BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25630_g1_i1 len=351 path=[481:0-350]

Length=351
                                                                      Score     E

ref|XP_009624631.1|  PREDICTED: L-ascorbate oxidase homolog             188   4e-54   
gb|AAQ90185.1|  ntp805                                                  188   4e-54   Nicotiana tabacum [American tobacco]
sp|P29162.1|ASOL_TOBAC  RecName: Full=L-ascorbate oxidase homolog...    187   6e-54   Nicotiana tabacum [American tobacco]
emb|CDP18567.1|  unnamed protein product                                187   1e-53   
dbj|BAO02510.1|  predicted pollen-specific protein ortholog             186   2e-53   
ref|XP_009588330.1|  PREDICTED: L-ascorbate oxidase homolog             184   3e-52   
ref|XP_006341879.1|  PREDICTED: L-ascorbate oxidase homolog             182   1e-51   
ref|XP_004164922.1|  PREDICTED: L-ascorbate oxidase homolog             181   3e-51   
gb|EYU32814.1|  hypothetical protein MIMGU_mgv1a003925mg                180   6e-51   
ref|XP_009785667.1|  PREDICTED: L-ascorbate oxidase homolog             180   6e-51   
ref|XP_004149634.1|  PREDICTED: L-ascorbate oxidase homolog             179   6e-51   
gb|KGN54013.1|  hypothetical protein Csa_4G267480                       178   7e-51   
ref|XP_004229062.1|  PREDICTED: L-ascorbate oxidase homolog             179   9e-51   
ref|XP_008449913.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    179   1e-50   
ref|XP_008449912.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    179   1e-50   
ref|XP_004149637.1|  PREDICTED: L-ascorbate oxidase homolog             179   1e-50   
ref|XP_004164925.1|  PREDICTED: L-ascorbate oxidase homolog             178   3e-50   
ref|XP_006354116.1|  PREDICTED: L-ascorbate oxidase homolog             178   3e-50   
ref|XP_009766183.1|  PREDICTED: L-ascorbate oxidase homolog             177   4e-50   
gb|AAL87103.1|AF479568_1  1-ascorbate oxidase                           177   4e-50   Petunia x hybrida [garden petunia]
ref|XP_004228635.1|  PREDICTED: L-ascorbate oxidase homolog             177   5e-50   
gb|AAQ90182.1|  ntp101                                                  177   6e-50   Nicotiana tabacum [American tobacco]
ref|XP_009591795.1|  PREDICTED: L-ascorbate oxidase homolog             177   6e-50   
gb|KGN54012.1|  hypothetical protein Csa_4G267470                       176   7e-50   
ref|XP_009773470.1|  PREDICTED: L-ascorbate oxidase homolog             176   1e-49   
ref|XP_006367595.1|  PREDICTED: L-ascorbate oxidase homolog             176   1e-49   
ref|XP_004149657.1|  PREDICTED: L-ascorbate oxidase homolog             176   2e-49   
ref|XP_004164924.1|  PREDICTED: L-ascorbate oxidase homolog             176   2e-49   
emb|CDP04133.1|  unnamed protein product                                175   4e-49   
gb|EYU32815.1|  hypothetical protein MIMGU_mgv1a003910mg                175   4e-49   
ref|XP_010673839.1|  PREDICTED: L-ascorbate oxidase homolog             174   7e-49   
ref|XP_008438536.1|  PREDICTED: L-ascorbate oxidase homolog             174   1e-48   
ref|XP_010044910.1|  PREDICTED: L-ascorbate oxidase homolog             172   4e-48   
ref|XP_007014661.1|  SKU5 similar 12                                    172   5e-48   
ref|XP_010673838.1|  PREDICTED: L-ascorbate oxidase homolog             171   7e-48   
emb|CDY10549.1|  BnaC03g70650D                                          171   7e-48   
emb|CDY56013.1|  BnaA08g29220D                                          171   8e-48   
ref|XP_009106861.1|  PREDICTED: L-ascorbate oxidase homolog             171   8e-48   
ref|XP_006303856.1|  hypothetical protein CARUB_v10012595mg             171   9e-48   
ref|XP_011089764.1|  PREDICTED: L-ascorbate oxidase homolog             171   1e-47   
ref|XP_007208287.1|  hypothetical protein PRUPE_ppa003715mg             171   1e-47   
ref|XP_008374030.1|  PREDICTED: L-ascorbate oxidase homolog             170   1e-47   
gb|KGN63948.1|  hypothetical protein Csa_1G031720                       169   2e-47   
ref|XP_009376274.1|  PREDICTED: L-ascorbate oxidase homolog             170   2e-47   
ref|XP_004137383.1|  PREDICTED: L-ascorbate oxidase homolog             170   3e-47   
ref|XP_004165665.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    170   3e-47   
ref|XP_006407227.1|  hypothetical protein EUTSA_v10020444mg             170   3e-47   
ref|XP_009339220.1|  PREDICTED: L-ascorbate oxidase homolog             170   3e-47   
ref|NP_564697.1|  SKU5 similar 14                                       169   3e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011089765.1|  PREDICTED: L-ascorbate oxidase homolog             170   3e-47   
ref|XP_007208285.1|  hypothetical protein PRUPE_ppa003733mg             169   3e-47   
gb|KHG03555.1|  L-ascorbate oxidase                                     169   3e-47   
ref|XP_002303974.1|  multi-copper oxidase type 1 family protein         169   3e-47   Populus trichocarpa [western balsam poplar]
gb|AAD10639.1|  putative pollen specific protein                        169   3e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010465173.1|  PREDICTED: L-ascorbate oxidase homolog             169   3e-47   
gb|KDP30647.1|  hypothetical protein JCGZ_16212                         169   4e-47   
ref|XP_011089763.1|  PREDICTED: L-ascorbate oxidase homolog             169   4e-47   
emb|CDX82540.1|  BnaA03g32810D                                          169   4e-47   
gb|EYU39285.1|  hypothetical protein MIMGU_mgv1a026945mg                169   4e-47   
ref|XP_011089702.1|  PREDICTED: L-ascorbate oxidase homolog             169   4e-47   
ref|XP_006299973.1|  hypothetical protein CARUB_v10016186mg             169   4e-47   
emb|CDY24188.1|  BnaC01g37680D                                          169   5e-47   
emb|CDX75708.1|  BnaC03g37910D                                          169   5e-47   
ref|XP_009135303.1|  PREDICTED: L-ascorbate oxidase homolog             169   5e-47   
gb|ABI52585.1|  pollen-specific protein                                 169   5e-47   Camellia sinensis [black tea]
ref|XP_002894511.1|  hypothetical protein ARALYDRAFT_474617             169   7e-47   
ref|XP_010501174.1|  PREDICTED: L-ascorbate oxidase homolog             168   9e-47   
ref|XP_010480096.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    168   1e-46   
gb|KFK38673.1|  hypothetical protein AALP_AA3G145200                    168   1e-46   
ref|XP_009600428.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    167   1e-46   
emb|CDY43994.1|  BnaA05g25890D                                          168   1e-46   
ref|XP_009600426.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    168   1e-46   
ref|XP_009146525.1|  PREDICTED: L-ascorbate oxidase homolog             168   1e-46   
emb|CDY23597.1|  BnaC05g39970D                                          167   2e-46   
ref|XP_011089767.1|  PREDICTED: L-ascorbate oxidase homolog             167   2e-46   
ref|XP_011025085.1|  PREDICTED: L-ascorbate oxidase homolog             167   2e-46   
ref|XP_007014658.1|  SKU5 similar 13                                    167   2e-46   
ref|XP_002882820.1|  hypothetical protein ARALYDRAFT_478721             167   2e-46   
ref|XP_010500435.1|  PREDICTED: L-ascorbate oxidase homolog             167   2e-46   
ref|XP_008359469.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    166   2e-46   
ref|XP_010487093.1|  PREDICTED: L-ascorbate oxidase homolog             167   3e-46   
ref|XP_006306349.1|  hypothetical protein CARUB_v10012235mg             167   3e-46   
ref|XP_006392622.1|  hypothetical protein EUTSA_v10011369mg             167   3e-46   
gb|KDP30646.1|  hypothetical protein JCGZ_16211                         165   3e-46   
ref|XP_002523382.1|  multicopper oxidase, putative                      167   3e-46   Ricinus communis
gb|KFK35575.1|  hypothetical protein AALP_AA4G008600                    167   3e-46   
ref|NP_187948.1|  protein SKU5-like 13                                  167   4e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008219577.1|  PREDICTED: L-ascorbate oxidase homolog             166   4e-46   
ref|XP_009339221.1|  PREDICTED: L-ascorbate oxidase homolog             166   4e-46   
ref|XP_010271079.1|  PREDICTED: L-ascorbate oxidase homolog             166   4e-46   
ref|XP_007157830.1|  hypothetical protein PHAVU_002G101700g             166   6e-46   
ref|XP_008219320.1|  PREDICTED: L-ascorbate oxidase homolog             166   7e-46   
ref|XP_008219429.1|  PREDICTED: L-ascorbate oxidase homolog             166   7e-46   
ref|XP_011089766.1|  PREDICTED: L-ascorbate oxidase homolog             166   7e-46   
ref|XP_008219681.1|  PREDICTED: L-ascorbate oxidase homolog             166   8e-46   
ref|XP_010044914.1|  PREDICTED: L-ascorbate oxidase homolog             166   9e-46   
ref|XP_002523381.1|  multicopper oxidase, putative                      166   1e-45   Ricinus communis
ref|XP_003635547.1|  PREDICTED: L-ascorbate oxidase homolog             165   1e-45   
ref|XP_009376784.1|  PREDICTED: L-ascorbate oxidase homolog             166   1e-45   
ref|XP_010034522.1|  PREDICTED: L-ascorbate oxidase homolog             165   1e-45   
ref|XP_009626538.1|  PREDICTED: L-ascorbate oxidase homolog             165   2e-45   
ref|XP_008374029.1|  PREDICTED: L-ascorbate oxidase homolog             165   2e-45   
ref|XP_011048128.1|  PREDICTED: L-ascorbate oxidase homolog             165   2e-45   
gb|KHG27164.1|  L-ascorbate oxidase                                     164   2e-45   
gb|AFC88081.1|  skewed-like protein                                     164   2e-45   
ref|XP_010462411.1|  PREDICTED: L-ascorbate oxidase homolog             164   2e-45   
emb|CDY23596.1|  BnaC05g39980D                                          164   2e-45   
ref|XP_006838146.1|  hypothetical protein AMTR_s00106p00093220          164   2e-45   
ref|XP_009773307.1|  PREDICTED: L-ascorbate oxidase homolog             164   3e-45   
ref|XP_011048127.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    164   3e-45   
ref|XP_011048126.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    164   3e-45   
ref|XP_010480098.1|  PREDICTED: L-ascorbate oxidase homolog             164   4e-45   
ref|XP_010501175.1|  PREDICTED: L-ascorbate oxidase homolog             164   4e-45   
ref|XP_010462412.1|  PREDICTED: L-ascorbate oxidase homolog             164   5e-45   
ref|XP_010247847.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    164   5e-45   
ref|XP_010247848.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    163   5e-45   
ref|XP_004505353.1|  PREDICTED: L-ascorbate oxidase homolog             163   5e-45   
gb|AGW80453.1|  pollen-specific protein                                 163   5e-45   
ref|XP_010247849.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    163   5e-45   
gb|EPS72881.1|  pollen-specific protein                                 164   6e-45   
ref|NP_175953.1|  protein SKU5 similar 12                               163   6e-45   Arabidopsis thaliana [mouse-ear cress]
sp|Q00624.1|ASOL_BRANA  RecName: Full=L-ascorbate oxidase homolog...    163   7e-45   Brassica napus [oilseed rape]
gb|AFK33666.1|  unknown                                                 162   7e-45   
ref|XP_002891844.1|  hypothetical protein ARALYDRAFT_892557             163   7e-45   
ref|XP_003601601.1|  L-ascorbate oxidase-like protein                   163   7e-45   
emb|CDY68850.1|  BnaA10g29650D                                          158   8e-45   
gb|KHG05644.1|  L-ascorbate oxidase                                     163   8e-45   
ref|XP_009384956.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    162   1e-44   
ref|XP_009384957.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    162   1e-44   
ref|XP_010552291.1|  PREDICTED: L-ascorbate oxidase homolog             162   1e-44   
ref|XP_002297609.2|  multi-copper oxidase type 1 family protein         162   1e-44   Populus trichocarpa [western balsam poplar]
ref|XP_010093150.1|  L-ascorbate oxidase-like protein                   162   2e-44   
ref|XP_002299087.1|  multi-copper oxidase type 1 family protein         162   2e-44   Populus trichocarpa [western balsam poplar]
ref|XP_006353286.1|  PREDICTED: L-ascorbate oxidase homolog             162   2e-44   
ref|XP_003538519.1|  PREDICTED: L-ascorbate oxidase homolog             162   2e-44   
ref|XP_009420229.1|  PREDICTED: L-ascorbate oxidase homolog             162   2e-44   
gb|KHN44494.1|  L-ascorbate oxidase like                                162   2e-44   
emb|CDX97352.1|  BnaA02g21430D                                          161   2e-44   
dbj|BAL41449.1|  SKU5 similar 1                                         162   2e-44   
ref|XP_009399915.1|  PREDICTED: L-ascorbate oxidase homolog             161   3e-44   
ref|NP_187947.1|  protein SKU5-like 11                                  161   3e-44   Arabidopsis thaliana [mouse-ear cress]
gb|EPS68478.1|  hypothetical protein M569_06286                         161   3e-44   
emb|CAA47177.1|  Bplo                                                   161   3e-44   Brassica napus [oilseed rape]
ref|XP_007157831.1|  hypothetical protein PHAVU_002G101800g             161   3e-44   
ref|XP_009387378.1|  PREDICTED: L-ascorbate oxidase homolog             161   4e-44   
ref|XP_007163844.1|  hypothetical protein PHAVU_001G269100g             161   4e-44   
ref|XP_009411781.1|  PREDICTED: L-ascorbate oxidase homolog             161   4e-44   
emb|CAN69061.1|  hypothetical protein VITISV_032605                     161   5e-44   Vitis vinifera
ref|XP_010093149.1|  L-ascorbate oxidase-like protein                   160   5e-44   
ref|XP_009402422.1|  PREDICTED: L-ascorbate oxidase homolog             160   5e-44   
ref|XP_009383852.1|  PREDICTED: L-ascorbate oxidase homolog             160   6e-44   
ref|XP_010034521.1|  PREDICTED: L-ascorbate oxidase homolog             160   6e-44   
emb|CDY49392.1|  BnaC09g53590D                                          159   6e-44   
ref|XP_006407228.1|  hypothetical protein EUTSA_v10020433mg             160   6e-44   
ref|XP_004502172.1|  PREDICTED: L-ascorbate oxidase homolog             160   6e-44   
gb|KFK27206.1|  hypothetical protein AALP_AA8G349600                    160   7e-44   
ref|XP_007163845.1|  hypothetical protein PHAVU_001G269200g             160   7e-44   
ref|XP_006299300.1|  hypothetical protein CARUB_v10015454mg             160   8e-44   
ref|XP_003556690.2|  PREDICTED: L-ascorbate oxidase homolog             160   9e-44   
ref|XP_006392621.1|  hypothetical protein EUTSA_v10011364mg             160   1e-43   
emb|CDX75707.1|  BnaC03g37900D                                          160   1e-43   
ref|XP_009412658.1|  PREDICTED: L-ascorbate oxidase homolog             159   1e-43   
ref|XP_009135302.1|  PREDICTED: L-ascorbate oxidase homolog             159   1e-43   
ref|XP_004305574.1|  PREDICTED: L-ascorbate oxidase homolog             159   1e-43   
emb|CDX82541.1|  BnaA03g32800D                                          159   1e-43   
emb|CAA47178.1|  Bplo                                                   159   1e-43   Brassica napus [oilseed rape]
ref|XP_003601595.1|  L-ascorbate oxidase-like protein                   159   1e-43   
gb|AFK44839.1|  unknown                                                 157   1e-43   
ref|XP_010465172.1|  PREDICTED: L-ascorbate oxidase homolog             159   2e-43   
emb|CDY54363.1|  BnaC06g07290D                                          159   2e-43   
ref|XP_009803815.1|  PREDICTED: L-ascorbate oxidase homolog             159   2e-43   
ref|XP_009611384.1|  PREDICTED: L-ascorbate oxidase homolog             159   2e-43   
ref|XP_009416330.1|  PREDICTED: L-ascorbate oxidase homolog             159   2e-43   
ref|XP_009120150.1|  PREDICTED: L-ascorbate oxidase homolog             159   2e-43   
gb|AES71848.2|  L-ascorbate oxidase-like protein                        158   3e-43   
ref|XP_003601600.1|  L-ascorbate oxidase-like protein                   159   3e-43   
ref|XP_002884964.1|  hypothetical protein ARALYDRAFT_478720             159   3e-43   
ref|XP_003601599.1|  L-ascorbate oxidase-like protein                   159   3e-43   
ref|XP_010500423.1|  PREDICTED: L-ascorbate oxidase homolog             159   3e-43   
ref|XP_003601596.1|  L-ascorbate oxidase-like protein                   159   3e-43   
ref|XP_003601597.1|  L-ascorbate oxidase-like protein                   159   3e-43   
ref|XP_009392060.1|  PREDICTED: L-ascorbate oxidase homolog             159   4e-43   
emb|CDY43353.1|  BnaA01g29840D                                          158   4e-43   
ref|XP_003529456.1|  PREDICTED: L-ascorbate oxidase homolog             157   6e-43   
ref|XP_009417950.1|  PREDICTED: L-ascorbate oxidase homolog             157   1e-42   
ref|XP_010534841.1|  PREDICTED: L-ascorbate oxidase homolog             157   1e-42   
gb|KFK35574.1|  hypothetical protein AALP_AA4G008500                    157   1e-42   
gb|KFK38671.1|  hypothetical protein AALP_AA3G145000                    157   2e-42   
emb|CAA47176.1|  Bplo                                                   157   2e-42   Brassica napus [oilseed rape]
gb|KHN20513.1|  L-ascorbate oxidase like                                156   2e-42   
ref|XP_004296148.1|  PREDICTED: L-ascorbate oxidase homolog             156   2e-42   
ref|XP_009124743.1|  PREDICTED: L-ascorbate oxidase homolog             156   2e-42   
emb|CDY50029.1|  BnaA06g00300D                                          156   2e-42   
gb|EYU39505.1|  hypothetical protein MIMGU_mgv1a003980mg                156   2e-42   
ref|XP_006352142.1|  PREDICTED: L-ascorbate oxidase homolog             156   3e-42   
ref|XP_003529457.1|  PREDICTED: L-ascorbate oxidase homolog             155   3e-42   
ref|XP_004505355.1|  PREDICTED: L-ascorbate oxidase homolog             155   3e-42   
ref|XP_003607814.1|  L-ascorbate oxidase-like protein                   155   5e-42   
ref|XP_003607816.1|  L-ascorbate oxidase-like protein                   155   6e-42   
emb|CDY24189.1|  BnaC01g37690D                                          154   1e-41   
ref|XP_006345828.1|  PREDICTED: L-ascorbate oxidase homolog             154   1e-41   
ref|XP_004250092.1|  PREDICTED: L-ascorbate oxidase homolog             154   1e-41   
ref|XP_010938086.1|  PREDICTED: L-ascorbate oxidase homolog             154   2e-41   
ref|XP_008793387.1|  PREDICTED: L-ascorbate oxidase homolog             152   5e-41   
ref|XP_011077090.1|  PREDICTED: L-ascorbate oxidase homolog             152   6e-41   
ref|XP_009147500.1|  PREDICTED: L-ascorbate oxidase homolog             152   7e-41   
ref|XP_008782736.1|  PREDICTED: L-ascorbate oxidase homolog             151   2e-40   
ref|XP_008449954.1|  PREDICTED: L-ascorbate oxidase homolog             150   2e-40   
ref|XP_004234818.1|  PREDICTED: L-ascorbate oxidase homolog             150   2e-40   
ref|XP_006445540.1|  hypothetical protein CICLE_v10018007mg             150   2e-40   
ref|XP_010921259.1|  PREDICTED: L-ascorbate oxidase homolog             150   4e-40   
ref|XP_008466955.1|  PREDICTED: L-ascorbate oxidase homolog             145   4e-40   
ref|XP_010552290.1|  PREDICTED: L-ascorbate oxidase homolog             149   8e-40   
gb|EEC79422.1|  hypothetical protein OsI_20394                          147   3e-39   Oryza sativa Indica Group [Indian rice]
gb|AAT01329.1|  putative L-ascorbate oxidase                            147   5e-39   Oryza sativa Japonica Group [Japonica rice]
gb|EEE55579.1|  hypothetical protein OsJ_03867                          147   6e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004961713.1|  PREDICTED: L-ascorbate oxidase homolog             147   6e-39   
ref|NP_001044620.1|  Os01g0816700                                       147   6e-39   Oryza sativa Japonica Group [Japonica rice]
gb|EEC71702.1|  hypothetical protein OsI_04207                          147   6e-39   Oryza sativa Indica Group [Indian rice]
ref|XP_003567221.1|  PREDICTED: L-ascorbate oxidase homolog             146   6e-39   
gb|ACN34077.1|  unknown                                                 145   2e-38   Zea mays [maize]
ref|NP_001151662.1|  L-ascorbate oxidase precursor                      145   2e-38   Zea mays [maize]
gb|EYU39761.1|  hypothetical protein MIMGU_mgv1a003754mg                145   2e-38   
ref|XP_008804666.1|  PREDICTED: L-ascorbate oxidase homolog             145   2e-38   
ref|XP_002456532.1|  hypothetical protein SORBIDRAFT_03g037970          144   3e-38   Sorghum bicolor [broomcorn]
gb|ADK47981.1|  L-ascorbate oxidase-like protein                        143   8e-38   
gb|EEE64155.1|  hypothetical protein OsJ_18987                          143   8e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004970369.1|  PREDICTED: L-ascorbate oxidase homolog             143   8e-38   
ref|XP_008788020.1|  PREDICTED: L-ascorbate oxidase homolog             143   8e-38   
dbj|BAK07214.1|  predicted protein                                      143   9e-38   
ref|NP_001132891.1|  uncharacterized protein LOC100194388               142   1e-37   Zea mays [maize]
gb|ACF86554.2|  unknown                                                 143   1e-37   Zea mays [maize]
ref|XP_009794442.1|  PREDICTED: L-ascorbate oxidase homolog             143   1e-37   
emb|CDM84722.1|  unnamed protein product                                142   2e-37   
gb|EMT02825.1|  L-ascorbate oxidase-like protein                        142   2e-37   
ref|XP_010103298.1|  L-ascorbate oxidase-like protein                   142   2e-37   
ref|XP_002441281.1|  hypothetical protein SORBIDRAFT_09g023770          142   3e-37   Sorghum bicolor [broomcorn]
ref|XP_008672229.1|  PREDICTED: uncharacterized protein LOC100194...    142   3e-37   
gb|EMS66047.1|  L-ascorbate oxidase-like protein                        142   3e-37   
ref|NP_001151772.1|  pollen-specific protein NTP303 precursor           142   4e-37   Zea mays [maize]
dbj|BAK05994.1|  predicted protein                                      140   1e-36   
gb|EYU36818.1|  hypothetical protein MIMGU_mgv1a004264mg                140   1e-36   
gb|EYU27771.1|  hypothetical protein MIMGU_mgv1a003982mg                140   2e-36   
gb|KHG04142.1|  L-ascorbate oxidase                                     139   2e-36   
ref|XP_006644902.1|  PREDICTED: L-ascorbate oxidase homolog             139   2e-36   
gb|ACN26659.1|  unknown                                                 139   2e-36   Zea mays [maize]
ref|NP_001151961.1|  pollen-specific protein NTP303 precursor           139   2e-36   Zea mays [maize]
ref|XP_010922850.1|  PREDICTED: L-ascorbate oxidase homolog             139   3e-36   
ref|XP_011008684.1|  PREDICTED: L-ascorbate oxidase homolog             138   3e-36   
ref|XP_003566121.2|  PREDICTED: L-ascorbate oxidase homolog             139   4e-36   
ref|XP_011046956.1|  PREDICTED: L-ascorbate oxidase homolog             139   4e-36   
gb|ABK95805.1|  unknown                                                 139   4e-36   Populus trichocarpa [western balsam poplar]
ref|XP_004243477.1|  PREDICTED: L-ascorbate oxidase homolog             138   5e-36   
ref|XP_006383902.1|  multi-copper oxidase type 1 family protein         138   7e-36   
gb|ABK25092.1|  unknown                                                 137   9e-36   Picea sitchensis
ref|XP_009397777.1|  PREDICTED: L-ascorbate oxidase homolog             137   1e-35   
ref|XP_007046384.1|  SKU5 similar 5 isoform 2                           137   1e-35   
ref|XP_007046383.1|  SKU5 similar 5 isoform 1                           137   1e-35   
ref|XP_006386039.1|  multi-copper oxidase type 1 family protein         137   2e-35   
ref|XP_010539014.1|  PREDICTED: L-ascorbate oxidase homolog             137   2e-35   
ref|XP_007026108.1|  SKU5 similar 4 isoform 1                           137   2e-35   
ref|XP_007026110.1|  SKU5 similar 4 isoform 3                           137   2e-35   
ref|XP_010529443.1|  PREDICTED: L-ascorbate oxidase homolog             136   2e-35   
emb|CDP19581.1|  unnamed protein product                                136   2e-35   
ref|XP_008440923.1|  PREDICTED: L-ascorbate oxidase homolog             136   2e-35   
gb|EYU17541.1|  hypothetical protein MIMGU_mgv1a004531mg                136   3e-35   
ref|XP_004145114.1|  PREDICTED: L-ascorbate oxidase homolog             136   3e-35   
ref|XP_010448953.1|  PREDICTED: L-ascorbate oxidase homolog             136   3e-35   
ref|XP_010439384.1|  PREDICTED: L-ascorbate oxidase homolog             136   3e-35   
ref|XP_010434093.1|  PREDICTED: L-ascorbate oxidase homolog             136   3e-35   
ref|XP_002869849.1|  hypothetical protein ARALYDRAFT_914433             136   3e-35   
ref|NP_193932.1|  protein SKU5 similar 4                                136   3e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004287955.1|  PREDICTED: L-ascorbate oxidase homolog             136   3e-35   
emb|CDP04415.1|  unnamed protein product                                136   4e-35   
ref|XP_009596487.1|  PREDICTED: L-ascorbate oxidase homolog             136   4e-35   
gb|KDP20733.1|  hypothetical protein JCGZ_21204                         136   4e-35   
ref|XP_002524823.1|  multicopper oxidase, putative                      135   5e-35   Ricinus communis
ref|XP_010931432.1|  PREDICTED: L-ascorbate oxidase homolog             135   5e-35   
ref|XP_007215641.1|  hypothetical protein PRUPE_ppa003877mg             135   5e-35   
ref|XP_002320467.1|  hypothetical protein POPTR_0014s15260g             135   6e-35   
ref|XP_010061137.1|  PREDICTED: L-ascorbate oxidase homolog             135   6e-35   
ref|XP_011099705.1|  PREDICTED: L-ascorbate oxidase homolog             135   6e-35   
gb|KCW68031.1|  hypothetical protein EUGRSUZ_F01712                     135   7e-35   
ref|XP_004231076.1|  PREDICTED: L-ascorbate oxidase homolog             135   7e-35   
ref|XP_008789824.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    134   7e-35   
gb|EMT12555.1|  L-ascorbate oxidase-like protein                        134   8e-35   
ref|XP_002282214.1|  PREDICTED: L-ascorbate oxidase homolog             135   8e-35   
emb|CDY43352.1|  BnaA01g29830D                                          135   9e-35   
ref|XP_008789823.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    135   1e-34   
ref|XP_010089487.1|  L-ascorbate oxidase-like protein                   132   1e-34   
gb|KDP22727.1|  hypothetical protein JCGZ_01829                         134   1e-34   
ref|XP_006282576.1|  hypothetical protein CARUB_v10004445mg             135   1e-34   
gb|KFK28784.1|  hypothetical protein AALP_AA7G047600                    134   1e-34   
gb|EPS74059.1|  hypothetical protein M569_00695                         134   2e-34   
ref|XP_010929557.1|  PREDICTED: L-ascorbate oxidase homolog             134   2e-34   
emb|CDX82897.1|  BnaC01g13470D                                          134   2e-34   
ref|XP_006467415.1|  PREDICTED: L-ascorbate oxidase homolog             134   2e-34   
ref|XP_006449754.1|  hypothetical protein CICLE_v10014825mg             134   2e-34   
ref|XP_004487420.1|  PREDICTED: L-ascorbate oxidase homolog             134   2e-34   
ref|XP_004166771.1|  PREDICTED: L-ascorbate oxidase homolog             134   2e-34   
ref|XP_004144498.1|  PREDICTED: L-ascorbate oxidase homolog             134   2e-34   
ref|XP_002518462.1|  multicopper oxidase, putative                      134   2e-34   
ref|XP_008455444.1|  PREDICTED: L-ascorbate oxidase homolog             134   2e-34   
ref|XP_009418785.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    134   3e-34   
emb|CDX79120.1|  BnaA01g11870D                                          133   3e-34   
ref|XP_009135529.1|  PREDICTED: L-ascorbate oxidase homolog             133   3e-34   
ref|XP_009418784.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    134   3e-34   
ref|XP_006413696.1|  hypothetical protein EUTSA_v10024862mg             133   4e-34   
ref|XP_009402576.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    132   4e-34   
ref|XP_009408654.1|  PREDICTED: L-ascorbate oxidase homolog             133   4e-34   
ref|XP_009402575.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    132   4e-34   
ref|XP_009402574.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    133   5e-34   
ref|XP_008663511.1|  PREDICTED: L-ascorbate oxidase homolog             133   5e-34   
ref|XP_006338228.1|  PREDICTED: L-ascorbate oxidase homolog             132   6e-34   
gb|KEH29685.1|  multi-copper oxidase-like protein                       132   6e-34   
ref|XP_008384084.1|  PREDICTED: L-ascorbate oxidase homolog             132   7e-34   
ref|XP_006850531.1|  hypothetical protein AMTR_s00159p00040990          132   7e-34   
emb|CBI18560.3|  unnamed protein product                                132   7e-34   
ref|XP_002270831.1|  PREDICTED: L-ascorbate oxidase homolog             132   7e-34   
ref|XP_007153964.1|  hypothetical protein PHAVU_003G080100g             132   7e-34   
ref|XP_006364519.1|  PREDICTED: L-ascorbate oxidase homolog             132   8e-34   
ref|XP_010923874.1|  PREDICTED: L-ascorbate oxidase homolog             132   8e-34   
ref|XP_007047154.1|  SKU5 similar 17 isoform 3                          131   8e-34   
ref|XP_004293304.1|  PREDICTED: L-ascorbate oxidase homolog             132   8e-34   
ref|XP_006360232.1|  PREDICTED: L-ascorbate oxidase homolog             132   8e-34   
ref|XP_004233429.1|  PREDICTED: L-ascorbate oxidase homolog             132   8e-34   
ref|XP_004232701.1|  PREDICTED: L-ascorbate oxidase homolog             132   9e-34   
emb|CAN72538.1|  hypothetical protein VITISV_028749                     132   1e-33   
ref|XP_006348131.1|  PREDICTED: L-ascorbate oxidase homolog             132   1e-33   
ref|XP_011047251.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    132   1e-33   
ref|XP_007156841.1|  hypothetical protein PHAVU_002G021900g             132   1e-33   
ref|XP_003517277.1|  PREDICTED: L-ascorbate oxidase homolog             132   1e-33   
ref|XP_004507683.1|  PREDICTED: L-ascorbate oxidase homolog             131   1e-33   
ref|XP_010099197.1|  L-ascorbate oxidase-like protein                   131   1e-33   
ref|XP_002269614.1|  PREDICTED: L-ascorbate oxidase homolog             131   1e-33   
ref|XP_008229964.1|  PREDICTED: L-ascorbate oxidase homolog             131   1e-33   
ref|XP_011088669.1|  PREDICTED: L-ascorbate oxidase homolog             131   2e-33   
ref|XP_008362259.1|  PREDICTED: L-ascorbate oxidase homolog             131   2e-33   
ref|XP_007047152.1|  SKU5 similar 17 isoform 1                          131   2e-33   
ref|XP_007047153.1|  SKU5 similar 17 isoform 2                          131   2e-33   
ref|XP_008806480.1|  PREDICTED: L-ascorbate oxidase homolog             131   2e-33   
gb|KHN44868.1|  L-ascorbate oxidase like                                131   2e-33   
emb|CDP10787.1|  unnamed protein product                                131   2e-33   
ref|XP_009794441.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    131   2e-33   
gb|EPS57861.1|  hypothetical protein M569_16956                         130   2e-33   
ref|XP_009597920.1|  PREDICTED: L-ascorbate oxidase homolog             131   2e-33   
ref|XP_009359037.1|  PREDICTED: L-ascorbate oxidase homolog             131   2e-33   
ref|XP_003540295.1|  PREDICTED: L-ascorbate oxidase homolog             131   2e-33   
ref|XP_011096053.1|  PREDICTED: L-ascorbate oxidase homolog             131   2e-33   
ref|XP_009794440.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    131   2e-33   
ref|XP_002272880.1|  PREDICTED: L-ascorbate oxidase homolog             131   2e-33   
ref|XP_010244491.1|  PREDICTED: L-ascorbate oxidase homolog             131   2e-33   
gb|KDP31876.1|  hypothetical protein JCGZ_12337                         131   2e-33   
ref|XP_002301616.1|  hypothetical protein POPTR_0002s21400g             131   2e-33   
gb|KDO79341.1|  hypothetical protein CISIN_1g0092422mg                  129   3e-33   
ref|XP_008792598.1|  PREDICTED: L-ascorbate oxidase homolog             130   3e-33   
ref|XP_006469674.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    130   3e-33   
gb|KDO54690.1|  hypothetical protein CISIN_1g009283mg                   130   3e-33   
ref|XP_008806482.1|  PREDICTED: L-ascorbate oxidase homolog             130   3e-33   
ref|XP_002285913.1|  PREDICTED: L-ascorbate oxidase homolog             130   3e-33   
ref|XP_009629876.1|  PREDICTED: L-ascorbate oxidase homolog             130   3e-33   
ref|XP_004987010.1|  PREDICTED: L-ascorbate oxidase homolog             130   3e-33   
ref|XP_009623446.1|  PREDICTED: L-ascorbate oxidase homolog             130   3e-33   
emb|CAA65634.1|  PS60                                                   130   3e-33   
ref|XP_010266952.1|  PREDICTED: L-ascorbate oxidase homolog             130   3e-33   
gb|KHG21949.1|  L-ascorbate oxidase                                     130   3e-33   
ref|XP_006447580.1|  hypothetical protein CICLE_v10014842mg             130   4e-33   
gb|AGJ03718.1|  multicopper oxidase                                     130   4e-33   
ref|XP_010908384.1|  PREDICTED: L-ascorbate oxidase homolog             130   4e-33   
ref|XP_009782819.1|  PREDICTED: L-ascorbate oxidase homolog             130   4e-33   
gb|ABR18324.1|  unknown                                                 130   4e-33   
gb|AGE09595.1|  SKU5-like protein                                       130   4e-33   
gb|KDO79340.1|  hypothetical protein CISIN_1g0092422mg                  130   4e-33   
ref|XP_010680450.1|  PREDICTED: L-ascorbate oxidase homolog             130   4e-33   
ref|XP_006425823.1|  hypothetical protein CICLE_v10025326mg             130   4e-33   
ref|XP_003596959.1|  L-ascorbate oxidase-like protein                   130   4e-33   
ref|XP_004506275.1|  PREDICTED: L-ascorbate oxidase homolog             130   4e-33   
ref|XP_002448327.1|  hypothetical protein SORBIDRAFT_06g025300          130   4e-33   
ref|XP_007041705.1|  SKU5 similar 5                                     130   4e-33   
gb|KHN42054.1|  L-ascorbate oxidase like                                130   4e-33   
ref|XP_003537368.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    130   4e-33   
ref|XP_003596958.1|  L-ascorbate oxidase-like protein                   130   5e-33   
ref|XP_006342102.1|  PREDICTED: L-ascorbate oxidase homolog             130   5e-33   
ref|XP_010070498.1|  PREDICTED: L-ascorbate oxidase homolog             130   5e-33   
ref|XP_009347125.1|  PREDICTED: L-ascorbate oxidase homolog             130   5e-33   
ref|XP_011013814.1|  PREDICTED: L-ascorbate oxidase homolog             130   6e-33   
ref|XP_011039228.1|  PREDICTED: L-ascorbate oxidase homolog             130   6e-33   
gb|ABK25324.1|  unknown                                                 130   6e-33   
ref|XP_003610452.1|  L-ascorbate oxidase-like protein                   130   6e-33   
gb|EMT20871.1|  L-ascorbate oxidase-like protein                        129   7e-33   
ref|XP_002528421.1|  multicopper oxidase, putative                      129   7e-33   
emb|CAN83942.1|  hypothetical protein VITISV_013559                     129   8e-33   
ref|XP_008371076.1|  PREDICTED: L-ascorbate oxidase homolog             129   8e-33   
ref|XP_009785141.1|  PREDICTED: L-ascorbate oxidase homolog             129   8e-33   
ref|XP_008241558.1|  PREDICTED: L-ascorbate oxidase homolog             129   8e-33   
ref|XP_007203632.1|  hypothetical protein PRUPE_ppa003976mg             129   8e-33   
ref|XP_004232058.1|  PREDICTED: L-ascorbate oxidase homolog             129   9e-33   
ref|XP_009381277.1|  PREDICTED: L-ascorbate oxidase homolog             129   1e-32   
ref|XP_010028301.1|  PREDICTED: L-ascorbate oxidase homolog             129   1e-32   
ref|XP_004141928.1|  PREDICTED: L-ascorbate oxidase homolog             129   1e-32   
ref|XP_008440238.1|  PREDICTED: L-ascorbate oxidase homolog             129   1e-32   
ref|XP_006855939.1|  hypothetical protein AMTR_s00037p00216460          129   1e-32   
ref|XP_003605947.1|  L-ascorbate oxidase-like protein                   129   1e-32   
ref|XP_008452926.1|  PREDICTED: L-ascorbate oxidase homolog             129   1e-32   
ref|XP_010052867.1|  PREDICTED: L-ascorbate oxidase homolog             129   1e-32   
ref|XP_010323833.1|  PREDICTED: L-ascorbate oxidase homolog             129   1e-32   
ref|XP_004511977.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    129   1e-32   
gb|KCW55012.1|  hypothetical protein EUGRSUZ_I00988                     129   2e-32   
ref|XP_006366591.1|  PREDICTED: L-ascorbate oxidase homolog             129   2e-32   
ref|XP_009407426.1|  PREDICTED: L-ascorbate oxidase homolog             128   2e-32   
gb|KHG03845.1|  L-ascorbate oxidase                                     129   2e-32   
emb|CAB08077.1|  pectinesterase                                         128   2e-32   
ref|XP_009353293.1|  PREDICTED: L-ascorbate oxidase homolog             128   2e-32   
ref|XP_004238406.1|  PREDICTED: L-ascorbate oxidase homolog             128   2e-32   
ref|XP_004506310.1|  PREDICTED: L-ascorbate oxidase homolog             128   2e-32   
ref|XP_002522337.1|  multicopper oxidase, putative                      128   2e-32   
ref|XP_010923873.1|  PREDICTED: L-ascorbate oxidase homolog             128   3e-32   
ref|XP_009140476.1|  PREDICTED: L-ascorbate oxidase homolog             128   3e-32   
ref|XP_010263761.1|  PREDICTED: L-ascorbate oxidase homolog             128   3e-32   
ref|XP_004509176.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    128   3e-32   
ref|XP_004145593.1|  PREDICTED: L-ascorbate oxidase homolog             128   3e-32   
ref|XP_010103300.1|  L-ascorbate oxidase-like protein                   128   3e-32   
gb|KHN36198.1|  L-ascorbate oxidase like                                128   3e-32   
ref|XP_004290036.1|  PREDICTED: L-ascorbate oxidase homolog             128   3e-32   
ref|XP_004509178.1|  PREDICTED: L-ascorbate oxidase homolog             128   3e-32   
ref|XP_002310162.1|  multi-copper oxidase type 1 family protein         127   3e-32   
ref|XP_004157080.1|  PREDICTED: L-ascorbate oxidase homolog             128   3e-32   
emb|CDY68812.1|  BnaAnng28440D                                          127   3e-32   
ref|XP_010558427.1|  PREDICTED: L-ascorbate oxidase homolog             127   4e-32   
gb|KHG11003.1|  L-ascorbate oxidase                                     127   4e-32   
ref|XP_009115829.1|  PREDICTED: L-ascorbate oxidase homolog             127   4e-32   
emb|CDY43557.1|  BnaC02g16540D                                          127   4e-32   
ref|XP_010046372.1|  PREDICTED: L-ascorbate oxidase homolog             127   4e-32   
ref|XP_010278638.1|  PREDICTED: L-ascorbate oxidase homolog             127   4e-32   
ref|XP_010676489.1|  PREDICTED: L-ascorbate oxidase homolog             127   4e-32   
ref|XP_008377105.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    127   5e-32   
ref|XP_010472357.1|  PREDICTED: L-ascorbate oxidase homolog             127   5e-32   
ref|XP_010429313.1|  PREDICTED: L-ascorbate oxidase homolog             127   5e-32   
ref|XP_010417106.1|  PREDICTED: L-ascorbate oxidase homolog             127   5e-32   
ref|XP_004509174.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    127   5e-32   
dbj|BAK00459.1|  predicted protein                                      127   5e-32   
dbj|BAJ91397.1|  predicted protein                                      127   5e-32   
gb|KHG02352.1|  L-ascorbate oxidase                                     127   5e-32   
ref|XP_002306213.1|  hypothetical protein POPTR_0004s18730g             127   5e-32   
ref|XP_008241557.1|  PREDICTED: L-ascorbate oxidase homolog             127   6e-32   
ref|XP_007204826.1|  hypothetical protein PRUPE_ppa003926mg             127   6e-32   
ref|XP_010028797.1|  PREDICTED: L-ascorbate oxidase homolog             127   6e-32   
ref|XP_006296162.1|  hypothetical protein CARUB_v10025315mg             127   6e-32   
ref|XP_007132533.1|  hypothetical protein PHAVU_011G102500g             127   6e-32   
ref|XP_004171059.1|  PREDICTED: L-ascorbate oxidase homolog             126   7e-32   
ref|XP_006304367.1|  hypothetical protein CARUB_v10010844mg             127   7e-32   
ref|XP_002866726.1|  predicted protein                                  127   7e-32   
gb|KCW55614.1|  hypothetical protein EUGRSUZ_I01478                     126   7e-32   
ref|XP_007213899.1|  hypothetical protein PRUPE_ppa003872mg             126   7e-32   
ref|XP_003563038.1|  PREDICTED: L-ascorbate oxidase homolog             127   7e-32   
ref|XP_004142986.1|  PREDICTED: L-ascorbate oxidase homolog             127   7e-32   
gb|EYU38005.1|  hypothetical protein MIMGU_mgv1a004001mg                127   8e-32   
gb|KEH20499.1|  multi-copper oxidase-like protein                       127   8e-32   
ref|XP_002880518.1|  hypothetical protein ARALYDRAFT_320180             126   9e-32   
ref|XP_008445302.1|  PREDICTED: L-ascorbate oxidase homolog             126   9e-32   
gb|EYU44358.1|  hypothetical protein MIMGU_mgv1a004238mg                126   1e-31   
ref|XP_003550084.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    126   1e-31   
ref|XP_006393890.1|  hypothetical protein EUTSA_v10003952mg             126   1e-31   
ref|XP_006393891.1|  hypothetical protein EUTSA_v10003952mg             126   1e-31   
ref|XP_009334388.1|  PREDICTED: L-ascorbate oxidase homolog             126   1e-31   
ref|XP_007213900.1|  hypothetical protein PRUPE_ppa003872mg             126   1e-31   
ref|XP_010444713.1|  PREDICTED: L-ascorbate oxidase homolog             126   1e-31   
ref|XP_003527501.1|  PREDICTED: L-ascorbate oxidase homolog             126   1e-31   
ref|XP_009594576.1|  PREDICTED: L-ascorbate oxidase homolog             126   1e-31   
ref|XP_008387887.1|  PREDICTED: L-ascorbate oxidase homolog             126   1e-31   
ref|XP_003529638.1|  PREDICTED: L-ascorbate oxidase homolog             125   2e-31   
ref|XP_003549771.1|  PREDICTED: L-ascorbate oxidase homolog             125   2e-31   
ref|XP_006280268.1|  hypothetical protein CARUB_v10026189mg             125   2e-31   
gb|KHG07318.1|  L-ascorbate oxidase                                     125   2e-31   
ref|XP_002522339.1|  multicopper oxidase, putative                      125   2e-31   
ref|XP_006486657.1|  PREDICTED: L-ascorbate oxidase homolog             125   2e-31   
ref|XP_009777142.1|  PREDICTED: L-ascorbate oxidase homolog             125   2e-31   
dbj|BAB08634.1|  pectinesterase like protein                            125   2e-31   
ref|XP_006422489.1|  hypothetical protein CICLE_v10028140mg             125   2e-31   
ref|NP_569041.1|  protein SKU5 similar 17                               125   2e-31   
gb|AAM61328.1|  pectinesterase-like protein                             125   2e-31   
ref|XP_009413373.1|  PREDICTED: L-ascorbate oxidase homolog             125   2e-31   
gb|KEH20500.1|  multi-copper oxidase-like protein                       125   3e-31   
ref|XP_010109886.1|  L-ascorbate oxidase-like protein                   125   3e-31   
ref|XP_010263764.1|  PREDICTED: L-ascorbate oxidase homolog             125   3e-31   
ref|XP_010547509.1|  PREDICTED: L-ascorbate oxidase homolog             125   3e-31   
gb|KHG25743.1|  L-ascorbate oxidase                                     125   3e-31   
ref|XP_009112343.1|  PREDICTED: L-ascorbate oxidase homolog             125   3e-31   
emb|CDY18626.1|  BnaA09g07690D                                          125   3e-31   
ref|XP_009758923.1|  PREDICTED: L-ascorbate oxidase homolog             125   3e-31   
ref|XP_002460757.1|  hypothetical protein SORBIDRAFT_02g034420          125   3e-31   
ref|XP_008224692.1|  PREDICTED: L-ascorbate oxidase homolog             125   3e-31   
ref|XP_006435292.1|  hypothetical protein CICLE_v10000783mg             124   3e-31   
ref|XP_003563398.1|  PREDICTED: L-ascorbate oxidase homolog             125   3e-31   
ref|XP_004957823.1|  PREDICTED: L-ascorbate oxidase homolog             125   4e-31   
gb|ACN28536.1|  unknown                                                 124   4e-31   
ref|XP_010690287.1|  PREDICTED: L-ascorbate oxidase homolog             125   4e-31   
ref|XP_009758924.1|  PREDICTED: L-ascorbate oxidase homolog             125   4e-31   
ref|XP_010464737.1|  PREDICTED: L-ascorbate oxidase homolog             125   4e-31   
ref|XP_011046313.1|  PREDICTED: L-ascorbate oxidase homolog             125   4e-31   



