GVPQ+VILINGQFPGP+++  +N+N+I+NV N+LD+P LLT
Sbjct  26   DDPYRFYTWTVTSGTLSPLGVPQEVILINGQFPGPRLDVVTNDNIILNVINKLDQPFLLT  85

Query  337  WSGI  348
            W+GI
Sbjct  86   WNGI  89



>ref|XP_004232058.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=538

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            ED Y +FTW  TYGT+ P+GVPQQVILINGQFPGP+++  +N+NVI+N+ N+LDEPLLLT
Sbjct  25   EDTYKYFTWTATYGTLYPLGVPQQVILINGQFPGPRLDLVTNDNVILNLINKLDEPLLLT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>ref|XP_009376274.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=552

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYLFFTW VTYGTISP+GVPQQ ILINGQFPGP IN TSNNN+++NVFN LDEP LLT
Sbjct  23   EDPYLFFTWNVTYGTISPLGVPQQAILINGQFPGPNINSTSNNNIVLNVFNNLDEPFLLT  82

Query  337  WSGI  348
            WSGI
Sbjct  83   WSGI  86



>ref|XP_010278638.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=541

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTWKVTYG I P+GV Q+ ILINGQFPGP+I+C +N+N+IV+V+N LDEP L++
Sbjct  23   EDPYRFFTWKVTYGDIYPLGVKQRGILINGQFPGPQIDCVTNDNLIVSVYNYLDEPFLIS  82

Query  337  WSGI  348
            W+GI
Sbjct  83   WNGI  86



>ref|XP_002459273.1| hypothetical protein SORBIDRAFT_02g001610 [Sorghum bicolor]
 gb|EER95794.1| hypothetical protein SORBIDRAFT_02g001610 [Sorghum bicolor]
Length=291

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY +FTW VTYG I+P+G  QQ ILINGQFPGP+I+C +N+N++V V N LDEP LLT
Sbjct  24   DDPYRYFTWTVTYGPITPLGTTQQGILINGQFPGPRIDCVTNDNLVVTVLNALDEPFLLT  83

Query  337  WSGI  348
            W+GI
Sbjct  84   WNGI  87



>ref|XP_002866796.1| hypothetical protein ARALYDRAFT_490604 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43055.1| hypothetical protein ARALYDRAFT_490604 [Arabidopsis lyrata subsp. 
lyrata]
Length=541

 Score =   101 bits (251),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY FF W+VTYG ISP+G+PQ+ ILINGQ+PGP I   +N+N+I+NV N+LDEP LL+
Sbjct  14   DDPYRFFDWRVTYGNISPLGIPQRGILINGQYPGPDIYSVTNDNLIINVHNDLDEPFLLS  73

Query  337  WSGI  348
            W+G+
Sbjct  74   WNGV  77



>ref|XP_008241558.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=537

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYL++TW VTYG +SP+G+PQ+ ILINGQFPGP I   +N+N+IVNV N+LDEP L+T
Sbjct  26   EDPYLYYTWTVTYGLVSPLGIPQKGILINGQFPGPTIEAVTNDNIIVNVINKLDEPFLIT  85

Query  337  WSGI  348
            W+GI
Sbjct  86   WNGI  89



>emb|CDY12788.1| BnaC07g16450D [Brassica napus]
Length=543

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E PY F+TW VTYG ISP+GVPQQVILINGQFPGPK+   +N+N+I+N+ N+LD+P LLT
Sbjct  30   ESPYKFYTWTVTYGVISPLGVPQQVILINGQFPGPKLEVVTNDNIILNLINKLDQPFLLT  89

Query  337  WSGI  348
            W+GI
Sbjct  90   WNGI  93



>ref|XP_007203632.1| hypothetical protein PRUPE_ppa003976mg [Prunus persica]
 gb|EMJ04831.1| hypothetical protein PRUPE_ppa003976mg [Prunus persica]
Length=537

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYL++TW VTYG +SP+G+PQ+ ILINGQFPGP I   +N+N+IVNV N+LDEP L+T
Sbjct  26   EDPYLYYTWTVTYGLVSPLGIPQKGILINGQFPGPTIEAVTNDNIIVNVINKLDEPFLIT  85

Query  337  WSGI  348
            W+GI
Sbjct  86   WNGI  89



>emb|CDY31468.1| BnaC05g15770D [Brassica napus]
Length=551

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY+F+ W VTYGTISPMGV QQ ILIN  FPGP+I   +N+N+I+NVFNELDEP L++
Sbjct  29   EDPYIFYEWHVTYGTISPMGVQQQGILINKMFPGPEIRSVTNDNLIINVFNELDEPFLIS  88

Query  337  WSGI  348
            W+GI
Sbjct  89   WAGI  92



>ref|XP_008374029.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=552

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYLFFTW VTYGTISP+GVPQQ ILINGQFPGP IN TSNNN+++NVFN LDEP LLT
Sbjct  23   EDPYLFFTWNVTYGTISPLGVPQQAILINGQFPGPNINSTSNNNIVLNVFNNLDEPFLLT  82

Query  337  WSGI  348
            WSGI
Sbjct  83   WSGI  86



>gb|AGE09595.1| SKU5-like protein, partial [Eucalyptus cladocalyx]
Length=517

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY F+TW VTYGTI+P+GV QQVILINGQFPGPK+   +N+N+++N+ N+LD+P LLT
Sbjct  7    DDPYRFYTWTVTYGTIAPLGVSQQVILINGQFPGPKLEVVTNDNIVLNLINKLDQPFLLT  66

Query  337  WSGI  348
            W+GI
Sbjct  67   WNGI  70



>ref|XP_002270831.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
Length=536

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY ++TW VTYGTISP+GVPQQVILINGQFPGP +   +N+N+I+++ N+LD+P LLT
Sbjct  23   EDPYKYYTWTVTYGTISPLGVPQQVILINGQFPGPALEVVTNDNIILDLINKLDQPFLLT  82

Query  337  WSGI  348
            W+GI
Sbjct  83   WNGI  86



>dbj|BAB08634.1| pectinesterase like protein [Arabidopsis thaliana]
Length=544

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E PY F+TW VTYG ISP+GVPQQVILINGQFPGPK+   +N+N+I+N+ N+LD+P LLT
Sbjct  31   ESPYKFYTWTVTYGIISPLGVPQQVILINGQFPGPKLEVVTNDNIILNLINKLDQPFLLT  90

Query  337  WSGI  348
            W+GI
Sbjct  91   WNGI  94



>gb|AAM61328.1| pectinesterase-like protein [Arabidopsis thaliana]
Length=546

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E PY F+TW VTYG ISP+GVPQQVILINGQFPGPK+   +N+N+I+N+ N+LD+P LLT
Sbjct  33   ESPYKFYTWTVTYGIISPLGVPQQVILINGQFPGPKLEVVTNDNIILNLINKLDQPFLLT  92

Query  337  WSGI  348
            W+GI
Sbjct  93   WNGI  96



>gb|AFW82336.1| hypothetical protein ZEAMMB73_082637 [Zea mays]
Length=106

 Score = 95.1 bits (235),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYLFF WKVTYGT S +GVPQ+VILING+FPGP+INC+SNNN++VNVFN+LD PLL T
Sbjct  26   EDPYLFFEWKVTYGTRSLLGVPQKVILINGEFPGPRINCSSNNNIVVNVFNQLDHPLLFT  85

Query  337  WSG  345
            WSG
Sbjct  86   WSG  88



>ref|XP_010680456.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=537

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E PY ++ W++TYGTISP+GVPQ+ ILINGQFPGP INC +N+N+I+ ++N LDEP L+T
Sbjct  25   ESPYRYYDWEITYGTISPLGVPQRGILINGQFPGPTINCDTNDNLIITIYNRLDEPFLMT  84

Query  337  WSGI  348
            W+G+
Sbjct  85   WNGV  88



>ref|NP_569041.1| protein SKU5 similar 17 [Arabidopsis thaliana]
 gb|AAM19780.1| AT5g66920/MUD21_18 [Arabidopsis thaliana]
 gb|AAN38699.1| At5g66920/MUD21_18 [Arabidopsis thaliana]
 gb|AED98278.1| protein SKU5 similar 17 [Arabidopsis thaliana]
Length=546

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E PY F+TW VTYG ISP+GVPQQVILINGQFPGPK+   +N+N+I+N+ N+LD+P LLT
Sbjct  33   ESPYKFYTWTVTYGIISPLGVPQQVILINGQFPGPKLEVVTNDNIILNLINKLDQPFLLT  92

Query  337  WSGI  348
            W+GI
Sbjct  93   WNGI  96



>emb|CBI18560.3| unnamed protein product [Vitis vinifera]
Length=535

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY ++TW VTYGTISP+GVPQQVILINGQFPGP +   +N+N+I+++ N+LD+P LLT
Sbjct  22   EDPYKYYTWTVTYGTISPLGVPQQVILINGQFPGPALEVVTNDNIILDLINKLDQPFLLT  81

Query  337  WSGI  348
            W+GI
Sbjct  82   WNGI  85



>emb|CDY01453.1| BnaA07g12260D [Brassica napus]
Length=545

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E PY F+TW VTYG ISP+GVPQQVILINGQFPGPK+   +N+N+I+N+ N+LD+P LLT
Sbjct  32   ESPYKFYTWTVTYGVISPLGVPQQVILINGQFPGPKLEVVTNDNIILNLINKLDQPFLLT  91

Query  337  WSGI  348
            W+GI
Sbjct  92   WNGI  95



>gb|ACN34077.1| unknown [Zea mays]
 gb|AFW84771.1| L-ascorbate oxidase [Zea mays]
Length=559