>ref|XP_009624631.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=559

 Score =   188 bits (478),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 88/116 (76%), Positives = 100/116 (86%), Gaps = 1/116 (1%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKL-DPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            +LKKILD GR+I RPDG+ INGK  KVGDK+ +PLF ME GKTYRYRVCNAG+RTSVNFR
Sbjct  174  SLKKILDGGRTIGRPDGIHINGKSVKVGDKVAEPLFTMEAGKTYRYRVCNAGMRTSVNFR  233

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
             QGH M +VE+EGSHTVQN Y+SLDLHVGQCLSVLVTA +E KDYY++ SSRF KQ
Sbjct  234  IQGHPMKLVEMEGSHTVQNVYESLDLHVGQCLSVLVTADQEPKDYYMIVSSRFLKQ  289



>gb|AAQ90185.1| ntp805 [Nicotiana tabacum]
Length=559

 Score =   188 bits (478),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 88/116 (76%), Positives = 100/116 (86%), Gaps = 1/116 (1%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKL-DPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            +LKKILD GR+I RPDG+ INGK  KVGDK+ +PLF ME GKTYRYRVCNAG+RTSVNFR
Sbjct  174  SLKKILDGGRTIGRPDGIHINGKSVKVGDKVAEPLFTMEAGKTYRYRVCNAGMRTSVNFR  233

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
             QGH M +VE+EGSHTVQN Y+SLDLHVGQCLSVLVTA +E KDYY++ SSRF KQ
Sbjct  234  IQGHPMKLVEMEGSHTVQNVYESLDLHVGQCLSVLVTADQEPKDYYMIVSSRFLKQ  289



>sp|P29162.1|ASOL_TOBAC RecName: Full=L-ascorbate oxidase homolog; AltName: Full=Pollen-specific 
protein NTP303; Flags: Precursor [Nicotiana tabacum]
 emb|CAA43454.1| pollen specific protein [Nicotiana tabacum]
Length=554

 Score =   187 bits (476),  Expect = 6e-54, Method: Composition-based stats.
 Identities = 86/115 (75%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TLKKILD GR+I RPDG++INGK  KVG+  +PLF ME GKTYRYR CN G+R+SVN RF
Sbjct  173  TLKKILDGGRTIGRPDGIIINGKSAKVGEAKEPLFTMEAGKTYRYRFCNLGMRSSVNIRF  232

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            QGH M +VE+EGSHTVQN Y SLDLHVGQCLSVLVTA +E KDYYLV SSRF KQ
Sbjct  233  QGHPMKLVELEGSHTVQNIYDSLDLHVGQCLSVLVTADQEPKDYYLVVSSRFLKQ  287



>emb|CDP18567.1| unnamed protein product [Coffea canephora]
Length=557

 Score =   187 bits (474),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 83/113 (73%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK +LDSGRS+ RPDG+ INGK  KVGD ++PLF MEPGKTYRYRVCN GL+TS+NFR Q
Sbjct  175  LKNMLDSGRSLGRPDGIQINGKSAKVGDNVEPLFTMEPGKTYRYRVCNVGLKTSINFRIQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            GH + +VE+EGSHTVQ D+ SLD+HVGQCLSVLVTA KE KDYY VASSRF +
Sbjct  235  GHPLKLVEIEGSHTVQYDFDSLDVHVGQCLSVLVTADKEPKDYYFVASSRFIQ  287



>dbj|BAO02510.1| predicted pollen-specific protein ortholog [Nicotiana alata]
Length=555

 Score =   186 bits (473),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 85/115 (74%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TLKKILD GR+I RPDG++INGK  KVG+  +PLF ME GKTYRYR CN G+R+SVN RF
Sbjct  174  TLKKILDGGRTIGRPDGIIINGKSAKVGEAKEPLFTMEAGKTYRYRFCNLGMRSSVNIRF  233

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            QGH M +VE+EGSHTVQN Y SLDLHVGQC SVLVTA +E KDYYLV SSRF KQ
Sbjct  234  QGHPMKLVELEGSHTVQNIYDSLDLHVGQCFSVLVTADQEPKDYYLVVSSRFLKQ  288



>ref|XP_009588330.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=589

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TLKKILD GR+I RPDG++INGK  KVG+  +PLF ME GKTYRYR CN G+R+SVN RF
Sbjct  208  TLKKILDGGRTIGRPDGIIINGKSAKVGEAKEPLFTMEAGKTYRYRFCNLGMRSSVNIRF  267

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            QGH M +VE+EGSHTVQN Y SLDLHVGQCLSVLVTA +E KDYYLV SSRF KQ
Sbjct  268  QGHPMKLVELEGSHTVQNIYDSLDLHVGQCLSVLVTADQEPKDYYLVVSSRFLKQ  322



>ref|XP_006341879.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=554

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TLKK+LD G ++ RPDG++INGK  KVG+  +PLF ME GKTYRYR CN G+R+SVN RF
Sbjct  173  TLKKVLDGGHTVGRPDGIIINGKSAKVGEAKEPLFTMEAGKTYRYRFCNLGMRSSVNVRF  232

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
            QGH M +VE+EGSHTVQN Y SLDLHVGQCLSVLVTA +E KDYYLV SSRF KQE
Sbjct  233  QGHPMKLVELEGSHTVQNIYDSLDLHVGQCLSVLVTADQEPKDYYLVVSSRFLKQE  288



>ref|XP_004164922.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TLK+ LDSGRSI RPDG++INGK  K     +PLF M+PGKTY+YRVCN GL+TS+NFRF
Sbjct  175  TLKQFLDSGRSIARPDGVLINGKTSKDDGIDEPLFTMKPGKTYKYRVCNVGLKTSLNFRF  234

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            QGH M +VE+EGSHTVQNDYKSLD+HVGQC SVLVTA +E KDYY+VAS+RF K
Sbjct  235  QGHTMKLVEMEGSHTVQNDYKSLDVHVGQCFSVLVTADQEPKDYYMVASTRFIK  288



>gb|EYU32814.1| hypothetical protein MIMGU_mgv1a003925mg [Erythranthe guttata]
Length=555

 Score =   180 bits (456),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 96/116 (83%), Gaps = 1/116 (1%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGD-KLDPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            TLKKILDSGRSI +PDG+ INGK  KVGD    PL  MEPGKTYRYRVCN G++ SVNFR
Sbjct  174  TLKKILDSGRSIGKPDGIQINGKSSKVGDVAAQPLAVMEPGKTYRYRVCNVGMKLSVNFR  233

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            FQGH M +VE+EGSHTVQN Y SLDLHVGQCLSVLVTA++  KDYYLV SSRF KQ
Sbjct  234  FQGHTMKLVELEGSHTVQNVYDSLDLHVGQCLSVLVTANQAPKDYYLVVSSRFSKQ  289



>ref|XP_009785667.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
 gb|AAQ90183.1| ntp201 [Nicotiana tabacum]
Length=559

 Score =   180 bits (456),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 99/116 (85%), Gaps = 1/116 (1%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKL-DPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            +LKKILD GR+I RPDG+ INGK  KVGDK+ +PLF ME GKTYRYR+CNAG+RTSVN R
Sbjct  174  SLKKILDGGRTIGRPDGIHINGKSLKVGDKVAEPLFTMEAGKTYRYRMCNAGMRTSVNVR  233

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
             QGH M +VE+EGSHTVQN Y+SLDLHVGQCLSVLVTA +E KDYY++ SSRF KQ
Sbjct  234  IQGHPMKLVEMEGSHTVQNVYESLDLHVGQCLSVLVTADQEPKDYYMIVSSRFLKQ  289



>ref|XP_004149634.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   179 bits (455),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TLK+ LDSGRSI RPDG++INGK  K     +PLF M+PGKTY+YRVCN GL++S+NFRF
Sbjct  175  TLKQFLDSGRSIARPDGVLINGKTSKDDGIDEPLFTMKPGKTYKYRVCNVGLKSSLNFRF  234

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            QGH M +VE+EGSHTVQNDYKSLD+HVGQC SVLVTA++E KDYY+VAS+RF K
Sbjct  235  QGHTMKLVEMEGSHTVQNDYKSLDVHVGQCFSVLVTANQEPKDYYMVASTRFIK  288



>gb|KGN54013.1| hypothetical protein Csa_4G267480 [Cucumis sativus]
Length=476

 Score =   178 bits (452),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 99/114 (87%), Gaps = 2/114 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            LK+ LDSGRSI RPDG++INGK  K GD  D PLF M+PGKTY+YRVCN GL++S+NFRF
Sbjct  152  LKQFLDSGRSIARPDGVLINGKSAK-GDGTDEPLFTMKPGKTYKYRVCNVGLKSSLNFRF  210

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            QGH M +VE+EGSHTVQNDY+SLD+HVGQC SVLVTA++E KDYY+VAS+RF K
Sbjct  211  QGHTMKLVEMEGSHTVQNDYESLDVHVGQCFSVLVTANQEPKDYYMVASTRFIK  264



>ref|XP_004229062.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=554

 Score =   179 bits (454),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TLKK+LD G ++ RPDG++INGK  KVG+  +PLF ME GKTYRYR CN G+R+SVN R 
Sbjct  173  TLKKVLDGGHTVGRPDGIIINGKSAKVGEAKEPLFTMEAGKTYRYRFCNLGMRSSVNVRL  232

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
            QGH M +VE+EGSHTVQN Y SLD+HVGQCLSVLVTA++E KDYYLV SSRF KQE
Sbjct  233  QGHPMKLVELEGSHTVQNIYDSLDIHVGQCLSVLVTANQEPKDYYLVVSSRFLKQE  288



>ref|XP_008449913.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Cucumis melo]
Length=554

 Score =   179 bits (453),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 84/116 (72%), Positives = 101/116 (87%), Gaps = 3/116 (3%)
 Frame = +3

Query  3    TLKKILDSG-RSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNF  176
            TLK+ILD+G RSI RP+G++INGK  K GD  D PLF M+PGKTY+YRVCN GL+TS+NF
Sbjct  175  TLKQILDNGHRSIARPEGVLINGKTAK-GDGTDEPLFTMKPGKTYKYRVCNVGLKTSLNF  233

Query  177  RFQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            RFQGH M +VE+EGSHTVQNDY+SLD+HVGQC SVLVTA++E KDYY+VAS+RF K
Sbjct  234  RFQGHTMKLVEMEGSHTVQNDYQSLDVHVGQCFSVLVTANQEPKDYYMVASTRFIK  289



>ref|XP_008449912.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Cucumis melo]
Length=554

 Score =   179 bits (453),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 84/116 (72%), Positives = 101/116 (87%), Gaps = 3/116 (3%)
 Frame = +3

Query  3    TLKKILDSG-RSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNF  176
            TLK+ILD+G RSI RP+G++INGK  K GD  D PLF M+PGKTY+YRVCN GL+TS+NF
Sbjct  175  TLKQILDNGHRSIARPEGVLINGKTAK-GDGTDEPLFTMKPGKTYKYRVCNVGLKTSLNF  233

Query  177  RFQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            RFQGH M +VE+EGSHTVQNDY+SLD+HVGQC SVLVTA++E KDYY+VAS+RF K
Sbjct  234  RFQGHTMKLVEMEGSHTVQNDYQSLDVHVGQCFSVLVTANQEPKDYYMVASTRFIK  289



>ref|XP_004149637.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 100/115 (87%), Gaps = 2/115 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            LK++LDSGRSI RPDG++INGK  K GD  D PLF M+PGKTY+YRVCN GL++S+NFRF
Sbjct  176  LKQLLDSGRSIARPDGVLINGKSAK-GDGTDEPLFTMKPGKTYKYRVCNVGLKSSLNFRF  234

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            QGH M +VE+EGSHTVQNDY+SLD+HVGQC SVLVTA++E KDYY+VAS+RF K 
Sbjct  235  QGHTMKLVEMEGSHTVQNDYESLDVHVGQCFSVLVTANQEPKDYYMVASTRFIKN  289



>ref|XP_004164925.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 99/115 (86%), Gaps = 2/115 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            LK+ LDSGRSI RPDG++INGK  K GD  D PLF M+PGKTY+YRVCN GL++S+NFRF
Sbjct  176  LKQFLDSGRSIARPDGVLINGKTAK-GDGTDEPLFTMKPGKTYKYRVCNVGLKSSLNFRF  234

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            QGH M +VE+EGSHTVQNDY+SLD+HVGQC SVLVTA++E KDYY+VAS+RF K 
Sbjct  235  QGHTMKLVEMEGSHTVQNDYQSLDVHVGQCFSVLVTANQEPKDYYMVASTRFIKN  289



>ref|XP_006354116.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=557

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 97/116 (84%), Gaps = 1/116 (1%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKL-DPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            +LKKILD GR+I RPDG+ INGK  KVGDK  +PL+KME GKTYRYR CN G+RTSVN R
Sbjct  174  SLKKILDGGRTIGRPDGIHINGKSVKVGDKAAEPLYKMEAGKTYRYRFCNVGMRTSVNVR  233

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
             QGH M +VE+EGSHTVQN Y+SLDLHVGQCLSVLVTA +E KDYY++ SSRF KQ
Sbjct  234  IQGHPMKLVEIEGSHTVQNVYESLDLHVGQCLSVLVTADQEPKDYYMIVSSRFLKQ  289



>ref|XP_009766183.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=558

 Score =   177 bits (450),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 96/117 (82%), Gaps = 1/117 (1%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKL-DPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            TLKKILD GR+I RPDG+ INGK  KVGDK  + LF ME GKTYRYR+CN G+RTSVN R
Sbjct  176  TLKKILDGGRTIGRPDGIHINGKSSKVGDKATEALFTMEAGKTYRYRMCNVGMRTSVNVR  235

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
             QGH M +VE+EGSHTVQN Y SLD+HVGQCLSVLVTA +E KDYY+V SSRF KQE
Sbjct  236  IQGHTMKLVEMEGSHTVQNVYDSLDIHVGQCLSVLVTADQEPKDYYMVVSSRFLKQE  292



>gb|AAL87103.1|AF479568_1 1-ascorbate oxidase [Petunia x hybrida]
Length=559

 Score =   177 bits (450),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 96/116 (83%), Gaps = 1/116 (1%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKL-DPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            +LKKILD GR+I RPDG+ INGK GKVGD   +PLF ME GKTYRYR+CN G+RTSVN R
Sbjct  176  SLKKILDGGRTIGRPDGIHINGKSGKVGDNAAEPLFTMEAGKTYRYRMCNVGMRTSVNVR  235

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
             QGH M +VE+EGSHTVQN Y+SLDLHVGQCLSVLVTA +E K YY+V SSRF KQ
Sbjct  236  IQGHTMKLVEMEGSHTVQNVYESLDLHVGQCLSVLVTADQEPKGYYMVVSSRFLKQ  291



>ref|XP_004228635.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=557

 Score =   177 bits (449),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 98/116 (84%), Gaps = 1/116 (1%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKL-DPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            +LKKILD GR+I RPDG+ INGK  KVG+K+ +PL+KME GKTYRYR CN G+RTSVN R
Sbjct  174  SLKKILDGGRTIGRPDGIHINGKSEKVGEKVAEPLYKMEAGKTYRYRFCNVGMRTSVNVR  233

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
             QGH M +VE+EGSHTVQN Y+SLDLHVGQCLSVLVTA +E KDYY++ SSRF KQ
Sbjct  234  IQGHPMKLVEIEGSHTVQNVYESLDLHVGQCLSVLVTADQEPKDYYMIVSSRFLKQ  289



>gb|AAQ90182.1| ntp101 [Nicotiana tabacum]
 gb|AAQ90184.1| ntp302 [Nicotiana tabacum]
Length=558

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 96/116 (83%), Gaps = 1/116 (1%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKL-DPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            TLKKILD GR+I RPDG+ INGK  KVGDK+ + LF ME GKTYRYR+CN G+RTSVN R
Sbjct  176  TLKKILDGGRTIGRPDGIHINGKSSKVGDKVAEALFTMEAGKTYRYRMCNVGMRTSVNVR  235

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
             QGH M +VE+EGSHTVQN Y SLDLHVGQCLSVLVTA +E KDYY+V SSRF KQ
Sbjct  236  IQGHTMKLVEMEGSHTVQNVYDSLDLHVGQCLSVLVTADQEPKDYYMVVSSRFLKQ  291



>ref|XP_009591795.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=558

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 96/116 (83%), Gaps = 1/116 (1%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKL-DPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            TLKKILD GR+I RPDG+ INGK  KVGDK+ + LF ME GKTYRYR+CN G+RTSVN R
Sbjct  176  TLKKILDGGRTIGRPDGIHINGKSSKVGDKVAEALFTMEAGKTYRYRMCNVGMRTSVNVR  235

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
             QGH M +VE+EGSHTVQN Y SLDLHVGQCLSVLVTA +E KDYY+V SSRF KQ
Sbjct  236  IQGHTMKLVEMEGSHTVQNVYDSLDLHVGQCLSVLVTADQEPKDYYMVVSSRFLKQ  291



>gb|KGN54012.1| hypothetical protein Csa_4G267470 [Cucumis sativus]
Length=480

 Score =   176 bits (445),  Expect = 7e-50, Method: Composition-based stats.
 Identities = 83/116 (72%), Positives = 100/116 (86%), Gaps = 3/116 (3%)
 Frame = +3

Query  3    TLKKILDSG-RSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNF  176
            TLK+ILD+G RSI RP+G++INGK  K GD  D PLF M+P KTY+YRVCN GL+TS+NF
Sbjct  174  TLKQILDNGHRSIARPEGVLINGKTAK-GDGTDEPLFTMKPEKTYKYRVCNVGLKTSLNF  232

Query  177  RFQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            RFQGH M +VE+EGSHTVQNDY+SLD+HVGQC SVLVTA++E KDYY+VAS+RF K
Sbjct  233  RFQGHTMKLVEMEGSHTVQNDYQSLDVHVGQCFSVLVTANQEPKDYYMVASTRFIK  288



>ref|XP_009773470.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=554

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TLKKILD GR+I R DG++INGK  KVG+  + LF ME GKTYRYR CN G+R+SVN RF
Sbjct  173  TLKKILDGGRTIGRADGIIINGKSAKVGEAKESLFTMEAGKTYRYRFCNLGMRSSVNVRF  232

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            QGH M +VE+EGSHTVQN Y SLDLHVGQCLSVLVTA +E KDYYLV SSRF KQ
Sbjct  233  QGHPMKLVELEGSHTVQNIYDSLDLHVGQCLSVLVTADQEPKDYYLVVSSRFLKQ  287



>ref|XP_006367595.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=567

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
             LKK LD GR+I RPDG+ INGK  K+GDK +PLF ME GK YRYR+CN G+RTSVN R 
Sbjct  178  ALKKTLDGGRTIGRPDGIHINGKSNKLGDKAEPLFSMEAGKIYRYRMCNVGMRTSVNVRI  237

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            QGH M +VE+EGSHTVQN Y SLD+HVGQCLSVLVTA +E KDYY+V SSRF KQ
Sbjct  238  QGHAMKLVEMEGSHTVQNMYDSLDIHVGQCLSVLVTADQEPKDYYMVVSSRFLKQ  292



>ref|XP_004149657.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=546

 Score =   176 bits (445),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 83/116 (72%), Positives = 100/116 (86%), Gaps = 3/116 (3%)
 Frame = +3

Query  3    TLKKILDSG-RSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNF  176
            TLK+ILD+G RSI RP+G++INGK  K GD  D PLF M+P KTY+YRVCN GL+TS+NF
Sbjct  174  TLKQILDNGHRSIARPEGVLINGKTAK-GDGTDEPLFTMKPEKTYKYRVCNVGLKTSLNF  232

Query  177  RFQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            RFQGH M +VE+EGSHTVQNDY+SLD+HVGQC SVLVTA++E KDYY+VAS+RF K
Sbjct  233  RFQGHTMKLVEMEGSHTVQNDYQSLDVHVGQCFSVLVTANQEPKDYYMVASTRFIK  288



>ref|XP_004164924.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   176 bits (445),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 83/116 (72%), Positives = 100/116 (86%), Gaps = 3/116 (3%)
 Frame = +3

Query  3    TLKKILDSG-RSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNF  176
            TLK+ILD+G RSI RP+G++INGK  K GD  D PLF M+P KTY+YRVCN GL+TS+NF
Sbjct  174  TLKQILDNGHRSIARPEGVLINGKTAK-GDGTDEPLFTMKPEKTYKYRVCNVGLKTSLNF  232

Query  177  RFQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            RFQGH M +VE+EGSHTVQNDY+SLD+HVGQC SVLVTA++E KDYY+VAS+RF K
Sbjct  233  RFQGHTMKLVEMEGSHTVQNDYQSLDVHVGQCFSVLVTANQEPKDYYMVASTRFIK  288



>emb|CDP04133.1| unnamed protein product [Coffea canephora]
Length=557

 Score =   175 bits (443),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 78/114 (68%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L+K+LDSGR++ RPDG++INGK GK   K +P+F M PGKTYRYRVCN G++ S+NFRFQ
Sbjct  177  LRKLLDSGRTLGRPDGVLINGKSGKADGKDEPMFTMIPGKTYRYRVCNVGMKNSLNFRFQ  236

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            GH M +VE+EGSHT+Q  Y SLDLH+GQC SVLVTA KE KDYY VAS+RF KQ
Sbjct  237  GHTMKLVEMEGSHTMQYLYDSLDLHLGQCASVLVTADKEPKDYYFVASTRFTKQ  290



>gb|EYU32815.1| hypothetical protein MIMGU_mgv1a003910mg [Erythranthe guttata]
Length=555

 Score =   175 bits (443),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 94/116 (81%), Gaps = 1/116 (1%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKL-DPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            TLK+ILDSGRSI +PDG+ INGK   VGD    PL  MEPGKTYRYRVCN G++ SVNFR
Sbjct  174  TLKRILDSGRSIGKPDGIQINGKSSSVGDAAAQPLAVMEPGKTYRYRVCNVGMKLSVNFR  233

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            FQGH M +VE+EGSHTVQN Y SLDLHVGQCLSVLVTA +  KDYYLV SSRF K+
Sbjct  234  FQGHTMKLVELEGSHTVQNVYDSLDLHVGQCLSVLVTADQAPKDYYLVVSSRFSKK  289



>ref|XP_010673839.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=558

 Score =   174 bits (441),  Expect = 7e-49, Method: Composition-based stats.
 Identities = 77/114 (68%), Positives = 96/114 (84%), Gaps = 1/114 (1%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGD-KLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            L+K L++G+S+ RPD +++NGK GKVGD K +PLF M+PGKTYRYR+CN G++ S+NFR 
Sbjct  178  LRKHLENGKSLARPDAVLMNGKQGKVGDPKEEPLFTMKPGKTYRYRICNVGMKNSINFRM  237

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            QGH M +VEVEGSHTVQN Y SLD+H+GQC SVLVTA KE KDYY+VAS+RF K
Sbjct  238  QGHTMKLVEVEGSHTVQNMYDSLDIHLGQCYSVLVTADKEPKDYYMVASTRFTK  291



>ref|XP_008438536.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=553

 Score =   174 bits (440),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 81/115 (70%), Positives = 95/115 (83%), Gaps = 2/115 (2%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            TLKK LDSGRSI RPDG++INGK  K GD  D PLF M PGKTY+YR+CN GL+ S+NFR
Sbjct  175  TLKKFLDSGRSIARPDGVLINGKIAK-GDGTDEPLFTMNPGKTYKYRICNVGLKISLNFR  233

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             QGH M +VE+EGSHTVQN Y+SLD+HVGQC SVLVTA ++ +DYY+VASSRF K
Sbjct  234  IQGHTMKLVEMEGSHTVQNVYQSLDVHVGQCFSVLVTADQDPRDYYMVASSRFTK  288



>ref|XP_010044910.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW87033.1| hypothetical protein EUGRSUZ_B03580 [Eucalyptus grandis]
Length=551

 Score =   172 bits (435),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 75/114 (66%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TL K LDSGR++ RPDG++INGK  K   K +PLF M+PGKTY+YR+CN GL+ S+NFR 
Sbjct  173  TLHKFLDSGRALGRPDGVLINGKSSKSKGKEEPLFTMKPGKTYKYRICNVGLKNSLNFRI  232

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            QGH M +VE+EGSHT+QN Y SLD+HVGQC +VLVTA KE KDYY+VAS+R+ K
Sbjct  233  QGHPMKLVEMEGSHTIQNSYDSLDVHVGQCFAVLVTADKEPKDYYMVASTRYTK  286



>ref|XP_007014661.1| SKU5 similar 12 [Theobroma cacao]
 gb|EOY32280.1| SKU5 similar 12 [Theobroma cacao]
Length=552

 Score =   172 bits (435),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 77/115 (67%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TLKK+LDSGR++ R DG+ INGK  K   K +PLF MEPGKTY+YR+CN G++TS+N RF
Sbjct  174  TLKKMLDSGRNLGRCDGVHINGKVAKGDGKDEPLFTMEPGKTYKYRICNVGIKTSLNVRF  233

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            QGHNM +VE+EGSHTVQN Y+SLD+HVGQC  VLVTA +E +DYY+VAS+RF K+
Sbjct  234  QGHNMKLVEMEGSHTVQNTYESLDVHVGQCFGVLVTADQEPRDYYVVASTRFTKR  288



>ref|XP_010673838.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=557

 Score =   171 bits (434),  Expect = 7e-48, Method: Composition-based stats.
 Identities = 74/114 (65%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGD-KLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            L+K+LDSG+S+ RPDG+++NGK GKVGD K +PLF M+PGKTY+YR+CN GL+ ++NFR 
Sbjct  177  LRKVLDSGKSLGRPDGVLMNGKQGKVGDAKEEPLFTMKPGKTYKYRICNVGLKNTLNFRI  236

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            QGH + +VEVEGSH+VQN Y SLD+H+GQC +VLVTA ++ KDYY+VAS RF K
Sbjct  237  QGHKIKLVEVEGSHSVQNSYDSLDVHLGQCYAVLVTADQDPKDYYMVASVRFTK  290



>emb|CDY10549.1| BnaC03g70650D [Brassica napus]
Length=549

 Score =   171 bits (434),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK  LDSGR++  P+G++INGK GKVG K +PLF M+PGKTY+YR+CN G ++++NFR Q
Sbjct  174  LKNFLDSGRTLGLPNGVLINGKSGKVGGKNEPLFTMKPGKTYKYRLCNVGFKSTLNFRIQ  233

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
             H M +VE+EGSH +QNDY SLD+HVGQC SVLVTA++EAKDYY+VAS+RF K+E
Sbjct  234  NHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVTANQEAKDYYMVASTRFLKKE  288



>emb|CDY56013.1| BnaA08g29220D [Brassica napus]
Length=549

 Score =   171 bits (433),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK  LDSGR++  P+G++INGK GKVG K +PLF M+PGKTY+YR+CN G ++++NFR Q
Sbjct  174  LKNFLDSGRTLGLPNGVLINGKSGKVGGKNEPLFTMKPGKTYKYRLCNVGFKSTLNFRIQ  233

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
             H M +VE+EGSH +QNDY SLD+HVGQC SVLVTA++EAKDYY+VAS+RF K+E
Sbjct  234  NHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVTANQEAKDYYMVASTRFLKKE  288



>ref|XP_009106861.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=549

 Score =   171 bits (433),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK  LDSGR++  P+G++INGK GKVG K +PLF M+PGKTY+YR+CN G ++++NFR Q
Sbjct  174  LKNFLDSGRTLGLPNGVLINGKSGKVGGKNEPLFTMKPGKTYKYRLCNVGFKSTLNFRIQ  233

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
             H M +VE+EGSH +QNDY SLD+HVGQC SVLVTA++EAKDYY+VAS+RF K+E
Sbjct  234  NHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVTANQEAKDYYMVASTRFLKKE  288



>ref|XP_006303856.1| hypothetical protein CARUB_v10012595mg [Capsella rubella]
 gb|EOA36754.1| hypothetical protein CARUB_v10012595mg [Capsella rubella]
Length=549

 Score =   171 bits (433),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LKK+LDSGR++  P+G++INGK GKVG K +PLF M+PGKTY+YR+CN G ++++NFR Q
Sbjct  174  LKKLLDSGRTLGLPNGVLINGKSGKVGGKNEPLFTMKPGKTYKYRLCNVGFKSTLNFRIQ  233

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
             H M +VE+EGSH +QNDY SLD+HVGQC SVLVTA + AKDYY+VAS+RF K+E
Sbjct  234  NHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVTADQAAKDYYMVASTRFLKKE  288



>ref|XP_011089764.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=554

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 90/113 (80%), Gaps = 1/113 (1%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGD-KLDPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            +LK ILDSGRSI RPDG+ ING+  KVGD    PLF  E GKTYR+RVCN GLR SVNFR
Sbjct  174  SLKNILDSGRSIGRPDGIQINGQSSKVGDANAKPLFTFEAGKTYRFRVCNVGLRLSVNFR  233

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRF  338
             Q H+M VVEVEGSHTVQN Y SLDLHVGQC+SVLVTA +  KDYY VASSRF
Sbjct  234  IQAHSMTVVEVEGSHTVQNVYDSLDLHVGQCMSVLVTADQTPKDYYFVASSRF  286



>ref|XP_007208287.1| hypothetical protein PRUPE_ppa003715mg [Prunus persica]
 gb|EMJ09486.1| hypothetical protein PRUPE_ppa003715mg [Prunus persica]
Length=554

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
             LKK LDSGRS+ RPDG++INGK  K   K +PLF M+PGKTY+YR+CN GL+ S+NFR 
Sbjct  174  ALKKHLDSGRSMARPDGVIINGKSAKGDGKDEPLFTMKPGKTYKYRICNVGLKNSLNFRI  233

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            QGH M +VE+EGSHTVQN Y+SLD+HVGQC SVLVTA K+ KDYY+VAS+RF K+
Sbjct  234  QGHPMKLVEMEGSHTVQNTYESLDVHVGQCFSVLVTADKDPKDYYMVASTRFTKK  288



>ref|XP_008374030.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=551

 Score =   170 bits (431),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 75/113 (66%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L+K LDSGRS+ RPDG++INGK  K   K +PLF M+ GKTY+YR+CN GL+ S+NFR Q
Sbjct  175  LRKFLDSGRSMARPDGVLINGKSAKGDGKDEPLFTMKAGKTYKYRICNVGLKNSLNFRIQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            GH M +VE+EGSHTVQN Y SLD+H+GQC S+LVTA KE KDYY+VAS+RF K
Sbjct  235  GHQMKLVEMEGSHTVQNTYDSLDVHIGQCFSMLVTADKEPKDYYMVASTRFTK  287



>gb|KGN63948.1| hypothetical protein Csa_1G031720 [Cucumis sativus]
Length=480

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 96/116 (83%), Gaps = 2/116 (2%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            TLKK LDSGRSI RPDG++ING+  K GD  D PLF M+P KTY+YR+CN GL+TS+NFR
Sbjct  175  TLKKFLDSGRSIARPDGVLINGRIAK-GDGTDEPLFTMKPEKTYKYRICNVGLKTSLNFR  233

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
             QGH M +VE+EGSHTVQN Y+SLD+HVGQC SVLVTA K+ KDYY+VAS+RF K 
Sbjct  234  IQGHTMKLVEMEGSHTVQNVYQSLDVHVGQCFSVLVTADKDPKDYYMVASTRFTKN  289



>ref|XP_009376274.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=552

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
             LKK+LDSGR++ RPDG++INGK+ K   K +PLF M+PGKTY+YRVCN GL+ S+NFR 
Sbjct  174  ALKKLLDSGRTMGRPDGILINGKNAKGDGKDEPLFTMKPGKTYKYRVCNVGLKNSLNFRI  233

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            QGH + +VE+EGSHTVQN Y+SLD+HVGQC S+LVTA KE KDYY+VAS+RF K
Sbjct  234  QGHPLKLVEMEGSHTVQNTYESLDVHVGQCFSLLVTADKERKDYYMVASTRFTK  287



>ref|XP_004137383.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 96/116 (83%), Gaps = 2/116 (2%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            TLKK LDSGRSI RPDG++ING+  K GD  D PLF M+P KTY+YR+CN GL+TS+NFR
Sbjct  175  TLKKFLDSGRSIARPDGVLINGRIAK-GDGTDEPLFTMKPEKTYKYRICNVGLKTSLNFR  233

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
             QGH M +VE+EGSHTVQN Y+SLD+HVGQC SVLVTA K+ KDYY+VAS+RF K 
Sbjct  234  IQGHTMKLVEMEGSHTVQNVYQSLDVHVGQCFSVLVTADKDPKDYYMVASTRFTKN  289



>ref|XP_004165665.1| PREDICTED: LOW QUALITY PROTEIN: L-ascorbate oxidase homolog [Cucumis 
sativus]
Length=553

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 96/116 (83%), Gaps = 2/116 (2%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            TLKK LDSGRSI RPDG++ING+  K GD  D PLF M+P KTY+YR+CN GL+TS+NFR
Sbjct  175  TLKKFLDSGRSIARPDGVLINGRIAK-GDGTDEPLFTMKPEKTYKYRICNVGLKTSLNFR  233

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
             QGH M +VE+EGSHTVQN Y+SLD+HVGQC SVLVTA K+ KDYY+VAS+RF K 
Sbjct  234  IQGHTMKLVEMEGSHTVQNVYQSLDVHVGQCFSVLVTADKDPKDYYMVASTRFTKN  289



>ref|XP_006407227.1| hypothetical protein EUTSA_v10020444mg [Eutrema salsugineum]
 gb|ESQ48680.1| hypothetical protein EUTSA_v10020444mg [Eutrema salsugineum]
Length=551

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK  LDSGR++  PDG++INGK GKVG   +PLF M+PGKTY+YR+CN G ++++NFR Q
Sbjct  175  LKNFLDSGRTLGSPDGVLINGKSGKVGGNNEPLFTMKPGKTYKYRICNVGFKSTLNFRIQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
            GH M +VE+EGSH +QNDY SLD+HVGQC +VLVTA + AK+YY+VAS+RF K+E
Sbjct  235  GHKMKLVEMEGSHVIQNDYDSLDVHVGQCFAVLVTADQVAKNYYMVASTRFLKKE  289



>ref|XP_009339220.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=552

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
             LKKILDSGRS+ RP G++INGK+ K   K +PLF M+PGKTY+YRVCN GL+ S+NFR 
Sbjct  174  ALKKILDSGRSMGRPAGVLINGKNAKGDGKDEPLFTMKPGKTYKYRVCNVGLKNSLNFRI  233

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            QGH + +VE+EGSHTVQN Y+SLD+HVGQC S+LVTA KE KDYY+VAS+RF K
Sbjct  234  QGHPLKLVEMEGSHTVQNTYESLDVHVGQCFSLLVTADKEPKDYYMVASTRFTK  287



>ref|NP_564697.1| SKU5 similar 14 [Arabidopsis thaliana]
 emb|CAB59910.1| BNH protein [Arabidopsis thaliana]
 dbj|BAC43197.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64845.1| At1g55560 [Arabidopsis thaliana]
 gb|AEE33266.1| SKU5 similar 14 [Arabidopsis thaliana]
Length=549

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK  LDSGR++  P+G++INGK GKVG K +PLF M+PGKTY+YR+CN G ++++NFR Q
Sbjct  174  LKNFLDSGRTLGLPNGVLINGKSGKVGGKNEPLFTMKPGKTYKYRLCNVGFKSTLNFRIQ  233

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
             H M +VE+EGSH +QNDY SLD+HVGQC SVLVTA++ AKDYY+VAS+RF K+E
Sbjct  234  NHKMKLVEMEGSHVIQNDYDSLDVHVGQCFSVLVTANQAAKDYYMVASTRFLKKE  288



>ref|XP_011089765.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=554

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 89/113 (79%), Gaps = 1/113 (1%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGD-KLDPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            TLK ILDSGRSI RPDG+ ING+  KVGD    PLF  E GKTY+ RVCN GLR SVNFR
Sbjct  174  TLKSILDSGRSIGRPDGIQINGQSSKVGDANAKPLFTFEAGKTYKLRVCNVGLRLSVNFR  233

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRF  338
             QGH M VVEVEGSHTVQN Y SLDLHVGQC+SVLVTA +  KDYY VASSRF
Sbjct  234  VQGHTMKVVEVEGSHTVQNLYDSLDLHVGQCMSVLVTADQTPKDYYFVASSRF  286



>ref|XP_007208285.1| hypothetical protein PRUPE_ppa003733mg [Prunus persica]
 gb|EMJ09484.1| hypothetical protein PRUPE_ppa003733mg [Prunus persica]
Length=552

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LKK+LDSGRS+ RPDG++INGK  K   K +PLF M+PGKTY+YR+CN GL+ S+NFR Q
Sbjct  175  LKKLLDSGRSMARPDGVLINGKSSKGDGKDEPLFVMKPGKTYKYRICNVGLKNSLNFRIQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            GH+M +VE+EGSHTVQN Y S+D+H+GQC SVLVTA K+ KDYY+VAS+RF K
Sbjct  235  GHSMKLVELEGSHTVQNTYDSMDVHLGQCFSVLVTADKDPKDYYMVASTRFTK  287



>gb|KHG03555.1| L-ascorbate oxidase [Gossypium arboreum]
 gb|KHG09844.1| L-ascorbate oxidase [Gossypium arboreum]
Length=551