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF WKVTYGT + MG  Q+VILIN  FPGP INC+SNNN++VNVFN LD+PLL T
Sbjct  31   EDPYHFFEWKVTYGTRTIMGTAQKVILINDMFPGPTINCSSNNNILVNVFNMLDQPLLFT  90

Query  337  WSGI  348
            W GI
Sbjct  91   WHGI  94



>ref|XP_009412658.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=545

 Score =   100 bits (250),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYLFFTW VTYGTISP+GVPQQ ILINGQFPGP IN T+NNN+++NVFN LDEP LLT
Sbjct  21   EDPYLFFTWNVTYGTISPLGVPQQGILINGQFPGPNINSTTNNNIVLNVFNNLDEPFLLT  80

Query  337  WSGI  348
            W+GI
Sbjct  81   WNGI  84



>ref|XP_009115829.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=541

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E PY F+TW VTYG ISP+GVPQQVILINGQFPGPK+   +N+N+I+N+ N+LD+P LLT
Sbjct  28   ESPYKFYTWTVTYGIISPLGVPQQVILINGQFPGPKLEVVTNDNIILNLINKLDQPFLLT  87

Query  337  WSGI  348
            W+GI
Sbjct  88   WNGI  91



>ref|XP_009103469.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=545

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E PY F+TW VTYG ISP+GVPQQVILINGQFPGPK+   +N+N+I+N+ N+LD+P LLT
Sbjct  32   ESPYKFYTWTVTYGVISPLGVPQQVILINGQFPGPKLEVVTNDNIILNLINKLDQPFLLT  91

Query  337  WSGI  348
            W+GI
Sbjct  92   WNGI  95



>ref|XP_006345828.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=552

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYL F WKVTYGTISP+GVPQQVILINGQFPGPKINCTSNNN++VNV N+LDEP L+T
Sbjct  21   EDPYLTFEWKVTYGTISPLGVPQQVILINGQFPGPKINCTSNNNIVVNVINQLDEPFLIT  80

Query  337  WSGI  348
            W GI
Sbjct  81   WKGI  84



>emb|CDY43557.1| BnaC02g16540D [Brassica napus]
Length=541

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E PY F+TW VTYG ISP+GVPQQVILINGQFPGPK+   +N+N+I+N+ N+LD+P LLT
Sbjct  28   ESPYKFYTWTVTYGIISPLGVPQQVILINGQFPGPKLEVVTNDNIILNLINKLDQPFLLT  87

Query  337  WSGI  348
            W+GI
Sbjct  88   WNGI  91



>ref|XP_008792598.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=538

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY +FTW VT+G ISP+GV QQ ILINGQFPGP+I+C +N+N+IV+V N++DEP+L+T
Sbjct  26   EDPYRYFTWTVTHGPISPLGVQQQGILINGQFPGPRIDCVTNDNMIVDVINKIDEPILIT  85

Query  337  WSGI  348
            W+GI
Sbjct  86   WNGI  89



>ref|XP_009101945.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=549

 Score =   100 bits (250),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W+VTYG I P+G+PQ+ ILINGQFPGP+I   +N+N+I+NV N+LDEP LL+
Sbjct  24   EDPYRFFDWRVTYGNIYPLGIPQRGILINGQFPGPEIYSVTNDNLIINVHNDLDEPFLLS  83

Query  337  WSGI  348
            W+G+
Sbjct  84   WNGV  87



>ref|XP_006283464.1| hypothetical protein CARUB_v10004509mg [Capsella rubella]
 gb|EOA16362.1| hypothetical protein CARUB_v10004509mg [Capsella rubella]
Length=554

 Score =   100 bits (250),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W+VTYGTISP+G+P + ILINGQ+PGP I   +N+N+I+NV N+LDEP LL+
Sbjct  29   EDPYRFFDWRVTYGTISPLGIPLRGILINGQYPGPDIYSVTNDNLIINVHNDLDEPFLLS  88

Query  337  WSGI  348
            W+G+
Sbjct  89   WNGV  92



>emb|CAB37498.1| putative pectinesterase [Arabidopsis thaliana]
 emb|CAB80507.1| putative pectinesterase [Arabidopsis thaliana]
Length=548

 Score =   100 bits (250),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY FF W+VTYG ISP+G+PQ+ ILINGQ+PGP I   +N+N+I+NV N+LDEP LL+
Sbjct  26   DDPYRFFDWRVTYGNISPLGIPQRGILINGQYPGPDIYSVTNDNLIINVHNDLDEPFLLS  85

Query  337  WSGI  348
            W+G+
Sbjct  86   WNGV  89



>ref|XP_011099705.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=538

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E PY F+TW VTYGTI P+GVPQQ ILINGQFPGP I   +N+N+IVNVFN LDEP L+ 
Sbjct  20   ESPYRFYTWNVTYGTIYPLGVPQQGILINGQFPGPDIYSVTNDNIIVNVFNSLDEPFLIH  79

Query  337  WSGI  348
            WSG+
Sbjct  80   WSGV  83



>ref|XP_003537368.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Glycine max]
 ref|XP_006590664.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Glycine max]
Length=537

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            ED Y ++TW VTYGTISP+G PQQVILINGQFPGP+++  +N NVI+N+ N+LDEP LLT
Sbjct  22   EDAYKYYTWTVTYGTISPLGSPQQVILINGQFPGPRLDLVTNENVILNLINKLDEPFLLT  81

Query  337  WSGI  348
            W+GI
Sbjct  82   WNGI  85



>gb|KHN42054.1| L-ascorbate oxidase like [Glycine soja]
Length=537

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            ED Y ++TW VTYGTISP+G PQQVILINGQFPGP+++  +N NVI+N+ N+LDEP LLT
Sbjct  22   EDAYKYYTWTVTYGTISPLGSPQQVILINGQFPGPRLDLVTNENVILNLINKLDEPFLLT  81

Query  337  WSGI  348
            W+GI
Sbjct  82   WNGI  85



>ref|XP_006838146.1| hypothetical protein AMTR_s00106p00093220 [Amborella trichopoda]
 gb|ERN00715.1| hypothetical protein AMTR_s00106p00093220 [Amborella trichopoda]
Length=546

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E+PY +F W +TYGTISP+GVPQ+ ILIN +FPGP IN T+N+N++VNVFN LD+P LL+
Sbjct  20   ENPYRYFNWNITYGTISPLGVPQKAILINNEFPGPNINSTTNDNIVVNVFNNLDQPFLLS  79

Query  337  WSGI  348
            W+GI
Sbjct  80   WNGI  83



>ref|NP_195555.2| protein SKU5 similar 9 [Arabidopsis thaliana]
 gb|AAL60036.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAM20243.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AEE86927.1| protein SKU5 similar 9 [Arabidopsis thaliana]
Length=549

 Score =   100 bits (250),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY FF W+VTYG ISP+G+PQ+ ILINGQ+PGP I   +N+N+I+NV N+LDEP LL+
Sbjct  26   DDPYRFFDWRVTYGNISPLGIPQRGILINGQYPGPDIYSVTNDNLIINVHNDLDEPFLLS  85

Query  337  WSGI  348
            W+G+
Sbjct  86   WNGV  89



>emb|CAB08077.1| pectinesterase [Solanum lycopersicum]
Length=504

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY +F W VTYGTI P+GVPQQ ILINGQFPGP IN  +N+N+++N+ N LDEP LL+
Sbjct  1    EDPYRYFDWNVTYGTIYPLGVPQQGILINGQFPGPDINSVTNDNLVINIHNSLDEPFLLS  60

Query  337  WSGI  348
            W+GI
Sbjct  61   WNGI  64



>ref|XP_006280268.1| hypothetical protein CARUB_v10026189mg [Capsella rubella]
 gb|EOA13166.1| hypothetical protein CARUB_v10026189mg [Capsella rubella]
Length=545

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E PY F+TW VTYG ISP+GVPQQVILINGQFPGPK+   +N+N+I+N+ N+LD+P LLT
Sbjct  33   ESPYKFYTWTVTYGIISPLGVPQQVILINGQFPGPKLEVVTNDNIILNLINKLDQPFLLT  92

Query  337  WSGI  348
            W+GI
Sbjct  93   WNGI  96



>ref|XP_006425823.1| hypothetical protein CICLE_v10025326mg [Citrus clementina]
 ref|XP_006466654.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|ESR39063.1| hypothetical protein CICLE_v10025326mg [Citrus clementina]
Length=539

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY F+TW VT GT+SP+GVPQ+VILINGQFPGP+++  +N+N+I+NV N+LD+P LLT
Sbjct  26   DDPYRFYTWTVTSGTLSPLGVPQEVILINGQFPGPRLDVVTNDNIILNVINKLDQPFLLT  85

Query  337  WSGI  348
            W+GI
Sbjct  86   WNGI  89



>gb|EYU38005.1| hypothetical protein MIMGU_mgv1a004001mg [Erythranthe guttata]
Length=550

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTW +TYG ISP+GVPQQ ILINGQFPGP I   +N+N+I+NVFN L EP LL+
Sbjct  23   EDPYRFFTWNITYGDISPLGVPQQGILINGQFPGPDIYSVTNDNIIINVFNNLPEPFLLS  82

Query  337  WSGI  348
            W+GI
Sbjct  83   WNGI  86



>ref|XP_010464737.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=545

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E PY F+TW  TYG ISP+GVPQQVILINGQFPGPK++  +N+N+I+N+ N+LD+P LLT
Sbjct  33   ESPYKFYTWTATYGIISPLGVPQQVILINGQFPGPKLDVVTNDNIILNLINKLDQPFLLT  92

Query  337  WSGI  348
            W+GI
Sbjct  93   WNGI  96



>ref|XP_006416260.1| hypothetical protein EUTSA_v10007292mg [Eutrema salsugineum]
 gb|ESQ34613.1| hypothetical protein EUTSA_v10007292mg [Eutrema salsugineum]
Length=545

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W VTYG ISP+GV QQ ILING+FPGP I   +N+N+I+NVFN+LDEP L++
Sbjct  28   EDPYRFFEWHVTYGNISPLGVEQQGILINGKFPGPDIYSVTNDNLIINVFNQLDEPFLIS  87

Query  337  WSGI  348
            WSGI
Sbjct  88   WSGI  91



>gb|EMT24760.1| L-ascorbate oxidase-like protein [Aegilops tauschii]
Length=530

 Score =   100 bits (249),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY +FTW VTYG I+P+G  QQ ILINGQFPGP+I+C +N+N+IVNV N LDEP L+T
Sbjct  27   DDPYRYFTWTVTYGPINPLGTTQQGILINGQFPGPRIDCVTNDNLIVNVVNNLDEPFLIT  86

Query  337  WSGI  348
            W+GI
Sbjct  87   WNGI  90



>ref|XP_007156841.1| hypothetical protein PHAVU_002G021900g [Phaseolus vulgaris]
 gb|ESW28835.1| hypothetical protein PHAVU_002G021900g [Phaseolus vulgaris]
Length=540

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            ED Y F+TW VTYG +SP+G PQQVILINGQFPGPK++  +N+NVI+N+ N+LDEP LLT
Sbjct  25   EDAYKFYTWTVTYGNLSPLGSPQQVILINGQFPGPKLDLVTNDNVILNLINKLDEPFLLT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>ref|XP_006657750.1| PREDICTED: L-ascorbate oxidase homolog [Oryza brachyantha]
Length=551

 Score =   100 bits (249),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY FFTW VTYG I+P+GV QQ ILINGQFPGP+I   +N+N+I+NVFN L EP LL+
Sbjct  31   DDPYRFFTWTVTYGDIAPLGVKQQGILINGQFPGPQIEAVTNDNLIINVFNNLTEPFLLS  90

Query  337  WSGI  348
            W+GI
Sbjct  91   WNGI  94



>ref|XP_010539810.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=542

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTW VTYG I P+GV QQ ILINGQFPGP +   +N+N+I+NVFN LDEP L++
Sbjct  24   EDPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDVRSVTNDNLIINVFNSLDEPFLIS  83

Query  337  WSGI  348
            WSGI
Sbjct  84   WSGI  87



>ref|XP_008457817.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=539

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY ++T++VTYGT +P+GV Q+VIL+NGQFP PKI C +N+N+IVNV N+LDEP L T
Sbjct  28   EDPYRYYTFQVTYGTRAPLGVAQKVILVNGQFPAPKIECATNDNIIVNVINKLDEPFLFT  87

Query  337  WSGI  348
            WSG+
Sbjct  88   WSGV  91



>emb|CDY64276.1| BnaCnng43630D [Brassica napus]
Length=614

 Score =   100 bits (249),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W+VTY  I P+G+PQ+ ILINGQFPGP+I   +N+N+I+NV N+LDEP LL+
Sbjct  87   EDPYRFFDWRVTYSNIYPLGIPQRGILINGQFPGPEIYSVTNDNLIINVHNDLDEPFLLS  146

Query  337  WSGI  348
            W+G+
Sbjct  147  WNGV  150



>ref|XP_010263761.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=538

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY ++TW VTYGTI+P+GVPQQ ILINGQFPGP ++  +N+N+I+N+ N+LD+P LLT
Sbjct  25   EDPYKYYTWTVTYGTIAPLGVPQQAILINGQFPGPILDVVTNDNIILNLINKLDQPFLLT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>ref|XP_010484570.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=543

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E PY F+TW  TYG ISP+GVPQQVILINGQFPGPK++  +N+N+I+N+ N+LD+P LLT
Sbjct  31   ESPYKFYTWTATYGIISPLGVPQQVILINGQFPGPKLDVVTNDNIILNLINKLDQPFLLT  90

Query  337  WSGI  348
            W+GI
Sbjct  91   WNGI  94



>ref|XP_010444713.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=545

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E PY F+TW  TYG ISP+GVPQQVILINGQFPGPK++  +N+N+I+N+ N+LD+P LLT
Sbjct  33   ESPYKFYTWTATYGIISPLGVPQQVILINGQFPGPKLDVVTNDNIILNLINKLDQPFLLT  92

Query  337  WSGI  348
            W+GI
Sbjct  93   WNGI  96



>ref|XP_010028301.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 ref|XP_010028302.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW55013.1| hypothetical protein EUGRSUZ_I00988 [Eucalyptus grandis]
 gb|KCW55014.1| hypothetical protein EUGRSUZ_I00988 [Eucalyptus grandis]
Length=538

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY F+TW VTYGTI+P+GV QQVILINGQFPGPK+   +N+N+++N+ N LD+P LLT
Sbjct  25   DDPYRFYTWTVTYGTIAPLGVSQQVILINGQFPGPKLEVVTNDNIVLNLINNLDQPFLLT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>gb|KCW55012.1| hypothetical protein EUGRSUZ_I00988 [Eucalyptus grandis]
Length=591

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY F+TW VTYGTI+P+GV QQVILINGQFPGPK+   +N+N+++N+ N LD+P LLT
Sbjct  78   DDPYRFYTWTVTYGTIAPLGVSQQVILINGQFPGPKLEVVTNDNIVLNLINNLDQPFLLT  137

Query  337  WSGI  348
            W+GI
Sbjct  138  WNGI  141



>gb|EYU39285.1| hypothetical protein MIMGU_mgv1a026945mg [Erythranthe guttata]
Length=558

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY+F  WKVTYGTISP+GVPQQ ILINGQFPGPKINCTSNNN++VNVFN LDEPLL T
Sbjct  26   EDPYVFLEWKVTYGTISPLGVPQQGILINGQFPGPKINCTSNNNIVVNVFNHLDEPLLFT  85

Query  337  WSGI  348
            W+GI
Sbjct  86   WTGI  89



>ref|XP_006342102.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=540

 Score = 99.8 bits (247),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY +F W VTYGTI P+GVPQQ ILINGQFPGP IN  +N+N+++N+ N LDEP LL+
Sbjct  23   EDPYRYFDWNVTYGTIYPLGVPQQGILINGQFPGPDINSVTNDNLVINIHNSLDEPFLLS  82

Query  337  WSGI  348
            W+G+
Sbjct  83   WNGV  86



>ref|XP_006390228.1| hypothetical protein EUTSA_v10018373mg [Eutrema salsugineum]
 gb|ESQ27514.1| hypothetical protein EUTSA_v10018373mg [Eutrema salsugineum]
Length=515

 Score = 99.8 bits (247),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W VTYG I P+GV QQ ILINGQFPGP I+  +N+N+I+NV+N LDEP LL+
Sbjct  24   EDPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  337  WSGI  348
            W+GI
Sbjct  84   WNGI  87



>emb|CAN72539.1| hypothetical protein VITISV_028750 [Vitis vinifera]
Length=503

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDP  ++TW VTYGTISP+G PQQ ILINGQFPGP I+C +N+N+IV V N+LD+P L+T
Sbjct  25   EDPSRYYTWTVTYGTISPLGSPQQGILINGQFPGPTIDCVTNDNIIVTVINKLDKPFLIT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>ref|XP_010436936.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=553

 Score = 99.8 bits (247),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W+VTYG ISP+G+P + ILINGQ+PGP I   +N+N+I+NV NELDEP LL+
Sbjct  25   EDPYRFFDWRVTYGNISPLGIPLKGILINGQYPGPDIYSVTNDNLIINVHNELDEPFLLS  84

Query  337  WSGI  348
            W+G+
Sbjct  85   WNGV  88



>emb|CAH67167.1| H0211B05.4 [Oryza sativa Indica Group]
Length=554

 Score = 99.8 bits (247),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W+VT G I+P+GV QQ ILINGQFPGP+I+C +N+N+IVNV N L EP LL+
Sbjct  27   EDPYRFFDWEVTTGNINPLGVQQQGILINGQFPGPEIDCQTNDNLIVNVHNRLSEPFLLS  86

Query  337  WSGI  348
            W+G+
Sbjct  87   WNGL  90



>ref|NP_001053555.1| Os04g0561900 [Oryza sativa Japonica Group]
 emb|CAE01850.2| OSJNBa0084K11.18 [Oryza sativa Japonica Group]
 dbj|BAF15469.1| Os04g0561900 [Oryza sativa Japonica Group]
 dbj|BAG92144.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92535.1| unnamed protein product [Oryza sativa Japonica Group]
Length=554

 Score = 99.8 bits (247),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W+VT G I+P+GV QQ ILINGQFPGP+I+C +N+N+IVNV N L EP LL+
Sbjct  27   EDPYRFFDWEVTTGNINPLGVQQQGILINGQFPGPEIDCQTNDNLIVNVHNRLSEPFLLS  86

Query  337  WSGI  348
            W+G+
Sbjct  87   WNGL  90



>ref|XP_006466655.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
Length=541

 Score = 99.8 bits (247),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY  +TW VTYGTISP GVPQQ ILINGQFPGP I   +N+N+IVN+ N+LDEP L+T
Sbjct  25   EDPYRSYTWTVTYGTISPFGVPQQGILINGQFPGPAIEAVTNDNIIVNLINKLDEPFLIT  84