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TLKKIL+SGR++ R DG+ INGK  K     +PLF ME GKTY+YR+CNAGL+TS+N RF
Sbjct  174  TLKKILESGRNLGRCDGVHINGKVAKGDGSDEPLFTMEAGKTYKYRICNAGLKTSLNVRF  233

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
            QGHNM +VE+EGSHTVQNDY+SLD+HVGQC SVLVTA +E  DY++VAS+RF KQE
Sbjct  234  QGHNMKLVEMEGSHTVQNDYESLDVHVGQCFSVLVTADQEPMDYFVVASTRFTKQE  289



>ref|XP_002303974.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE78953.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=553

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
             L+K+LDSGR++ RPDG+++NGK+ K   K +PLF M+PGKTY+YR+CNAGL+ ++NFR 
Sbjct  174  ALQKLLDSGRTLARPDGVLVNGKNAKGDGKDEPLFTMKPGKTYKYRICNAGLKNTLNFRI  233

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            QGH M +VE+EGSH VQN Y+SLD+HVGQC SVLVTA+++ KDYY+VAS+RF KQ
Sbjct  234  QGHTMKLVEMEGSHVVQNVYESLDVHVGQCFSVLVTANQDPKDYYMVASTRFNKQ  288



>gb|AAD10639.1| putative pollen specific protein [Arabidopsis thaliana]
Length=558

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
             LK  LDSGR++  P+G++INGK GKVG K +PLF M+PGKTY+YR+CN G ++++NFR 
Sbjct  182  ALKNFLDSGRTLGLPNGVLINGKSGKVGGKNEPLFTMKPGKTYKYRLCNVGFKSTLNFRI  241

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
            Q H M +VE+EGSH +QNDY SLD+HVGQC SVLVTA++ AKDYY+VAS+RF K+E
Sbjct  242  QNHKMKLVEMEGSHVIQNDYDSLDVHVGQCFSVLVTANQAAKDYYMVASTRFLKKE  297



>ref|XP_010465173.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=551

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK  LDSGR++  PDG++INGK GKVG+K + LF M+PGKTY+YR+CN G ++S+NFR Q
Sbjct  175  LKNFLDSGRTLGSPDGVLINGKFGKVGEKNEALFTMKPGKTYKYRICNVGFKSSLNFRIQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
            GH M +VE+EGSH +QNDY SLD+HVGQC +VLVTA + AK+YY+VAS+RF K+E
Sbjct  235  GHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQVAKNYYMVASTRFLKKE  289



>gb|KDP30647.1| hypothetical protein JCGZ_16212 [Jatropha curcas]
Length=551

 Score =   169 bits (429),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 74/113 (65%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L+  LD GR + RPDG++INGK+ K   K +PLF+M+P K Y+YR+CNAGL+ S+NFR Q
Sbjct  175  LRSFLDEGRVLGRPDGVLINGKNAKGDGKDEPLFEMKPEKVYKYRICNAGLKASLNFRIQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            GH M++VE+EGSHTVQN Y+SLD+HVGQC SVLVTA KE KDYY+VAS+RF K
Sbjct  235  GHTMMLVEMEGSHTVQNVYESLDVHVGQCFSVLVTADKEPKDYYMVASTRFLK  287



>ref|XP_011089763.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   169 bits (429),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 89/113 (79%), Gaps = 1/113 (1%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGD-KLDPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            TLK ILDSGRSI RPDG+ ING+  KVGD    PLF  E GKTY+ RVCN GLR SVNFR
Sbjct  175  TLKSILDSGRSIGRPDGIQINGQSSKVGDANAKPLFTFEAGKTYKLRVCNVGLRLSVNFR  234

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRF  338
             QGH M VVEVEGSHTVQN Y SLDLHVGQC+SVLVTA +  KDYY VASSRF
Sbjct  235  VQGHTMKVVEVEGSHTVQNLYDSLDLHVGQCMSVLVTADQTPKDYYFVASSRF  287



>emb|CDX82540.1| BnaA03g32810D [Brassica napus]
Length=551

 Score =   169 bits (428),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK  LDSGR++  PDG++INGK GKVG +  PLF M+PGKTY+YR+CN G ++++NFR Q
Sbjct  175  LKNFLDSGRTLGSPDGVLINGKSGKVGGQDKPLFTMKPGKTYKYRICNVGFKSTLNFRIQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
            GH M +VE+EGSH +QNDY SLD+HVGQC +VLVTA + AK+YY+VAS+RF K+E
Sbjct  235  GHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQAAKNYYMVASTRFLKKE  289



>gb|EYU39285.1| hypothetical protein MIMGU_mgv1a026945mg [Erythranthe guttata]
Length=558

 Score =   169 bits (428),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 94/116 (81%), Gaps = 1/116 (1%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGD-KLDPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            TLKKILDSG +I  P+G+ ING+ GKVG   L PL  +EPGKTYRYRVCN GLRTS+NFR
Sbjct  177  TLKKILDSGATIGLPNGIHINGQSGKVGSAPLTPLAIVEPGKTYRYRVCNVGLRTSINFR  236

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            FQ H M +VEVEGSHTVQN Y SLDLH GQC+SVLVTA +  KDYYLVASSRF K+
Sbjct  237  FQSHIMKLVEVEGSHTVQNVYDSLDLHAGQCVSVLVTADQAPKDYYLVASSRFSKK  292



>ref|XP_011089702.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   169 bits (428),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 89/113 (79%), Gaps = 1/113 (1%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGD-KLDPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            TLK ILDSGRSI RPDG+ ING+  KVGD    PLF  E GKTY+ RVCN GLR SVNFR
Sbjct  175  TLKSILDSGRSIGRPDGIQINGQSSKVGDANAKPLFTFEAGKTYKLRVCNVGLRLSVNFR  234

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRF  338
             QGH M VVEVEGSHTVQN Y SLDLHVGQC+SVLVTA +  KDYY VASSRF
Sbjct  235  VQGHTMKVVEVEGSHTVQNLYDSLDLHVGQCMSVLVTADQTPKDYYFVASSRF  287



>ref|XP_006299973.1| hypothetical protein CARUB_v10016186mg [Capsella rubella]
 gb|EOA32871.1| hypothetical protein CARUB_v10016186mg [Capsella rubella]
Length=551

 Score =   169 bits (428),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK  LDSGR++  PDG++INGK GKVG K +PLF M PGKTY++R+CN G ++++NFR Q
Sbjct  175  LKNFLDSGRTLGSPDGVLINGKSGKVGHKNEPLFTMNPGKTYKFRICNVGFKSTLNFRIQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
            GH M +VE+EGSH +QNDY SLD+HVGQC +VLVTA + AK+YY+VAS+RF K+E
Sbjct  235  GHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQVAKNYYMVASTRFLKKE  289



>emb|CDY24188.1| BnaC01g37680D [Brassica napus]
Length=550

 Score =   169 bits (428),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK  LDSGR++  PDG++INGK GKVG +  PLF M+PGKTY+YR+CN G ++++NFR Q
Sbjct  174  LKNFLDSGRTLGSPDGVLINGKSGKVGGQDKPLFTMKPGKTYKYRICNVGFKSTLNFRIQ  233

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
            GH M +VE+EGSH +QNDY SLD+HVGQC +VLVTA + AK+YY+VAS+RF K+E
Sbjct  234  GHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQNAKNYYMVASTRFLKKE  288



>emb|CDX75708.1| BnaC03g37910D [Brassica napus]
Length=551

 Score =   169 bits (428),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK  LDSGR++  PDG++INGK GKVG +  PLF M+PGKTY+YR+CN G ++++NFR Q
Sbjct  175  LKNFLDSGRTLGSPDGVLINGKSGKVGGQDKPLFTMKPGKTYKYRICNVGFKSTLNFRIQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
            GH M +VE+EGSH +QNDY SLD+HVGQC +VLVTA + AK+YY+VAS+RF K+E
Sbjct  235  GHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQAAKNYYMVASTRFLKKE  289



>ref|XP_009135303.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=551

 Score =   169 bits (428),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK  LDSGR++  PDG++INGK GKVG +  PLF M+PGKTY+YR+CN G ++++NFR Q
Sbjct  175  LKNFLDSGRTLGSPDGVLINGKSGKVGGQDKPLFTMKPGKTYKYRICNVGFKSTLNFRIQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
            GH M +VE+EGSH +QNDY SLD+HVGQC +VLVTA + AK+YY+VAS+RF K+E
Sbjct  235  GHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQAAKNYYMVASTRFLKKE  289



>gb|ABI52585.1| pollen-specific protein [Camellia sinensis]
Length=566

 Score =   169 bits (428),  Expect = 5e-47, Method: Composition-based stats.
 Identities = 74/115 (64%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            +++K LD+GRS+ RPDG+ INGK GKVG   +P+F ME GK YRYRVCN G++TS+NFR 
Sbjct  178  SIQKQLDTGRSLGRPDGIQINGKSGKVGGSNEPMFNMEAGKIYRYRVCNVGMKTSLNFRI  237

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            QGH++ +VE+EGSHTVQN Y SLD+H+GQC SVLV A++E  DYY+V SSRF KQ
Sbjct  238  QGHSLKLVEMEGSHTVQNVYDSLDVHIGQCFSVLVEANQEPNDYYMVFSSRFTKQ  292



>ref|XP_002894511.1| hypothetical protein ARALYDRAFT_474617 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70770.1| hypothetical protein ARALYDRAFT_474617 [Arabidopsis lyrata subsp. 
lyrata]
Length=549

 Score =   169 bits (427),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
             LK  LDSGR++  P+G++INGK GKVG K +PLF M+PGKTY+YR+CN G ++++NFR 
Sbjct  173  ALKNFLDSGRTLGLPNGVLINGKSGKVGGKNEPLFTMKPGKTYKYRLCNVGFKSTLNFRI  232

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
            Q H M +VE+EGSH +QNDY SLD+HVGQC SVLVTA + AKDYY+VAS+RF K+E
Sbjct  233  QNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVTADQAAKDYYMVASTRFLKKE  288



>ref|XP_010501174.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=549

 Score =   168 bits (426),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK +LDSGR++  P+G++INGK GKVG   +PLF M+PGKTY+YR+CN G ++++NFR Q
Sbjct  174  LKNLLDSGRTLGLPNGVLINGKSGKVGGNNEPLFTMKPGKTYKYRLCNVGFKSTLNFRIQ  233

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
             H M +VE+EGSH +QNDY SLD+HVGQC SVLVTA++ AKDYY+VAS+RF K+E
Sbjct  234  NHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVTANQAAKDYYMVASTRFLKKE  288



>ref|XP_010480096.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Camelina sativa]
 ref|XP_010480097.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Camelina sativa]
Length=549

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK +LDSGR++  P+G++INGK GKVG   +PLF M+PGKTY+YR+CN G ++++NFR Q
Sbjct  174  LKSLLDSGRTLGLPNGVLINGKSGKVGGNNEPLFTMKPGKTYKYRLCNVGFKSTLNFRIQ  233

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
             H M +VE+EGSH +QNDY SLD+HVGQC SVLVTA++ AKDYY+VAS+RF K+E
Sbjct  234  NHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVTANQAAKDYYMVASTRFLKKE  288



>gb|KFK38673.1| hypothetical protein AALP_AA3G145200 [Arabis alpina]
Length=551

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK  LDSGR++  PDG++INGK GKVG K +PLF ++PGKTY++R+CN G ++++NFR Q
Sbjct  175  LKNFLDSGRTLGLPDGVLINGKSGKVGGKNEPLFTLKPGKTYKFRICNVGFKSTLNFRVQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
            GH M +VE+EGSH +QNDY SLD+HVGQC +VLVTA + AK+YY+VAS+RF K+E
Sbjct  235  GHKMKLVEMEGSHVLQNDYDSLDIHVGQCFAVLVTADQTAKNYYMVASTRFLKKE  289



>ref|XP_009600428.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Nicotiana 
tomentosiformis]
Length=520

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TL+ ILD GRSI RP+G++INGK+GK   K +P+F M  GKTYRYR CN G++ S+N RF
Sbjct  172  TLRSILDEGRSIGRPEGIIINGKNGKGDGKDEPMFSMVSGKTYRYRFCNVGMKDSINVRF  231

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            QGH M +VE+EGSHTVQN Y+SLD+H+GQCLSVLVTA +E KDY+LVASSRF K+
Sbjct  232  QGHTMKLVEMEGSHTVQNMYESLDIHLGQCLSVLVTADQEPKDYFLVASSRFTKE  286



>emb|CDY43994.1| BnaA05g25890D [Brassica napus]
Length=552

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK  LDSGR++  PDG++INGK GKVG    PLF M+PGKTY+YR+CN G ++++NFR Q
Sbjct  176  LKTFLDSGRTLGSPDGVLINGKSGKVGGPNVPLFTMKPGKTYKYRICNVGFKSTLNFRIQ  235

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
            GH M +VE+EGSH +QNDY SLD+HVGQC +VLVTA + AK+YY+VAS+RF K+E
Sbjct  236  GHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQNAKNYYMVASTRFLKKE  290



>ref|XP_009600426.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nicotiana 
tomentosiformis]
Length=549

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TL+ ILD GRSI RP+G++INGK+GK   K +P+F M  GKTYRYR CN G++ S+N RF
Sbjct  172  TLRSILDEGRSIGRPEGIIINGKNGKGDGKDEPMFSMVSGKTYRYRFCNVGMKDSINVRF  231

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            QGH M +VE+EGSHTVQN Y+SLD+H+GQCLSVLVTA +E KDY+LVASSRF K+
Sbjct  232  QGHTMKLVEMEGSHTVQNMYESLDIHLGQCLSVLVTADQEPKDYFLVASSRFTKE  286



>ref|XP_009146525.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=552

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK  LDSGR++  PDG++INGK GKVG    PLF M+PGKTY+YR+CN G ++++NFR Q
Sbjct  176  LKTFLDSGRTLGSPDGVLINGKSGKVGGPNVPLFTMKPGKTYKYRICNVGFKSTLNFRIQ  235

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
            GH M +VE+EGSH +QNDY SLD+HVGQC +VLVTA + AK+YY+VAS+RF K+E
Sbjct  236  GHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQNAKNYYMVASTRFLKKE  290



>emb|CDY23597.1| BnaC05g39970D [Brassica napus]
Length=552

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK  LDSGR++  PDG++INGK GKVG    PLF M+PGKTY+YR+CN G ++++NFR Q
Sbjct  176  LKTFLDSGRTLGSPDGVLINGKSGKVGGPNVPLFTMKPGKTYKYRICNVGFKSTLNFRIQ  235

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
            GH M +VE+EGSH +QNDY SLD+HVGQC +VLVTA + AK+YY+VAS+RF K+E
Sbjct  236  GHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQTAKNYYMVASTRFLKKE  290



>ref|XP_011089767.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGD-KLDPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            TLK ILDSGRSI RPDG+ ING+  KVGD    PLF  E G TY+ RVCN GLR SVNFR
Sbjct  175  TLKSILDSGRSIGRPDGIQINGQSSKVGDANAKPLFTFEAGNTYKLRVCNVGLRLSVNFR  234

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRF  338
             QGH M VVEVEGSHTVQN Y SLDLHVGQC+SVLVTA +  KDYY VASSRF
Sbjct  235  VQGHTMKVVEVEGSHTVQNLYDSLDLHVGQCMSVLVTADQTPKDYYFVASSRF  287



>ref|XP_011025085.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=553

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
             L+K+LDSGR++ RPDG+++NGK+ K   K +PLFKM+P KTY+YR+CNAG++ ++NFR 
Sbjct  174  ALQKLLDSGRTLARPDGVLVNGKNAKGDGKDEPLFKMKPEKTYKYRICNAGIKNTLNFRI  233

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            QGH M +VE+EGSH VQN Y+SLD+HVGQC SVLVTA+++ KDYY+VAS+RF KQ
Sbjct  234  QGHTMKLVEMEGSHVVQNVYESLDVHVGQCFSVLVTANQDPKDYYMVASTRFNKQ  288



>ref|XP_007014658.1| SKU5 similar 13 [Theobroma cacao]
 gb|EOY32277.1| SKU5 similar 13 [Theobroma cacao]
Length=553

 Score =   167 bits (423),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 75/113 (66%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LKK LDSGRS+ RPDG++INGK  K   K  PLF M+PGKTY+YR+CN GL+ S+NFR Q
Sbjct  176  LKKFLDSGRSLGRPDGVLINGKVAKGNGKDKPLFTMKPGKTYKYRICNVGLKNSLNFRIQ  235

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            GH M +VE+EGSHTVQN Y+SLD+HVGQC +VLVTA +  KDY++VAS+RF K
Sbjct  236  GHRMKLVEMEGSHTVQNVYESLDVHVGQCFAVLVTADQGPKDYFMVASTRFTK  288



>ref|XP_002882820.1| hypothetical protein ARALYDRAFT_478721 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59079.1| hypothetical protein ARALYDRAFT_478721 [Arabidopsis lyrata subsp. 
lyrata]
Length=551

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK  LDSGR++  PDG++INGK GK+G    PLF M+PGKTY+YR+CN G ++++NFR Q
Sbjct  175  LKNFLDSGRTLGSPDGVLINGKSGKIGGNNAPLFTMKPGKTYKYRICNVGFKSTLNFRIQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
            GH M +VE+EGSH +QNDY SLD+HVGQC +VLVTA + AK+YY+VAS+RF K+E
Sbjct  235  GHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQVAKNYYMVASTRFLKKE  289



>ref|XP_010500435.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=551

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK  LDSGR++  PDG++INGK GKVG+K + LF M+PGKTY++R+CN G ++++NFR Q
Sbjct  175  LKNFLDSGRTLGSPDGVLINGKSGKVGEKNEALFTMKPGKTYKFRICNVGFKSTLNFRIQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
            GH M +VE+EGSH +QNDY SLD+HVGQC +VLVTA + AK+YY+VAS+RF K+E
Sbjct  235  GHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQVAKNYYMVASTRFLKKE  289



>ref|XP_008359469.1| PREDICTED: LOW QUALITY PROTEIN: L-ascorbate oxidase homolog [Malus 
domestica]
Length=487

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LKK LDSGR++ RPDG++INGK  K   K +PLF M+ GKTY+YR+CN GL+ S+NFR Q
Sbjct  175  LKKFLDSGRAMARPDGVLINGKSAKGDGKDEPLFTMKAGKTYKYRICNVGLKNSLNFRIQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            GH M +VE EGSHTVQN Y SLD+H+GQC +VLVTA KE KDYY+VAS+RF K
Sbjct  235  GHQMKLVETEGSHTVQNTYDSLDVHIGQCFAVLVTADKEPKDYYMVASTRFSK  287



>ref|XP_010487093.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=551

 Score =   167 bits (423),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK  LDSGR++  PDG++INGK GKVG+K + LF M+PGKTY++R+CN G ++++NFR Q
Sbjct  175  LKNFLDSGRTLGSPDGVLINGKSGKVGEKNEALFTMKPGKTYKFRICNVGFKSTLNFRIQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
            GH M +VE+EGSH +QNDY SLD+HVGQC +VLVTA + AK+YY+VAS+RF K+E
Sbjct  235  GHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQVAKNYYMVASTRFLKKE  289



>ref|XP_006306349.1| hypothetical protein CARUB_v10012235mg [Capsella rubella]
 gb|EOA39247.1| hypothetical protein CARUB_v10012235mg [Capsella rubella]
Length=555

 Score =   167 bits (423),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LKK LDSGR++ RPDG++INGK GK      PLF ++PGKTYR R+CN GL+TS+NFR Q
Sbjct  177  LKKFLDSGRTLGRPDGILINGKSGKTDGSDKPLFTLKPGKTYRVRICNVGLKTSLNFRIQ  236

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
             H M +VE+EGSH +QNDY SLD+HVGQC  V+VTA++EAKDYY+VAS+RF K+
Sbjct  237  NHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVIVTANQEAKDYYMVASTRFLKK  290



>ref|XP_006392622.1| hypothetical protein EUTSA_v10011369mg [Eutrema salsugineum]
 gb|ESQ29908.1| hypothetical protein EUTSA_v10011369mg [Eutrema salsugineum]
Length=549

 Score =   167 bits (422),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
             LK  LDSGR++  P+G++INGK GKVG   +PLF M+PGKTY+YR+CN G ++++NFR 
Sbjct  173  ALKNFLDSGRTLGLPNGVLINGKSGKVGGNNEPLFTMKPGKTYKYRLCNVGFKSTLNFRI  232

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
            Q H M +VE+EGSH +QNDY SLD+HVGQC SVLVTA + AKDYY+VAS+RF K+E
Sbjct  233  QNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVTADQAAKDYYMVASTRFLKKE  288



>gb|KDP30646.1| hypothetical protein JCGZ_16211 [Jatropha curcas]
Length=450

 Score =   165 bits (418),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L+  LDSGRS+ RPD ++INGK  K   K +PLF M+PGKTY+YR+CNAGL+TS+NFR Q
Sbjct  175  LRSFLDSGRSLGRPDAVLINGKTAKGDGKDEPLFTMKPGKTYKYRICNAGLKTSINFRIQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            GH M +VE+EGSH +QN Y+SLD+HVGQCL+VLVTA +  +DYY+VAS+RF K
Sbjct  235  GHTMKLVEMEGSHVIQNVYESLDVHVGQCLTVLVTADQAPRDYYIVASTRFIK  287



>ref|XP_002523382.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF38961.1| multicopper oxidase, putative [Ricinus communis]
Length=551

 Score =   167 bits (422),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            +L+K LDSG SI RP+G++INGK  K   K  PLF M+PGKTY+YR+CNAGL+TS+NFR 
Sbjct  174  SLRKSLDSGVSIGRPEGVLINGKTAKGNGKDKPLFTMKPGKTYKYRICNAGLKTSINFRI  233

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            QGH M +VE+EGSH VQN Y+SLD+HVGQC SVLVTA++  KDYY+VAS+RF K
Sbjct  234  QGHTMKLVEMEGSHVVQNIYESLDVHVGQCFSVLVTANQAPKDYYMVASTRFLK  287



>gb|KFK35575.1| hypothetical protein AALP_AA4G008600 [Arabis alpina]
Length=549

 Score =   167 bits (422),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK +LDSGR++  P+G++INGK GKVG   +PLF M PGKTY+YR+CN G ++++NFR Q
Sbjct  174  LKNLLDSGRTLGLPNGVLINGKSGKVGGNNEPLFTMNPGKTYKYRLCNVGFKSTLNFRIQ  233

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
             H M +VE+EGSH +QNDY SLD+HVGQC +VLVTA++ AKDYY+VAS+RF K+E
Sbjct  234  NHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTANQAAKDYYMVASTRFLKKE  288



>ref|NP_187948.1| protein SKU5-like 13 [Arabidopsis thaliana]
 dbj|BAB01745.1| BNH protein; pectinesterase-like protein; pollen-secific protein-like 
[Arabidopsis thaliana]
 gb|AAL08265.1| AT3g13400/MRP15_3 [Arabidopsis thaliana]
 gb|AAL60046.1| putative pollen specific protein [Arabidopsis thaliana]
 gb|AAM20113.1| putative pollen-specific protein [Arabidopsis thaliana]
 gb|AEE75342.1| protein SKU5-like 13 [Arabidopsis thaliana]
Length=551

 Score =   167 bits (422),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK  LDSGR++  PDG++INGK GK+G    PLF M+PGKTY+YR+CN G ++++NFR Q
Sbjct  175  LKNFLDSGRTLGSPDGVLINGKSGKLGGNNAPLFTMKPGKTYKYRICNVGFKSTLNFRIQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
            GH M +VE+EGSH +QNDY SLD+HVGQC +VLVTA + AK+YY+VAS+RF K+E
Sbjct  235  GHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQVAKNYYMVASTRFLKKE  289



>ref|XP_008219577.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=552

 Score =   166 bits (421),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LKK+LD GRS+ RPDG++INGK  K   K +PLF M+PGKTY+YR+CN GL+ ++NFR Q
Sbjct  175  LKKLLDGGRSMARPDGVLINGKSSKGDGKDEPLFVMKPGKTYKYRICNVGLKNTLNFRIQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            GH+M +VE+EGSHTVQN Y S+D+H+GQC SVLVTA K+ KDYY+VAS+RF K
Sbjct  235  GHSMKLVELEGSHTVQNTYDSMDVHLGQCFSVLVTADKDPKDYYMVASTRFTK  287



>ref|XP_009339221.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=552

 Score =   166 bits (421),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LKK LDSGR++ RPDG++INGK  K   K +PLF M+ GKTY+YR+CN GL+ S+NFR Q
Sbjct  175  LKKFLDSGRAMARPDGVLINGKSAKGDGKDEPLFTMKAGKTYKYRICNVGLKNSLNFRIQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            GH M +VE EGSHTVQN Y SLD+H+GQC +VLVTA KE KDYY+VAS+RF K
Sbjct  235  GHQMKLVETEGSHTVQNTYDSLDVHIGQCFAVLVTADKEPKDYYMVASTRFSK  287



>ref|XP_010271079.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=552

 Score =   166 bits (421),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 98/115 (85%), Gaps = 1/115 (1%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKV-GDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            +LKK+LD+GRS+ +PDG++INGK GKV GDK +PLF M+P K YRYRVCN GL+ S+NFR
Sbjct  173  SLKKLLDTGRSLGKPDGVLINGKSGKVEGDKDEPLFTMKPHKXYRYRVCNVGLKXSLNFR  232

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             QGH++ +VE+EGSHTVQN Y SLD+HVGQC SVLVTA++  KDYY+VAS+RF K
Sbjct  233  IQGHSLKLVEMEGSHTVQNVYDSLDVHVGQCYSVLVTANQTPKDYYMVASTRFTK  287



>ref|XP_007157830.1| hypothetical protein PHAVU_002G101700g [Phaseolus vulgaris]
 gb|ESW29824.1| hypothetical protein PHAVU_002G101700g [Phaseolus vulgaris]
Length=547

 Score =   166 bits (420),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 75/115 (65%), Positives = 93/115 (81%), Gaps = 4/115 (3%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TLK+ LDSGRSI RP G+ INGK+G     L+P + MEPGKTY+YR+CN GL+ S+NFR 
Sbjct  174  TLKQFLDSGRSIGRPSGVHINGKNGG----LEPAYTMEPGKTYKYRICNVGLKDSLNFRI  229

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            QGH++ +VE+EGSH VQN Y SLD+HVGQC SVLVTA +E KDYY+VAS+RF K+
Sbjct  230  QGHSLKLVEMEGSHVVQNQYDSLDVHVGQCFSVLVTADQEPKDYYMVASTRFAKK  284



>ref|XP_008219320.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=552

 Score =   166 bits (419),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LKK+LD GRS+ RPDG++INGK  K   K +PLF M+PGKTY+YR+CN GL+ ++NFR Q
Sbjct  175  LKKLLDGGRSMARPDGVLINGKSSKGDGKDEPLFVMKPGKTYKYRICNVGLKNTLNFRIQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRF  338
            GH+M +VE+EGSHTVQN Y S+D+H+GQC SVLVTA K+ KDYY+VAS+RF
Sbjct  235  GHSMKLVELEGSHTVQNTYDSMDVHLGQCFSVLVTADKDPKDYYMVASTRF  285



>ref|XP_008219429.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=552

 Score =   166 bits (419),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LKK+LD GRS+ RPDG++INGK  K   K +PLF M+PGKTY+YR+CN GL+ ++NFR Q
Sbjct  175  LKKLLDGGRSMARPDGVLINGKSSKGDGKDEPLFVMKPGKTYKYRICNVGLKNTLNFRIQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRF  338
            GH+M +VE+EGSHTVQN Y S+D+H+GQC SVLVTA K+ KDYY+VAS+RF
Sbjct  235  GHSMKLVELEGSHTVQNTYDSMDVHLGQCFSVLVTADKDPKDYYMVASTRF  285



>ref|XP_011089766.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   166 bits (419),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGD-KLDPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            TLK ILDSGRSI RPDG+ ING+  KVGD    PLF  E GKTY+ RVCN GLR SVNFR
Sbjct  175  TLKSILDSGRSIGRPDGIQINGQSSKVGDANAKPLFTFEAGKTYKLRVCNVGLRLSVNFR  234