Query  337  WSGI  348
            W+G+
Sbjct  85   WNGV  88



>ref|XP_004238406.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=540

 Score = 99.8 bits (247),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY +F W VTYGTI P+GVPQQ ILINGQFPGP IN  +N+N+++N+ N LDEP LL+
Sbjct  23   EDPYRYFDWNVTYGTIYPLGVPQQGILINGQFPGPDINSVTNDNLVINIHNSLDEPFLLS  82

Query  337  WSGI  348
            W+G+
Sbjct  83   WNGV  86



>ref|XP_010431777.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=553

 Score = 99.8 bits (247),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W+VTYG ISP+G+P + ILINGQ+PGP I   +N+N+I+NV NELDEP LL+
Sbjct  25   EDPYRFFDWRVTYGNISPLGIPLKGILINGQYPGPDIYSVTNDNLIINVHNELDEPFLLS  84

Query  337  WSGI  348
            W+G+
Sbjct  85   WNGV  88



>ref|XP_010558427.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=539

 Score = 99.8 bits (247),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY ++TW VTYG ISP+GVPQQVI INGQFPGP+++  +N+N+I+N+ N+LD+P LLT
Sbjct  26   DDPYKYYTWTVTYGIISPLGVPQQVIFINGQFPGPRLDVVTNDNIILNLINKLDQPFLLT  85

Query  337  WSGI  348
            W+GI
Sbjct  86   WNGI  89



>gb|KDO79346.1| hypothetical protein CISIN_1g009171mg [Citrus sinensis]
Length=541

 Score = 99.8 bits (247),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY  +TW VTYGTISP GVPQQ ILINGQFPGP I   +N+N+IVN+ N+LDEP L+T
Sbjct  25   EDPYRSYTWTVTYGTISPFGVPQQGILINGQFPGPAIEAVTNDNIIVNLINKLDEPFLIT  84

Query  337  WSGI  348
            W+G+
Sbjct  85   WNGV  88



>ref|XP_007155969.1| hypothetical protein PHAVU_003G247700g [Phaseolus vulgaris]
 gb|ESW27963.1| hypothetical protein PHAVU_003G247700g [Phaseolus vulgaris]
Length=543

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            ED Y ++TW VTYGT+SP+G PQQVILINGQFPGP+++  +N+NV++N+ N+LDEP LLT
Sbjct  27   EDSYKYYTWTVTYGTLSPLGTPQQVILINGQFPGPQLDLVTNDNVVLNLVNKLDEPFLLT  86

Query  337  WSGI  348
            W+GI
Sbjct  87   WNGI  90



>ref|XP_009149524.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=551

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY+F+ W VTYGTISPMGV QQ ILIN  FPGP+I   +N+N+I+NVFNELDEP L++
Sbjct  29   EDPYIFYEWHVTYGTISPMGVQQQGILINKMFPGPEILSVTNDNLIINVFNELDEPFLIS  88

Query  337  WSGI  348
            W+GI
Sbjct  89   WAGI  92



>ref|XP_006425822.1| hypothetical protein CICLE_v10027285mg, partial [Citrus clementina]
 gb|ESR39062.1| hypothetical protein CICLE_v10027285mg, partial [Citrus clementina]
Length=554

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY  +TW VTYGTISP GVPQQ ILINGQFPGP I   +N+N+IVN+ N+LDEP L+T
Sbjct  38   EDPYRSYTWTVTYGTISPFGVPQQGILINGQFPGPAIEAVTNDNIIVNLINKLDEPFLIT  97

Query  337  WSGI  348
            W+G+
Sbjct  98   WNGV  101



>ref|XP_002268020.2| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
Length=537

 Score = 99.4 bits (246),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDP  ++TW VTYGTISP+G PQQ ILINGQFPGP I+C +N+N+IV V N+LD+P L+T
Sbjct  25   EDPSRYYTWTVTYGTISPLGSPQQGILINGQFPGPTIDCVTNDNIIVTVINKLDKPFLIT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>emb|CDY18626.1| BnaA09g07690D [Brassica napus]
Length=541

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E PY F+TW VTYG I P+GVPQQVILINGQFPGPK++  +N+N+I+N+ N+LD+P LLT
Sbjct  28   ESPYKFYTWTVTYGIIYPLGVPQQVILINGQFPGPKLDVVTNDNIILNLINKLDQPFLLT  87

Query  337  WSGI  348
            W+GI
Sbjct  88   WNGI  91



>ref|XP_009112343.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=541

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E PY F+TW VTYG I P+GVPQQVILINGQFPGPK++  +N+N+I+N+ N+LD+P LLT
Sbjct  28   ESPYKFYTWTVTYGIIYPLGVPQQVILINGQFPGPKLDVVTNDNIILNLINKLDQPFLLT  87

Query  337  WSGI  348
            W+GI
Sbjct  88   WNGI  91



>ref|XP_009339220.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=552

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYLFFTW VTYGTISP+GVPQQ ILINGQFPGP IN TSNNN+++NVFN LDEP LLT
Sbjct  23   EDPYLFFTWNVTYGTISPLGVPQQAILINGQFPGPNINSTSNNNIVLNVFNNLDEPFLLT  82

Query  337  WSGI  348
            W+G+
Sbjct  83   WNGV  86



>ref|XP_009794442.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=541

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY F+TW +TYG + P+GV QQ ILINGQFPGP I C +N+N+I+NVFN LDEP L++
Sbjct  24   EDPYRFYTWNITYGDVYPLGVKQQGILINGQFPGPTIECVTNDNLIINVFNNLDEPFLIS  83

Query  337  WSGI  348
            W+G+
Sbjct  84   WNGV  87



>emb|CDX81353.1| BnaC09g07640D [Brassica napus]
Length=541

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E PY F+TW VTYG I P+GVPQQVILINGQFPGPK++  +N+N+I+N+ N+LD+P LLT
Sbjct  28   ESPYKFYTWTVTYGIIYPLGVPQQVILINGQFPGPKLDVVTNDNIILNLINKLDQPFLLT  87

Query  337  WSGI  348
            W+GI
Sbjct  88   WNGI  91



>ref|XP_003550444.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
 gb|KHN48525.1| L-ascorbate oxidase like [Glycine soja]
Length=541

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTW VTYG I P+GV QQ ILINGQFPGP I+  +N+N+I+NVFN LD+P LL+
Sbjct  23   EDPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDQPFLLS  82

Query  337  WSGI  348
            W+G+
Sbjct  83   WNGV  86



>gb|KGN62015.1| hypothetical protein Csa_2G286480 [Cucumis sativus]
Length=478

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY +FT++VTYGT +P+G  Q+VIL+NGQFP PKI C +N+N+IVNV N+LDEP L T
Sbjct  29   EDPYRYFTFQVTYGTRAPLGFNQKVILVNGQFPAPKIECVTNDNIIVNVINKLDEPFLFT  88

Query  337  WSGI  348
            WSG+
Sbjct  89   WSGV  92



>ref|XP_006416404.1| hypothetical protein EUTSA_v10007361mg [Eutrema salsugineum]
 gb|ESQ34757.1| hypothetical protein EUTSA_v10007361mg [Eutrema salsugineum]
Length=524

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W VTYGTISPMGV QQ ILIN  FPGP+I   +N+N+I+NVFN+LDEP L++
Sbjct  13   EDPYKFFEWHVTYGTISPMGVQQQGILINKMFPGPEIRSVTNDNLIINVFNKLDEPFLIS  72

Query  337  WSGI  348
            W GI
Sbjct  73   WGGI  76



>emb|CBI18561.3| unnamed protein product [Vitis vinifera]
Length=601

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDP  ++TW VTYGTISP+G PQQ ILINGQFPGP I+C +N+N+IV V N+LD+P L+T
Sbjct  89   EDPSRYYTWTVTYGTISPLGSPQQGILINGQFPGPTIDCVTNDNIIVTVINKLDKPFLIT  148

Query  337  WSGI  348
            W+GI
Sbjct  149  WNGI  152



>ref|XP_010498473.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=538

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY +F W +TYG I PMGV QQ ILIN  FPGP+I C +N+N+I+NVFN LDEP L++
Sbjct  25   EDPYRYFQWHITYGDIYPMGVKQQGILINKMFPGPEIRCVTNDNLIINVFNHLDEPFLIS  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WAGI  88



>ref|XP_010459724.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Camelina sativa]
Length=548

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY +F W +TYG I PMGV QQ ILIN  FPGP+I C +N+N+I+NVFN LDEP L++
Sbjct  35   EDPYRYFQWHITYGDIYPMGVKQQGILINKMFPGPEIRCVTNDNLIINVFNHLDEPFLIS  94

Query  337  WSGI  348
            W+GI
Sbjct  95   WAGI  98



>ref|XP_004291312.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=545

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W VTYG I P+GV Q+ ILINGQFPGP IN  +N+N+I+NVFN LDEP LL+
Sbjct  27   EDPYRFFQWNVTYGDIYPLGVRQRGILINGQFPGPDINSVTNDNLIINVFNSLDEPFLLS  86

Query  337  WSGI  348
            W+GI
Sbjct  87   WNGI  90



>gb|EMS54595.1| L-ascorbate oxidase-like protein [Triticum urartu]
Length=553

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY +FTW VTYG I+P+G  QQ ILINGQFPGP+I+C +N+N+IVNV N LDEP L+T
Sbjct  101  DDPYRYFTWIVTYGPINPLGAIQQGILINGQFPGPRIDCVTNDNLIVNVVNNLDEPFLIT  160

Query  337  WSGI  348
            W+GI
Sbjct  161  WNGI  164



>ref|XP_010459725.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Camelina sativa]
Length=537

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY +F W +TYG I PMGV QQ ILIN  FPGP+I C +N+N+I+NVFN LDEP L++
Sbjct  24   EDPYRYFQWHITYGDIYPMGVKQQGILINKMFPGPEIRCVTNDNLIINVFNHLDEPFLIS  83

Query  337  WSGI  348
            W+GI
Sbjct  84   WAGI  87



>ref|XP_009766183.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=558

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYLFF W VTYGTI+P+GVPQQ ILINGQ PGP+INCTSNNN++VNV+N LDEPLLLT
Sbjct  25   EDPYLFFEWNVTYGTIAPLGVPQQGILINGQLPGPRINCTSNNNIVVNVYNNLDEPLLLT  84

Query  337  WSGI  348
            WSGI
Sbjct  85   WSGI  88



>tpg|DAA62868.1| TPA: hypothetical protein ZEAMMB73_701617, partial [Zea mays]
Length=237

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY FFTW VTYG I P+GV QQ ILIN QFPGP+I   +N+N+I+NVFN+L+EP LL+
Sbjct  30   DDPYRFFTWTVTYGDIYPLGVKQQGILINNQFPGPQIEAVTNDNLIINVFNKLNEPFLLS  89

Query  337  WSGI  348
            WSG+
Sbjct  90   WSGL  93



>gb|EEC82126.1| hypothetical protein OsI_26158 [Oryza sativa Indica Group]
Length=546

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY FFTW VTYG I+P+GV QQ ILINGQFPGP I   +N+N+I+NVFN+L++P L++
Sbjct  25   DDPYRFFTWTVTYGDITPLGVKQQGILINGQFPGPTIEAVTNDNLIINVFNKLNDPFLIS  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>ref|XP_010547509.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=541

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY ++TW  TYG ISP+GVPQQVILINGQFPGP+++  +N+N+++N+ N+LD+P LLT
Sbjct  28   DDPYKYYTWTATYGIISPLGVPQQVILINGQFPGPRLDLLTNDNIVLNLINKLDQPFLLT  87

Query  337  WSGI  348
            W+GI
Sbjct  88   WNGI  91



>tpg|DAA62867.1| TPA: hypothetical protein ZEAMMB73_701617 [Zea mays]
Length=217

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY FFTW VTYG I P+GV QQ ILIN QFPGP+I   +N+N+I+NVFN+L+EP LL+
Sbjct  30   DDPYRFFTWTVTYGDIYPLGVKQQGILINNQFPGPQIEAVTNDNLIINVFNKLNEPFLLS  89

Query  337  WSGI  348
            WSG+
Sbjct  90   WSGL  93



>gb|ACL53812.1| unknown [Zea mays]
 tpg|DAA62866.1| TPA: L-ascorbate oxidase [Zea mays]
Length=550

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY FFTW VTYG I P+GV QQ ILIN QFPGP+I   +N+N+I+NVFN+L+EP LL+
Sbjct  30   DDPYRFFTWTVTYGDIYPLGVKQQGILINNQFPGPQIEAVTNDNLIINVFNKLNEPFLLS  89

Query  337  WSGI  348
            WSG+
Sbjct  90   WSGL  93



>dbj|BAC83966.1| putative PS60 [Oryza sativa Japonica Group]
Length=563

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY FFTW VTYG I+P+GV QQ ILINGQFPGP I   +N+N+I+NVFN+L++P L++
Sbjct  25   DDPYRFFTWTVTYGDITPLGVKQQGILINGQFPGPTIEAVTNDNLIINVFNKLNDPFLIS  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>gb|EEE67250.1| hypothetical protein OsJ_24405 [Oryza sativa Japonica Group]
Length=546

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY FFTW VTYG I+P+GV QQ ILINGQFPGP I   +N+N+I+NVFN+L++P L++
Sbjct  25   DDPYRFFTWTVTYGDITPLGVKQQGILINGQFPGPTIEAVTNDNLIINVFNKLNDPFLIS  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>ref|XP_006657409.1| PREDICTED: L-ascorbate oxidase homolog [Oryza brachyantha]
Length=543

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/65 (69%), Positives = 54/65 (83%), Gaps = 1/65 (2%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMG-VPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLL  333
            +DPY FFTW VTYG I+P+G   QQ ILINGQFPGP+I+C +N+N+IVNV N LDEP LL
Sbjct  24   DDPYRFFTWSVTYGPINPLGSTQQQGILINGQFPGPRIDCVTNDNIIVNVINNLDEPFLL  83

Query  334  TWSGI  348
            TW+GI
Sbjct  84   TWNGI  88



>ref|XP_009596487.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=544

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY F+TW VTYG I P+G+ QQ ILINGQFPGP I C +N+N+I+NVFN LDEP L++
Sbjct  27   EDPYRFYTWNVTYGDIYPLGLKQQGILINGQFPGPPIECVTNDNLIINVFNNLDEPFLIS  86

Query  337  WSGI  348
            W+G+
Sbjct  87   WNGV  90



>gb|EYU32815.1| hypothetical protein MIMGU_mgv1a003910mg [Erythranthe guttata]
Length=555

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYLFF WKVTYGTI+P+GVPQQ ILING+FPGP INCTSNNN++VNVFN LDEPLLLT
Sbjct  23   EDPYLFFDWKVTYGTIAPLGVPQQGILINGEFPGPVINCTSNNNIVVNVFNYLDEPLLLT  82

Query  337  WSGI  348
            W+GI
Sbjct  83   WAGI  86



>ref|XP_004243477.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=537

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY F+ W VTYG I P+GV QQ ILINGQFPGP I C +N+N+I+NVFN LDEP L++
Sbjct  27   EDPYRFYAWNVTYGDIYPLGVKQQGILINGQFPGPPIQCVTNDNLIINVFNNLDEPFLIS  86

Query  337  WSGI  348
            W+G+
Sbjct  87   WNGV  90



>gb|KEH20500.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=541

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            ED Y +FTW VTYGT+SP+G PQQVILINGQFPGP+++  +N NV++N+ N+LD+P LLT
Sbjct  27   EDGYKYFTWTVTYGTLSPLGTPQQVILINGQFPGPQLDLVTNENVVLNLVNKLDQPFLLT  86

Query  337  WSGI  348
            W+GI
Sbjct  87   WNGI  90



>ref|XP_010028303.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW55016.1| hypothetical protein EUGRSUZ_I00990 [Eucalyptus grandis]
Length=538

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY +F W+VTYGTISP+GV QQ ILINGQFPGP I   +N+N+++NV N+LDEP LLT
Sbjct  26   EDPYRYFNWEVTYGTISPLGVSQQGILINGQFPGPPIEAITNDNIVLNVVNKLDEPFLLT  85

Query  337  WSGI  348
            W G+
Sbjct  86   WKGV  89



>ref|XP_011039228.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=538

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY ++TW VTYGT+  + VPQQVILINGQFPGP+++  +N+N+I+N+FN+LD+P LLT
Sbjct  25   DDPYRYYTWTVTYGTVKLLDVPQQVILINGQFPGPRLDVVTNDNIILNLFNKLDQPFLLT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>ref|XP_011013814.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=538

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY ++TW VTYGT+  + VPQQVILINGQFPGP+++  +N+N+I+N+FN+LD+P LLT
Sbjct  25   DDPYRYYTWTVTYGTVKLLDVPQQVILINGQFPGPRLDVVTNDNIILNLFNKLDQPFLLT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>ref|XP_002310162.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE90612.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=538

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY ++TW VTYGT+  + VPQQVILINGQFPGP+++  +N+N+I+N+FN+LD+P LLT
Sbjct  25   DDPYRYYTWTVTYGTVKLLDVPQQVILINGQFPGPRLDVVTNDNIILNLFNKLDQPFLLT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>ref|XP_004148037.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
 ref|XP_004161722.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=541

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY +FT++VTYGT +P+G  Q+VIL+NGQFP PKI C +N+N+IVNV N+LDEP L T
Sbjct  29   EDPYRYFTFQVTYGTRAPLGFNQKVILVNGQFPAPKIECVTNDNIIVNVINKLDEPFLFT  88

Query  337  WSGI  348
            WSG+
Sbjct  89   WSGV  92



>ref|XP_002460757.1| hypothetical protein SORBIDRAFT_02g034420 [Sorghum bicolor]
 gb|EER97278.1| hypothetical protein SORBIDRAFT_02g034420 [Sorghum bicolor]
Length=548

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY FFTW VTYG I P+GV QQ ILIN QFPGP+I   +N+N+I+NVFN+L+EP LL+
Sbjct  30   DDPYRFFTWTVTYGDIYPLGVKQQGILINNQFPGPQIEAVTNDNLIINVFNKLNEPFLLS  89

Query  337  WSGI  348
            WSG+
Sbjct  90   WSGL  93



>ref|XP_008452926.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
 gb|ADN34135.1| multicopper oxidase [Cucumis melo subsp. melo]
Length=541

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E+PY FFTW V+Y  I P+GV QQ ILINGQFPGP I+C +N+N+I+NVFN LDEP L++
Sbjct  24   ENPYRFFTWNVSYANIYPLGVRQQGILINGQFPGPDIHCVTNDNLIINVFNSLDEPFLIS  83

Query  337  WSGI  348
            W+GI
Sbjct  84   WNGI  87



>ref|XP_007208287.1| hypothetical protein PRUPE_ppa003715mg [Prunus persica]
 gb|EMJ09486.1| hypothetical protein PRUPE_ppa003715mg [Prunus persica]
Length=554