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRF  338
             QGH + VVEVEGSH VQN Y SLDLHVGQC+SVLVTA +  KDYY VASSRF
Sbjct  235  VQGHTLKVVEVEGSHNVQNLYDSLDLHVGQCMSVLVTADQTPKDYYFVASSRF  287



>ref|XP_008219681.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=554

 Score =   166 bits (419),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
             LKK LDSGRS+ RPDG++INGK  K   K +PLF M+PGKTY+YR+CN GL+ S+NFR 
Sbjct  174  ALKKHLDSGRSMGRPDGVIINGKSAKGDGKDEPLFTMKPGKTYKYRICNVGLKNSLNFRI  233

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            QGH M +VE+EGSHT+QN Y+SLD+H+GQC SVLVTA K+  DYY+VAS+RF K+
Sbjct  234  QGHPMKLVEMEGSHTMQNTYESLDVHLGQCFSVLVTADKDPMDYYMVASTRFTKK  288



>ref|XP_010044914.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW87034.1| hypothetical protein EUGRSUZ_B03581 [Eucalyptus grandis]
Length=552

 Score =   166 bits (419),  Expect = 9e-46, Method: Composition-based stats.
 Identities = 72/114 (63%), Positives = 93/114 (82%), Gaps = 1/114 (1%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGK-VGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            L++ LD+GR + RPDG++ING+ GK  G  + PLF M+PGKTY+YR+CN GL+ S+NFR 
Sbjct  173  LRQKLDAGRPLARPDGVLINGQTGKGKGKDVKPLFTMKPGKTYKYRICNVGLKNSLNFRI  232

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            QGH M +VE+EGSHTVQN Y SLD+HVGQC SVL+TA K+ +DYY+VAS+RF K
Sbjct  233  QGHQMKLVEMEGSHTVQNTYDSLDVHVGQCFSVLITADKDPRDYYMVASTRFTK  286



>ref|XP_002523381.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF38960.1| multicopper oxidase, putative [Ricinus communis]
Length=551

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            +L+  LDSGRS+ RPDG++INGK+ K   K +PLF M+P KTY+YRVCNAG++TS+NFR 
Sbjct  174  SLRTFLDSGRSLGRPDGVLINGKNAKGDGKDEPLFTMKPDKTYKYRVCNAGIKTSLNFRI  233

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            QGH M +VE+EGSH VQN Y+SLD+HVGQCLSVLV A++  KDYY+VAS+RF K
Sbjct  234  QGHEMKLVEMEGSHVVQNVYESLDVHVGQCLSVLVRANQAPKDYYMVASTRFMK  287



>ref|XP_003635547.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 ref|XP_003635599.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI18839.3| unnamed protein product [Vitis vinifera]
 emb|CBI41110.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   165 bits (418),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 76/114 (67%), Positives = 93/114 (82%), Gaps = 3/114 (3%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LKK LDSG SI RPDG+ INGK     DK +PLF M+PG TYRYR+CN G+++S+NFR Q
Sbjct  176  LKKKLDSGHSIGRPDGVQINGKSE---DKDEPLFTMKPGLTYRYRICNVGIKSSLNFRIQ  232

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            GH M +VE+EGSHTVQN Y SLD+H+GQC SVLVTA+++ KDYY+VAS+RF KQ
Sbjct  233  GHTMKLVELEGSHTVQNVYDSLDVHLGQCYSVLVTANQDPKDYYMVASTRFLKQ  286



>ref|XP_009376784.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=706

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L+K LDSGRS+ RPDG++INGK  K   K +PLF M+ GKTY+YR+CN GL+ S+NFR Q
Sbjct  175  LRKFLDSGRSMARPDGVLINGKSAKGDGKDEPLFTMKAGKTYKYRICNVGLKNSLNFRIQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            GH M +VE+EGSHTVQN Y SLD+H+GQC S+LVTA KE KDYY+VAS+RF K
Sbjct  235  GHQMKLVEMEGSHTVQNTYDSLDVHIGQCFSMLVTADKEPKDYYMVASTRFTK  287



>ref|XP_010034522.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW52300.1| hypothetical protein EUGRSUZ_J01720 [Eucalyptus grandis]
Length=552

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK  LDSGRS+ RPDG+VINGK GK      P+F M+PGKTY+YR+CN GL+ S+NFR Q
Sbjct  175  LKTFLDSGRSLARPDGVVINGKSGKGPGGDKPVFTMKPGKTYKYRICNVGLKNSLNFRIQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            GH M +VE+EGSH VQN Y+SLD+HVGQC SVLVTA +E +DYY+VAS+RF K+
Sbjct  235  GHPMKLVEMEGSHVVQNVYESLDVHVGQCFSVLVTADQEPRDYYMVASTRFTKE  288



>ref|XP_009626538.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=557

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L+K+LDSGRS  RP+G++INGK GK  +K +P+F M PGKTYRYR CN G++ S+N R Q
Sbjct  176  LRKLLDSGRSAGRPNGVIINGKSGKGDNKDEPMFTMTPGKTYRYRFCNVGMKDSINVRIQ  235

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            GH M +VE+EGSHTVQN Y SLD+H+GQC+SVLVTA K+ KDY+LVAS+RF K+
Sbjct  236  GHIMKLVEIEGSHTVQNMYDSLDVHLGQCMSVLVTADKDPKDYFLVASTRFTKE  289



>ref|XP_008374029.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=552

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LKK+LDSGR++ RPD ++INGK+ K   K +PLF M+PGKTY+YRVCN G + S+NFR Q
Sbjct  175  LKKLLDSGRTMGRPDXILINGKNAKGDGKDEPLFTMKPGKTYKYRVCNVGFKNSLNFRIQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            GH + +VE+EGSHTVQN Y+SLD+H+GQC S+LVTA KE KDYY+VAS+RF K
Sbjct  235  GHPLKLVEMEGSHTVQNTYESLDVHLGQCFSLLVTADKERKDYYMVASTRFTK  287



>ref|XP_011048128.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=551

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TL+K LD GRS+ RP G++INGK+ K   K +PLFKM+P KTY+YR+CNAG++ ++NFR 
Sbjct  174  TLRKYLDDGRSLARPTGVLINGKNAKGDGKDEPLFKMKPEKTYKYRICNAGIKNTLNFRI  233

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            QGH M +VE+EGSH VQN Y+SLD+HVGQC SVLVTA++  KDYY+VAS+RF KQ
Sbjct  234  QGHTMKLVEMEGSHVVQNVYESLDVHVGQCFSVLVTANQAPKDYYMVASTRFNKQ  288



>gb|KHG27164.1| L-ascorbate oxidase [Gossypium arboreum]
Length=475

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            +LKKILDSGR++ R DG+ +NGK  K   K +PLF ME GKTY+YR+CN G +TS+N RF
Sbjct  98   SLKKILDSGRNLGRCDGVHLNGKVAKGDGKDEPLFTMEAGKTYKYRICNTGTKTSLNVRF  157

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
            QGH M +VE+EGSHT+QNDY SLD+HVGQC SVLVTA++E +DYY+VAS+RF K+E
Sbjct  158  QGHTMKLVEMEGSHTMQNDYDSLDVHVGQCFSVLVTANQEPRDYYVVASTRFTKRE  213



>gb|AFC88081.1| skewed-like protein [Brassica rapa subsp. oleifera]
Length=555

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 92/114 (81%), Gaps = 2/114 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            LKK LD GR+I RPDG+VINGK GK GD  D PLF ++PGKTYR R+CN GL+TS+NFR 
Sbjct  176  LKKFLDGGRTIGRPDGIVINGKSGK-GDGSDAPLFTLKPGKTYRVRICNVGLKTSINFRI  234

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            Q H M +VE+EGSH +QNDY SLD+HVGQC   +VTA++E KDYY+VASSRF K
Sbjct  235  QNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGTIVTANQEPKDYYMVASSRFLK  288



>ref|XP_010462411.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=549

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK +LDSGR++  P+G++INGK GKVG   +PLF M+P KTY+YR+CN G ++++NFR Q
Sbjct  174  LKNLLDSGRTLGLPNGVLINGKSGKVGGNNEPLFTMKPRKTYKYRLCNVGFKSTLNFRIQ  233

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
             H M +VE+EGSH +QNDY SLD+HVGQC SVLVTA++ AKDYY+VAS+RF K+E
Sbjct  234  NHMMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVTANQAAKDYYMVASTRFLKKE  288



>emb|CDY23596.1| BnaC05g39980D [Brassica napus]
Length=555

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 92/114 (81%), Gaps = 2/114 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            LKK LD GR+I RPDG+VINGK GK GD  D PLF ++PGKTYR R+CN GL+TS+NFR 
Sbjct  176  LKKFLDGGRTIGRPDGIVINGKSGK-GDGSDAPLFTLKPGKTYRVRICNVGLKTSINFRI  234

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            Q H M +VE+EGSH +QNDY SLD+HVGQC   +VTA++E KDYY+VASSRF K
Sbjct  235  QNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGTIVTANQEPKDYYMVASSRFLK  288



>ref|XP_006838146.1| hypothetical protein AMTR_s00106p00093220 [Amborella trichopoda]
 gb|ERN00715.1| hypothetical protein AMTR_s00106p00093220 [Amborella trichopoda]
Length=546

 Score =   164 bits (416),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 75/112 (67%), Positives = 93/112 (83%), Gaps = 1/112 (1%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TL++ LDSGRSI +PDG++ING + K      PLF MEPGKTYRYR+CN GL+TS+NFR 
Sbjct  171  TLRRRLDSGRSIGQPDGVLINGMN-KPNKANKPLFNMEPGKTYRYRICNVGLKTSLNFRI  229

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRF  338
            QGH + +VE+EGSHTVQN Y+SLD+HVGQC SVLVTA+K  +DYY+VAS+RF
Sbjct  230  QGHTLKLVEIEGSHTVQNIYESLDVHVGQCYSVLVTANKVPRDYYIVASTRF  281



>ref|XP_009773307.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=557

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            ++K+LDSGR++ RP+G++INGK GK  +K +P+F M PGKTYRYR CN G++ S+N R Q
Sbjct  176  MRKLLDSGRALGRPNGVIINGKSGKGDNKDEPMFTMTPGKTYRYRFCNVGMKDSINVRIQ  235

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            GH M +VE+EGSHTVQN Y SLD+H+GQC+SVLVTA K+ KDY+LVAS+RF K+
Sbjct  236  GHVMKLVEIEGSHTVQNMYDSLDVHLGQCMSVLVTADKDPKDYFLVASTRFTKE  289



>ref|XP_011048127.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Populus euphratica]
Length=537

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
             L+K+LDSGRS+ RPDG++INGK+     K +PLF M+P KTY+YR+CNAGL+ ++NFR 
Sbjct  158  ALQKLLDSGRSLARPDGVLINGKNAMGDGKDEPLFTMKPEKTYKYRICNAGLKNTLNFRI  217

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            QGH M +VE+EGSH VQN Y+SLD+HVGQC SVLVTA++  KDYY++AS+RF KQ
Sbjct  218  QGHTMKLVEMEGSHVVQNVYESLDVHVGQCFSVLVTANQAPKDYYMMASTRFNKQ  272



>ref|XP_011048126.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Populus euphratica]
Length=553

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
             L+K+LDSGRS+ RPDG++INGK+     K +PLF M+P KTY+YR+CNAGL+ ++NFR 
Sbjct  174  ALQKLLDSGRSLARPDGVLINGKNAMGDGKDEPLFTMKPEKTYKYRICNAGLKNTLNFRI  233

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            QGH M +VE+EGSH VQN Y+SLD+HVGQC SVLVTA++  KDYY++AS+RF KQ
Sbjct  234  QGHTMKLVEMEGSHVVQNVYESLDVHVGQCFSVLVTANQAPKDYYMMASTRFNKQ  288



>ref|XP_010480098.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=555

 Score =   164 bits (414),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LKK LDSGR++ RPDG++INGK GK      PLF ++PGKTYR R+CN GL+ S+NFR Q
Sbjct  177  LKKFLDSGRTLGRPDGILINGKSGKTDGSDKPLFTLKPGKTYRVRICNVGLKASLNFRIQ  236

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
             H M +VE+EGSH +QNDY SLD+HVGQC  V+VTA++E KDYY+VAS+RF K+
Sbjct  237  NHKMKLVEMEGSHVLQNDYDSLDIHVGQCFGVIVTANQEPKDYYMVASTRFLKK  290



>ref|XP_010501175.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=555

 Score =   164 bits (414),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LKK LDSGR++ RPDG++INGK GK      PLF ++PGKTYR R+CN GL+ S+NFR Q
Sbjct  177  LKKFLDSGRTLGRPDGILINGKSGKTDGSDKPLFTLKPGKTYRVRICNVGLKASLNFRIQ  236

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
             H M +VE+EGSH +QNDY SLD+HVGQC  V+VTA++E KDYY+VAS+RF K+
Sbjct  237  NHKMKLVEMEGSHVLQNDYDSLDIHVGQCFGVIVTANQEPKDYYMVASTRFLKK  290



>ref|XP_010462412.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=555

 Score =   164 bits (414),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LKK LDSGR++ RPDG++INGK GK      PLF ++PGKTYR R+CN GL+ S+NFR Q
Sbjct  177  LKKFLDSGRTLGRPDGILINGKSGKTDGSDKPLFTLKPGKTYRVRICNVGLKASLNFRIQ  236

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
             H M +VE+EGSH +QNDY SLD+HVGQC  V+VTA++E KDYY+VAS+RF K+
Sbjct  237  NHKMKLVEMEGSHVLQNDYDSLDIHVGQCFGVIVTANQEPKDYYMVASTRFLKK  290



>ref|XP_010247847.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nelumbo nucifera]
Length=552

 Score =   164 bits (414),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 97/115 (84%), Gaps = 1/115 (1%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKV-GDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            +LKK+LD+GRS+ +PDG++INGK GKV G K +PLF M+P K YRYRVCN GL+ S+NFR
Sbjct  173  SLKKLLDTGRSLGKPDGVLINGKSGKVEGHKDEPLFTMKPHKXYRYRVCNVGLKXSLNFR  232

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             QGH++ +VE+EGSHTVQN Y SLD+HVGQC SVLVTA++  KDYY+VAS+RF K
Sbjct  233  IQGHSLKLVEMEGSHTVQNVYDSLDVHVGQCYSVLVTANQXPKDYYMVASTRFTK  287



>ref|XP_010247848.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Nelumbo nucifera]
Length=551

 Score =   163 bits (413),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 97/115 (84%), Gaps = 1/115 (1%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKV-GDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            +LKK+LD+GRS+ +PDG++INGK GKV G K +PLF M+P K YRYRVCN GL+ S+NFR
Sbjct  172  SLKKLLDTGRSLGKPDGVLINGKSGKVEGHKDEPLFTMKPHKXYRYRVCNVGLKXSLNFR  231

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             QGH++ +VE+EGSHTVQN Y SLD+HVGQC SVLVTA++  KDYY+VAS+RF K
Sbjct  232  IQGHSLKLVEMEGSHTVQNVYDSLDVHVGQCYSVLVTANQXPKDYYMVASTRFTK  286



>ref|XP_004505353.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=545

 Score =   163 bits (413),  Expect = 5e-45, Method: Composition-based stats.
 Identities = 77/114 (68%), Positives = 91/114 (80%), Gaps = 4/114 (4%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TLKK LDSGRS+ RPDG+ I GK   V    +PL+ ME GKTY+YR+CN GL+ ++NFR 
Sbjct  172  TLKKFLDSGRSMGRPDGVHIMGKSNSV----EPLYTMESGKTYKYRICNVGLKDTLNFRI  227

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            QGH+M +VE+EGSHTVQN Y SLD+HVGQC SVLVTA KE KDYYLVAS+RF K
Sbjct  228  QGHSMKLVEMEGSHTVQNMYDSLDVHVGQCYSVLVTADKEPKDYYLVASTRFTK  281



>gb|AGW80453.1| pollen-specific protein [Gossypium hirsutum]
Length=551

 Score =   163 bits (413),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            +LKKILDSGR++ R DG+ +NGK  K   K +PLF ME GKTY+YR+CN G++TS+N RF
Sbjct  174  SLKKILDSGRNLGRCDGVHLNGKVAKGDRKDEPLFTMEAGKTYKYRICNTGIKTSLNVRF  233

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
            QGH M +VE+EGSHT+QNDY SLD+HVGQC SVLVTA++E +DYY+VAS+RF ++E
Sbjct  234  QGHTMKLVEMEGSHTMQNDYDSLDVHVGQCFSVLVTANQEPRDYYVVASTRFTRRE  289



>ref|XP_010247849.1| PREDICTED: L-ascorbate oxidase homolog isoform X3 [Nelumbo nucifera]
Length=553

 Score =   163 bits (413),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 97/115 (84%), Gaps = 1/115 (1%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKV-GDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            +LKK+LD+GRS+ +PDG++INGK GKV G K +PLF M+P K YRYRVCN GL+ S+NFR
Sbjct  174  SLKKLLDTGRSLGKPDGVLINGKSGKVEGHKDEPLFTMKPHKXYRYRVCNVGLKXSLNFR  233

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             QGH++ +VE+EGSHTVQN Y SLD+HVGQC SVLVTA++  KDYY+VAS+RF K
Sbjct  234  IQGHSLKLVEMEGSHTVQNVYDSLDVHVGQCYSVLVTANQXPKDYYMVASTRFTK  288



>gb|EPS72881.1| pollen-specific protein [Genlisea aurea]
Length=585

 Score =   164 bits (414),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TLK ILDSGRSI  PDG+ INGK GKVG    P+F +E GKTYRYRVCN G+R SVNFR 
Sbjct  201  TLKSILDSGRSIGFPDGVHINGKFGKVGGGSPPMFTVEKGKTYRYRVCNVGMRLSVNFRI  260

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            QGH++ +VE+EGSHTVQN Y SLDLHVGQC+SVL+TA +   DY+ V SSRF K+
Sbjct  261  QGHDLKLVEMEGSHTVQNVYDSLDLHVGQCMSVLITADQAPADYHFVVSSRFTKK  315



>ref|NP_175953.1| protein SKU5 similar 12 [Arabidopsis thaliana]
 gb|AAK32912.1|AF367325_1 At1g55570/T5A14_1 [Arabidopsis thaliana]
 gb|AAD10638.1| putative pollen specific protein [Arabidopsis thaliana]
 gb|AAM91432.1| At1g55570/T5A14_1 [Arabidopsis thaliana]
 gb|AEE33267.1| protein SKU5 similar 12 [Arabidopsis thaliana]
Length=555

 Score =   163 bits (413),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LKK LDSGR+I RPDG++INGK GK      PLF ++PGKTYR R+CN GL+ S+NFR Q
Sbjct  177  LKKFLDSGRTIGRPDGILINGKSGKTDGSDKPLFTLKPGKTYRVRICNVGLKASLNFRIQ  236

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
             H M +VE+EGSH +QNDY SLD+HVGQC  V+VTA +E KDYY++AS+RF K+
Sbjct  237  NHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVIVTADQEPKDYYMIASTRFLKK  290



>sp|Q00624.1|ASOL_BRANA RecName: Full=L-ascorbate oxidase homolog; Flags: Precursor [Brassica 
napus]
 emb|CAA45554.1| Bp10 [Brassica napus]
 emb|CDY43995.1| BnaA05g25900D [Brassica napus]
Length=555

 Score =   163 bits (413),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 2/114 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            LKK LD GR+I RPDG+VINGK GK GD  D PLF ++PGKTYR R+CN G++TS+NFR 
Sbjct  176  LKKFLDGGRTIGRPDGIVINGKSGK-GDGSDAPLFTLKPGKTYRVRICNVGVKTSINFRI  234

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            Q H M +VE+EGSH +QNDY SLD+HVGQC   +VTA++E KDYY+VASSRF K
Sbjct  235  QNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGTIVTANQEPKDYYMVASSRFLK  288



>gb|AFK33666.1| unknown [Lotus japonicus]
Length=467

 Score =   162 bits (410),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 93/115 (81%), Gaps = 2/115 (2%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            TLK +LDSGRSI RP+G++INGK  K GD  D PL+ M+PGKTY+YR+CN GL+ S+NFR
Sbjct  172  TLKSLLDSGRSIGRPNGVLINGKTAK-GDGSDQPLYTMKPGKTYKYRICNVGLKDSLNFR  230

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             QGH M +VE EGSH VQN Y SLD+HVGQC +VLVTA K+ KDYYLVAS+RF K
Sbjct  231  IQGHPMKLVETEGSHVVQNTYDSLDVHVGQCYTVLVTADKDPKDYYLVASTRFTK  285



>ref|XP_002891844.1| hypothetical protein ARALYDRAFT_892557 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68103.1| hypothetical protein ARALYDRAFT_892557 [Arabidopsis lyrata subsp. 
lyrata]
Length=555

 Score =   163 bits (413),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LKK LDSGR+I RPDG++INGK GK      PLF ++PGKTYR R+CN GL+ S+NFR Q
Sbjct  177  LKKFLDSGRTIGRPDGILINGKSGKTDGSDKPLFTLKPGKTYRVRICNVGLKASLNFRIQ  236

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
             H M +VE+EGSH +QNDY SLD+HVGQC  V+VTA +E KDYY+VAS+RF K+
Sbjct  237  NHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVIVTADQELKDYYMVASTRFLKK  290



>ref|XP_003601601.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71852.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=550

 Score =   163 bits (412),  Expect = 7e-45, Method: Composition-based stats.
 Identities = 74/114 (65%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TLK  LDSGRSI RP G++INGK+ K     +PL+ M+PGKTY+YR+CN GL+ ++NFRF
Sbjct  173  TLKMELDSGRSIGRPAGVIINGKNAKGDGSDEPLYTMKPGKTYKYRICNTGLKDTLNFRF  232

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            QGH M +VE EGSH VQN Y SLD+HVGQC +VLVTA KE KDYY+VAS+R  K
Sbjct  233  QGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVLVTADKEPKDYYMVASTRMTK  286



>emb|CDY68850.1| BnaA10g29650D [Brassica napus]
Length=303

 Score =   158 bits (400),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK  LDSGRSI RP+G++INGK GK     +P+F M+PGKTY+YR+CN GL+ ++NFR Q
Sbjct  174  LKDNLDSGRSIGRPEGVLINGKAGKPDGTGEPIFTMKPGKTYKYRICNVGLKMALNFRIQ  233

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             H + +VE+EGSHT+QN Y SLDLHVGQC  VLVTA +E KDYY+VAS+RF K
Sbjct  234  NHKIKLVELEGSHTLQNLYDSLDLHVGQCFGVLVTADQEPKDYYMVASTRFLK  286



>gb|KHG05644.1| L-ascorbate oxidase [Gossypium arboreum]
Length=535

 Score =   163 bits (412),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            +LKK+L SGR++ R DG+ INGK  K     +PLF ME GKTY+YR+CNAG++TS+N RF
Sbjct  158  SLKKVLLSGRNLGRCDGVHINGKVAKGDGNDEPLFTMEAGKTYKYRICNAGIKTSLNVRF  217

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
            QGH M +VE+EGSHTVQNDY+SLD+HVGQC SVLVTA++E KDY++VAS+RF K+E
Sbjct  218  QGHTMKLVEMEGSHTVQNDYESLDVHVGQCFSVLVTANQEPKDYFVVASTRFTKRE  273



>ref|XP_009384956.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=550

 Score =   162 bits (411),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 75/115 (65%), Positives = 91/115 (79%), Gaps = 2/115 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGK--VGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            L ++LD+GRSI  P G++ING  GK   G    PLF ME GKTYRYR+CN GL+ S+NFR
Sbjct  173  LAQLLDAGRSIGNPAGVIINGSPGKDAAGKDDAPLFTMEAGKTYRYRICNVGLKVSLNFR  232

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             Q H M +VE++GSHTVQNDYKSLD+HVGQC SVLVTA++E KDYY+VAS+RF K
Sbjct  233  IQSHLMKLVEMDGSHTVQNDYKSLDIHVGQCFSVLVTANQEPKDYYMVASTRFTK  287



>ref|XP_009384957.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=556

 Score =   162 bits (411),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 75/115 (65%), Positives = 91/115 (79%), Gaps = 2/115 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGK--VGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            L ++LD+GRSI  P G++ING  GK   G    PLF ME GKTYRYR+CN GL+ S+NFR
Sbjct  179  LAQLLDAGRSIGNPAGVIINGSPGKDAAGKDDAPLFTMEAGKTYRYRICNVGLKVSLNFR  238

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             Q H M +VE++GSHTVQNDYKSLD+HVGQC SVLVTA++E KDYY+VAS+RF K
Sbjct  239  IQSHLMKLVEMDGSHTVQNDYKSLDIHVGQCFSVLVTANQEPKDYYMVASTRFTK  293



>ref|XP_010552291.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=549

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            ++K +LDSGR++  PDG++INGK  K+  K  PLF M+PGKTY++R+CN G ++++NFR 
Sbjct  173  SIKNLLDSGRALGSPDGVLINGKSAKMDGKDQPLFTMKPGKTYKFRICNVGFKSTLNFRI  232

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
            Q H M +VE+EGSH +QNDY SLD+HVGQC +VLVTA + AKDYY+VAS+RF K+E
Sbjct  233  QNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQAAKDYYMVASTRFLKKE  288



>ref|XP_002297609.2| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE82414.2| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=553

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
             L+K+LDSGRS+ RPDG++INGK+     K +PLF M+P KTY+YR+CNAGL+ ++NFR 
Sbjct  174  ALQKLLDSGRSLARPDGVLINGKNAMGDGKDEPLFTMKPEKTYKYRICNAGLKNTLNFRI  233

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            Q H M +VE+EGSH VQN Y+SLD+HVGQC SVLVTA++  KDYY+VAS+RF KQ
Sbjct  234  QDHTMKLVEMEGSHVVQNVYESLDVHVGQCFSVLVTANQAPKDYYMVASTRFNKQ  288



>ref|XP_010093150.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB53609.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=535

 Score =   162 bits (410),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 72/114 (63%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TL+K LD GRS+ RPDG++INGK  K     +PLF M+PGK Y+YR+CN GL+ S+NFR 
Sbjct  156  TLRKFLDIGRSLGRPDGVLINGKSAKSDGSDEPLFTMKPGKIYKYRICNVGLKNSLNFRI  215

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            QGH + +VE+EGSHTVQN Y+SLD+HVGQC +VLVTA K  KDY +VAS+RF K
Sbjct  216  QGHPLKLVEMEGSHTVQNTYESLDVHVGQCFAVLVTADKAPKDYLVVASTRFTK  269



>ref|XP_002299087.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE83892.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=551

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TL+K LD GRS+ RP G++INGK+ K   K +PLF M+PGKTY+YR+CNAG++ ++NFR 
Sbjct  174  TLRKYLDDGRSLARPTGVLINGKNAKGDGKDEPLFTMKPGKTYKYRICNAGIKNTLNFRI  233

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            QGH M +VE+EGSH VQN Y++LD+HVGQC SVLVTA++  KDYY+V ++RF KQ
Sbjct  234  QGHTMKLVEMEGSHVVQNVYEALDVHVGQCFSVLVTANQAPKDYYMVTTTRFNKQ  288



>ref|XP_006353286.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=558

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK++LDSGR++ RP G+VINGK GK   K +P+F + PGKTYR+R+CN GL+ S+N R Q
Sbjct  176  LKRLLDSGRALGRPQGVVINGKSGKGDGKDEPMFTVTPGKTYRFRICNVGLKDSINVRMQ  235

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            GH + +VE+EGSHTVQN Y+SLD+H+GQC SVLVTA++E KDY+LVAS+RF K
Sbjct  236  GHTLKLVEIEGSHTVQNVYESLDIHLGQCFSVLVTANQEPKDYFLVASTRFTK  288



>ref|XP_003538519.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=552

 Score =   162 bits (409),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L+K+LDSGRS+ RP+G++INGK  K   K +PLF M+P KTY+YR+CN GL+ S+N+R Q
Sbjct  176  LRKLLDSGRSLGRPEGVLINGKTAKGDGKDEPLFTMKPAKTYKYRICNVGLKNSLNYRIQ  235

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            GH+M +VE+EGSH VQN Y SLD+HVG+C SVLVTA KE KDYY+VAS+RF K
Sbjct  236  GHSMKLVEMEGSHVVQNMYDSLDVHVGECFSVLVTADKEPKDYYMVASTRFTK  288



>ref|XP_009420229.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=551

 Score =   162 bits (409),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 76/115 (66%), Positives = 92/115 (80%), Gaps = 2/115 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGK--VGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            L  ILD+GRSI  P G+++NG  GK   G    PLF ME GKTYRYR+CN GL+ S+NFR
Sbjct  174  LAGILDAGRSIGNPAGVLMNGLSGKDATGKDDPPLFTMEAGKTYRYRICNVGLKLSLNFR  233

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             QGH M +VE++GSHTVQNDY+SLD+HVGQCLSVLVTA++E KDYY+VAS+RF K
Sbjct  234  IQGHLMKLVEMDGSHTVQNDYESLDVHVGQCLSVLVTANQEPKDYYMVASTRFTK  288



>gb|KHN44494.1| L-ascorbate oxidase like [Glycine soja]
Length=551

 Score =   162 bits (409),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L+K+LDSGRS+ RP+G++INGK  K   K +PLF M+P KTY+YR+CN GL+ S+N+R Q
Sbjct  175  LRKLLDSGRSLGRPEGVLINGKTAKGDGKDEPLFTMKPAKTYKYRICNVGLKNSLNYRIQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            GH+M +VE+EGSH VQN Y SLD+HVG+C SVLVTA KE KDYY+VAS+RF K
Sbjct  235  GHSMKLVEMEGSHVVQNMYDSLDVHVGECFSVLVTADKEPKDYYMVASTRFTK  287



>emb|CDX97352.1| BnaA02g21430D [Brassica napus]
Length=488

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 94/115 (82%), Gaps = 2/115 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            LKK LDSGR+I RPDG++INGK GK GD  D PLF ++ GKTYR R+CN GL+TS+NFR 
Sbjct  110  LKKFLDSGRTIGRPDGILINGKAGK-GDGSDQPLFTLKQGKTYRVRICNVGLKTSLNFRI  168

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            Q H M +VE+EGSH +QNDY SLD+HVGQC  V+VTA++E KDYY+VAS+RF K+
Sbjct  169  QNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVIVTANQEPKDYYMVASTRFLKK  223



>dbj|BAL41449.1| SKU5 similar 1 [Linum grandiflorum]
Length=552

 Score =   162 bits (409),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 69/113 (61%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L+ +LDSGR++ RP+G+++NGK+ K   K +PLF M+ GKTY+YR+CNAGL+TS+NFR Q
Sbjct  175  LRTMLDSGRTLARPEGVLLNGKNAKGDGKDEPLFTMKAGKTYKYRICNAGLKTSLNFRIQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            GH M +VE+EGSH VQN Y SLD+HVG C++VLVTA ++ KDYY++AS+RF K
Sbjct  235  GHTMKLVEMEGSHVVQNMYDSLDVHVGGCMAVLVTADQDPKDYYMIASTRFTK  287



>ref|XP_009399915.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=550

 Score =   161 bits (408),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 73/115 (63%), Positives = 93/115 (81%), Gaps = 2/115 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD--PLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            L+KILD+GR++ RP GL+ING  GK G   D  PLF ME  KTYRYR+CN G++ ++NFR
Sbjct  173  LEKILDAGRAVGRPAGLLINGHSGKNGAGKDEPPLFTMEAKKTYRYRICNIGMKVTLNFR  232

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             Q H+M +VE++GSHTVQN+Y SLD+HVGQCLSVLVTA++  +DYY+VASSRF K
Sbjct  233  IQSHSMTLVEMDGSHTVQNNYDSLDIHVGQCLSVLVTANQSPRDYYMVASSRFTK  287



>ref|NP_187947.1| protein SKU5-like 11 [Arabidopsis thaliana]
 dbj|BAB01744.1| l-ascorbate oxidase; pectinesterase-like protein; pollen-specific 
protein-like [Arabidopsis thaliana]
 gb|AAO42003.1| putative pectinesterase (pectin methylesterase) family protein 
[Arabidopsis thaliana]
 gb|AAO50591.1| putative pectinesterase (pectin methylesterase) family protein 
[Arabidopsis thaliana]
 gb|AEE75341.1| protein SKU5-like 11 [Arabidopsis thaliana]
Length=554

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 94/114 (82%), Gaps = 2/114 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            LKK LDSGR++ RPDG++INGK GK GD  D PLF ++PGKTYR R+CN GL+TS+NFR 
Sbjct  176  LKKFLDSGRTLGRPDGILINGKSGK-GDGSDAPLFTLKPGKTYRVRICNVGLKTSLNFRI  234

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            Q H + +VE+EGSH +QNDY SLD+HVGQC   ++TA++EAKDYY+VASSRF K
Sbjct  235  QNHKLKLVEMEGSHVLQNDYDSLDVHVGQCYGTILTANQEAKDYYMVASSRFLK  288



>gb|EPS68478.1| hypothetical protein M569_06286, partial [Genlisea aurea]
Length=533

 Score =   161 bits (408),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 71/114 (62%), Positives = 90/114 (79%), Gaps = 4/114 (4%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            +LKK+LD+GR++ RPDG++INGKH    D  +P+F  E GKT+R+RVCN GL+ S+NFR 
Sbjct  159  SLKKLLDTGRTLGRPDGVIINGKH----DSNEPMFSFEAGKTHRFRVCNVGLKNSINFRI  214

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            Q H + +VE+EGSHTVQN Y SLDLH+GQC SVLVTA +  KDYY VAS+RF K
Sbjct  215  QAHTLTLVEIEGSHTVQNVYDSLDLHLGQCASVLVTADQTPKDYYFVASTRFTK  268



>emb|CAA47177.1| Bplo [Brassica napus]
Length=555

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 93/115 (81%), Gaps = 2/115 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            LKK LD GR+I RPDG+VINGK GK GD  D PLF ++PGKTYR R+CN G++TS+NFR 
Sbjct  176  LKKFLDGGRTIGRPDGIVINGKSGK-GDGSDAPLFTLKPGKTYRVRICNVGIKTSLNFRI  234

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            Q H M +VE+EGSH +QNDY SLD+HVGQC   +VTA++E KDYY+VAS+RF K+
Sbjct  235  QNHKMKLVEMEGSHVLQNDYDSLDVHVGQCYGTIVTANQEPKDYYMVASTRFLKK  289



>ref|XP_007157831.1| hypothetical protein PHAVU_002G101800g [Phaseolus vulgaris]
 gb|ESW29825.1| hypothetical protein PHAVU_002G101800g [Phaseolus vulgaris]
Length=553

 Score =   161 bits (408),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 74/115 (64%), Positives = 92/115 (80%), Gaps = 2/115 (2%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            TL K+LDSGR++ RP  L++NG++ K GD  D PLF M PGKTY+YR+CN GL+ S+NFR
Sbjct  176  TLAKLLDSGRALGRPQALLVNGQNAK-GDGTDKPLFTMLPGKTYKYRLCNVGLKNSINFR  234

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             Q H M +VE+EGSHTVQN Y SLD+H+GQC  VLVTA +EAKDYY+VAS+RF K
Sbjct  235  IQNHQMKLVEMEGSHTVQNVYDSLDVHLGQCFGVLVTADQEAKDYYIVASTRFTK  289



>ref|XP_009387378.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=550

 Score =   161 bits (407),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 75/117 (64%), Positives = 91/117 (78%), Gaps = 2/117 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGK--VGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            L  ILD+GRSI  PDG++INGK GK   G    PLF ME GK YRYR+CN G+R S+NFR
Sbjct  173  LAGILDAGRSIGLPDGVIINGKTGKDRTGKDGKPLFVMESGKVYRYRICNTGIRASLNFR  232

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
             QGH+M +VE++GSHT+QN Y SLD+HVGQC SVLVTA++   DYYLVAS+RF K+E
Sbjct  233  IQGHSMELVEIDGSHTMQNLYDSLDVHVGQCYSVLVTANQAPGDYYLVASTRFMKKE  289



>ref|XP_007163844.1| hypothetical protein PHAVU_001G269100g [Phaseolus vulgaris]
 gb|ESW35838.1| hypothetical protein PHAVU_001G269100g [Phaseolus vulgaris]
Length=549

 Score =   161 bits (407),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 94/115 (82%), Gaps = 2/115 (2%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            TLKK LDSGRSI RP+G++INGK  K GD  D P+F M+PGKTY+YR+CN G++ S+N R
Sbjct  172  TLKKFLDSGRSIGRPEGVLINGKTAK-GDGSDKPMFTMKPGKTYKYRICNVGMKNSLNLR  230

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            FQGH M +VE+EGSH VQN+Y SLD+HVG C SVL+TA K+ KDYY+VAS+RF K
Sbjct  231  FQGHLMKLVEMEGSHVVQNNYDSLDVHVGGCFSVLITADKDPKDYYIVASTRFSK  285



>ref|XP_009411781.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=548

 Score =   161 bits (407),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 73/116 (63%), Positives = 94/116 (81%), Gaps = 3/116 (3%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TL +ILD+GRSI  P G++INGK GK     +PLF ME GK YRYRVCN G +TS+NFR 
Sbjct  175  TLARILDTGRSIGLPAGVLINGKAGK---DDEPLFVMEAGKVYRYRVCNIGTKTSLNFRI  231

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
            QGH+M++VE++GSHT+QN Y+SLD+HVGQC SVLVTA++   DYY+VAS+RF ++E
Sbjct  232  QGHSMLLVEMDGSHTMQNTYESLDIHVGQCFSVLVTANQAPGDYYMVASTRFLRKE  287



>emb|CAN69061.1| hypothetical protein VITISV_032605 [Vitis vinifera]
Length=562

 Score =   161 bits (407),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 93/114 (82%), Gaps = 3/114 (3%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LKK LDSG SI RPDG+ INGK     DK +PLF M+PG TYRYR+CN G+++S+NFR Q
Sbjct  188  LKKKLDSGHSIGRPDGVQINGKSE---DKDEPLFTMKPGLTYRYRICNVGIKSSLNFRIQ  244

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            GH M +VE+EGSHTVQN Y SLD+H+GQC SVLVTA+++ KDYY+VAS+RF KQ
Sbjct  245  GHTMKLVELEGSHTVQNVYDSLDVHLGQCYSVLVTANQDPKDYYMVASTRFLKQ  298



>ref|XP_010093149.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB53608.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=550

 Score =   160 bits (406),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 92/114 (81%), Gaps = 3/114 (3%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TLK  LDSGRS+ RPDG++INGK G   DK  PLF M+PGKTY+YR+CN GL+ S+NFR 
Sbjct  173  TLKNFLDSGRSLGRPDGVLINGKSGN--DK-KPLFTMKPGKTYKYRICNVGLKDSLNFRI  229

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            Q H M +VE+EGSHTVQN Y+SLD+HVGQC SVLVTA K  K+YY+VAS+RF K
Sbjct  230  QDHPMKLVEMEGSHTVQNTYESLDVHVGQCFSVLVTADKAPKEYYMVASTRFTK  283



>ref|XP_009402422.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=550

 Score =   160 bits (406),  Expect = 5e-44, Method: Composition-based stats.
 Identities = 75/115 (65%), Positives = 91/115 (79%), Gaps = 2/115 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGK--VGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            L  ILD+GRSI  P G+++NG  GK   G    PLF ME GKTYRYR+CN GL+ S+NFR
Sbjct  173  LAGILDAGRSIGNPTGILMNGSPGKNAAGKDDAPLFAMEAGKTYRYRICNVGLKVSLNFR  232

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             Q H M +VE++GSHTVQNDY+SLD+HVGQCLSVLVTA++E KDYY+VAS+RF K
Sbjct  233  IQNHLMKLVEMDGSHTVQNDYESLDVHVGQCLSVLVTANQEPKDYYMVASTRFTK  287



>ref|XP_009383852.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=552

 Score =   160 bits (406),  Expect = 6e-44, Method: Composition-based stats.
 Identities = 74/117 (63%), Positives = 89/117 (76%), Gaps = 2/117 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD--PLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            L K LD GRSI  P G++INGK GK G   D  PLF ME GK YRYR+CN G++ S+NFR
Sbjct  175  LAKTLDMGRSIGLPSGVLINGKSGKHGSGKDDKPLFVMEAGKVYRYRICNTGIKASINFR  234

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
             QGH M +VE++GSHT+QN Y SLD+HVGQC SVLVTA +  KDYYLVAS+RF ++E
Sbjct  235  IQGHTMELVEMDGSHTMQNMYDSLDIHVGQCFSVLVTADRAPKDYYLVASTRFLRKE  291



>ref|XP_010034521.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW52299.1| hypothetical protein EUGRSUZ_J01719 [Eucalyptus grandis]
Length=551

 Score =   160 bits (406),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK  LDSGR++ RPDG++INGK  K   K +PLF M+PGKTY+YR+CN GL+ S+NFR Q
Sbjct  174  LKSFLDSGRALGRPDGVLINGKSNKSRGKDEPLFTMKPGKTYKYRICNVGLKNSLNFRIQ  233

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             H M +VE+EGSHTVQN+Y+SLD+HVGQC  VLVTA K+ KDY +VAS+RF K
Sbjct  234  DHPMKLVEMEGSHTVQNNYESLDVHVGQCFGVLVTADKKPKDYLMVASTRFTK  286



>emb|CDY49392.1| BnaC09g53590D [Brassica napus]
Length=446

 Score =   159 bits (402),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK  LDSGRSI RP+G++INGK GK     +P+F M+PGKTY+YR+CN GL+ ++NFR Q
Sbjct  174  LKDNLDSGRSIGRPEGVLINGKAGKPDGTGEPIFTMKPGKTYKYRICNVGLKMALNFRIQ  233

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             H + +VE+EGSHT+QN Y SLDLHVGQC  VLVTA +E KDYY+VAS+RF K
Sbjct  234  NHKIKLVELEGSHTLQNLYDSLDLHVGQCFGVLVTADQEPKDYYMVASTRFLK  286



>ref|XP_006407228.1| hypothetical protein EUTSA_v10020433mg [Eutrema salsugineum]
 gb|ESQ48681.1| hypothetical protein EUTSA_v10020433mg [Eutrema salsugineum]
Length=554

 Score =   160 bits (406),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 92/114 (81%), Gaps = 2/114 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            LKK LD GR++ RPDG++INGK GK GD  D PLF ++PGKTYR R+CN GL+TS+NFR 
Sbjct  176  LKKFLDGGRTLGRPDGILINGKAGK-GDGSDAPLFTLKPGKTYRVRICNVGLKTSLNFRI  234

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            Q H M +VE+EGSH +QNDY SLD+HVGQC   +VTA++E KDYY+VASSRF K
Sbjct  235  QNHKMKLVEMEGSHVLQNDYDSLDVHVGQCYGTIVTANQEPKDYYMVASSRFLK  288



>ref|XP_004502172.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=545

 Score =   160 bits (406),  Expect = 6e-44, Method: Composition-based stats.
 Identities = 72/114 (63%), Positives = 91/114 (80%), Gaps = 4/114 (4%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TLK +LDSGRSI RPDG+++NGK        +PL+ M+PGKTY+YR+CN GL+ ++NFRF
Sbjct  172  TLKMMLDSGRSIGRPDGVIMNGK----ATNEEPLYTMKPGKTYKYRICNVGLKDALNFRF  227

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            QGH M +VE EGSH VQ+ Y SLD+HVGQC +VLVTA K+ KDYY+VAS+RF K
Sbjct  228  QGHAMKLVETEGSHVVQSFYDSLDVHVGQCYTVLVTADKDPKDYYMVASTRFTK  281



>gb|KFK27206.1| hypothetical protein AALP_AA8G349600 [Arabis alpina]
Length=559

 Score =   160 bits (406),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TLK  LDSGRSI RP G++INGK GK     +P+F M+PGKTYRYR+CN G++ ++NFR 
Sbjct  178  TLKNNLDSGRSIGRPAGVLINGKSGKPDGTGEPIFTMKPGKTYRYRICNVGMKMALNFRI  237

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            Q H + +VE+EGSHT+QN Y SLDLHVGQC  VLVTA +E KDYY+VAS+RF K
Sbjct  238  QNHKIKLVELEGSHTLQNLYDSLDLHVGQCFGVLVTADQEPKDYYMVASTRFLK  291



>ref|XP_007163845.1| hypothetical protein PHAVU_001G269200g [Phaseolus vulgaris]
 gb|ESW35839.1| hypothetical protein PHAVU_001G269200g [Phaseolus vulgaris]
Length=549

 Score =   160 bits (405),  Expect = 7e-44, Method: Composition-based stats.
 Identities = 74/117 (63%), Positives = 95/117 (81%), Gaps = 2/117 (2%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            +L+K+LDSGRSI RP+G++INGK  K GD  D PL+ M PGKTY+YR+CN GL+ ++NFR
Sbjct  173  SLQKLLDSGRSIGRPNGVLINGKTAK-GDGSDQPLYTMIPGKTYKYRLCNVGLKDALNFR  231

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
             QGH++ +VE EGSH VQN Y SLD+HVGQC +VLVTA K+ KDYY+VAS+RF K +
Sbjct  232  IQGHSLKLVETEGSHVVQNVYDSLDVHVGQCFTVLVTADKDPKDYYMVASTRFTKYD  288



>ref|XP_006299300.1| hypothetical protein CARUB_v10015454mg [Capsella rubella]
 gb|EOA32198.1| hypothetical protein CARUB_v10015454mg [Capsella rubella]
Length=554

 Score =   160 bits (405),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 93/114 (82%), Gaps = 2/114 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            LKK LD GR++ RPDG++INGK GK GD  D PLF ++PGKTYR R+CN GL+TS+NFR 
Sbjct  176  LKKFLDGGRTLGRPDGILINGKSGK-GDGSDAPLFNLKPGKTYRVRICNVGLKTSLNFRI  234

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            Q H + +VE+EGSH +QNDY SLD+HVGQC   ++TA++EAKDYY+VASSRF K
Sbjct  235  QNHKLKLVEMEGSHVLQNDYDSLDVHVGQCYGTILTANQEAKDYYMVASSRFLK  288



>ref|XP_003556690.2| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=557

 Score =   160 bits (405),  Expect = 9e-44, Method: Composition-based stats.
 Identities = 73/114 (64%), Positives = 92/114 (81%), Gaps = 4/114 (4%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK+ LDSGRSI RP G+ INGK+G     L+PL+ MEPGKTY+YR+CN GL+ S+NFR Q
Sbjct  185  LKQKLDSGRSIGRPVGVHINGKNGG----LEPLYTMEPGKTYKYRICNVGLKDSLNFRIQ  240

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            GH + +VE EGSH VQN+Y SLD+HVGQC +VLVTA +E KDY++VAS+RF K+
Sbjct  241  GHPLKLVETEGSHVVQNNYDSLDVHVGQCYTVLVTADQEPKDYFMVASTRFTKK  294



>ref|XP_006392621.1| hypothetical protein EUTSA_v10011364mg [Eutrema salsugineum]
 gb|ESQ29907.1| hypothetical protein EUTSA_v10011364mg [Eutrema salsugineum]
Length=553

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 2/114 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            LKK LDSGR+I RPDG++INGK GK GD  D PLF ++ GKTYR R+CN GL+ S+NFR 
Sbjct  175  LKKFLDSGRTIGRPDGILINGKAGK-GDGSDQPLFTLKQGKTYRVRICNVGLKASLNFRI  233

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            Q H M +VE+EGSH +QNDY SLD+HVGQC  VLVTA++E KDYY+VAS+RF K
Sbjct  234  QNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVLVTANQEPKDYYMVASTRFLK  287



>emb|CDX75707.1| BnaC03g37900D [Brassica napus]
Length=555

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 93/115 (81%), Gaps = 2/115 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            +KK LD GR+I RPDG+VINGK GK GD  D PLF ++PGKTYR R+CN G++TS+NFR 
Sbjct  176  VKKFLDGGRTIGRPDGIVINGKSGK-GDGSDAPLFTLKPGKTYRVRICNVGIKTSLNFRI  234

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            Q H M +VE+EGSH +QNDY SLD+HVGQC   +V+A++E KDYY+VASSRF K+
Sbjct  235  QNHKMKLVEMEGSHVLQNDYDSLDVHVGQCYGTIVSANQEPKDYYMVASSRFLKK  289



>ref|XP_009412658.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=545

 Score =   159 bits (403),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 75/113 (66%), Positives = 91/113 (81%), Gaps = 3/113 (3%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L  +LD+GRSI  P G++ING  GK      PLF ME GKTYRYR+CN GL+ S+NFR Q
Sbjct  173  LAGLLDAGRSIGNPAGVLINGLTGKDNA---PLFTMEAGKTYRYRICNVGLKVSLNFRIQ  229

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             H M +VE++GSHTVQNDY+SLD+HVGQCLSVLVTA++EAKDYY+VAS+RF K
Sbjct  230  SHLMKLVEMDGSHTVQNDYESLDVHVGQCLSVLVTANQEAKDYYMVASTRFTK  282



>ref|XP_009135302.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=555

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 92/115 (80%), Gaps = 2/115 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            LKK LD GR+I RPDG+VINGK GK GD  D PLF ++PGKTYR R+CN G++TS+NFR 
Sbjct  176  LKKFLDGGRTIGRPDGIVINGKSGK-GDGSDAPLFTLKPGKTYRVRICNVGIKTSLNFRI  234

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            Q H M +VE+EGSH +QNDY SLD+HVGQC   +V A++E KDYY+VAS+RF K+
Sbjct  235  QNHKMKLVEMEGSHVLQNDYDSLDVHVGQCYGTIVAANQEPKDYYMVASTRFLKK  289



>ref|XP_004305574.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=553

 Score =   159 bits (403),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 72/115 (63%), Positives = 93/115 (81%), Gaps = 2/115 (2%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            +L+K LD GRS+ RP+G++INGK+ + GD  D PLF M+PGKTY++RVCN GL+ S+NFR
Sbjct  175  SLRKQLDMGRSLGRPEGVLINGKNAR-GDGTDEPLFTMKPGKTYKFRVCNVGLKNSLNFR  233

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             QGH M +VE+EGSH VQN Y+SLD+H+GQC S LVTA KE KDY++VA +RF K
Sbjct  234  IQGHTMKLVEMEGSHVVQNTYESLDVHLGQCFSALVTADKEPKDYWMVADTRFTK  288



>emb|CDX82541.1| BnaA03g32800D [Brassica napus]
Length=555

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 92/115 (80%), Gaps = 2/115 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            LKK LD GR+I RPDG+VINGK GK GD  D PLF ++PGKTYR R+CN G++TS+NFR 
Sbjct  176  LKKFLDGGRTIGRPDGIVINGKSGK-GDGSDAPLFTLKPGKTYRVRICNVGIKTSLNFRI  234

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            Q H M +VE+EGSH +QNDY SLD+HVGQC   +V A++E KDYY+VAS+RF K+
Sbjct  235  QNHKMKLVEMEGSHVLQNDYDSLDVHVGQCYGTIVAANQEPKDYYMVASTRFLKK  289



>emb|CAA47178.1| Bplo [Brassica napus]
Length=555

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 93/115 (81%), Gaps = 2/115 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            +KK LD GR+I RPDG+VINGK GK GD  D PLF ++PGKTYR R+CN G++TS+NFR 
Sbjct  176  VKKFLDGGRTIGRPDGIVINGKAGK-GDGSDAPLFTLKPGKTYRVRICNVGIKTSLNFRI  234

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            Q H M +VE+EGSH +QNDY SLD+HVGQC   +V+A++E KDYY+VASSRF K+
Sbjct  235  QNHKMKLVEMEGSHVLQNDYDSLDVHVGQCYGTIVSANQEPKDYYMVASSRFLKK  289



>ref|XP_003601595.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71846.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TLK  LDSGRSI RP G++INGK+ K   + +PL+ M+PGKTY+YR+CN GL+ ++NFRF
Sbjct  172  TLKMELDSGRSIGRPAGVIINGKNAKGDGRDEPLYTMKPGKTYKYRICNTGLKDTLNFRF  231

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            QGH M +VE EGSH VQN Y SLD+HVGQC +VLVTA KE +DYY++AS+R  K
Sbjct  232  QGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVLVTADKEPRDYYMIASTRMTK  285



>gb|AFK44839.1| unknown [Medicago truncatula]
Length=375

 Score =   157 bits (396),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +3

Query  18   LDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQGHNM  197
            LDSGRSI RP G++INGK+ K     +PL+ M+PGKTY+YR+CN GL+ ++NFRFQGH M
Sbjct  3    LDSGRSIGRPAGVIINGKNAKGDGSDEPLYTMKPGKTYKYRICNTGLKDTLNFRFQGHGM  62

Query  198  IVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             +VE EGSH VQN Y SLD+HVGQC +VLVTA KE KDYY+VAS+R  K
Sbjct  63   KLVETEGSHVVQNVYDSLDVHVGQCYTVLVTADKEPKDYYMVASTRMTK  111



>ref|XP_010465172.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
 ref|XP_010487091.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Camelina sativa]
 ref|XP_010487092.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Camelina sativa]
Length=554

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 92/114 (81%), Gaps = 2/114 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            LKK LD GR++ RPDG++INGK GK GD  D PLF ++PGKTYR R+CN GL+TS+NFR 
Sbjct  176  LKKFLDGGRTLGRPDGILINGKSGK-GDGSDAPLFTLKPGKTYRVRICNVGLKTSLNFRI  234

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            Q H + +VE+EGSH +QNDY SLD+HVGQC   ++TA +EAKDYY+VASSRF K
Sbjct  235  QNHKLKLVEMEGSHVLQNDYDSLDVHVGQCYGTILTADQEAKDYYMVASSRFLK  288



>emb|CDY54363.1| BnaC06g07290D [Brassica napus]
Length=545

 Score =   159 bits (402),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 73/114 (64%), Positives = 90/114 (79%), Gaps = 2/114 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            LK  LDSGR+I RPDG++INGK GK GD  D PLF ++ GKTYR R+CN GL+ S+NFR 
Sbjct  179  LKNFLDSGRTIGRPDGILINGKAGK-GDGSDQPLFTLKQGKTYRIRICNVGLKASLNFRI  237

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            Q H M +VE+EGSH +QNDY SLD+HVGQC  V +TA++E KDYY+VAS+RF K
Sbjct  238  QNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVTLTANQEPKDYYMVASTRFLK  291



>ref|XP_009803815.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=557

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK +LD+GR++ RP G++INGK GK   K +P++ + PGKTYR+R CN G++ S+N RFQ
Sbjct  175  LKNLLDNGRALGRPQGVIINGKSGKGDGKDEPMYTLTPGKTYRFRFCNVGMKDSINVRFQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            GH M +VE+EGSHTVQN Y+SLD+H+GQC+SVL+TA ++ KDY+LVAS+RF K+
Sbjct  235  GHTMKLVEIEGSHTVQNVYESLDVHLGQCMSVLITADQDPKDYFLVASTRFTKE  288



>ref|XP_009611384.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=557

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK +LD+GR++ RP G++INGK GK   K +P++ + PGKTYR+R CN G++ S+N RFQ
Sbjct  175  LKNLLDNGRALGRPQGVIINGKSGKGDGKDEPMYTLTPGKTYRFRFCNVGMKDSINVRFQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            GH M +VE+EGSHTVQN Y+SLD+H+GQC+SVL+TA ++ KDY+LVAS+RF K+
Sbjct  235  GHTMKLVEIEGSHTVQNVYESLDVHLGQCMSVLITADQDPKDYFLVASTRFTKE  288



>ref|XP_009416330.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=552

 Score =   159 bits (402),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 73/115 (63%), Positives = 90/115 (78%), Gaps = 2/115 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD--PLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            L  ILD+G  I  P G++ING+ GK     D  PLF ME GKTYRYR+CN G++ S+NFR
Sbjct  175  LAAILDAGHGIGNPAGVLINGRTGKDASGKDDTPLFTMEAGKTYRYRICNVGMKVSLNFR  234

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             Q H M +VE++GSHTVQNDY+SLD+HVGQCLSVLVTA++E KDYY+VAS+RF K
Sbjct  235  MQNHRMKLVEMDGSHTVQNDYESLDVHVGQCLSVLVTANQEPKDYYMVASTRFTK  289



>ref|XP_009120150.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=554

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
             LK  LDSGRSI RP+G++INGK GK     +P+F M+PGKTY+YR+CN GL+ ++NFR 
Sbjct  173  ALKDNLDSGRSIGRPEGVLINGKAGKPDGTGEPIFTMKPGKTYKYRICNVGLKMALNFRI  232