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYL+FTW VTYGTISP+GVPQQ ILINGQFPGP IN TSNNN+++NVFN LDEPLL T
Sbjct  23   EDPYLYFTWNVTYGTISPLGVPQQGILINGQFPGPNINSTSNNNIVLNVFNNLDEPLLFT  82

Query  337  WSGI  348
            WSG+
Sbjct  83   WSGV  86



>ref|XP_008219681.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=554

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYL+FTW VTYGTISP+GVPQQ ILINGQFPGP IN TSNNN+++NVFN LDEPLL T
Sbjct  23   EDPYLYFTWNVTYGTISPLGVPQQGILINGQFPGPNINSTSNNNIVLNVFNNLDEPLLFT  82

Query  337  WSGI  348
            WSG+
Sbjct  83   WSGV  86



>ref|NP_173604.1| SKU5 similar 7 protein [Arabidopsis thaliana]
 gb|AAF16543.1|AC013482_17 T26F17.7 [Arabidopsis thaliana]
 gb|AEE30163.1| SKU5 similar 7 protein [Arabidopsis thaliana]
Length=538

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W VTYG ISP+GV QQ ILING+FPGP I   +N+N+I+NVFN LDEP LL+
Sbjct  25   EDPYRFFEWHVTYGNISPLGVAQQGILINGKFPGPDIISITNDNLIINVFNHLDEPFLLS  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>ref|XP_002522337.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF40021.1| multicopper oxidase, putative [Ricinus communis]
Length=539

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY ++TW VT GTISP+G PQQVILINGQFPGP+++  +N+N+I+N+ N+LD+P LLT
Sbjct  26   DDPYRYYTWTVTDGTISPLGSPQQVILINGQFPGPRLDVVTNDNIILNLINKLDQPFLLT  85

Query  337  WSGI  348
            W+GI
Sbjct  86   WNGI  89



>gb|KFK28370.1| hypothetical protein AALP_AA8G506600 [Arabis alpina]
Length=544

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E PY ++TW VTYG ISP+GVPQQVILINGQFPGP ++  +N+N+I+N+ N+LD+P LLT
Sbjct  31   ESPYKYYTWTVTYGIISPLGVPQQVILINGQFPGPTLDVVTNDNIILNLINKLDQPFLLT  90

Query  337  WSGI  348
            W+GI
Sbjct  91   WNGI  94



>ref|NP_001152000.1| L-ascorbate oxidase precursor [Zea mays]
 gb|ACG45329.1| L-ascorbate oxidase precursor [Zea mays]
Length=550

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY FFTW VTYG I P+GV QQ ILIN QFPGP+I   +N+N+I+NVFN+L+EP LL+
Sbjct  30   DDPYRFFTWTVTYGDIYPLGVKQQGILINNQFPGPQIEAVTNDNLIINVFNKLNEPFLLS  89

Query  337  WSGI  348
            WSG+
Sbjct  90   WSGL  93



>ref|XP_006367595.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=567

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYLFF W VTYGTI+P+GVPQQ ILINGQ PGP+INCTSNNN++VNV+N+LDEPLLLT
Sbjct  27   EDPYLFFEWNVTYGTIAPLGVPQQGILINGQLPGPRINCTSNNNIVVNVYNKLDEPLLLT  86

Query  337  WSGI  348
            W+GI
Sbjct  87   WNGI  90



>ref|XP_004287955.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=542

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY F+ W VTYG I P+GV QQ ILINGQFPGP+I+C +N+N+I++VFN LDEP L++
Sbjct  24   EDPYRFYNWNVTYGDIYPLGVKQQGILINGQFPGPQIDCVTNDNLIISVFNSLDEPFLIS  83

Query  337  WSGI  348
            W+G+
Sbjct  84   WNGV  87



>ref|XP_002510630.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF52817.1| multicopper oxidase, putative [Ricinus communis]
Length=546

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W VTYG I P+G+ QQ ILINGQFPGP I+  +N+N+I+NVFN LDEP LL+
Sbjct  28   EDPYRFFNWNVTYGDIYPLGIRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  87

Query  337  WSGI  348
            W+GI
Sbjct  88   WNGI  91



>ref|XP_006390229.1| hypothetical protein EUTSA_v10018373mg [Eutrema salsugineum]
 gb|ESQ27515.1| hypothetical protein EUTSA_v10018373mg [Eutrema salsugineum]
Length=541

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W VTYG I P+GV QQ ILINGQFPGP I+  +N+N+I+NV+N LDEP LL+
Sbjct  24   EDPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  337  WSGI  348
            W+GI
Sbjct  84   WNGI  87



>ref|XP_006360232.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=539

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY +FTW  TYG  S +G PQQVILINGQFPGP+++  +N+N+++N+ N+LDEPLLLT
Sbjct  25   EDPYKYFTWTATYGMASLLGTPQQVILINGQFPGPRLDLVTNDNIVLNLINKLDEPLLLT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>ref|XP_004157080.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=541

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E+PY FFTW V+Y  I P+GV QQ ILINGQFPGP ++C +N+N+I+NVFN LDEP L++
Sbjct  24   ENPYRFFTWNVSYANIYPLGVRQQGILINGQFPGPDVHCVTNDNLIINVFNSLDEPFLIS  83

Query  337  WSGI  348
            W+GI
Sbjct  84   WNGI  87



>ref|XP_010428667.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=542

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY F+ W VTYG I P+GV QQ ILINGQFPGP I+  +N+N+I+NVFN LDEP LL+
Sbjct  25   EDPYRFYEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIINVFNSLDEPFLLS  84

Query  337  WSGI  348
            W+G+
Sbjct  85   WNGV  88



>ref|XP_004145593.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=541

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E+PY FFTW V+Y  I P+GV QQ ILINGQFPGP ++C +N+N+I+NVFN LDEP L++
Sbjct  24   ENPYRFFTWNVSYANIYPLGVRQQGILINGQFPGPDVHCVTNDNLIINVFNSLDEPFLIS  83

Query  337  WSGI  348
            W+GI
Sbjct  84   WNGI  87



>ref|XP_010673838.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=557

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYLF+ WKVTYGT SP+G PQQVILINGQFPGP +N T+NNN+++NVFN+LDEPLL T
Sbjct  25   EDPYLFYDWKVTYGTQSPLGAPQQVILINGQFPGPNLNTTTNNNIVLNVFNQLDEPLLFT  84

Query  337  WSGI  348
            W GI
Sbjct  85   WVGI  88



>gb|KGN55480.1| hypothetical protein Csa_4G653410 [Cucumis sativus]
Length=447

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E+PY FFTW V+Y  I P+GV QQ ILINGQFPGP ++C +N+N+I+NVFN LDEP L++
Sbjct  24   ENPYRFFTWNVSYANIYPLGVRQQGILINGQFPGPDVHCVTNDNLIINVFNSLDEPFLIS  83

Query  337  WSGI  348
            W+GI
Sbjct  84   WNGI  87



>ref|XP_006848556.1| hypothetical protein AMTR_s00169p00049950 [Amborella trichopoda]
 gb|ERN10137.1| hypothetical protein AMTR_s00169p00049950 [Amborella trichopoda]
Length=539

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            ++PY F TW VTYGTISP+GVPQQ ILINGQFPGP+++  +N+N+ +NV N+LDEP LLT
Sbjct  25   DNPYRFLTWTVTYGTISPLGVPQQGILINGQFPGPQLDVITNDNLDINVINKLDEPFLLT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>ref|XP_007136137.1| hypothetical protein PHAVU_009G021000g [Phaseolus vulgaris]
 gb|ESW08131.1| hypothetical protein PHAVU_009G021000g [Phaseolus vulgaris]
Length=548

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W VTYG I P+GV Q+ ILINGQFPGP I+  +N+N+I+NVFN LDEP LL+
Sbjct  30   EDPYRFFNWNVTYGDIFPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  89

Query  337  WSGI  348
            W+GI
Sbjct  90   WNGI  93



>emb|CDP19581.1| unnamed protein product [Coffea canephora]
Length=541

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTW VTYG I P+GV QQ ILINGQFPGP I   +N+N+I+NVFN LDEP L++
Sbjct  26   EDPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPAIESVTNDNLIINVFNNLDEPFLIS  85

Query  337  WSGI  348
            W+G+
Sbjct  86   WNGL  89



>ref|XP_004957823.1| PREDICTED: L-ascorbate oxidase homolog [Setaria italica]
Length=550

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY FFTW VTYG I P+GV QQ ILIN QFPGP+I   +N+N+I+NVFN+L+EP LL+
Sbjct  32   DDPYRFFTWTVTYGDIYPLGVKQQGILINNQFPGPQIEAVTNDNLIINVFNKLNEPFLLS  91

Query  337  WSGI  348
            WSG+
Sbjct  92   WSGL  95



>gb|EYU32814.1| hypothetical protein MIMGU_mgv1a003925mg [Erythranthe guttata]
Length=555

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYLFF WKVTYGTI+P+GVPQQ ILING+FPGP INCTSNNN++VNVFN LDEPLLLT
Sbjct  23   EDPYLFFDWKVTYGTIAPLGVPQQGILINGEFPGPIINCTSNNNIVVNVFNYLDEPLLLT  82

Query  337  WSGI  348
            W GI
Sbjct  83   WGGI  86



>gb|EMT15848.1| L-ascorbate oxidase-like protein [Aegilops tauschii]
Length=545

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTW V+YG I P+G  QQ ILINGQFPGP+I   +N+N++VNVFN+L+EP LL+
Sbjct  27   EDPYRFFTWNVSYGDIYPLGGKQQGILINGQFPGPQIEAVTNDNLVVNVFNKLNEPFLLS  86