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            Q H + +VE+EGSHT+QN Y SLDLHVGQC  VLVTA +E KDYY+VAS+RF K
Sbjct  233  QNHKIKLVELEGSHTLQNLYDSLDLHVGQCFGVLVTADQEPKDYYMVASTRFLK  286



>gb|AES71848.2| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=513

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TLK  LDSGRSI RP G++INGK+ K     +PL+ M+PGKTY+YR+CN GL+ ++NFRF
Sbjct  136  TLKMELDSGRSIGRPAGVIINGKNAKGDGSDEPLYTMKPGKTYKYRICNTGLKDTLNFRF  195

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            QGH M +VE EGSH VQN Y SLD+HVGQC +VLVTA KE +DYY++AS+R  K
Sbjct  196  QGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVLVTADKEPRDYYMIASTRMTK  249



>ref|XP_003601600.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71851.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   159 bits (401),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TLK  LDSGRSI RP G++INGK+ K     +PL+ M+PGKTY+YR+CN GL+ ++NFRF
Sbjct  172  TLKMELDSGRSIGRPAGVIINGKNAKGDGSDEPLYTMKPGKTYKYRICNTGLKDTLNFRF  231

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            QGH M +VE EGSH VQN Y SLD+HVGQC +VLVTA KE +DYY++AS+R  K
Sbjct  232  QGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVLVTADKEPRDYYMIASTRMTK  285



>ref|XP_002884964.1| hypothetical protein ARALYDRAFT_478720 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61223.1| hypothetical protein ARALYDRAFT_478720 [Arabidopsis lyrata subsp. 
lyrata]
Length=554

 Score =   159 bits (401),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 93/114 (82%), Gaps = 2/114 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            LKK LD GR++ RPDG++INGK GK GD  D PLF ++PGKTYR RVCN GL+TS+NFR 
Sbjct  176  LKKFLDGGRTLGRPDGILINGKAGK-GDGSDAPLFTLKPGKTYRVRVCNVGLKTSLNFRI  234

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            Q H + +VE+EGSH +QNDY SLD+HVGQC   +++A++EAKDYY+VASSRF K
Sbjct  235  QNHKLKLVEMEGSHVLQNDYDSLDVHVGQCYGTILSANQEAKDYYMVASSRFLK  288



>ref|XP_003601599.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71850.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   159 bits (401),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TLK  LDSGRSI RP G++INGK+ K     +PL+ M+PGKTY+YR+CN GL+ ++NFRF
Sbjct  172  TLKMELDSGRSIGRPAGVIINGKNAKGDGSDEPLYTMKPGKTYKYRICNTGLKDTLNFRF  231

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            QGH M +VE EGSH VQN Y SLD+HVGQC +VLVTA KE +DYY++AS+R  K
Sbjct  232  QGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVLVTADKEPRDYYMIASTRMTK  285



>ref|XP_010500423.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=554

 Score =   159 bits (401),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 92/114 (81%), Gaps = 2/114 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            LKK LD GR++ RPDG++INGK GK GD  D PLF ++PGKTYR R+CN G++TS+NFR 
Sbjct  176  LKKFLDGGRTLGRPDGILINGKSGK-GDGSDAPLFTLKPGKTYRVRICNVGMKTSLNFRI  234

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            Q H + +VE+EGSH +QNDY SLD+HVGQC   ++TA +EAKDYY+VASSRF K
Sbjct  235  QNHKLKLVEMEGSHVLQNDYDSLDVHVGQCYGTILTADQEAKDYYMVASSRFLK  288



>ref|XP_003601596.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71847.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   159 bits (401),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TLK  LDSGRSI RP G++INGK+ K     +PL+ M+PGKTY+YR+CN GL+ ++NFRF
Sbjct  172  TLKMELDSGRSIGRPAGVIINGKNAKGDGSDEPLYTMKPGKTYKYRICNTGLKDTLNFRF  231

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            QGH M +VE EGSH VQN Y SLD+HVGQC +VLVTA KE +DYY++AS+R  K
Sbjct  232  QGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVLVTADKEPRDYYMIASTRMTK  285



>ref|XP_003601597.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=554

 Score =   159 bits (401),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TLK  LDSGRSI RP G++INGK+ K     +PL+ M+PGKTY+YR+CN GL+ ++NFRF
Sbjct  177  TLKMELDSGRSIGRPAGVIINGKNAKGDGSDEPLYTMKPGKTYKYRICNTGLKDTLNFRF  236

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            QGH M +VE EGSH VQN Y SLD+HVGQC +VLVTA KE +DYY++AS+R  K
Sbjct  237  QGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVLVTADKEPRDYYMIASTRMTK  290



>ref|XP_009392060.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=639

 Score =   159 bits (401),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 73/115 (63%), Positives = 91/115 (79%), Gaps = 2/115 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGK--VGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            L ++LD+GR+I RP G++ING+ GK   G    PLF M+ GKTYRYRVCN G++ S+NFR
Sbjct  262  LARLLDAGRTIGRPSGILINGRPGKDSTGKDDPPLFTMKSGKTYRYRVCNVGMKVSLNFR  321

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             Q H M +VE++GSHTVQN Y SLD+HVGQCLSVLVTA +E +DYY+VASSRF K
Sbjct  322  IQSHAMKLVEMDGSHTVQNVYDSLDVHVGQCLSVLVTAHQEHRDYYMVASSRFTK  376



>emb|CDY43353.1| BnaA01g29840D [Brassica napus]
Length=554

 Score =   158 bits (400),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 93/114 (82%), Gaps = 2/114 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            LKK LD GR++ RP+G++INGK GK GD  D PLF ++PGK+YR R+CN GL+TS+NFR 
Sbjct  176  LKKFLDGGRTLGRPNGVLINGKAGK-GDGSDAPLFTLKPGKSYRVRICNVGLKTSLNFRI  234

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            Q H M +VE+EGSH +QND+ SLD+HVGQC   +VTA++EAKDYY+VASSRF K
Sbjct  235  QNHKMKLVEMEGSHVLQNDFDSLDVHVGQCFGTIVTANQEAKDYYMVASSRFLK  288



>ref|XP_003529456.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=550

 Score =   157 bits (398),  Expect = 6e-43, Method: Composition-based stats.
 Identities = 71/114 (62%), Positives = 90/114 (79%), Gaps = 4/114 (4%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK+ LDSGRSI RP G+ INGK+G     L+ L+ MEPGKTY+YR+CN GL+ ++NFR Q
Sbjct  175  LKQTLDSGRSIGRPSGVHINGKNGG----LEALYTMEPGKTYKYRICNVGLKEALNFRIQ  230

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            GH M +VE EGSH VQN Y SLD+HVGQC +VLVTA +E +DY++VAS+RF K+
Sbjct  231  GHPMKLVETEGSHVVQNTYDSLDVHVGQCFTVLVTADQEPRDYFMVASTRFTKK  284



>ref|XP_009417950.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=560

 Score =   157 bits (397),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 71/115 (62%), Positives = 91/115 (79%), Gaps = 2/115 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGK--VGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            L K+LDSGR+I RP G++ING+ GK   G    PLF ME GKTYRYR+CN G++ ++NFR
Sbjct  183  LAKLLDSGRTIGRPAGVLINGRSGKDSTGKDDPPLFTMEAGKTYRYRICNVGMKVTLNFR  242

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             Q H+M +VE++GSHT+QN Y+SLD+HVGQCLS LV A++  KDYY+VASSRF K
Sbjct  243  IQSHSMKLVEMDGSHTMQNVYESLDIHVGQCLSALVEATQAPKDYYMVASSRFTK  297



>ref|XP_010534841.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=549

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            +LK +LDSGR++  PDG++INGK  K+  K  PLF M+ GKTY+YR+CN G ++++NFR 
Sbjct  173  SLKNLLDSGRALGSPDGVLINGKSAKMDGKDQPLFTMKLGKTYKYRICNVGFKSTLNFRI  232

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
            Q H M +VE+EGSH +QNDY SLD+HVGQC +VLVTA + A DYY+VASSRF K++
Sbjct  233  QNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQTATDYYMVASSRFLKKQ  288



>gb|KFK35574.1| hypothetical protein AALP_AA4G008500 [Arabis alpina]
Length=555

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 91/114 (80%), Gaps = 2/114 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            LKK LDSGR+I RPDG++INGK GK GD  D PLF ++ GKTYR R+CN GL++S+NFR 
Sbjct  177  LKKFLDSGRTIGRPDGILINGKAGK-GDGSDQPLFTLKQGKTYRVRICNVGLKSSLNFRI  235

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            Q H M +VE+EGSH +QNDY SLD+HVGQC  V+VTA +E KDYY+ AS+RF K
Sbjct  236  QNHKMRLVEMEGSHVLQNDYDSLDVHVGQCYGVIVTADQEPKDYYMAASTRFLK  289



>gb|KFK38671.1| hypothetical protein AALP_AA3G145000 [Arabis alpina]
Length=554

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 92/114 (81%), Gaps = 2/114 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            LKK LD GR++ RPDG++INGK GK GD  D PLF ++PGKTYR R+CN GL+TS+NFR 
Sbjct  176  LKKFLDGGRTLGRPDGILINGKSGK-GDGSDAPLFTLKPGKTYRLRICNVGLKTSLNFRI  234

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            Q H + +VE+EGSH +QNDY SLD+HVGQC   +++A ++AKDYY+VASSRF K
Sbjct  235  QNHKLKLVEMEGSHVLQNDYDSLDVHVGQCYGTILSADQQAKDYYMVASSRFLK  288



>emb|CAA47176.1| Bplo [Brassica napus]
Length=554

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 92/114 (81%), Gaps = 2/114 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            LKK LD GR++ RP+G++INGK GK GD  D PLF ++PGK+YR R+CN GL+TS+NFR 
Sbjct  176  LKKFLDGGRTLGRPNGVLINGKAGK-GDGSDAPLFTLKPGKSYRVRICNVGLKTSLNFRI  234

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            Q H M +VE+EGSH +QND+ SLD+HVGQC   +VTA++E KDYY+VASSRF K
Sbjct  235  QNHKMKLVEMEGSHVLQNDFDSLDVHVGQCFGTIVTANQEPKDYYMVASSRFLK  288



>gb|KHN20513.1| L-ascorbate oxidase like [Glycine soja]
Length=516

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 92/114 (81%), Gaps = 4/114 (4%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK+ LDSGRSI RP G+ INGK+G     L+PL+ MEPGKTY+YR+CN GL+ S+NFR Q
Sbjct  144  LKQKLDSGRSIGRPVGVHINGKNGG----LEPLYTMEPGKTYKYRICNVGLKDSLNFRIQ  199

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            GH + +VE EGSH VQN+Y SLD+HVGQC +VLVTA +E KDY++VAS+RF K+
Sbjct  200  GHPLKLVETEGSHVVQNNYDSLDVHVGQCYTVLVTADQEPKDYFMVASTRFTKK  253



>ref|XP_004296148.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=522

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK+ LDSGR++ RPDG++INGK  K   K +PLF M+ GKTY++R+CN G+++S+NFR Q
Sbjct  175  LKQQLDSGRTLARPDGVLINGKDAKGDGKDEPLFTMKAGKTYKFRICNIGVKSSLNFRIQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             H M++VE+EGSHTVQN Y+SLD+H+GQC++VLVTA +  KDYY+VAS+RF K
Sbjct  235  EHWMMLVEMEGSHTVQNTYQSLDVHLGQCMAVLVTADQTPKDYYMVASTRFTK  287



>ref|XP_009124743.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=554

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 92/114 (81%), Gaps = 2/114 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            LKK LD GR++ RP+G++INGK GK GD  D PLF ++PGK+YR R+CN GL+TS+NFR 
Sbjct  176  LKKFLDGGRTLGRPNGVLINGKAGK-GDGSDAPLFTLKPGKSYRVRICNVGLKTSLNFRI  234

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            Q H M +VE+EGSH +QND+ SLD+HVGQC   +VTA++E KDYY+VASSRF K
Sbjct  235  QNHKMKLVEMEGSHVLQNDFDSLDVHVGQCFGTIVTANQEPKDYYMVASSRFLK  288



>emb|CDY50029.1| BnaA06g00300D [Brassica napus]
Length=540

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 91/114 (80%), Gaps = 2/114 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            LK  LDSGR+I RPDG++INGK GK GD  D PLF ++ GKTYR R+CN GL+ S+NFR 
Sbjct  177  LKNFLDSGRTIGRPDGILINGKAGK-GDGSDQPLFTLKQGKTYRIRICNVGLKASLNFRI  235

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            Q H M +VE+EGSH +QNDY SLD+HVGQC  V++TA++E KDYY+VAS+RF K
Sbjct  236  QNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVILTANQEPKDYYIVASTRFLK  289



>gb|EYU39505.1| hypothetical protein MIMGU_mgv1a003980mg [Erythranthe guttata]
Length=551

 Score =   156 bits (394),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 72/114 (63%), Positives = 91/114 (80%), Gaps = 2/114 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDP-LFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            LK+ +D+G++I R DG++INGK GK GD  DP +F M PGKTYRYR CN G++ S+N R 
Sbjct  174  LKRHMDNGKTIGRTDGVIINGKQGK-GDGSDPPMFTMIPGKTYRYRFCNVGMKNSLNVRI  232

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            QGH M +VE+EGSHTVQN Y SLD+H+GQC SVLVTA ++ KDYYLV+S+RF K
Sbjct  233  QGHTMKLVEIEGSHTVQNVYDSLDVHMGQCYSVLVTADQKPKDYYLVSSTRFTK  286



>ref|XP_006352142.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=556

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L+K LDSGRS+ RPDG++INGK GK   K +PLF M PGKTYRYR CNAG++ S+N R Q
Sbjct  176  LRKFLDSGRSMGRPDGIIINGKGGKGDGKDEPLFSMTPGKTYRYRFCNAGMKDSINVRIQ  235

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            GH M +VE+EGSH VQN Y SLD+H+GQC+SVLVTA K+ KDY LVAS+RF K+
Sbjct  236  GHTMKLVEMEGSHVVQNMYDSLDIHLGQCVSVLVTADKDPKDYLLVASTRFTKE  289



>ref|XP_003529457.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=552

 Score =   155 bits (393),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 92/115 (80%), Gaps = 2/115 (2%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            TL+K+LD GRS+ RP  +++NG++ K GD  D PLF M PGKTY+YR+CN GL+ ++NFR
Sbjct  175  TLRKLLDGGRSLGRPQAVLLNGQNAK-GDGTDKPLFTMIPGKTYKYRICNVGLKNTINFR  233

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             Q H M +VE+EGSHTVQN Y SLD+H+GQC  VLVTA++E KDYY+VAS+RF K
Sbjct  234  IQNHPMKLVEMEGSHTVQNTYNSLDVHLGQCFGVLVTANQEPKDYYMVASTRFTK  288



>ref|XP_004505355.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=550

 Score =   155 bits (393),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 90/115 (78%), Gaps = 2/115 (2%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFR  179
             L K+LDSGRS+ RP  +++NG+  K GD  D PLF M+PGKTY+YR+CN GL+ S+NFR
Sbjct  174  ALAKLLDSGRSLGRPQAVLVNGQVAK-GDGSDKPLFTMKPGKTYKYRICNVGLKNSLNFR  232

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             QGH M +VE EGSHTVQN Y SLD+H+GQC  VLVTA K+ KDYY+VAS+RF K
Sbjct  233  IQGHPMKLVEFEGSHTVQNSYDSLDVHLGQCFGVLVTADKDPKDYYMVASTRFTK  287



>ref|XP_003607814.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES90011.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=550

 Score =   155 bits (392),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 90/115 (78%), Gaps = 2/115 (2%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            TL K+LDSGR++ RP  +++NG++ K GD  D PLF M+PGKTY+YR+CN GL+ S+NF 
Sbjct  174  TLSKLLDSGRALGRPQAVLVNGQNAK-GDGSDKPLFTMKPGKTYKYRICNVGLKNSLNFG  232

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             Q H M +VE EGSHTVQN Y SLD+HVGQC  VLVTA KE KDYY+VAS+RF K
Sbjct  233  IQNHPMKLVEFEGSHTVQNSYDSLDVHVGQCFGVLVTADKEPKDYYMVASTRFTK  287



>ref|XP_003607816.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES90013.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=545

 Score =   155 bits (391),  Expect = 6e-42, Method: Composition-based stats.
 Identities = 73/113 (65%), Positives = 88/113 (78%), Gaps = 4/113 (4%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L+K LDSGRS+ RPDG+ I GK     +  +PL+KMEPGKTY+YR+CN GL+ S+NFR Q
Sbjct  173  LQKFLDSGRSMGRPDGVHIMGK----SNSAEPLYKMEPGKTYKYRLCNVGLKDSLNFRIQ  228

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             H M +VE+EGSHTVQN Y SLD+HVGQC SVLVTA KE K Y +VAS+RF K
Sbjct  229  DHPMKLVEMEGSHTVQNVYDSLDVHVGQCFSVLVTADKEPKQYKMVASTRFTK  281



>emb|CDY24189.1| BnaC01g37690D [Brassica napus]
Length=554

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 92/114 (81%), Gaps = 2/114 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            LKK LD GR++ RP+G++INGK GK GD  D PLF ++PGK++R R+CN GL+TS+NFR 
Sbjct  176  LKKFLDGGRTLGRPNGVLINGKAGK-GDGSDAPLFTLKPGKSHRVRICNVGLKTSLNFRI  234

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            Q H M +VE+EGSH +QND+ SLD+HVGQC   +VTA++E KDYY+VASSRF K
Sbjct  235  QNHKMKLVEMEGSHVLQNDFDSLDVHVGQCFGTIVTANQEPKDYYMVASSRFLK  288



>ref|XP_006345828.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=552

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            +LK +LD+GRS+ RPDG+VINGK GK   K +P+F M  GKTYR+R CN G++ ++N R 
Sbjct  172  SLKGLLDTGRSLGRPDGIVINGKSGKGDGKDEPMFTMVKGKTYRFRFCNVGMKDTINVRI  231

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            QGH M +VE+EGSHTVQN Y+ LD+H+GQCLSVL+TA +  KDY++VA+SRF K+
Sbjct  232  QGHTMKLVEMEGSHTVQNLYELLDIHLGQCLSVLITADQNPKDYFIVATSRFTKE  286



>ref|XP_004250092.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=555

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK++LDSGR++ RP G++INGK GK   K +P+F +  GKTYR+R CN G++ S+N R Q
Sbjct  176  LKRMLDSGRALGRPTGVLINGKSGKGDGKDEPMFTVIAGKTYRFRFCNVGMKDSINVRMQ  235

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            GH M +VE+EGSHTVQN Y+S+D+H+GQC SVLVTA++E KDYYLV S+RF K
Sbjct  236  GHTMKLVEIEGSHTVQNVYESIDIHLGQCFSVLVTANQEPKDYYLVVSTRFTK  288



>ref|XP_010938086.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=550

 Score =   154 bits (388),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 68/115 (59%), Positives = 88/115 (77%), Gaps = 2/115 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD--PLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            L ++LDSGR + RP G++INGKHGK     D  P+F ME GKTYRYRVCN G++TS++FR
Sbjct  173  LARLLDSGRGVGRPAGVLINGKHGKDASGKDEPPMFTMEAGKTYRYRVCNVGIKTSLSFR  232

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             Q H + +VE+EGSHT+QN Y SLD+H+GQC SV VTA ++  DYY+V S+RF K
Sbjct  233  IQKHALRLVEMEGSHTIQNVYDSLDIHIGQCFSVFVTADQQPGDYYMVISTRFTK  287



>ref|XP_008793387.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=550

 Score =   152 bits (385),  Expect = 5e-41, Method: Composition-based stats.
 Identities = 69/115 (60%), Positives = 85/115 (74%), Gaps = 2/115 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD--PLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            L ++LD GR I RP G++INGKHGK     D  P+F ME GKTYRYRVCN G++TS+N R
Sbjct  173  LARLLDRGRGIGRPAGVLINGKHGKDASGKDEPPMFTMEAGKTYRYRVCNVGIKTSLNLR  232

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             Q H + +VE+EGSHT+QN Y SLDLH GQC SV VTA ++  DYY+V S+RF K
Sbjct  233  IQKHKLRLVEMEGSHTIQNVYDSLDLHTGQCFSVFVTADQQPGDYYMVISTRFTK  287



>ref|XP_011077090.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=558

 Score =   152 bits (384),  Expect = 6e-41, Method: Composition-based stats.
 Identities = 71/112 (63%), Positives = 84/112 (75%), Gaps = 4/112 (4%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            TLKK LDSGRS+ RPDG+VINGK G       P + + PGKTYRYR+CN G++ SVN R 
Sbjct  175  TLKKFLDSGRSLGRPDGVVINGKSGNEA----PKWNLIPGKTYRYRICNVGMKNSVNVRI  230

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRF  338
            QGH M +VE+EGSHTVQN Y SLD+H+GQC SVLVTA +  KDY  V S+RF
Sbjct  231  QGHTMKLVEIEGSHTVQNVYDSLDIHLGQCNSVLVTADQTPKDYAFVVSTRF  282



>ref|XP_009147500.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=555

 Score =   152 bits (384),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 90/114 (79%), Gaps = 2/114 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
            LK  LDSGR+I RPDG++INGK GK GD  D PLF ++ GKTYR R+CN GL+ S+NFR 
Sbjct  177  LKNFLDSGRTIGRPDGILINGKAGK-GDGSDQPLFTLKQGKTYRIRICNVGLKASLNFRI  235

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            Q   M +VE+EGSH +QNDY SLD+HVGQC  V++TA++E KDYY+VAS+RF K
Sbjct  236  QNLKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVILTANQEPKDYYIVASTRFLK  289



>ref|XP_008782736.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=550

 Score =   151 bits (381),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 68/111 (61%), Positives = 85/111 (77%), Gaps = 2/111 (2%)
 Frame = +3

Query  18   LDSGRSITRPDGLVINGKHGKVGDKLD--PLFKMEPGKTYRYRVCNAGLRTSVNFRFQGH  191
            LDSGRSI RP G++INGKHGK     D  P+F ME GKTYR+RVCN G++ S+NFR Q H
Sbjct  177  LDSGRSIGRPAGVLINGKHGKDASGKDEPPMFTMEAGKTYRFRVCNIGIKDSLNFRIQKH  236

Query  192  NMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            ++ +VE+EGSH VQN Y SLDLH+GQC SV VTA ++  DYY++ S+RF K
Sbjct  237  SLRLVEMEGSHVVQNTYDSLDLHIGQCFSVFVTADQQPGDYYILMSTRFTK  287



>ref|XP_008449954.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=446

 Score =   150 bits (378),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 64/83 (77%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  96   DPLFKMEPGKTYRYRVCNAGLRTSVNFRFQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCL  275
            +PLF M+PGKTY+YRVCN GL+TS+NFRFQGH M +VE+EGSHTVQNDYKSLD+HVGQC 
Sbjct  99   NPLFTMKPGKTYKYRVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQNDYKSLDVHVGQCF  158

Query  276  SVLVTASKEAKDYYLVASSRFFK  344
            SVLVTA +E KDYY+VAS+RF K
Sbjct  159  SVLVTADQEPKDYYMVASTRFIK  181



>ref|XP_004234818.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=556

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L+K LDSGRS+ RPDG++INGK G    K +P+F M PGKTYRYR CNAG + S+N R Q
Sbjct  176  LRKFLDSGRSMGRPDGVIINGKGGNGDGKDEPMFSMTPGKTYRYRFCNAGNKDSINVRIQ  235

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            GH M +VE+EGSH VQN Y SLD+H+GQC+SVLVTA K+ KDY LVAS+RF K+
Sbjct  236  GHTMKLVEIEGSHVVQNMYDSLDIHLGQCVSVLVTADKDPKDYLLVASTRFTKE  289



>ref|XP_006445540.1| hypothetical protein CICLE_v10018007mg [Citrus clementina]
 ref|XP_006489004.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|ESR58780.1| hypothetical protein CICLE_v10018007mg [Citrus clementina]
 gb|KDO54549.1| hypothetical protein CISIN_1g046746mg [Citrus sinensis]
Length=561

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 94/118 (80%), Gaps = 8/118 (7%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKV-------GDKLDPLFKMEPGKTYRYRVCNAGLRT  164
            L K LDSG+ + +PDG++INGK G++       GD  +PLF M+ GK Y+YR+CN G++T
Sbjct  178  LGKQLDSGKLLGKPDGVLINGKSGRLDYDSDGKGDN-EPLFTMKAGKVYKYRICNVGVKT  236

Query  165  SVNFRFQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRF  338
            S+NFR QGH M +VE+EGSH VQN+Y+SLD+HVGQC +VLVTA+++ KDYYL+AS+RF
Sbjct  237  SLNFRIQGHTMKLVEMEGSHVVQNEYESLDVHVGQCFTVLVTANQDPKDYYLIASTRF  294



>ref|XP_010921259.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=550

 Score =   150 bits (378),  Expect = 4e-40, Method: Composition-based stats.
 Identities = 68/115 (59%), Positives = 86/115 (75%), Gaps = 2/115 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD--PLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            L + LDSGR I RP G++INGKHGK     D  P+F +E GKTYR+RVCN G++ S+NFR
Sbjct  173  LARFLDSGRGIGRPAGVLINGKHGKDASGKDEPPMFTVEAGKTYRFRVCNIGIKNSLNFR  232

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             Q H + +VE+EGSH VQN Y SLDLH+GQC SV VTA ++  DYY++AS+RF K
Sbjct  233  IQKHALRLVEMEGSHVVQNMYDSLDLHIGQCFSVFVTADQQPGDYYILASTRFTK  287



>ref|XP_008466955.1| PREDICTED: L-ascorbate oxidase homolog, partial [Cucumis melo]
Length=281

 Score =   145 bits (367),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +3

Query  96   DPLFKMEPGKTYRYRVCNAGLRTSVNFRFQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCL  275
            +PLF M+PGKTY+YRVCN GL++S+NFRFQGH M +VE+EGSHTVQNDY+SLD+HVGQC 
Sbjct  1    EPLFTMKPGKTYKYRVCNVGLKSSLNFRFQGHTMKLVEMEGSHTVQNDYQSLDVHVGQCF  60

Query  276  SVLVTASKEAKDYYLVASSRFFK  344
            SVLVTA++E+KDYY+VAS+RF K
Sbjct  61   SVLVTANQESKDYYMVASTRFIK  83



>ref|XP_010552290.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=553

 Score =   149 bits (376),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 89/115 (77%), Gaps = 1/115 (1%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLD-PLFKMEPGKTYRYRVCNAGLRTSVNFR  179
             LKK LDSGRS+ RPDG++INGK GK     D PLF M+PGKTYR R+CN G++TS+NFR
Sbjct  175  ALKKFLDSGRSLGRPDGILINGKSGKGSSGSDAPLFTMKPGKTYRVRICNVGIKTSLNFR  234

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
             Q H M +VE+EGSH +QNDY SLD+HVGQC   +VTA ++ KDY +VASSRF K
Sbjct  235  IQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCYGTIVTADQDPKDYLMVASSRFLK  289



>gb|EEC79422.1| hypothetical protein OsI_20394 [Oryza sativa Indica Group]
Length=466

 Score =   147 bits (370),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 67/114 (59%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            + K+LD+G+S  RP G+VINGK GK      P+F +E GKTYR RVCN G++ S+NFR Q
Sbjct  90   MAKMLDAGKSFGRPHGVVINGKSGKAAAD-PPMFTVEAGKTYRLRVCNVGIKASLNFRIQ  148

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            GH+M +VE+EGSHTVQ+ Y SLD+HVG CLSVLV A ++  DYY VAS+RF  +
Sbjct  149  GHDMKLVEMEGSHTVQDMYDSLDVHVGHCLSVLVDADQKPGDYYAVASTRFIHE  202



>gb|AAT01329.1| putative L-ascorbate oxidase [Oryza sativa Japonica Group]
 gb|AAT01403.1| putative L-ascorbate oxidase [Oryza sativa Japonica Group]
Length=556

 Score =   147 bits (370),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 67/114 (59%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            + K+LD+G+S  RP G+VINGK GK      P+F +E GKTYR RVCN G++ S+NFR Q
Sbjct  180  MAKMLDAGKSFGRPHGVVINGKSGKAAAD-PPMFTVEAGKTYRLRVCNVGIKASLNFRIQ  238