Query  337  WSGI  348
            WSG+
Sbjct  87   WSGL  90



>gb|KEH40258.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=543

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W VTYG I P+GV QQ ILINGQFPGP I+  +N+N+I+NVFN LDEP L++
Sbjct  25   EDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLIS  84

Query  337  WSGI  348
            W+G+
Sbjct  85   WNGV  88



>gb|KDP36848.1| hypothetical protein JCGZ_08139 [Jatropha curcas]
Length=542

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W VTYG I P+GV Q+ ILINGQFPGP I+  +N+N+I+NVFN LDEP LL+
Sbjct  25   EDPYRFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>ref|XP_008455444.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=543

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTW +TYG I P+GV QQ ILINGQFPGP+I   +N N+I+NVFN LDEP L++
Sbjct  25   EDPYRFFTWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTNENLIINVFNSLDEPFLIS  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>gb|AAQ90182.1| ntp101 [Nicotiana tabacum]
 gb|AAQ90184.1| ntp302 [Nicotiana tabacum]
Length=558

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYLFF W VTYGTI+P+GVPQQ ILINGQ PGP+INCTSNNN++VNV+N LDEPLLLT
Sbjct  25   EDPYLFFEWNVTYGTIAPLGVPQQGILINGQLPGPRINCTSNNNIVVNVYNNLDEPLLLT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>ref|NP_173603.1| SKU5 similar 8 protein [Arabidopsis thaliana]
 gb|AAF16544.1|AC013482_18 T26F17.6 [Arabidopsis thaliana]
 gb|ABE65639.1| multi-copper oxidase type I family protein [Arabidopsis thaliana]
 gb|AEE30162.1| SKU5 similar 8 protein [Arabidopsis thaliana]
Length=551

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W VTYG ISP+ V QQ ILING+FPGP I   +N+N+I+NVFN LDEP L++
Sbjct  25   EDPYKFFEWHVTYGNISPLKVAQQGILINGKFPGPDIAAVTNDNLIINVFNHLDEPFLIS  84

Query  337  WSGI  348
            WSGI
Sbjct  85   WSGI  88



>gb|ABK25324.1| unknown [Picea sitchensis]
Length=538

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTW +TYG I P+GVPQQ ILINGQFPGP I+  +N+N+I+NV+N L EP LL+
Sbjct  28   EDPYKFFTWNITYGIIYPLGVPQQGILINGQFPGPPIDSVTNDNIIINVYNNLPEPFLLS  87

Query  337  WSGI  348
            W+GI
Sbjct  88   WNGI  91



>ref|XP_010908384.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=536

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            +DPY +FTW V+YG ISP+GV QQ ILINGQ+PGP+++C +N+N++V+V N++DEP+L+T
Sbjct  24   DDPYRYFTWTVSYGPISPLGVQQQGILINGQYPGPRVDCVTNDNMVVSVINKIDEPILIT  83

Query  337  WSGI  348
            W+GI
Sbjct  84   WNGI  87



>ref|XP_003563038.1| PREDICTED: L-ascorbate oxidase homolog [Brachypodium distachyon]
Length=543

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTW VTYG I P+GV QQ ILINGQFPGP+I+  +N+N++VNV+N L+EP LL+
Sbjct  25   EDPYRFFTWNVTYGDIFPLGVKQQGILINGQFPGPQIDAVTNDNLVVNVYNNLNEPFLLS  84

Query  337  WSGI  348
            W+G+
Sbjct  85   WNGV  88



>emb|CDP02461.1| unnamed protein product [Coffea canephora]
Length=539

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTW +TYG I+P+GV Q+ ILINGQFPGP I+C +N+N+IVNV N+LDEP L+T
Sbjct  25   EDPYRFFTWVITYGQIAPLGVKQRGILINGQFPGPTISCITNDNIIVNVINKLDEPFLIT  84

Query  337  W  339
            W
Sbjct  85   W  85



>ref|XP_010101299.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB88234.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=541

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W VTYG I P+GV QQ ILINGQFPGP I+  +N+N+I+NV+N LDEP LL+
Sbjct  22   EDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  81

Query  337  WSGI  348
            W+GI
Sbjct  82   WNGI  85



>ref|XP_002889063.1| hypothetical protein ARALYDRAFT_895494 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65322.1| hypothetical protein ARALYDRAFT_895494 [Arabidopsis lyrata subsp. 
lyrata]
Length=541

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W +TYG I P+GV QQ ILINGQFPGP I+  +N+N+I+NV+N LDEP LL+
Sbjct  24   EDPYRFFEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  337  WSGI  348
            W+GI
Sbjct  84   WNGI  87



>ref|XP_006302110.1| hypothetical protein CARUB_v10020107mg [Capsella rubella]
 gb|EOA35008.1| hypothetical protein CARUB_v10020107mg [Capsella rubella]
Length=541

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W +TYG I P+GV QQ ILINGQFPGP I+  +N+N+I+NV+N LDEP LL+
Sbjct  24   EDPYRFFEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIINVYNSLDEPFLLS  83

Query  337  WSGI  348
            W+G+
Sbjct  84   WNGV  87



>ref|XP_006596528.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=547

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W VTYG I P+GV QQ ILINGQFPGP I+  +N+N+I+NVFN LD+P LL+
Sbjct  29   EDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDQPFLLS  88

Query  337  WSGI  348
            W+G+
Sbjct  89   WNGV  92



>ref|XP_009591795.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=558

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYLFF W VTYGTI+P+GVPQQ ILINGQ PGP+INCTSNNN++VNV+N LDEPLLLT
Sbjct  25   EDPYLFFEWNVTYGTIAPLGVPQQGILINGQLPGPRINCTSNNNIVVNVYNNLDEPLLLT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>ref|XP_008377105.1| PREDICTED: LOW QUALITY PROTEIN: L-ascorbate oxidase homolog [Malus 
domestica]
Length=544

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W VTYG I P+GV Q+ ILINGQFPGP I+  +N+N+I+NVFN LDEP LL+
Sbjct  26   EDPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  85

Query  337  WSGI  348
            W+GI
Sbjct  86   WNGI  89



>gb|KFK34458.1| hypothetical protein AALP_AA5G148000 [Arabis alpina]
Length=541

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W +TYG I P+GV QQ ILINGQFPGP I+  +N+N+I+NV+N LDEP LL+
Sbjct  24   EDPYRFFEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  337  WSGI  348
            W+GI
Sbjct  84   WNGI  87



>ref|XP_007160607.1| hypothetical protein PHAVU_001G001500g [Phaseolus vulgaris]
 gb|ESW32601.1| hypothetical protein PHAVU_001G001500g [Phaseolus vulgaris]
Length=539

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W VTYG I P+GV QQ ILINGQFPGP I+  +N+N+I+NVFN LD+P LL+
Sbjct  21   EDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDQPFLLS  80

Query  337  WSGI  348
            W+G+
Sbjct  81   WNGV  84



>ref|XP_008663511.1| PREDICTED: L-ascorbate oxidase homolog [Zea mays]
 gb|AFW59208.1| hypothetical protein ZEAMMB73_577476 [Zea mays]
Length=544

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E PY FF W++TYG+ISP+G  QQ ILINGQFPGPKI C +N N+I+NV N+L +P LL+
Sbjct  21   EGPYQFFDWEITYGSISPIGSLQQGILINGQFPGPKIECQTNENLIINVRNKLPDPFLLS  80

Query  337  WSGI  348
            W+G+
Sbjct  81   WNGL  84



>emb|CDP02462.1| unnamed protein product [Coffea canephora]
Length=540

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            ED Y ++TW VTYGT SP+G  QQVILINGQFPGPK++  +N+NVI+N+ N+LD+P LLT
Sbjct  26   EDAYRYYTWTVTYGTASPLGFSQQVILINGQFPGPKLDLVTNDNVILNLINKLDQPFLLT  85

Query  337  WSGI  348
            W+GI
Sbjct  86   WNGI  89



>gb|EYU36818.1| hypothetical protein MIMGU_mgv1a004264mg [Erythranthe guttata]
Length=536

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W +TYGTI P+G+ QQ ILINGQFPGP+I   +N+N+IVNVFN LD+P L+ 
Sbjct  18   EDPYRFFNWNITYGTIYPLGIAQQGILINGQFPGPEIYSVTNDNIIVNVFNSLDQPFLIH  77

Query  337  WSGI  348
            W+GI
Sbjct  78   WNGI  81



>ref|XP_009773470.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=554

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYL+FTW VTYGTI+P+GVPQQ ILINGQFPGP+INCTSNNN++VNVFN LDEP L T
Sbjct  22   EDPYLYFTWNVTYGTIAPLGVPQQGILINGQFPGPRINCTSNNNIVVNVFNNLDEPFLFT  81

Query  337  WSGI  348
            W+G+
Sbjct  82   WNGV  85



>ref|XP_011048128.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=551

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYLFFTW VTYGT SP+GVPQQVILIN QFPGP IN TSNNN+++NVFN LDEP LLT
Sbjct  23   EDPYLFFTWNVTYGTRSPLGVPQQVILINNQFPGPNINSTSNNNIVLNVFNNLDEPFLLT  82

Query  337  WSGI  348
            WSG+
Sbjct  83   WSGV  86



>ref|XP_002299087.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE83892.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=551

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYLFFTW VTYGT SP+GVPQQVILIN QFPGP IN TSNNN+++NVFN LDEP LLT
Sbjct  23   EDPYLFFTWNVTYGTRSPLGVPQQVILINDQFPGPNINSTSNNNIVLNVFNNLDEPFLLT  82