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            GH+M +VE+EGSHTVQ+ Y SLD+HVG CLSVLV A ++  DYY VAS+RF  +
Sbjct  239  GHDMKLVEMEGSHTVQDMYDSLDVHVGHCLSVLVDADQKPGDYYAVASTRFIHE  292



>gb|EEE55579.1| hypothetical protein OsJ_03867 [Oryza sativa Japonica Group]
Length=550

 Score =   147 bits (370),  Expect = 6e-39, Method: Composition-based stats.
 Identities = 68/114 (60%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L K LD+G+SI RP GLVINGK+ K      P++ ME GK YR+RVCN G++TS+N R Q
Sbjct  173  LAKNLDAGKSIGRPAGLVINGKNEKDASN-PPMYTMEAGKVYRFRVCNVGIKTSLNVRIQ  231

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            GH++ +VE+EGSHTVQN Y SLD+HV QC+S LVTA ++  DY LVAS+RF K+
Sbjct  232  GHSLKLVEMEGSHTVQNSYDSLDVHVAQCVSFLVTADQKPGDYLLVASTRFLKE  285



>ref|XP_004961713.1| PREDICTED: L-ascorbate oxidase homolog [Setaria italica]
Length=556

 Score =   147 bits (370),  Expect = 6e-39, Method: Composition-based stats.
 Identities = 65/111 (59%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            + ++LD+GRS+ RP+G++INGK G       P+F  E GKTYR+RVCN G++ S+NFR Q
Sbjct  179  MARMLDAGRSVGRPEGVLINGKGGPDAAAA-PMFTFEAGKTYRFRVCNTGIKASLNFRIQ  237

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRF  338
            GH+M +VE+EGSHTVQ+ Y SLD+HVG CLSVLV A ++  DYY+VAS+RF
Sbjct  238  GHDMKLVEMEGSHTVQDMYDSLDVHVGHCLSVLVDADQKPGDYYMVASTRF  288



>ref|NP_001044620.1| Os01g0816700 [Oryza sativa Japonica Group]
 dbj|BAB64824.1| putative L-ascorbate oxidase [Oryza sativa Japonica Group]
 dbj|BAF06534.1| Os01g0816700 [Oryza sativa Japonica Group]
Length=553

 Score =   147 bits (370),  Expect = 6e-39, Method: Composition-based stats.
 Identities = 68/114 (60%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L K LD+G+SI RP GLVINGK+ K      P++ ME GK YR+RVCN G++TS+N R Q
Sbjct  176  LAKNLDAGKSIGRPAGLVINGKNEKDASN-PPMYTMEAGKVYRFRVCNVGIKTSLNVRIQ  234

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            GH++ +VE+EGSHTVQN Y SLD+HV QC+S LVTA ++  DY LVAS+RF K+
Sbjct  235  GHSLKLVEMEGSHTVQNSYDSLDVHVAQCVSFLVTADQKPGDYLLVASTRFLKE  288



>gb|EEC71702.1| hypothetical protein OsI_04207 [Oryza sativa Indica Group]
Length=565

 Score =   147 bits (370),  Expect = 6e-39, Method: Composition-based stats.
 Identities = 68/114 (60%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L K LD+G+SI RP GLVINGK+ K      P++ ME GK YR+RVCN G++TS+N R Q
Sbjct  173  LAKNLDAGKSIGRPAGLVINGKNEKDASN-PPMYTMEAGKVYRFRVCNVGIKTSLNVRIQ  231

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            GH++ +VE+EGSHTVQN Y SLD+HV QC+S LVTA ++  DY LVAS+RF K+
Sbjct  232  GHSLKLVEMEGSHTVQNSYDSLDVHVAQCVSFLVTADQKPGDYLLVASTRFLKE  285



>ref|XP_003567221.1| PREDICTED: L-ascorbate oxidase homolog [Brachypodium distachyon]
Length=557

 Score =   146 bits (369),  Expect = 6e-39, Method: Composition-based stats.
 Identities = 67/114 (59%), Positives = 91/114 (80%), Gaps = 1/114 (1%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L+K +D+G+SI RP GL+INGK+ K      P++ +E GKTYR+RVCN G+++S+N R Q
Sbjct  181  LEKHIDTGKSIGRPAGLLINGKNEKDASN-PPMYNVEAGKTYRFRVCNVGIKSSLNVRVQ  239

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            GH + +VE+EGSHTVQN+Y SLD+HVGQCLS LVTA+++  DY LVAS+RF K+
Sbjct  240  GHMIKLVEMEGSHTVQNEYDSLDVHVGQCLSFLVTANQKPGDYLLVASTRFIKE  293



>gb|ACN34077.1| unknown [Zea mays]
 gb|AFW84771.1| L-ascorbate oxidase [Zea mays]
Length=559

 Score =   145 bits (365),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 68/115 (59%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L K LD+G+ I RP GLVINGK+ K      P++ +E GKTYR+RVCN G++ S N R Q
Sbjct  183  LAKNLDAGKGIGRPAGLVINGKNEKDASN-PPMYNVEAGKTYRFRVCNVGIKASFNVRIQ  241

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
             H M +VE+EGSHT+QNDY SLDLH+GQCLS LVTA ++  DY LVAS+RF K++
Sbjct  242  DHIMKLVEMEGSHTMQNDYDSLDLHIGQCLSFLVTADQKPGDYLLVASTRFIKEK  296



>ref|NP_001151662.1| L-ascorbate oxidase precursor [Zea mays]
 gb|ACG43714.1| L-ascorbate oxidase precursor [Zea mays]
Length=559

 Score =   145 bits (365),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 68/115 (59%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L K LD+G+ I RP GLVINGK+ K      P++ +E GKTYR+RVCN G++ S N R Q
Sbjct  183  LAKNLDAGKGIGRPAGLVINGKNEKDASN-PPMYNVEAGKTYRFRVCNVGIKASFNVRIQ  241

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQE  350
             H M +VE+EGSHT+QNDY SLDLH+GQCLS LVTA ++  DY LVAS+RF K++
Sbjct  242  DHIMKLVEMEGSHTMQNDYDSLDLHIGQCLSFLVTADQKPGDYLLVASTRFIKEK  296



>gb|EYU39761.1| hypothetical protein MIMGU_mgv1a003754mg [Erythranthe guttata]
Length=566

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 88/121 (73%), Gaps = 6/121 (5%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHG-----KVGDKLDPLFKMEPGKTYRYRVCNAGLRTS  167
            +L+K+LD GRS+ RPDG++INGK       K G +  P+F M   KTYRYR CN G++ S
Sbjct  179  SLRKLLDGGRSLGRPDGVIINGKGSFGTGNKTGGEDSPMFTMIAKKTYRYRFCNVGMKDS  238

Query  168  VNFRFQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTA-SKEAKDYYLVASSRFFK  344
            VN R QGH M +VE+EGSHTVQN Y SLD+H+GQC SVLVTA  K   DYYLVAS+RF K
Sbjct  239  VNVRIQGHTMKIVEIEGSHTVQNVYDSLDVHLGQCYSVLVTADQKPESDYYLVASTRFSK  298

Query  345  Q  347
            +
Sbjct  299  K  299



>ref|XP_008804666.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=551

 Score =   145 bits (365),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 67/112 (60%), Positives = 84/112 (75%), Gaps = 2/112 (2%)
 Frame = +3

Query  18   LDSGRSITRPDGLVINGKHGK--VGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQGH  191
            LD+GRS+  P G++ING+ GK   G    P+F M+ G  YR+R CN GL+TS+NFR Q H
Sbjct  178  LDAGRSVGHPAGVLINGRRGKDAAGHDEPPMFTMQAGDVYRFRFCNVGLKTSLNFRIQKH  237

Query  192  NMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
             + +VE+EGSHTVQN Y SLD+HVGQCLSVLVTA +   DYYLVAS+RF K+
Sbjct  238  PLKLVEMEGSHTVQNLYTSLDVHVGQCLSVLVTADQAPGDYYLVASTRFTKK  289



>ref|XP_002456532.1| hypothetical protein SORBIDRAFT_03g037970 [Sorghum bicolor]
 gb|EES01652.1| hypothetical protein SORBIDRAFT_03g037970 [Sorghum bicolor]
Length=558

 Score =   144 bits (364),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 67/114 (59%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L K LD+G+ I RP GLVINGK+ K      P++ +E GKTYR+R+CN G++ S+N   Q
Sbjct  182  LAKNLDAGKGIGRPSGLVINGKNEKDAAN-PPMYNVEAGKTYRFRICNVGMKASINIGIQ  240

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
             H M +VE+EGSHT+QNDY SLD+HVGQCLSVLVTA ++  DY LVAS+RF K+
Sbjct  241  NHIMKLVEMEGSHTMQNDYDSLDIHVGQCLSVLVTADQKPGDYLLVASTRFIKE  294



>gb|ADK47981.1| L-ascorbate oxidase-like protein [Cynodon dactylon]
Length=550

 Score =   143 bits (361),  Expect = 8e-38, Method: Composition-based stats.
 Identities = 66/114 (58%), Positives = 85/114 (75%), Gaps = 1/114 (1%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L K LD+G+ I RP GL+INGK+ K      P++  E GKTYR+RVCN G++ S+N R  
Sbjct  174  LAKHLDAGKGIGRPAGLIINGKNDKDAASA-PMYNFEAGKTYRFRVCNVGIKASLNVRVP  232

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            GHN+ +VE+EGSHTVQN Y SLD+HVGQCLS LVTA ++  DY+LV S+RF K+
Sbjct  233  GHNLKLVEMEGSHTVQNMYDSLDVHVGQCLSFLVTADQKPADYFLVVSTRFIKE  286



>gb|EEE64155.1| hypothetical protein OsJ_18987 [Oryza sativa Japonica Group]
Length=513

 Score =   143 bits (361),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = +3

Query  3    TLKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRF  182
             + K+LD+G+S  RP G+VINGK GK      P+F +E GKTYR RVCN G++ S+NFR 
Sbjct  179  AMAKMLDAGKSFGRPHGVVINGKSGKAAAD-PPMFTVEAGKTYRLRVCNVGIKASLNFRI  237

Query  183  QGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            QGH+M +VE+EGSHTVQ+ Y SLD+HVG CLSVLV A ++  DYY VAS+RF  +
Sbjct  238  QGHDMKLVEMEGSHTVQDMYDSLDVHVGHCLSVLVDADQKPGDYYAVASTRFIHE  292



>ref|XP_004970369.1| PREDICTED: L-ascorbate oxidase homolog [Setaria italica]
Length=557

 Score =   143 bits (361),  Expect = 8e-38, Method: Composition-based stats.
 Identities = 69/114 (61%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L K LDSG+ I RP GLVINGK+ K      P++ ME GKTYR+RVCN G++ S N R Q
Sbjct  181  LAKNLDSGKGIGRPAGLVINGKNEKDASN-PPMYNMEAGKTYRFRVCNLGIKASFNVRIQ  239

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
             H + +VE+EGSHTVQN Y SLDLH+GQCLS LVTA +   DY LVAS+RF K+
Sbjct  240  KHILKLVEMEGSHTVQNTYDSLDLHIGQCLSFLVTADQAPGDYLLVASTRFIKE  293



>ref|XP_008788020.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=551

 Score =   143 bits (361),  Expect = 8e-38, Method: Composition-based stats.
 Identities = 67/116 (58%), Positives = 86/116 (74%), Gaps = 2/116 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGK--VGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            L + LD+GR +  P G++ING+ GK   G    P+F M+ G  YR+R CN GL+TS+NFR
Sbjct  174  LARQLDAGRGLGLPAGVLINGRLGKDAAGRDEPPMFTMQAGNVYRFRFCNVGLKTSLNFR  233

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
             Q H++ +VE+EGSHTVQN Y SLD+HVGQCLSVLVTA +   DYYLVAS+RF K+
Sbjct  234  LQKHSLKLVEMEGSHTVQNLYDSLDVHVGQCLSVLVTADQAPGDYYLVASTRFTKE  289



>dbj|BAK07214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=557

 Score =   143 bits (361),  Expect = 9e-38, Method: Composition-based stats.
 Identities = 64/113 (57%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L K LD+G+ I RP GL+INGK+ K      P++ +E GKTYR+RVCN G++T++N R Q
Sbjct  181  LAKNLDTGKGIGRPAGLLINGKNEKDASN-PPMYNVETGKTYRFRVCNVGIKTTLNVRIQ  239

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            GH + +VE+EGSHTVQN+Y SLD+H+GQCLS L TA+++  DY+L+AS+RF K
Sbjct  240  GHVVKLVEMEGSHTVQNEYDSLDVHIGQCLSFLTTANQKPGDYFLIASTRFIK  292



>ref|NP_001132891.1| uncharacterized protein LOC100194388 [Zea mays]
 gb|ACF81925.1| unknown [Zea mays]
Length=421

 Score =   142 bits (357),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 66/114 (58%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L K LD+G+ I RP GLVINGK+ K      P++ +E GKTYR+RVCN G++ S N R Q
Sbjct  45   LAKNLDAGKGIGRPAGLVINGKNEKDASN-PPMYNVEAGKTYRFRVCNVGIKASFNIRIQ  103

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
             H M +VE+EGSHT+QNDY SLDLH+GQCLS LVTA ++  DY L  S+RF K+
Sbjct  104  NHIMKLVEMEGSHTMQNDYDSLDLHIGQCLSFLVTADQKPGDYLLAVSTRFIKE  157



>gb|ACF86554.2| unknown [Zea mays]
 gb|AFW82337.1| pollen-specific protein NTP303 [Zea mays]
Length=559

 Score =   143 bits (360),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 64/111 (58%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L + LD+G+S+ RP G++INGK GK  +   P+   E GKTYR RVCN G++ S+NFR Q
Sbjct  180  LARQLDAGKSVGRPAGVLINGKGGKDLEAAAPMLTFEAGKTYRLRVCNTGIKASLNFRIQ  239

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRF  338
            GH+M +VE+EGSHT+Q+ Y SLD+HVG CLSVLV A +   DYY+VAS+RF
Sbjct  240  GHDMKLVELEGSHTLQDVYDSLDVHVGHCLSVLVDADQAPGDYYMVASTRF  290



>ref|XP_009794442.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=541

 Score =   143 bits (360),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 69/114 (61%), Positives = 84/114 (74%), Gaps = 5/114 (4%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK ILDSG  +  PDGL+ING HG  G      F ++ GKTYR+R+ N GL TS+NFR Q
Sbjct  176  LKAILDSGHDLPFPDGLLING-HGSNGYT----FTIDQGKTYRFRISNVGLTTSINFRIQ  230

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            GH M+VVEVEG+HTVQN Y SLD+H+GQ  SVL+TA + AKDYY+V S+RF  Q
Sbjct  231  GHKMMVVEVEGTHTVQNTYDSLDIHLGQSFSVLLTADQPAKDYYIVVSTRFTSQ  284



>emb|CDM84722.1| unnamed protein product [Triticum aestivum]
Length=556

 Score =   142 bits (359),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 63/113 (56%), Positives = 87/113 (77%), Gaps = 1/113 (1%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L K LD+G+ I RP GL+INGK+ K      P+F +E GKTYR+RVCN G++T++N R Q
Sbjct  180  LAKNLDTGKGIGRPAGLLINGKNEKDASN-PPMFNVEAGKTYRFRVCNVGIKTTLNVRIQ  238

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            GH + +VE+EGSHTVQN+Y S+D+H+GQCLS L TA+++  DY+ +AS+RF K
Sbjct  239  GHVLKLVEMEGSHTVQNEYDSMDVHIGQCLSFLSTANQKPGDYFFIASTRFIK  291



>gb|EMT02825.1| L-ascorbate oxidase-like protein [Aegilops tauschii]
Length=556

 Score =   142 bits (358),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 63/113 (56%), Positives = 87/113 (77%), Gaps = 1/113 (1%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L K LD+G+ I RP GL+INGK+ K      P+F +E GKTYR+RVCN G++T++N R Q
Sbjct  180  LAKNLDTGKGIGRPAGLLINGKNEKDASN-PPMFNVEEGKTYRFRVCNVGIKTTLNVRIQ  238

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            GH + +VE+EGSHTVQN+Y S+D+H+GQCLS L TA+++  DY+ +AS+RF K
Sbjct  239  GHVLKLVEMEGSHTVQNEYDSMDVHIGQCLSFLSTANQKPGDYFFIASTRFIK  291



>ref|XP_010103298.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB95365.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=632

 Score =   142 bits (359),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 67/114 (59%), Positives = 81/114 (71%), Gaps = 4/114 (4%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK ILD GR +  PDGL+ING+    G      F  EPGKTYR R+ N GL+ S+NFR Q
Sbjct  357  LKAILDGGRRLPNPDGLLINGR----GPNSTTTFTFEPGKTYRLRISNVGLQNSLNFRIQ  412

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            GHNM +VEVEG+H+VQ +Y SLD+HVGQ  SVLVTA K  +DYY+V S+RF  Q
Sbjct  413  GHNMTLVEVEGTHSVQTNYSSLDIHVGQSYSVLVTADKAPQDYYIVVSTRFTNQ  466



>ref|XP_002441281.1| hypothetical protein SORBIDRAFT_09g023770 [Sorghum bicolor]
 gb|EES19711.1| hypothetical protein SORBIDRAFT_09g023770 [Sorghum bicolor]
Length=559

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L + LD+G+S+ RP G+VINGK GK  +   PLF  + GKTYR RVCN G++ S+NFR Q
Sbjct  182  LARQLDAGKSVGRPAGVVINGKGGKDLESA-PLFTFDAGKTYRLRVCNTGIKASLNFRIQ  240

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRF  338
            GH+M +VE+EGSHT+Q+ Y SLD+HVG CLSVLVTA ++  DYY+VAS+RF
Sbjct  241  GHHMTLVELEGSHTLQDVYDSLDVHVGHCLSVLVTADQKPGDYYMVASTRF  291



>ref|XP_008672229.1| PREDICTED: uncharacterized protein LOC100194388 isoform X1 [Zea 
mays]
 gb|ACN27218.1| unknown [Zea mays]
 tpg|DAA57111.1| TPA: hypothetical protein ZEAMMB73_564948 [Zea mays]
Length=557

 Score =   142 bits (357),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 66/114 (58%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L K LD+G+ I RP GLVINGK+ K      P++ +E GKTYR+RVCN G++ S N R Q
Sbjct  181  LAKNLDAGKGIGRPAGLVINGKNEKDASN-PPMYNVEAGKTYRFRVCNVGIKASFNIRIQ  239

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
             H M +VE+EGSHT+QNDY SLDLH+GQCLS LVTA ++  DY L  S+RF K+
Sbjct  240  NHIMKLVEMEGSHTMQNDYDSLDLHIGQCLSFLVTADQKPGDYLLAVSTRFIKE  293



>gb|EMS66047.1| L-ascorbate oxidase-like protein [Triticum urartu]
Length=570

 Score =   142 bits (357),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 62/113 (55%), Positives = 87/113 (77%), Gaps = 1/113 (1%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L K LD+G+ I RP GL+INGK+ K      P++ +E GKTYR+RVCN G++T++N R Q
Sbjct  205  LAKNLDTGKGIGRPAGLLINGKNEKDASN-PPMYNVEAGKTYRFRVCNVGIKTTLNVRIQ  263

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            GH + +VE+EGSHTVQN+Y S+D+H+GQCLS L TA+++  DY+ +AS+RF K
Sbjct  264  GHVLKLVEMEGSHTVQNEYDSMDVHIGQCLSFLTTANQKPGDYFFIASTRFIK  316



>ref|NP_001151772.1| pollen-specific protein NTP303 precursor [Zea mays]
 gb|ACG44269.1| pollen-specific protein NTP303 precursor [Zea mays]
Length=559

 Score =   142 bits (357),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 64/111 (58%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L + LD+G+S+ RP G++INGK GK  +   P+   E GKTYR RVCN G++ S+NFR Q
Sbjct  180  LARQLDAGKSVGRPAGVLINGKGGKDLEAAAPMLTFEAGKTYRLRVCNTGIKASLNFRIQ  239

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRF  338
            GH M +VE+EGSHT+Q+ Y SLD+HVG CLSVLV A +   DYY+VAS+RF
Sbjct  240  GHYMKLVELEGSHTLQDVYDSLDVHVGHCLSVLVDADQAPGDYYMVASTRF  290



>dbj|BAK05994.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=560

 Score =   140 bits (353),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 62/111 (56%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            +  +LD+GRS  RP G++INGK GK      P+F  E  KTYR R+CN G+++S+NFR Q
Sbjct  184  MASLLDAGRSFGRPAGVLINGKGGKEATN-PPMFTWEAAKTYRLRICNVGIKSSLNFRIQ  242

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRF  338
            GH+M +VE++GSHT+Q+ Y SLD+HVGQCLSVLV A ++  DY +VAS+RF
Sbjct  243  GHDMKLVEIDGSHTLQDSYDSLDVHVGQCLSVLVDADQKPADYLMVASTRF  293



>gb|EYU36818.1| hypothetical protein MIMGU_mgv1a004264mg [Erythranthe guttata]
Length=536

 Score =   140 bits (353),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 64/111 (58%), Positives = 82/111 (74%), Gaps = 5/111 (5%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK ILD G  +  PDG++ING+   V       F ++ GKTYR+R+CN GL+ S+NFR Q
Sbjct  170  LKAILDKGNKLPFPDGILINGRGPNVTS-----FTIQQGKTYRFRICNVGLQNSLNFRIQ  224

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRF  338
            GH M VVEVEG+HTVQ  Y SLD+HVGQC+SVL+TA ++ +DYY+V SSRF
Sbjct  225  GHKMKVVEVEGTHTVQVSYSSLDIHVGQCMSVLLTADQQPQDYYIVVSSRF  275



>gb|EYU27771.1| hypothetical protein MIMGU_mgv1a003982mg [Erythranthe guttata]
Length=551

 Score =   140 bits (352),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 69/111 (62%), Positives = 85/111 (77%), Gaps = 5/111 (5%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK ILDSG ++  PDGL+ING+ G  G      F +EPGKTYR+R+ N GL TSVNFR +
Sbjct  185  LKYILDSGHNLPSPDGLIINGR-GWNGYT----FTVEPGKTYRFRISNVGLTTSVNFRIE  239

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRF  338
            GH+M ++EVEGSHTVQN Y SLD+HVGQ  SVLV A++ +KDYY+V SSRF
Sbjct  240  GHSMKLIEVEGSHTVQNTYTSLDVHVGQSYSVLVEANQPSKDYYVVVSSRF  290



>gb|KHG04142.1| L-ascorbate oxidase [Gossypium arboreum]
Length=550

 Score =   139 bits (351),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 66/114 (58%), Positives = 86/114 (75%), Gaps = 5/114 (4%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            LK ILDSG  +  PDGL+ING+ G  G      F ++ GKTYR+R+ N G+ TS+NFR Q
Sbjct  182  LKAILDSGHDLPFPDGLIINGR-GANGYT----FTVDQGKTYRFRISNVGITTSINFRIQ  236

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
            GH +++VEVEG+HT+QN Y SLD+H+GQ LSVLVTA + A+DYY+VAS+RF  Q
Sbjct  237  GHKLLLVEVEGTHTLQNTYDSLDIHLGQSLSVLVTADQPARDYYIVASTRFTSQ  290



>ref|XP_006644902.1| PREDICTED: L-ascorbate oxidase homolog [Oryza brachyantha]
Length=555

 Score =   139 bits (351),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 66/114 (58%), Positives = 84/114 (74%), Gaps = 1/114 (1%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L K L++G+SI RP GLVINGK+ K      P++ ME GK YRYRVCN G++TS+N R Q
Sbjct  179  LAKNLEAGKSIGRPAGLVINGKNEKDASN-PPMYTMEAGKVYRYRVCNVGIKTSLNVRIQ  237

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
             H + +VE+EGSHTVQN Y SLD+HV QC+S LV A ++  DY LVAS+RF K+
Sbjct  238  SHIIKLVEMEGSHTVQNTYDSLDVHVAQCVSFLVAADQKPGDYLLVASTRFMKE  291



>gb|ACN26659.1| unknown [Zea mays]
 gb|AFW78430.1| pollen-specific protein NTP303 [Zea mays]
Length=559

 Score =   139 bits (351),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 64/111 (58%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L + +D+G+ + RP G++INGK GK   +  P F  E GKTYR RVCN G++ S+NFR Q
Sbjct  182  LARQIDAGKGVGRPAGVLINGKGGK-DLEAAPAFTFEAGKTYRLRVCNTGIKASLNFRIQ  240

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRF  338
            GH M +VE+EGSHT+QN Y SLD+HVG CLSVLV A ++  DYY+VAS+RF
Sbjct  241  GHYMKLVELEGSHTLQNTYDSLDVHVGHCLSVLVDADQKPGDYYMVASTRF  291



>ref|NP_001151961.1| pollen-specific protein NTP303 precursor [Zea mays]
 gb|ACG45153.1| pollen-specific protein NTP303 precursor [Zea mays]
Length=559

 Score =   139 bits (351),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 64/111 (58%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L + +D+G+ + RP G++INGK GK   +  P F  E GKTYR RVCN G++ S+NFR Q
Sbjct  182  LARQIDAGKGVGRPAGVLINGKGGK-DLEAAPAFTFEAGKTYRLRVCNTGIKASLNFRIQ  240

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRF  338
            GH M +VE+EGSHT+QN Y SLD+HVG CLSVLV A ++  DYY+VAS+RF
Sbjct  241  GHYMKLVELEGSHTLQNTYDSLDVHVGHCLSVLVDADQKPGDYYMVASTRF  291



>ref|XP_010922850.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=551

 Score =   139 bits (350),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 64/116 (55%), Positives = 85/116 (73%), Gaps = 2/116 (2%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLD--PLFKMEPGKTYRYRVCNAGLRTSVNFR  179
            L + LD+GR +  P G++ING+ G+     D  P+F M+ G  YR+R CN GL+ S+NFR
Sbjct  174  LARKLDAGRRLGLPAGVLINGRSGRNAAGHDDLPMFTMQAGNVYRFRFCNVGLKASLNFR  233

Query  180  FQGHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFKQ  347
             Q H++ +VE+EGSHTVQN Y SLD+HVGQC+SVLVTA +   DYYLVAS+RF K+
Sbjct  234  IQKHSLKLVEMEGSHTVQNLYDSLDVHVGQCMSVLVTADQAPGDYYLVASTRFTKK  289



>ref|XP_011008684.1| PREDICTED: L-ascorbate oxidase homolog, partial [Populus euphratica]
Length=468

 Score =   138 bits (348),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 67/113 (59%), Positives = 84/113 (74%), Gaps = 5/113 (4%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            L++ILD G ++  PDGL+ING+ G  G      F ++PGKTYR+R+ N GL TS+NFR Q
Sbjct  102  LRRILDGGHNLPFPDGLLINGR-GWNG----CTFTVDPGKTYRFRISNVGLTTSINFRIQ  156

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRFFK  344
            GH M +VEVEGSHT+QN Y  LD+H+GQ  SVLVTA + AKDYY+V SSRF K
Sbjct  157  GHKMKLVEVEGSHTLQNTYSDLDIHLGQSYSVLVTADQPAKDYYIVVSSRFTK  209



>ref|XP_003566121.2| PREDICTED: L-ascorbate oxidase homolog [Brachypodium distachyon]
Length=540

 Score =   139 bits (349),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  6    LKKILDSGRSITRPDGLVINGKHGKVGDKLDPLFKMEPGKTYRYRVCNAGLRTSVNFRFQ  185
            + ++LD GRS  RP G++ING+ GK      PLF  E GKTYR R+CN G+++++NFR Q
Sbjct  164  MARLLDEGRSFGRPAGVLINGRGGKEAAD-PPLFTFEAGKTYRLRICNVGIKSTLNFRIQ  222

Query  186  GHNMIVVEVEGSHTVQNDYKSLDLHVGQCLSVLVTASKEAKDYYLVASSRF  338
            GH+M +VE++GSHTVQ+ Y SLD+HVG CLSVLV A ++  DYY+VAS+RF
Sbjct  223  GHDMKLVEMDGSHTVQDMYDSLDVHVGHCLSVLVDADQKPGDYYVVASTRF  273



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506325383488