Query  337  WSGI  348
            WSG+
Sbjct  83   WSGV  86



>ref|XP_003517277.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=540

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            ED Y +FTW VTYGT+ P+  PQQVILINGQFPGP+++  +N NVI+N+ N+LDEP LLT
Sbjct  25   EDAYKYFTWTVTYGTLYPLASPQQVILINGQFPGPRLDLVTNENVILNLINKLDEPFLLT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>ref|XP_007213899.1| hypothetical protein PRUPE_ppa003872mg [Prunus persica]
 gb|EMJ15098.1| hypothetical protein PRUPE_ppa003872mg [Prunus persica]
Length=447

 Score = 96.3 bits (238),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTWK+TYG I P+GV QQ ILINGQFPGP+I+  +N+N++++VFN L EP L++
Sbjct  24   EDPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLVISVFNYLREPFLIS  83

Query  337  WSGI  348
            W GI
Sbjct  84   WDGI  87



>ref|XP_009420229.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=551

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYLFFTW VTYGTI+P+GV QQ ILINGQFPGP IN T+NNN+++NVFN LDEP L T
Sbjct  22   EDPYLFFTWNVTYGTIAPLGVAQQAILINGQFPGPNINSTTNNNIVLNVFNNLDEPFLFT  81

Query  337  WSGI  348
            W+GI
Sbjct  82   WNGI  85



>ref|XP_009334388.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=544

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W VTYG I P+GV Q+ ILINGQFPGP I+  +N+N+I+NVFN LDEP LL+
Sbjct  26   EDPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  85

Query  337  WSGI  348
            W+GI
Sbjct  86   WNGI  89



>gb|KDP20733.1| hypothetical protein JCGZ_21204 [Jatropha curcas]
Length=541

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E+PY FFTWKVTYG I P+GV QQ ILINGQFPGP+I+  +N+N+I+NVFN L EP L++
Sbjct  23   ENPYRFFTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIINVFNYLREPFLIS  82

Query  337  WSGI  348
            W+GI
Sbjct  83   WNGI  86



>gb|KHN36198.1| L-ascorbate oxidase like [Glycine soja]
Length=540

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            ED Y +FTW VTYGT+ P+  PQQVILINGQFPGP+++  +N NVI+N+ N+LDEP LLT
Sbjct  25   EDAYKYFTWTVTYGTLYPLASPQQVILINGQFPGPRLDLVTNENVILNLINKLDEPFLLT  84

Query  337  WSGI  348
            W+GI
Sbjct  85   WNGI  88



>gb|ABI52585.1| pollen-specific protein [Camellia sinensis]
Length=566

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPYLFF W VTYGTISP+GVP Q ILINGQFPGPKINCTSNNN++VNVFN+LDEP LLT
Sbjct  27   EDPYLFFEWTVTYGTISPVGVPVQAILINGQFPGPKINCTSNNNIVVNVFNKLDEPFLLT  86

Query  337  WSGI  348
            W GI
Sbjct  87   WYGI  90



>ref|XP_002518462.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF43849.1| multicopper oxidase, putative [Ricinus communis]
Length=541

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E+PY FFTWKVTYG I P+GV QQ ILINGQFPGP+I+  +N+N+I+NVFN L EP L++
Sbjct  23   ENPYRFFTWKVTYGDIYPLGVKQQGILINGQFPGPQIDVVTNDNLIINVFNYLREPFLIS  82

Query  337  WSGI  348
            W+GI
Sbjct  83   WNGI  86



>ref|XP_003524640.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=508

 Score = 96.7 bits (239),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            ED Y ++TW VTYGT+SP+G PQQVI+ING FPGP+++  +N+NV++N+ N+LDEP LLT
Sbjct  26   EDAYKYYTWTVTYGTLSPLGSPQQVIMINGDFPGPQLDLVTNDNVVLNLVNKLDEPFLLT  85

Query  337  WSGI  348
            W+GI
Sbjct  86   WNGI  89



>ref|XP_004506275.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=536

 Score = 96.7 bits (239),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY F+TW VTYG I P G+ QQ ILINGQFPGP+I   +N+NVI+NVFN LDEP L++
Sbjct  23   EDPYRFYTWNVTYGDIYPFGIQQQGILINGQFPGPQIESVTNDNVIINVFNSLDEPFLIS  82

Query  337  WSGI  348
            W+G+
Sbjct  83   WNGV  86



>ref|XP_008384084.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=543

 Score = 96.7 bits (239),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FFTWKVTYG I P+GV QQ ILINGQFPGP+I+  +N+N++++VFN L EP L++
Sbjct  24   EDPYRFFTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLVISVFNYLREPFLIS  83

Query  337  WSGI  348
            W GI
Sbjct  84   WDGI  87



>gb|EPS65321.1| hypothetical protein M569_09457, partial [Genlisea aurea]
Length=201

 Score = 93.2 bits (230),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            ED Y +FTW VTYG   P+GVPQQVILINGQFPGP I+  +N+N+++N+ N+LD+P L+T
Sbjct  18   EDAYKYFTWTVTYGKAFPLGVPQQVILINGQFPGPTIDTVTNDNIVLNLINKLDQPFLIT  77

Query  337  WSGI  348
            W+GI
Sbjct  78   WNGI  81



>ref|XP_010555198.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=553

 Score = 96.7 bits (239),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W V+YG I P+G PQ+ ILINGQFPGP I   +N+N+I+NV N+LDEP LL+
Sbjct  28   EDPYRFFDWTVSYGLIYPLGFPQRGILINGQFPGPNIYSVTNDNLIINVHNDLDEPFLLS  87

Query  337  WSGI  348
            W+G+
Sbjct  88   WNGV  91



>ref|XP_010686816.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=543

 Score = 96.7 bits (239),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            E+PY F+ WKVTYG I P+G+ QQVI+INGQFPGP+I+C +N+N++++V N L+EP LL+
Sbjct  25   ENPYRFYDWKVTYGYIYPLGIKQQVIMINGQFPGPQIDCVTNDNLVISVHNYLNEPFLLS  84

Query  337  WSGI  348
            W+G+
Sbjct  85   WNGL  88



>ref|XP_009368021.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=539

 Score = 96.7 bits (239),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            ED YL+FTW VTYGTI P+GVPQ+ ILINGQFPGP I   +N+N+IV+V N LDEP L+T
Sbjct  26   EDRYLYFTWTVTYGTIFPLGVPQKGILINGQFPGPNIEAVTNDNIIVDVINMLDEPFLIT  85

Query  337  WSGI  348
            W+GI
Sbjct  86   WNGI  89



>ref|XP_004506310.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=536

 Score = 96.7 bits (239),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY F+TW VTYG I P G+ QQ ILINGQFPGP+I   +N+NVI+NVFN LDEP L++
Sbjct  23   EDPYRFYTWNVTYGDIYPFGIQQQGILINGQFPGPQIESVTNDNVIINVFNSLDEPFLIS  82

Query  337  WSGI  348
            W+G+
Sbjct  83   WNGV  86



>ref|XP_008387887.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=544

 Score = 96.7 bits (239),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W VTYG I P+GV Q+ ILINGQFPGP I+  +N+N+I+NVFN LDEP LL+
Sbjct  26   EDPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  85

Query  337  WSGI  348
            W+GI
Sbjct  86   WNGI  89



>ref|XP_008362259.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=542

 Score = 96.7 bits (239),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY F+ W VTYG I P+GV QQ ILINGQFPGP+I+  +N+N+I+NVFN LDEP L++
Sbjct  24   EDPYRFYNWNVTYGDIYPLGVKQQGILINGQFPGPQIDSVTNDNLIINVFNSLDEPFLIS  83

Query  337  WSGI  348
            W+G+
Sbjct  84   WNGV  87



>ref|XP_011034917.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=547

 Score = 96.7 bits (239),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W VTYG I P+GV QQ ILINGQFPGP I+  +N+N+I+NV+N LDEP LL+
Sbjct  29   EDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  88

Query  337  WSGI  348
            W+GI
Sbjct  89   WNGI  92



>ref|XP_004500896.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=548

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W VTYG I P+GV Q+ ILINGQFPGP I+  +N+N+I+NVFN LDEP L++
Sbjct  30   EDPYRFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLIS  89

Query  337  WSGI  348
            W+GI
Sbjct  90   WNGI  93



>gb|KFK44156.1| hypothetical protein AALP_AA1G222300 [Arabis alpina]
Length=538

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY  F W VTYG I PMGV QQ ILIN QFPGP+I   +N+N+I+NVFNELDEP L++
Sbjct  24   EDPYRNFEWHVTYGDIYPMGVKQQGILINNQFPGPEIRSVTNDNLIINVFNELDEPFLIS  83

Query  337  WSGI  348
            W+GI
Sbjct  84   WAGI  87



>ref|XP_010536445.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=541

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W VTYG I P+GV Q+ ILINGQFPGP I+  +N+N+I+NVFN LDEP L++
Sbjct  24   EDPYRFFDWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLIS  83

Query  337  WSGI  348
            W+GI
Sbjct  84   WNGI  87



>gb|KHN33820.1| L-ascorbate oxidase like [Glycine soja]
Length=540

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +1

Query  157  EDPYLFFTWKVTYGTISPMGVPQQVILINGQFPGPKINCTSNNNVIVNVFNELDEPLLLT  336
            EDPY FF W VTYG I P+GV Q  ILINGQFPGP I+  +N+N+I+NVFN LDEP LL+
Sbjct  22   EDPYRFFNWNVTYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  81

Query  337  WSGI  348
            W+GI
Sbjct  82   WNGI  85



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 508176617088